__MAIN_TEXT__
feature-image

Page 1

2021 #51

In de wijk

Margrite Kalverboer

‘Buurt waarin kind opgroeit, speelt belangrijke rol bij ontwikkeling’ Bianca van Vreeswijk

‘Bij een huisbezoek is een kind soms veel opener’ AJN-bestuur zoekt actieve leden

‘Wij kunnen het niet alleen’


COLUMN VOORZITTER

3 - 2021 #51

Voorlichting in de moskee Laatst kreeg ik via WhatsApp een foto doorgestuurd. Een beeld van een grote ruimte in een moskee. Tientallen mannen zittend op de vloer, op mooi rood tapijt, 1,5 meter van elkaar, kroonluchters boven hun hoofden en luisterend naar twee van mijn collega’s. Een jeugdarts en een jeugdverpleegkundige die werken in de wijk waar de moskee staat. Mijn collega’s vertelden over ziekten en over de vaccinaties die deze ziekten bij kinderen en jongeren, bij de zonen en dochters van deze vaders, kunnen voorkomen. Extra voorlichting en communicatie over het Rijksvaccinatieprogramma is in deze wijk broodnodig. De HPV-vaccinatiegraad ligt hier zelfs onder de 20 procent. Terwijl die in andere wijken tientallen procenten hoger ligt. Heel veel meisjes met een Marokkaanse of Turkse migratie-achtergrond zijn hier niet beschermd tegen kanker als gevolg van een HPV-infectie. Jeugdartsen wisten wel dat vaccineren voor deze jongeren niet altijd vanzelfsprekend is. De vragen, twijfels en misleidende informatie op sociale media komen voorbij in de gesprekken met hen. Nu blijkt ook uit onderzoek dat sommige vaccinatiegraadcijfers op wijkniveau confronterend en zorgwekkend zijn. Landelijk gaat het goed met de vaccinatiegraad, maar in wijken als deze, in grote steden en daarbuiten, en in de bekende biblebelt, is er nog heel veel gezondheidswinst te behalen! Werk aan de winkel voor jeugdartsen die zich op wijkniveau willen inzetten. Met onderzoek doen, analyseren wat er speelt en meedenken met een gerichte aanpak en nieuwe initiatieven. De foto zorgde bij mij voor een glimlach en een trots gevoel. Het is een van vele voorbeelden van wat jeugdartsen in hun wijk kunnen betekenen. Ik ben blij dat we met elkaar veel beelden en verhalen delen. NU voor het leven!

Astrid Nielen voorzitter AJN Jeugdartsen Nederland voorzitter@ajnjeugdartsen.nl

Mijn laatste JA!

Improviseren

Profileren én verbinden

“Ik maak een stapel van de negen JA!’s waar ik aan heb meegewerkt. Een nieuwe baan betekent afscheid van mijn hoofdredacteurschap van de JA! Op een zichtbaar plekje bij mijn boeken leg ik ze neer. Zo kan ik af en toe naar ze blijven kijken, met liefde en trots.” Jeanne-Marie is onlangs gestart als programmamanager van het RVP bij het RIVM.

“Een weekje sneeuw- en ijspret in coronatijd. Kinderen passen zich snel aan, aan de omstandigheden. Daar neem ik als fotograaf van vier jeugdartsen in dit magazine, een voorbeeld aan! Op anderhalve meter afstand en soms - gedwongen door sneeuw, ijs of code rood - binnen in plaats van buiten. Improviseren en meebewegen met omstandigheden dat maakt het werk van een fotograaf zo leuk.”

“De coronacrisis raakt kinderen en jongeren hard. De Kinderombudsvrouw komt op voor de rechten van het kind. Ik mocht haar interviewen en vond het knap hoe zij zowel duidelijk stelling neemt en haar standpunten profileert, als heel verbindend contact maakt. Die houding past ook goed bij de jeugdarts!”

Jeanne-Marie Hament, hoofdredacteur JA!

