Tyne Valley Express Magazine May / June

Handy Man Service! for all your household job needs Page 4

DAVID MUERS & SON Ltd YOUR COMPLETE BUILD SERVICE COMPANY

FINANCE NOW AVAILABLE

FULL PROJECT MANAGMENT SERVICE See our advert on page 7

Telephone: 0191 413 6121 Email: info@davidmuersandson.com www.davidmuersandson.com

We are a top

10%

Middle Hedgefield Farm, Hedgefield Farm, Blaydon-On-Tyne, Tyne & Wear NE21 4NJ

Issue 63 - May/June 2019

LTD

A free publication for the people of the Valley

The Dinosaurs are coming to the Gate Church in Prudhoe Fly fishing and the monster of Hallington Hexham Juniors FC - can you help?

Corbridge Music festival - best line up ever Minsteracres upcoming dates Great editorial from our regular team Full of this Spring

er v e e

Ou

zin homes a g ma 2,000 t s rge ing to 3 ard! a l r go

n and

b n o Get

ow

RedHotproperty .co.uk

Property Sales, Lettings & Auctions

Open: 9am-9pm - Telephone: 0844 800 1913 (local rates)

o

Our elegant designs and energy efficient range of doors, windows and roofs will bring the great outdoors into your home.

Visit our onsite showroom to see first-hand....

Architectural aluminium systems.

Established in 2002 with over 30 years’ experience

If you’re involved in a new build, extension or upgrade please ring 0191 4140944 and ask for John or Paul to arrange a no hassle visit to discuss your requirements or call in for one of our product brochures and a look at the showroom.

Visit our showroom to see our fantastic range including: • Visofold 1000 bi-folding door • Visoglide Plus Slide door (with integral blinds)

• Alitherm Plus French Door • Alitherm 600 Windows (including the new Parallel design)

• Ultraframe roof • Secondary glazing

All our products are fully guaranteed and from our reputable suppliers

Metal Services Limited Ryton Industrial Estate, Newburn Bridge Road, Blaydon on Tyne, Tyne and Wear NE21 4SQ.

Tel: 0191 414 0944 E-mail: sales@metalservices.co.uk Web: www.metalservices.co.uk

EDITOR

Next issue out on Monday 1st July. Deadline for entries is Friday 21st June 2019.

Front cover picture by Roger Clegg of; Black Carts, Hadrians Wall . See his advert on page 21.

With the clocks going back and longer days it means there is more time to be depressed! Only joking but it can be hard at times not to get sucked in to the vortex of the mainstream that is pretty depressing at the moment.

Divide and conquer springs to mind!

DAVID MUERS & SON Ltd

Some are still shooting for the moon though and barista trained Emily Hanvey has opened up her very own cafe. The crossing coffee bar has given you a voucher on page 15. Good luck Emily!

We (I) got the County show date wrong last edition. The date is actually Monday 27th May! Always a great day out - away from the mainstream.

Tynedale beer festival just keeps getting better - details on page 18.

HANDYMAN SERVICES

OUR SERVICES: l

Corbridge Festival is back and tickets are now available. Full details on page 59.

l l

Hexham Juniors FC is having an open day at Dukes House Wood.

Great football club and help needed on all fronts - see page 71

l l

Ever fancied trying fly fishing or looking for local water if you do fish?

Hallington reservoir run by Westwater Fly Fishing are looking for new members. See their story and the monster ferox brown trout that has just been caught and released - page 54.

The Gate Church is giving early notice that the dinosaurs are coming too - page 50.

l l

Tel: Michael: 01661 852 684 or 07702 267 478

Email: michael@tynevalleyexpress.co.uk

The Lodge, Bays Leap Farm, Heddon on the Wall, Northumberland, NE15 0JW.

GROUND

10%

Flat Pack Furniture Builds Hanging - Lights / Curtain Poles Door Shaving, Lock or Hinge Repairs.

Leaky Taps or Minor Bathroom Repairs Kitchen Door Repairs Any Job Big or Small - We are here to Help.

Help with any Household Job - Just Call!!

Call out charge is ÂŁ69 + v.a.t for a one hour booking - we will do a number of jobs in that hour so if you have one or two or even several we will get them all done under the same hourly charge. EMERGENCY Subsequent hourly charge after initial charge is only ÂŁ39 + v.a.t per hour

Michael and the Tyne Valley Team.

We are a top

PLUMBING

CALLOUT SERVICE!

Middle Hedgefield Farm, Hedgefield Farm, Blaydon-On-Tyne, Tyne & Wear, NE21 4NJ

Telephone: 0191 413 6121 Email: info@davidmuersandson.com

www.davidmuersandson.com

BREAKERS

PAVING SPECIALISTS & GROUNDWORKS

Based in Ryton with over 30 years ground work experience across the Tyne valley and beyond.

Block Paving Specialists Driveways and patios Curb / border laying Foundation Drainage work Call Ben on: 07523 639 478 Fellview West Ryton

4

AFTER

Many references on request Over 35 years experience Professional quality paints used

Highly recommended, very respectful of your home and very reliable.

Valley Best rates in the Tyne Based in Prudhoe

Call: 07976 395 763

Ruth Craig, Ponteland

Tel: 01207 549211 Mobile: 07747 805 212 Email: tomwansell67@gmail.com 3 Ethel Terrace, High Spen, Rowlands Gill, Tyne & Wear NE39 2BH

www.tynevalleyexpress.co.uk

Free estimates l

Commercial

Painter & Decorator

l

Tom Wansell

Private

24 / 7 Access

TW

l

SECURE CONTAINER STORAGE

External

“The new hall looks brilliant, I have so much storage space.

The attention to detail in design and fitting was outstanding”

Call 0191 580 8550 to arrange a FREE design consultation or for a copy of our brochure visit www.nookdesign.co.uk

l

Mrs. P from Ryton hated her existing pine spindled staircase.

She also needed more storage as well as coat hanging.

Nook Design replaced the spindles and posts, painted them in ivory to match the new understairs storage units, along with a solid oak handrail and seat, complimented by brass coat hangers and handles.

Internal

BEFORE

5

CONTENTS 4. Editors page 8. Dr Nic Perry - Nettles 10. Antique trends and the art of the auctioneer 14. Blaydon What’s On 15. New Garden Centre for the Valley 16. Nicky Robertson - Motivation 18. Tynedale Beer Festival 20. Ryton What’s On 28. Heddon & Horsley What’s On 32. Sarah Fae - Privilege 34. Greenside What’s On 38. Crawcrook What’s On 42. Wylam & Ovingham What’s On 44. Bruce Ferguson - Wild Garlic 48. Prudhoe What’s On 50. Dinosaur road show comes to the

Gate Church 54. Westwater Fly fishing club at Hallington 57. Minster acres retreat dates and

open day 56. Stocksfield What’s On 59. Corbridge Music Festival is back 60. Riding Mill What’s On 63. Cherryburn reopens 64. Corbridge What’s On 68. Hexham What’s On 69. Pilates for the Valley 71. Hexham Juniors football club Can you help 74. Bill Clegg - No plan B 76. Queen’s Hall listings 78. Darras Hall & Ponteland what’s on 83. Superfast broadband for the

Tyne Valley 86. Trader index

Covering 31,000 homes and businesses throughout the Tyne Valley

The Super Six

In this issue...

Dr Nicolette Perry Nettles Page 8

Nicy Robertson Motivation Page 16

Sarah Fae Privilege Page 32

Bruce Ferguson Wild Garlic Page 44

Bill Clegg No plan B Page 74

Mike Pratt Back next issue.

Want to advertise with us?

Getting an advert is easy with us. From ideas to design we will help you for free.

Full colour adverts start from as little as £45 “32,000 homes is over twice as much as any other printed advertiser in the region!”

Contact Michael for a sales pack 01661 852 684 / 07702 267 478 or Email michael@tynevalleyexpress.co.uk

6

DAVID MUERS & SON Ltd BATHROOMS AND KITCHENS Free Consultation Service! Simply log on to our NEW website and book an appointment time that suits your circumstances – www.davidmuersandson.com

Call Out Service

for any job big or small

£69

for 1st hour then

£39

for subsequent hours

Book online or just call.

Prices on callouts include V.A.T

FINANCE NOW

AVAILABLE

COMPLETE BUILDING SERVICES:

We are a top

10%

OVER 25 YEARS EXPERIENCE

BATHROOMS

we are experts at both traditional and adapted bathroom installations!

KITCHEN FITTING + our own bespoke range

Get a space to fit your space and ideas – we can colour match doors too! We can install any off the shelf kitchen for you too!

CARPENTRY

Our carpenters have years of experience and are here to help!

PLUMBING

From simple fittings like an leaky tap to a full boiler replacement !

HOME HELP

Whatever job you need help with we will attend – from flat pack furniture to a simple install or repair.

BOILER SERVICING

Repair or replacement specialists. Let us get your boiler running as it should.

in E B D xp at is er hr ab ts oo ili m ty s

David Muers and Son Ltd is an introducer appointed representative of Ideal Sales Solutions Ltd. T/A Ideal4Finance. Ideal Sales Solutions is a credit broker and not a lender FRN 703401 Finance available subject to status.

Loans of 25000 and above available on a secured basis.

Think carefully before securing other debts against your home. Your home may be repossessed if you do not keep up repayments on a mortgage or any other debt secured on it.

Handy Man Service! for all your household job needs Page 4

PLASTERING

From a small patch repair up to a full room skimming!

FLOORING

None slip flooring or wood / laminate installation.

ADAPTED BATHROOMS Get it right 1st time with the experts!

DAVID MUERS & SON Ltd BATHROOMS AND KITCHENS

Middle Hedgefield Farm, Hedgefield Farm, Blaydon-On-Tyne, Tyne & Wear NE21 4NJ

KBBI

The Institute of Kitchen, Bedroom & Bathroom Installers

Telephone: 0191 413 6121 Email: info@davidmuersandson.com www.davidmuersandson.com

Spring into energy.

A plant to combat mental fatigue and restore our spring vitality.

Overwhelmed, stretched to the limit and pounded by sensory overload? For many of us, mental and physical fatigue goes with today’s lifestyle and expresses itself through stress, irritability or altered mood and also by physical signs like headaches, gastro-intestinal problems or fatigue. Fortunately, the right plant can boost mental and physical energy by helping to strengthen overstressed body systems.

This plant came to mind while weeding, when rather than compost it I recalled how fantastic nettle tea tastes. And then, what power this spring sting has to help as a restorative tonic.

Plants can be energizers that reduce fatigue, tonics that strengthen relevant body systems, or adaptogens that restore stress systems that go out of kilter – and yes there is science behind how plants can do this but not enough space to go into here.

Few energising plants have been tested in human trials for mental fatigue, because apart from chronic fatigue syndrome (ME, myalgic encephalopathy), multiple sclerosis and to a lesser extent depression, mental fatigue is not recognized as a symptom in Western mainstream medicine. Lab-based scientific studies show the impact of energizer balms, or their chemical ingredients, on the brain and nervous system.

Around the world, of many core energizers, two are traditional medicinal plants with origins in China, astragalus and ginkgo, two European plants, one sweet and the other with a sting - liquorice and nettle, one the Chinese and Indian spice ginger, and one the fiery Asian vegetable garlic, as well as the celebrated superfood green tea. Today though we focus on the stinging nettle.

Urtica urens The taste and tonic action of fresh spring nettle tea and soup should overcome reluctance to use this weed with a sting as a medicinal plant. Its use since ancient times as a tonic comes with a series of lab studies showing how it stimulates mood and memory and works as a neuro-regenerative.

About the plant Originating from Russia, Scandinavia, Europe and northern Africa, nettle grows to 1m, much to the annoyance of most gardeners and farmers. This annual has heart-shaped leaves and green flowers (which are incomplete, with stamens on male and pistils on female flowers). The larger nettle U. dioica has similar health uses.

History and folklore The Latin name uro translates as “I burn”. Roman soldiers allegedly brought nettle (U. pilulifera) to Britain to chafe their limbs in the cold, the sting stimulating blood supply. Recommended for several ailments

by Dioscorides according to J.H. Clarke who writes in A Dictionary of Practical Materia Medica, “Being eaten, as Dioscorides saith, boiled with periwinkles, it maketh the body soluble, doing it by a kind of cleansing faculty.” The Greek philosopher Platonicus (c.400AD) said it would “treat symptoms of feeling cold after being burnt” (burnt is now thought to mean being shocked). Recognised today as a stimulating tonic, it’s claimed to be a restorative tonic for stressed adrenals. Some medical herbalists say it’s particularly useful for those suffering from severe “burnout” that results from profound fatigue, brain fog, chronic pain and feelings of depression and intense anxiety.

What scientists say In humans Clinical trials, not yet focused on mental states, have confirmed other traditional uses such as reducing blood lipids, joint pain, infections and oxidative stress in diabetics.

In the lab Reduces oxidative stress in exercise-stressed models and depressive behaviour, as well as enhancing cognitive function. Acts on the brain’s memory signal (acetylcholine receptors) and in models of encephalopathy (brain disease) nettle increases the number of nerve cells in the memory area (hippocampus) and also the number of cells (glia) which support nerve cells in the brain. Also antibiotic, anti-inflammatory and neuroprotective in cell models.

Key ingredients Flavonol glycosides (like rutin), carotenoids and histamine, serotonin and acetylcholine as well as formic acid in stinging hairs and the coumarin scopolecin in root. High in vitamin C and K, calcium, potassium and other minerals.

8

Photography by David Taylor

CAUTION Always consult a registered medical herbalist before taking any plant at a medicinal level, inform your health care provider if you are taking medication or have any medical condition and do not stop taking prescribed medication. Be sure of the identity of your plant and take only at the recommended dose.

How to take it For internal use, pick leaves before flowering to make tea (5–12g fresh or 2-6g dried daily / 240ml water). Fresh leaves also make pressed juice, salads (in early spring before sting develops), soup, pesto, pasta (young shoots cooked taste like spinach) and puddings, as well as beer, wine and liqueur. Tinctures, capsules and dried root also used. Can be used in skin and hair creams (externally) for pain such as arthritic where the stinging is part of the treatment.

Safety Apart from the hazard of being stung, or if you’re allergic to nettle stings, nettle is regarded as free of contraindications, though it is advised to abstain from topical use if breastfeeding. Listed in the US pharmacopeia and freely available as a dietary supplement.

References Mzid, Ben Khedir, Ben Salem, Regaieg & Rebai. Antioxidant and antimicrobial activities of ethanol and aqueous extracts from Urtica urens. In Pharm Biol.

2017 Dec;55(1):775-781. doi: 10.1080/13880209.2016.1275025.

Patel, Sita Sharan; Udayabanu, Malairaman (2014): ‘Urtica dioica extract attenuates depressive like behavior and associative memory dysfunction in dexamethasone induced diabetic mice.’ In Metabolic Brain Disease 29 (1), pp.121–130. DOI: 10.1007/s11011-014-9480-0.

Toldy, Anna; Atalay, Mustafa; Stadler, Krisztián; Sasvári, Mária et al. (2009): ‘The beneficial effects of nettle supplementation and exercise on brain lesion and memory in rat.’ In The Journal of Nutritional Biochemistry 20 (12), pp.974–81.

DOI: 10.1016/j.jnutbio.2008.09.001.

Physic garden spring tonic - nettle and wild garlic soup Heat a knob of butter or dollop of olive/ coconut oil in a large saucepan over a medium heat. Add a finely chopped onion, carrot and celery and soften for 5 mins. Add 2-3 sliced potatoes, salt and pepper and cook for 10 minutes.

Add 1-2 tsp freshly chopped or dried turmeric and fresh ginger and 1L veg or other stock and cook for a further 10-15 minutes until potatoes are soft.

Add big bunch (400g) of chopped nettle tips and garlic leaves to pan and cook for a further 5 mins. Remove from heat, liquidize, add freshly ground pepper to taste. Serve with cream, cream fraiche or parmesan and sprinkled garlic flowers and chopped leaves.

This is taken from an extract of Botanical Brain Balms, Medicinal Plants for Memory, Mood and Mind published by Filbert Press and available buy at Dilston Physic Garden and bookstores.

Dr Nic Perry PhD

New for the Tyne valley!

Family run traditional plant centre offering a friendly service and exceptional value for money.

Delivery service available too.

l l

PERENNIALS SHRUBS BEDDING PLANTS EVERGREENS l

l

Find us on the South side of Newburn Bridge, just on the bend! Follow the flags for Prudhoe Timber!

l

TREES Some parts of our site are still under construction, so wear stout footwaer

Telephone Roger on: 07845 947 502 Bridgefields, Peth Lane, Newburn, NE15 8NR OPEN: Mon - Fri 8am – 5pm Sat 8am – 3pm Sun 10am – 3pm

www.littleolliesgardencentre.co.uk

T.C. Tree Services Your Tyne Valley Tree Surgeon

Tree pruning or removal l Stump removal l Hedging work l Planting advice l Free quotations & advice l

T: 01434 673918 M: 07815 613444 TcTreeservices

www.tynevalleyexpress.co.uk

9

The art of being an auctioneer Overseeing an auction may seem like a simple responsibility, but there’s a lot more to it than meets the eye. Fred Wyrley-Birch, Director at North East Auction House Anderson and Garland, explains the intricacies of being an auctioneer and the art behind the auction:

Valuations: how do we know?

The ability to predict a value of an object requires a great deal of knowledge about antiques, art and the ever-changing market.

Skilled auctioneers have an eye for quality, there are tell tail signs for all items whether antique, vintage or ephemeral that steer us in the right direction. The auctioneers at Anderson and Garland have a combined 200 years’ experience and have seen thousands of items sold at auction.

Estimates are placed on the majority of lots before an auction. They are guides to buyers on what they may have to pay to purchase the items but are also a reflection of other things. A conservative estimate on an item a buyer is sure is worth more has often been put on purposely to both entice competition and reflect perhaps the clients willingness to sell the item. However, a strong estimate may well be a reflection of a reserve and the seller wouldn’t want to part with it for anything less.

It’s all about sellers’ expectations.

Auctioneers work as agents for sellers. This is vital to keep in mind as both the vendor and as someone buying at auction. We are always working in the sellers’ best interests. But at the same time we want the experience to be as fulfilling to the buyers as possible which is why Anderson and Garland don’t place any reserve higher than we thing it will achieve. This way our buyers are ensured that if they are interested in a lot and attend our auctions, they have a chance of taking it home. It is also why we don’t charge a vendor for an unsold lot.

A successful auction house makes certain sales techniques a high priority. We provide a full-time, in-house photographer who ensures each lot is depicted professionally and accurately. We also print high-quality catalogues for many specialist sales and always ensure lots are catalogued aesthetically and accurately. In depth condition reports are also provided upon request.

Lights, camera, auction!

Skilled auctioneers have a few tricks up their sleeves to keep auctions interesting.

Each auction catalogue is devised to entice peaks of excitement and keep momentum up, so it doesn’t become monotonous.

It’s also key to keep it smooth, calm and to not intimidate bidders with the pace. A&G’s live display screen and online bidding portal provide real-time visual cues of the current bids and track progress in time with the auctioneer, which is an added benefit for viewers to keep track of the pace.

On the other hand, silence is not golden. It’s not comfortable to let the room fall silent, you lose momentum and interest falls away. This is why the auctioneer will often repeat the current bidding price to fill the gaps between bids.

Every Auctioneer has to have presence. The body language is always a good indicator of a great auctioneer. Simple gestures like an auctioneer raising their hand or arm, it may not get noticed but encourages a faltering bidder to go that little bit further. Looking into the camera so that an internet bidder feels like they are there in the room and welcome to click that button any time they like.

The most important thing is to have fun with it. If an Auctioneer is enjoying themselves, it invites everybody else to, relaxes them and makes it that bit easier to raise that paddle.

Anderson and Garland is set to feature a variety of specialist sales, including The Wine and Whiskey Sale (9/5/19), The Watches Sale (9/5/19), The Modern Sale (23/5/19), The Stamps and Coins Sale (4/6/19) and our quarterly Fine Art Sale (18/6/19). View all forthcoming auctions online at https://www.andersonandgarland.com/auction-calendar?m=2019-05.

Fred Wyrley-Birch

Auction trends: a brief history and how 2019 is shaping up John Bullock-Anderson, auctioneer of 40+ years, comments on auction trends by the decade and looks at the most popular items going in 2019: Auction houses suffered in the 1950s-1970s because all the trends were about new and shiny things – telephones, televisions, refrigerators and more were becoming available in homes and everyone wanted their furnishings to match their shiny new toys.

The ‘80s and ‘90s saw auction houses begin to thrive again, but the way it worked back then was different to how it works today. Auctions were almost only frequented by antique dealers. It wasn’t accessible for the general public and it was dominated by professional antique dealers who had physical storefronts. They could purchase lots and then make a profit by pricing individual items above buying cost to sell in their antique stores.

The popularity of eBay in the 1990s and 2000s made collectible items soar in popularity, which is still driving today’s auction trends.

Today’s auction trends are varied, but here are some of the most popular items going at auction:

GMT Master: a gentleman’s stainless steel bracelet watch sold for £8,600 in March of this year at Anderson and Garland’s auction house.

Guitars and musical instruments

Another range of collector’s items popular at auction are musical instruments and vintage guitars, especially those played by rock stars gone past. Specialist LP records are another area that were shunned for years to make way for the ‘new’ cassettes and CD’s, now some can be worth thousands.

Looking to sell collectibles at auction? Get in touch with the knowledgeable auctioneers at Anderson and Garland for a pre-sale estimate by ringing 0191 4303000, emailing info@andersonandgarland.comor or by visiting https:// www.andersonandgarland.com/online-valuation.

Vintage signage and advertising memorabilia

A sign for the Spillers flour mill on the riverside at Newcastle, which is believed to have been the tallest flour mill in the world and also the biggest in Europe, fetched £300 at Anderson and Garland’s recent Collector’s sale.

Retro toys

Two words: Star Wars! Vintage toys evoke nostalgia, and toys from the last four decades have been adored and cared for by a huge generation of geeks.

We recently auctioned more than 5,000 toys and movie props from a toy museum for around £130,000! The top seller was a Star Wars Han Solo for the French market in its original packaging, which went under the hammer for £1,090.

Coins and medals

Global accessibility to provincial auction houses, due to internet bidding platforms, has made the sales of coins and medals increase within the last decade. Expert cataloguing that pays careful consideration to the contents of each lot has also boosted this area.

Watches

Vintage watches are at prime-time rates at auction, especially Rolex. A Rolex

John Bullock-Anderson

We will use our 17 years of experience to provide first class physiotherapy treatments.

We’ll make the journey back to recovery simple through in-depth assessment, hands on treatment and advice that you can understand.

PRIVATE CLINICS IN PRUDHOE & BLAYDON Urgent & evening appointments available.

Online Booking Comprehensive rehabilitation facilities.

Conditions commonly treated: • Lower back and neck pain • Osteoporosis • Sports injuries • Tendon related injuries • Pre and post operative rehabilitation

PHYSIO FOR BUSINESS

Expect a minimum return on investment of around £4 for every £1 spent.

• On & off site clinics.

• Work station assessment.

• Health & well-being activity for employees.

• Early access to physiotherapy treatment.

PHYSIO AT HOME

Ideal for patients that are unable to come to us.

Receive the same quality of treatment in the comfort of your own home.

Conditions commonly treated: • Those recently discharged from hospital including hip fractures • Post elective surgery including Total Hip and Knee replacement • Improve balance and minimise falls risk

www.northumberlandphysiotherapy.co.uk

Book Now by calling:

01661 520 269

Chris Barrett, Owner of Northumberland Physiotherapy

Quote TVE1

Quote TVE2

Paving or Gutter cleaning

Paving and Gutters cleaned at same time

15%OFF 20%OFF DRIVEWAY, PATIO & GUTTER CLEANING GUTTER CLEANING

OUR GUTTER CLEANING SERVICE The GleamTeam use the world’s most powerful gutter cleaning machines to suck your gutters clean. Our unique system enables one person standing on the ground to efficiently and safely clean gutters and internal high level areas, up to a previously inconceivable 12 metres. From a bungalow to the height of a four-storey building - we can clean your gutters.

Our onboard camera system ensures the job is done and can provide photographic evidence of clean gutters!

DRIVEWAY / PAVING CLEANING

ALL TYPES OF PAVING CLEANED We use the latest Honda Surface cleaning equipment. This equipment is vastly superior to domestic pressure washers and can be seen in the results.

The surface cleaner reduces splashing and is designed to retain the integrity of your paving’s base layer - it won’t disturb the sand layer of your block paving.

All the waste is removed and your property is left clean and tidy.

We clean domestic properties as well as paving for commercial Based in the Tyne Valley premises including the NHS trust hospitals in the North East.

100’s of happy customers

PHONE NOW FOR A FREE QUOTE

01434 322719 or 07910 446843 Ask about our conservatory roof cleaning and gum removal services!

The Gleam Team is here for all your outside cleaning needs. We use the latest equipment to get the job done in a clean and efficient manner!

Andy

BLAYDON & WINLATON ST.PAUL’S CHURCH WINLATON We now also have a beautiful, fully refurbished Church Hall, available for all manner of parties and celebrations.

For further details and to book please contact:Mrs Anne Readshaw on 01914145061 Sundays - 8am Holy Communion 9.30 am Sung Communion - every Sunday All age family communion - 1st Sunday of month 6.30pm Evensong (first Sunday of each month) Wednesdays - 10am Holy Communion Saturdays 10am Messy Church ( third Saturday of each month Contact: 07563 644038 - Lillian. ..............................................................

ST. ANNE’S RC CHURCH, WINLATON / ST. JOSEPH’S RC CHURCH, BLAYDON. Masses: St. Anne’s, Sunday 9.00am. St. Joseph’s, Vigil Mass, Saturday 6.30pm, Sunday Mass, 11.00am. For enquiries please contact Fr. Adrian Tuckwell, Tel. 0191 4142654. email st.annewinlatonrc@gmail.com ..............................................................

ST CUTHBERT’S BLAYDON & HOLY TRINITY SWALWELL Wednesday 9.30 morning service Thursday 11.15 to 12.45 Lite Bite (serving refreshments) 3rd Saturday of month 10.30 Messy Church Sunday 10.15 family communion service St Cuthbert’s Community Hall, Blaydon.

Monday - Yoga 19.00 Tuesday - Pilates 19.00 Wednesday - Zumba 12.00 Bowls 13.00 - Yoga 18.00 Saturday - Dance Club 19.00 ..............................................................

YOGA Held in Blaydon on a Monday evening 7pm -8.30pm £5 per session at St. Cuthberts Community hall Shibdon Rd Blaydon NE21 5PT and On Wed. 4.15pm -- 5.45pm.Held at:The Winlaton Centre .North St.Winlaton Tyne & Wear NE21 6BY Mats etc; available. £5 per session. Tel;Carol 0191 4134665 Please bring own mat & any more info tel. 0191 4134665 ..............................................................

WINLATON WOMEN’S INSTITUTE Meetings held in St. Anne’s Church Hall on the 1st Wednesday of each month at 6.45 p.m. Contact either Joyce Little on 0191 4142829 or Alice O’Halleron on 0191 4401432 for further details. ..............................................................

WINLATON ART CLUB Join a small friendly group of all abilities. New members more than

We are a top

10%

welcome! We meet at Winlaton Community Centre on Wednesdays between 6-8pm. ..............................................................

INDOOR BOWLING CLUB St. Cuthbert`s Indoor Bowling Club” Shibdon Road, Blaydon. 1st floor of Church Hall Wednesday afternoons between 1.00pm and 3.30pm.

2 Hours of friendly and Social Carpet Bowling including Tea and Biscuits.

New members very welcome.

WINLATON CENTRE Coffee Morning – Last Friday of every month - 9.30 - 11.30am ..............................................................

WINLATON LIBRARY opening times Monday 9 am - 5 pm Tuesday 9 am - 1 pm Thursday 9 am - 1 pm Friday 9 am - 5 pm Saturday 9 am - 12 Our weekly events are: Knit & Natter every Mon & Fri 1-3 pm Crafts Club every Monday 1 pm Rhymetime for under 5’s every Friday 10 am. No charge for weekly events ..............................................................

WINLATON & DISTRICT LOCAL HISTORY SOCIETY. Winlaton & District Local History Society meets 2d.Tuesday monthly from September to May at Winlaton West End Club, West Lane, Winlaton Ne21 6PQ starting at 7.30pm. Annual membership £5.00 Concessions £4.00 (over 60’s) Visitors £1.00 per session. All welcome. Full programme on our website: www. winlatonhistorysociety.btck.co.uk ..............................................................

BLAYDON LIBRARY Back in Time for Cake Thursday 2nd May 2 - 3.30pm Blaydon Library A taste of cake through the decades with a smattering of fiction Adults only £4 Book in Advance Keeping up with the Kids – coding for adults Blaydon Library Saturday 11 May 10 – 11.30am Why not see what the kids are up to at school and try coding for yourself.

Scratch for beginners. Advance Booking essential – places are limited(10 places) Free. Adults only. Not sure if this is for you? Talk to us and find out.

E: JacquiThompson@gateshead.gov.uk Tel: 0191 4338406 Half Term Spring time Rhymetimes Blaydon Library Tuesday 28thMay 2 – 2.30pm . £1 – Just Turn up Adventures in Electro Dough Blaydon Library Friday 31stMay, 10.30 – 11.30am Explore fun things to make with electric

DAVID MUERS & SON Ltd BATHROOMS AND KITCHENS

14

playdoh! Make something special then, make it light up or make a sound.

Ages 6+, Free to participate in event £3 if you wish to take your electro playdoh kit home with you Find out how to use Borrowbox absolutely free on your smart device Blaydon Library Monday 3rd June, 10.30 – 11.30am Pyjamarama 3rd – 9th June Rhymetimes at Blaydon Library Tues 4th June 2pm £1 - Just Turn Up Get arty – for Childrens art week Saturday 8th June Blaydon Library What can you make from our maker box? Suitable for families. Free Just turn up 10th – 15th June Carers week Carers Week - if someone you know can’t get to a library because they are a carer, young carer or have mobility problems, then the library can come to you. Our Readers at Home service delivers books, large print books and audio books to your home. For more information please tel 0191 4336415 Jo Cox great get together weekend Rhyme Time Plus - Beside the Seaside Blaydon Library. 10.30-11.30 Saturday June 22nd Extended families welcome to join our summer themed sing-a-long. Songs, rhymes and activities suitable for very young children and their grown ups £2 per child. Please book in advance limited numbers Beginner Coding in Python Blaydon Library Saturday 13thJuly, 10 – 11.30am Learn some basic python coding.

Suitable for absolute beginners.

Adults only. Free - booking essential as places are limited Reading Well: Books on Prescription Reading Well helps you to understand and manage your health and wellbeing using helpful reading. Books are available from libraries and are all chosen and endorsed by health experts, as well as people with living with the conditions and their relatives and carers. Choose from Reading Well for Mental Health, Reading Well for Dementia, and Reading Well for long term conditions Regular groups Weekly Rhymetimes Rhymes and songs to explore with your little one. Blaydon Library Tuesday, 2 – 2.30pm. £1 – Just Turn up Knit & Natter Mondays 10 – 12noon at Blaydon Library Thursdays 2pm at Crawcrook Library Monthly Events Teen Reading Group Blaydon Library. 13 years+

10- 11.30am.

To book tickets call 0191 433 8420 or for further information visit: www.gatesheadlibraries.com Or Contact : Blaydon Library 0191 433 6201 ..............................................................

ART DIAMONDS Is a new arts project for people of retirement age in Gateshead. Sessions will be fun, friendly and suitable for beginners, so if you’re feeling arty, join our party.

Weekly Challenges will take place at the Library For a full list of workshops please register for our Art Diamonds news by contacting Rachel Horton on 0191 433 3864 email: rachelhorton@gateshead. gov.uk This project is supported by Arts Council England and the Baring Foundation in partnership with 64millionartisits and Gateshead Older People’s Assembly For further information on all events visit: www.gatesheadlibraries.com or pick up Events brochure at Gateshead Libraries ..............................................................

NORTHERN TASKFORCE We meet every week at Swalwell visitors centre, Tuesday to Thursday.

