Lægemagasinet nr. 3 2022

Page 1

www.laegemagasinet.dk LÆGE MAGASINET Magasin for praktiserende læger og speciallæger Nr. 3 september 2022 36. årgang ISSN Nr. 0902-1787 Forebyggelse kræver ressourcer, men helbredelse kræver flere AF VIDENSKABSJOURNALIST GORDON VAHLE Et paradigmeskift er på vej AF PROFESSOR, OVERLÆGE, DR.MED. STEN MADSBAD Vasodilaterende betablokkere i hypertensionsbehandlingen AF PROFESSOR EM. DR.MED. HANS IBSEN KOL og seksualitet: Opmærksom hedspunkter til almen praksis AF PSYKOLOG, POST.DOC. INGEBORG FARVERVESTERGAARD, AUT. PSYKOLOG YOON FREDERIKSEN OG LEDENDE OVERLÆGE ANDERS LØKKE

ANNONCE

Publishing ApS

16 4760 Vordingborg

40 50 80 00 Udgiver:

Ansvarshavende: Cand. polit John Vabø Journalist: Gordon gordon@sciencejournalist.dkVahle

påtrykt bag på magasinet). e-mail:

39 90 80 00 ISSN Nr. 0902-1787 Layout og tryk: Stibo Complete Besøg www.cotedor.dk Ferieboliger i www.cotedor.dkProvence 2sp x50_Cote dOr_2019_streamer.indd 1 30.08.2022 09.53 Forebyggelse kræver ressourcer, men helbredelse kræver flere 5 AF VIDENSKABSJOURNALIST GORDON VAHLE Se på sundhedsudgifter som investeringer – og invester, hvor det giver værdi for patienter og for samfundet 8 AF FORMAND HANS MARTENS Semaglutide (Wegovy®) og Tirzepatid (Mounjaro®) 10 AF PROFESSOR, OVERLÆGE, DR.MED. STEN MADSBAD Mere døgnblodtryksmåling hos patienter med synkope? 13 AF OVERLÆGE, DR. MED. KENT LODBERG CHRISTENSEN Vasodilaterende betablokkere i hypertensionsbehandlingen 14 AF PROFESSOR EM. DR.MED. HANS IBSEN Bidrager AK-behandling hos ældre patienter med atrieflimren til at bevare deres funktion og livskvalitet? 18 AF OVERLÆGE OG LEKTOR HELENA DOMÍNGUEZ OG OVERLÆGE OG PROFESSOR AHMAD SAJADIEH KOL og seksualitet: Opmærksomhedspunkter til almen praksis 20 AF PSYKOLOG, POST.DOC. INGEBORG FARVER-VESTERGAARD, AUT. PSYKOLOG YOON FREDERIKSEN OG LEDENDE OVERLÆGE ANDERS LØKKE Nyt fra gynækologifronten 26 AF GYNÆKOLOG CHRISTINE FELDING

LÆGEMAGASINET 3 3 Indhold 3/2022

Redaktør Cand. polit John Vabø Tlf. 39 90 80 00 Dir. 39 48 51 06/39 48 51 07 e-mail: john@vaboe.dk

Redaktionen: Speciallæge dr. med., Jette Ingerslev Speciallæge i gynækologi, Christine Felding Professor emeritus, dr. med., Hans Ibsen Tina Brage Vabø Artikler, pressemeddelelser, produkt informationer m.v. modtages på e-mail: tina@vaboe.dk, og skal være redaktionen i hænde senest 3 uger før udgivelsestids punktet. Illustrationer, fotos mv. skal leveres som orginalmateriale eller elektronisk som PDF, JPG. Citat tilladt med kildeangivelse. Abonnement: 4 udgaver (incl. moms): Kr. Adresseændringer240,- m.v. bedes mailet til Vedinfo@vaboe.dkhenvendelse bedes abonnements nummer oplyst (otte cifre, info@vaboe.dk Kontakt: John Vabø, jv@vaboe.dk Tlf. +45 Vabø Fjordternevej Tlf.

ANNONCE

Det er naturligvis en karikatur, at det dan ske sundhedsvæsen er så skarpt opdelt i en forebyggende, plejende og helbre dende del. Samarbejdet på tværs er blevet meget bedre. Men det forebyggende arbejde kan stadig forbedres væsentligt, hvis vi er indstillet på det. Det er grunden til, at PLO i foråret udsendte et idékatalog, der skal inspirere til en fælles og mere mål rettet forebyggende indsats. Kataloget indeholder 15 indsatspunkter, fordelt på fire områder: ’børn og unge i mistrivsel’, ’unge og voksne i risikogrup per’, ’ældre og kronisk syge’ samt ’psykia tri’.

AF GORDONVIDENSKABSJOURNALISTVAHLE

Forebyggelse kræver ressourcer, men helbredelse kræver flere

Denne tredeling vil PLO gerne lave om på, for forebyggelse ER bedst – OG et fælles ansvar.

– Det er fint at have nogle fixpunkter at styre efter, og kataloget har også givet anledning til en god snak i kommuner og regioner. Men det vigtigste er, at vi siger højt, at forebyggelse er en afgørende opgave, som vi skal prioritere og kun kan løse i fællesskab, siger formand for PLO’s udvalg for Nær Sundhed Lise Høyer. Tillid er en forudsætning – Jo tidligere, vi kan sætte ind med en forebyggende indsats, jo større er chan cen for, at de første symptomer eller

”Det er bedre at forebygge end at helbrede”, lyder en indlysende talemåde. I Danmark er det forebyggende sundhedsarbejde ofte lagt i hænderne på sociale eller kommunale instanser, plejepersonale sørger for at ”trøste, lindre og pleje”, mens det er lægerne, som sørger for rosinen i pølseenden: helbredelsen.

LÆGEMAGASINET 3 5

Hvordan illustrerer man betydningen af tillid? PLO viser med denne graf, at der er en tydelig sammenhæng mellem, hvor længe en patient har kendt sin læge, og brugen af øvrige dele af sundhedsvæsenet. Man kan endda dø af kun at have kendt sin læge i kort tid. Og tillid opbygges jo over Figurentid...viser odds rationen for et udfald sammenlignet med, at man har været tilknyttet den samme praktiserende læge i 1 år. Kilde: Undersøgelse om kontinuitet i almen praksis af Sandvik, Hetlevik, Blinkenberg og Hunskaar, 2021.

”Formålet med forebyggelse er at hindre fysisk eller psykisk sygdom i at opstå, eller at sygdom forværres, samt at øge livs kvaliteten for det enkelte menneske,” står der i forordet til PLO’s idékatalog over forebyggelsesindsatser. Du kan finde idékataloget i sin helhed på www.laeger.dk/PLO/ politikpapirer PLO foreslår Børn og unge i mistrivsel

8. forebyggelsestilbud om motion, kost og sygdomshåndte ring for borgere med truende livsstilssygdom, eller som har kronisk sygdom. De praktiserende læger bør i stigende grad henvise til disse tilbud, hvor det giver mening for patienten. 9. forebyggelsestilbud i kommunerne til stressramte, som al men praksis vil kunne henvise til tidligt i forløbet for at undgå langvarig sygemelding på grund af belastningsreaktion/ stress.

det er langt fra sikkert, at borgeren åbner sig til de myndigheder eller personer, der har forebyggelse som deres primære opgave. Det kræver tillid at åbne sig, og det er lige her, at den praktiserende læge kommer ind i billedet. Mange patienter har kendt deres praktiserende læge i flere år, og de har fået opbygget et tillidsforhold, der gør, at de tør henvende sig – også om forhold, der måske ikke lige har med sygdom at gøre, tilføjer hun. – Ikke sjældent oplever jeg, at nogle af de mere skrøbe lige patienter eller familier, fx personer med svær psykisk lidelse, kommer ud for mindre hændelser, der påvirker deres tilstand så meget, at de er i fare for at udvikle alvor lig forværring. Den lille tue, der vælter læsset. Og jeg er, som deres praktiserende læge, ofte den, der først bliver kontaktet. Men vi mangler handlemuligheder, at kunne skabe et sikkerhedsnet, der kan forebygge yderligere for værring og indlæggelser, siger Lise Høyer. Barrierer i systemet Situationen, hvor en læge ved en samtale med en patient får mistanke om, at der er andet og måske mere alvorligt i vejen, er velkendt for mange læger. Og lægerne må så tage sig den tid, det tager at få afklaret patientens situation bedst muligt. Men det er ikke altid muligt med venteværelset fyldt med utålmodige patienter, og hvordan får man hjulpet borgeren videre, når det er instanser med specialer i økonomiske, sociale, misbrugs- eller psykia triske problemer, der bedst kan hjælpe i den konkrete situation?–Forebyggelse tager tid, og den tid har vi ikke altid.

– Vi skal tage ved lære fra områder, hvor det rent fak tisk går godt. Praktiserende læger og hjemmeplejen har fx 15 FORSLAG FOREBYGGELSESINDSATSERTIL

faresignaler ikke udvikler sig til noget værre, mener Lise

5. henvisningsmulighed til indledende samtale ved et alkohol behandlingssted i kommunen og elektronisk kommunikation under forløbet.

6. mulighed for at henvise til rygestop blot ved at skrive ”ønsker rygestop” på henvisningen.

2. mulighed for at benytte elektronisk kommunikation med PPR.

6 LÆGEMAGASINET 3

Men også i selve ’systemet’ er der barrierer, der forhindrer den optimale indsats, siger Lise Høyer og nævner som et eksempel, at praktiserende læger ikke uden videre kan henvise patienter til lokalpsykiatrien. Nogle af PLO’s forslag gå netop ud på at fjerne bar riererne og gøre samarbejdet mellem forskellige dele af sundhedsvæsenet mere smidigt.

10. mulighed for afklarende samtale/krisesamtale hos egen læge.

Formand for PLO’s udvalg for Nær Sundhed Lise Høyer (Foto: PLO).

11. at praktiserende læge indtænker ensomhed ved fysisk og psykisk sygdom som en risikofaktor på lige fod med rygning, alkohol mm. Ældre og kronisk syge 12. helhedsvurderinger hos patienter på +75 år. Disse inddrages i vægtning af behandlingsindsats frem for sygdomsinddelte vurderinger. 13. fælles elektroniske platforme, så almen praksis og hjem meplejen får adgang til et hurtigt overblik over patientens sygdomme, medicinering, antal daglige besøg af hjemmeple jen og patientens stillingtagen til genoplivning.

Høyer.–Men

1. styrket dialog med sundhedsplejen og familieafdelingen med klare retningslinjer for samarbejdet, særligt omkring de sår bare familier.

3. gruppebaserede tilbud i kommunen til unge med mistrivsel, stress og angst, som den praktiserende læge kan henvise til. 4. mulighed for op til fem afklarende samtaler ved psykolog. Unge og voksne i risikogrupper

7. mulighed for elektronisk kommunikation mellem almen prak sis og misbrugsbehandlingssted for at understøtte komplekse problematikker af fysisk-, psykisk- og social karakter.

14. en fast tilknyttet læge ved ældreboliger på samme måde som ved plejehjem. Psykiatri 15. mulighed for, at almen praksis – med patientens samtykke –kan kommunikere elektronisk med socialpsykiatrien.

LÆGEMAGASINET 3 7 Vi forsøger at nedbryde dem ved at udbrede viden om ADHD Hos piger med ADHD er det ikke nød vendigvis hyperaktiviteten, der er det mest iøjnefaldende. Ofte er de uopmærksomme, glemsomme og generte. Det er symptomer, der er svære at få øje på, og de bliver ofte overset af forældre og øvrige voksne, der omgås pigerne i deres dagligdag. I vores brochureserie ”ADHD og ...” foku serer vi på de mange aspekter ved ADHD. Brochurerne kan være til stor hjælp for dem, der har ADHD inde på livet – enten som patient eller som pårørende. Du finder alle 17 brochurer i serien på vores hjemmeside: medicenordic.dk ADHD er ikke altid til at få øje på. I mange år har børn og unge med diagnosen ADHD været betragtet som hyperaktive og dem, der ”kravler på væggene”. Men mange – især piger og kvinder – lever med ADHD som en skjult sygdom. Storgade 30B / DK-4180 Sorø / Tel +45 5786 2525 / Fax +45 5786 2526 / info@medicenordic.dk / medicenordic.dk Du kan læse, downloade og bestille brochurerne her: medicenordic.dk. Du er også velkommen til at kontakt os på mail info@medicenordic.dk eller på tlf. 5786 2525 Patienter og pårørende kan have stor glæde af emnerne i de 17 temabrochurer. Du er også velkommen til at bestille brochurerne til udlevering. Der er fordommemangeom ADHD Bliv klogere på ADHD ”ADHDbrochureserienmedog...” ADHD og drengeADHD og tid OgADHDtid ADHD og seksualitet OGADHDSEKSUALITET ADHD og uddannelse ogADHDuddannelse ogADHDmisbrugogADHDmotivation ADHD og kost ADHD ogkost ADHDog adfærdogADHDpiger ogADHDpædagogik ogADHDtrafik ADHD og arbejdspladsen ADHD OGARBEJDSPLADSEN ogADHDparforhold ADHD og teenagere OGADHDTEENAGERE ogADHDsøvnogADHDsøskende ADHD og misbrugADHD og motivation ADHD og adfærdADHD og piger ADHD og pædagogik ADHD og søvnADHD og søskende ADHD og bedsteforældre ADHDogbedsteforældre Sæt fokus på de mange aspekter ved ADHD – få dine temabrochurer her! udbygget og formaliseret samarbejdet, og i fællesskab lægger vi nu en plan for pleje, medicinering, tilsyn mv. Denne indsats har reduceret antallet af indlæggelser og vagt lægebesøg og øget trivslen og trygheden hos de ældre og kronisk syge, der bor i eget hjem, påpeger Lise Høyer. Skal lære hinanden at kende Ideen om at mødes og lære af hinanden kan godt overføres til mange andre sekto rer inden for sundhedsvæsenet. – Vi må også være ærlige og sige, at vi som praktiserende læger ofte ikke kender nok til de tilbud, metoder og arbejds forhold som gælder i nogle af de andre dele af sundhedsvæsenet. Derfor er det nødvendigt, at vi mødes på tværs af sek torerne, og at vi både under uddannelsen og med forskellige former for efteruddan nelse lærer mere om hinanden – og det gælder begge veje, påpeger Lise Høyer. Samarbejdet kunne allerede i dag gø res mere smidigt og enkelt, hvis blot de forskellige instanser kunne kommunikere direkte med hinanden. PLO’s foreslår, at samarbejdet mellem forskellige dele af sundhedsområdet prioriteres. Det kan blandt andet ske ved at der etableres en styrket dialog og klare retningslinjer for samarbejdet – især om de sårbare familier – mellem sundhedsplejen, familieafde lingen i kommunen og de praktiserende læger.Og samarbejdet mellem hjemmeplejen og almen praksis kunne styrkes yderligere, hvis man kunne bruge fælles elektroniske platforme. Det ville give begge parter et bedre overblik over patientens sygdomme, medicin og medicinadministration, antal daglige besøg af hjemmeplejen, patientens stillingtagen til genoplivning m.m. Kræver tid og ressourcer Lise Høyer er godt klar over, at det er tid- og ressourcekrævende at identificere fx livsstilssygdomme, børn i mistrivsel, psykiske problemer, sygdomme hos ældre og kronikere eller gryende misbrug på et tidspunkt, hvor symptomerne er diffuse og advarselslamperne kun blinker svagt.