Dirk Jansen, fotograaf

Roselin van der Torren, jeugdarts

Ja! magazine


INHOUD

2021 #51 - 4

INHOUDSOPGAVE

06

Vertrouwd contact Het hebben van een vaste jeugdarts draagt bij aan vertrouwd contact met ouders en kinderen, daar is Natascha Cikor van overtuigd. Ze is jeugdarts KNMG bij CJG Rijnmond. Ze vindt bereikbaarheid van de jeugdarts heel belangrijk: “Je weet beter wat er speelt, binnen en buiten de spreekkamer.”

08 Angst na aardbeving Jeugdarts Bianca van Vreeswijk woont en werkt in het aardbevingsgebied in Groningen. Regelmatig gaat ze op huisbezoek bij gezinnen waar kinderen problemen ervaren door de (gevolgen van) aardbevingen. ‘Als het nodig is, verwijs ik door naar specialisten.’

20

Expertise Kinderombudsvrouw Margrite Kalverboer heeft de gevolgen van de lockdown voor kinderen scherp in beeld. Ze benadrukt het belang van een goede leefomgeving, zeker wanneer kinderen niet naar school kunnen.

Ja! magazine

Onderzoek Betere voorzieningen om tienerouders en hun kinderen te helpen, zijn hard nodig, concludeert Margreet de Wolff. Ze is stafarts bij Vérian in de omgeving Apeldoorn en volgt de opleiding tot arts M+G. Voor haar opleiding deed ze onderzoek naar de behoeften van tienerouders.

14


INHOUD

5 - 2021 #51

26

Visie Wat kun je als jeugdarts bijdragen aan de AJN? Bestuurslid Jacqueline Deurloo geeft een overzicht van de mogelijkheden. “Bezig zijn met je vak op een heel andere manier, brengt vaak persoonlijke groei en ontwikkeling.”

34

Achter de voordeur Verpleegkundig specialist Mirjam Jobse komt regelmatig over de vloer bij gezinnen in Rivierenland. Eenmaal achter de voordeur combineert ze hoog-complexe verpleegkundige zorg met laag-complexe medische zorg. Een handige combinatie.

Verder in dit nummer

03 16 19 25 30 37 38

Colofon

Voorwoord Astrid Nielen Dilemma: Jeugdarts zou altijd deel uit moeten maken van het wijkteam Column Nicky Platte Oproep: schrijvers voor JA! gezocht Interview met Els Jonker, voormalig jeugdarts, over wijkgericht werken Recensies Markant: Vijf vragen aan jeudarts-onderzoekster Laura van Hylckama Vlieg

Aan dit nummer werkten mee:

Jacqueline Deurloo, Dirk Jansen, Eric Kampherbeek, Nicky Platte, Roselin van der Torren

Marktvisie: Advertenties, advertorials en pagina’s Marktvisie vallen niet onder de verantwoordelijkheid van de redactie. Rechten: Niets uit deze uitgave mag geheel of gedeeltelijk

COVER: JA! magazine van de AJN

Frequentie: 3 keer per jaar ISSN: 1873-8346 EDITIE: 2021 #51

Hoofdredacteur: Jeanne-Marie Hament Eindredactie: Bureau Bax Redactiecoördinatie: Louise Dijkmans

Model: Esther Ratering met oppaskindje Güneş Fotografie: Eric Kampherbeek

worden overgenomen zonder schrif telijke toestemming en bronvermelding van de uitgever. SECRETARIAAT/CONTACT AJN: Churchillaan 11, 7e etage

ART DIRECTION/SALES:

Elma Media BV, Silvèr Snoek Salesmanager, s.snoek@elma.nl Postbus 18, 1720 AA Broek op Langedijk T: 0226 331 600, I: www.elma.nl ABONNEMENT: Alle AJN-leden ontvangen JA!

Niet-leden kunnen losse nummers bestellen via secretariaat@ajnjeugdartsen.nl.