We’re a small team and we go out performing tasks which help protect the 12 or so nature reserves in the area, (Shibdon Pond, Milkwellburn Woods, Cross Lane Meadows etc) these include installing fencing and gates, removing invasive species, coppicing trees and littler picking among other things. Those interested just need to contact this email address - northern@ durhamwt.co.uk .

Chris – living landscapes: 0191 5843112 c.jones@durham.wt.co.uk ..............................................................

Winlaton Evangelical Church (next to Winlaton Library) Sunday Services :10.30 am & 6.00 pm Tuesdays :1.00 pm Bible Study & Prayer Meeting Coffee Morning 10.30 am on first Tuesday of each month Thursdays : Fellowship Hour at 1.30 pm on 2nd and 4th Thursday each month All warmly welcome email: winlatonevch@talktalk.net ..............................................................

Winlaton Parkhead Estate Gardens Association Shop now open every Saturday and Sunday 10am – 12 noon providing gardening essentials at affordable prices. 0191 4144337 or email frankandpat.smith@blueyonder.co.uk ..............................................................

GATESHEAD SPECIAL OLYMPICS Gateshead Special Olympics would

BATHROOMS

We are experts at both traditional and adapted bathroom installations!

See our main advert on page 7

like to advertise their weekly archery session held at Winlaton Centre, c/o Winlaton Community Base, North Street, Winlaton, Tyne and Wear, NE21 6BY. Tel no: 4336080 Session times : 10.30 am – 11.30 am Every Wednesday - Held in the large sports hall. The session is for people with disabilities aged from 8 yrs old onwards. Please call to book a place. ..............................................................

NEFIRST CREDIT UNION - Local Service Point where you can open an account and deposit money to save for holidays, Christmas, school uniforms or simply put something by for that “rainy day”!Trinity Methodist Church Blaydon, Lucy Street, Blaydon -Monday 12.00-1.00pm (except Bank Holidays) A “not for profit” financial organisation that provides saving accounts and loans for its members.For more information please contact our local Gateshead office on 0330 055 3666. ..............................................................

Blaydon Youth & Community Centre, Shibdon Road, Blaydon. Tuesday 9.30 - 12.30pm;Victory Programme run by The Salvation Army. A six week cooking and budgeting programme using recipes for World War 2. All food and equipment provided.Free of charge and a free gift for everyone who completes the course. Places must be booked in advance.For more information and to book a place please contact Allison Ellis on 07564 303275. ..............................................................

Kalma Baby - Baby Yoga Trinity Church Blaydon Tuesdays 6 weeks to Crawling class 11:45am Crawling to 2 years class 1:00pm (Crawling to 2 years class starting w/c 16th April) For more info contact emma@ gatesheadwest.kalmababy.co.uk Bookings are termly and based on a 6 week term the cost is £33. Sessions are run in 5/6/7 week blocks -Term dates are: w/c 16/04 until 25/05 or w/c 04/06 until 20/07 ..............................................................

Trinity Methodist Church Lucy Street, Blaydon Join us for worship 10.45am Sundays (News at 10 Cafe Church, 10am, third Sunday of month) Delicious soup lunch from 12, Mondays (not Bank Holidays) Coffee morning, 10am, first Saturday of the month We are a collection point for donations for Gateshead Food bank.

Follow us on Face book for details of special events, church family news and

our free community lunches. www.facebook.com/ TrinityMethodistBlaydon We look forward to welcoming you!

Deacon Tracey Hume tel:07584662564 ...........................................................

Blaydon Baby Bears We are a parent/carer and toddler group based in Blaydon Youth and Community Centre; we operate a drop in between 9.30-11.30am every Monday, term time only and excluding bank holidays; Cost is £2.50. We cater for children from 0-4 years, We have a large spacious hall and we all join in with singing (using puppets and props) at around 11.15am. Children’s snacks are included, which usually includes fruit/veg. There is a cafe available for parents - thanks Shirley & Natalie. ...........................................................

Branches out of school Ltd Breakfast club / out of school and holiday care schemes.

Qualified + experienced staff Selection of nutritional health breakfasts + hot or cold snacks Spacious setting Outdoor play Toys / games / resources Based at Winlaton Centre Winlaton – Tel No for info and bookings 07428 081194 OFSTEAD Registered

Winlaton Mill Village Hall May Avenue, Winlaton Mill NE21 6SF Monday Yoga 6 - 7 Monday Club 7.30 - 9.30 (womans group 1st and 3rd Monday) Tuesday Tai Chi 10.30 - 11.30 Wednesday Mill Motivators (health and wellbeing group) 10.30 - 12.30 Dance Eclipse 5 - 7 Thursday Playgroup 10 - 12 (birth - 5 years) Singing group 7.30 - 10 Friday Folk group 7.30 - 10 Saturday Coffee morning 10.30 - 11.30.

Includes councillors surgery 1st Saturday.

The Hall is also available for hire.

We are a friendly, volunteer ran Hall and you will be warmly welcomed to any of the groups.

MACULAR SOCIETY - NEW MEET

Tynedale Macular Support Group meets on the first Wednesday of every month (excluding January and August), from 1-3pm, at Corbridge Parish Hall, St Helens Street, Corbridge, Northumberland. NE45 5BE.

Contact Isobel Johnson on: 01434 602 969

Serving FRESH COFFEE daily Speciality TEAS and SOFT DRINKS A variety of homemade

TRAYBAKES, CAKES and LIGHT BITES

WALKERS CYCLISTS & DOGS WELCOME

Addison Industrial Estate, Newburn Bridge Road, Blaydon, NE21 4TE (attached to Speedline Tyres)

Tel: 07913 780 627 Email: info@thecrossingcoffeebar.co.uk the crossing coffee bar

BUY ANY HOT DRINK GET A SNACK HALF PRICE Snack includes traybake / slice of cake / scone etc.

Terms / conditions. Present voucher for offer.

Only one voucher per customer. Offer ends 31st May 2019

Tel: 07913 780 627 E: info@thecrossingcoffeebar.co.uk

Owner Managed Business Specialists

Paul S.Axcell

F.C.A.

CHARTERED ACCOUNTANT A Complete Service l l l l

Self Assessment Accounts Preparation Payroll Bookkeeping

l l l l

Management Accounts Company Formations VAT Fixed Fees

Telephone: 01661 831490

www.axcell.co.uk

10 Springfield, Ovington, Prudhoe. NE42 6EH

www.tynevalleyexpress.co.uk

15

10 Springfield, Ovington, Prudhoe NE42 6EH

A little bit of motivation…

What motivates us and how can we stay motivated? The beautiful signs of Spring are definitely in the air. The sound of the birds, chirping in the early morning, the sunny splashes of yellow daffodils scattered along the paths, the soft pink of the blossoms, the longer and lighter days, dare I add, warmer too?

What is it about this change in nature that gives everyone a new spring in their step? We are being drawn out of our caves, out of hibernation and into movement. Walking, exercising, Spring cleaning, re-evaluating our now forgotten-about New Year resolutions and even re-evaluating relationships and work commitments.

What is it that turns our motivation mojo back on? Research shows that 1 in 3 Brits suffer from Seasonal Affective Disorder (SAD); also know as Winter depression. Sunlight stimulates our hypothalamus, a part of the brain that is responsible for producing amongst other hormones, serotonin. Serotonin is our feel-good hormone and affects our mood. Increased levels of serotonin increases our feeling of wellbeing. The better we are feeling the more motivated we will be to goals, commitments and even applying ourselves to changes that need to be made.

The human brain has a negative bias propensity and is constantly looking for threat. When the mind is locked into this negative bias it will affect our general outlook, as well as affect how we engage with people or things. This negativity will drop our motivation mojo.

Studies show that re-framing how our mind sees a situation in a positive way is helpful in boosting our motivation mojo. Simple? Well it can be, but it will require practice and effort. If our mind naturally goes into a negative frame, then it will take effort and conscious choice for us to choose positive mental thoughts. A positive mind frame stimulates the release of serotonin, which means that we start feeling good about what we are thinking of. The more we feel good, the more we want to continue feeling that way. When we are feeling good about ourselves and what we are doing in life, we are more willing to 1. Make changes, 2. Stick to commitments made, and 3.

Become open minded to explore new avenues.

Bottom line - positive thoughts promote a sense of wellbeing in us and when we are feeling well our motivation mojo is back on.

Studies also show that our motivation is linked to our energy levels.

We are more likely to be motived with tasks or goals set when our energy levels are at their optimal. Not getting enough sleep and burning the candle at both ends leaves us feeling tired, depleted and even burnt out. Ensuring that we are recognising our limits, knowing when to say ‘no’ to commitments so we can get enough self-care time and making sure that we get enough good quality sleep at night is going to be hugely beneficial to our wellbeing, and this ensures we maintain optimal levels of energy.

1. Focus on bite-size tasks. Most people take on too much, too quickly or want to change too many things at once. It all feels ‘do-able’ at the time, but as the days tick by, people run out of steam. Breaking a task down into shorter bite-size compartments not only helps people feel more in control over the execution and outcome, but helps them feel that they are achieving their goals. Smaller tasks in a shorter time frame can be achieved. This also helps improve the person’s mindset. When things become ‘do-able’ it changes how a person views the task and the energy output required to achieve their goal. When the mindset and energy levels are synchronised, it motivates people on to stay on their chosen path. I always suggest that people use sentences such as “For today, I will…”, “For this week, I will…” to help them break their tasks down.

2. Reward achievements. It is so important to slow things down and focus on the achievements, no matter how small they are.

People are so busy looking ahead that they often miss out on what they are achieving right now. As adults, we are conditioned to only acknowledge big achievements which goes against how we developed as a child. All achievements, no matter how small or insignificant were appaulded. If we re-direct our focus to zone into the small things we achieve every day, we will see a boost in our feel-good factor, which will drive our motivation mojo.

Another important reason to make sure your energy levels are optimal, is that it takes energy and effort to change our mind from a negative outlook to a positive one, and we all know that we tend to feel less motivated, grumpy and even procrastinate with tasks when we are feeling tired. So sleep is not just to beautify us, it plays a vital role in how we engage and commit to the people and activities around us.

“What now? I’ve got my motivation mojo back, but how do I keep it going?” This is one of the most common questions I hear with my clients. When we feel inspired, our energy levels are up, and we feel positive about our future. But how can we keep the longevity in that momentum? Here are a few top tips:

16

Nicky Robertson Co-director at Back to Balance.

Intuitive Wellness Therapist www.back-to-balance.co.uk

Celebrate a new look to better hearing at our Open Day on Friday 10th May! Our recent refurbishment is now complete so Nick and Andrew, your local hearing specialists, would love you to call in for the guided tour of their modern, new look branch. To further celebrate this occasion, they’ll also be on hand to provide:

free refreshments and bloom goody bag 10% off our hearing aids on the day free clean and check of your hearing aids We look forward to seeing you on the day but if you are unable to make it then give them a call on 01661 823281 to arrange an appointment at a day and time more convenient for you.

bloom hearing specialists 34 Merton Way, Merton Road, Ponteland NE20 9PS www.bloomhearing.co.uk

Open Day Offer!

no fuss, plain English Wills, written by experts I’m Nicole, your local Will Writer and all things estate related! I pride myself on being professional, knowledgeable but most of all honest, open, and straight forward with a no fuss approach. The world of Wills and Estate Planning can seem a daunting one. Whether you want to make sure your children’s future is protected by appointing guardians should the worst happen, or if you are concerned about care home fees and making decisions for yourself in the future I can help and make this a simple process for you. I offer a face to face service at a time that suits you or a telephone service if you prefer. Make sure you protect what matters the most to you, for those who matter the most.

Nicole Dean - Will writer “We worked with Nicole Dean recently who provided us with a will, the process was seamless and she explained every little detail. She made what could be quite a daunting/overwhelming process, simple and easy. Her gentle, warm and friendly approach made us feel at ease straight away, the cost of the will was also less than expected, which was a nice surprise!

Thanks again Nicole for making the process so straightforward, I have already recomended this service to friends and family.” Chloe Hill “Had my Will done by Nicole today. I’m awful at these kind of things so I was surprised at how easy she made it. It was all done over the phone and only took 20mins. my Will was sent

right out special delivery right away. Can’t recommend Nicole enough.” - James Green “We’ve just had our appointment with Nicole, she was fabulous! So professional and knowledgeable but made us feel so comfortable, such a great company to choose to put your affairs in order, would highly recommend” - Hayley Dickinson

l

l

l

l

l

Tel: 07496 698737

Email: Nicole@thewillguys.co.uk

l

Wills Trusts Long term care planning Lasting Power of Attorney Estate Planning Funeral Plans

www.tynevalleyexpress.co.uk

17

BIGGEST

JOIN US FOR PROBABLY THE REGION’S BEST &

BEER & CIDER FESTIVAL

Tynedale Beer & Cider Festival is a fun, friendly festival in the heart of the Tyne Valley. Beer, cider, wine, gin, food, music, rugby and more – and even bigger and better than before!

The North East’s biggest beer festival takes place at Tynedale Park in Corbridge this June. Over three days we bring you the very best in beers and ciders from the region and the UK plus amazing street food, live music, rugby and much, much more… tickets on sale online now, why not visit our website to find out more?

BEER • CIDER • CRAFT BEER • WINE • PIMMS • GIN • RUM STREET FOOD • LIVE MUSIC • SATURDAY FAMILY AFTERNOON

Tickets from £ 8 – buy online:

tynedalebeerfestival.org.uk IN 2019 WE ARE PROUD TO SUPPORT: TYNEDALE HOSPICE AT HOME • NORTH TYNE YOUTH (RTC) WECAN • TYNEDALE RUGBY FOOTBALL CLUB

f

@tynebeerfest tynedalebeerfestival

TYNEDALE RUGBY CLUB, CLOSE TO CORBRIDGE TRAIN STATION CAMPING • FREE CARPARKING TWO ENORMOUS MARQUEES

PRESSURE TREATED TIMBER: POSTS, RAILS, BOARDS, JOISTS, SLEEPERS, DECKING….Etc,Etc,Etc Also stocking your HARDWARE, NAILS AND SCREWS to make your job complete.

Call us on 07845 947 502 and we will happily give you a quote over the phone.

Delivery is also available. Ring, text, or email us with your postcode for a delivery price.

We are an independent Timber Merchant open to both the public and trade. Offering competitive prices with excellent service you will find us at our new improved premises

Bridgefields, Peth Lane, Newburn, Newcastle upon Tyne, NE15 8NR Just on the South side of Newburn Bridge

Email: prudhoetimber@outlook.com Call: Roger on 07845 947 502

NEW PREMISES

www.prudhoetimber.com

Boiler Installations & Repairs Congratulatio

Appollo Ga

ns

s Services

letion On the comp

Ltd

of

500

Whether it’s a service, repair or full installation We are here for you! l 10 YEAR GUARANTEE - Parts & labour on new installations l Local family run business for over 32 years l The boiler people serving the Tyne Valley & beyond l Servicing from only £59+v.a.t l Over 500 reviews on your in safe hands!

Reputation

Report Cards

Kevin Byrne

l

MD and Founder

t: 0191 414 5555

A New

high efficiency boilers with...

0% FINANCE AVAILABLE

www.appollogasservices.co.uk Appollo Gas Services, Haugh Lane, Blaydon on Tyne, NE21 4SB. info@appollogasservices.co.uk Proud members of

Where reputation matters

www.tynevalleyexpress.co.uk

19

RYTON RYTON METHODIST CHURCH Sunday Services 9am Traditional style worship.

10.30 Modern style Family and young peoples Church service. 6pm Traditional style service.

Additionally, the 3rd Sunday of each month is Godly Play, a different, fun approach to worship. Refreshments are served after each service.

Everyone is welcome.

Monday Rhyme Time 10-11am A fun and engaging session including songs and stories for Babies and preschool Children. Refreshments served. (During school term only) Organised and run by Ryton Community Library -£2 per family Tuesday Slimming World - 9.30am and 5.00pm Held in the Church Basement-the entrance is opposite the Ryton Deli Wednesday Ladies Fellowship Group - 7.30pm (Commencing 16 January then every 2 weeks following) Guest speakers introduce the group to a variety of interesting subjects.

Come along and meet other people and make new friends.

Thursday CAMEO (Come and meet each other)

10am-12pm Come along and have a coffee and a chat and make new friends.

Twice monthly join us for lunch, alternating between soup and a sandwich/fish and chips. Booking is required. Weigh Watchers - 6pm Saturday Coffee Morning. 10-11.30am First Saturday of each month.

Local Councillors surgery operates at the same time.

Ryton Methodist Church is a Drop off Point for the Food Bank.

Dry foods, non perishables and tins greatly appreciated.

Bible Cell Group Dorian Contact Dorian on 07969401783

.........................................................

RYTON COMMUNITY LIBRARY Below Methodist Church, entrance opposite Ryton Deli Tel 0191 413 1890 (during library hours) Books, computer, free Wi-Fi, local information, laminator, shredder Rhyme Time for under 5’s Monday mornings 10-11a.m. term time onlyin theMethodist Church Hall. Cost £2 per family Readers’ Group Last Thursday of month 1.30pm

In the library.

If you’d like join our happy band of volunteers, phone or find us on Facebook!

.........................................................

HOLY CROSS CHURCH, RYTON VILLAGE SUNDAY 8.00 am Holy Communion 10.00 am Parish Communion with Young Church 1st SUNDAY EACH MONTH 4.30 pm ‘The Ark’ - for pre-school children and their families 2nd SUNDAY EACH MONTH 6.00 pm Evensong; the traditional service TUESDAY EVENINGS from 2nd May 7.00 pm - 9.00 pm TRANQUILLITY. Stillness Sacred Space Beautiful Books Refreshments Prayer Stations.

Just drop in.

THURSDAYS 10.00 am Holy Communion, coffee following.

SATURDAY 11th MAY 3.00 pm 6.00 pm “Sunyata” improvised music.

THURSDAY 30th MAY 10.00 am Ascension Day - Holy Communion

.........................................................

HOLY CROSS CHURCH HALL Thinking of holding a party or celebration, this may be the perfect venue for you. For further details please telephone 0191 4132453

.........................................................

RYTON CHORAL SOCIETY Come and join us on Tuesday evenings (6.50 - 9.00) at Charles Thorp Academy, Main Road, Ryton ( in the music room).

Get more details by visiting our website: www.rytonchoralsociety.org. uk or call Neil on 07786823637

.........................................................

ON

SATURDAY, 29TH JUNE

11.00 A.M. TO 3.00 P.M.

AT

BARMOOR HUB Charity Number 1154893 Main Road, Ryton, NE40 3AG

Telephone No 0191 4132053

FREE ADMISSION

Afternoon Tea £4.00 per person (Children £2.00) Fair Ground Rides Craft Stalls including Ͳ jewellery, cards, preserves

and mosaics. Raffle, Tombola, Children’s Activities including—Treasure Hunt, Hook a Duck, Tea Cup Races and lots more

We are a top

10%

DAVID MUERS & SON BATHROOMS AND KITCHENS

20

U3A RYTON A friendly group with membership of 120 plus members who enjoy a variety of activities. Main Monthly meeting held on 3rd Wednesday(pm) in Barmoor Hub, where guests are very welcome, and Interesting Speaker. New Members are Welcome, please come along!

Main activities are Weekly Carpet Bowls - Tues, Wed, Thurs (am Craft Group - Mon. (pm) Art Group - Thurs. (am) Monthly History - 4th Tues. (pm) Music Appreciation - 2nd Wed. (pm) Board games - 4th Wed. (pm) Reading Group - 3rd Thurs. (pm) Walking Group - 3rd Friday (am) For details of activities and times please contact Jenny Roberts 0191 4133366 Email jennyroberts8@yahoo.co.uk

.........................................................

RYTON METHODIST CHURCH HALL - Local Councillor surgeries.

Ryton Methodist Church - 1st Saturday of the month between 10 and 11am.

Stargate Hall on the 3rd Friday of the

month between 6 and 7pm. ( We also don’t have surgeries in August, over Christmas and on public holidays.) Please contact Alex or Freda Geddes on 0191 413 1574 or Chris Buckley on 07718696514.

You can also email us at Cllr.ageddes@gateshead.gov.uk cllr.fgeddes@gateshead.gov.uk or cllr.cbuckley@gateshead.gov.uk

.........................................................

RYTON OUTDOOR BOWLING Home to the Towers, Vets and Women`s Clubs. Based in Ferndene Park, Ryton. Come and join us either for pleasure on most afternoons or Sunday (am), or in Competitions throughout the Summer.

For more details Contact Colin Diball 0191 413 3872 or Hughie Armstrong 0191 4143019.

.........................................................

RYTON LITTER ACTION GROUP We’re a group of volunteers aiming to keep Ryton, and the surrounding area, free from litter. We litter pick every 2-3 weeks from 10am-12noon on Sunday mornings. For details, check the website www.litteraction. org.uk/ryton-litter-action, email Andrew at rytonlitteraction@ hotmail.co.uk or phone Lisa 07747 805175. Come and join us for some fresh air and exercise. It’s very rewarding!

.........................................................

RYTON LOCAL HISTORY SOCIETY - Meets on the last Thursday of the month at 7pm in Crawcrook Library.

For further details contact 0191 4138164.

.........................................................

MOVERS AND SHAKERS PRESCHOOL DANCE Music and movement classes for pre-school children and their parents and carers. Ryton Methodist Church Hall (entrance on Grange Road) on Wednesday mornings 9.30-10.30am.

Term time only,. £3 per child per session (£1 each for siblings), payable on the door. Alison 07775 760670

.........................................................

PRE-SCHOOL MOVERS New movement and dance class for pre-school children aged 3-4. Ryton Methodist Church Hall (entrance on Grange Road). Wednesday afternoons 12.30-1.15pm. Term time only. £20 per child per term (sibling discount available). Alison 07775 760670

.........................................................

PARENT AND TODDLER GROUPS Monday 9.30am – 11.00am Holy Cross Church Hall, £2. All Welcome Friday 9.30am – 11.30am (NCT Group) Holy Cross Church Hall, - £2.

All Welcome

.........................................................

BARMOOR HUB - Barmoor, Ryton Keep Fit Monday 10.00 – 11.00am Friday 10.00 – 11.00am Contact Richie 07792360740

ADAPTED BATHROOMS Get it right 1st time with the experts!

See our main advert on page 7

Zumba with Natasha Monday 6-7pm Tuesday 6.30 – 7.30pm Contact Natasha 07725400567 Kettle Bells with Natasha Tuesday 7.45 – 8.45pm Contact Natasha 07725400567 Ryton Art Club Tuesdays 6.30 – 8.30pm Contact Tammy 01914132053 Junior Club (8-11yrs old) Wednesday 6.00 – 7.30pm (£1 admission) Pool room / Fun games and craft activities / Sports Hall activities / Shop.

Contact Tammy 01914132053 Walking Sports Wednesday 1- 2 p.m.

Contact Nancy 01914132053 The Hub – inclusive youth club for years 13+ Friday 6.30 – 8.00 pm Pool room / craft activities / Sports Hall activities / Shop Contact Tammy 01914132053 For further information please contact 0191 413 2053. http://barmoorhub.weebly.com Find us and Like us on Face book

care about our community. If you do to and want to join a very friendly organisation then get in touch. Every penny we collect goes back to good causes we support! We meet every 2nd Tuesday at Tyne Valley Golf Club, Old Ryton village, NE40 3QE. Come along – you will be most welcome. Tel No 0845 833 9527. www.midtynelionsclub.co.uk

.........................................................

BRIGHTEN RYTON Local Environment Group We’re a newly formed group of local people who cherish Ryton. We look after Ryton’s roadside flowers, heritage sites and memorials.

Get involved in making a positive difference to our lovely village.

Email: rickyrichardsonryton@ gmail.com Message us on Facebook

STARGATE COMMUNITY CENTRE – All Welcome Mon – Bingo Night 6.15 – 8.15pm Tues - Darby & Joan 1.00 till 3.00 Thurs - Yoga Night 2pm – 3pm – contact Carol 0191 4134665 Wed – Toddler Group (Stargazers stay & play) 9.30 – 11am Fri – Sylvia Dobson Street & Freestyle dance for children 5 – 5.45pm Contact 01207 544557

.........................................................

Physic night – with Sean Roper May 23rd At 7-9 Tickets £10.00 Contact Fiona 07505275837

.........................................................

Mike Mephis Elvis Tribute act.

June 29th - Ryton Social Club

ell t o t r e e b Remeamdvertisers wher our found you ! them

.........................................................

.........................................................

Ryton & District Camera Club Ryton & District Camera Club meets every Tuesday at 7:30 p.m. in the RytonCommunity Centre, Cross House, Ryton, NE40 3QP. Anyone interested in photography will be made very welcome whether an expert or a beginner. Wheelchair accessible.

.........................................................

Mid-Tyne Lions Club We are actively looking for new members to join out vibrant club. We

RNLI GATESHEAD BRANCH Local meetings to arrange support for this life saving charity.

For meeting times or other information contact Mrs Brenda Graham on 01914138593

.........................................................

RYTON & DISTRICT PATHFINDERS Come and join us on some lovely Spring walks for fresh air, good company and exercise.

May 25 Wolsingham - 6.5 miles June 8 Whitby Coach trip June22 Riding Mill - 6 miles For more details or a copy of our Summer Programme of walks, speak to Michael Curry on 01207-507841

ROGER CLEGG P H O T O G R A P H Y

Artwork available at “Artful” 13 Battle Hill, Hexham

and also online at:

Northern Horizons Photography

www.northern-horizons.co.uk

.........................................................

Lowther Funeral Services Ltd

www.lowtherfuneralservices@gmail.com

8 Barmoor Terrace Ryton Tyne & Wear NE40 3BB Tel: 0191 447 1450 @lowtherfuneralservices

A family run independent funeral service with a Private Chapel of Rest offering 24 hour personal care. We aim to provide a dignified, professional service of the highest standard that only a truly independent funeral director can provide. We offer funeral packages with fair prices starting from £1195 for a direct cremation or bespoke funeral services to ensure your needs are taken care of. Take away the worry of funeral arrangements with our prepayment plans. We offer home appointments and can also collect you if you have no transport to visit your loved one.

PACKAGES

Simply Cremation - £1195

A direct cremation including third party costs (doctors fees, cremation fee). Its a cremation with no service or attendance and includes collection of your loved one within office hours. A £90 fee is applicable out of office hours. Service time restrictions apply. Simple coffin and ashes scattered in the Garden of Remembrance. £95 to have ashes returned.

Direct Cremation / Burial - £1695

A direct cremation or burial including third party costs (doctors fees, cremation fee or interment fee). A grave must be purchased in addition to this package with the use of a Mercedes Estate to transport your loved one. No formal service will be held. Service time restrictions apply. Choice of The Morpeth or The Arran wood effect coffin.

Direct Cremation / Burial with a service - £2195

A direct cremation or burial including third party costs (doctors fees, cremation fee or interment fee). A grave must be purchased in addition to this package with the use of a Mercedes Estate to transport your loved one. No limousines included. There will be a choice of a religious service or non religious ceremony at the crematorium or graveside for your loved one to pay your respects. Service time restrictions apply.

Choice of The Morpeth or The Arran wood effect coffin.

Bronze Package - £2450

A cremation or burial funeral service including third party costs (doctors fees, cremation fee or interment fee, minister or non religious celebrant fee and professional services). A grave must be purchased in addition to this package. Hearse only and no limousines. Choice of The Newcastle or The Stirling veneered coffin.

Silver Package - £2695

A cremation or burial funeral service including third party costs (doctors fees, cremation fee or interment fee, minister or non religious celebrant fee and professional services). A grave must be purchased in addition to this package. Hearse and one limousine included. Choice of The Guisborough or The Kinross veneered coffin.

Gold Package - £2995

A cremation or burial funeral service including third party costs (doctors fees, cremation fee or interment fee, minister or non religious celebrant fee and professional services). A grave must be purchased in addition to this package. Includes hearse and two limousines. Choice of The Raby or The Langdale veneered coffin.

Excludes Church Service • Purchase of a Grave • Flowers • Obituary Notice Out of Area Burial Charges • Order of Service

www.tynevalleyexpress.co.uk

21

...

FRIENDLY STAFF

Pub side of things: l Fine selection of both gravity fed and pumped beers and ales. l Large Gin and Whisky bars l Sky / BT / Racing Channel l Live Music every Sunday l Great meeting venue l A genuine pub with bar snacks and good crack!

Food side of things:

Traditional Sunday Roast Booking is a must. 12 - 5pm l Sunday lunch - Local Delivery £1 delivery charge. 12pm - 3pm l

FREE homemade pudding with every order!

l

Sunday lunch takeaway - just book and collect 12pm - 5pm l Recently reviewed

by Mr Eats!

would like to welcome you to the Half Moon Inn, a traditional pub serving good local beers, where customer service and quality beverages are the pubs heartbeat.

The pub does a great Sunday lunch and provides bar snacks through the week.

The pub has had an extensive makeover and it would be lovely for you to pop in and say hello!

THURSDAY: Premium brands of beer /cider day! all is r Happy Hou only £3.00 per pint. Cask ales only £2.50!

THURSDAY: have an open microphone night. we k wee r othe y Ever FRIDAY: 4-6pm. Free curry + rice with a pint SUNDAY 6-9pm “ Live music.

arden G r e e B e iv s n Exte Area y la P ’s n e r d il h & C

Function side of things: l Room for hire l Buffet menu l Anniversaries l Birthdays l Funerals l Christenings

Other features l FREE HOUSE l Lovely outside seating l Play area for kids l Pool room l Dog Friendly

cue Outdoor Barebneu Food M ! coming soon New - Pub Classic Menu!

Thursday to Saturday

The Half Moon Inn 11a, Ryton Village East, Ryton, NE40 3NU 0191 413 2028

, Jack and Jo s

on

Va il

id

pr od

un til

30

O

uc tio

/06

/19

-

10

David Castonguay

%

FF

no ft Pro hi s mo

ad v e 0 er

co d

Baskets 2 Go

12

30

Packs of bedding plants – 5 for £10 Hanging basket trailers – 6 for £10 60l bags of compost – 3 for £12 Selection of veg strips - 5 for £10 Plant ornaments from £4.99 Ceramic pots from £6.99 Plants from as little as 40p each Summer Perennials

Hanging Basket Plants

Bedding Plants

HANDYMAN

t

Compost Bags

WE HAVE A GREAT SELECTION OF Baskets • Gift Ideas • Ornaments • Shabby Chic Gifts • Pots • Statues • Stone Troughs • Bird Baths & Boxes LOADS OF QUIRKY STUFF

Jack and Jo’s Baskets 2 Go

Middle Hedgefield Farm, Hedgefield, Blaydon Tel: 0191 413 6121 Mobile: 07960 940 634 Email: davidmuersandson@gmail.com

Winlaton Evangelical Church (next to Winlaton Library)

Sunday Services 10:30am and 6:00pm This is a caring Church with a warm and friendly congregation. Young and old are warmly invited to our Services where you will be very much ‘at home’ in the only independent Church in the Village.

Minister: Pastor David Harrison email: winlatonevch@talktalk.net Affiliated with FIEC (Fellowship of Independent Evangelical Churches)

l

l

l

l

l

l

Painting Ceramic Tiling Laminated Flooring Garden Work Building Repairs General Maintenance No job is too small!

Just call: 07889 474364

Email: handymantynevalley@gmail.com

FREE ESTIMATES

Fultons Electrical Services All aspects of Electrical Work Single Lights - Sockets Rewires - Testing “The work Stuart has done is 1st rate! Would recommend him to anyone” “Excellent job and a really friendly guy”

Fast, Friendly, Reliable.

Call Stuart: 07970 821528 www.tynevalleyexpress.co.uk

23

www.grants-garage.co.uk

HAVE A VEHICLE HEALTH CHECK WITH ME!

We now have our own in house M.O.T testing facility for both cars and commercial vehicles up to 3,500kg” Vehicle servicing and diagnostics to main dealer standards All makes and Models MOT Testing Station Get your Tyre fitting and balancing AIR CON RE GASSED Wheel alignment ready for the

Air conditioning service and repairs Summer All aspects of mechanical repairs Air conditioning special offer when booked with a service Local vehicle collection and delivery can be arranged Loan car or van available Headlight alignment and brake testing available For trades and businesses who rely on their vans or vehicles being on the road during the working week we offer an after-hours and weekend service.