– Hvis vi ikke får identificeret og rea gerer på de faresignaler, der er, og de udvikler sig til behandlingskrævende sygdomme eller mistrivsel med hyppige indlæggelser på psykiatriske eller somati ske sygehuse, bliver det jo for alvor dyrt. De ressourcer, der kræves for at kunne yde en optimal indsats på forebyggelses området, har vi ikke endnu. Derfor er det afgørende, at vi samtidig satser på dét, der kaldes strukturel forebyggelse. Det er fx at uddanne flere læger til almen praksis, styrke sundhedshusene og øge prisen på cigaretter eller sænke afgiften på sund kost. Det sidste er uden sammenligning den mest effektive form for forebyggelse, understreger Lise Høyer.

Men omvendt er den forebyggende ind sats, der er behov for, mindre, jo tidligere i forløbet, man sætter ind. – Det kræver ofte et langt og indgå ende samtaleforløb mellem borgeren og

den praktiserende læge – eller en anden person i sundhedssystemet, som vedkom mende har tillid til. Det kræver også en tæt og ofte også tidkrævende dialog mellem flere forskellige instanser, siger formanden for PLO’s udvalg for Nær Sundhed, der dog ikke er i tvivl om, at investeringen af tid og ressourcer i forebyggelse og tidlig indsats er givet godt ud.

AF FORMAND HANS MARTENS, CHES – COALITION FOR HEALTH, ETHICS AND SOCIETY

8 LÆGEMAGASINET 3 Se på sundhedsudgifter som investeringer – og invester, hvor det giver værdi for patienter og for

BNP vækst i Danmark og nabolande1) 2021 2022 2023 Danmark 4,9 3,0 1,2 Tyskland 2,9 1,4 1,3 Sverige 5,1 1,3 0,8 Finland 3,0 1,8 1,2

Et par kommentarer til tallene: For det første er der her tale om en fremskriv ning fra 2020 til 2030, dvs. en periode på kun 10 år, og det vil også sige, at tal lene kan forventes at være ret præcise. Man kan også glæde sig over stigningen i fødselstallet – de mellem 0 til 5-årige – men problemet er, at de ikke er klar til arbejdsmarkedet før om 20-25 år, og i mellemtiden skal de bruge pædagoger og skolelærere! Gruppen 18-64 år er også lidt problematisk, fordi den traditionelt udgør den arbejdsdygtige alder, men dels er der ikke så mange, som allerede starter deres erhvervskarriere, når de er 18, men sna rere når de er omkring 25 år. dels er der nogle, der fortsætter med at arbejde efter de 65 år. Men som gennemsnit for tilba getrækningsalderen passer det nok meget godt med situationen i Danmark i tiden frem til 2030. Og læg så lige mærke til, at stigningen i befolkningen kommer fra de personer, der er over 65 år gamle – og der kommer 60 pct. flere i aldersgruppen over 80 år. Og det er ofte mennesker, der har flere sygdomme, som sundheds- og pleje sektorerne skal tage sig af. Udsigten til flere ”varme hænder” er ikke til stede. Der er klart en krise på vej på sygeplejerskeområdet, hvor mange en ten stopper med at arbejde, går på deltid eller tager til udlandet for at arbejde, mens færre søger ind til uddannelsen. Og da vi næppe hverken kan eller ønsker at inte grere ikke-danskere i sundhedssektoren – eller i det hele taget – kan man vifte med så mange poser penge, man kan finde i den mere og mere slunkne statskasse. Men de ekstra varme hænder er der bare ikke.Det er derfor, at reformer af sundheds væsenet må på operationsbordet. Og ku ren kan ikke være endnu en lappeløsning.

fra større udgifter til arbejdsløshedsunder støttelse, lønstigninger, højere energipri ser og meget mere. Det stigende pres på de offentlige fi nanser ledsages af et stigende pres fra den demografiske udvikling. Fremover skal et faldende antal yngre betale for og tage sig af et stigende antal ældre – der ofte lider under flere forskellige sygdomme.

konkurrencehedsområdet,deoffentligevækstnomiskeglemt,stiger!atfordiinternationaleUkraine,påøkonomiskeogogmodelmindrederligt,europæiskeMangennemegenbetalingtilharoggende.alleredesundhedsvæsnet.pæiskemærkesystemetikkederliggendeblevet,varmeomOgsmåSundhedsreformersamfundetskeroftevedatsætteplastrepå,hvordetgørmestondt.de”løsninger”drejersigmegetofteatskaffeenposepengeognogleflerehænder.Menproblemeterbareatderersåmegetprespådeunfaktorer,atplasterløsningerkanbrugesmere.Nuskalsundhedspåoperationsbordet–velathvismanvilbevaredeneuromodelmedligeadgangforalletilDenmodelersådansetundertrussel,ogulighedenerstiLangeventetiderpåudredningerbehandlingeridetoffentligesystemfåetmange(blandtdemsomharråd)atsøgeoveridenprivatesektormod–entenbetaltdirekteellerenprivatsygeforsikring.SituationeniDanmarkerikkeunik.finderlignendesituationeriandrelande,ogdeterikkesåunfordivijoleverundermereellersammebetingelser.Deoffentligefinanserharmåttetståtilmegetgennemdesidste20år,senestharpandemienkostetpengelavvækstogfrastartenaf2022erdensituationfuldstændigvendthovedet,delspågrundafkrigenidelspågrundafsammenbrudafforsyningskæder,ogdelsmangepludseligsermulighederforsættederespriserop,nudaaltandetInflationogplusrentervarvelnæstenmenstårpludseligstærktidetøkobillede,ogdetsammegørlavereoggenereltetstigendeprespådefinanser.Sermanspecifiktpåoffentligefinanserirelationtilsundvildetkommeunderny–frastørreforsvarsudgifter,

Der er flere ting, man kan gøre, men de ligger alle sammen på systemniveau, og de kan komme til at pille ved nogle siloer, som instinktivt skal forsvares, men her må ansatte og ledere i sundhedsvæsenet se mere fordomsfrit på reformer. En første ting man kunne gøre, er at holde op med at tale om sundhedsudgifter som omkostninger, og i stedet for se dem som investeringer – og samtidig finde modeller for, hvordan værdiskabelsen – for patienter og for vores samfund og samfundsøkonomi – sker. Ved at foku sere på det forventede afkast (i form af værdiskabelse) fastholder man naturligvis omkostningerne som centrale i billedet, men holder dem op mod, hvad man får for pengene. Det vil f.eks. være ret klart, at man får mere værdi for både patienter og samfund for penge investeret i fore byggelse end helbredelse. Og med det stærkt stigende antal ældre i samfundet, bør fokus ikke alene være på at forebygge sygdomme, men også at forbygge, at syg domme forværres. Det gælder f.eks. for de kroniske sygdomme. Rigtig mange vil få Diabetes 2, selvom forebyggelsen for bedres, men det er mindst lige så vigtigt at sørge for, at den sygdom ikke udvikler sig og fører til amputationer, blindhed osv., som vil gøre den samfundsmæssige værdi beregning dårligere, fordi patienterne ikke kan klare sig selv, men har brug for offent ligt finansieret støtte og pasning. Som det ofte er beskrevet, bruger man i Danmark ikke så mange penge på fore byggelse, men det bør ændres i lyset af de baggrundsfaktorer, vi nu opererer med. Den anden ting er, at vi simpelthen må blive mere smarte. Mere smarte til at bruge teknik og innovationer til at sætte personale fri fra tidskrævende opgaver til at gøre det, de er ansat til, nemlig at tage sig af patienterne og sørge for, at vente tiderne i sundhedssystemet kan bringes ned, hvilket igen kan skabe en stor sam fundsværdi.Oftekommer innovationer, inkl., data systemer, til sundhedssektoren fra tekni kere og ingeniørers hænder og hjerner, og det er et spørgsmål, om det ikke vil være bedre at inddrage sundhedspersonalet i udviklingen af løsningerne, dels for at sikre at de rammer de rigtige behov (og ikke bare er teknik for teknikkens skyld) og for det andet at de bliver til at betjene på en sådan måde, at de skaber mere tid for sundhedspersonalet til pleje end til at arbejde med komplicerede teknologiske løsninger.Etområde, hvor der kan vindes meget ret hurtigt, er ved at investere i det mest moderne diagnoseudstyr og samtidig ud vikle kunstig intelligens på en sådan måde, at man kan stille mere præcise diagnoser og planlægge de mest optimale behand lingsveje for patienterne. Derved kan

man også mindske en stor mænge spild i systemerne.Det,deri realiteten er på spil nu, har potentielt store omkostninger, nemlig at vi taber den europæiske model på gulvet og bliver mere amerikanske i den forstand, at dem, der har råd, kan få, mens andre må vente – måske til det er for sent. Det er i alle europæiske lande højt prioriteret at have universelle sundhedssystemer, og det er bredt accepteret at finansieringen skal være solidarisk.

Læs Lægemagasinet på nettet www.laegemagasinet.dk

Men man kan jo ikke sammenligne med andre lande, er en ofte brugt – og særde les uintelligent – måde at udgå at se over grænserne, men som også beskrevet i tidligere artikler er der gennem EU mange muligheder for at samarbejde og få data og anden inspiration på områder, som vir ker i andre lande og i andre landes regio ner. Dermed være ikke sagt, at andre altid gør det bedre. Danske løsninger kan også være de fremmeste, men det er ikke poin ten. Pointen er, at vi har brug for smarte løsninger, og hvis de allerede findes, hvor for så ikke tilpasse dem og bruge dem. For man kan sammenligne med andre lande. Vi er såmænd ikke så forskellige på tværs af store dele af Europa, og hvis vi så ikke er ens, så er det måske netop i forskellene, at nye løsninger kan findes! 1

forecast-russias-war-worsens-outlook_enmic-forecasts/summer-2022-economic-economic-forecast-and-surveys/econohttps://economy-finance.ec.europa.eu/ 2 ny-befolkningsfremskrivning-2020-2060/analyseenheden/nyt-om-dansk-oekonomi/https://www.kl.dk/nyheder/makroIfølge en ny befolkningsfremskrivning vil antallet af personer i den ”arbejdsduelige” alder falde lidt, mens antallet af ældre stiger markant.2) 2020 2030 Ændring personer Ændring pct. 0-5 år 366.881 420.010 53.129 14.5 6–17 år 789.257 748.642 -40.615 -5.7 18-64 år 3.510.634 3.503.538 -7.096 -0.2 65-79 år 883.665 937.563 53.904 6.1 Over 80 år 272.326 433.511 161.185 59.2 I alt 5.822.763 6.043.270 220.507 3.8

LÆGEMAGASINET 3 9

Der er naturligvis mange andre aspek ter i sundhedsreformer, herunder som om talt i en tidligere artikel et bedre og mere afslappet offentligt-privat samarbejde i lande som Danmark. Men faktisk kan man også finde inspiration til løsninger, som har bevist, at de virker, i andre systemer.

Referencer

Semaglutid er videreudviklet til brug af be handling af overvægt og fedme i en dosis på 2.4 Semaglutidmg. 2.4 mg er undersøgt i et stort fase 3 program (STEP studierne af 68 til 108 ugers varighed). Det placeboju sterede vægttab i studierne har været på omkring 15 % på tværs af studierne og 35 til 40 % af deltagerne tabte sig over 20 % i vægt.Effekten af Wegovy® på risikoen for iskæmisk hjertekarsygdom er aktuelt uaf klaret, men semaglutid molekylet admini streret som semaglutid 1 mg (Ozempic®) eller som oral semaglutid (Rybelsus®) har i store kardiovaskulære endepunktsstudier vist at beskytte mod hjertekarsygdom og at reducere mortalitet ved type 2 diabetes. Således blev MACE (sammensat ende punkt af mortalitet pga. hjertekarsygdom, ikke dødeligt myokardieinfarkt og ikke dø deligt apopleksia cerebri) reduceret med 25 %, og Ozempic® anbefales nu som be handling til type 2 diabetes patienter med erkendt kardiovaskulær sygdom, eller som har flere kardiovaskulære risikofaktorer.

Er en dual GLP-1/GIP receptor agonist, der aktuelt er registreret til behandling af type 2 diabetes i USA, hvor fase 3 studi erne har vist store vægttab på 11-13 kg og store reduktioner i HbA1c.