Ja! magazine

3527 GV Utrecht, T: 0854 894 980 ja@ajnjeugdartsen.nl www.ajnjeugdartsen.nl www.facebook.com/jeugdartsennederland www.twitter.com/jeugdartsen www.linkedin.com/company/ajn-jeugdartsen-nederland/


INTERVIEW

2021 #51 - 6

‘Wees bereikbaar en investeer in je netwerk’ Ja! magazine


INTERVIEW

7 - 2021 #51

Het hebben van een vaste jeugdarts draagt bij aan een vertrouwd contact met ouders en kinderen, daar is Natascha Cikor van overtuigd. Ze is jeugdarts KNMG bij CJG Rijnmond en verdeelt haar tijd over de locaties Brielle en Nissewaard. Ze vindt het belangrijk om goed bereikbaar te zijn voor kinderen en ouders. “Dan weet je beter wat er speelt, binnen en buiten de spreekkamer.” Tekst: Louise Dijkmans Beeld: Dirk Jansen

Natascha werkt nu zes jaar als jeugdarts 0-18 in Brielle. Ze is vooral

maar de fysiotherapeut wel. Dat kan een meerwaarde zijn in het

actief op het consultatiebureau en de basisscholen. Daar heeft ze

vinden van rust en het kan helpen bij de hechting tussen moeder

regelmatig contact met ouders vanwege vaccinaties of gerichte

en kind.”

vragen. “Buiten de officiële afspraken zijn er ook veel losse contactmomenten. Dan komen ouders met een jong kind, maar stellen ze

Vlot bereikbaar

me tegelijk ook vragen over de ontwikkeling van een ouder kind.”

De jonge arts werkt ook in Spijkenisse, gemeente Nissewaard. Met

Natascha neemt in Brielle alle groep 2-consulten voor haar reke-

drie andere jeugdartsen werkt ze samen met het Jeugd Ondersteu-

ning. Ze komt op alle zes de scholen die de plaats rijk is: “Dat helpt

ningsTeam, kortweg JOT. Het onderlinge contact is hier ongewild

om bekendheid te krijgen”, zegt ze lachend.

wat meer op afstand. “Letterlijk, omdat we in tegenstelling tot Brielle over meerdere panden verspreid werken. Je spreekt elkaar

Gecombineerde afspraken

dan vaker telefonisch dan persoonlijk. Als je slechts één deur van

In Brielle is het heel gemakkelijk en snel schakelen met andere

de ander verwijderd bent, loop je - ook met een kleine vraag - veel

professionals om kinderen, jongeren en gezinnen zo goed mogelijk

gemakkelijker even bij elkaar binnen. Dat maakt ook dat je de

te helpen. Het is een kleine gemeente die een, mede vanuit de JGZ

ander beter kent en anders terugkoppelt.” Een andere belangrijke

geïnitieerd, Kind-Zorg Overleg kent. Daarin participeren naast de

factor die bijdraagt aan een optimaal contact, is volgens Natascha

jeugdgezondheidszorg, ook (school)maatschappelijk werk, IB-ers,

een stabiel personeelsbestand met weinig wisselingen.

de gemeente en het samenwerkingsverband VO Voorne-Putten.

Vlot bereikbaar zijn voor ouders en kinderen, vindt ze enorm

Twee tot drie keer per jaar vindt het genoemde overleg plaats

belangrijk. “Dan weet je beter wat er speelt, binnen en buiten de

waarin aan de orde komt wat er goed gaat in Brielle en wat nog

spreekkamer. Kan een gezin bijvoorbeeld de zwemlessen niet beta-

voor verbetering vatbaar is. “We leren van elkaar en elk volgend

len? Dan is het lijntje met de gemeente zo gelegd!” Met een aantal

overleg is vooral een follow-up van onderwerpen die we een vorige

gezinnen trekt ze al langere tijd intensief op, bijvoorbeeld in de

keer bespraken. Soms is er ook een gastspreker.”

zoektocht naar een goede school voor een kind met beperkingen.