This would eliminate vehicle down time and potential loss of business for the customer.

Local vehicle collection and delivery can be arranged.

Are you a new vehicle owner?

No need to take them to a main dealer for servicing work and pay high dealer prices. COME TO US!

What our customers say...

“Brilliant service, my brakes went on my car and I brought it to this garage.

Excellent and great on price.”

“Excellent service and very competitively priced. I highly recommend Grants Garage.”

“First class service from Grants Garage. Honest and professional service.

Thank you.”

“Thanks for sorting my car service, and my mum’s sensor replacement for the starting problem. Great job, great service and competitive prices.”

Unit 2, Station Works, Prudhoe, NE42 6NP Opening times: Mon - Fri 8am till 6pm. Sat 8pm - 1pm Out of hours service available!

Directions: Turn left just before railway Traffic lights as you approach Ovington bridge ( yes it is now open) or right after the lights if you have just crossed the river. Follow the lane to the end and you will see our premises at the very end!”

Telephone: 01661 832 434

Mobile: 07976 154 328

2019 MEMBERSHIP OFFER NOW ON!

Please contact the secretary for your personal deal!

FUNCTION ROOM FOR HIRE

The clubhouse provides the ideal location for any special occasion, offering peace and tranquillity in delightful surroundings.

A warm welcome awaits you and your guests.

The function room, overlooking the 18th green, provides an attractive setting for your celebration or event.

We cater for all occasions including christenings, birthdays, anniversaries and weddings.

We offer a range of hot and cold buffets, carvery, along with a formal menu for seated dinners.

Ryton Golf Club has a large and comfortable open lounge with bar, dance floor, the room is available to hire at a nominal rate.

Full-in house catering service can be provided to suit your requirements.

TO SECURE YOUR DATE PLEASE RING: 0191 413 3253 AND SPEAK TO AGNES

HELENA’S

KITCHEN

FISH & CHIPS FRIDAY

ONLY £14.95 FOR TWO PEOPLE! Two fresh fish and home cooked chips, mushy peas, tartare sauce, bread and butter, lemon wedge, and pot of tea for two!

Clara Vale, Ryton, Tyne and Wear, NE40 3TD

www.rytongolfclub.co.uk

OPEN TO THE PUBLIC

TraditioLnuanlc h Sunday ade.

All Homem

Tel: 0191 413 3253

*Terms

ns apply on all offers please ask in-store for & Conditio full det

ails.

HEDDON & HORSLEY THE HEARTH ART CENTRE & CAFE Main Road, Horsley, NE15 0NT - www.thehearth.co.uk Registered Charity 1106143 See all our listings on adjacent page .........................................................

Horsley WI Meets every first Monday each month 7:30 pm in the WI hall at the west end of the village. We enjoy a wide variety of speakers and a delicious supper! New members and visitors are always welcome.

WI Secretary Pam McAllister and her telephone number is 01661 853813 .........................................................

Horsley Book Club meets the first Friday of each month, 4 pm onwards in The Hearth cafe.

New members and visitors are always welcome. Please contact Hazel Holliday 01661853919 for details. .........................................................

Heddon on the Wall Ballroom Dancing Classes We welcome beginners and those with some experience. The classes take place every Tuesday during term time in the Knott Memorial Hall from 8 – 10pm. The teachers have endless patience and everyone has great fun. Find a partner and give it a try. Contacts: 0191 2365878 ( Jenian School of Dancing) or 01661 853798 (local contact) ........................................................

Heddon WI. (WI Hall) - Held on the first Monday of the month at 7pm.

Contact President: 01661 853422 or Secretary: 01661 853365 watersidemill1@btinternet.com ........................................................

The Heddon Patchers 10.30am.

A quilting and patchwork group who meet every other Wednesday in the Women’s Institute at Heddon on the Wall. We have a tutor and can be contacted through Ann Allsopp on: 01661 853422 or on line at allsopprayann@btopenworld.com ........................................................

HEDDON STITCHERS Anyone who enjoys needle or craft work of any variety is welcome and their expertise would be of interest to the group. Stitchers is a friendly self-help group and offer help (if required) to anyone who has not picked up a needle for years. Optional workshops are held on a regular basis. Occasionally a guest speaker will give a talk and/ or demonstration on a particular technique. Trips are organised to local craft shops and exhibitions.

Heddon Stitchers meet in the Knott Memorial Hall every Monday from 1pm - 3pm. Contact: Ann Lockey

We are a top

10%

- 01661 852832 or Alison Laker -01661 853798 .........................................................

HEDDON LOCAL HISTORY GROUP We host a series of monthly talks (usually on the second Monday in the month) by different speakers on a wide variety of subjects of local interest to which all are welcome.

Meetings are held in the hall of Heddon Methodist Church on Towne Gate starting at 7:30pm. A small fee covers hire of the venue and refreshments. Further details :www.heddonhistory.weebly.com Contact us through the website or Andy Curtis (01661 853095). ........................................................

HEDDON ART GROUP We are a friendly enthusiastic Art group in Heddon on the Wall. We meet fortnightly in the W.I. Hall from 7 to 9pm. At present we are up to capacity but if you are interested please get in touch and we will be happy to tell you more about what we do. Contact: Win Warcup -01661 853346 or email: win. heddon@hotmail.co.uk .........................................................

AD MURUM SINGERS Ad Murum Singers are a community choir based in Heddon-on-the-Wall.

The choir enjoys a wide range of music, and constantly explores new ways to make singing fresh, fulfilling and especially fun. Singing is a social activity, and has been found to stimulate the brain, relieve stress, and improve cardio-vascular function!

We are always keen to welcome new members of all ages and abilities - No auditions! With the money raised from our concerts, the choir is able to send donations to a variety of charities, both local and national. The choir meets in Heddon Methodist Church at 7-30pm on Tuesday evenings (September to June). This is to practise for our Christmas and Summer concerts, which are performed in The Knott Memorial Hall. The choir also perform at other venues or events during the year, by special invitation.

If you would like to help Ad Murum Singers make music, contact Christine Champion on 0191 2740217 for informatiom. .........................................................

HEDDON CARPET BOWLS Knott Memorial Hall - Thursdays 7.00pm. Bowling provides gentle exercise, it has a good social atmosphere and there are always plenty of laughs. So if you would like to meet new people and make new friends, come along and join us any Thursday evening. You will be made most welcome. For further information Contact -Lil Cruickshank 07810473460

DAVID MUERS & SON BATHROOMS AND KITCHENS

28

KEEP FIT & FLEXIBLE 1 hour to spare on Wednesday mornings? Join us for gentle exercise to music. The class is aimed at the over 50s but younger people are most welcome. 10 - 11 a.m. in the Knott Memorial Hall. Contact: Pauline Wright 01661 853365 .........................................................

HEDDON ON THE WALL Methodist Church Minister: Rev Colin can be contacted on: 01661 853530 If you would like to receive Holy Communion in your home, would like a visit, or to arrange a baptism, marriage or funeral please get in touch Website: www.heddonmethodists. org.uk or Facebook: Heddon Methodist Church Sunday Services: 10.30am-11.30am ‘All Age’ Service (first Sunday of each month) – all our services welcome anyone of any age – this service offers an opportunity to focus a little more on our younger generation The Living Room: (Third Sunday of the month) – Alternative Worship 6.00pm Exploring the Christian faith and worshiping in a more relaxed and non-traditional way Bible Study (weekly): Thursdays 7.00pm Prayer Group (weekly): Thursdays 1.15pm-2.00pm The Garden Room – Open Door (Coffee Mornings – weekly) *will continue to take place alongside other events: Thursdays from 10.00am-11.30am Company, Friendship, Good Conversation and a Cuppa . . .

Community Church Lunch: *Thursday 23 May 11.30-1.00pm.

Soup, Cake and Fellowship.

All Welcome . . .

Prayer and Activity Day: *Thursday 6 June - the day includes prayer stations and activities to help you focus and direct your prayers.

Open to all to come along anytime between 10am-4pm (come and go as you choose – light refreshments available).

Commencing at 10 am with a short time of worship to open the day and ending with another short time of worship at 4pm to close the day.

Ladies Breakfast (quarterly): Saturday 9.00am (next event Saturday 22 June 2019) Enjoy a healthy breakfast and fellowship. Guest Speaker: Anne Donaldson £6 per person - to book email: ladiesbreakfast@heddonmethodists. org.uk or telephone: Brenda 01661 598518 or Muriel 01661 854788

Men’s Coffee Fellowship (monthly): First Saturday of the month at 10.00am Craft and Chat (monthly): Tuesdays 1.30-3.00pm Messy Church (every other month): 2.30pm-4.30pm A united (ecumenical) activity for families with Heddon Methodist Church and St Andrew’s Church Buffet Tea included (children need to be accompanied by an adult) Next Event: Sunday 9 June 2019 at St Andrew’s Church (Topic: Travelling/ Discipleship) Church Walks: Saturday 11 May & 29 June. All welcome - for those who are used to taking long strolls.

We try to keep the walk to no more than 5 miles. Suitable footwear and clothing recommended. Meet outside the Church at 10.30 am (approx) 1.30pm. Bring an ‘on-thego’ snack . . .

Alpha: Starts Wednesday 1 May at 6pm. A chance to explore life and the Christian faith. Share your thoughts in an honest, friendly, open and informal environment. Each session includes food and a short talk. An opportunity to hear from others and contribute your own perspective. There’s no obligation to say anything and there’s nothing you can’t say. There’s no charge, no follow up, no pressure . . .

If you think you’re coming along let us know or if you want more info email: alpha@ heddonmethodists.org.uk Other Events Taking Place at Heddon Methodist Church Heddon Photography Group (monthly): Every 2nd Thursday of each Month 7.00-9.00pm All levels welcome, get together informally, share an interest in photography, be inspired by others, learn what your camera is capable of and get involved in photo opportunities. £2.00 (members) £4.00 (guests) Tel: Lynn (07809) 683213 History Society (monthly): Mondays 7.30-9.00pm Admurum Choir Practice (weekly): Tuesday evenings 7.00pm Heddon Methodist Church have Rooms to Hire (very good rates).

For further information please contact: Brenda 01661 598518 or Muriel 01661 854788 .........................................................

HORSLEY VILLAGE CHURCH Services each Sunday at 11am.

For more information www.horsleyvillagechurch.btck.co.uk .........................................................

Dru Yoga Classes Wednesdays at the Hearth in Horsley 5.30 - 6.30pm Rachel Orange 07545865009

CENTRAL HEATING Repair or replacement specialists + emergency call out service!!

See our main advert on page 7

THE HEARTH CENTRE, MAY & JUNE 2019 THE HEARTH ART CENTRE AND CAFE, Main Road, Horsley, NE15 0NT www.thehearth.co.uk Registered Charity 1106143 The Hearth is home to nine professional artists whose studios are open to the public when they are in. Artists’ studio days can be found on The Hearth’s website. There are regular classes, courses and art workshops.

Evening activities include live music and talks. Café open Monday to Friday 9.30am – 4pm, Saturday and Sunday 10am - 4pm.

MUSIC

THE CHERRY PICKERS Friday 24th May 7.30.pm Hexham-based band perform traditional Americana, Folk, Jazz and Blues.

THE BROTHERS GILLESPIE Friday 28th June, 7.30.pm Folk duo from Northumberland inspired by their native music and landscape.

Tickets £12.50 / £7.50 (under 19s) from Hearth Café, and online via the website www.thehearth.co.uk Café open for pre-concert evening meals from 5.30pm, please book on 01661 853 563

TALKS

OUR PETERLOO - THE AWFULLY BLOODY HEXHAM RIOT OF 1761 Thursday 30th May, 7.30pm - Speaker John Sadler ‘HUNTING THE HUN’ - WW1 AND THE GERMAN COMMUNITIES IN THE NORTH EAST OF ENGLAND Thursday 27th June, 7.30pm Speaker Silvie Fisch - £5 on the door, free to under 21s.

OPEN STUDIOS AND EXHIBITION OF WORK BY NETWORK ARTISTS NORTH EAST - Saturday 18th & Sunday 19th May, 10am - 4pm Free Entry.

CL ASSES PERSONAL PASTEL INSPIRATIONS - Friday 3rd May, 10am - 4pm FUSED GLASS WORKSHOP - Friday 10th May, 2.30 - 4.30pm FOLK EMBROIDERY - Saturday 11th May, 10am - 4pm JAPANESE SHIBORI - Saturday 1st June, 10am - 4pm THE HEARTH TUESDAY WOOL GROUP - Second & Fourth Tuesday of the Month, 1.15 - 3.15pm

Check the website for more information on talks, concerts and classes at The Hearth - www.thehearth.co.uk

UNDER

NEW MANAGEMENT

THE

LION & LAMB OPEN DAILY | GREAT FOOD | FUNCTION ROOM | TRADITIONAL PUB | BEER GARDEN | SUNDAY LUNCHES The Lion & Lamb is a traditional local pub, situated in the beautiful village of Horsley.

We have just launched our extensive new menu. Serving the best quality pub grub, daily specials and Sunday lunches. Please book early to avoid disappointment.

We have a function room that can be hired for special events and occasions.

Don’t miss our regular quiz nights. See our website for more details

Friday is FIZZ FRIDAY Prosecco Only £12.95 a bottle

Horsley, Newcastle Upon Tyne, NE15 0NS ~ 01661 852 952 ~ www.lionandlambhorsley.co.uk

www.tynevalleyexpress.co.uk

29

l l l

SALES LETTINGS MANAGEMENT

Looking to Moov this

Spring?

Dissington Lane, Ponteland £895,000

Greenside, Ryton £299,950

LANDLORDS LET FROM ONLY £195

100% Recommend 100% Fee Satisfaction

Currently on the market with another agent?

Are you starting to get frustrated with the lack of viewings or sensible offers and think you will never sell? Before you consider reducing your price give us a call to discuss how we can change this for you. We’ve helped many vendors achieve sales by using our unique marketing approach. Our properties stand out, which generates more buyer enquiries leading to sales.

It was reported in the press that our properties get the most views in the North East on Zoopla and we also have the highest average for the area on Rightmove. I look forward to hearing from you so you can also experience why we were awarded Best Sales & Lettings Agent in Northumberland 2018.

By far the best agents I have ever dealt with and would not hesitate to use in the future Mrs K Excellent, professional service with a personal touch from the outset. We were very impressed by Michelle from our first meeting and felt confident to have her dealing with our property. Mrs R

Included FREE:

Michelle Roper - Managing Director & Co-Founder

Professional Photography

Floorplans

Eye catching online brochure

Sale board

Dean Terrace, Ryton £150,000

24/7 Support

Seller portal live property updates

Contact us today for a FREE property valuation 1st Floor Smithyside, 7 Bell Villas, Ponteland, Northumberland, NE20 9BD

Email: info@propertyrung.com

*Stats taken from Rightmove Jan 19 for Ponteland & NE20.

Telephone: 01661 829 266

www.propertyrung.com

Family Run Local Estate Agent - Unrivalled Service – Unbeatable Fees

Have you got failed double glazing?

Broken locks or hinges?

Are you sick of the cold drafts?

YES?

...then caollday!

M ic hael t

Michael Carroll of M.B.C Double Glazing Repairs LTD is fast becoming the Tyne Valley’s most trusted glass expert when it comes to steamed up double glazing.

Issues with double glazing can often be gradual and may only be noticed during a clear sunny day or the winter. A failed glass unit will no longer provide you with the protection or be energy efficient.

Save Money by replacing

just the glass not the whole

BEFORE

window!

AFTER

We can replace steamed up double glazing panels, broken window & door locks, hinges and handles

Why not spend a few minutes checking your home to see if you have any failed double glazing? If you act now you can avoid these problems.

You may be thinking that you need the whole window including the frames and all the hardware but Michael has a simple cost saving solution of being able to just replace the glass!

So if you see condensation in your windows just give me a call...

No silly call out charges FREE quotations Change your panes, not your frames Save £££’s by repairing

TELEPHONE:

07949 909 580 Email: m.b.cdoubleglazingrepairs@gmail.com

www.doubleglazingrepairs.co.uk

Buy locally... from a family run mobility company.

RISE & RECLINE CHAIRS FROM ONLY

£595 SHOWROOMS IN ALL of OUR outlets

SCOOTERS - POWERCHAIRS - RISE & RECLINERS WHEELCHAIRS - WALKING AIDS - STAIR LIFTS - ELECTRIC BEDS MATTRESSES - SERVICE & REPAIRS l l l

WHY DO WE SAY IT’S WORRY-FREE? Your lease includes all the services and support you need, whether you’re popping to the shops or traveling a little further, you get...

l l l l l

A new scooter or powered wheelchair every three years Around 300 products to choose from Insurance from RSA Motability 24 hour ‘Get You Home’ recovery from Motability Assist A dedicated UK-based Customer Services team Free no obligation home demonstrations Servicing, maintenance and repairs MOTABILITY FROM £11.55 Tyres and battery replacement PER WEEK

From the most affordable to the best available... Email: info@mobilitydirectnorth.co.uk SOUTH GOSFORTH - Tel: 0191 285 4245

6 Tenerife Buildings, Station Road, South Gosforth, Newcastle upon Tyne, NE3 1QD.

SOUTH SHIELDS - Tel: 0191 454 5331 Unit 1, The Nook, 254 Sunderland Rd, South Shields, Tyne & Wear, NE34 6QY.

ASHINGTON - Tel: 01670 855400 56 Station Road, Ashington, Northumberland, NE63 9UJ

Visit our website at: www.mobilitydirectnorth.co.uk www.tynevalleyexpress.co.uk

31

Redefining Self Worth…

On 01.11.01 at the age of 17 I flew to Poland alone. I had been selected by Blue Peter to visit Auschwitz and Birkenau as a trainee reporter. My assignment; to share the consequences of prejudice and discrimination upon my return. As I arrived home other than a deep seated sense of relief I found myself wanting to explore the topic of responsibility and accountability instead. My 17 year-old self really struggled to understand how no one had intervened in the extermination of the Jewish population. My 35 year old self still hankers for that just and inclusive world still curious as to why the human condition prefers to look the other way.

“Our lives begin and end the day we become silent about things that matter.” - Martin Luther King I want to talk about privilege.

Put simple, privilege is when you think something is not a problem because it’s not a problem for you (see previous paragraph for example). Google defines it as ‘a set of unearned benefits given to people who fit into a specific group.’ For example society grants privilege to people due to aspects of their identity such as gender, race, class, sexuality, language, geographical location and religion. I define it as a modern day discrimination so insidious we aren’t even aware it’s there. It’s kind of like playing a game of chess but were 1 player only has knowledge of the pawns knowing nothing of the big lads on the backline. Whereas your opponent has access to multiple options thus can afford to make more decisions and cultivate more opportunities to get ahead. All the while player 1 is none the wiser!

If ignorance is bliss then why aren’t more people happy? – Thomas Jefferson So what does it mean in 2019 to be privileged?

Let’s imagine you’re about to run a 100m race and as you look across the start line on the surface it appears you and your peers are all in it together. The referee announces that he will ask everyone series of questions, if your answer is YES take 2 large leaps forward.

Are you able bodied..?

Are you white..?

Are you male..?

Are you middle class…?

Are you Christian..?

Are you heterosexual…?

Are you privately educated..?

The race begins and you must run it regardless of your starting point. It’s easy to forget when we are winning our advantage can come from things we have had no control over.

“Where’s my white collarless shirt from Fred Segel?

It’s my most capable looking outfit!”- Cher in the film Clueless I am aware the very fact that I am even able to write this article means I know it all too well myself. I am a heterosexual (ish), educated, white women with a UK passport on that alone, to some extent, I have already won the lottery. So as I sit comfortably in a capitalist coffee house and share with you through my apple mac some of the social injustices I feel, well, the cringe factor is not lost on me. I spent my late 20’s in numerous third world countries on various humanitarian endeavors.

Returning home I was always aware my contributions would likely fade as the cultural/political issues would continue to systematically oppress.

Still I went back, I was hopeful, curious and wanted to see/experience it for myself. Maybe my writing this is the justification for those journeys and may give what I’m about to say now some substance.

So how is privilege a more socially acceptable version of discrimination?

The best example I can give you is the comparison between how cases of missing children are currently treated around the world. Take the disappearance of Madeline McCann. Now compare the 12 year campaign/coverage of that one incident (investment of police time, resources, mainstream media contribution, political and religious energy) and weigh it up against the current scale of child trafficking in the third world. One receives worldwide attention and fame whilst the other largely underreported, underfunded thus invisible. Research by Unicef found child trafficking is currently the world’s fastest growing crime with the industry taking £99 billion annually. They estimate there are presently 5.5 million children trafficked globally. By the way if you ever wondered were all the cheap mass marketed hair comes from for extensions, one women’s exploitation is another’s Saturday night selfie.

So why isn’t this more news worthy? What is the difference between the 5.5 million and the disappearance of Madeleine McCann? Is this the modern day example of our proverbial Holocaust as once again we look the other way?

There’s really no such thing as the ‘voiceless.’

There are only the deliberately silenced or the preferably unheardArundhati Roy I don’t pretend to have the answers.

I only hope to spark a few questions e.g. entitlement vs contribution or consciousness vs ignorance. Just beginning the journey to awareness of how privilege works is a start. You’ve already made the first move by reaching the end of this article and if after all that you still don’t think it exists for you, congratulations you must be thoroughly enjoying the benefits of it!

Those who have the privilege to know have the duty to act - Albert Einstein

Sarah Fae

32

Yoga in the Home with Sarah Fae Bespoke yoga sequences designed especially for you in the comfort and privacy of your own home.

“Sarah has such a bright healing energy and inspires as a teacher. She is warm, honest and can hold a space with integrity and a lot of fun. I always leave practice with her feeling I have gained a little bit more of myself back.

Thanks Sarah, Namaste!”

Helen in Humshaugh

121 practice ● Group/family practices ● Children’s yoga ● Hands on adjustments & assists ● Times to suit you ● Wellness help & guidance ● Guided meditations ●

Contact Sarah - Fae@Jamboyoga.com Tel: 07419 323393

Registered Yoga Alliance RT 200 hrs

METRO SECURITY SERVICES (NE) LTD SUPPLIERS & INSTALLERS OF INTRUDER ALARMS & CCTV SYSTEMS For advice and a competitive quotation.

Call today on 0191 4138790 Protect your home or business with a CCTV system • High definition cameras delivering quality images • Remote viewing of live or recorded footage on your smart phone or tablet Wire free alarm systems • No disruptive installations as there are no cables to run around your home • The option to set/unset your alarm and receive notifications on your smart phone • Simple setting and un-setting of the alarm by use of a key-fob

email: metrossneltd@yahoo.co.uk

www.metrosecurityservicesneltd.co.uk

Family Company based in the Tyne Valley, with over 30 years experience.

Protect your home or business with a CCTV system

www.tynevalleyexpress.co.uk

33

GREENSIDE ST JOHN’S COMMUNITY HALL The hall can be booked for birthday parties or celebrations. Bookings for regular classes also welcome.

Regular weekly Classes as follows:Monday 11.00-noon Mature Movers Monday 19.00-20.30 Iyengar Yoga Wednesday 10.00am-11.00am Mature Movers Thursday 10.00-11.30 Footprints for Preschool children Thursday 18.15-20.00 Judo Friday 13.45-14.45 LJ Bounce Saturday 08.45 – 13.00 Judo Contact numbers – Mature Movers Mon & Wed am Laura Jane: 07810297198 Iyenga Yoga Mon eve David: 07779342183 Footprints Thurs am Rachel: 07976757116 Judo Thurs eve and Sat morning John Pattison: 0191 447 6836 LJ Bounce: Fri afternoon Laura Jane: 07810297198 For further information on booking the hall please contact Beth on 07941257936 or email

We are a top

10%

bethsjhgreenside@gmail.com or check out the Greenside Parish website www.greensideparish.org. uk where you can check the diary, complete a booking form or find out more about us. ..............................................................

GREENSIDE COMMUNITY CENTRE MONDAY/FRIDAY The hall can be booked for birthday parties or celebrations. Bookings for regular classes also welcome.

Regular weekly Classes as follows:Monday 19.30-20.30 Iyengar Yoga Tuesday 14.00- 16.00 Watercolour class Thursday 10.00-11.30 Footprints for Preschool children Thursday 18.15-20.00 Judo Friday 13.45-14.45 LJ Bounce Saturday 08.45 – 13.00 Judo Contact numbers – Iyenga Yoga Mon eve David: 07779342183 Watercolour classes Tues Gordon: 01434 675415 Footprints, Thurs am Rachel: 07976757116 Judo, Thurs eve and Sat morning -

DAVID MUERS & SON BATHROOMS AND KITCHENS

John Pattison: 0191 447 6836 LJ Bounce, Fri afternoon Laura Jane: 07810297198 For further information on booking the hall please contact Beth on 07941257936 or email bethsjhgreenside@gmail.com or check out the Greenside Parish website www.greensideparish.org. uk where you can check the diary, complete a booking form or find out more about us. ..............................................................

BABY AND TODDLER GROUP Every Monday 9.15am – 10.45am at Greenside Primary School. 50p per session. ..............................................................

KALMA BABY - BABY YOGA Greenside Children’s CentreThursdays - 6 weeks to 6 months class 1:00pm - 6 months to Crawling class 2:15pm For more info contact emma@ gatesheadwest.kalmababy.co.uk Bookings are termly and based on a 6 week term the cost is £30.

Sessions are run in 5/6/7 week blocks

-Term dates are: w/c 16/04 until 25/05 or w/c 04/06 until 20/07 ..............................................................

GREENSIDE METHODIST CHURCH SUNDAY Sunday School 10.30-11.30 Morning Worship 10.30-11.30 Prayer Meeting 1st Sunday in the month 09.45 WEDNESDAY Church Fellowship fortnightly 7.30pm (Sept to May excluding Jan) THURSDAY Slimming Club 5.00 pm and 7.00 pm FRIDAY Coffee Morning 09.30-11,30 Everyone is welcome.

Messy Church Quarterly on Saturday afternoon.

Contact:-jenny.gill@sky.com 01207654683.

NEW HANDY MAN SERVICE!

for all your household job needs

SEE OUR ADVERT ON PAGE 4

See our main advert on page 7

Robin Building Services Local Family Business Established 1980

• All building & plumbing work undertaken • Bathroom Installation • Boiler and Central Heating Installation/Repair • Boiler & Gas Fire Servicing • CP12 Landlord Certificates • Leaks & Bursts • Toilets & Taps

Tel: 0191 413 2990 Mob: 0774 082 3639

7123

Email: robinbuildingservices@talktalk.net

www.robinbuildingservices.co.uk

34

Are you Sun Ready l

Personal styling for the best sunglasses for unique you

Bespoke fitting for the lifetime of your sunglasses l Best value with exclusive offers affordable direct debit option l

Personalised prescription for best vision l Quality UV protection l

elizabethevans opticians personal & professional eyecare

23 Front Street, Prudhoe, Northumberland, NE42 5HN. info@evansopticians.co.uk

t: 01661 832 564 www.evansopticians.co.uk

Like us on Facebook

BEFORE

AFTER

EN SE TV AS N O

TIME TO CLEAN YOUR OVEN? LET US DO THE JOB YOU HATE

With Ovenclean, you can rely on over 20 years experience with friendly, professional specialists.

Our unique cleaning system removes all grease, fat and burnt on carbon deposits quickly, efficiently, and fume-free! ●

Ovens

●

Filters

●

Hobs

●

Grills

●

BBQs

●

Ranges

●

Extractors

●

Microwaves

●

AGAs

I’m simply delighted at how sparkly clean my oven and hob look now! It really does look like the cooker is brand new again!

Call Pete Whaley or go online today for your FREE quote

www.tynevalleyexpress.co.uk

35

www.insidetransformations.co.uk

l

Kitchens

l

Bathrooms + Wet rooms

l

Bedrooms

l

Studies / Home offices

l

Media centres

l

Kitchen makeovers

l

Worktop replacements

Don’t move... Improve!

...small enough to care, yet big enough to cope

Incorporates:

We offer a full design and fitting service from an experienced and knowledgeable team with over 126 years experience between them. We will do everything to take the hassle out of a new installation! We will remove your old fixtures with the minimum of mess and also include plastering, electrics, plumbing, tiling and flooring – the whole job. That, I have found is what people want, because they don’t have time to manage it all themselves and they want guidance. They also want honesty, reliability and a price to reflect their budget!”

l

Visit our 12,000 sq ft showroom for design ideas and to...

meet the team!

Tundry Way, Chainbridge Ind Est, Blaydon on Tyne, NE21 5SJ Opening times: Mon - Fri 8am to 5pm Sat - 9am to 5pm Sun - 10am to 4pm

E: enquiries@insidetransformations.co.uk

Huge range of Indoor / outdoor tiles l Patio / Driveway tiles l Alternative decking tiles l Grouts l Adhesives l Accessorise l Helpful advice

telephone: 0191 414 1222 or mobile: 07886 454964

CRAWCROOK HOLY SPIRIT CHURCH Crawcrook and ST JOHN’S CHURCH Greenside.

Sunday services include Children’s Club. The venue alternates between Holy Spirit Church on 1st and 3rd Sunday of the month, and St John’s Church Greenside on 2nd and 4th of the month.

Hall Hire @ Church of the Holy Spirit, Main Street Crawcrook. Very reasonable rates. Contact the Church Office on 0191 4137279 or email info@greensideparish.org.uk Monday 17:30 - 19:00 Brownies Tuesday 10:00 - 14:00 Coffee Stop, open to all For more information go to www. greensideparish.org.uk and check out the What’s On page.

If you need to contact vicar Rev Tom Brazier, please email vicar@ greensideparish.org.uk or Tel 07799 217775. ..............................................................

CRAWCROOK CENTENARY METHODIST CHURCH Sunday 10.15am Sunday School age 2+, 10:30am Morning Worship, 6pm Evening Worship Monday 6.30pm Club 812 8 to 12 year old youth club Tuesday 10am Chocs A Weigh Social Slimmers Group, 10am Alternate weeks Coffee Stop, 2pm Ladies Friendship Group.

Wednesday 10am Indoor Bowls.

Alternate Weeks 7.30pm WoW (What’s on Wednesday Group) Thursday 10am and 1pm Craft Club, 7.30pm Youth Fellowship (12+).

Saturday 10.30am till 12 noon Coffee Morning.

Find us on Facebook- Centenary Crawcrook, Website- centenarymc. org.uk or e-mail - info@centenarymc. org.uk for any other information. ..............................................................

CRAWCROOK LIBRARY Tech Tasters: Save Money Online Crawcrook Library Tuesday 7th May 10.30 – 11.30am Half Term Spring time Rhymetimes Crawcrook Library. Friday 31stMay 10-10.30am. £1 – Just Turn up That’s not my meerkat! - celebrating 20 years of “That’s not my …” books Mini Meerkats at Crawcrook Library Thursday 30th May 2.15 – 2.45pm Make your own touch and feel picture. £1 - just turn up Suitable for under 5s Code Kids Crawcrook Library Wednesday 29th May 10.30 – 11.30am

We are a top

10%

Try coding some easy projects with our digital team. Age 8+. Booking essential – places are limited. Free Pyjamarama 3rd – 9th June Rhymetimes at Crawcrook Library Fri 7th June 10am. £1 – Just turn up Mini Meerkats at Crawcrook Library Thursday 6th June 2.15 – 2.45pm £1 – Just Turn up Get arty – for Childrens art week Saturday 8th June. Crawcrook Library What can you make from our maker box? Suitable for families. Free Just turn up 10th – 15th June Carers week Carers Week - if someone you know can’t get to a library because they are a carer, young carer or have mobility problems, then the library can come to you. Our Readers at Home service delivers books, large print books and audio books to your home. For more information please tel 0191 4336415 How to Get More from Your Tablet Crawcrook Library – Monday 17th June 2.30 – 4pm Find out more about how to use your tablet or if you’re thinking about buying one, try one of ours Free. Just turn up Reading Well: Books on Prescription Reading Well helps you to understand and manage your health and wellbeing using helpful reading.