Resultaterne forventes i 2024. Wegovy® er godkendt i Danmark til be handling af svær overvægt med BMI > 30 kg/m2, eller BMI > 27 kg/m2 og mindst en vægtrelateret komorbiditet som prædiabe tes eller manifest diabetes, hypertension, dyslipidemi, obstruktiv søvnapnø eller kardiovakulær sygdom. Wegovy® har ikke fået generel klausuleret tilskud, og der skal søges om enkeltilskud, og prisen er aktuelt ukendt. Wegovy® er markedsført i USA, men endnu ikke markedsført i Danmark. Tirzepatid (Mounjaro®)

Semaglutid 2.4 mg (Wegovy®) Semaglutid 1 mg (Ozempic®) er en vel etableret behandling til personer med type 2 diabetes og medfører i gennemsnit et vægttab på 5-6 kg, og en forbedring i HbA1c på i gennemsnit 18- 20 mmol/mol.

10 LÆGEMAGASINET 3 Semaglutide (Wegovy ®) og Tirzepatid (Mounjaro ®) – Et paradigmeskift indenfor behandlingen af overvægt og fedme AF PROFESSOR, OVERLÆGE, DR.MED. STEN HVIDOVREENDOKRINOLOGISKMADSBADAFDELING,HOSPITAL

Overvægt og fedme er kommet i fokus efter, at der er kommet nye lægemidler til behandling af disse tilstande. Behandlin gen af fedme er vanskelig. Livsstilsinter vention eventuel i kombination med de godkendte lægemidler til overvægtsbe handling har kun medført mindre vægttab på omkring 5- 6 % og ofte kun forbigå ende, specielt efter livsstilsintervention har vægttabet 1-2 år efterfølgende være minimal eller helt forsvundet, altså været en behandlingsmæssig fiasko.

I juni måned i år blev det første studie publiceret, hvor tirzepatid (Mounjaro®) blev undersøgt i relation til behandling af fedme og overvægt. I alt 2539 overvæg tige personer med en gennemsnitsvægt på 105 kg (BMI 38.0 kg/m2) deltog i studiet. De blev randomiseret til behand ling med tirsepatid 5 mg, 10 mg 15 mg eller placebo i 72 uger. Vægttabet var 16 % på tirzepatid 5 mg, 21.4 % på 10 mg og 22.5 % på 15 mg mod 2.4 % i place bogruppen for dem, der gennemførte behandlingen (figur 1). Omkring 56 % af deltagerne tabte mindst 20 % i vægt og omkring 36 % tabte mindst 25 % i vægt (intention-to-treat analyse inkluderende alle deltagerne) (figur 2). Tirzepatid reducerede taljemål og blodtrykket og havde en gunstig effekt på lipidprofilen og leverenzymer. I alt 93 % af deltagerne med prædiabetes før studiet fik normal glukosetolerance efter 72 uger. Bivirknin gerne med tirzepatide er de velkendte fra behandling med en GLP-1 receptor ago nister, og i alt 6.2 % stoppede behandling med 15 mg mod 2.6 % i placebogruppen

Den hjertebeskyttende effekt vil for mentlig blive mere udtalt med Wegovy® 2.4 mg, også pga. af det større vægttab, der vil have en gunstig effekt på de kardio vaskulære risikofaktorer. Effekten af Weg ovy® på bla. hjertekarsygdom undersøges aktuelt i det store SELECT studie, hvor over 17.000 overvægtige er inkluderet.

Figur 2 illustrerer (intention-to- treat analyse), at omkring 56 % af deltagerne tabte mindst 20 % i vægt og 36 % tabte sig mindst 25 % i vægt på Mounjaro® 15 mg. Figuren viser også vægttabene for placebo, 5 og 10 mg Mounjaro.

Figur 1 viser vægttabet under 72 ugers behandling med tirzepatid (Mounjaro®) 5, 10, 15 mg og placebo for dem der gennemførte behandlingen. Tallene ude til højre viser resultaterne for alle der deltog i studiet (intention-to-treat analyse).

LÆGEMAGASINET 3 11 pga. bivirkninger fra mavetarmkanalen i form af kvalme og opkastninger. Effekten af tirzepatid på hjertekarsygdom under søges aktuelt i et stort kardiovaskulær endepunktsstudie. Kommentar I det svenske ”Swedish Obesity Study” (SOS) var der efter 20 års opfølgning et gennemsnitlig vægttab på 17 % opnået vha. fedmekirurgi, hvilket var associeret med 29 % reduktion i mortalitet, apoplek sia cerebri var reduceret med 34 % og myokardieinfarkt med 29 % sammenlignet med en overvægtig kontrolgruppe. Fore komsten af diabetes var også signifikant reduceret.Enpost-hoc analyse af LookAHEAD studiet viste, at 10 % vægttab over en 10 årsperiode medførte 21 % reduktion i risi koen for hjertekarsygdom.

I ”Direct” studiet medførte 15 kg vægt tab 80 % remission af type 2 diabetes med kortere end 6 års diabetesvarighed og som ikke var i insulinbehandling. Hidtil har vi behandlet følgesygdom mene til overvægt og fedme, da vi ikke har haft en effektiv behandling af selve overvægten. Det har vi nu og det bliver muligt at behandle årsagen til type 2 dia betes, søvnapnø, afhjælpe smerterne fra artroser, samtidig med at hypertensionen og dyslipidemien bedres ved at behandle overvægten effektivt. Der er fortsat et spring op til de 40 kg vægttab, som ses efter fedmekirurgi, men det indsnævres med Wegovy® og Moun jaro®, og der er andre effektive fedmemid ler på vej – der er således sket et paradig meskifte i behandlingen af overvægt og fedme fra livsstilintervention med lille eller ingen langsigtede effekter eventuel kom bineret med farmakologisk behandling med omkring 3- 5 kg yderligere vægttab til nu mellem 15-20 % vægttab. Med Weg ovy® og Mounjaro® vil vi kunne tilbyde en sikker og effektiv behandling af fedme uden de bivirkninger, der ses efter fedme kirurgi, der har den fordel at vægttabet er stort og langvarig. Et 5 % vægttab har hidtil været et suc ceskriterie for vægttab, da det var reali stisk at opnå med livsstilsintervention og farmakologisk behandling. I fremtiden bliver 15 %, evt. 20 % eller mere det vægt tab, der vil definere succes når en effektiv livsstilsintervention kombineres med far makologisk behandling. Aktuelt er omkring 18-20 % af den dan ske befolkning overvægtige med et BMI > 30 kg/m2, og det går den forkerte vej. Flere og flere bliver svært overvægtige, og det er nødvendigt i Danmark med en ny overordnet strategi for behandlingen af overvægt og fedme. Den aktuelle har væ Figur 3. Efter 68 uger var vægttabet 17 % i gruppen behandlet med Wegovy® 2.4 mg mod 1-2 kg i placebogruppen. Figuren viser også, at når behandlingen stopper tager deltagerne hurtigt på igen og efter 1 år var mere end halvdelen af vægttabet taget på igen.

12 LÆGEMAGASINET 3 ret en behandlingsmæssig fiasko og ofte spild af penge. Til sammenligning I USA, hvor antal let af fede og overvægtige er signifikant højere end i Danmark havde i 2018 om kring 42 % et BMI > 30 kg/m2. De sidste prognoser fra USA estimerer, at omkring 49% af befolkningen i 2030 vil have et BMI > 30 kg/m2 og omkring 24 % vil være svært overvægtige med et BMI over 35 kg/m2, hvilket medfører et dystert billede omkring de fremtidige sundhedsudgifter til behandling af følgesygdommene til fedme. Behandling af fedme er fortsat problematisk Fedme er for hovedparten af de overvæg tige en kronisk livslang recidiverende syg dom. Det viste STEP studierne også som illustreret i figur 3. Når behandlingen med Wegovy® blev stoppet, tog patienterne på igen, og det går hurtigt. Der er ingen studier, der tyder på at kroppens vægt regulation efter flere års behandling med vægtreducerende medicin vil acceptere den nye lavere vægt. Det er derfor vigtigt at der forsøges ændringer i livsstil i form af bedre spisevaner, øget motion under den farmakologiske behandling for at begrænse vægtstigningen når denne del af behandlingen stopper. Eventuelt kan f.eks. frokosten erstattes med et lavkalo risk pulvermåltid. Alternativt kan intermit terende brug af antifedme midler være en løsning for at undgå vægtstigning. Et andet stort problem er, at behand lingen synes at blive dyr, hvilket betyder at formentlig kun velhavende, der er i stand til selv at betale, vil få mulighed for behandlingen. Det er uheldigt, da fore komsten af fedme er skæv fordelt med en højere forekomst blandt de økonomisk dårligst stillede. Vi mangler flere sundhedsfaglige analy ser af hvilke grupper, hvor de nye behand linger vil være mest optimale. Oplagte grupper er overvægtige personer med type 2 diabetes fra diagnosetidspunktet og de første år efter diagnosen. Norma lisering af blodglukose vil spare penge pga. mindre forbrug af medicin til den antihyperglykæmiske behandling, færre ambulante kontroller og reduceret risiko for udvikling af de sendiabetiske kompli kationer inklusiv kardiovaskulær sygdom. Andre grupper er personer med svære artrosegener, der vil bedres samtidig med, at de får bedre livskvalitet pga. bedre fy sisk formåen. Store vægttab vil også øge muligheden for at kunne blive fastholdt på arbejdsmarkedet, som vist i det svenske SOSDetstudie.ervigtig slå fast, at overvægt koster samfundet mange penge, og i en dansk undersøgelse viste vi, at i perioden fra 2002 til 2018 kostede en normalvæg tig person sundhedssystemet omkring 20.000 kr., mens overvægtig person kostede 41.000 kr. årligt, og jo mere over vægtigt desto større udgifter. Endvidere var udgiften til overførselsindkomster 31 % større end for normalvægtige. Over vægt og følgesygdommene har derfor store personlige og samfundsøkonomiske omkostninger, og det vil ofte være en rig tig god samfundsforretning at behandle fedme. Der bør snarest initieres store randomiserede studier, hvor det mest optimale samspil mellem kommuner, prak tiserende læger og hospitaler vurderes, og herefter udarbejdes en national strategi for behandling af overvægt og fedme. Besøg www.cotedor.dk Ferieboliger i Provence

LÆGEMAGASINET 3 13

Redaktionen har bedt mig om en kom mentar til artiklen "Association between hypotension during 24 h ambulatory blood pressure monitoring and reflex syncope: the SynABPM 1 study" trykt i juni 2022 i European Heart Journal. Synkope kan være svært at have med at gøre, og hvis patienten virkeligt har en synkope (kortvarig besvimelse, frisk igen umiddelbart efter), er det nyttigt at skelne mellem de tre hovedgrupper – ortosta tisk, kardielt betinget og reflexmedieret.

Mere døgnblodtryksmåling hos patienter med synkope?

Sidstnævnte er studiets målgruppe, altså patienter med vasovagale synkoper, situationsbestemte synkoper (afføring, vandladning, hoste) eller sinus caroticus synkoper. I dette studie, som udgør en ret stor regneøvelse, blev pt med sinus caroticusoverfølsomhed dog udelukket sammen med patienter med permanent hypotension sv.t. 24-timers gennemsnit for systolisk BT < 106 mmHg for mænd og < 99 mmHg for kvinder. Spørgsmålet er om døgnblodtryks måling i denne selekterede gruppe kan bidrage til at stille diagnosen. Der er tale om et retrospektivt studie, hvor patienter med diagnosen reflekssynkope havde fået lavet døgn-BT < 3 mdr efter diagnosen blev stillet (på anden vis – ved udeluk kelse af øvrige årsager til synkope). Hver case blev matchet med to patienter, som havde fået lavet døgn-BT af andre grunde end synkope, og matchet blev udført for alder, køn og døgn-BT. Det kan ikke ses af artiklen, hvad gennemsnits-BT var i de to grupper.Hovedresultatet var at der var en større andel med episoder med BT-fald < 90 mmHg blandt patienter med reflekssyn kope sammenlignet med patienterne uden synkope. Grundig analyse viste, at disse BT-fald udviste høj specificitet men dårlig sensitivitet for synkope. Med andre ord –episoder med fald i SBP < 90 mmHg under døgn-BT måling er almindeligt for pt uden synkoper med BT i den lave ende, men det forekommer hyppigere hos pt med reflekssynkope.Forfatternekonkluderer, at der bør ud føres mere døgn-BT på synkopepatienter, men de terapeutiske forslag adskiller sig ikke fra hvad man ellers ville have gjort –grundig instruktion af patienten i hvordan man skal forholde sig for at undgå eller mildne synkoper, eventuelt hos udvalgte patienter midodrinebehandling. Bidraget af døgn-BT måling i denne sammenhæng er nok begrænset, og jeg synes man må forholde sig kritisk til artiklens konklusion. Helt afgørende hos patienter med bevidsthedstab er fortsat at få skelnet mellem synkope/ikke synkope samt at skelne mellem ortostatisk betinget syn kope (seponer antihypertensiva) kardielt betinget synkope (udredning og behand ling!) og reflekssynkope (primært trøst og vejledning). Første prioritet for lægen er at fange de kardielt betingede synkoper (dårlig prognose) og få dem udredt og behandlet. Primært i praksis med grundig anamnese, klinisk undersøgelse, EKG og hjertestetoskopi. Hos udvalgte patienter supplerende holtermonitorering, ekkokar diografi og evt. undersøgelse for iskæmisk hjertesygdom.Døgnblodtryksmåling kan være vigtigt, hvis der findes en diskrepans mellem målte høje klinik- eller hjemmeblodtryk og symptomer på for lavt blodtryk (besvi melse eller svær ortostatisme) – ISÆR hvis patienten er i antihypertensiv behandling. Anvendelse af døgn-BT måling generelt som diagnostisk redskab ved formodet reflekssynkope synes jeg ikke retfærdig gøres af de præsenterede data. Det er værd at huske muligheden for behandling med midodrine (alfa-agonist, som øger blodtrykket, og som kan have en sær deles gunstig symptomatisk effekt) ved gentagne hyppige synkoper betinget af hypotension. Det foregår og udskrives via kardiologisk ambulatorium efter grundige supplerende undersøgelser (vippelejetest m.m.).