Zo kwam een medewerker van Veilig Thuis een keer vertellen over

Dan is er contact met het speciaal onderwijs, maar ook bijvoor-

de Meldcode Huiselijk Geweld en Kindermishandeling. “Dat was

beeld met de revalidatiearts voor onderzoeken en de vertaling

heel verhelderend en gaf een goede boost!” vertelt ze enthousi-

richting de meester of juf. Ze moet meteen denken aan een zesjarig

ast. “De plaatselijke scholen hadden vragen over de Meldcode.

ernstig autistisch jongetje die nog thuis woont. “Bij een open deur

Hoe moet je precies omgaan met het signaleren en melden van

is het kind zo verdwenen, met alle gevaren van dien. Moeder heeft

(vermoedens van) huiselijk geweld en kindermishandeling? Na die

nog een jonger kind om voor te zorgen, dus dat is pittig.” Bij een

middag was het allemaal een stuk duidelijker. Ook dat we elkaar

dergelijke casus is er nauw contact tussen jeugdarts, gemeente en

kunnen ondersteunen bij zorgen.”

gezinscoach, vertelt Natascha. “Samen organiseren we het contact

Natascha haalt ook de Brielse samenwerking aan tussen de fysio-

met deze alleenstaande moeder en haar kinderen, ook buiten een

therapeut, de logopedist en de jeugdarts. Maandelijks vindt er een

hulpvraag om, zoals in deze lastige coronatijd. Je moet het grotere

overleg plaats. “Dan bespreken we een aantal kinderen, uiteraard

beeld niet uit het oog verliezen. Hoe groter en breder je netwerk als

met toestemming van ouders. We kunnen zo eenvoudig doorpak-

jeugdarts, hoe beter. Als je namen kunt noemen, boezemt dat ook

ken bij kleine signalen, elkaars expertise benutten en samen kijken

vertrouwen in bij ouders. Een netwerk is overal. Investeer daarin

naar wat een kind nodig heeft. We regelen dan gecombineerde

en wees open naar elkaar. Dan verwijzen anderen ook weer sneller

afspraken, waar ouders heel blij mee zijn. Bijvoorbeeld bewegings-

naar jou.”

oefeningen samen met logopedische.” Een ander voorbeeld is de Shantala babymassage: “Die bieden we als JGZ-locatie niet aan,

Q

Ja! magazine


ONDERZOEK

2021 #51 - 8

‘Tienerouders vragen niet zelf om hulp’ Betere kansen voor tienerouders en hun kinderen, dat is waar Margreet de Wolff op hoopt en op aanstuurt. Ze is stafarts bij Vérian in de de omgeving Apeldoorn en volgt de opleiding tot arts M+G. Voor haar opleiding deed ze onderzoek naar de situatie en behoeften van tienerouders. “Het ontbreekt aan voorzieningen om deze groep goed te kunnen ondersteunen,” vertelt ze. “Dit vraagt om een nieuwe JGZ-richtlijn!” Tekst: Jeanne-Marie Hament Beeld: Eric Kampherbeek

Hoe ben je betrokken geraakt bij dit onderwerp?

tienermoeders en vijf tienervaders. Gelukkig voordat de corona-

“Ik kreeg een aantal tienerouders kort achter elkaar op mijn spreek-

pandemie uitbrak. Mijn artikel heb ik net afgerond.”

uur. Dat vond ik opvallend. Tijdens een 4-weken consult vroeg ik de moeder hoe het met haar ging, zoals ik altijd doe. Ze antwoordde:

Wat is je het meest bijgebleven aan deze gesprekken?

‘Ik ga morgen weer naar school.’ Dat greep me aan. Toen ik vrij

“Een van de tienermoeders deed een studie van een half jaar. Ze

kort daarna weer een tienermoeder sprak, vroeg ik specifiek naar

was heel gemotiveerd. Tijdens een stage voelde ze zich misselijk

school. Zij bevestigde dat ze ook weer met school ging begin-

en daardoor kwam ze erachter dat ze zwanger was. Ze mocht

nen. Daarmee werd het voor mij duidelijk dat ik graag wat met

haar stage niet afmaken, maar erger nog, ze werd uit de opleiding

dit onderwerp wilde. Normaal werk ik alleen in de 0-4 jaar op het

gezet. Terwijl ze voor de bevalling haar opleiding had kunnen

consultatiebureau. Maar de opleiding heeft als doel om breder te

afronden! Na de bevalling mocht ze dus niet verder. Dat is een van

kijken dan mijn eigen werkgebied. Tienerouders vallen zelf nog

de voorbeelden die mij raakten. Omdat dan de kans dat iemand op

onder de jeugdgezondsheidzorg 12- 21 jaar en hun kindje onder

hetzelfde niveau afstudeert, afneemt. En vervolgens bepaalt dat

de 0-4 jaar. Daardoor is het bij uitstek een thema dat in de jeugd-

ook vaak de toekomst van hun inkomen.”