Books are available from libraries and are all chosen and endorsed by health experts, as well as people with living with the conditions and their relatives and carers. Choose from Reading Well for Mental Health, Reading Well for Dementia, and Reading Well for long term conditions Regular groups - Weekly Rhymetimes Rhymes and songs to explore with your little one. Crawcrook Library Friday, 10 -10.30am. £1 - Just turn up Mini Meerkats Crawcrook Library Thursday, 2.15 2.45pm. Stories, rhymes & activities for your little ones. Under 5 years. £1 - just turn up Knit & Natter Thursdays 2pm at Crawcrook Library Coffee Morning Wednesday 10 – 12noon at Crawcrook Library To book tickets call 0191 433 8420 or for further information visit: www.gatesheadlibraries.com Or Contact Blaydon Library 0191 433 6201 Crawcrook Library 0191 413 8164 ..............................................................

CRAWCROOK SLIMMING WORLD Emmaville Hall every Wednesday 5pm and 7pm.

DAVID MUERS & SON BATHROOMS AND KITCHENS

38

Contact Amanda 0789 428 4343 OUR VILLAGES (Crawcrook & Greenside) Our aim is to make our villages nicer places to live in, while bringing the community together. Let us know if you have any ideas for us to consider.

New volunteers are always welcome!

Come along, make new friends while improving our local environment and have fun along the way.

Our Gardening Angels are ramping up the pace this Spring and they are looking for volunteers to help maintain the beautiful village flower beds!

We have enjoyed two extremely successful events since the last publication, namely the Daffodil Fair at Greenside and the popular Easter Egg Hunt in Crawcrook Park.

This year’s Crawcrook Fair is being held on Saturday 3rd August 2019.

Do you fancy getting involved in this?

If you do want to help out that would be fantastic, please let us know (see contact details below) What about getting involved with the monthly litter picks! All equipment is provided.

The next dates are: Greenside – “Spring Clean the Green” meet on Greenside Millennium Green(beside Londis) • Saturday 11th May 10.30 a.m. – 12.00 noon. Families welcome.

Crawcrook – meet outside Holy Spirit Church, Main Street • Saturday 8thJune 10a.m. - 11 a.m.

• Saturday 5th July 10a.m. - 11 a.m.

Find us on the Our Villages page on Facebook, Twitter, on our website at www.ourvillages.org.ukor for more information about becoming involved, please contact Caroline on 07534288301 ..............................................................

CLARA VALE VILLAGE HALL Clara Vale Village Hall and Business Centre The village hall is in a beautiful, peaceful setting with 3 spacious recently refurbished rooms (including a kitchen) available to hire for parties, classes, talks, meetings, hot-desking and other events. Free wifi, ample parking, disabled parking and access.

Hire rates start at just £8/hour.

For more information, availability, hire rates and bookings please contact Rachel on 07543 281301, email bookings@claravale.org.uk or see our website www.claravale.org.uk.

Party Packages To book an Arty Party, Soft play, Disco Don or Animal Handling party see details of packages on our website.

Catering packages Email bookings@

claravale.org.uk to discuss your requirements Monthly Takeaway Nights 5-7pm- Eat in or takeaway:29 MayFrosts Fish and Chips, 26 JuneThe Pickle Palace Curry REGULAR EVENTS Monday1st Monday of month- Councillor surgery 6.30-7.30pm/ Village Hall Committee meeting 7.30pm 2nd Monday of month- Clara Vale Conservation Group Committee meeting 8pm Tuesday- Dru Yoga : 9.30-11am Coffee Morning and Library: 1112pm Wednesday: The Vale Dog Club- Ring class for dogs. Educating dog owners in the skills of showing their dogs in the ring at Kennel Club registered shows.

7.45-9pm Thursday- Toddler Group 9.3011.30am Bread Basket 5-6pm. Email cvbreadbaket@hotmail.com or message facebook page Clara Vale Bread Basket to order artisan bread or just turn up.

Iyengar Yoga 8-9.15pm Friday- Karate 6.30-8.30pm. For more information contact Joe Robson: Facebook Clara Vale Karate/ Ring or text 07519009874/email joe. robson96@btinternet.com 2nd Friday of month - Lunch Club 12-1.30pm £5 2 courses with tea and coffee Saturday- 1st Saturday of month Village Hall Breakfast 9-11am Sunday- Iyengar yoga 7-8.30pm COMING SOON Saturday 4 May 9-11am Village Breakfast 10am -12pm Strolls with Poles Nordic walking. £10. Book online at www.strollswithpoles.com/shop Friday 10 May Lunch Club 12-1.30pm. £5 for 2 courses with tea & coffee. Children half price Saturday 18 May 10-11am /11.15-12.15pm The Baby Hub £5 book online at www. the-baby-hub.co.uk or email lucyg@ the-baby-hub.co.uk Sunday 26th May 10am-12pm Strolls with Poles Nordic Walking. £10. Book online at www. strollswithpoles.com/shop Friday 14 June Lunch Club 12-1.30pm. £5 for 2 courses with tea & coffee. Children half price.

Sunday 16 June 2pm-5pmOpen Gardens and Art Fair with WhittonstallCommunity Band 2-3pm.Beccy Own’s Pop up Choir 3-5pm. Afternoon tea served

New - CALLOUT SERVICE Visit our NEW website and book an appointment! Any job big or small.

See our main advert on page 7

all afternoon. Entry £3. Followed by 5pm-11pm Midsummer Supper with wood-fired pizzas, hog roast, bar and live music Saturday 22nd June 10-11am /11.15-12.15pm The Baby Hub £5 book online at www. the-baby-hub.co.uk or email lucyg@ the-baby-hub.co.uk ..............................................................

CRAWCROOK JUDO CLUB Held at St Johns Community Hall, Greenside Road, Greenside,

NE40 4LF Saturday session times Mini Fighters age 4yrs – 5yrs Time 9am – 9.30am Beginner’s age group 6yrs -8yrs Time 9.30am 10.15am Junior and Intermediate class Age group 9yrs – 14yrs Time 10.15am -11.15am Senior class 14+ Time 11.15am -12.45pm Thursday sessions Junior and Senior classes 6.30pm – 7.45pm Contact Kevin Pattison 07145955238 or John Pattison 0191 4476836

l l l l

Corn removal Fungal infections Verruca treatment Ingrowing toenails

l

Funeral Director Darren Johnstone

A personal and professional service from your local community funeral director We offer a complete service, day or night for personal attention covering ALL areas.

Personally supervised by Mr D. Johnstone

A thoughtful way to plan ahead

Peace of mind for you and your family

Foot care in the comfort of your own home General foot care l Nails trimmed l Thick nails reduced l Callus reduction

E. PEART LTD

Save your family worry and expense with a Funeral Plan from E Peart Ltd.

Tyne Valley Foot Care l

Serving the Tyne Valley area for over 80 years!

Specify your wishes in advance

Foot healthcare advice for diabetics

Protection against rising funeral costs Contact us today for more information

1 Kepier Chare, Crawcrook Ryton NE40 4TS

Karen McCarthy S.A.C. Dip. Registered Foot Health Practitioner Email: tynevalleyfootcare@gmail.com

0191 413 2318

Telephone: 07841 511674

www.epeartltd.co.uk

Crookhill Primary School and Crookhill Early Years

“Working together, we succeed”

Crookhill Early Years is a privately managed nursery for 2 to 4 year old children.

Graded ‘OUTSTANDING’ by OFSTED Fantastic new building and facilities Crookhill School, Early Years and GAP Out of School Club work together to provide high quality, wrap around care and education for 2 to 11 year olds. 7.30am to 6pm Monday to Friday.

NEW NURSERY

Crookhill Primary School has been at the heart of the Crookhill community in Ryton for 111 YEARS! Our school provides a happy, friendly and highly positive environment where everyone feels safe, valued and respected.

Contact us at:

Crookhill Primary School - Tel: 0191 4334066 - www.crookhillprimary.org Crookhill Early Years - Tel: 0191 4137473 - www.crookhillearlyyears.com Hexham Old Road, Ryton, Tyne and Wear, NE40 3ES

www.tynevalleyexpress.co.uk

39

with

Slimming World find your neerest

warm &friendly group

Jerk chicken with fruity Caribbean slaw

This tasty jerk chicken recipe is pure Caribbean sunshine. Serve with fruity slaw for a Syn-free dinner that’s packed with flavour l

Serves: 4

35 minutes

l

INGREDIENTS l 12 skinless chicken drumsticks l 1 tbsp white wine vinegar l 2 tbsp jerk seasoning powder l 2 tbsp tomato pureée l 2 garlic cloves, finely chopped l 1 Scotch Bonnet chilli, deseeded and finely chopped l 1 tbsp dark soy sauce/ tamari l Salt and freshly ground black pepper l 2 lime wedges, to serve FOR THE SLAW: l 200g roasted red peppers in brine from a jar, drained and roughly chopped l 1 carrot, peeled and shredded l 1 red onion, thinly sliced

METHOD 1. Put the chicken drumsticks, vinegar, jerk seasoning, tomato purée, garlic, chilli and soy sauce in a food bag, season, seal and shake to mix well.

Marinate in the fridge for 3-4 hours, or overnight if you can.

2. Preheat your grill to medium hot.

Line the grill rack with kitchen foil and lay the chicken on the rack in a single layer. Grill for 8-10 minutes on each side, or until cooked through, brushing with any remaining marinade after the first 5 minutes.

3. Meanwhile, for the slaw, put the roasted red peppers, carrot, red onion, mango and pineapple in a bowl. Add the jerk seasoning and lime zest and juice, season and toss well to combine.

4. Divide the slaw between plates and garnish with parsley. Top with the chicken and serve with lime wedges for squeezing over.

MONDAY THROCKLEY

PRUDHOE

HEXHAM

WEDNESDAY

Community Hall (Back Victoria Tce) Mondays 7.00pm Charmaine 07809 201 077 Community Centre, Gilesgate Monday mornings 9.30am & 11.30am Caroline 07500 336 943

HEXHAM

Community Centre, Gilesgate Mondays 5.00pm & 7.00pm Caroline 07500 336 943

WINLATON

St Annes Church Hall, Half Fields Rd Mondays 9.30am, 5.00pm & 7.00pm Sandra 07876 494 908

Methodist Church Hall (opp. Dr Syntax Pub) Tuesdays 5.30pm & 7.30pm Julie 07960 352 811

PRUDHOE

STOCKSFIELD

CRAWCROOK

HALTWHISTLE

BLAYDON - NEW CONSULTANT

SATURDAY

HEXHAM - NEW VENUE & TIMES

RYTON

Methodist Church, Hexham Old Road

Tuesday’s 9.30am & 11.30am Tracey 07500 807 103 RYTON

Methodist Church, Hexham Old Road Tuesday’s 5.00pm & 7.00pm Tracey 07500 807 103

Corbridge First School, St Helens Lane Thursdays 5.30pm & 7.30pm Laura 07825 180 494

HALTWHISTLE

Trinity Methdist Church, Lucy St Wednesdays 5.30pm & 7.30pm Joy 07904 551 028

Masonic Hall, Westfield Terrace Tuedays 5.30pm & 7.30pm Nici 07730 582 570

CORBRIDGE

Community Centre (SICA), Mount View Tce Wednesdays 5.30pm & 7.30pm Catherine 07919 236 868

PONTELAND

Methodist Church Hall, Bell Villas Monday 7.30pm Jane 0781 480 5464

Methodist Church Hall, Lead Road Thursdays 5.00pm & 7.00pm Amanda 07894 284 343

Methodist Church Hall PONTELAND (opp. Dr Syntax Pub) Wednesdays mornings 9.30am & 11.30am Merton Hall, Merton Way Thursdays 5.00pm & 7.00pm Alison 07734 103 833 Jane 0781 480 5464

Emmaville Hall, Main Street Wednesdays 3.00pm, 5.00pm & 7.00pm Amanda 07894 284 343

TUESDAY

GREENSIDE

LEMINGTON

Lemington Centre, Tyne View Wednesdays 5.00pm Sarah 07772 687 438

THURSDAY BLAYDON - NEW CONSULTANT Trinity Methdist Church, Lucy St Thursdays 9.30am Joy 07904 551 028

NEWBURN

Village Parish Hall, Station Rd Thursdays 5.00pm & 7.00pm Sarah 07772 687 438

Haltwhistle Library, West Gate Thursday mornings 9.30am Jane 0781 480 5464 Haltwhistle Library, West Gate Thursday evenings 5.00p & 7.00pm Catherine 07919 236 868

HEXHAM

Hexham East First School, Beaufront Avenue Saturday mornings 8.30am Laura 07825 180 494

WYLAM & OVINGHAM WYLAM INSTITUTE We have many classes each week, from children’s dance to adult Zumba, Art, Pilates, Yoga - Mon, Wed and Thu mornings 9.30 - 11am also sundays 4 - 5.30pm Badminton, drama (senior and junior) carpet bowls, exercise for over 50s and monthly clubs like gardeners and bridge. Ring Fiona on 01661 852498 for further details. The Institute office is open on Mondays, Wednesdays and Fridays between 9.30am and 12noon. ..............................................................

WYLAM METHODIST CHURCH Chapel Lane, Wylam NE41 8DZ A warm welcome awaits you.

Minister : Rev Jenny Porterpryde, 01661833869 Snr Steward : Nigel King 01661854313 Regular Service Sundays at 10.45am 1st Sunday Communion 3rd Sunday All Age Service Messy Church : 2nd Sunday at 4.00pm - Crafts , songs and stories, and tea for young familiesays Junior Ukulele Group Fridays between 4.00 and 5.00pm Soup and Pud Lunch for over 70’s . 1st Wednesday of each month. Contact Anne Featonby 01661853552 Saturday Coffee Morning Drinks served between 10.30 and Noon.

Methodist woman in Britain Every other Tuesday at 2.30p, in the foyer. Guest speakers and friendship for women of all ages Rooms are available for hire for meetings /parties etc Contact Alan Smart 832717 ..............................................................

WYLAM ST OSWIN’S CHURCH OF ENGLAND Wylam St Oswin’s Church of England Church Road, Wylam, NE41 8AT www.stoswinschurchwylam.btck.co.uk WEEKLY SERVICES: Sunday 8.00am and 10am (at St Mary Ovingham Sunday at 8.00 am (2nd & 4th weeks each month) & 10.00am.)

See our website for any service changes.

Thursday 9.30am. Children are welcome at our services. Contact Revd Tom Birch Tel. 01661 853254 Wylam Church Hall with its own sheltered private garden is available and ideal for children’s parties, receptions, fundraising events, meetings and classes.

Brownies meet on a Tuesday at 6.00 pm. Beavers on a Thursday at 5.30 pm Cubs on a Thursday at 6.30pm and Scouts at 7.00 pm on a Friday Contact: Helena Bates 07947 116735 or helenabates@waitrose. com Monday 3.30 to 5.00pm Judo Monday Fitness Class 6.30pm to 7pm Wednesday 11.00 to 12.00 Chair

We are a top

10%

Yoga Wednesday Metafit 18.15 to 18.50 & Karate 19.00 to 21.00 Friday Metafit 9.15am to 9.50am (not summer) Friday Wylam Singers 11.00am to 12.30pm Domino Night in St Oswin’s Church Hall Saturday 15th June 6.30 for 7.00pm.

Licensed bar, supper. £7.50 (Child £5.00) Please insert contact email address. email: wylamst.oswin@hotmail.co.uk ..............................................................

WYLAM PRE-SCHOOL PLAYGROUP Falcon Centre, Wylam.

OFSTED registered playgroup for 2 to 4 year olds. Monday to Friday 9.10am to 12.10pm. Warm welcome to all!

Term time Contact 01661 854190 or 07070818974 wylamplaygroup@yahoo.co.uk ..............................................................

Wylam YOGA Yoga for all at Wylam Institute Ongoing Yoga courses each 1/2 term HATHA YOGA on Thursday evening 7-8.30pm and Friday morning 9.45 - 11am Contact Maria Knight for booking form. 01661 854636. email:yogawithmaria@gmail.com ..............................................................

WYLAM TENNIS CLUB: Sessions: Tues 10-12am, Tues 7-9pm, Sun 2-5pm. For further information please contact Marion Muir at 01661 852 058 or visit our website at: www.wylamtennisclub.co.uk ..............................................................

WYLAM AMATEUR DRAMATIC SOCIETY Meets every Monday at the Wylam Institute 7.30pm. For more details of the Society, please contact Gail Lawler Tel.07817 769174 ..............................................................

WYLAM W.I. Meets every 3rd Tuesday of the month in Wylam Institute at 7.30pm.

All VISITORS VERY WELCOME. For further details, please contact Mrs Robin Piette 01661 853727 ..............................................................

Wylam Duplicate Bridge Group Meets every 3rd Monday of the month at 7.00pm in the Wylam Institute. New Members Welcome Contact Roger Turner 01661 852582 ..............................................................

WHAT’S ON IN OVINGHAM Ovingham Reading Room To book your event, please contact the Bookings Secretary on 01661 836793, or email bookingreadingroom.gmail.com.

Hire charges on request Further information can be found on the website www. ovinghamreadingroom.org.uk Ovingham WI 2nd Monday of each month 7.30 – 9.30 pm Toddlers Play Group Tuesdays during

DAVID MUERS & SON BATHROOMS AND KITCHENS

42

term time 10.00 - 11.30 am Yoga Tuesdays (Term Time) 2.00–3.00pm Ovingham District Choir Tuesdays (except July/August) 7.45 – 9.30 pm Energize Dance sessions (Term Time only) Wednesdays 1.30 - 7.15 pm; Fridays 4 - 5 pm; Sundays 6.30 - 8 pm Buggy Fit - Tuesdays 1:00pm to 1:45pm, Wylam (meet at war memorial car park). Buggy Blast is a walking with your baby exercise class.

Not too strenuous but fun and in the fresh air. Often the ladies will go for coffee afterwards!

Craft Group Wednesdays (September to May) 7.30 – 9.30 pm Drop in Chat Club for over 60’s Thursdays (except July/August) 10.30 am–1.00 pm Drama Group Thursdays We meet on Thurs 8-10 pm ( except July / August) Film Night Usually the last Friday of each month, doors open 7 pm, film starts 7.30 pm.

Check the noticeboard outside the Reading Room for latest information or go to the website: www.ovinghamreadingroom.org.uk ..............................................................

Yoga Ovingham (The Old School) Sat mornings 9 - 10.30am ..............................................................

THE BADGER CLUB an out of school club. We operate from The Old School in Ovingham, Monday to Friday. Breakfast Club is from 7.30am until 9.00am and then After School Club from 3.00pm until 6.00pm. We take children from 4-14 years of age.

We also operate a Holiday Club during the school holidays, from 8.00am until 6.00pm. For further information call 01661 833327 ..............................................................

EXERCISE CLASSES IN WYLAM Monday Buggy Blast: 9.30 – 10.15am (Meet at Wylam station car park) Tues in Wylam Methodist Church Hall Pilates: 6 - 6.55pm Core & Cardio 7 - 7.55pm Mens Only Core & Cardio 8 - 8.55PM Wednesday Pilates: 9.30 - 10.25am Post Natal Exercise Class (restore your core) 10.30 - 11.25am (Babies welcome) Buggy Blast 2.15 - 3.00PM (Meet in Wylam station car park) For more information or 1:1 sessions please get in touch.www.annalittle. couk Mob: 07747624541 ..............................................................

WYLAM BIRD CLUB Led by Bryan Galloway. One indoor meeting a month on a Wednesday evening in Wylam Methodist Church Hall. One field trip a month at weekends. For information contact Bob Doughty 01661 853398 www.wylambirdclub.co.uk

OVINGHAM BRIDGE CLUB “Ovingham Bridge club meets every Monday night in the old school. New member would be welcome anyone interested contact Ann Smith tel 01661833815” ..............................................................

Wylam Gardeners’ Society We are a small but friendly group that hold monthly meetings which have now finished but begin again in September.

Saturday 18th May brings our Spring Plant Sale and Coffee morning, held in Wylam Institute at 10.00 am.

After a mixed Winter and Spring come and stock up with plants from our members gardens and two local nurseries. Enjoy a coffee and advice from our members plus home baking stall too.

For further information please contact WGS secretary Mary McElroy telephone 01661 881245 or email, marymcelroy@hotmail.co.uk ..............................................................

Wylam Library Visit online at Eventbrite - http:// nlandlibs.eventbrite.com for events or ask library staff. ..............................................................

WYLAM MEDITATION Wylam Institute 7-9pm every Tuesday Everyone welcome – no need to book Suggested donation £4 / £6 For more information visit www.compassioncentre.org Email info@ compassioncentre.org Phone 0191 - 284 3501 ..............................................................

WYLAM CHOIRS Tyne Valley Voices Thursday evening, 7.30pm-9pm at Wylam Methodist Centre Wylam Singers Friday morning, 11am-12.30pm at St Oswin’s Church Hall Both choirs are open to anyone, no audition required, and are payas-you-go at £5 per week in term time. Led by Simon Davies-Fidler, conductor of National Choirs of the Year winners Voices of Hope, both choirs sing a range of repertoire and perform regularly in Wylam and further afield. For more details email wylam.singers@gmail.com or just drop in to a session. ..............................................................

Ovingham Allotment Association.

We meet at The White Swan in Ovingham, 8pm, every 2nd Wednesday of the month. £2 to become a member & join the waiting list - open to all living within Ovingham Parish. For more details contact kirstycruickshank@yahoo. co.uk or pop along to a meeting. ..............................................................

Ovingham UPLIFTED 2nd & 4th Wednesday in each month, 8 – 10 pm, Ovingham St Mary’s Church A group of women who sing, laugh

Which? TOP 10% Trusted Trader

See their website to see our fantastic feedback

See our main advert on page 7

and enjoy a glass of wine. No auditioning, no need to read music, open to all from Tyne Valley and beyond. Come and try us out? For more detail we are on Facebook or call Kate 830499 ..............................................................

Growing Gang – last Saturday in each month (March to November), 10.30 – 12 noon. GO Local Fields, Ovington Nursery A chance to find out more about our environment and wildlife with an opportunity to grow your own veg and fruit. Open to all children, (you need to bring an adult with you).

Details at http://golocalfood.co.uk/ growing-gang/ or email us admin@ golocalfood.org.uk

GO Local Food Acting locally … demonstrating how to look after the environment whilst producing good quality seasonal veg, learning more traditional skills, volunteering and learning about the wildlife around us. New members from across the Tyne Valley always welcome, find out more about who we are, what we do and how you can join, www.golocalfood.org.uk or arrange a visit by emailing admin@ golocalfood.org.uk ..............................................................

Dru Yoga Classes Mondays 6.30 - 8.00pm ….

Fridays 9.30 - 11.00am (Both at Ovingham Reading Rooms) contact details are ; Rachel Orange 07545865009

Carol Davison

GUY OPPERMAN MP Your local Member of Parliament for the Hexham Constituency

Guy Opperman, your local Member of Parliament, holds regular surgeries across the constituency. If you would like to arrange an appointment to discuss an issue of concern to you, please get in touch with Guy using the details below.

Fine Artist

GET IN TOUCH WITH GUY t: 01670 789161 w: GuyOpperman.co.uk e: TeamOppy@gmail.com fb.com/GuyOppermanMP

Carol Davison captures the light, atmosphere and expressions of the people of India and her native Northumberland, in her original oil paintings and prints.

Tel: 07989 047693

GuyOpperman.co.uk

www.caroldavison.com

MJ

BUILDING

AND

PROPERTY

SVC (UK) LIMITED

OLDS, F IB , S IE R E G N A R O S WINDOWS & DOOR

50%OFF JU N E 20 19 O F F E R E N D S 30 th

Telephone: 0191 495 7931 or 07780 124455 Email: info@mjpropertysvc.co.uk

www.mjpropertysvc.co.uk

Land Girls &rvCicoes. e S g in n e d r a G y lit a Qu

l

Regular Year Round Maintenance

l

One Off Garden Tidy

l

Soft Landscaping - Design Through to Completion

l

Planting Plans & Aftercare

l

Lawn & Hedge Maintenance

l

Tree Work & Felling

l

Qualified & Insured

For Free Advice or an Estimate Please Call: Rachel: 01661 854309

Sharon: 07804 027591

Email: landgirlsandco@gmail.com

www.tynevalleyexpress.co.uk

43

Wild Garlic Time - Gourmet Heaven Walk into any well-established broadleaved woodland in the area at this time of year and you are likely to get an enticing garlicky whiff that tells you, “There’s something really tasty in these here woods”. Yes, it is wild garlic time again – we should have an annual woodland festival just especially for all things wild garlic.

The Italians or Spanish – I can never remember quite who - spend a mad time chucking tomatoes at each other and literally painting the town red to celebrate their wonderful tomato harvest; I think we should be very British about it and have a civilized time sharing the huge range of tasty foods you can make with this gift from nature. Along with a cup of nettle tea perhaps it would take the form of a picnic with gingham table cloths spread on the ground in the dappled sunlit woodland.

Usually the plants don’t take much finding as they often carpet the woodland floor, stretching far into the distance; the leaves are up to about 15 to 20cm long with a pointy end and narrowing again towards the base. Just pick a bit off a leaf if you want to check if you have got the right plant – if it smells of garlic you are right. There are a couple of plants that look similar and are harmful, particularly Lily of the Valley, but none of them smell of garlic, so it is dead easy to sort out whether you have found it or not. When it flowers it has wonderful, white, rounded pom-poms, about 5cm across, made up of smaller flowers that look like pointed stars and creating a very impressive mass floral display.

Every part of the plant is edible but please note it is illegal to dig up or uproot any wild plant without the land owner’s permission; you don’t really need the plant bases anyway – there’s plenty to keep every cook and gourmet happy in the flowers, seeds and leaves. The flowers are great scattered to brighten up and flavour a salad. Later the green seeds are a marvellous spice used for the hot garlic kick they give. Try them in curries or anywhere else you’d like a garlic flavour. Unfortunately, they lose their kick and are unusable when they go brown and dry. The leaves are brilliant in cooking of all sorts. Here are a few things for you to try: WILD GARLIC AND CAULIFLOWER CURRY 300 to 400g approx. wild garlic leaves roughly chopped 1 cauliflower cut into florets 1 large onion diced 2.5cm piece fresh root ginger, peeled and chopped 2 teaspoons ground coriander 1 teaspoon ground cumin 1 teaspoon ground turmeric 2 teaspoons black mustard seeds 1 teaspoon garam masala 1 teaspoon cayenne pepper 250ml water plus veg stock cube 2 tablespoons vegetable oil Serves 4 You’ll need a big pan. Fry the onions till brown in the veg oil. Add ginger, coriander, cumin, turmeric, mustard seeds, garam masala and cayenne pepper and heat for a minute.

Add cauliflower and stir to coat with the spices and onion. Add water and stock cube and stir in. Bring to the boil, cover and reduce heat to simmer for about 8 minutes.

Stir in wild garlic until it begins to wilt. Cover and simmer until cauliflower is tender.

There are a number of different ways of preserving wild garlic leaves so you can enjoy the flavour long after they have vanished from the woods.

WILD GARLIC PESTO 100g wild garlic leaves 200 ml olive oil 80g grated parmesan cheese 50g walnuts Pinch of salt Put all the ingredients into a blender and turn into a paste. Put into sterilised jars.

Great mixed with pasta.

WILD GARLIC OIL & WILD GARLIC LOAF If you make wild garlic oil you can use it in your usual cooking and salad dressings to give a great garlic flavour. You can also use it to make a really tasty garlicky loaf.

To make the oil chop up the wild garlic leaves and loosely fill a large sterilised jar to about three quarters full, fill the jar with olive oil, put the lid on and leave for 5 days or so. Pour oil into a bottle and keep the leaves for cooking – they’re nice just chucked into a Bolognese sauce.

44

To make the loaf: 500gms white bread flower 260 ml warm water 2 tablespoons of your wild garlic oil A good handful of finely chopped wild garlic leaves 1.5 tsp salt 2 tsp sugar 1 sachet quick bread yeast Mix it all together and knead for 10 mins. Leave to rise in a warm place for 30 to 45 mins. Knock back the dough so it is the original size and then put on an oiled baking tray in a warm place till doubled in size. Put in an oven on 200 – 210 C for about 30 mins.

We use our own sour dough starter (nick-named the Yeasty Beasty) which lives in our fridge, rather than bought quick yeast. If you are going to be making bread regularly it is well worth cultivating your own and it is really quite easy to get one started.

Finally, a few guidelines for wild food foragers: Always follow the few simple rules for safe foraging outlined below: • Always be careful about where you forage – avoid any obvious places, or signs, of pollution e.g. dodgy looking water courses, landfill areas, industrial sites and waste land you don’t know the history of, farm yards and middens, field edges where a crop may have been sprayed with chemicals, busy roadside verges (lead lasts a long time in the soil), places treated by some folk as a dog toilet and so on.

• Always be 100% certain of your identification before eating anything you have foraged; if in doubt leave it out! I would recommend ‘The Wild Flower Key’ by Francis Rose to anyone serious about identifying what they’re about to eat and a wish to stay healthily alive!

• Different people may react differently to new wild food stuffs so when trying a plant for the first time eat just a little on the first occasion and if there are no ill-effects, you can eat a bit more of it next time.

• Finally forage sustainably. Be sparing in any one place, never pick everything that is there, leaving plenty untouched. Only collect if the plant is plentiful.

There are plants, protected by law, which it is illegal to pick (see the Wildlife and Countryside Act 1981 Schedule B). Never uproot a plant.

Learn to forage safely, legally and sustainably by joining one of my courses (see email address below)

Bruce Ferguson Wild North Discovery For more information please ring 01388 529154 Email: bruce@natureholiday.co.uk Web: www.natureholiday.co.uk

Bushcrafts for Families

Top northern bushcraft instructor, Bruce Ferguson, over 30 years experience Qualified to teach bushcrafts through the Institute for Outdoor Learning

Family bushcraft half day

Family Bushcrafts Sleepout

£40 per family (2 to 4 people) £10 per additional person Children should be 5 years or over.

£60 per family group (2 to 4 people) (£30 per additional adult, £15 per additional child) Children should be 8+

25/26th May 3pm to 9am Hamsterley Forest

Build a shelter, light a fire, cook a meal, make something to take away

Set up a tarp shelter, light a fire, cook a meal and sleep out in the wild woods!

Hamsterley Forest dates

in partnership with the Forestry Commission

Wilderness Survival Challenge

April 21st Easter Sunday August 4th, 25th October 27th

£15 per person. Not a family activity Must be 8 to 13 years old.

2nd June, 13th August 1.30pm - 4.30pm Hamsterley Forest

Kielder Forest dates

in partnership with Kielder Water and Forest Park

Your light airplane has crash landed in dense forest hundreds of miles from civilisation. Solve the problems and stay alive!

April 11th, 14th, 18th May 28th August 1st, 8th, 15th, 22nd, 29th October 26th, 31st

Can’t make these dates?

Book your own for a date that suits

For more information: Wild North Discovery Tel. 01388 529154 enquiries@natureholiday.co.uk or visit www.natureholiday.co.uk

Other services: Our experienced and trustworthy team also provide the following skills and services”

GROUND WORKS

With over 18 years experience we offer the best possible service throughout the Tyne valley and beyond.

l

ROOFING - We undertake and guarantee all aspects

l

of roofing work including:

l l l l l

Repairs-large or small Full renewals Chimney work Dormer roofs Pitched roofs

l l l l l l

Felt roofing Fibre Glass roofing Liquid plastic roofing Rubber roofing Flat roofing Lead work

l

l

Block paving/resin/tarmac or gravel driveways Re-pointing - either brick or stone Patios and landscaping Plastering or rendering Brick laying and building work All work fully insured.

18 years experience.