AF OVERLÆGE, DR. MED. KENT LODBERG CHRISTENSEN, HJERTESYGDOMME OG AARHUSBLODTRYKSKLINIKKEN,UNIVERSITETSHOSPITAL

IBSEN

AF

14 LÆGEMAGASINET 3 Vasodilaterende betablokkere

DR.MED.

i hypertensionsbehandlingenBetareceptorerblevinitialtdefineretafAhlquisti1948somendelafdetadrenergesympatiskesystem(1).Detteførtetiletvældafpublikationerogopdelingibeta-1,specieltihjertetogbeta-2receptoreriperiferekaroglunger.Denførstekliniskanvendeligebetablokker,propranolol,blevudvikletafSirJamesW.Blacki1960(1,2)medpåvisningafeffektpåanginapectorissamtantihypertensivvirkning.Blackblevtildeltnobelpriseni1988(3)fordenneopdagelse–ogikkeatforglemme,ogsåforhansklarlæggelseafcimetidin–tobanebrydendekliniskefarmakologiskefundafeenogsammeperson.Propranololsanvendelseblevoverhaletafdenbeta-1selektivebetablokkermetoprolol(2)medenmegetsoliddokumentationvediskæmiskehjertesygdommeoghjertesvigt.Herharmetoprololbevaretsinvigtigeposition.Helttil2002mentemanatalleantihypertensivavarligeværdigemedhensyntileffektpåkardio-vaskulæresygdomme.MenLIFE-studiet(4),hvorhypertensionspatientervarrandomiserettilbehandlingmedangiotensin-antagonisten(AIIA)losartanversusdenbeta-1selektivbetablokkeratenololviste,atforsammeblodtryksniveauvargevinstenstørrepålosartansammenlignetmedatenolol.Detterokkedevedgrundprincippet–varforklaringen,atlosartanbeskytterbedremodhjerte-karsygdommeendandreantihypertensiva–elleratatenololvardårligereendandremedikamenter?–ogmindreeffektivtendmetoprolol?Enafforklaringernekunnevære,atlosartanharengunstigvirkningpånedsættelseafdetcentraleaortablodtrykogkarsitvhed,hvilketermodsatforatenololsvedkommende.Deterogsåvist,atmetoprololharenugunstigvirkningpåcentralearterierblodtryk,sammenlignetmedmedikamenterderhæmmerrenin-angiotensinsystemet.Deteroverbevisendedokumenteret,atdetcentraleblodtrykogkarstivhedertættererelaterettilhjerte-karkomplikationer,sammenlignetmedtraditioneltmåltblodtrykpåoverarmen,samtatmedikamenterdereffektivtreducerercentraleblodtrykgiverenstørregevinstpåhjerte-karkomplikationer.Fleresolidemetaanalyser(2,3,4)fraomkring2005dokumentererligeledesatblodtryksbehandlingmedmetoprolologspecieltmedatenololgivermindregevinstpåhjerte-karkomplikationer,sammenlignetmedandreantihypertensivaforsammeblodtryksreduktion.Deharderforideflestenyereguidelinesmistetderespositionsomførstevalgspræparatervedblodtryksbehandling(5)Tredjegenerationsbeta-blokkerennebivolol,somerbeta-1selektivharenspecifikkardilaterendevirkningvedenpositiveffektpåendotelfunktion,ogdermedpåcentraleblodtryk,sammenlignetmedmetoprolologatenolol(2).Derharderforværetmangeovervejelseromnebivololseffektpåhjerte-karkomplikationerskulleværestørresammenlignetmedmetoprolologatenolol.Dererdesværrealdriggennemførtomfattenderandomiseredeundersøgelsertilbelysningheraf.Derfindestoandrekardilaterendebeta-blokkerepådetdanskemarked,labetalologcarvedilol,hvoreffektenerviaalfareceptorerneogsomkunbrugesmegetlidtvedhypertension.IJournalofHypertensionapril2022(2)erderpubliceretetomfattendearbejdesombelyserforskelleieffektpåkardialekomplikationerforbehandlingmednebivololversusmetoprolologatenolol.DerertaleomenretrospektivanalysefraColoradoUniversityafetstortmaterialeafhypertensivepatienterudentidligerekardio-vaskulærehændelser.Databasenblevscreenedforpatienterdermellem2010til2021varsatibehandlingmednebivololversusmetoprololelleratenolol.Godt1.100pånebivololblevsammenlignetmedgodt2.000påhenholdsvismetoprolologatenolol.Hovedparten,79%varhvideog54%kvinder,medianalder58år.Medianefolow-upvar3,8år.Detprimæreendepunktbestodafapopleksi,AMI,revaskularisering,anginapectorisoghjertesvigt.Behandlingmednebivololvarledsagetaf17%reduktionidetprimæreendepunktsammenlignetmedde2non-PROFESSOR EM. HANS

Importantly,theprimaryfindingofthisstudyisbiologicallyplausiblebasedonpriorhumantrialsofnebivolol showingbeneficialvasculareffects.Nebivololinduces vasodilationthroughnitricoxidestimulationandinhibition ofendothelin-1-mediatedvasoconstriction[11–13]and shouldtheoreticallybesuperiorforSBPcontrol.Inthe currentstudy,therewasnosignificantdifferenceinmedian brachialSBPorchangeinbloodpressureafterinitiationfor nebivololversusnonvasoactivebetablockers.Thismaybe becauseoftheretrospectivedesignofthestudy,with infrequentbloodpressureassessmentswithoutsystematic assessmentpriortoinitiationofeachbetablockerand frequentconcomitantuseofotherantihypertensives.However,aprevioustrialofnebivololversusmetoprololalso foundnodifferenceinbrachialbloodpressuresorheart ratebutabeneficialeffectofnebivololoncentralaortic bloodpressureandleftventricularwallthickness[23]. Centralaorticbloodpressureandcentralarterialstiffness havebeenfoundtobesuperiorpredictorsofcardiovascular eventscomparedwithbrachialbloodpressure[23,24].

Additionallyinanalysisofsecondarycardiovascularoutcomesinthecurrentstudy,wefoundthatnebivololhadthe strongestassociationwithstrokereduction;theremaybe

Ny

behandling

efter

Devereux RB,

en positiv dokumentation i randomiseret undersøgelse for behandling af

med mildere former for hjertesvigt. En randomiseret hypertensionsunder søgelse får vi næppe. Referencer 1. Black J. Ahlquist and the development of beta-adrenoceptor antagonists. Postgrau ate medical journal 1976;52 Suppl 4:11-13 2. cine/1988/black/facts/https://www.nobelprize.org/prizes/medi 3. Huck DM, Rosenberg MA, Stauffer BL. Nebivolol and incident cardiovascular events in hypertensive patients compared with nonvasodilatory beta blockers. J. hy pertension 2022,40:1019-1029. 4 Dahlöf

SE, Julius S, Beevers G, Lindholm L,,,Ibsen, H et al Cardiovascular morbidity and mortality in the Losartan Intervention For Endpoint reduction in hypertension study (LIFE): a randomised trial against

tale om et urandomi seret, retrospektivt design er der god overensstemmelse mellem de her fundne forskelle og basale eksperimentelle og kliniske undersøgelser der dokumenter en positiv virkning af nebivolol, specielt på centralt blodtryk og perifere kar, for klaret ved en positiv effekt på nitrogen oxid medieret vasodilation og hæmning af endothelin -1- medieret vasokonstriktion, positive effekter som metoprolol og ateno lol ikke besidder. Som konklusion må man sige, at ateno lol har udspillet sin rolle i hypertensionsbe handling, specielt som førstevalgspræpa rat. Metoprolol kan være velvalgt, hvis der er ledsagende iskæmiske hjertesygdomme – og selvfølgelig også som førstevalg ved iskæmiske hjertesygdomme/hjertesvigt udenNebivololhypertension.vilvære et meget velegnet valg til supplerende antihypertensiv be handling – og sandsynligvis også som førstevalgspræparat. Nebivolol også ældre B, Kjeldsen atenolol. Lancet. 2002 Mar 23;359(9311):995-1003. Bojer AS, Oxlund C, Christensen KL et al Arteriel Hypertension https://nbv.cardio. dk/hypertension 2022 6. Lindholm LH, Carlberg B, Samuelsson O. Should beta blockers remain first choice in the treatment of primary hypertension? A meta-analysis. Lancet. 2005 Oct 29-Nov 4;366(9496):1545-53 publicandprivateinsurance,andmatched/adjustedfora widevarietyofconfoundersincludingothermedications, socioeconomic,andbehavioralriskfactors,andtypeof insurancewhilesystematicallyexcludingpatientswithpreexistingcardiovascularandcerebrovasculardisease.As betablockermonotherapyisnotafirst-linerecommendationinhypertensionguidelinesintheUnitedStates,the currentstudyreflectsmorerealisticpotentialuseofthebeta blockernebivololasanadjuncttofirstlinetherapies(88% weretakingotherantihypertensivesalongwithnebivolol, seeFig.4)ratherthanoldergenerationbetablockers,such asatenololandmetoprolol.

z

med akut

LÆGEMAGASINET 3 15 vasodilaterende beta-blokkere, hazardratio 0,83 (konfidensinterval 0,74-0,94). Sammenlignet med metropolol var reduk tionen 24 %, hazard-ratio 0,76 (0,66-0,87). Forskellen mellem nebivolol og atenolol var, noget overraskende, ikke signifikant. Det positive udkomme til fordel for nebi volol er specielt båret af en stor gevinst vedrørende Apopleksi, 4,6% versus 7,4%, hazard ratio 0,67 (0,50-0,90), figur 1. I en retrospektiv kohorte opgørelse kan der være mange confounders på spil, som man vanskeligt kan justere for. Forfat terne har gjort sig store anstrengelser for at tage sådanne forhold i betragtning. De kunne ikke finde forklarende faktorer for de fundne forskelle udover medikamen terne. Man vurderede sociale forhold, behandlere, dosering og en lang række andre forhold, såsom comorbiditet, andre medikamenter eller en grundlæggende forskel i sundhedsforhold hos dem, hvor der valgtes at give nebivolol versus metro polol/atenolol.Selvomderer

1026292 www.laegemagasinet.dk LÆGE MAGASINET Magasin for praktiserende læger og speciallæger

syndrom PROFESSOR

Finerenon (Kerendia OVERLÆGE,

LARSEN Behandling af mild hypertensiongraviditeten PROFESSOR Da Costa Syndromet og

Nebivololhasalsobeenpositedtohavebeneficialantioxidativeeffectsandimproveglucoseandlipidmetabolism comparedwithotherbetablockers[11].Beneficialeffectsof nebivololfortotalcholesterolandLDLwereshownina priorrandomizedtrialcomparingnebivololtometoprolol [13].Thecurrentstudywasonlyabletopartiallyexplore theseeffects.TherewaslimiteddataonhemoglobinA1c andlipidprofilesavailableforpatientsinthecurrentstudy, andtherewerenosignificantdifferencesinmedianvalues oftheseparametersoverthestudybetweenbetablocker groups(Table4).Comparisonsbetweencholesterollevels andhemoglobinA1catinitiationofthebetablockerandat theendofthestudywerenotfeasiblebecauseofmissing databecauseoftheretrospectivedesignofthestudy. Furtherexplorationofthesepotentialeffectsandtheir relationshiptoincidenceofadversecardiovascularevents inaprospectivetrialdesignwouldbebeneficial. Thestudyhasseverallimitations.Thecurrentstudywasa retrospectiveandnonrandomizeddesignthatishypothesisgenerating.Itcouldnotfullyexplorepotentialcausative factorsunderlyingthebeneficialassociationofnebivololwith reducedcardiovascularevents,suchasimprovedperipheral Unadjustedcumulativeincidenceandhazardratiosforprimaryandsecondaryoutcomes,forthecomparisonofnebivololandnonvasoactivebetablockers. �P valuedeterminedbytheWaldchi-squaretestforthehazardratiofortheoutcomebetweenbetablockers. yPrimaryoutcomeconstitutesincidentcardiovascularhospitalizationordiagnosisofcardiovasculareventincludingmyocardialinfarction,stroke,acuteheartfailure,anginapectoris,andsurgicalorpercutaneousrevascularization. Secondaryoutcomesadjudicated(forties)inhierarchicalorderaslistedinthetable. VIDENSKABSJOURNALIST Døgnurin–udskillelseafnatriumogkaliumogkardio-vaskulærrisiko Nr. 2022 36. årgangISSN 0902-1787 national udredning og af2 diabetes OVERLÆGE,DR.MED. MADSBAD Udfordringer årskontrollenindlæggelse koronart MOGENS Funktionelle GORM JENSEN

behandlingsvejledningfor

har

hjertelidelserPROFESSOR

maj

LM2_2022.indd 12.33

uniquebenefitsofb-3agonismonthecentralandcerebral vasculatureforstrokereduction[25].InaCochranereview ofbetablockersforhypertension,oldergenerationbeta blockerswereinferiortorenin-angiotensinsysteminhibitorsandcalcium-channelblockersforstrokereduction[6]; theuniquevasodilatorypropertiesofnebivololmayreverse thisinferiority.Nebivololmayhavebeneficialcardiovasculareffectsoncentralbloodpressurecontrolandarterial stiffnessindependentofbrachialSBPcontrol,whichcould beexploredinaprospectivetrialdesignassessingcentral bloodpressure,centralarterialstiffness,andleftventricular echocardiographicparametersandtheirrelationshipto cardiovascularoutcomes.

FIGURE3

type

5.