gezondheidszorg aandacht verdient. Ik besloot mijn onderzoek hieraan te wijden.” Wat wilde je precies onderzoeken? “Ik wilde nagaan wat tienerouders nodig hebben. Ik was dus onder de indruk dat ze zo snel weer naar school moesten en vroeg me daardoor nog veel meer af. Krijgen ze zwangerschapsverlof? Hoe doen ze het met de opvang? Waar gaan ze wonen? Van wie ervaren ze de meeste steun? Door te vragen naar hun ervaringen, wilde ik

‘Ze hebben geen recht op zwangerschapsverlof van school’

een breder beeld krijgen. En inzichtelijk krijgen welke knelpunten er zijn en wat daaraan gedaan zou kunnen worden. Ik heb daarom kwalitatief onderzoek gedaan. Dat wil zeggen dat je door een

Wat zijn knelpunten voor deze jonge ouders?

beperkt aantal diepte-interviews een indruk kunt krijgen van wat

“Een schoolopleiding houdt geen rekening met een zwangerschap

er speelt in deze groep. Ik heb dertien interviews gedaan met acht

van een leerling. Deze jongeren worden afhankelijk van de goodwill

Ja! magazine


9 - 2021 #51

Ja! magazine

ONDERZOEK


ONDERZOEK

2021 #51 - 10

van een school. Omdat je niet ziek bent, maar zwanger, wordt de

met vriendinnen. Ze willen op school zo normaal mogelijk mee-

leerplichtambtenaar niet ingeschakeld. Ze gaan zo kort mogelijk

doen. En daarbij past ook dat ze niet om hulp vragen. Ze willen het

van school. Soms maar twee weken voor de bevalling en twee

graag zelf uitzoeken. Uit mijn onderzoek blijkt dat ze vaak overal

weken erna. Opleidingen raden tienerouders aan een niveau lager

tussendoor geslopen zijn.

te gaan doen, omdat dit makkelijker zou zijn of ze worden uit de opleiding gezet. Dus er zijn geen goede regelingen hiervoor vanuit

En wat is rol van de JGZ?

de scholen.”

“Geen van de geïnterviewde ouders is bij de jeugdgezondheidszorg in beeld geweest. Hoe jammer is dat! Ik denk dat we deze groep

Er wordt dus eigenlijk geen rekening gehouden met deze groep?

alleen gaan zien als we er actief naar vragen op scholen. Want

“Ze vallen letterlijk tussen wal en schip. In een land als Nederland,

de JGZ kan hier heel veel betekenen. Daarnaast maken we soms

waar zoveel sociale regelingen bestaan, zijn er geen regelingen

een denkfout. We denken vaak ‘er zijn er toch heel weinig? Bijna

voor deze groep. Daar was ik geschokt over. Ze zijn niet volwas-

vijfeneenhalf op de duizend kinderen hebben tienerouders. Om te

sen, maar eigenlijk ook geen kind meer. Ze hebben geen recht op

vergelijken: zes op de duizend kinderen per jaar is het aantal kin-

zwangerschaps- en ouderschapsverlof. Ze hebben dus geen recht

deren dat we in de JGZ eruit halen met een hartafwijking. En daar

op tijdelijk schoolverzuim, maar ook geen terugkomgarantie. Als ze

hebben we een hele goede richtlijn voor.”

terugkomen op school, dan houdt school niet altijd rekening met de verantwoordelijkheden die bij het ouderschap horen. Er zijn wel

Zou een JGZ-richtlijn iets kunnen bijdragen?

regelingen voor topsporters en zieke leerlingen, waarom dan ook

“Jazeker, daar wil ik echt voor pleiten. Kennis en een handelingsper-

niet voor tienerouders? Hoe mooi zou het zijn als tienerouders tijd

spectief zorgen er namelijk voor dat we deze groep beter in beeld

hebben om een sensitieve ouder te worden voor hun kind en daar-

krijgen. Het vraagt ook om een goede samenwerking tussen de

naast op een flexibele manier hun opleiding kunnen afronden.”