Tel: 0191 499 0629 Mobile: 07778 520 636 Email: leerichardsonroofing@outlook.com 26 Derwent View, NE12 6LP

www.tynevalleyexpress.co.uk

45

COMMUNITY BUDDIES Non Medical Home Services

We are a team of highly experienced individuals, who can offer all our clients an individual package to suit their needs. We have many years of working within the social care sector. We are passionate about offering a professional service and thrive to make your life as stress free as possible. We offer non medical services that assist our community of all ages. Giving you and your family peace of mind, and making it possible to live a active and independent happy life. l

l

l

l

l

Companionship services

This service can be from a few hours to a full day of shopping, attending you to appointments. Having a cuppa and a chat to playing games and completing cross words. We offer a reading, walking service within this time. Or having your hair washed and dried, nails painted whatever you would like to do.

Assistance to appointments

All our staff are fully insured to take you to appointments ie hospital appointments, doctors we can accompany you and take notes to pass on to family or just for your records.

Breakfast, lunch, tea calls

These calls are based on a comfort call to make sure all is well, make breakfast or a sandwich up for lunch. Lunch we can make you a fresh meal and make a sandwich up for tea. Tea call, again make you a fresh meal or heat a microwave meal up.

Bed calls

This call is based on a comfort call, make sure things are all good and support to lock up and make sure you have everything needed until the next morning.

Companionship and reassurance.

Shopping services -

We can take you out shopping, or we can go and get your shopping and support you to put away.

l

l

l

DEMENTIA DAY CARE CENTRE

We now offer a Day Centre for Dementia, vulnerable adults, which offers a sociab le and relaxing environment.

Lunch included, snacks and refreshments.

Day Centre will run MondayFriday 10.00am-3.30pm.

You must book in advance.

Respite services

We are here to support family members if they need a break for a few hours or even a full day visit. Our aim is for you to go and do the things you need to do without the worry that your loved one has no support. We encourage engagement with activity packs that include games, cards, dominoes, colouring books if that would be of interest. All our activities are there to engage and boost brain activity.

Domestic services

We offer basic domestic cleaning for our clients. Hoovering, polishing, cleaning of kitchens and bathrooms. Support with laundry services.

Learning disabilities/ Independent living services

We offer enabling services to support clients to live independently, shopping, cinema, preparing food and many more activities to suit.

many more services tailored to your needs

Please visit our website for more details: www.communitybuddies.com Tel: Rackel Miller on: 01661 844456 On call number: 07748 802712 Email: info.communitybuddies@gmail.com NEW 16/17 Dene Workshops Mickley, Northumberland NE437BJ OFFICE Find us on Facebook and Twitter

A. Douglas Construction (North East) Ltd

Professional & Reliable www.adouglasconstruction.co.uk

I would like to introduce my company, A.Douglas Construction (North East) Ltd. We have been established for over 10 years and are a building company based on a family tradition with a reputation for quality project management, timely delivery and aftercare service.

All work undertaken is fully guaranteed and is completed to the highest standards of quality control.

●

Extensions & alterations

●

●

Timber frame construction

● ●

●

Design to completion

●

●

Specialist joinery

●

●

Refurbishments

●

●

Kitchen design and installation

● ●

Plumbing and heating All types of electrical work Porches Garages Commercial work Insurance repairs Conservatories uPVC windows

●

Dry verges

● ● ●

Plastering Dry lining

● ● ● ●

Driveways Fencing Drainage

For a free no obligation quotation contact: Anthony Douglas

Tel: 0191 267 2277

Mobile: 07967 250744

email: adouglasconstruction@gmail.com

PRUDHOE PRUDHOE W.I. Meets on the third Wednesday of each month in the St Mary Magdalene Parish Hall. Why not come along and join us and see what the WI can offer you? Our meetings are interesting, informative and most of all enjoyable. It is a great way to meet new folk and make lasting friendships in a relaxed, warm and welcoming environment. Visitors are always welcome.

Contact either Caroline Stow on 07801031015 or Alison Scrimshaw 01661 830071 ...........................................................

PRUDHOE LADIES NETBALL CLUB We meet at Prudhoe High School Sports Hall every Wednesday evening (term time only) between 7pm-9pm.

If you want to get fit, have fun and meet new friends- we’d love to welcome you to our club. We are a friendly group of young (and not so young) ladies who meet for a coaching session each week and for those who want to play competitive netball- we have two teams in the netball league. For more information call Chris 01661 834901 or Janet 01661 836395 - or just pop along one week- we’d love to see you. ...........................................................

EDGEWELL CHRISTIAN CENTRE There’s a warm welcome at our Sunday Service so join us for a time of praise in word and song, with a short bible message to take into the week ahead!

SUNDAY: 11.15am Refreshments served 11.30am Sunday Service MONDAY: (Term time only) Toddler Time, 10.00-11.30am Visit our website:edgewellchristian. org.uk or find us on Facebook. ...........................................................

PRUDHOE CASTLE BOWLING CLUB We meet every afternoon from1.30pm at Oaklands Park, next to Waterworld Monday to Saturday with League Matches and Friendly encounters. Why not come along and join us from Late April to September. For further information contact: Phil on 01661 843372 ...........................................................

PRUDHOE METHODIST CHURCH (West Road) LUNCHEON CLUB Meets in on the First Floor at 12 noon on every second Friday of the month when we serve Soup and a Sweet, followed by tea/coffee and biscuits. Price £3. All are welcome.

PARENT AND TODDLER GROUP

We are a top

10%

9.30-11 am Tuesdays and Thursdays (term-time) Margaret Glendinning 01661 832066 Sunday services: 10 am MESSY CHURCH 3.15pm refreshments 1st Friday of the month.

Families welcome.

YOUTH CLUB: Fridays 6-7.30pm (age 5-11) term-time ...........................................................

PRUDHOE & DISTRICT U3A We are a friendly organisation with a wide variety of activities and interests.

The U3A is not about study and qualifications, it is about members improving the quality of their lives by getting together to share interests and join in activities. Our members are from all walks of life and are either retired or in part-time work, with different life experiences to share with each other.

We hold a general meeting with invited speakers on the last Monday morning of each month these meetings are in Prudhoe St Mary’s Parish Hall on Front Street. A less formal meeting on the second Tuesday morning of each month 10am - 11.30am is held at The Spetchells Centre, Prudhoe; Interest groups meet at times and places to suit their members. For more information please contact the Membership Secretary on 01434 682220 or visit our website https:// sites.google.com/site/u3a4prudhoe/ ...........................................................

PRUDHOE HEALTH WALKS Meet every Thursday at Tyne Riverside Country Park Visitor Centre at 10:30am for a short walk with longer extension on second Thursday of month. Tel: 01670 622368 See all our walks listed on the Hexham what’s on pages. ...........................................................

PRUDHOE GLEEMEN MALE VOICE CHOIR New members welcome. www.prudhoegleemen. org.uk . We meet 7.15pm every Monday night at Prudhoe Methodist Chapel for our practices. Everyone who would like to join in can just come along. You do not need to read music. Tel no 01661 832162 ...........................................................

WEST WYLAM RESIDENTS ASSOCIATION Meet on the last Monday of every other month, We meet in The Manors, Adderlane Road, Prudhoe at 6.30 p.m.

For further information please contact Caroline on 01661 831380 ...........................................................

PRUDHOE OVER 50’S FORUM

DAVID MUERS & SON BATHROOMS AND KITCHENS

48

meets on the 3rd Monday of every month in St. Mary Magdelene’s Church Hall (at the traffic lights in Prudhoe ) Meetings begin with coffee and biscuits at 9:45am. Speaker at 10am. Don’t sit at home alone this year. Come and join us. Anyone over 50 living in and around Prudhoe is very welcome at our friendly and informative meetings. Meets on the 3rd Monday of the month in St Mary Magdalene Church Hall, Front Street, Prudhoe at 9.45 for coffee and speaker at 10am ...........................................................

PRUDHOE PARISH HALL ARTventurers Tyne Valley, art and craft classes, parties and events for babies, toddlers and children.

Wednesday 9:50am Baby ARTventurers (6-18 months) For more information please contact Justine, 07737108061 justine@ artventurers.co.uk ...........................................................

PRUDHOE GARDENERS’ ASSOCIATION We manage the Prudhoe Town Allotments on behalf of Prudhoe Town Council. These allotments are available for those who live within the parish of Prudhoe (which includes Mickley). To apply for an allotment you need to go to the Hut behind the West Wylam Inn Inn, Front Street, Prudhoe on Saturday mornings between 10am and 12 noon to add your name to the waiting list. Any gardener who has a home garden can be a member of the Prudhoe Gardeners’ Association on payment of a small annual fee.

This allows you to purchase seeds, fertilisers, compost and garden sundries at our discount rates during our Saturday morning opening hours. For more information visit http://prudhoegardenersassociaton. wordpress.com or come along to the Hut. ...........................................................

PRUDHOE COMMUNITY ALLOTMENT If you are interested in gardening, happy to help, share knowledge and learn new skills we would love to hear from you. The allotment is run by volunteers and can only thrive with their help.

We meet on Wednesday and Friday mornings between 10 and 12am and we are open for the 2019 season.

We usually finish the morning with a coffee and chat in the summerhouse.

We’ve already got lots of seedlings coming on and some overwintered crops looking good. You’re welcome to pop in and have a look round.

We will be holding our Hanging Basket and Container planting day on Saturday 1st June from 10am til 1.00pm on the allotment. We are combining this with our Plant Sale this year and we’ll be serving tea and coffee - that’s going to be a busy day! We hope you can come along.

Advance notice for your diary - our Open Day is on Wednesday 7th August.

Whether you can help us with tending the allotment beds or can help support less able members please come along to the allotment and join us. The allotment is sited on Redwell Court (off the junction between Redwell Road and Drawback).

Contact Ann Curran 844675 or email Jo Bentley - pca@jobentley.plus.com for further information. ...........................................................

PRUDHOE GROUND FORCE Meets every Wednesday morning 9 - 10am at various locations in Prudhoe to litter pick or do other environmental work.

Anyone wishing to join this group 01661 833895 for details of the day or email: j.dobson@ic24.net ...........................................................

PRUDHOE COMMUNITY CHOIR Welcomes new members. The choir meets on Wednesday evenings between 7.45pm and 9.45pm at Stocksfield Baptist Church. Contact Chairperson Joan Sulter Tel. 0191 4133442 or Catherine Edge (Secretary) Tel: 01661 835738. ...........................................................

TYNE VALLEY CANOE CLUB We meet every Friday throughout the year in either Tyne Riverside Country Park (April-September) @ 6.30 pm or Waterworld (October-March) @ 8.30 pm. All ages welcome. For more details contact John Dean (Tel. 01661 832575) ...........................................................

PRUDHOE PARISH CHURCH ST MARY MAGDALENE. We are a welcoming, family-friendly church in the heart of the community.

SUNDAY WORSHIP 10am Family Communion with Young Church (term time) followed by refreshments in the Church Hall.

8am Holy Communion (1st, 3rd& 5th Sundays) MIDWEEK SERVICES Tuesday 8.30am Morning Prayer Thursday 10am Holy Communion with refreshments at the Coffee Morning.

COFFEE MORNINGS 9-11.30am Thursdays&Saturdays in the Church Hall.

FOR KIDS (Term time only) Toddler Group Wednesday 1.30-3pm Fun and games in the Church Hall. FREE!

NEW HANDY MAN SERVICE!

for all your household job needs

SEE OUR ADVERT ON PAGE 4

See our main advert on page 7

Gallery and Gallery B&B News ies of Windows Watercolours, Featuring Village Windows

An Interview with Paul Stangroom Noli, Himalayas, Painted onto Handmade Khadi Paper Grove Rake Mine, left, is located between Allenheads and Rookhope, and began life as a lead mine. When the lead was finished, fluorspar was mined there, and was most likely used to temper steel at Consett. Grove Rake is one of the few remaining pit heads in the area - a reminder of l Watercolours our industrial history.

The original painting of ‘Pit Head, Grove Rake Mine’ is for l sale at Robinson Gay Gallery, Hexham, and I have printsPrints for sale on my website. I’m so fond of this scene thatl this Books painting features as a sign to my gallery.

Alison’s Gallery B&B is open for business abovel theCards gallery - the Indian Room and the Country Room, right, l Posters which share a private shower room. Visitors are welcome to enjoy the long garden behind the gallery on springl and summer evenings. Alison is offering cooked breakfasts Art – Classes full Northumbrian; fresh, continental or scrambled eggs and smoked salmon. Prudhoe has plenty of restaurants, cafes and pubs for guests to visit.

45, Front Street, Prudhoe, NE42 5DB. E: paulstangroom.fineart@gmail.com

T: 07968 990552 www.paulstangroom.co.uk

Grove Rake Mine

Gallery B&B E: alison190656@hotmail.co.uk

T: 07792 278139

ALL DOGS ARE WELCOME AT

DOGGY DAY CARE & BOARDING SERVICE!

We have 10 comfortable Kennels, with one extra large kennel for family dogs that need to be together.

We are located on a farm surrounded by fields and woodlands so the dogs will enjoy 3 good walks throughout the day on their short stay with us.

We will also supply food, water, bedding and toys to keep your dog happy!

ALSO AVAILABLE

COLLECTION /DROP OFF We can collect your dog and drop off.

(Please ask for details).

TAKING BOOKINGS NOW!

Middle Hedgefield Farm, Blaydon on Tyne, NE21 4NN (B6317 - Blaydon to Ryton) Open7 Days a Week

Telephone: OVERNIGHT 07960 236 905 STAYS AVAILABLE

Your first call for a clean sweep * No Mess * No Fuss * Insurance Recognised Certification

Please call Simon:

0191 268 3147 or 07595 622 020 w:www.premierchimneysweepingservices.co.uk e: premierchimneysweepingservices@gmail.com

Email: sarahestanton@googlemail.com www.fbook/doggiedaycareservices.com

Proud member of the Guild of Master Chimney Sweeps

www.tynevalleyexpress.co.uk

49

EMIW N SES PRE “I would like to welcome you to our new studio based in Prudhoe. We specialise in handcrafted, made to measure seating cushions of all shapes, fabrics and sizes. Previously located in Ryton our business had outgrown our previous premises. I saw this as a fantastic opportunity to relocate the business to a space where customers can come and discuss their needs in a comfortable environment.

We have a wide range of fabric options and there are samples available for you to take home should you wish to.

With years of experience working in domestic and commercial settings we are always on hand to advise on your next project.

We combine your ideas with our skills to create luxurious, durable, bespoke soft furnishings to suit your home and your lifestyle. “ Laura

outdoor cushions - indoor cushions - seat and bench pads - loose covers commercial and domestic seating

Holly’s Kitchen: 07551 959977 e: hello@hollyskitchen.co.uk www.hollyskitchen.co.uk Holly’s Kitchen, Edgewell Road, Prudhoe, NE42 6JH - Mon – Fri: 9am - 3pm (The premises may be closed if / when out on appointments)

BRIAN HEWISON INTERIOR DECORATOR

TIME SERVED - OVER 30 YEARS EXPERIENCE Wallpapering - Emulsion - Gloss - Coving.

Interiors only!

HOME: 01207 775518 MOBILE: 07854 597299 EMAIL: hewisonbrian@gmail.com l l l l

ECOLOGICAL CLEANING & GARDENING SERVICE W I T H I N A 10 M I L E R A D I U S O F C R A W C R O O K

GARDENING General g a rd e n i n g m a i n t e n a n c e a n d l a n d s c a p i n g.

CLEANING Domestic cleaning with p ro v i d e d e c o f r i e n d l y c l e a n i n g p ro d u c t s.

RELIABLE AND PRECISE LADY GARDENER/ CLEANER WITH MANY YEARS OF EXPERIENCE AND REFERENCES

l

FENCING PERGOLAS DECKING SHEDS GATES

l l l l l

FULLY TRELLIS INSURED PLANTERS RAISED BEDS GARDEN MAINTENANCE LANDSCAPING

FREE

QUOTES

Referreenqceuess t on

Call Ashley Proctor to discuss your project!

Tel: 01434 632 528 Email: ashfence@outlook.com Find us on facebook @ashfencing see our latest projects/feedback etc

PHONE: 0191 413 3979 - MOBILE: 07564 544 504

www.tynevalleyexpress.co.uk

51

PRUDHOE ARTVENTURERS TYNE VALLEY Art and craft classes, parties and events for babies, toddlers and children.

Wednesday PRUDHOE PARISH HALL ARTventurers Tyne Valley, art and craft classes, parties and events for babies, toddlers and children.

Wednesday 9:50am Baby ARTventurers (6-18 months) For more information please contact Justine, 07737108061 justine@ artventurers.co.uk ...........................................................

PRUDHOE TOWN COMMUNITY CENTRE has the following regular classes - Monday: 9:20 - 9:50 ABY Fitness Metafit 7-9 Yoga Tuesday: 9:20 - 9:50 A

BY Fitness Insanity Live 30 9:50 - 10:20 ABY Fitness Piyo Live 30 5:30 - 6:30 LJL Bounce Thursday: 9:20 - 9:50 ABY Fitness Metafit 9:50 - 10:20 ABY Fitness A&A Attack It has a bar and Kitchen, and is available for hire for any function such as Birthday party, wake, coffee mornings etc.

They have a facebook page and website, all bookings and enquiries go to Brian Batey: 07855771335 ...........................................................

PRUDHOE PLODDERS Prudhoe Plodders: Main Session and Juniors Mondays 18:00 - 19:00 and Fridays 18:30 – 19:30.

Couch to 5k Sundays 09:30 for information visit www. prudhoeplodders.co.uk or email prudhoeplodders@outlook.com Prudhoe Riverside park run: ages 4+, free, all abilities welcome to run, walk or jog 5km. Every Saturday at 09:00.

Prudhoe Riverside junior park run: ages 4-14, free, all abilities welcome to run, walk or jog 2km. Every Sunday at 09:00. ...........................................................

ANY FITNESS The Tory Club, West Road in Prudhoe Monday’s 6:30pm - Metafit (30 mins) 7pm - Insanity Abs & Core (30 mins) 7:30pm - Metafit (30 mins) Wednesday’s 6:30pm - Totally Shredded (60 mins) Thursday’s 6:30pm - Insanity Live 50 (50 mins) 7:30pm - PiYo Live 50 (50 mins) Saturday’s 10:15am - PiYo Live 50 (50 mins) Classes are suitable for all fitness levels and abilities and are child friendly too.

No need to book you can just turn up ...........................................................

PRUDHOE LIBRARY Story & Rhymetime Every Friday during term time, 10am - 10.30am. Listen to stories, sing rhymes and take part in craft activities. Come along and join the fun - no need to book, just turn up!

52

This session is aimed at children aged 0-4 years. ...........................................................

PRUDHOE SOCIAL CLUB. May Fabulous Solo Acts Every Weekend on Saturday Evening and Sunday Evenings, also Great Live Band The Fontain’s with DJ Derek Hodgson on 26th May Sunday Bank Holiday.

Steve Wraith & Newcastle Legends Presents an Evening with Lee Clarke, Tickets Available @ Prudhoe Town FC and Prudhoe Social Club. 1st June 2019 Doors open 7pm.

June Fabulous Solo Acts Every Weekend on Saturday Evening and Sunday Evenings, also Live Band Gotcha with DJ Derek Hodgson, Saturday 22nd June 2019.

BT SPORT Showing all Live games, Free Pool Table, Snooker Table 50p.

We have regular excellent Saturday/ Sunday evening entertainment to include bingo.

Bingo is on every Monday Wednesday & Friday evenings.

Fridays we have meat draw, last ticket no draw and key to the box.

We have sky sports - England / Newcastle matches 20pence off a pint..!

Room hire available for all parties, christenings weddings, funerals & children’s parties.

Snooker, Pool & Dart rooms.

Find us on Facebook. All events are advertised on Facebook and Useyourlocal.com ...........................................................

SPETCHELLS CONSERVATION INTEREST GROUP We need help to protect this beautiful and unique chalk grassland which is situated in the Tyne Riverside Country Park at Low Prudhoe.

Contained within this habitat are 14 species of butterflies and many unusual solitary bee populations.

Unfortunately the area has become threatened by an invasion of Cotoneaster shrubs which are shading the grassland and threatening to overwhelm native plants. More volunteers are needed to remove the invaders!

Please join us on the Spetchells for a few hours once a fortnight, usually over the weekend, when we carry out practical conservation work.For further details please contact Keith Shaw – 07890 808127 THE GATE CHURCH PRUDHOE (formerly Prudhoe Community Church) Swalwell Close off South Road, Prudhoe NE42 6EX You are welcome to join us for: SUNDAY WORSHIP 10.30am Celebration Service with Kids Church (4 – 10yrs) followed by refreshments

WEDNESDAYS 12.30pm Friendship Lunch Club (Donation £3.50) For all other activities see our website: thegatechurch.org.uk Office: 01661 598843 or Mobile: 07944 118314 ...........................................................

PRUDHOE SINGERS Prudhoe Singers meet at the Bowling Pavilion, Waterworld.

Tuesday’s 10am - 11.50am during term time.

Three part community choir material from pop, gospel, folk, jazz traditions. Learn by copying, but note reading is an advantage. Try it for £5. ...........................................................

BORDER REIVER ARCHERS Course 2: commencing early September 2019 for the winter indoor season.

Each Course comprises 3 x 3 hr sessions and is open to those aged 14 yrs+.

Price is £60.00 per person.

Numbers on each Course are limited and are accepted on a firstcome, first-served basis.

For further information and an Application Form, please apply to the Club Secretary, Email: borderreiverarchers@yahoo.com, as soon as possible. ..........................................................

TAI CHI/QI GONG FOR HEALTH Come and de-stress with the flowing movements of Tai Chi and Qi Gong at our friendly, relaxing classes.

Suitable for all ages and abilities.

Mondays - Prudhoe Parish Hall 1.15 - 2.45 Fridays - The Manors, Prudhoe 10.00 - 11.00 For further details contact Liz on 07949866481 ..........................................................

DRAGON TALE THEATRE GROUP new members wanted. Based in Prudhoe. For more details contact Stuart on 07525494980

MONDAY 27th MAY 2019

at BYWELL

The Iron Lady Ironing with the professional touch

Domestic Ironing service Spring Clean l Washing/dry cleaning l Clothing alterations l House cleaning Services l Pick up & Collection

of Prudhoe

l l

www.iron-lady.org

15 Dukes Court

Prudhoe Northumberland NE42 6DA

Office : 01661 831 749 Mobile : 07914 881 226

MACULAR SOCIETY - NEW MEET

Tynedale Macular Support Group meets on the first Wednesday of every month (excluding January and August), from 1-3pm, at Corbridge Parish Hall, St Helens Street, Corbridge, Northumberland. NE45 5BE.

Contact Isobel Johnson on: 01434 602 969

PRUDHOEAUTOCARE Your local garage you can trust!

Courtesy car now available

New Tyre

*

*Prices ba sed on Size 155/65 Tyre /13

• Exhausts • Suspension • Steering

BACK

d conditio ns apply

s

Air Conditio n g Rechargin e

£40

*

*Terms an

d conditio ns apply

from

LANE

FACTORY SHOP

d conditio ns apply

ent Plan

• Windows • Trade Parts Supply • Windscreens • Accident Management • Window Tinting • Payment Scheme

Call now for your: FREE 20 POINT SPRING CHECK

*

*Terms an

*Terms an

Your local garage you can trust!

• MOT’s • Diagnostics • Body Repairs

from

Interest Free Paym

We understand that your car is a major investment, so if you have any issues or concerns just pop in to see us, we are always available for a quick chat or for advice.

• Tyres • Servicing • Batteries

Service & MOT

0%

After running large garages for a number of years for other people Mark decided that he could offer the customers of Prudhoe and surrounding areas exactly the same as the large garages but on a ‘local’ scale - quality and honesty locally!

OUR SERVICES INCLUDE:

s

£35 £139

from

ONE STOP

SHOP FRON T STR Tel: 01661 830 839 EET E-mail: mark@prudhoeautocare.co.uk www.prudhoeautocare.co.uk The Old Co-op Buildings, Tyne View Terrace, Prudhoe NE42 5PX

BA Paving & Landscape Garden Services l All

Aspects Of Gardening trimming

l Hedge l Tree

Felling/pruning or topping removal l Artificial grass laid l Hedge/Stump

l Decking l Fencing l Gravelling

and free design cleaning driveways, paving and roofs

l Steam l Patio

laid or existing can be cleaned & resanded

l Ponds

and water features designed and installed

l Full

Garden Tidy Ups

l Block

paving and cobbled driveways and paths laid

l Re-sand,

re-seal and steam clean existing paving and patios l Stone houses or walls power cleaned to look like new For a free quotation or any other information contact:

01661 598 519 or 07955207178

www.tynevalleyexpress.co.uk

53

Welcome to Westwater and the monster trout of Hallington!

Westwater Fly Fishing Club operated by Westwater Angling has private bank and boat fishing on two superb 125 acre lakes at Hallington, approximately eight miles north of Corbridge in Northumberland. Regularly stocked with hard-fighting, fully-finned rainbow and brown trout, these waters offer the angler, novice or expert, something very different; something quieter, a haven away from the pressure, competitiveness and sometimes crowded atmosphere of pay-by-the-hour venues. Members may fish as often as they like and for as long as they like, restricted only by open season dates, opening hours & catch limits.

The Hallington fishery, managed by Westwater Angling for over 50 years, provides a very special environment; quiet, peaceful and tranquil, where fishing can be enjoyed as its very best in the heart of the most beautiful countryside in the UK. We have a fine fishing lodge with ladies and gents toilets, a well-equipped kitchen and a comfortable members lounge which overlooks the fishing lakes. The club can also provide professional coaching at a range of levels from beginner to advanced. The club also offers trial membership on a pro rata basis which includes a loan of a starter kit for those new to the sport.

NEW TO FLY FISHING, WHY NOT TRY THE WESTWATER EXPERIENCE?

The monster of Hallington!

New to fly fishing? No kit? No problem. New full members and trial members who do not already own the necessary equipment will be supplied with a starter kit of the basic essentials and free coaching sessions. A deposit of ÂŁ50 will be required which will be refunded if and when the kit is returned.

Why not try the Westwater experience? You may discover a style of fishing you thought no longer existed.

Contact us to arrange a visit: Office Manager Tel: 01434 681405

Day tickets A limited number of day tickets are available each day for fishing from the bank only. The price is ÂŁ45/day and must be pre-booked. An individual may fish by day ticket only twice in any one season.

Trial membership A two month trial membership is available, once only for any individual. If you subsequently become a member, you will be required to pay only pro rata for the remainder of the season.

Beautiful brown trout, weight 13lb plus, caught by member Stephen Henderson. This fish was safely returned to the water.

Boat fishing Boat use is free of charge to members.

Bank fishing With over 5 km of bank to explore it never feels crowded at Hallington

Catch and release With catch & release it is essential that the fish are released back into the water in the best possible condition

Tel: 01434 681405

Catch and keep Fish may be caught and kept up to a daily bag limt Season The season runs from the beginning of April to the end of October.

New Members Wanted HELP & DAYS FOR BEGINNERS

www.westwaterflyfishingclub.co.uk

The Bed and Chair Centre

l

l l l l

l

Largest selection of rise recliners in Northumberland Huge selection of quality beds Adjustable beds Divan beds Mattresses - traditional sprung or Memory foam Fire side chairs Excellent (matching sofas on request)

l l l

l

Pop in for a browse or contact the store and staff will be glad to help you.

customer service from your local independent retailer.

Bedroom furniture Stair lifts Free home demonstration appointments The very best after sales service available!

We look forward to seeing you soon!

Proud suppliers of quality craftsmanship at the best possible price!

If you can’t get to the shop, then staff will gladly come out to you for a no obligation home demonstration.

The Bed and Chair Centre 10 Front street Prudhoe, Northumberland, NE42 5HJ.

Telephone: 01661 836 566 www.thebedandchaircentre.co.uk

STOCKSFIELD STOCKSFIELD STRIDERS running club meet at the Cricket Club every Tuesday at 7.30pm and are always open to new members of all abilities. Thanks, David Reed ...........................................................

WHAT’S ON AT STOCKSFIELD COMMUNITY CENTRE (SiCA) Weekly MONDAY 6.30pm.-7.45pm - Low impact Aerobics/Body toning TUESDAY .

9.30am - 11.30am - Computer Club 10.30am - Noon - Carpet Bowls 10.00am - 2.00pm - Tuesday Club 4.00pm - 6.00pm - Feet First Dance Class (term time) 6.00pm - 7.00pm - Step Class - all levels 7.00pm - 9.00pm - Mah Jong WEDNESDAY 9.30am -11.30am - Parent & Toddlers (term time) 9.30am -11.30am - Digital Photography Club 2pm - 3pm - Italiano Facile! Easy Italian conversation 3pm - 4pm - Italiano Conversation & elementare 5.30pm and 7.30pm - Slimming World 6.00pm - 7.30pm - Yoga THURSDAY 1.30pm - 3.30pm - Mah Jong 6.45pm - 7.45pm - Pilates using Stability Balls 7.00pm - 9.00pm - Bridge 8.00pm - 10.00pm - Badminton FRIDAY 9.30am - 10.45am - Low impact aerobics for legs,bums and tums!

11.00am-12.30pm - Yoga SATURDAY 9.15am - 12.15pm - Feet First Dance Class (term time) 1pm - 5.00pm - Stocksfield Gaming Centre For further information please contact Beth at SCA on 01661 842346 or email admin@ stocksfieldca.org.uk SCA is located on Mount View Terrace, Stocksfield (near the Railway Station) ...........................................................

STOCKSFIELD COMMUNITY CENTRE in MAY & JUNE MAY Wed 1st - 7.30pm - Stocksfield WI Thurs 2nd - 1.45pm - Stocksfield South of Tyne Flower Club Fri 10th - 6.30pm - Junior Players Sat 11th - 6.30pm - Junior Players Mon 13th - 7.30pm - Parish Council Meeting Tues 14th - 7.30pm - SCA Board meeting Sat 18th - 10-4pm Tynedale Spinners & Weavers Tues 21st 7.30pm - Plants& Gardens Soc. Sat 25th - 10.30am - Plant Sale and coffee morning Sun26th - 4-7pm - StocksfieldTea We are a top

10%

Dance Fri 31st - 10am-1pm - MacMillan Coffee morning JUNE Mon 3rd - 7.30pm - Parish Council Meeting Wed 5th - 7.30pm Stocksfield WI - Sat 8th - 7.30pm Pierre Schryer in concert Tues 11th - 7.30pm - SCA Board meeting Wed 12th - 7.30pm - Hedley WI Sat 15th - 10-4pm - Tynedale Spinners & Weavers Sat 22nd - 10-1pm - Antonella cooks…

Sat 22nd - 12-6pm - Bywell Castle Food Fair Sun 30th - 4-7pm - Stocksfield Tea Dance For further information please contact Beth at SCA on 01661 842346 or email admin@ stocksfieldca.org.uk SCA is located on Mount View Terrace, Stocksfield (near the Railway Station) Stocksfield Community Association is a Registered Charity no.1139996 and is a Company Limited by Guarantee 7468137 Registered at Companies House. ...........................................................

STOCKSFIELD BAPTIST CHURCH SUNDAY MEETINGS – We are a warm, welcoming and informal church that meets every Sunday 10am 11.30am. All are welcome, wherever you are on your faith journey.

For more info see stocksfieldbaptistchurch.net.

STAY AND PLAY – Mums and tots meet every Tuesday during term time 10am – 11.30am LUNCHEON CLUB – Meets on the 2nd + 4th Thursday of the month at 11am for a mini service plus lunch from our talented volunteers, or alternatively 12pm for just lunch. For Everyone of all ages – see website.

RED BANANA YOUTH CLUB ( 7-13 yrs ) – Meets every Sunday night 7pm - 8.45pm.

Retired Men - Meet 1st + 3rd Thurs of the month 9.30am - 11.30am. ...........................................................

NATIONAL TRUST CHERRYBURN Birthplace of Thomas Bewick Volunteer opportunities to support visitor welcome, family activities, museum and print room. Whether you want to put years of skills and experience towards our cause or just want to try something brand new, we’ll have a role to suit you. Our team is full of inspiring people from all walks of life who get a real buzz from working and learning together. For more information contact the Volunteer Manager heather.cook@nationaltrust. org.uk or visit us at Cherryburn. ...........................................................