Hucketal. 1026 www.jhypertension.com Volume40 � Number5 � May2022 Figur 1. Kumulativ incidence og hazard ratio af primære og sekundære hændelser for nebivolol versus metoprolol og atenolol (efter reference 3). Læs udgivelsertidligerepå www.laegemagasinet.dk www.laegemagasinet.dk LÆGE MAGASINET Magasin for praktiserende læger og speciallæger ISSNfebruarårgang0902-1787 Plejehjemslæger fasterammer skalfåordningenhelt mål

16 LÆGEMAGASINET 3 PRESSENYT De fleste børn med ADHD har sygdomsforløbvekslende

https://ajp.psychiatryonline.org/doi/10.1176/appi.ajp.2021.21010032#

Modsat den udbredte opfattelse af at symptomerne på ADHD hos cirka halvdelen af alle patienter gradvist aftager hen mod voksenalderen, kan symptomerne forsvinde helt og vende tilbage flere gange under sygdomsforløbet hos de fleste patienter. Kun cirka 10% opnår stabil remission ved voksenalderen. Konklusionerne er fra en artikel publiceret i American Journal of Psychiatry Det er normalt antaget at ADHD typisk diagnosticeres tidligt i barndommen og vedvarer indtil voksenalderen i cirka 50% af tilfældene. Men ifølge førsteforfatteren Margaret Sibley, fra University of Washington i Seattle, USA, forholder den videnskabelige litteratur sig til, hvorvidt børn med ADHD fortsat opfylder kriterierne for diagnosen eller”Deej.fleste opfølgningsstudier definerer blot remission som ’opfylder ikke kriterierne’ for diagnosen”, skriver forfatteren. ”Der er ikke forsket meget i, hvorvidt der er tale om remission, tilbagefald eller recovery”. Hun påpeger, at man kan have symptomer på ADHD, selvom det ikke er i et omfang, der er nok til at stilleDerdiagnosen.findesogså tidligere forskningsresultater, som vurderede, at en patient var i remission, selvom vedkommende fortsat var i aktiv medikamentel behandling mod ADHD. I nuværende studie fulgte forskerne 558 børn i op til 16 år. Symptomerne blev vurderet ved hjælp af spørgeskemaer til deltagerne, deres forældre og deres lærere, cirka hvert andetOmkringår. 30% af børnene oplevede fuld remission (symptomremission, ingen funktionspåvirkning og ingen behandling i mindst en måned) ved mindst en af opfølgningerne. Men de fleste af disse (60%) oplevede tilbagefald efter den første remissionsperiode.Kun9,1%afdeltagerne oplevede vedvarende remission under studiets forløb, og kun 11% havde et kronisk forløb med vedvarende symptomer. ”De fleste deltagere havde fluktuerende symptomer fra barndommen til voksenalderen”, konkluderer forfatterne. Kilde: RegionADHD-foreningen/HovedstadensPsykiatri

Læs den videnskabelige artikel her:

ANNONCE

Dansk perspektiv Et lignende studie, som det som Shah et al. foreslår [1], ville være meget relevant også i RegisterDanmark.data i Europa viser en stigende tendens til brug af AK-behandling til over 80 % af AF patienter [15]. Til sammen ligning, hos indlagte patienter med AF over 75 år i Øst Danmark, får over 85 % administreret AK-behandling under deres indlæggelse (Figur 1). Spørgsmålet om effekten af AK-be handling på livskvalitet og daglige færdig heder hos ældre patienter er dog fortsat ubesvaret.Envigtig pointe at tage i betragtning er, hvorvidt de Europæiske data afspejler hele den ældre befolkning idet de er baseret på dedikerede databaser, hvori der kun ind går selekterede patienter [15]. Danmark er et af de få lande hvor det er muligt at un dersøge brugen af AK-behandling i hele den ældre del af befolkningen, som det er gjort i Holland [7]. På samme vis har man i Danmark vurderet effekten af DOAC hos patienter med AF, som får diagnosticeret cancer [16]. Derudover, skulle der kobles Kommune data for at undersøge ændrin ger i plejebehovet hos disse patienter. For at belyse livskvaliteten hos ældre i relation til AK-behandling ville et rando miseret studie være vanskeligt at gennem føre, ud fra det aktuelle AK-forbrug (Figur 1) og etiske betragtninger. Derimod kunne det være meget interessant at inddrage ældre patienter i at udvælge hvilke livskva litets parametre der er de meningsfulde at monitorere ud fra deres perspektiv. OG LEKTOR HELENA DOMÍNGUEZ OG OG PROFESSOR AHMAD SAJADIEH,

Forfattere tager udgangspunkt i en case om 82-årig kvinde som får netop diagnosticeret atrieflimren og der over vejes gevinster og risici ved at iværksætte AK-behandling. Patienten er selvhjulpen og går normalt omkring med rollator, men hun er faldet to gange inden for det sidste år. Det er dilemmaet. Der er jo klar evidens for, at AKbehandling kan forebygge apopleksi [2, 3]

HJERTEAFDELING, BISPEBJERG-FREDERIKSBERG HOSPITAL

18 LÆGEMAGASINET 3

Det er det spørgsmål der stilles af hjer telæger fra San Francisco i USA, i et per spektiv artikel, i tidsskriftet New England Journal of Medicine [1]

Bidrager AK-behandling hos ældre patienter med atrieflimren til at bevare deres funktion og livskvalitet?

Alligevel er der under halvdelen af den ældre del af befolkningen med AF, som bruger AK-behandling i USA [4], selv om risikoen for apopleksi stiger med alder [5, 6]. Tilsvarende, viser Europæiske studier, at en fjerdedel af patienter ophører med AK-behandling efter at have startet AKbehandling med nye direkte orale anti koagulerende medikamenter (DOACs) [7] Forventet kort levetid, faldtendens, og skrøbelighed er de faktorer som får læger i Almen Praksis til at afholde sig fra AKbehandling, hvilket er mere eller mindre forenelig med kliniske studier [8, 9]. Frygten er jo blødninger. Selv om DOACs med fører færre større cerebrale blødninger end vitamin K-antagonister (VKA) [10, 11] er brugen af DOACs forbundet med, blød ninger som har kliniske konsekvenser [10, 12], som hospitalsindlæggelse, og behov for operation. AK-behandling øger blød ningsrisikoen med 65 % men hos en sjet tedel af deltagere med større eller klinisk relevante ikke-større blødninger, blev konsekvenserne af disse blødninger ikke omtalt i studierne. Shah et al. [1] fremhæver i deres per spektiv artikel, at der mangler kliniske studier med fokus på livskvalitet og funk tionalitet især hos ældre som den 82-årige i eksemplet. Forfatterne foreslår et klinisk studie med inddragelse af både patienter, plejere og læger [1]. Ud fra antagelser om funktionstab efter både iskæmisk stroke og hjerneblødninger [13], og ud fra data om livskvalitet med AF [14], beregner Shah et al., at der skulle randomiseres 1600 patienter til AK-behandling, for at kunne identificere en 5 % forskel i andelen af pa tienter der fortsat er selvhjulpen efter 18 måneder samt en relevant forskel i et livs kvalitet spørgeskema (36-item Short-Form Health Survey (SF-36)).

AF OVERLÆGE

OVERLÆGE

References 1. Shah, S.J.C., K.E., Do Anticoagulants Preserve Function and Quality of Life in Older Adults with Atrial Fibrillation? New England Journal of Medi cine Evidence, 2022. 1(3).

2. Hart, R.G., L.A. Pearce, and M.I. Aguilar, Adjusted-dose warfarin versus aspirin for preventing stroke in patients with atrial fibrillation. Ann Intern Med, 2007. 147(8): p. 590-2.

12. Franco, L., et al., Clinically relevant non-major bleeding with oral anticoagulants: non-major may not be trivial. Blood Transfus, 2018. 16(4): p. 38791.

9. Osasu, Y.M., R. Cooper, and C. Mitchell, Patients' and clinicians' perceptions of oral anticoagulants in atrial fibrillation: a systematic narrative review and meta-analysis. BMC Fam Pract, 2021. 22(1): p. 254.

8. Mas Dalmau, G.S.A., E.; Endefaque Montes, M.B.; Sola, I.; Pequeño Saco, S.; Alonso Coello, P., Patients’ and physicians’ perceptions and attitudes about oral anticoagulation and atrial fibrillation: a qualitative systematic review. BMC Family Practice, 2017. 18(3).

3. Xian, Y., et al., Association of Preceding Antithrombotic Treatment With Acute Ischemic Stroke Severity and In-Hospital Outcomes Among Patients With Atrial Fibrillation. JAMA, 2017. 317(10): p. 1057-67.

5. Hindricks, G., et al., 2020 ESC Guidelines for the diagnosis and management of atrial fibrillation developed in collaboration with the European As sociation for Cardio-Thoracic Surgery (EACTS). Eur Heart J, 2021. 42(5): p. 373-498.

7. Toorop, M.M.A., et al., Predictors, time course, and outcomes of persistence patterns in oral anticoagulation for non-valvular atrial fibrillation: a Dutch Nationwide Cohort Study. Eur Heart J, 2021. 42(40): p. 4126-37.

6. January, C.T., et al., 2014 AHA/ACC/HRS guideline for the management of patients with atrial fibrillation: a report of the American College of Car diology/American Heart Association Task Force on practice guidelines and the Heart Rhythm Society. Circulation, 2014. 130(23): p. e199-267.

11. Larsen, T.B., et al., Comparative effectiveness and safety of non-vitamin K antagonist oral anticoagulants and warfarin in patients with atrial fibril lation: propensity weighted nationwide cohort study. Bmj, 2016. 353: p. i3189.

16. Ording, A.G., et al., Bleeding complications in patients with gastrointestinal cancer and atrial fibrillation treated with oral anticoagulants. Cancer Med, 2021. 10(13): p. 4405-14.

4. Hernandez, I., et al., Trajectories of Oral Anticoagulation Adherence Among Medicare Beneficiaries Newly Diagnosed With Atrial Fibrillation. J Am Heart Assoc, 2019. 8(12): p. e011427.

15. Proietti, M., et al., Increased burden of comorbidities and risk of cardiovascular death in atrial fibrillation patients in Europe over ten years: A com parison between EORP-AF pilot and EHS-AF registries. Eur J Intern Med, 2018. 55: p. 28-34.

10. Halvorsen, S., et al., A nationwide registry study to compare bleeding rates in patients with atrial fibrillation being prescribed oral anticoagulants. Eur Heart J Cardiovasc Pharmacother, 2017. 3(1): p. 28-36.

LÆGEMAGASINET 3 19 Figur 1. Procentdel af patienter som indlægges med diagnosen atrieflimren (AF) og som får AK-medicin under indlæggelsen

13. Parks, A.L., et al., Long-term individual and population functional outcomes in older adults with atrial fibrillation. J Am Geriatr Soc, 2021. 69(6): p. 1570-8. 14. Kotecha, D., et al., Effect of Digoxin vs Bisoprolol for Heart Rate Control in Atrial Fibrillation on Patient-Reported Quality of Life: The RATE-AF Ran domized Clinical Trial. Jama, 2020. 324(24): p. 2497-508.

Vores nyligt offentliggjorte oversigtsarti kel over videnskabelige undersøgelser af seksualitet blandt mennesker med KOL [3] viser, at tre ud af fire mandlige patien ter med KOL lider af erektil dysfunktion (ED), sammenlignet med kun to ud af fire mænd i den alderssvarende sammenlig ningsgruppe uden KOL. Størstedelen af patienter med KOL er nuværende eller tidligere rygere, og rygning har vist sig at være forbundet med højere risiko for ED i den generelle befolkning [4]. Dog så ryg ning ikke ud til at være signifikant forbun det med ED i oversigtsartiklen fra vores tidligere nævnte litteraturgennemgang, og udviklingen af ED skyldes sandsynligvis adskillige indbyrdes forbundne biopsy kosociale faktorer. Derudover fremgik det, at rigtig mange mennesker med KOL oplever vanskeligheder med det seksuelle samliv – ikke kun på funktionsniveau, men i forhold til at turde være intim med en partner. Med henblik på ikke at overse væsentlige aspekter ved seksualitet og intimitet blandt både kvinder og mænd, er der derfor brug for en mere helhedsorien teret vurdering af seksualitet og intimitet ved KOL. Dette vil kunne have en positive indflydelse på livskvaliteten for mange mennesker med KOL og deres partnere.