STOCKSFIELD TEA DANCE Last Sunday of each month (except August). 4pm - 7pm

DAVID MUERS & SON BATHROOMS AND KITCHENS

56

Stocksfield Community Centre, Mount View Terrace, Stocksfield, NE43 7HL ...........................................................

TYNEDAL BIPOLAR Support Group. We meet the third Saturday in the month between 11a.m. and 1p.m. at Hexham Community Centre, Gilesgate, Hexham, NE46 3NP. ...........................................................

SCOTTISH Country Dancing Club We meet in the Baptist Church Hall, Main Road, Stocksfield, on Tuesday evenings from 7.45 p.m. to 10.p.m. from February to December.

No partner needed, and beginners welcome. Contact Rosemary Newton, 01661-843163 for further information. ...........................................................

Saturday May 18th from 10-12 noon. IN AID OF CHRISTIAN AID WEEK, 12-19th May A United Coffee Morning with Bring and Buy stall, will be held in the Stocksfield Methodist Church Hall.

This fund raising event is in place of door to door collections for Christian Aid, so we hope to welcome many people from the village to join us. ...........................................................

COUNTY SHOW AT BYWELL, on Bank Holiday Monday May 27th.

Huge number of stalls, attractions, activities for adults and children. Look

out for posters, press advertising, and information on social media. Churches Together will be a presence there, welcoming people on the entrance gates, signposting you to all that the Show field has to offer, and we also hope to have a quiet place for you to have some ‘time out’ if you wish. ...........................................................

ADVANCE DATES FOR YOUR DIARIES Stocksfield Festival on Saturday 13th July Churches Together Holiday Club ....all to be held in the Prudhoe church halls this year. Dates are July 22-26. Look out for publicity and details about booking places for your children to enjoy this very popular, fun filled week. ...........................................................

STOCKSFIELD TENNIS CLUB Small friendly tennis club based at Guessburn always looking for new members. Ladies night Monday evenings, 7-9pm, Men’s night Thursdays 7-9pm, weekend social tennis on Saturday afternoons. We run separate junior sessions too.

There is also adult and junior coaching available.

Please see our website for contact details and further information http:// www.stocksfieldtennis.com/ Adult member enquiries Mel Bland 07813859412 Junior member enquiries Claire Collinson 07985015408 or Brian Mcveigh 07912351524

BT AERIALS Erected • Repaired Digital Tuning Call Billy on Mob: 07714 330 690 Available 24 hours l Contract work l Mini bus and cars available l Short and long haul l Airport transfers l

Clark’s 24 HOUR SERVICE CONTRACTS WELCOME

01661 830333 0191 4135111

www.clarkscabs.co.uk

EMERGENCY 24HR CALLOUTS 1st Hr £69 + V.A.T

See our main advert on page 7

ELECTRICAL SOLUTIONS FOR RESIDENTIAL, COMMERCIAL & INDUSTRIAL

RESIDENTIAL We offer a wide range of services for domestic properties. No matter how big or small, a member of the team will be happy to asisst.

Maintenance & Repairs Installation of new items l Landlord inspections l Rewiring l Alarm systems l Lighting l Consumer unit upgrades l Nest Smart thermostats

COMMERCIAL

We carry out a wide range of electrical installations, supplying quotes and project specifications in order to design and implement the most appropriate and cost-effective solutions to your electrical needs.

l l

Ask us about our Smart Wiring services

At 123 Electric we provide a wide range of electrical services, from domestic repairs and upgrades right through to commercial and industrial installations.

Our team of Napit qualified and highly experienced electricians provide a professional and reliable service every time. Based in Riding Mill and covering the whole of the Tyne Valley and beyond, we are committed to providing the best service and products with customer satisfaction being our number one priority. Offering free quotations and competitive rates... Give us a call today and a member of the team will be happy to help.

INDUSTRIAL

We offer a range of industrial electrical services. For more information please contact us. l Agricultural l Three phase fault finding l Industrial units l l

Three phase motors

Rewires

Tel: 01434 682 328 Mon-Fri: 08.00-17.00 Emergency Contact: 0747 456 4099

www.123electric.co.uk

OPEN HOUSE

Have you ever wanted to have a look around our house and

grounds? Now’s your chance! With exhibitions, tours and moments of reflection, Tea, coffee and good home cooking provided.

Monday 6 May 11am - 4pm

DAY OF PRAYER Minsteracres is an ideal venue for self-led groups, with overnight accommodation and catering for up to 80 people and a variety of meeting and prayer rooms and 110 acres of outdoor space.

Experience different ways of praying in a beautiful setting with time for quiet personal prayer. Lunch, tea and coffee are provided.

Wednesday 8 May 10am - 4pm - £20

OUR RELATIONSHIP WITH NATURE: A CHALLENGE TO CHRISTIANS - Mary Colwell

Examining how we can help our depleted earth restore its natural resources, challenging Christians to find joy and sustenance in promoting a better world for all.

Mary Colwell is an award winning writer, TV/radio producer on natural history and the environment.

Friday 10 (7pm) - Sunday 12 May (2pm) - £150

SACRED CALLIGRAPHY - Maureen Rimmer

The art of calligraphy and reflecting on scripture, a creative workshop built on the ancient art of illuminating manuscripts.

No experience required. Maureen is an experienced icon writer/artist with a great passion for bringing to light the Word of God in art.

Tuesday 21 (6.30pm) - Thursday 23 May (2pm) - £145

WALKING RETREAT - Minsteracres Team For further information and bookings visit:

www.minsteracres.org or call: 01434 673248 Email: info@minsteracres.org

Enjoy a walk of seven to ten miles through the beautiful countryside around Minsteracres, with time for prayer, reflection and sharing the beauty of creation. You will need to bring suitable walking boots, warm, weatherproof clothing and a packed lunch.

Wednesday 22 May 10am - 5pm - £10

www.tynevalleyexpress.co.uk

57

TAN DAWSO

S

TORAGE TIMBER, STEEL, S & RECLAMATION

N

n!

ta S to e m co en th n? la P Y. I. D. .

I WANT YOU.. ation m a cl e R & e g ra to S s, e li p p u S Building East in Northumberland & the Nor

th

RECLAMATION

Welcome to the world of Stan Dawson.

A world of reclamation to bring your projects and ideas to life.

Whether you want some pre cut raised beds for a strawberries or enough timber to build your own barn we have the stock and ideas.

We also have stone, steel and interesting reclamation on site too! l

l

l

l

l

Huge range of stock to view at our premises!

Massive timber yard for all your building projects!

Reclaimed woods like, Sleepers, telegraph poles – perfect for raised beds etc!

Our friendly and knowledgeable staff are here to help!

Delivery service available!

Stan Dawson Ltd - Building Materials & Containerised Storage

When yoaun hisavyeouar pmlanan! then... St

Through experience as a family business we have built up detailed market knowledge and offer prompt and efficient delivery services.

Stan Dawson Ltd also offer a price guarantee, so why not get in touch with us today?

We are here to help so give us a ring today!

We also offer self-storage units for short and long term hire or even to purchase.

TIMBER

OUR WOOD SHED

STORAGE

FOR HIRE OR SALE

Kirkley Head Office. Tel: 01661 860 413 Stan Dawson Ltd, Kirkley Sawmill, Ponteland, Northumberland, NE20 0BD.

www.standawsonltd.com Email: info@standawsontimberandsteel.co.uk Hours: Mon - Fri 8 am to 5 pm. Saturday - 8 am to 12 noon. Lunch - 12:00 - 12:30

STEEL

LINE

UP

RIDING MILL ST JAMES’ CHURCH All are welcome to join us at our worship services.

Sundays: 8.00 Holy Communion (BCP said) 10.00 Parish Eucharist Wednesdays: 9.30 Holy Communion for further information or visit us online stjameschurchridingmill. com ...........................................................

YOGA AT RIDING MILL PARISH HALL. Wed 7-8.30pm with Rose.

Call on 01914137653 email – Rose@yogawithRose.co.uk ...........................................................

RIDING MILL PARISH HALL REGULAR BOOKINGS Monday Brown bin collection 9am - 1pm Cafe @ The Foyer 1pm - 5pm Carpet bowls club 3pm – 4.45pm x2 Spanish lessons.

Adults 3.30pm and children 4pm 5pm – 7pm Karate club 7.15pm – 9.30pm Choral Society (Sep – Easter) Tuesday 2pm – 3pm Table Tennis 5pm – 9pm Tyne valley youth We are a top

10%

theatre Wednesday Bin collection 7pm - 8.30pm Yoga 7pm - 10pm Photographic society in supper room (2nd Wed monthly) Thursday 10am – 12pm Badminton club 2pm – 4pm Craft group in supper room (No class on 2nd Thursday) 7.30pm WI (1st Thursday monthly) Friday 9am - 1pm Cafe @ the Foyer( Barber bus last Friday of every month whilst cafe is open) 10.30am – 11.30am Linda’s exercise class 1pm – 5pm Bridge club For bookings and enquiries ring Pam – 01434 682 927 Email – pampryor@btinternet.com ...........................................................

RIDING MILL MILLENNIUM HALL REGULAR BOOKINGS Monday 7pm – 9.15pm Table tennis Tuesday 6pm – 7.30pm Club Scout ( 8 – 10 ½ year old)

DAVID MUERS & SON

Wednesday 9.30am – 1.30pm Pilates (beginner / intermediate/ advanced) 7pm – 9.30pm Art Club (1st & 3rd Wed in the month) Thursday 4.30pm – 6.45pm T yne valley youth theatre 7pm – 9pm Happy hounds dog training Friday 6pm – 7pm B eaver scouts ( 6-8 year olds)

7.30pm – 9pm Scouts ( 10 ½ - 14 year olds) Saturday 9.30am – 11.30am Nia Class Sunday St James’ church ( fair-trade coffee mornings held 1st, 2nd & 5th Sunday of every month) For bookings and enquiries ring Pam – 01434 682 927 Email – pampryor@btinternet.com

DMAC Heating and Gas Services

REGISTER

Also: SOILD FUEL HETAS CERT. ALL PLUMBING & BATHROOMS personal attention covering ALL areas.

Personally supervised by Mr D. Johnstone MR. D. Mackenzie

35 Bells Lonnen, Castlefields, Prudhoe, 5FR RYTON: 0191 413 2318 (24NE42 hours)

01661 830 551 Mobile: 950 1 Telelephone: Kepier Chare, Crawcrook, Ryton.

Tyne07947 & Wear,506 NE40 4TS

ADAPTED BATHROOMS Get it right 1st time with the experts!

BATHROOMS AND KITCHENS

See our main advert on page 7

CLEANING SERVICES Would you like an honest, professional, reliable and affordable cleaner to clean your house?

We are family running company with over 10 years of experience in cleaning. We started our journey in 2004.

For over 10 years we provide services to households across Tyne and Wear and Northumbland.

We pride ourselves on 100% clients satisfaction and over 90% clients recommendations.

In 2016 we expanded our service to Northumbland and successfully gaining clients in areas such as Hexham, Prudhoe, Wylam, Ovingham.

We offer discounts for people 80+

We offer: l l

£12,50 per hour

l l l l

Call us today to arrange a home visit at your convenience to discuss your requirements...

Agnes: 07851 143721 Polishmaidsuk@gmail.com

60

£5 OFF

cleaning when signed for 3 months

l l l l

Domestic cleaning Office cleaning One-off cleaning End of tenancy cleaning Spring clean Students accommodation Windows cleaning (interior) Emergency cleaning Ironing Shopping

Specialist day retreats for carers and people who have been bereaved Holistic therapies, arts and crafts, led by local artists and craftspeople

Ceramics Woodcarving Painting Reiki Nordic walking Yoga These retreats are fully funded for carers and people who have been bereaved

Relax

Recharge

Restore

www.uretreat.co.uk

To reserve your free place tel: 07541 637706 or email: uretreat1@gmail.com *These retreats are also open to anyone needing some ‘U time’ at £65.

Contact us for an early bird discount.

Roy Cave French Polisher Highly skilled French polishers with 30 years experience

Polishing, Staining, Painting, Spraying, Colour matching Repairs & restoration Domestic & work including: Dinning Furniture, Kitchen, Bedroom, Panelling etc.

Insurance work undertaken Opening Times: Mon - Thurs: 8.00am to 4.30pm Fri: 8.00am to 3.00pm Email: cavepolishers@aol.com www.roycave.co.uk Tel: 0191 4146216 Mobile: 07801 683133 Unit 21, Blaydon Business Park, Tundry Way Blaydon on Tyne, NE21 5SZ

www.tynevalleyexpress.co.uk

61

Conference for the Birds

by Marcus Coates - Cherryburn, 15 June - 3 November

Artist Marcus Coates has reimagined Thomas Bewick’s birthplace through a new sound and visual installation, featuring a group of human-sized birds gathered round the fire discussing their lives, knowledge and culture.

Conference for the Birds is part of the research project ‘Mapping Contemporary Art in the Heritage Experience’.

Find out more at https://research.ncl.ac.uk/mcahe/

Cherryburn, Station Bank, Mickley Square, Stocksfield, Northumberland, NE43 7DD www.nationaltrust.org.uk/cherryburn facebook.com/CherryburnNT @CherryburnNT For any enquiries please email: cherryburn@ nationaltrust.org.uk or call: 01661 843276

#nationaltrust

Blinds Ryton Based in the Tyne Valley for over 15 years Providing quality products at affordable prices

National trust is an independent charity – registration number 205846.

Free fitting and measuring service

All blinds supplied and fitted to child safety regulations.

Blinds for every room

We have blinds for every room and every budget.

We combine craftsmanship with superb design and all our products have a three year guarantee with free fitting.

Made-to-measure

We can provide made-to-measure and ready-made blinds in vertical, Roman, Venetian, roller and wooden designs. We also specialise in conservatory blinds.

A personal service

If you are unsure of the right blinds for your home or room, we can offer advice. View blind samples in your own home so you feel confident in your purchase.

Trust the experts

With more than 15 years in the business, we will provide you with a fully professional service from start to finish. All blinds are supplied and fitted to child-safety standards. Contact us to discuss your individual needs.

Perfect fit window blinds (no drilling) Free measuring and fitting service, please call to arrange a free home visit covering Newcastle-upon-Tyne, Northumberland and Gateshead.

Call now: 0191 413 6212 VERTICAL BLINDS

ROLLER BLINDS

Vist our website: www.blindsryton.co.uk ROMAN BLINDS

VENETIAN BLINDS

WOOD BLINDS

CONSERVATORY BLINDS

www.tynevalleyexpress.co.uk

63

CORBRIDGE CORBRIDGE PARISH HALL Weekly Monday 9.15am - 10.00am - Zumba class 11.00am - 1.00pm - Age UK Lunch Club 7.00pm - 10.00pm - Bridge Club Tuesday 9.30am - 10.15am - Zumba Class 10.15am - 10.30am - Tummy Toning 10.00am - 3.00pm - Art Class 2.00pm - 4.00pm & 7.00pm - 9.00pm Carpet Bowls Wednesday 9.30am - 10.15am - Yogalates 10.00am - 1.00pm - Lace Makers (fortnightly) 10.30am - 3.30pm - Art Class 1.00pm - 3.00pm - Tynedale Macular Society (First Wednesday Monthly) 3.45pm - 6.15pm - Corbridge School of Dance Ballet Class 7.00pm - 10.00pm - Bridge Club Thursday 10.00am - 12.00pm - Corbridge Community Choir 11.00am - 1.00pm - Age UK Lunch Club 6.00pm - 7.00pm - Pilates 7.00pm - 10.00pm - Tynedale Chess Club 7.30pm - 9.30pm - Badminton Friday 9.30am - 11.30am - Badminton 1.00pm - 2.00pm - Art Venturers - 5.00pm - 6.00pm - Karate Class

We are a top

10%

(Children) 6.00pm - 7.00pm - Karate Class (Adults) Saturday 7.30pm - 9.30pm - Tynedale Scottish Dancing Sunday 9.30am - 10.00am - C T Fitness (Body Attack) 7.00pm - Corbridge Film Nights (September – April) dates vary For further information please contact Mandy Senior on 01661 852277 or email corbridge@ukpc.net ................................................................

NORTHUMBERLAND WEDDING CRÈCHE Mobile crèche available for weddings, allowing parents the opportunity to relax and enjoy the wedding knowing their children are cared for. Contact:07955843665 northumberlandweddingcreche@ gmail.com - www. northumberlandwedding creche.co.uk ..............................................................

CORBRIDGE PRESCHOOL Good Quality, Affordable Childcare.

Corbridge preschool, Corbridge First School, St Helens Lane, Corbridge.

NE45 5JQ. Open weekdays 9-12, 123.15 or 9-3.15. Please contact Claire Milburn 07870761730; corbridge. preschool@googlemail.com www.corbridgepreschool.weebly.com

DAVID MUERS & SON Ltd BATHROOMS AND KITCHENS

ST ANDREWS CHURCH Services SUNDAYS - The Parish of St. Andrew’s Church Corbridge with Halton Services Morning Worship Every Sunday - 9.30am - Parish Communion 2nd and 4th Sunday - 8.00am- Holy Communion 2nd Sunday - 3.00pm - Messy Church 4th Sunday - 4.00pm - All Age Family Worship 1st Sunday - 9.15am - Holy Communion at Halton Evening Worship 1st Sunday - 6.00pm - Holy Communion with hymns 2nd and 4th Sunday - 6.00pm - Evening Prayer 3rd Sunday - 6.00pm - Choral Evensong For further information please look at our website www.corbridgechurch.org.uk Events Thursday 9th May - 7.30pm Historical Talk A talk ‘Corbridge’s two greatest 19th century Benefactors’. By David Waugh Wednesday 19th June to Sunday 23rd June Flower Festival The theme will be songs from the shows.

Opening times: Thursday 20th June - 9.30am – 9.00pm to link in with the village Midsummer

Late Night shopping event.

Friday 21st June - 9.30am – 5.00pm which will include from 12.30pm to 1.00pm Lunchtime Summer Music.

Saturday 22nd June - 9.30am - 5.00pm Sunday 23rd June - 9.30am - Festival Eucharist 4.00pm - All Age Worship with a Flower Festival theme ..............................................................

SCOTTISH DANCING At Parish Hall most Saturdays 7.30 p.m. Newcomers welcome. No partner needed. For details please phone Ros on 01434 604639. ..............................................................

CORBRIDGE LACE MAKERS: Corbridge Lacemakers: a friendly group welcoming lacemakers of all skill levels from complete beginners to experienced lacemakers. Tuition available in bobbin and needle lace, and craft laces such as tatting, crochet and filet. Corbridge Parish Hall, 10am - 1pm, on Wednesdays (roughly fortnightly) . Cost £50 for 7 classes (or £8 per session). For dates and more information, contact the tutor Gil Dye on 01661 824696 or gildye6@ gmail.com ..............................................................

TYNEDALE CHESS CLUB We meet every Thursday in the Corbridge Parish Hall from 7-10 pm [during Sep - Apr]. If you live in Hexham, then transport will be available on most club nights.

For details please contact Dave Humphreys, dwhump3@ahoo.co.uk; Tel 01434 694296

BATHROOMS

We are experts at both traditional and adapted bathroom installations!

See our main advert on page 7

COMMUNITY BUDDIES

Art Fair & Open Studios

Featuring Network Artists North East Saturday 18th & Sunday 19th May, 10am - 4pm

DAY CENTRE

We now offer a Day Centre for vulnerable adults in our Community, which offers a sociable and relaxing environment.

Our centre offers a range of activities such as:

Simple exercises - Bingo - Quizzes - Singing Arts and crafts - Baking ... and many more.

Our day centre also includes a hot meal, snacks and refreshments.

Our aim is to bring happiness back into peoples lives and to help develop new skills.

The individual can choose which activity they would like to get involved with, there is no pressure.

Our services are for up to 10 people per day.

Our day centre is situated in Mickley, Northumberland.

We are open Monday to Friday 10:00am- 15:30pm.

Paintings, Jewellery, Ceramics, Wood Carving, Original Prints, Textiles and more from resident and guest artists.

Home baked cakes and light lunches in The Hearth Café.

www.thehearth.co.uk Horsley, NE15 0NT - Registered charity 1106143

64

How to book: You must book in advance.

You can do so by ringing our office on: 01661 844456 or email us at: Info.communitybuddies@gmail.com.

For more information visit: www.facebook.com/communitybuddies/ www.instagam.com/communitybuddies/.

16/17 Dene Workshops Mickley, Northumberland NE437BJ Find us on Facebook, Instagram and Twitter

Designed with skill and a vision. Built to last more than a lifetime!

From a traditional design to a bespoke commission - we will... design, build and install your chosen interior or exterior project.

DESIGN

BUILD

Getting cheaper quality products and cutting corners on inferior build quality will always cost in the long run.

Here at Designs in Steel we produce the finest bespoke products in our own workshop based locally in Blaydon.

ALL OUR PRODUCTS ARE BUILT WITH THE FINEST MATERIALS AND QUALITY CRAFTSMANSHIP AT A COMPETITIVE PRICE.

l l l

Commercial work undertaken Free estimates Site visit Over 25 years of experience

l

l

l

Railings

INSTALL

We will make your exterior or interior ideas a reality.

l

Gates

Design / Build / Delivery and installation.

Disabled friendly designs available Based in Blaydon

“Gates fitted today and we’re very pleased indeed. Excellent people to deal with, everything went exactly as we were told and the finished job is top class.” - Ian Lauriston “Just had gates made and fitted by this company.... first class job carried out by very professional workers.... cannot recommend them highly enough.”

- Alison Edwards

Extensive range of beautifully hand crafted wrought iron / solid / timber filled gates. GATE AUTOMATION SPECIALISTS

Interior

Don’t just think outside the home -we do interiors too! Just like these interior railings and staircase

Timber Fill

By combining both steel frames with timber you get a Natural look with the strength and dependability of steel.

We have over 20 years designing and fitting railings. We can accommodate your height preferences in either a traditional or bespoke design.

Balconies/Steps

Giving your home a stylish and safe entrance or creating a safe area on any sized balcon.

Coatings

All our products are galvanised 1st.

We then can create any finish or colour to merge with the surroundings - like these stairs!

Designs in Steel, Unit 10, Tundry Way, Blaydon, Newcastle upon Tyne, NE21 5SJ Tel: 0191 4147760 info@designsinsteel.co.uk

www.designsinsteel.co.uk

FIND YOUR FREEDOM THIS YEAR!

OVER

25 YEARS

EXPERIENCE in...

Mobility Scooter & Powered Wheelchairs l Boot Hoists l Wheelchair Accessible Vehicles l Stairlifts l Walking Aids l Driving Assesments l Finance Available l

Chainbridge Road, Blaydon, NE21 5AB. Next to Morrisons Fuel Station

Contact us: 0191 414 0240 or vist: www.bewickmobility.co.uk

GILMORE ESTATES Property Sales, Lettings & Management

NEW

24/7 BOOKING SYSTEM

24/7 Booking system for valuatins, viewings and making an offer no need to wait, our office is open book your viewings and make your offers at a time to suit you from your tablet, smart phone or PC.

2 Bedroom Detached Bungalow Fully Refurbished & great location

LEADING THE WAY IN ESTATES AGENCY!

WOODSIDE RYTON £170,000

2 Bedroom Bungalow Garden & Garage

Kepier Chare, CRAWCROOK £175,000

6 bedrooms, 5 bathrooms, close to Derwent Reservoir

Large extended 4 Bedroom Detached Infinity Decking and BBQ House

4 Bedroom Detached Garden Room, Corner Plot

4 Bedroom Detached Extended Garden Room

Detached Bungalow, 3 Double Bedrooms, Excellent Location

2 Bedroom Stone Cottage Stunning Décor throughout

4 Bedroom Detached Extended Garden Room

PRUDHOE £315,000

PRUDHOE £225,000

PROPERTY MANAGEMENT FROM ONLY 5% + VAT

PRUDHOE £309.950

PRUDHOE £175,000

RENTAL PROPERTIES URGENTLY REQUIRED

FOR WAITING TENANTS

Call us now for a free no obligation valuation...

EDMUNBYERS £425,000

BLAYDON £245,000

PRUDHOE £119,950

Are you a landlord currently using the service of another agent? Move your management service to our dedicated team and we will manage your property with 2 months free. Are you a landlord who still wants be hands on but would like someone to take care of the legislation for you. We now offer a ½ management service call now to discuss your requirements and what we can do to help you.

Tel: 0191 814 7474 3A Front Street, Prudhoe, Northumberland, NE42 5HJ,

www.gilmoreestates.com

HEXHAM HEXHAM BEACON CLUB FOR RETIRED MEN meets weekly at 10.30 am - 12 noon on Wednesday mornings throughout the year at Trinity Methodist Church Hall, Beaumont Street, Hexham and is open to all retired men in the district.

There is no subscription, only a small charge for coffee.

New members are always welcome.

Visit our website for more details www.hexhambeaconclub.com ...........................................................

HEADWAY TYNEDALE The Tynedale Centre, Unit 13, Haugh Lane Industrial Estate, Hexham, NE46 3PU Every Wednesday 11am – 1pm Headway Tynedale is a regional branch of the National Headway UK charity, who provide support and information to individuals with an acquired brain injury and their family/ carers. Headway Tynedale is a peer group for those individuals and their family/ carers to access information, support and socialise with individuals who have also suffered acquired brain injuries.

The group often go on outings around the local area and get involved with other local Headway groups. The group are very friendly and are welcoming of new members. For further information contact: David Haxon, Group Chair on (0191) 232 0234 or dhaxon@ momentumskills.org ...........................................................

CREATIVE WRITING CLASSES Suitable for beginners and experienced writers alike, these popular and successful classes will inspire and encourage you to write poetry, fiction or memoir, and to share and develop your writing through stimulating workshop sessions in a friendly and supportive group. Classes take place in Hexham on Tuesday evenings or Wednesday/ Thursday afternoons. For more information, or to arrange a FREE taster session, please phone Claire on 01434 605276 or email Claire@ claire276.plus.com ...........................................................

TYNEDALE BRIDGE CLUB Tynedale Bridge Club - (formerly known as Hexham Ladies Bridge Club) We meet at Tynedale Cricket Club, Eilansgate, Hexham, NE46 3EW on Wednesday afternoons at 1:15 pm to 4:15 pm, with a tea and biscuit break. We play Duplicate, Rubber and Chicago Bridge. If you enjoy a ‘gentle’ game of bridge do come and join us - you will be sure of a warm welcome. Both Men and Women now welcome. For further information please call Margaret White on 01434 673199 ...........................................................

THE NT TYNE VALLEY ASSOCIATION is a local supporter group We are a top

10%

for NT English and Scottish members. We meet monthly in the Hexham Abbey Great Hall for Talks and Sociai activities.

During the summer months we organise Day and Holiday trips. Details of our program and events can be viewed on www.northumberlandlife.org/ tynevalleynt or obtained by contacting the Secretary Christine Seal 01434 608733 ...........................................................

HEXHAM - MESSY CHURCH First Saturday of every month (except August) 11am to 1pm at Hexham Community Church, Beaumont Street, Hexham. Lunch included. No charge! For further details contact the church office on 01434 601113 ...........................................................

HEXHAM CADETS We are open for boys and girls 12 to 18yrs who want to join. We do fieldcraft, shooting on our range, drill, first aid and the Duke of Edinburgh scheme amongst many other activities. We meet Mondays and Thursdays 7pm to 9pm at the TA centre, Hencotes, Hexham. For information call second lieutenant Sean Ferguson on 07977 410385 ...........................................................

HEXHAM MALE VOICE CHOIR For all ages. We do six - eight concerts a year in churches & venues for fund raising & the joy of singing. We rehearse every Thursday evening 7-9pm, West End Methodist Church Hexham.

Any new members would be most welcome. Contact: John Rose Email: hexhammalevoice@gmail. com Phone: 01434 607661 ...........................................................

HEXHAM BRIDGE CLUB meets on Thursday evenings at Wentworth Leisure Centre at 7.00 p.m. Friendly, competitive duplicate bridge - new members and visitors always welcome. Separate tuition for beginners/improvers available Contact the secretary- Jocelyn Gordon on (01434) 604610. ...........................................................

TYNE VALLEY CANOE CLUB We meet every Friday throughout the year in either Tyne Riverside Country Park (April-September) @ 6.30 pm or Waterworld (OctoberMarch) @ 8.00 pm. All ages welcome. For more details contact Keith Park tel. 07846711984 ...........................................................

FACTORY DANCE ACADEMY Every Tues and Thurs at the Community Centre, Hexham from 4pm to 6pm. Urban street dance classes for 4 to 14 year olds in Hip Hop, Pop Grooves, Street Dance, Zumbatonic and Hip Hop Totz. Cost £2.50. Every Tues at the Torch Centre, Hexham from 7.15pm. Bokwa and zumba classes

DAVID MUERS & SON Ltd BATHROOMS AND KITCHENS

68

for adults from 7.15pm. See www. factorydanceacademy.co.uk or call 01670 363 037 for details. ...........................................................

HEXHAM AND DISTRICT PHOTOGRAPHIC SOCIETY We meet on Tuesday evenings at 7-30 pm in the Torch Centre, Corbridge Road, Hexham. We meet every week from the beginning of September through to the end of April. We welcome all abilities from very raw beginners to advanced photographers. We have a very varied programme throughout our season to suit all levels of photography.

Anyone interested in coming along will be made very welcome and they can turn up at the club, contact our webmaster via our website www. hexhamphotographic.org.uk. ...........................................................

THE ROTARY CLUB OF HEXHAM We are a friendly Club who meet for fun and fellowship while helping other Charities. We are open to Men and Women of all ages. Meetings are 12.30 for 12.45 for lunch each Monday at the Beaumont Hotel, Beaumont Street, Hexham, except for the second Monday of each month, which is at the Beaumont at 18:30, and the last Monday of each month, which is an evening meeting at the Priors Hall, Hexham Abbey, at 19:00 for 19:30. More information is at www.hexhamrotary.co.uk If you would like to visit then check first with John on 01434 609802 or Brian on 01434 673413” ...........................................................

TYNEDALE U3A We are part of a national organisation comprising self help groups (including all aspects of art, walking, literature, botany, languages, history, etc) for the retired and semi retired, who come together to share our skills, experience, and knowledge. We also meet on the first Tuesday of every month at 2pm in the The Great Hall, Hexham Abbeyl, Beaumont Street, Hexham. when we have a variety of speakers.

If you are interested please see our website http://u3asites.org.uk/ tynedale/home. Contact details Barbara Herring tel no 01434673016 ...........................................................

HEXHAM BRASS BAND We are a group of brass musicians who have recently formed a new brass band in Hexham. We practise in the West End Methodist church in Hexham on Tuesday evenings from 7.15pm. Anyone who plays a brass instrument (or even percussion) would be welcome to come along to join us. Visit our website: www. hexhambrass.co.uk ...........................................................

MUSIC AND MOVEMENT CLASSES

For pre-school children. Join us for 40 minute sessions with live piano every Friday morning in Trinity Methodist Church hall, Beaumont St, Hexham.

Classes at 9.30 am or 10.30 am. Please contact Sheelagh on Tel No 01434 601017 or email - musicmove79@ gmail.com. Visit www.musicmovement. weebly.com to book your place. 1st Session is free! ...........................................................

HEXHAM YOUTH INITIATIVE Provides projects and opportunities for local young people. Based at Hexham Community Centre. Contact Keda Norma 01434 607350 .............................................................

QUEEN ELIZABETH HIGH SCHOOL – YOUTH THEATRE Meets all year round on Wednesday 4:30 – 6:30pm and is open to all young people aged 13 – 21. Contact Emily Macdonald 01434 610365 .............................................................

HIRE OF QUEEN ELIZABETH HIGH SCHOOL Premises Facilities including meeting rooms, concerts, ceilidhs, charity fundraising, indoor and outdoor sports facilities are available to hire during the evening and at weekends. Contact Debbie Graham 01434 610341 ...........................................................

QEHS COMMUNITY & LEISURE PROGRAMME Contact Debbie Graham 01434 610341 .............................................................