Da den regelmæssige KOL-kontrol og -behandling fortrinsvis foregår i almen praksis, er det vigtigt at praktiserende læger og sygeplejersker er opmærksom på betydningen af seksualitet og intimitet i denne patientgruppe. Derfor vil vi her beskrive en række specifikke områder, som er relevante for at kunne håndtere biopsykosociale aspekter af seksualitet og intimitet hos mennesker med KOL. Ho vedbudskaberne er opsummeret i Tabel 1. Vejrtrækningsbesvær og seksuel aktivitet Trods optimal medicinsk behandling op lever mange patienter med KOL refraktær dyspnø, især i forhold til fysiske aktiviteter. Åndenød er ofte forbundet med katastro fetænkning (f.eks. "dette er farligt") og følelse af angst. Derfor kan frygt-baseret undgåelse af åndenød ved anstrengelse resultere i væsentlig nedsat fysisk aktivitet – herunder også seksuel aktivitet. Dette kommer ofte til udtryk som nedsat seksuel lyst eller aversion [5], manglende evne til at få erektion for mandlige patienter [6] og/eller nedsat seksuel tilfredsstillelse [7] Derudover er partnere til mennesker med KOL ofte bekymrede for, at seksuel ophid selse og -aktivitet kan føre til akut forvær ring af KOL, især i perioderne efter drama

Introduktion Kronisk obstruktiv lungesygdom (KOL) forårsager de klassiske luftvejssymptomer dyspnø, hoste og slimproduktion, men medfører også systemiske effekter som træthed, energitab og muskelsvaghed [1]

KOL og Opmærksomhedspunkterseksualitet: til almen praksis

20 LÆGEMAGASINET 3 AF PSYKOLOG, POST.DOC. INGEBORG FARVERVESTERGAARD, MEDICINSK AFDELING, SYGEHUS LILLEBÆLT (VEJLE SYGEHUS), AUT. PSYKOLOG YOON FREDERIKSEN, SEXOLOGISK ENHED AARHUS UNIVERSITETSHOSPITAL PSYKIATRIEN OG INSTITUT FOR KLINISK MEDICIN, AARHUS UNIVERSITET OG LEDENDE OVERLÆGE ANDERS LØKKE, MEDICINSK AFDELING, SYGEHUS LILLEBÆLT (VEJLE SYGEHUS) OG INSTITUT FOR REGIONAL SUNDHEDSFORSKNING, SYDDANSK UNIVERSITET

For en stor del af patienterne har sygdom men betydelige psykosociale konsekven ser i form af a) symptomer på angst og depression, b) skyldfølelse og selvbebrej delse i forbindelse med nuværende eller tidligere rygning, og c) passivitets- og isolationstendenser [2]. Disse følgevirknin ger hænger typisk sammen. For eksempel er frygt for dyspnø ved anstrengelse for bundet med undgåelse af fysisk aktivitet, social tilbagetrækning og udvikling af depressive symptomer, og samlet set kan sygdommen derfor have massiv indvirk ning på patienternes fysiske, psykologiske og relationelle funktionsniveau. Sociale relationer og intimitet kan fungere som beskyttende faktorer i livet med KOL, for eksempel gennem fælles mestring og ved at mindske risikoen for at udvikle depression og andre psykiske li delser. Desuden kan seksuel aktivitet være en måde for patienterne at være fysisk aktive på, hvilket er en meget vigtig med virkende faktor til at øge livskvalitet og forhindre sygdomsprogression ved KOL. På den anden side, kan relationelle fakto rer være med til at belaste den seksuelle trivsel og den generelle sygdomsbyrde, hvis intimiteten og parforholdet går skævt.

Hjælpe patienten og partneren i gang med gradvis eksponering til intime og seksuelle aktiviteter.

Vær opmærksom på, at cirka hver anden patient med KOL ikke har en partner, men stadig kan have et ønske om intimitet. behandlinghelhedsorienteretOptimal

Sørg for, at den medicinske behandling med langtidsvirkende bronkodilatatorer er optimeret, og at patienten bruger inhalatoren korrekt (konsultér lungemedicinsk speciallæge ved behov).

LÆGEMAGASINET 3 21 tisk hændelser i sygdomsforløbet, såsom lungetransplantation [8] eller en svær, ind læggelseskrævende exacerbation. Når man sammenligner indvirkningen af luftvejssymptomer på seksuel aktivitet ved henholdsvis KOL og hjertesvigt, hvor dyspnø også er et udbredt symptom, rap porterer en større andel af patienter med KOL, at vejrtrækningsproblemerne er ge nerende under seksuel aktivitet, sammen lignet med patienter med hjertesvigt (44 % versus 5 %) [9]. Derimod ser indvirkningen af vejrtrækningsproblemer på seksuel ak tivitet ud til at være mere ens på tværs af mennesker med KOL og astma [10]. Disse fund kunne tyde på, at patienternes syg domsopfattelse spiller en væsentlig rolle: Mennesker med KOL og astma deler ofte forståelsen af, at luftvejssymptomer er et resultat af luftvejssygdommen, og derfor bør undgås med det formål at kontrollere sygdommen. Ved hjerte-kar-sygdomme kan patienter have en forståelse af, at hjer tet er det berørte organ, hvilket betyder, at dyspnø er et sekundært symptom, og derfor ikke er så centralt for sygdomskon trollen.Men henblik på at undersøge mulige årsager til nedsat seksuel aktivitet, er det er derfor helt centralt at spørge ind til pa tientens egen forståelse af vejrtræknings problemerne. Hvis patienten fx opfatter, at ændringer i vejrtrækningen bør undgås med det formål at forhindre KOL exacer bation, kan det være relevant at undervise patienten i forskellen på forpustethed og tegn på exacerbation. Dette kan eventu elt følges op med at instruere patienten i gradvist at eksponere sig selv mere og mere for intim og/eller seksuel aktivitet. Disse interventioner kan suppleres med ikke-farmakologiske åndedrætsteknikker, såsom diafragmatisk vejrtrækning, fløjte munds-vejrtrækning og andre teknikker [12, 13]. Det er vigtigt at niveauet og typen af seksuel aktivitet tilpasses til patientens fysiske kapacitet. Det betyder, at for nogle patienter med meget begrænset lunge funktion kan seksuel aktivitet begynde med kys og let kærtegn af hele kroppen, mens andre patienter med mindre be grænset funktionsniveau kan være i stand til at udføre seksuelle aktiviteter, der er mere fysisk krævende, se figur 1.

Tabel 1. KOL og seksualitet. Opmærksomhedspunkter i almen praksis Areal Konkrete forslag/overvejelser aktivitetbesværVejrtrækningsogseksuel

Relationelle faktorer Søg altid at inkludere partnere i kliniske samtaler om seksuel sundhed ved KOL.

Figur 1. Energibesparende seksuelle stillinger for patienter med KOL. Gengivet fra ger_lungeforeningen.jpg][https://www.lunge.dk/sites/default/files/hjaelp-til-din-hverdag_hjaelp_sexstillinmedtilladelsefraLungeforeningen.

Sørg for, at symptomer på angst og depression udredes og behandles optimalt.

Iltbehandling i hjemmet Hvis patienten bruger iltbehandling i hjemmet, vurderes patientens og partnerens opfattelse af apparatet i forhold til seksuelle aktiviteter. Hvis iltudstyret er en praktisk barriere, foreslå da patienter at prøve seksuelle stillinger, der muliggør samtidig brug af ilt (se figur 1), eller giv instruktioner i at pausere ilten under intime eller seksuelle aktiviteter (konsultér eventuelt den speciallæge, der har ordineret iltbehandlingen).

Vurdér patientens og partnerens sygdoms- og symptomforståelse, herunder om seksuelle problemer opstår pga. frygtbaseret undgåelse af åndenød ved anstrengelse. Informér patienten og partneren om forskellen på forpustethed ved anstrengelse og tegn på KOL-forværring (konsultér lungemedicinsk speciallæge ved behov).

Støt patienten og partneren i at tale sammen om ændringer i roller i parforholdet, fx 'patient', 'plejer', og indfly delsen på intimitet/seksuelle aspekter.

Praktiserende læger, lungemedicinske og sexologiske speciallæger har et fælles ansvar for at opspore, under søge og behandle seksuelle problemer hos patienter med KOL.

Iltbehandling i hjemmet En undergruppe af patienter med KOL er kronisk hypoxæmiske og modtager derfor langvarig iltbehandling (LTOT) med det formål at forbedre langtidsover levelsen [1]. Patienten instrueres typisk i at bære iltbehandling med næsekateter i >15 timer om dagen. Mange patienter føler sig trygge, når de får supplerende ilt og kan derfor være tilbageholdende med at pausere ilten i løbet af dagen [14]. Sam tidig kan iltudstyret dog blive en fysisk og psykologisk barriere for intime aktiviteter, f.eks. a) ved kys eller under andre in time/seksuelle aktiviteter og b) en synlig påmindelse om den skrøbelighed, der er relateret til KOL. Med det formål at støtte patienter, der oplever, at iltudstyret er en barriere for intimitet og seksualitet, anbefales det at spørge patienten hvordan og i hvilke situationer iltudstyret er til besvær. Hvis problemet er begrænset til bestemte situationer, for eksempel når man ligger tæt med partneren inden sovetid, kan patienten informeres om, at udstyres kan tages af i denne periode uden at kom promittere de langsigtede virkninger af LTOT-behandlingen. I tilfælde af tvivl om sikkerheden ved begrænset brugstid, kan den praktiserende læge rådføre sig med den lungemedicinske speciallæge, der har ordineret iltbehandlingen. I de tilfælde, hvor iltbehandlingen er problematisk, fordi den udfordrer patientens seksuelle identitet generelt, anbefales det at støtte patienten og plejepersonalet i at indlede samtaler om mulige veje til gensidig ac cept af behandlingen og udvikling af et nyt 'vi' i forhold til at være et intimt par. Relationelle faktorer Den gradvise forværring af KOL fører over tid til nedsat funktionsniveau, hvilket kan have stor indflydelse på daglige opgaver og rutiner, da patienten ikke er i stand til at udføre aktiviteter i samme niveau og tempo som tidligere. Dette kan udfordre arbejdsdelingen i et parforhold og kan resultere i, at parterne i forholdet påtage sig roller som fx 'patient' og 'plejer', hvilket potentielt kan påvirke de seksuelle roller. På grund af sygdommens relativt lang somme progression kan daglige ændrin ger i funktionsniveau og partnerskabsrol ler være svære at opdage og adressere. Desuden kan sygdommens ikke-maligne karakter resultere i, at partnere er mindre involveret i behandlingen sammenlignet med for eksempel behandling af ondar tede sygdomme som kræft, hvor partnere har en tendens til at tage en aktiv rolle i behandlingsmæssige beslutninger og den følelsesmæssige støtte [15]. Derudover kan følelser af selvbebrejdelse og seksuel stigmatisering hos enkeltpersoner og par også påvirke patienters og partneres åbenhed omkring seksuelle problemer. Alt i alt kan det resultere i manglende kommunikation om konsekvenserne af sygdommen mellem patient og partner, og patienter kan stå tilbage med en følelse af at være kilden til problemet. Ikke desto mindre skal der ”to til tango”, og proble mer med intimitet og seksualliv opstår altid i den relationelle interaktion mellem to individer – de håndteres derfor mest effektivt ved at inkludere partneren såvel somDyadiskpatienten.mestring refererer til de for skellige måder, som par ofte interagerer på, når de søger at håndtere sygdoms relaterede stressfaktorer, for eksempel involvering, støtte, samarbejde, kontrol og overbeskyttelse [16]. Hensigtsmæssig dya disk mestring forudsætter, at begge parter tager ansvar, for eksempel "intimitetspro blemer er vores problem", samt at man sammen foretager vurderinger af, hvor slemt problemet er, og hvad der kan gøres – i fællesskab [16]. Åben kommunikation og fælles ansvarstagen er forudsætninger for succesfuld dyadisk mestring. Eksempelvis viste en longitudinel undersøgelse af 63 patienter med KOL og deres partnere, at patienternes livskvalitet var steget ved 3-års opfølgning, når partnere kontinuer ligt kommunikerede åbent om stress [17]

Desuden blev partnernes livskvalitet ved opfølgningen positivt påvirket, når patien terne vedblev med at tage ejerskab over daglige opgaver. Læger og sygeplejersker i almen praksis bør derfor give patienterne og deres partnere mulighed for at tale om relationelle vanskeligheder på lige fod med enhver anden sundhedsrelateret udfordring.Meddet formål at understøtte åben kommunikation mellem patienter og partnere anbefales det, at praktiserende læger og sygeplejersker inddrager part nere i konsultationerne. Med henblik på at facilitere samtalen, kan klinikeren følge strukturen i PLISSIT-modellen [18], hvor a) tilladelse til at tale om intime forhold efterfølges af b) afgrænset information om den potentielle indvirkning af KOL på intimitet og seksualliv. Når det er relevant, og i henhold til modellen, bør patienter og partnere henvises til specialiserede tilbud med det formål at iværksætte c) konkrete støtteforanstaltninger eller d) intensiv terapi til deres seksuelle problemer. Des uden bør klinikeren være opmærksomme på, at cirka hver anden patient med KOL ikke har en partner [19], men alligevel kan have et ønske om intimitet, og dog føle sig begrænset i at kunne opnå det på grund af de tidligere beskrevne sygdomsrelaterede problemer.