QUEEN ELIZABETH HIGH SCHOOL WINTER GARDENS AND HYDRO HALL Both rooms are licensed for weddings. These facilities make a stunning and unique venue for wedding ceremonies and or receptions and private parties.

Debbie Graham 01434 610341 ...........................................................

JIVE ALIVE Tyndale’s Modern Jive Group - Wednesday 8.00pm Torch Centre, Corbridge Road, Hexham, NE46 1QS. Join an enthusiastic and friendly group of dancers. No need for a partner, all abilities welcome, expert tuition offered. For more information contact Sheelagh 07712108685 ...........................................................

TYNEDALE ARCHERS We meet in Hexham and all details are on our website www.tynedalearchers. co.uk or call John Hope on 07887364433 ...........................................................

INNER WHEEL group Inner Wheel is one of the biggest international women’s voluntary service organisations in the world and the Inner Wheel Club of Hexham & Tynedale has been in existence for over 75years in Hexham and is still going strong.

We meet every month at the Boatside Inn at Warden but and are very active in fund-raising for local, national and international charities.

Our aims are threefold – to promote true friendship; to encourage the ideals of personal service; to foster international understanding.

Further information from jmproud@ btinternet.com

BESPOKE KITCHENS

Get a space to fit your space and ideas We can colour match doors too!

See our main advert on page 7

Hexham Community Partnership presents

HEXHAM HIDDEN GARDENS £

The new centre for authentic Classical Pilates Instruction is opening in Hexham Classical Pilates Classes commence on Friday 17th May and Saturday 18th May, both at 10 am and weekly thereafter Studio sessions available. Telephone for more information.

Classes can be booked at:

www.precisionfitness.org.uk £12.50 per class or £100 for 10. Class sizes are limited so booking is essential.

Telephone: 01434 601981 or 07855 404411 West Greenridge, Hexham, NE46 2NX

NEW PILATES STUDIO IN HEXHAM

www.tynevalleyexpress.co.uk

69

To find out more visit

www.jpwestall.co.uk or call 01434 602 740

Hexham Juniors FC a club with a big heart

OPEN DAY at Dukeshouse on 6 July - All Welcome.

It was 1958 when Hexham’s first football club, the Hexham Hearts, faded into history after its FA Cup glory days in the post-war period, but that doesn’t mean the town no longer has a club with a heart.

The passion shown by everyone at Hexham Juniors FC is testament to that.

Founded in 2002 when the two junior sides in the town merged, today Hexham Juniors is a busy club with big ambitions. It has some 260 players across 18 teams (21 next season) from Junior Development/U6s right through to U18s participating in the Tyne Valley Soccer and Pinpoint Saturday and Sunday leagues, and several cup and trophy competitions. Hexham proudly sports green and white hoops in homage to its predecessor and hosts numerous matches every weekend at its Dukeshouse ground.

It has enjoyed some outstanding achievements such as the U14 Girls being crowned Pin Point league winners and receiving the Respect Trophy in 2018, U7 Santos Boys winning the U8s Abbey Division Knockout Trophy this year, and the U18 Boys recently lifting the West Division Cup in their last season in junior football. As this article hits the press, several teams are set to contest other West Division Cup finals including both U15 Boys teams competing against each other in an all-Hexham final.

While cups and medals are fantastic, a grassroots club’s success is not just about the size of its trophy cabinet; what is more satisfying for everyone at the club is how much it has grown. There has been a 50% increase in players in just six years and the sheer number of youngsters it has attracted is especially impressive for a club in a rural area such as West Northumberland. Indeed, it has as many players as some city clubs in Newcastle with access to far larger pools of children.

So, what lies behind Hexham’s success? “We want kids to have fun: that’s why they’re here. But we believe kids will have more fun by focusing on the principles of responsibility, pride, development and teamwork. This is echoed in the club’s philosophy,” says club chairman, Patrick McAlindon, who took over the role last year and is excited about the future. McAlindon reveals that the plan over the next three years is to develop the experience of being a Hexham Juniors FC member for all kids and parents to a level where everyone feels at home. It has just agreed a deal with a new kit supplier, regularly hold coach development sessions and planning meetings, is building stronger links with Northumberland County Council and is in the process of becoming a charitable incorporated organisation.

The club also boasts FA Charter Standard accreditation: a clear demonstration that it is well-organised, safe and offers opportunities for all. Players are often commended for their excellent conduct on and off the field and all 28 coaches have obtained or are working towards their Level 1 qualification while some are already Level 2 and UEFA B coaches, in line with the club’s philosophy of improving coaching standards from within.

Nevertheless, it has set its sights even higher and is actively working with other stakeholders to develop state-of-the-art sports installations in Hexham. “It is hoped that the town will boast some

New players, volunteers and spo

nsors wanted.

of the best all-weather facilities in the region”, says Hexham’s chairman. “They have been desperately needed in Tynedale for a long time and will mean our kids can play on top-notch pitches whatever the weather. This will definitely help us reach our ultimate goal of developing an elite level footballer in the future,” he adds.

“Hexham Juniors is a fantastic club and I look forward to working together with them to help to sustain and develop their future,” says Cath Homer, county councillor for Hexham East and cabinet member for culture, arts, leisure and tourism at Northumberland County Council.

The club’s committee is also striving to bring in new volunteers and players in light of the exciting times ahead. These efforts have already borne fruit, with three new teams being established and three new coaches joining the club recently. But there is still much to be done, and as part of its recruitment drive the club will be hosting an Open Day at Dukeshouse on 6 July when anyone can come along and find out what the club has to offer.

Hexham Juniors FC also recently opened as an SSE Wildcats centre to provide football opportunities for girls aged 5-11. Wildcats sessions will run 10-11am every Sunday until 11 August offering a safe environment where girls can have fun engaging with a new sport, make new friends and develop fundamental skills. “As the women’s professional game grows, we are seeing more girls joining the club,” says Joe Speed, SSE Wildcats coordinator. “Wildcats will open the door to the youngest girls who currently don’t have an opportunity to play football.”

In short, the club’s contribution to the local community and wellbeing of local kids is something all its members are proud of and want to further develop. However, they need more support.

“The club wouldn’t exist without the dedication of our volunteers, but more hands make light work and we could definitely do with more help, particularly given the waiting lists we have for some of our teams,” explains club secretary, Gwyneth Scott. “We’ve been privileged to have some great sponsors too but as we grow, we must raise more funds for equipment, coaches’ training and the club’s overheads. We are generating revenue by renting out space to local groups at our well-equipped clubhouse and through fundraising, but bringing new sponsors on board is a priority right now.”

Parents standing on the side lines at Dukeshouse every weekend would certainly agree as they watch their sons and daughters playing their hearts out. As the final whistle blows, it’s off to the clubhouse for a brew and a chat about what’s next for their club.

One thing’s for sure, Hexham Juniors has as bright a future as all the youngsters it is helping to develop both on and off the pitch.

For further information or to offer support as a volunteer or sponsor, please contact the club secretary:

Gwyneth Scott (07787106092 or gwynethscott@outlook.com)

HEXHAM HADRIAN’S WALL ROTARY CLUB Hadrian’s Wall Rotary meets on two Thursdays each month. On the first Thursday we hold our Business meeting at the RAFA Club, Market Street, Hexham, 7.30pm for 7.45pm and we have a social evening on the third Thursday - eg dinner, bowling, quoits, geocaching. We support mainly local charities through our fund-raising events each year. We are a small group of enthusiastic, innovative and flexible Rotarians, very much young at heart and definitely put the fun into fundraising. For further information please contact Secretary Guy Galpin : guy. galpin@uwclub.net .............................................................

ELVASTON BOWLING CLUB (ELVASTON ROAD) Bowls is a game for all ages. Beginners are especially welcome. For more information phone Jean on 01434 604654, or visit www.elvastonbowls. co.uk. .............................................................

HEXHAMSHIRE W.I. Whitley Chapel Hall. 1st Wed in month. Always have a speaker, night’s out/BBQ’s etc. Thoroughly good time.

For further details, contact: Joyce 01434 602496 .............................................................

TYNEDALE TENNIS CLUB Come along and play tennis at Prior’s Flat, Eilansgate in Hexham (shared entrance with Tynedale Cricket Club).

We meet for casual tennis play on Tuesday evenings from 6pm and on Saturday afternoons from 2pm.

Feel free to come along and play as a guest (all standards, including complete beginners) are welcome.

For more information call George Miller on 01434 606300 or see our www.tynedaletennisclub.co.uk .............................................................

WARDEN IN HEXHAM WI St Mary’s church hall on the 2nd Wednesday of every month. Always a guest speaker and home made supper.

All non members always welcome.

For more information contact Fiona 07540884421 .............................................................

HEXHAM AND DISTRICT FLOWER CLUB Meets on the second Monday of the month at the Torch Centre, Corbridge Road, Hexham at 2pm.

The club has varied programmes during the year, e.g. visits to gardens, workshops and demonstrations by qualified flower arrangers, so if you wish to get involved, in a friendly environment, to further a love of plants and flowers, please contact Carol on 01434 602431 .............................................................

SCOTTISH COUNTRY DANCING Tuesday 5.15 to 7 p.m. Children Age 6 upwards at the West End Methodist Church Hall Wednesday 7.30 to 9.30 p.m. Adults - Lockhart Room, Moothall For further details contact Carol on 01434 602431 .............................................................

TYNEDALE LIONS CLUB Meetings every second and fourth Monday evening 7.45pm at the County Hotel, Hexham. We are

72

ordinary people doing much to serve the local community and organizing a range of social and fundraising events.

We would love you to join us by contacting tynedalelionsclub@gmail. co.uk or see further details on our website www.tynedalelionsclub.org HEXHAM ART CLUB We meet fortnightly on a Tuesday afternoon 1.00pm to 4.00 pm in the Hexham Community Centre Gilesgate, Hexham NE46 3NP Our meetings are mostly practical sessions led by local professional artists and by club member.

The club provides a friendly atmosphere where ‘absolute beginners’ are as much at home as more established artists. We have an open membership policy; to people who say I can’t paint, we say, yes you can! - If you would like to learn more contact Gillian Silsbury 01434 634744 or email gillian.silsbury@ gmail.com .............................................................

TYNEDALE COMMUNITY CHOIR Monday evenings 8.00-9.30, St Aidan’s Church, Hencotes, Hexham.

Sing, relax and unwind with folk songs, rounds, gospel, contemporary songs led by musical director Kat Davidson. Suitable for beginners and experienced singers. contact: Diana Greenwood 01434 602385 .............................................................

HEXHAM HOUSE BOWLING CLUB Set in the beautiful grounds below Hexham Abbey and behind Hexham House.

The Club is open to all ages and gender this is an outdoor sport the season running from Early April till Mid September and is open most afternoons from 1.30pm for more information call Brenda Carr on 01434 606693 .............................................................

MORRIS DANCING CLASSES. Morris dancing for both men and women. Women meet every Monday @ Corbridge Middle School ( Term time only) 8pm-9.30pm Men meet every Thursday @ Acomb Village Hall ( Sep – May) from 7.30pm.

Come and join our friendly groups For more information call Valerie on 01434 684705 or visit www. hexhammorris.com .............................................................

MACULAR SOCIETY Meets 11am last Thursday in the month at the Therapy Centre, opposite Hexham Hospital. Please ring Jeanne on 01661 833 988 for more details. .............................................................

ST MARYS CHURCH HALL ARTventurers Tyne Valley, art and craft classes, parties and events for babies, toddlers and children.

Monday - 9:50am Baby ARTventurers (6-18 months) 11:30am Little ARTventurers (18 months - preschool) For more information please contact Justine, 07737108061 justine@ artventurers.co.uk .............................................................

HEXHAM PROBUS CLUB

Provides regular gatherings for retired or semi-retired professional or business men aged over 55. We meet most months at the Tynedale Mart for a talk preceded by lunch. New members from the Tynedale area are always welcome. Contact the Hon. Secretary on 01434 603131 or email: home@highfield02.plus.com .............................................................

ROTARY CLUB OF TYNEDALE The Rotary Club of Tynedale serves the whole of the Tynedale area.

We support a number of local charities as well as Rotary’s international activities using our collective business and professional expertise to both identify and facilitate these various projects.

We meet at the County Hotel, Hexham every Wednesday for a convivial lunch and occasionally we run social events for our members throughout the year.

We are an active fund-raising club and are always keen to welcome potential new members.

For further information, please contact the Rotary Club on tynedalerotary@hotmail.co.uk alternatively; please visit our website or Facebook page, both at Tynedale rotary. .............................................................

MUSIC AND MOVEMENT for pre-school children aged 1-4 years. Meet at Trinity Methodist Church Hall on Friday mornings during school term times. Sessions start at 9.30 and 10.30a.m. Fun and educational.Free taster session.

Contact Sheelagh 01434 601017, e-mail musicmove79@gmail.com www.musicmovement@weebly.com .............................................................

CHRYSALIS AT TYNEDALE Chrysalis at Tynedale is a club for people with dementia, their families and friends, it is based at the Torch Centre in Hexham. Activities run every Monday and Wednesday afternoon from 2 til 4 p.m. Tutors facilitate these sessions, supported by volunteers, in a friendly, relaxed and supportive setting. Please let us know if you are interested in attending so we can ensure to give you a warm welcome. Contact:chrysalis.tynedale@gmail.com Or 07760124539. .............................................................

ARTventurers Tyne Valley Art and craft classes, parties and events for babies, toddlers and children.

Monday at Masonic Hall Hexham 11:00am Baby ARTventurers (6-18 months) 1:00pm Little ARTventurers (18 months - preschool) For more information please contact Justine, 07737108061 justine@artventurers. co.uk .............................................................

ACTIVE NORTHUMBERLAND HEALTH WALKS All walks are FREE, if you wish to join just turn up a few minutes before the walk starts and make yourself known to the leader (the one with the register!) The walks are graded for difficulty but are aimed at people with health conditions so are

suitable for almost anyone. Sensible footwear and clothing are advised if the weather conditions on the day.

Some small change may be needed as some groups go for coffee after the walk - this is NOT compulsory! Walks are between one and one and a half hours long, some are home walks and others are with shared cars - you DO NOT need a car to take part. More details on the leaflets and from the coordinator.

Times and venues of walks are as follows: Allendale - every Thursday 10am outside the co-op Bellingham - every Wednesday 10.30am outside The Rose and Crown Corbridge - every Wednesday 10am at Coigns Corner by Angel Inn Haltwhistle - every Tuesday 11.30am outside Sainsburys Hexham - every Monday(except Bank Holiodays) 10am inside Wentworth Leisure Centre Prudhoe - every Thursday 10.30am outside cafe at Tyne Riverside Park Stocksfield - every Monday (except Bank Holidays) 10am at train station Wark - every Tuesday 10am (10.30am on away days) outside post office. Contact Lorraine on 01670 622368 for more information .............................................................

TYNEDALE BIPOLAR SUPPORT GROUP - The Group offers support and information in a friendly, safe and confidential setting for anyone affected by bipolar, including family members, partners, friends, in Tynedale and surrounding areas. We meet the third Saturday in the month between 11a.m. and 1p.m. at Hexham Community Centre, Gilesgate, Hexham, NE46 3NP. Just come along, all are welcome. .............................................................

TYNEDALE CHESS CLUB We meet every Thursday in the Corbridge Parish Hall from 7-10 pm [ during Sep - Apr]. If you live in Hexham, then transport will be available on most club nights.

For details please contact Dave Humphreys:- dwhump3@ahoo.co.uk; Tel 01434 694296 .............................................................

HEXHAM LIBRARY Story &Rhymetime every Monday during term time, 9.45am - 10.15am.

Listen to stories and take part in craft activities. Come along and join the fun - no need to book, just turn up!

This session is aimed at pre-schoolers.

Silence in the Library. Come along and spend time in our new, uniquely designed, quiet space at Hexham Library. From 1 May to 1 June, the listening pod will be available to listen to audio books, read a story to your child or just retreat with a book.

Preschool children will be delighted to snuggle up and listen to classic storybook titles such as The Gruffalo.

Older children will enjoy listening to a range of titles and some by our fantastic local authors David Almond and Chloe Daykin. We haven’t forgotten the adults. Whether you like a novel by local author Ann Cleeves or prefer to relax with a

selection of poems, there is something for everyone in the Northumberland Libraries Listening Space. The new Listening Space is accessible to all and can be pre-booked for groups by contacting 01670 620450.

Free IT Help! Want to get online or need some help to improve your IT skills? Learn My Way Computer courses are available at Hexham Library. Visit the drop in IT session held every Wednesday 2pm - 3pm or telephone 01670 620450 for further details.

Interested in researching your family history? Need some help with your research? Pop into Hexham Library and book a 30min to an hour slot and access Ancestry and Find My Past for free. Telephone library staff to book a slot on 01670 620450 during May and June.

A Knit and Natter group meets every Thursday from 2pm - 4pm at Hexham Library. New members always welcome. hexham.library@northumberland. gov.uk. .............................................................

MARY’S HEALTHY WEIGH We meet every Tuesday morning and evening from 9.30am – 12 noon and 6 – 8pm at the Conservative Club, 6 Beaumont Street, Hexham, NE46 3LZ, for sensible advice on diet control.

Everyone welcome, friendly group support and guidance for all weighty matters! No commitment to regular

attendance. Contact Mary Reed on 01434 673489 .............................................................

HEXHAM BRIDGE CLUB meets on Thursday evenings at Wentworth Leisure Centre at 7.00 pm.

Friendly, competitive duplicate bridge.

New members and visitors always welcome.

Bridge tuition for Beginners and Improvers available. New term commences September.

Contact the secretary - Jocelyn Gordon (01434) 604610 or visit www.bridgewebs.com/hexham for information. .............................................................

TYNEDALE FAMILY HISTORY BRANCH We are part of the Northumberland & Durham Family History Society.

We are a small friendly group who meet on the second Thursday of the month (except August) at 7pm at the Community Centre, Gilesgate, Hexham for talks or discussions on family history related topics. Phone 01434 606897 or email tynedalebranch@ ndfhs.org.uk or just come along. ..............................................................

WHIST DRIVE Community Centre Hexham Tuesday evening 7 00 pm entry is £2 plus a small prize currently a small group but would welcome new players of any ability.Enquiries to Jean Thirlwell Hexham 01434600974

NORTHUMBERLAND CANCER SUPPORT GROUP MAY/JUNE EVENTS Tuesday May 7th 2019

Guest speaker - Professor Deborah McGarrity “Advocacy for Long Term Conditions”

Tuesday June 4th 2019

Guest speaker - David Belcher “Cancer - What’s it all about” Meetings above start at 6.30pm 2nd Floor, Education Centre, Hexham General Hospital

Tuesday May 14th

A.G.M 1.30pm for 2pm start

Tuesday May 28th

Social afternoon of activities

Tuesday June 25th

Social afternoon of activities: including making Brigid’s Crosses Meetings above for Social afternoons start at 1pm onwards Trinity Methodist Church Hall, Community Room, Beaumont Street, Hexham.

All Welcome!

Please call: 07598 620599

For more details about our group and events visit our website:

www.northumberlandcancersupportgroup.co.uk

www.tynevalleyexpress.co.uk

73

There is no Planet B

According to a recent survey, the UK’s top fantasy neighbour is Sir David Attenborough. If he did live next door, you’d probably find yourself often discussing the environment. Just the other week he presented a BBC documentary on ‘Climate Change – The Facts’, with dire warnings about the disastrous effects we face unless we take drastic action to reduce the production of carbon dioxide, methane and other greenhouse gases. In this he joins the almost unanimous opinion of expert climate scientists worldwide. Attenborough’s popularity, even when saying uncomfortable and unpalatable things, can be seen from the flood of protests when he was criticised on TV by Richard Madeley after the documentary.

The topic is certainly in the news currently, with the Extinction Rebellion protests on the streets of London and elsewhere, and their earlier highprofile disruption of a Brexit debate in Parliament. The School Strike 4 Climate movement started by Swedish teenager Greta Thunberg last year has been joined by many, with much support from some of their families, teachers, and leading politicians; this article’s title is one of their slogans. Environmental campaigns are also attracting well-known actors and musicians.

Climate change, while being particularly prominent, is by no means the only environmental problem we currently face. A marked decline in insects, including bees and butterflies, and many other wildlife species is a consequence of human activity such as intensive farming methods, wasteful fishing practices, and gross international inequalities in food production and consumption. Mike Pratt wrote about the loss of insects in his article in the last TVE, together with human responsibility for it.

74

I’ve just returned from a science conference at which the first talk was about the PET-digesting enzyme that was discovered last year (you read about it here in the Tyne Valley Express!), and now scientists are trying to modify this genetically to make it work on a wider range of plastics.

It would certainly help! Another speaker, presenting new research on the science of battery materials for practical applications, was pointedly asked by someone in the audience if she drove an electric car; the answer was that she has a hybrid.

Meanwhile highly controversial plans for the development of opencast coal mining have been hotly contested legally for a site at Druridge Bay on the Northumberland coast, and more recently approval has been sought for similar plans in our more immediate local area near Throckley. The Druridge Bay (Highthorn) scheme has gone right up to the High Court and to two successive government environment ministers, and a delayed final(?) decision is due during May according to the latest information.

I was pleased to hear last month that our local Newcastle University stands very high up in an international league table of universities judged by their environmental impact, taking in teaching, research, policies and practice; the use of 100% green electricity, rapid progress in reducing investment in fossil fuels, an emphasis on recycling, and a strong policy of sustainable food purchasing all contribute to this success, and are institutional models for the sorts of things we can all contribute individually. Do you know that many people aimed to give up, as far as possible, single-use plastics for Lent this year? It makes a change from chocolate and alcohol!

If you’re interested in finding out more, you may like to come to a day conference I’m organising on Saturday 18 May in Durham. The title is ‘Stewards of Creation: Christian perspectives on environmental issues’, but it’s designed for a general audience and no particular scientific or religious background is required or expected. There’s a small fee (with a reduction for students), but this includes lunch. You can see further information on our website bigquestions-anyanswers.org, including a link for buying tickets in advance (before 10 May) for catering purposes. The topics to be presented and discussed include nature conservation, sustainable living, and our use of mineral resources – all very relevant to the issues mentioned above. And we’ll be asking, and trying to answer, the fundamental questions of why we should bother anyway, and what we can do about it. What you do personally really can make a difference!

Bill Clegg Emeritus Professor of Structural Crystallography Newcastle University

bill.clegg@ncl.ac.uk bigquestions2017@gmail.com

New independent Travel Agent.

My name is Joanne Robson and I was formerly the Branch Manager at The Cooperative Travel in Prudhoe. I have over 25 years experience in the Travel Industry and am now a self employed Business Associate with Designer Travel. This means that I am fully independent and not tied to any particular Tour Operator so I can access the best holiday deals for you. I have the flexibility to offer any type of Holiday from a UK Break or Summer Package to something more bespoke & unique. I go beyond the computer, I am there for you, by phone or email if you prefer. I can also provide free home visits so you can book your holiday in a relaxed no pressure environment.

You can contact me : Mobile: 0786 2997349 Email: joanne@ designertravel.co.uk www.facebook.com/joannedesignertravel

The most experienced and dedicated of travel agents, would happily recommend again and again.

Gail,15 Dec18

Joanne joined the Tyne valley Express while I was booking my summer holiday – good timing! I normally book directly with the company via the internet and thought the price offered was the best I could get. Joanne proved me wrong and saved me £££.

Michael, editor of the Tyne Valley Express Feb 2019

I'd love to hear from you and look forward to planning your next adventure. Joanne.

www.designertravel.co.uk/travel-expert/joannerobson/

Our Services:

Slating/Tiling l Dry Ridge/Verge Systems l Velux Windows l Lead Work l Flat Roofs l Chimney Stack Work l Gutters/Fascias l Pointing l Storm Damage l Fully Insured l FREE & Friendly Advice l All Work Guaranteed l FREE Roof inspections l

High View Roofing

20 Year Membrane Guarantee Certified Installer

CONTACT US FOR A FREE ESTIMATE

07934 062 084 or 0191 660 5561 highviewroofingservices@gmail.com

www.highviewroofing.com

High Quality Work at Affordable Prices!

www.tynevalleyexpress.co.uk

75

Beaumont Street, Hexham. NE46 3LS. Box Office 01434 652477

May Exhibition

ART with HEART Until Thursday 23 May ART with HEART is a charity art auction and gallery exhibition developed by QHA to raise funds to develop arts-based activities. Free Entry

Theatre / Comedy

Confessions of a Cockney Temple Dancer - Saturday 4 May 7.30pm At Hexham Trinity Methodist Church In this funny and honest solo show, Shane Shambhu combines Indian dance and stand-up comedy leading you on a revealing journey of his life experiences.

Tickets: £10.00 / £7.50 (student)

Community Dance

An Evening of Dance, Song & Fashion Friday 10 May 7.00pm Presented by Splitz Dance and featuring dance, song and fashion.

Tickets: £9.00 / £7.00 (conc)

Community Theatre

Encore!

Wednesday 15 - Saturday 18 May Hexham Amateur Stage Society presents musical favourites from stage and screen. Tickets: £15.00 / £13.50 (conc)

Theatre

Foods and Feuds: Two Cooks of Hexham Tuesday 21 May 6.30pm & 8.00pm A preview of a new work-in-progress celebrating the 18th century Hexham born author of the best-selling cookbook of all time, The Art of Cookery made Plain and Easy. - Tickets: £10.00

Children’s Theatre

Americana Music

Ron Block & Tony Furtado Thursday 9 May 8.00pm Nashville’s Ron Block has 14 Grammy Awards to his name and is a member of bluegrass supergroup, Alison Krauss & Union Station. Tony Furtado is a stunning live performer who’s been hailed as a genius on banjo and slide guitar.

Tickets: £14.00

The Tiger Who Came to Tea Wednesday 22 May 1.30pm & 4.00pm Thursday 23 May 10.30am & 1.30pm Join the tea-guzzling tiger in this delightful family show, packed with oodles of magic, sing-a-long songs and clumsy chaos!

Tickets: £14.00 / £9.50 (10 tickets or more) / £50 (Family of 4)

www.queenshall.co.uk

Children’s Theatre

HONK! - Thursday 30 May 7.00pm Friday 31 May 1.00pm A heart-warming reimagining of Hans Christian Andersen’s The Ugly Duckling, HONK! tells the story of a plucky little bird who gets picked on by the other farmyard animals because he’s different.

Tickets: £12.00 / £10.00 (conc) / £40.00 (Group of 4)

Comedy

Paul Mayhew-Archer Friday 31 May 7.30pm A one man show about the therapeutic power of comedy; the debut stand-up hour from the multi award-winning cowriter of The Vicar of Dibley.

Tickets: £14.00 / £13.00 (conc)

Theatre

Three Men in a Boat Friday 24 May 7.30pm A rip roaring barrel of fun, with Giles Shenton playing the part of Jerome K Jerome. - Tickets: £14.50 / £12.50 (conc) / £7.50 (student)

Folk Music

Kathryn Tickell & the Darkening Saturday 25 May 7.00pm Expect some of the oldest Northumbrian tunes and songs throbbing to life intermingled with new material.

Tickets: £20 / £15 (under 18s)

Children’s Theatre

Community Theatre

Tons of Money Thursday 13 - Saturday 15 June 7.30pm A vintage 1920s comedy in a polished new adaptation by Alan Ayckbourn, presented by Queen’s Hall Theatre Club.

Tickets: £14.00 / £12.00 (conc)

Folk Music

The Mile Roses - ‘Blue Skies’ Album Launch - Thursday 13 June 8.00pm Contemporary British Folk Music with a Nod to Nashville! Born out of a musical interest in both. British folk and the transatlantic connections to new country and Americana, the trio are fast gaining a reputation across the UK folk scene.

Tickets: £12.50

June Theatre

Oysters - Saturday 1 June 7.30pm A party celebrates Johannes Brahms’ Violin Concerto’s first performance.

The evening unfolds in a series of passionate recriminations and farcical misunderstandings until its moving climax. -Tickets: £10.00 / £7.50 (student)

Theatre

The Death Show Tuesday 4 June 7.30pm Take time to celebrate your own mortality, laugh, cry, stick two fingers up at the grim reaper and discover why talking about death is ultimately life affirming.

Tickets: £10.00 / £7.50 (student)

Music

Theatre

Pricks - Friday 10 May 8.00pm Setting the record straight about Type 1 diabetics, this is a funny new show blending warmly, engaging storytelling with poetry and an original soundscape.

Tickets: £10.00 / £7.50 (student)

What’s On

Mari Wilson Wednesday 5 June 7.30pm An evening of hits old and new, Mari Wilson will take you on a musical journey with her enchanting voice and beautiful arrangements of classic and contemporary songs.

Tickets: £17.00 / £15.00 (conc)

Theatre

Joey - Thursday 6 June 7.30pm A true story about growing up in 80s Britain; a story about playgrounds and care-homes, DMs and red laces, punk and cassette tapes– a story of love and rage and surviving it all.

Tickets: £10.00 / £7.50 (student)

Exhibition

Presence Friday 7 June - Saturday 13 July The unique energy and vision of young artists from Queen Elizabeth High School will provide the strong visual presence at the heart of this exhibition. - Free Entry

Bird’s Nest Billy Wednesday 29 May 2.00pm An adventurous show for 3-7 year olds blending imaginative storytelling, puppetry and playful audience interaction.

Music Tickets: £8.50 / The Supersonic 70s Show £7.50 (group Friday 7 June 7.30pm per person) Bring your favourite 70s outfit, as it is time for you to live out your childhood memories once more on this glorious rollercoaster ride of 70s nostalgia.

Tickets: £18.50 / £20.00

Children’s Theatre

Dinosaur World Live Tuesday 18 June 5.00pm Wednesday 19 June 10.30am & 5.00pm Grab your compass and join our intrepid explorer. Meet a host of impressive creatures, including every child’s favourite, the Tyrannosaurus Rex. Tickets: £14.00 / £8.50 (Groups of 10 or more per person)

Folk Music

Through the Seasons Saturday 22 June 7.30pm A celebration of the year in Morris and folk dance bringing all the joy of a summer festival and the thrill of a winter fireside rapper sword-dance to the stage.

Tickets: £12.00 / £10.00 (conc)

Community Dance

Moving Pictures Friday 28 - Saturday 29 June Youth Dance Tynedale presents a contemporary dance performance inspired by favourite movies.

Tickets: £10.00 / £8.00 / £5.00

Folk Music

Nancy Kerr and James Fagan Sunday 30 June 7.30pm Outstanding musicianship, a lifelong grounding in traditional singing and instrumental playing, and acclaimed original compositions. - Tickets: £14.00

Dance

Edge 2019 - Tuesday 2 July 7.30pm 13 powerful dancers from across the globe embark on a deeply personal and collaborative journey in celebration of life, death and the challenges in between.

Tickets: £10.00 / £7.50 (student)

The UK’s No1 dry carpet and upholstery and hard floor cleaners

Ready for your

Best Ever Clean?

LOCA L Fa mily R Busin un ess

CHOOSE US TO CLEAN YOUR SOFA

AND WE’LL CLEAN YOUR LIVING ROOM CARPET FOR

1/2 PRICE

Dry carpet cleaning Upholstery cleaning Hard floor cleaning Wooden floor cleaning

Domestic & Commercial

0800 180 42 80

zerodrytime.com

DARRAS HALL & PONTELAND ST MARY’S CHURCH, PONTELAND - SUNDAY Sundays 10 am 1st Sunday - Morning Service 2 and 4th Sundays Parish Eucharist 3rd Sunday All Age Worship 6.30 pm 1st Sunday Holy Communion (BCP) 2nd and 4th Sunday Evening Worship 3rd Sunday Evensong WEEKDAY SERVICES Wednesdays 10.00am - Holy Communion 12th March – Flower arranging at Fratellis - £20 24th March – Hartlepool Choir at the church 28th April – Pipes and Fiddles Visit our website for all activities and events www.pontelandstmary.co.uk ...............................................................

PONTELAND CIVIC SOCIETY Ponteland Civic Society holds 5 talks meetings per year in its new Permanent venue at the CIU Club Merton Road at 7.30 p.m. Meetings are held on the last Monday of the month in Ponteland Club and Institute in the following months: September, November, February March and April - Non members welcome to attend for a nominal charge of £2.