Optimal behandlinghelhedsorienteret

22 LÆGEMAGASINET 3

Forud for iværksættelsen af specialiseret seksuel rådgivning og/eller behandling bør den praktiserende læge sikre sig, at patienten modtager optimal behandling af sin KOL [1]. For det første bør den medi cinske behandling med langtidsvirkende bronkodilatatorer tilpasses – eventuelt i samarbejde med lungemedicinsk special læge – og det bør vurderes, om patien ten anvender den korrekte inhalator og inhalationsteknik. For det andet bør det overvejes, om patienten kunne have gavn af at bruge korttidsvirkende bronkodila tator forud for seksuelle aktiviteter. Og for det tredje bør symptomer på angst og depression vurderes og behandles opti malt med psykofarmakologisk behandling og/eller psykoterapi, for eksempel i form af kognitiv adfærdsterapi [20]. Ydermere er det vigtigt, at både praktiserende læger og lungemedicinere tager ansvar for at indlede samtaler om intimitet og seksua litet, samt at henvise patienter og/eller partnere til specialiseret sexologisk be handling, når det er nødvendigt. Skriftlige helbredsoplysninger, for eksempel i form af korte informationsfoldere, kan bruges til at understøtte verbal kommunikation om seksuelle emner [21]

Hvis der er behov for supplerende farmakologisk behandling for seksuelle problemer, er der – så vidt vi ved – ingen eksisterende undersøgelser, der fraråder brug af medicin mod seksuel dysfunktion, såsom fosfodiesterase type 5 (PDE5) hæmmere eller hormonbehandling, i kom bination med farmakologisk behandling af KOL. Konklusioner Denne artikel har fremhævet en række opmærksomhedspunkter vedrørende KOL og seksualitet, som er relevante for praktiserende læger og sygeplejersker. For det første, selvom ED forekommer hyp pigt blandt mennesker med KOL, er det vigtigt også at vurdere andre aspekter af intimitet og seksualitet, da a) ED kan være forårsaget af frygt for fysisk aktivitet og/ eller relationelle faktorer, og da b) mange kvindelige patienter med KOL også op lever problemer med intimitet og/eller seksualitet. For det andet kan ekspone ringsteknikker bruges til at reducere frygt baseret undgåelse af seksuelle aktiviteter. I den forbindelse er det relevant at formidle til patienten, at forpustethed ved anstren gelse er normal og ikke behøver afholde vedkommende fra seksuel aktivitet. For det tredje bør det altid vurderes, om pa tienten får optimal medicinsk og psykolo gisk behandling for KOL og/eller angst og

19. Løkke A, Lange P, Lykkegaard J, Ibsen R, Andersson M, Licht S de F, Hilberg O. Economic burden of copd by disease se verity – a landsdækkende kohortestudie i Danmark. Int. J. COPD Dove Medical Press Ltd; 2021; 16: 603-613. 20. Farver-Vestergaard I, Danielsen JTT, Løkke A, Zachariae R. Psychosocial intervention in chronic obstructive pulmonary disease. Psykosom. Med. 2022; 84: 347-358. 21. Rubio-Rask SE, Farver-Vestergaard I, Hilberg O, Løkke A. Seksuel sundheds kommunikation ved KOL: Patientin formationsfoldernes rolle, indhold og udformning. Chron. Respir. Dis. 2021; 18: 147997312110203. MORTEN BUSCH, SCIENCE NEWS Der er de sygdomme, der altid skrives om, fordi man fx dør på kort tid. Og så er der de langsomme og skjulte dræbere, der koster mange år, men kun sjældent får op mærksomhed. Nu har en gruppe forskere opgjort dødeligheden for 39 kategorier af sygdomme. Det sker dog ikke for at høste overskrifter i aviserne, for det er faktisk slet ikke så nemt at udpege de mest fatale sygdomme. Målet er derimod at give andre forskere et værktøj til at få indblik i sygdommene samt tjene som benchmark til at evaluere fremtidige initiativer om kring behandling og forebyggelse. Dødelighed er ikke overraskende det mest definitive mål for sundhed. Hvor mange, der dør af hvilke sygdomme, er af største betydning som grundlag for prio Fortsættes side 30

18. Mercer B. Interview af mennesker med kronisk sygdom om seksualitet: en tilpas ning af PLISSIT-modellen. J. Clin. Sygeple jersker. 2008; 17: 341-351.

10. Kaptein AA, van Klink RCJ, de Kok F, Scharloo M, Snoei L, Broadbent E, Bel EHD, Rabe KF. Seksualitet hos patienter med astma og KOL. Respir. Med. England; 2008; 102: 198-204. 11. Avery-Clarke C, Weiner L, Adams-Clark AA. Sensate fokus for seksuelle bekymrin ger: en opdateret, kritisk litteraturgennem gang. Curr. Køn. Hele. Rapporter 2019; 11:84-94. 12. Gosselink R. Kontrolleret vejrtrækning og dyspnø hos patienter med kronisk obstruk tiv lungesygdom (KOL). J. Rehabil. Res. Dev. 2003; 40:25-33. 13. Hanania NA, O'Donnell DE. Aktivitets relateret dyspnø ved kronisk obstruktiv lungesygdom: Fysiske og psykologiske konsekvenser, udækkede behov og fremti dige retninger. Int. J. COPD Dove Medical Press Ltd.; 2019; 14: 1127-1138.

PRESSENYT Top-39 over sygdomme: Så ofte dør vi af dem, og så mange år koster de AF

LÆGEMAGASINET 3 23 depression, før sexologisk rådgivning eller behandling igangsættes. Referencer 1. GOLD Global Initiative for Kronisk Ob struktiv Lungesygdom. Global strategi for diagnosticering, håndtering og forebyg gelse af kronisk obstruktiv lungesygdom. 2022. 2. von Leupoldt A, Kenn K. Psykologien af kronisk obstruktiv lungesygdom. Curr. Opin. Psykiatri 2013; 26: 458-463. 3. Farver-Vestergaard I, Frederiksen Y, Za chariae R, Rubio-Rask S, Løkke A. Sexual Health in COPD: A Systematic Review and Meta-Analysis. Int. J. Chron. Forhindre. Pulmon. Dis. 2022; 17: 297-315. 4. Allen MS, Walter EE. Erektil dysfunktion: En paraplygennemgang af metaanalyser af risikofaktorer, behandling og prævalensre sultater. J. Sex. Med. 2019; 16: 531-541. 5. Zysman M, Rubenstein J, Le Guillou F, Col son RMH, Pochulu C, Grassion L, Escamilla R, Piperno D, Pon J, Khan S, RaherisonSemjen C. KOL byrde på seksuelt velvære. Respir. Res. BioMed Central Ltd; 2020; 21: 1–10. 6. Agle DP, Baum GL. Psykologiske aspekter af kronisk obstruktiv lungesygdom. Med. Clin. North Am. 1977; 61: 749-758. 7. Macêdo TE, da Silva G, Morano MT, Holanda MA, Pereira ED. Seksualitet og as socierede faktorer i kronisk obstruktiv lun gesygdom (KOL)-patienter, der går på et henvisningshospital i det nordøstlige Brasi lien. J. Sex Ægteskabelige Ther. Routledge; 2020;: 10.1080/0092623X.2020.1869124.

15. Rosland AM, Heisler M, Piette JD. Indvirk ningen af familieadfærd og kommunikati onsmønstre på udfald af kronisk sygdom: en systematisk gennemgang. J. Behav. Med. 2012; 35: 221-239.

16. Badr H, Acitelli LK. Gentænkning af dya disk mestring i forbindelse med kronisk sygdom. Curr. Opin. Psychol. 2017; 13:44–48. 17. Vaske I, Thöne MF, Kühl K, Keil DC, Schür mann W, Rief W, Stenzel NM. På godt og ondt: et longitudinelt studie om dyadisk mestring og livskvalitet blandt par med en partner, der lider af KOL. J. Behav. Med. 2015; 38: 851-862.

8. Thomsen D, Jensen BO. Patienternes ople velser af hverdagen efter lungetransplanta tion. J. Clin. Sygeplejersker. England; 2009; 18: 3472-3479. 9. Hansen MF, Willemoes J, Nielsen SL, Kri stensen E, Giraldi A, Hansen EF. Seksuel dysfunktion, depression og trivsel blandt patienter med KOL eller hjertesvigt. Er. J. Respir. Crit. Care Med. 2012; 185: A3343.

14. Kelly CA, Lynes D, O'Brien MR, Shaw B. En ulv i fåretøj? Patienters og sundhedsprofes sionelles opfattelse af iltbehandling: En fortolkende fænomenologisk analyse. Clin. Respir. J. 2018; 12: 616-632.

ANNONCE

ANNONCE

– Lad os starte med mere fokus og mere forskning i kvindekroppen og kvin desygdomme, hvilket halter bagefter, så vi sikrer bedre oplysning om reproduktiv sundhed for alle. Derefter kan det være relevant at genbesøge, om det er noget, der skal ses på lovgivningsmæssigt i Dan mark også, siger Helena Gleesborg Han sen.

Den har været længe undervejs, jeg hørte om Estetrol for første gang til en kongres i 2008. Det bliver spændende, at få erfaring med den.

26 LÆGEMAGASINET 3 NYT FRA GYNÆKOLOGIFRONTEN AF CHRISTINEGYNÆKOLOGFELDING

Og listen over præparater i restordre bliver længere og længere!

Ny medicin Cystifos fra firmaet Nordic Prime Cystifos indeholder 3 g fosfosmycin og er beregnet til behandling af ukompliceret cystit hos kvinder og piger > 12 år. Det gives som engangsdosis. Det er et bred spektret antibioticum og kan bruges mod såvel gram positive som gram negative bakterier. Det har dog ikke fået gene relt tilskud og IRF mener, at det kun bør bruges ved behandlingssvigt af gængse midler. Drovelis® fra firmaet Gedeon-Richter Drovelis® er den helt nye p-pille, som in deholder 14,2 mg E4 (Estetrol) som er et foetalt østrogen, samt 3 mg drospirenon.

I Dansk Kvindesamfund synes vi, at det er en progressiv tilgang, som rummer mange gode tiltag, som både er relevant i en national og global kontekst. Vores forkvinde Helena G. Hansen har talt med TV2 om den spanske reformpakke: – Det her kan godt komme de mange kvinder til gode, der har kvindesygdomme som endometriose, hvor deres menstrua tion i mange tilfælde gør dem syge med kraftige blødninger og smerter. Menstrua tion er et biologisk faktum og skal ikke lægge kvinder unødigt til last, siger Helena Gleesborg Hansen. Men hun mener, at det egentlige større problem ligger et andet sted. Nemlig at samfundet retter et større fokus mod de kvindesygdomme, der giver kvinderne cyklusproblemer.

Nyheder Dansk Kvindesamfund skriver følgende på Facebook: Menstruation Som det første europæiske land vil Spa nien nemlig indføre op til tre dages men struationsfri om måneden for kvinder, der lider af kraftige menstruationssmerter. Re formpakken indeholder desuden moms fritagelse på menstruationsprodukter i supermarkeder og gratis bind på skoler og til socialt udsatte kvinder. Derudover plan lægger den spanske regering, at fjerne kravet om forældregodkendelse af abort til 16- og 17-årige, samt at give fridage i forbindelse med abort.

Abortloven i USA er ændret til det værst tænkelige. Nye regler for labiumresektion. Psoriasis og ekstrauterin graviditet. Mænds sædkvalitet ved vægttab.

DSOGLabiumresektion er kommet med en ny udmelding vedrørende labiumresektion: DSOG er lige udkommet med en ny guideline, hvor indikationen alene kan stilles på kvindens oplevede gener, med mindre pt. fejler noget, der kontraindice rerDetkirurgi.kommer sig af, at kosmetisk labi umkirurgi er ulovligt i Danmark og mange kvinder, som ønsker indgrebet udført, har følt sig stigmatiseret i mødet med sund hedsvæsenet. Derfor er det blevet beslut tet, at subjektive gener nu betragtes som en medicinsk lidelse i sig selv, så indgrebet stort set kan udføres indenfor sygesikrin gen på alle, som ønsker det SEX OG SAMFUND skriver om RETTEN TIL FRI ABORT i USA Det umulige er sket; USA's Højesteret har omstødt Roe vs. Wade dommen fra 1973. Det skete den 24. juni, hvor retten til fri abort i USA blev slagtet.

Allerede nu er 26 delstater – altså mere end halvdelen – klar til helt at forbyde Der sker meget i pressen lige nu indenfor mit fag!

Tamoxifen® fra firmaet Viatris Tamoxifen® 20 mg tabletter til brug ved behandling af østrogenreceptor følsom mammacancer. Præparatet er i restordre til engang i efteråret Terrosa® fra firmaet Gedeon-Richter Terrosa® er et middel mod osteoporose. Hver dosis indeholder 20 µg teriparatid (PTH-hormon), som gives s.c. daglig i højst 24 mdr. Præparatet er ikke længere i restordre. Vivelle Dot® fra firmaet Sandoz Vivelle Dot® plastre med hhv. 50, 75 og 100 µg østradiol er i restordre indtil en gang i efteråret. Skilt i venteværelse: ”Kvindelige patienter bedes undlade at Detsygdomssymptomer.udveksleforvirrerlægenformeget”.

Calcium® Sandoz fra firmaet Sandoz Calcium Sandoz brusetabletter indeholder 500 mg calcium, som carbonat og lactog luconat. Præparatet er i restordre året ud.

LÆGEMAGASINET 3 27

Colifoam® fra firmaet Meda Colifoam® er rektalskum indeholdende 100 mg hydrocortisonacetat/dosis, bruges (af gynækologer) til behandling af Lichen planus. Præparatet kan forventes i taksten igen i 2023. Crinone® fra firmaerne Merck m.fl. Crinone® indeholder 90 mg progesteron/ dosis vaginalgel til brug ved fertilitetsbe handling. Præparatet er i restordre.

Opdatering om udgået medicin og medicin i restordre: Angusta® fra firmaet Norgine Angusta® indeholder 25 µg misoprostol og bruges til igangsættelse af fødsler. Præpa ratet er i restordre pga. kvalitetsproblemer i produktionen.

Octostim® fra firmaet Ferring Octostim® næsespray indeholder des mopressin (en vasopressinanalog) og bruges bl.a. til behandling af menoragi ved von Willebrands sygdom. Hvert pust indeholder 50 µg desmopressinacetat.

Der er problemer med produktionen og præparatet forventes først tilbage i 2023.

DAGENS MEDICIN omtaler et studie fra hudafdelingen på Bispebjerg Hospital, hvor læge og ph.d. Cæcilie Bachdal Johan sen har påvist en øget risiko for ekstraute rin graviditet hos kvinder med psoriasis. Årsagen kan være en systemisk inflamma tion i vævet. Desværre er det ikke noget man kan forebygge eller behandle, men kun opdage og gøre kvinderne opmærk somme på risikoen.

Dalacin® vaginalcreme fra firmaet Pfizer Dalacin® 2% vaginalcreme indeholder 40 g clindamycin. Præparatet har været i restor dre, men skulle være tilbage i taksten. Depo-Provera® fra firmaet Pfizer Depo-Provera® – også kaldet P-sprøjte – indeholder 150 mg medroxyprogeste ronacetat og gives som injektion i.m. hver 3. måned.Præparatet har været i restordre, men skulle være tilbage i taksten. Duavive® fra firmaet Pfizer Duavive® er et præparat til behandling af kvinder i overgangsalderen, indeholdende 0,45 mg konjugeret østrogen og 20 mg bazedoxifen. Præparatet foreløbig god kendt til brug af kvinder, der ikke tåler ge stagener. Præparatet er i restordre p.g.a. produktionsproblemer, og forventes først tilbage i 2023. Loette® fra firmaet Pfizer Loette® er p-pillen med 100 µg levonorge strel og 20 µg ethinyløstradiol. Præparatet har været i restordre, men skulle være tilbage i taksten.

abort eller lave hårde stramninger, selv for ofre for voldtægt og incest. Det er et kæmpe slag mod kvinders ret tigheder og får hårde konsekvenser for de op mod 40 millioner amerikanske kvinder, som nu tvinges til at rejse langt for at få en abort. Og især for den store gruppe af kvinder, som allerede er udsatte og som ikke har den mulighed, kommer det til at have katastrofale konsekvenser.

Cytotec® fra Pfizer Cytotec® indeholder 0,2 mg misoprostol og bruges i forbindelse med medicinske aborter. Præparatet har været i restordre, men skulle være tilbage i taksten.

Ovestin® vagitorier fra firmaet Aspen OvestinNordic® vagitorier indeholder 0,5 mg østriol. Præparatet er i restordre, forment lig resten af året. Parlodel® fra firmaet Paranova Parlodel® indeholder 2,5 mg bromocriptin. Præparatet er i restordre, men forventes tilbage til efteråret. Pergotime® fra firmaet Serono Pergotime® er et syntetisk non-steroid med svag østrogenvirkning. Tabletten indeholder 50 mg Clomifen. Præparatet er udgået fra det danske marked, men kan rekvireres på særlig udleveringstilladelse fra Lægemiddelstyrelsen. Pregnyl® fra firmaet Organon (ikke i DK) Pregnyl® er beregnet til ovulationsinduk tion og indeholder 5.000 IE HCG. Kan indtil videre skaffes via ringstilladelser/delstyrelsen.dk/da/godkendelse/udlevehttps://laegemid

"Det betyder i værste fald, at kvinderne tvinges til at føde uønskede børn. Eller i yderste konsekvens tvinge dem til at risikere eget liv ved usikre og ulovlige aborter. Og tag ikke fejl; dette vil koste amerikanske kvindeliv," siger Bjarne B. Christensen, generalsekretær i Sex & Samfund. Graviditeter efter sterilisation UNIVADIS referer en artikel fra Fertil Steril fra April 2022, hvor man sammen ligner hysteroskopisk sterilisation (Essure) – 5.906 tilfælde – med laparoskopisk ste rilisation – 23.965 tilfælde. Begge havde 6 % ”failure” (læs graviditeter) 5 år efter indgrebet, hvilket jo er langt mere end for ventet. Artiklen er fra Californien og inklu derer sterilisationer fra 2008-2014. Essure blev afregistreret i 2019. Lidt ærgerligt, da det var en ret nem procedure, som ville kunne foretages i praksis. UNIVADIS beretter også om en historie, hvor en kvinde i USA har fået tilkendt 5,2 millioner dollars, fordi hendes kæreste har smittet hende med HPV! Politiken skriver om svært overvægtige mænd og deres elendige sædkvalitet. I et studie fra Københavns Universitet og Hvidovre hospital indgik 56 mænd med BMI mellem 32 og 43. Efter 8 uger på lavkalorie diæt tabte de i gennemsnit 16,5 kilo og en sædprøve lige efter forsøget viste en 40 % øget sædkvalitet.

AF JAKOB BINDERUP, AARHUS UNIVERSITET

Op mod ti procent af alle kvinder i den fødedygtige alder vurderes at lide af endometriose – en sygdom, der giver stærke smerter i underlivet, nedsat ferti litet, udbredt træthed, og kræver medi cinsk behandling eller operation. Men langt de fleste kvinder med syg dommen får aldrig stillet en diagnose, og chancen for at blive diagnosticeret – og dermed komme i behandling – af hænger af, hvor i landet man bor. Det er konklusionen i et stort forsk ningsprojekt ved Aarhus Universitet, der har undersøgt, hvordan man kan forbedre diagnosen af endometriose i Danmark for at sikre rettidig behandling.

• Op mod ti procent af kvinder i den fødedygtige alder har endometriose.

Foto: AU Health

• Smerter ved samleje.

kvindesygdom

”Resultaterne viser, at der i løbet af årene fra 1990 til 2017 er sket en stig ning i hyppigheden af diagnosticeret endometriose i Danmark. Studiet viser dog også, at der er tydelige regionale forskelle. Dette betyder sandsynligvis, at der i nogle områder af Danmark fin des mange kvinder, der lider af sygdom men, men som ikke får stillet diagnose, og som måske derfor heller ikke får den nødvendige behandling,” siger Dorte Rytter, der er lektor i epidemiologi på Aarhus Universitet. Lever med symptomer i mange år Selv om der er sket en stor stigning i an tallet af diagnoser af sygdommen – 46,8 procent fra 1990 til 2017 – får under to procent af kvinder i den fødedygtig alder i dag stillet diagnosen. For de resterende kvinder kan en manglende diagnose have voldsomme konsekvenser og føre til forværring af sygdommen, forklarer Dorte Rytter.

• Hyppigste symptom er smerter ved menstruation og ægløsning

• Endometriose kan pt ikke kureres, så behandlinger er gearet til at holde symptomerne i ave Læs den videnskabelige artikel her: https://obgyn.onlinelibrary.wiley.com/doi/10.1111/aogs.14364 Mange kvinder kommer ikke i behandling for endometriose, fordi der ikke er nok opmærksomhed på symptomerne, vurderer lektor i epidemiologi Dorte Rytter.

”Endometriose er en meget under diagnosticeret sygdom, og mange kvinder lever med symptomer i mange år, inden de får stillet en diagnose. For nogle kvinder kan symptomerne være svært invaliderende og medføre væ sentligt forringet livskvalitet og arbejds evne.”Etinternationalt studie fra 2011 har vist, at kvinder med endometriose i gen nemsnit mister 11 timers produktivitet på en arbejdsuge. Dermed har sygdom men også vidtrækkende personlige – og samfundsøkonomiske konsekvenser. Store regionale forskelle

• Nedsat frugtbarhed – 30-40 procent af kvinder med endometriose har problemer med at blive gravide.

• På længere sigt kan man udvikle kroniske smerter, som kan medføre ud præget træthed og søvnforstyrrelser

28 LÆGEMAGASINET 3 PRESSENYT Studie afslører stor underdiagnosticering af udbredt

FAKTA OM ENDOMETRIOSE

Endometriose rammer op mod hver tiende kvinde i den fødedygtige alder, men under to procent får en diagnose i Danmark, viser stort forskningsprojekt ved Aarhus Universitet.Mange kvinder kommer ikke i behandling for endome triose, fordi der ikke er nok opmærk somhed på symptomerne, vurderer lektor i epidemiologi Dorte Rytter.

Den markante stigning i antallet af diagnoser de seneste to årtier er sket, efter der omkring årtusindeskiftet blev etableret henholdsvis patientforening og en række specialiserede klinikker for kvinder med Stigningenendometriose.erdoglangtfra ligeligt fordelt over hele landet. Studiet, der er gennemført som led i det internationale forsknings- og innovationssamarbejde FEMaLe, afslører således, at der er store regionale forskelle på opmærksomhe den omkring Incidensratensygdommen.–antallet af diagnoser per 10.000 personer – svinger således mellem 4,98 og 12,37 i landets 98 kom muner med klar overvægt af diagnoser i det nordlige og østlige Jylland. Kvinder bosiddende i Nordjylland havde i perioden 13 procent højere sandsynlighed for at få en diagnose for sygdommen sammenlignet med kvinder i Østjylland. For kvinder i resten af landet var sandsynligheden endnu lavere. Vigtigt med øget kendskab til symptomer ”Nogle af forskellene kan måske for klares med regionale forskelle i sund hedsvæsenets struktur og andre med, at opmærksomheden på symptomerne blandt kvinder og læger er forskellig alt efter hvor man bor i landet,” siger Dorte Rytter.Hun mener derfor, det er vigtigt at få udbredt kendskabet til endometriose – både for kvinder, der oplever sympto mer, samt for sundhedspersonale og for myndigheder.”Vihåber,at vi med dette studie kan være med til at skabe en øget op mærksomhed omkring symptomerne på endometriose og vigtigheden af en hurtigere og mere lige diagnose. Det er også vigtig viden for politikere og beslutningstagere, som kan være med til at rette op på uligheden i diagnosen,” siger hun.

ANNONCE

30 LÆGEMAGASINET 3 PRESSENYT ritering af ressourcer i sundhedssektoren. Det kan dog være endnu vigtigere at kigge på relativ risiko i forbindelse med dødelig hed. Hvor meget tidligere dør mennesker af eller med bestemte sygdomme – altså hvor mange tabte år i alt er forbundet med de forskellige typer af sygdomme? Det er præcist det, en gruppe forskere har gjort nu for 39 sygdomskategorier, der ifølge WHO’s ICD-10 findes.

Hvordan kan vi redde flest leveår? Metoden bag undersøgelsen stammer fra forskernes tidligere undersøgelser af psykiske lidelser, der typisk fører til store reduktioner i forventet levetid. Læren fra de psykiske lidelser var dog, at den alder, hvor den psykiske sygdom sætter ind, har stor betydning for, hvor mange leveår de ramte i gennemsnit mister.

”Så selvom det ville give bedre over skrifter, er det meningsløst at lave en egentlig liste over de største dræbere. Det afhænger nemlig af øjnene, der ser.

”Tidligere undersøgelser, der estime rer forventet levetid, har antaget en fast

begyndelsesalder på 15 år for dem med psykiske lidelser og 55 år for dem med tyktarmslidelser, men den forenklede antagelse påvirker estimatet af forventet levetid markant. Vi håber vores nye kort lægning kan give andre forskere en mere finkornet analyse af sammenhængen mel lem en række lidelser og dødelighedsesti mater, og dermed et bedre udgangspunkt for at finde ud af hvilke sammenhænge det er værd at undersøge,” siger Oleguer Plana-Ripoll.OleguerPlana-Ripoll understreger at tallene kun er et udgangspunkt. Fx viser tallene en lavere dødelighed end normalen for kvinder, der har været ramt af sygdomme under graviditeten. Umid delbart ikke et logisk faktum, men et fak tum, der ifølge Plana-Ripoll understreger vigtigheden af ikke at drage unødvendige konklusioner af tallene. Alligevel håber han, at læger men også sundhedsmyndig heder og politikere kan få stor glæde af det medfølgende interaktive datavisualise ringswebsted, der er åbent for alle. ”Mål for sygdommes dødelighed kan bruges i forbindelse med beslutnings tagning og prioriteringer af ressourcer i sundhedsvæsenet. Hvordan kan vi med færrest ressourcer samlet set redde flest leveår? Så hvis det benyttes rigtigt, kan være blive et særdeles effektivt værktøj i sundhedsforskning og fungere som sam menligningsgrundlag for fremtidige sund hedstiltag ved at undersøge, om dødelig heden falder eller stiger som konsekvens af forskellige indsatser,” slutter Oleguer Plana-Ripoll.

Fortsat fra side 23

Formålet med vores forskning er ikke at kunne give simple svar, men tværtimod at give det bedst mulige udgangspunkt for andres dyberegående undersøgelse,” ud dyber Oleguer Plana-Ripoll.

”Vi har brugt nationale danske registre til at identificere personer med 39 for skellige sygdomme indenfor i alt 1.803 sygdomme. Det giver et nyt overblik både over hvilke sygdomme, vi dør af og med, men også hvilke der i absolutte tal er forbundet med de fleste tabte år. Det kan både hjælpe andre forskere til at finde vigtige steder at kigge nærmere og sundhedsmyndigheder til at prioritere deres indsatser og måle effekterne af dem,” fortæller en af studiets hovedfor fattere Oleguer Plana-Ripoll fra Institut for Klinisk Medicin ved Aarhus Univer sitet. Døden har sjældent kun én årsag Der har tidligere været mange under søgelser relateret til dødelighed – altså antallet af døde pr. indbygger af specifikke lidelser, men aldrig nogen, der har dækket alle kendte lidelser på én gang. Ligesom undersøgelserne heller ikke har kigget på variation i alderen for, hvornår forskellige sygdomme sætter ind. Med det nye ”Da nish Atlas of Disease Mortality”, der byg ger på anonymiserede data fra de natio nale sundhedsregistre, forsøger forskerne at råde bod på det. ”Tidligere studier har enten brugt relative mål for dødelighed eller grove estimater for forventet levetid. Via en ny metode er det lykkedes os at måle døde ligheden mere præcist end før for de mere end 1.800 sygdomme via data fra 7,4 mio. danskere i perioden 2000-2018. Ved at inkludere alderen for forskellige sygdom mes begyndelse, kan vi også pludselig for binde forskellige typer af dødelighedses timater og dermed give en rigere og mere nuanceret forståelse for sammenhængen mellem lidelser og dødelighed,” forkla rer Oleguer Plana-Ripoll. Hvis man spørger Oleguer Plana-Ripoll ind til en liste over de mest dødelige lidel ser, får man derfor af samme grund heller ikke et simpelt svar, fordi døden sjældent kun har én årsag. Nogle lidelser fører nemlig ofte andre med sig som fx diabetes eller psykiske sygdomme. Derudover vil en sådan liste afhænge af, om man tæller risikoen for at dø af en lidelse eller det samlede antal tabte leveår. ”Nogle lidelser, der opstår sent i livet, som fx kræft, har relativt store dødelig hedsrisici, men tæller du det i antal tabte leveår, betyder de sygdomme ikke ligeså meget i det samlede billede. Omvendt kan sygdomme, der opstår hos yngre men nesker, ofte være forbundet med et større antal tabte leveår, også selv om lidelserne måske har en relativt lavere dødelighedsri sici,” siger Oleguer Plana-Ripoll. Som eksempel har kredsløbssygdomme som åreforkalkning og hjerteanfald en meget høj dødelighed, men da sygdom mene typisk rammer i en meget høj alder, er antallet af tabte leveår lavt.

ANNONCE

ANNONCE

Issuu converts static files into: digital portfolios, online yearbooks, online catalogs, digital photo albums and more. Sign up and create your flipbook.