For details of membership and talks please see website:

www.pontcivicsociety. pontelandonline.co.uk ...............................................................

PONTELAND METHODIST CHURCH - by the traffic lights Sunday services 10 am & 6.30 pm.

Sunday 10am ‘The Bridge’: modern worship.

Children’s activities provided during both of the 10am services.

Monday ‘Open Door’ drop-in cafe 2 pm to 5 pm: soups/drinks/home-bakes/ friendship.

Monday Carpet bowls 1.30 pm Tuesday 2.30 pm Women’s Fellowship Tuesday Boys’ Brigade: various agegroups at times between 6 pm & 9 pm.

Wednesday Girls’ Brigade: various age groups at times between 5.45 & 8 pm Thursday Toddlers at 9.30 am Thursday Women’s Focus 7.30 pm & Men’s Forum 7.30 pm Friday Carpet bowls 7 pm.

Saturday various walking groups.

House groups at various times.

Charity concerts, coffee mornings, sales, & meals as announced.

For information on any of these events contact : Ann Cooper 01661 824347 or email anncooperx@gmail.com ...............................................................

ZUMBA ® GOLD IN PONTELAND Lower impact moves, same great Zumba® music and easy to follow rhythms

designed to make you smile whatever your fitness level.

Tuesdays 11.00am, Ponteland Methodist Church. Thursdays 9.30am, Ponteland United Reformed Church ...............................................................

BODY CONDITIONING IN PONTELAND Top to toe work out, great for toning up. Please bring hand weights if you have them. Thursdays 10.15am Ponteland United Reformed Church

...........................................................

PONTELAND UNITED REFORMED CHURCH, Broadway, Ponteland 10am Sunday morning Service Nursery: Monday - Friday 7.30 a.m. 5.30 p.m.

Dance classes Tues., Weds & Thurs 3p.m - 6.20 p.m.

Physiotherapy (chair based exercises): Wednesday 10 a.m. - 11 a.m.

Zumba Gold: Thursday 9.30 a.m. - 11 a.m. (already advertised).

Mothers & Toddlers: Friday 9.30 a.m. - 11 a.m. Friday: Soup and Sandwich lunches (already advertised): 12.30 p.m. - 1.30 p.m.

...........................................................

CREATIVE WRITING GROUP Led by a qualified tutor, this class will inspire and encourage you to write poetry and stories through stimulating workshop sessions in a friendly and

supportive group. New or experienced writers welcome. We meet on Wednesday mornings at 9.30am in members homes around Ponteland. If you are interested contact Claire on 01434 605276 claire@claire276. plus.com

...........................................................

PONTELAND FLORAL ART CLUB 3rd Tuesday of the month, Ponteland Memorial Hall, Darras Road 7.30pm ...........................................................

NORTHUMBERLAND FUCHSIA SOCIETY 1st Thursday of the month,

St Matthew’s Church Hall, Ponteland 7.30pm. Ponteland Civic Society

...........................................................

CALLERTON GARDEN & FLOWER CLUB Meeting Held At Memorial Hall Lounge, Darras Hall, Ponteland 2nd Wednesday at 2pm.

...........................................................

PONTELAND U3A We meet on the first Wednesday in the month at 2.00pm in St Mary’s Church Hall, Thornhill Road. We have a speaker followed by a cup of tea, visitors are always welcome.

To find out about our activities visit u3asites.org.uk/Ponteland or ring 01661 824953.

GEORGE STEPHENSON

DOUBLE GLAZING LTD

For all your ‘A’ Rated Windows, Composite Doors, Porches, Warm Roofs, Conservatories, Sliding Sash, Bi-folds.

Repairs to Windows & Doors Locks, Replacement Glass Units.

OVER 30 YEARS EXPERIENCE SHOWROOM & OFFICE AT:

23c Haugh Lane Ind Est, Hexham, NE46 3PU.

01434 608619

78

BRIAN HEWISON INTERIOR DECORATOR

TIME SERVED - OVER 30 YEARS EXPERIENCE Wallpapering - Emulsion - Gloss - Coving.

Interiors only!

HOME: 01207 775518 MOBILE: 07854 597299 EMAIL: hewisonbrian@gmail.com

CHIC SHUTTERS

ENHANCE YOUR HOME, LOVE OUR SHUTTERS. Transform your home with stunning interior window shutters by your local expert.

Superior quality shutters available in a wide range of styles and colours to suit any room.

Energy saving too! Our shutters help keep your home warm in the winter and cool in the summer.

We offer exceptional customer service, let us guide you through the options available, honest reliable advice from a local Company you can trust.

We also supply & install high quality venetian blinds

Call Shuttercraft Newcastle today on 0191 2069467

www.shuttercraft-newcastle.co.u k

RETIRED GENT SEEKS LAND / PERMISSIONS TO SHOOT

Est. 1994 - We know what we’re doing!

RABBITS PIGEONS VERMIN Respectful of land, crops, fencing etc Discreet and can shoot at night using night sights Air rifle only

Tyne valley area Call Bill on: 07793241968

Range & AGA Specialist • Ovens & Hobs • Extractor Hoods Microwave Ovens • Traditional Stoves • Unique valeting process Caustic soda free products To join out thousands of regular OvenU customers call:

STEVEN BELL & SON BUILDING CONTRACTORS

Providing quality work for all of our customers since 1986 l l l l l l

l l

80

We specialise in extensions and loft conversions offering a full Building service from plans to completion.

We also under take repairs and mainteance providing a Joinery guaranteed fully insured service.

Extensions “We are based in the Tyne Valley with over 30 years experience.

Paving Many of my customers have become good friends and plenty of references on request.” teven Loft conversions S us Conservatory roof Contact 0191 413 5579 for a FREE conversions competetive or 07967 827 806 quote Facias & Guttering Email sas.bell@btinternet.com Bramble Cottage, Barmoor Lane, Ryton, Tyne & Wear, NE40 3AA upvc Windows & Doors

Thanks for bringing some tired looking carpets back to life! Great job, efficient service and good price.

Thanks – Maria

Si & Richie were superb and did a brilliant job on my carpets. They were punctual and professional. I wouldn’t use anyone else.

Cheers lads! - Joe

UPHOLSTERY CLEANING *CARPET CLEANING

DRIVEWAYS

Patios, Facias Cleaning etc

Cleaning Services

Making a clean home easy

RUGS

See below for details

LEATHER CLEANING & CONDITIONING

END of TENANCY Builders clean 1 off Sparkle clean

WE also offer a

STAIN PROTECTION

CARPET CLEANING 3 ROOMS FOR £99

*

HARD FLOOR CLEANING

FREE Demonstration/Test Clean On All Hard Floors - TILE, STONE, CERAMIC, AMTICO, KARNDEAN, ETC. *subject to size

Where to find us...

Unit 1E, Princess Court, Prudhoe, Northumberland, NE42 6PL

Part of

HARD FLOOR

Stone, Slate, Ceramic etc

Follow us on our Facebook page Independent Restoration, for regular offers.

COLLECT & RETURN or DROP OFF & COLLECT SERVICE RUG CLEANING FROM ONLY £15

Tel: 01661 529997 / 01434 629888 / 0191 5002119 www.ircleaning.co.uk Unit 1E Princess Court, Prudhoe, Northumberland, NE42 6PL

DARRAS & PONT PONTELAND VILLAGE WI We are a busy, friendly group with a variety of sub-groups including a book/film club, dining out group, walking group and theatre club. We meet on the second Tuesday of each month (except August) at 7.30pm in Ponteland Parish Centre (formerly St Mary’s Church Hall). Come along, learn something new, have a laugh and make new friends. Our meeting on Tuesday, May 14, will be our annual meeting, with a baking competition - and lots of cake! Our June meeting, on Tuesday, June 11, will be a games evening. Lots of laughs promised. And cake. Come along and give us a try. Find us on face book, Ponteland Village WI or email pontelandvillagewi@hotmail.com ...........................................................

HEARING AID SUPPORT SERVICE on the 2nd Monday monthly (excluding bank holidays), 2.00 – 3.30 pm at Ponteland Medical Group. Free service open to all run by charity, Action on Hearing Loss (previously RNID). Re-tubing & batteries for NHS hearing aids. Information for all. Drop in service, no need to book. ...........................................................

Zumba ® Gold - Lower impact moves same great Zumba® music and easy to follow rhythms designed to make you smile whatever your fitness level.

Tues 11.00am, Ponteland Methodist Church. Thurs 9.30am, Ponteland United Reformed Church Body Conditioning - Top to toe work out, great for toning up. Please bring hand weights if you have them Thursdays 10.15am Ponteland United Reformed Church £4 per class. Contact Lindsey Thomson-Heley Tel: 07732 359399 Email: lindsey.thomson-heley@ talktalk.net ...........................................................

PONTELAND BADMINTON GROUP - Mondays 11am - 12noon, Tuesdays 7pm - 8pm, Fridays 10am - 11am and Saturdays ( Juniors) 10:30am - 11:30am. at Ponteland Leisure Centre. All ages/abilities are welcome, enquiries Phil Hall 078100 84153 ...........................................................

PONTELAND BOWLING CLUB Ponteland Bowling Club will be holding free ’Taster’ sessions at 10.30am on the following dates:- Sat. 4th,11th.18th and 25th May as well as 2.00pm on Sat. 18 May. Come and give bowls a try, all equipment provided. The morning session on 18th May will run alongside a Coffee Morning to raise funds for the Moto Neurone Disease Association.

Why not come along and support a worthwhile cause and have a go at bowling. More Inf. at www. pontelandbowls.com ...........................................................

DALTON CARPET BOWLS CLUB

We are a top

10%

Dalton Village Hall every Monday between 7 - 9pm.

Come and join a winning team – ALL WELCOME! Contact 07593 700332 ...........................................................

PONTELAND LADIES CHOIR Meet Mondays at 7.15pm in Ponteland Methodist Church, next to traffic lights, and sing a wide variety of music. Please contact Nina Tel 0191 670 9055 for more details.

NEW MEMBERS WELCOME! NO AUDITIONS REQUIRED. ...........................................................

ARTventurers Tyne Valley Art and craft classes, parties and events for babies, toddlers and children.

Thursday ST MARYS CHURCH HALL 1:30pm Little ARTventurers (18 months - preschool) For more information please contact Justine, 07737108061 justine@artventurers.co.uk ...........................................................

PONTELAND LOCAL HISTORY SOCIETY We meet every Thursday at St Mary’s church Hall at 7.30pm Come and say hello at The party in the Park event on Sunday 9th June between 1-5pm ...........................................................

PONTELAND SENIOR GENTLEMANS CLUB Monday 13th May - The man who lost 3 kingdoms Monday 10th June – The Roman Military Monday 8th July – Cresswell Pele Tower Club now has its own website: http:// pontelandsgc.co.uk/ See site for all events and information New members always welcome Contact Colin Potts for more details cvp88@john-lewis.com ...........................................................

EMBROIDERERS GUILD PONTELAND BRANCH Monday May 20th A mini workshop – 3-D vegetable plot, part 1

By Anne Hefford Monday June 24th 3-D vegetable plot part 2 2-4pm Memorial Hall, Darras Road All welcome, £4 (please contact me for requirements details) Membership of the Branch and the Embroiderers Guild is open to all; everyone, whatever their level of experience, is welcome at meetings and workshops.

You can become a member or come to a meeting as a visitor for £4 For further information contact the Secretary, Penny Ford on 01670 788278 Or email: penelopeford636@

DAVID MUERS & SON BATHROOMS AND KITCHENS

82

PARTNERSHIP The Community Partnership organises a wide range of local projects for the benefit of all ages of residents, come to observe a meeting and share btinternet.com your ideas and expectations for ........................................................... improving the quality of life in FRIENDS OF KIRKLEY HALL. our community. View our website Friends of Kirkley Hall Talks taking to see current and past projects: place at Kirkley Hall nr Ponteland. pontelandcommunitypartnership.

THE DROVE ROADS OF NORTHUMBERLAND - Wednesday co.uk - All welcome.

Meetings are held every third 8 May, 2019 Wednesday of the month at Dr Ian Roberts talks about how Ponteland Memorial Hall, Darras Rd, droving was a hugely important Ponteland at 7pm aspect of farming across ...........................................................

Northumberland for more than ROTARY CLUB OF PONTELAND 1,000 years. The need to move We are a group of ladies & gents large numbers of sheep and cattle who meet every Tuesday at over considerable distances has Ponteland Golf Club. Meetings shaped the landscape and left an alternate between lunchtimes & enduring imprint in the form of evenings. We have a light meal, major highways, country lanes and chat & socialise & try to arrange wayside inns. fund-raising events to support good NORTHUMBERLAND’S SECRET charitable causes. Why not come SEAS - Wednesday 12 June, 2019 along & join us. Alan Hall -President Discovering the mysterious Rotary Club of Ponteland underwater world off the Mob: 07740 866764 – call for details.

Northumberland coast, this talk, ........................................................... given by Ben Burville, will focus on the behaviour of grey seals, dolphins PONTELAND WILDLIFE GROUP MEETINGS and some incredible marine birds.

On Tuesday 2nd April Kelly Hollings will Ben is a keen diver with over 30 years experience. He has spent more give a talk on Ratty Returns at 7.30pm in St Mary’s Parish Centre, Thornhill Road, time in the water with grey seals Ponteland. Admission £2 including than anyone else in the world. He refreshments. Open to all featured in series 1 & 2 of Robson ...........................................................

Green’s TV programme Tales from CROQUET. Northumberland.

Fancy trying a new sport?

Both talks: Belsay Hall Croquet Club, is located Place: Kirkley Hall, nr Ponteland Time: 7.00 pm (note change of time in a beautiful setting within the walled garden at the Hall. to summer schedule) The playing season is typically the No booking necessary. There is a beginning of May until the end of charge of £3 for non members and September. Members pay a small £2 for members annual fee to the club and must For more information ring also become members of English 07551974955 or email: Heritage who manage the site. friendsofkirkleyhall@gmail.com Future talks can be found on: www. To get started you will only need to have a pair of flat soled shoes. All friendsofkirkleyhall@yahoo.com other equipment needed to play the ........................................................... game is provided completely free of TAI CHI IN PONTELAND charge by the club.

Every Thursday morning a friendly class meet at St. Mary’s Church Hall, Anyone wishing to give the game a Ponteland, from 10-11am. Beginners try or develop their existing croquet welcome. If you are interested why skills should contact either Colin on 01661 825980 or David on 0191 not give it a try? Contact Steve 236 5374. Alternatively, you can Oliver on 07989 171701 email: belsaycroquet@gmail.com ........................................................... ...........................................................

NORTH EAST ENGLAND GROUP OF THE ALPINE GARDEN SOCIETY RAF AIR CADETS 733 Sqn Air Training Corps is On Monday 13th May 2019 we open to boys and girls between are holding our 70th Anniversary the ages of 12 to 17 years. The celebration. Please come along to Squadron activities include flying, join in the fun. The meeting will gliding, shooting, first aid, cadet be held at Ponteland Social Club camps home and abroad and the (CIU), Merton Way, Ponteland, Duke of Edinburgh Award Scheme.

NE20 9PX, doors open at 7pm for 7.30pm start. The charge to visitors The Squadron meets Mondays and Fridays, 7pm to 9.30pm at is £2 per meeting. Contact us by the Squadron HQ, Army Reserve Email neegroup@agsgroups.org or further details can be found on www. Centre, Kingston Park. For further information contact Flt Lt G Smith alpinegardensociety.net/groups/ RAFAC, Officer Commanding North-East-England or facebook. at 733@aircadets.org or (0191) com/groups/AGSNEE. 2862691 Monday and Friday ........................................................... evenings PONTELAND COMMUNITY

EMERGENCY 24HR CALLOUTS 1st Hr £69 + V.A.T

See our main advert on page 7

SUPERFAST BROADBAND IS HERE! FOR WORK OR PLAY - CONNECT TODAY...

Superfast Broadband can make your online life easier and more efficient. There are lots of ways being online with Superfast Broadband can help you: FOR HOME

FOR BUSINESS

• Save money by finding new utility suppliers and comparing prices quickly and easily

• Access to secure cloud services means you can run your business from anywhere that has an internet connection and ensures data remains safe

• Stay connected with friends and family across the world via emails, Skype and social media • Keep control of your finances by banking online, access and manage your money 24/7 • Fast and easy access to information such as booking a holiday, searching for jobs or helping children with homework • Stream films and music faster and watch online content without annoying buffering • Access to secure cloud services means you can store photographs, documents and music safely in the cloud rather than on your home computer

• Save travelling costs by using Facetime and Skype • Offer free Wi-Fi access to your B&B or holiday cottage guests without slowing down your own service • Have a better website and digital presence to showcase your business. The use of videos and photographs on your website and using social media will increase engagement with your customers • Sell online to customers nationally or internationally

• Have several members of your family using the internet at the same down with no timeouts

To find out if Superfast Broadband is available to you and for information on how to upgrade go to our website www.iNorthumberland.org.uk.

Any questions? Contact us via email: info@inorthumberland.org.uk or call us 01670 626001

DENTAL

The No1 request we have from our clients is, “I would like straight and white teeth.”

Here at Louise Hunter Associates we can help!

PLANS AVAILABLE spread the cost with peace of mind.

From 25p per day

You’re in safe hands Welcome to the Tyne Valleys premier dental practice based in Prudhoe.

Not only do we offer the best in dental treatments for you and your family we also offer other treatments too.

We are delighted to open our ‘NEW’ facial aesthetics clinic for all types of dermal fillers and wrinkle reducing toxin treatments. Based within the practice our newly designed room offers the very best in skin care products too.

We have teamed up with and can tailor treatments for your particular skin needs. Whether you suffer from melasma (sun damage) / hyper pigmentation / acne / rosacea / any other problematic skin conditions - or you simply want to make your skin look and feel the best it can, we are here to help. Skin peels are also available as well as our tattoo removal service.

SERVICES: l GENERAL NHS & PRIVATE DENTISTRY l DENTAL IMPLANTS l WHITENING

l

l l

REALIGNEMENT PROGRAMS FACIAL AESTHETICS TATTOO REMOVAL SYSTEM

We start by giving your teeth a pain free full 3d scan so we can show any issues and exactly how invisalign will realign your teeth. Invisalign is a clear brace program that is almost invisible and quicker than traditional straightening techniques.

Implants are now easier than ever so don’t let missing teeth stop you smiling

Enlighten is widely regarded as the most effective whitening system available with guaranteed results

louise hunter & associates www.louisehunterdental.co.uk

njectable treatments form our dental practice. The treatments are all carried out Our dental practice also offers a full range of NHS Private Dentistry

by Louise our principle Dentist and practice owner in a &safe and clinical setting

To book an appointment for any of our services call: 01661 835722 34 West Road, Prudhoe, Northumberland, NE42 6HR, Email info@prudhoedentalpractice.co.uk.

Find us on Facebook

Welcome to Comet Garage Doors

Serving Durham and Newcastle since 1968, we want to be your garage door.

90% of our work is through recommendation, this shows “where you buy is just as important as what you buy.”

90% OF OUR WORK IS FROM RECOMMENDATION

01207 270 711

07801 926 355

www.cometgaragedoors.co.uk

We carry out repairs to all makes and types of Garage Doors.

We carry cones, cables and locks for most doors.

All our doors are from leading UK manufacturers.

Comet Garage Doors are authorised distributors for: Gliderol - Henderson - Cardale - Hormann - Seceuroglide.

North East of England. ● ● ● ●

GARAGE DOORS REMOTE CONTROL SPECIALISTS

●

Up and Over Garage Doors Insulated Roller Doors Sectional Garage Doors Roller Doors Automatic Operators

● ● ● ●

Security Grills / Gates Removable Window Bars Bar Gates

BACK TO BALANCE RESTORING HEALTH & WELLBEING A wellness centre nestled on the banks of the River Tyne, offering treatments for body, mind and soul in tranquil surroundings at Newcastle Business Park Aromatherapy - Bach Flower Remedies Clinical Psychology Intuitive Energy Healing Massage - Osteopathy - Reflexology Psychology of Eating Pilates - Mindfulness and Meditation - Yoga www.back-to-balance.co.uk 01914661441 contact@back-to-balance.co.uk

www.tynevalleyexpress.co.uk

85

Traders Index Here at the Tyne Valley Express we always work hard to find good quality local traders.If we didn’t, the magazine would not work for us or for you. Any poor trader will always be removed once we become aware. Our traders are a loyal bunch and most have been with us for years.

They also help us list 100’s of What’s on entries for free thanks to their adverts. We are now actively looking for ‘NEW’ local traders and would like our readers help to fill in the WANTED spaces - or even create new ones. So if you are a business owner or know a trader that might benefit from the exposure to 31,000 homes then please get in touch? We promise to look after you too!

Accountants ......................................... Paul Axcel p15 Aerial services ......................................BT Aerials p56 Artists / Galleries / Photography ............................................................... Roger Clegg p21 ........................................ Paul Stangroom Fine Art p49 ............................................................ Carol Davison p43 Auctioneers ...................Anderson & Garland p11 Bakers / Catering .......................................... WANTED Bathroom Showroom / Installation .................................... Inside Transformations p36/37 Beauty / Health & Hair ............................................ Louise Hunter Beauty p84 ................................................. Slimming World p40/41 Bi-fold Doors / Extensions ............................................................ Metal Services p2 Blinds ..................................................Blinds Ryton p63 .............................................................. Shutter Craft p67 Builders .........................Robin Building Services p34 ...............................A. Douglas Construction LTD p47 ............................................................... MJ Property p43 .....................................................Steven Bell & Son p80 Burglar Alarms & Security ................................... Metro Security Service Ltd p33 Cafe .............................. The Crossing Coffee Bar p15 Car Dealerships ............................................ WANTED Car / Van Hire ................................................ WANTED Carpet Cleaning ..............IR Cleaning Services p21 ...........................................................Zero Dry Time p77 Carpet Shop / fitter .......................Karpet Mills p87 Central Heating Services / Installation / Repairs ..........................................................................DMAC p60 ............................................... Appollo Gas Service p19 .................................................................... JP Westall p70 Chimney Sweeps ................................. Premier Chimney Sweeping p49 Chiropodists / Foot care ............................................ Tyne Valley Foot Care p39 Chiropractic ................................................... WANTED Churches ............................................................................. ................................Winlaton Evangelical Church p23 ......................................................................The Gate p53 Cleaning Services ..........Double Green Care p31 ............................................................... Polish Maids p60 Cleaning (outside surfaces) .......................................................The Gleam Team p13 ....................................................Jesmond Jet Clean p34 Computer Repairs ....................................... WANTED Counselling .................................................... WANTED Decorator ...........................................Tom Wansell p5 ................ Brian Hewison Interior Decorator p51/78 Dentist ..................Louise Hunter & Associates p84 Dog & Cat Grooming ................The Dog Lady p61 Drains ............................................................... WANTED Driving Instructor ........................................ WANTED Electrician ................Fultons Electrical Services p23 ............................................................. 123 Electrical p67 Estate Agents ......................... Red Hot Property p1 ...........................................................Property Rung p30 ......................................................... Gilmore Estates p67 Events / Classes / Info or Help Wanted ............................................Tynedale Beer Festival p18 ..........................................Barmoor Hub Craft Fair p20 ...........................................................The Hearth p29/64 ..........................................Bushcraft for the Family p45 ................................................ Dinosaur Roadshow p52 .............................................................County Show p46 ...................................Westwater Fly Fishing Club p54 ...............................................................Minsteracres p57

86

....................................................Corbridge Festival p59 ............................................................National Trust p63 ......................................Hexham Hidden Gardens p69 ...................................................Hexham Juniors FC p71 ..........................Ponteland Photography Society p78 ..............................................Superfast Broadband p83 Fabrics / Soft Furnishings ...........................................................Holly’s Kitchen p51 Fencing / Wrought Iron work / Gates ................................................................Ash Fencing p51 .........................................................Designs in Steel p65 Financial Adviser ......................................... WANTED Fitness Classes / Pilates / Yoga .................................................... Yoga in the Home p33 .........................................................Precision Pilates p69 Florist ............................................................... WANTED Furniture Retailer /Repair / French Polisher .................................... The Bed and Chair Centre p55 ...................................... Roy Cave French Polisher p61 ......................................................... Furniture Clinic p62 Funeral Directors + Plans .......................................Lowther Funeral Services p21 ..........................................................................E.Peart p39 Garden Centre ......Little Ollie’s Garden Centre p9 .........................................Jack & Jo’s Baskets to Go p23 Garden Services ..................................Land Girls p43 ...............................................................Ash Fencing p51 .................................................Double Green Care p51 ...............................BA Paving & Garden Services p53 Garage Doors ................ Comet Garage Doors p85 Garage Services ...........................Grants Garage p24 ................................................. Prudhoe Auto Care p53 Golf Clubs ..................................Ryton Golf club p25 Ground Works .........................................................Ground Breakers p4 Handyman ......................................... David Muers p4 ....................................................David Castonguay p23 Health / Support / Wellbeing .....................................................................U Retreat p61 ......................................................... Back to Balance p85 ........Northumberland Cancer Support Group p73 Hearing Service ....Bloom Hearing Specialists p17 Home Care Services .........................................Community Buddies p46/64 Home Improvements / Repairs .................................................................Nook Design p5 .................................................... David Muers & Son p7 .................................... Inside Transformations p36/37 ......................................MJ Building and Property p43 .................................................................Shuttercraft p79 Housing Developments ............................ WANTED Ironing ...............................................The Iron lady p52 Jewellers .......................................................... WANTED Joiner ....................................................Nook Design p5 Key Cutting .................................................... WANTED Kitchen Supplier / Fitter .................................................... David Muers & Son p7 .................................... Inside Transformations p36/37 Legal Services ............................... The Will Guys p17 Locksmith ........................................................ WANTED Loft conversion .............................................. WANTED Mobility ........................................Mobility Direct p31 ....................................................... Bewick Mobility p66 Opticians .........................Wade Opticians p26 / 27 ..........................................................Elizabeth Evans p35 Outside Buildings / Sheds / Greenhouses ...............................................GCS-Leisure Buildings p3 Oven Cleaning .................................Oven Clean p35

........................................................................Oven U p80 Paving and Driveways ............Ground Breakers p4 ................................................................Resin Drives p88 Pet Services .............................. Doggy Day Care p49 .................................................................... Dog Lady p19 Plasterer .......................................................... WANTED Plumber ........................Robin Building Services p34 ..............................................Appollo Gas Services p19 Physiotherapy ......................... Northumberland Physiotherapy p12 Reclamation / Timber ..........Prudhoe Timber p19 ...............................................................Stan Dawson p58 Removal & Storage ..................................... WANTED Residential Homes ...................................... WANTED Restaurants / Pubs / Cafe / Clubs ........................................................Ryton Golf Club p18 ....................................................The half moon Inn p22 .............................................. The Lion & the Lamb p29 .........................................................Danielle’s Bistro p73 Roofing ..................................High View Roofing p75 .............................................L. Richardson Roofing p45 Scaffolding ..................................................... WANTED School ..................Crookhill Primary + Nursery p39 Skip Hire ......................................................... WANTED Solicitor ........................................................... WANTED Storage........................ Secure Container Storage p5 Tattoo Removal ........................... Rethink Laser p84 Taxi ........................................................Clarks Cabs p56 Theatre / Cinema ..........................Queen’s Hall p76 Tiler .................................................................. WANTED Travel Agent ............Designer Travel – Joanne p75 Tree Surgeon .............................TC Tree Services p9 Tyres ................................................................. WANTED Vape Shop ...................................................... WANTED Vets .....................................................................WANTED Waste Disposal ............................................. WANTED Wheelie Bin Cleaner ...................................WANTED Windows / Doors / Double Glazing / Repairs .............................................M.B.C Glazing Repairs p31 .................George Stephenson Double Glazing p78 Window Cleaner ..........................................WANTED

Tyne Valley Express

for the People by the People!

Advertise your business in and around the Tyne Valley.

The Tyne Valley Express is the only FREE publication going to the majority of the homes within the Tyne Valley.

Here at the Tyne Valley Express we always work hard to find good quality local traders. If we didn’t, the magazine would not work for us or for you. Any poor trader will always be removed once we become aware. Our traders are a loyal bunch and most have been with us for years. They also help us list 100’s of What’s on entries for free thanks to their adverts.

Full Page from............................................. £360 Half Page...................................................... £210 Quarter Page ........................................... £120 Eighth Page ............................................... £60 Costs to suit your budget!

As a small locally based company we can provide a tailored package to suit your advertising budget.

...and FREE design too!

DOUBLE DISCOUNT

UP TO

75% OFF

SPRING SALE

Plus

EXTRA

DISCOUNT

TWO CARPET & FLOORINGF! EXPERTS UNDER ONE ROO

CARPET

No.1 FOR

CARPETS & FLOORING!

EVERY ROOM

FOR LESS

EST

IN STORE

1878

DESIGNER FLOORING

By DICKINSON BROS LTD

FAMOUS BRANDS AT FACTORY PRICES! NEW! Crucial Trading High Quality Sisal .. was £50.00 Tomkinson Twin-ply Berber ........................ was £29.99 Regency Heavyweight Luxury Saxony ......... was £24.99 Hugh Mackay 80/20 Wool Twist ................. was £26.99 Tomkinson Lothian 100% Wool Berber ...... was £24.99











NOW £19.99 NOW £19.99 NOW £14.99 NOW £9.99 NOW £12.99











1000’s OF BARGAINS BEDROOM

LOUNGE

LUXURY SAXONY

SUPER SOFT PILE

WAS

£19.99

£9.99



WAS

£17.99

HALL & STAIRS

£7.99



FULL HOUSE

STAINPROOF TWIST

FAMOUS LUXURY BRANDS

DEALS

£5.99 Starting from £349 £1000 CASH BACK WAS

BESPOKE DESIGN & PLANNING



£15.99

IF ANYONE CHEAPER!

*

The Original Dickinsons Return to Hexham!

“Karpet Mills, run by Joel Dickinson (son of Conrad), brings the family business back to the town exactly 140 years after it was established there in 1878; six generations as flooring specialists.”

TRUSTED EXPERT ADVICE SPECIALIST FITTING SERVICE

Conrad Dickinson Director, 5th Generation

Joel Dickinson, Director, 6th Generation

DESIGNER FLOORING PREMIUM RANGES NOW IN ALL STORES *Terms and conditions apply. Ask for details.

GATESHEAD 0191 478 3049

HETTON - le - HOLE 0191 526 1770

KINGSTON PARK 0191 271 6576

(Next to Matalan)

(10 mins from S/land/Durham)

(Behind TK Maxx)

Unit 2, Tyne Bridge Retail Park, NE8 1EJ

Market Street DH5 9DZ.

www.karpetmills.co.uk

HEXHAM 01434 600 100

8b Airport Ind Est NE3 2EF

l

ESTABLISHED 1878

l

OPEN 7 DAYS

43 Gilesgate, Hexham NE46 3QB (2 mins from Tesco)

l

FREE PARKING

Revive your drive with Resin Drives Combine extra parking space with stunning kerb appeal.

Give your outdoor space the ‘wow’ factor with landscaped pathways.

Why Choose Resin?

• Completely porous and puddle free • Hardwearing, durable and weed-adverse • 10 times more environmentally friendly than concrete • Slip resistant, wheelchair friendly and excellent tyre traction

BUY

*

NOW AND PAY

NOTHING UNTIL 2020

Create a unique and stylish patio area.

Why Choose Resindrives.co.uk?

• Highly skilled installation team • No subcontracting • Multiple colour schemes & styles to choose from • Over 10 years experience

For ultimate kerb appeal add a state of the art garage door, maintenance-free composite fencing or a realistic artificial lawn

CALL TODAY FOR A FREE QUOTE AND SURVEY

0800 007 5733 www.resindrives.co.uk

Approved Materials & Systems Cert No. 18/5476

*Resindrives.co.uk is a trading name of resindrives.co.uk ltd. Authorised and regulated by the Financial Conduct Authority (FRN743675) We are a credit broker and not a lender, we offer credit facilities from a panel of lenders. Finance subject to status. Terms and conditions apply.