deelgebieden van 0-4 jaar en 12-19 jaar. De ene jeugdarts zal het kindje zien op het consultatiebureau en de andere zal wat kunnen doen in de begeleiding op school en het welzijn van de ouders. Er moet in ieder geval overleg zijn tussen deze twee. Natuurlijk moet je er wel voor waken dat er teveel mensen betrokken raken,

‘Een JGZ-richtlijn voor tienerouders leidt tot betere kansen voor deze groep’

dat werkt niet goed. Maar buiten de JGZ heb je nog meer partijen nodig om te werken naar betere regelgeving.”

Hoe regelen ze de zorg voor hun kind nu?

Hoeveel tienermoeders zijn er?

“De eerste vier jaar wordt het kind vaak door een grootouder opge-

Het aantal tienermoeders per duizend 15- tot

voed of ze gaan naar de kinderopvang. Want ouders willen graag

20-jarige meisjes is in Nederland het laagst

naar school of ze moeten werken om rond te komen. Realiseer je

van alle EU-landen. Het aantal tienermoeders

ook dat wanneer ze een opleiding volgen, ze geen inkomen krijgen.

neemt al jarenlang af. In 2015 waren dat er 2579

Dat is een extra reden waarom de opleiding vaak wordt afgebro-

(onder leeftijd van 20 jaar) en in 2020 1643. De

ken. Maar na die eerste vier jaar gaat het kind naar de basisschool.

daling is een gevolg van een goede toegang

Vaak wordt er dan van deze ouders verwacht dat ze het ouderschap

tot anticonceptie en een ‘lange traditie van

onder de knie hebben. Maar dat is zeker niet vanzelfsprekend. Door

seksuele voorlichting’. Deze daling is zichtbaar

de omstandigheden hebben ze soms stukken uit dat belangrijke

in alle provincies van Nederland.

hechtingsproces gemist.”

Het onderzoek van Margreet de Wolff laat zien dat de voorzieningen voor deze tienerouders een stuk beter kunnen.

Kan je daar wat meer over vertellen? “Net als andere ouders willen ze goed voor hun kind zorgen en voelen ze zich vaak verantwoordelijk, maar daarnaast voelen ze zich net als andere jongeren. Ze willen leuke dingen doen en uitgaan

Ja! magazine


11 - 2021 #51

ONDERZOEK

Wat levert het de samenleving op als er meer geregeld wordt

centage zelfs 63 procent. Betere regelingen voorkomen armoede,

voor tienerouders?

werkloosheid, kindermishandeling, huiselijk geweld en schulden.

“Het zal leiden tot betere kansen voor deze ouders en kinderen. Het

En als je het positiever bekijkt; het zorgt ervoor dat iemand die

voorkomen van schooluitval gaat verder dan alleen de generatie

vroeg zwanger wordt toch een toekomst kan hebben, die hij of zij

van de tienerouder. Uit onderzoek blijkt dat wanneer de ouder

wenst voor zichzelf en voor het kind.’

gestopt is met school de kans dat het kind ook vroegtijdig school verlaat 53 procent is en onder de lage SEP met veel stress is dat per-

Q

Ja! magazine


Advertentie

HMO’S: DE UNIEKE BESTANDDELEN VAN MOEDERMELK

Moedermelk is uniek en bevat bijzondere bestanddelen, waaronder zogenoemde Human Milk Oligosaccharides (HMO’s).1 HMO’s zijn onverteerbare vezels die zorgen voor een uitgebreide en gevarieerde darmmicrobiota. Een gezonde darmmicrobiota legt de basis voor een gezonde darm en daarmee een gezond immuunsysteem aangezien 70% van de immuuncellen zich in de darmwand bevinden.2,3

Moedermelk is uniek, mede door HMO’s Op dit moment zijn er ruim 200 verschillende van deze prebiotische oligosacchariden beschreven. Ze zijn ruim aanwezig in moedermelk. In een liter zit maar liefst 12-15 gram HMO’s.4,5 Dit is meer dan er eiwit in moedermelk zit. Het eiwitgehalte van moedermelk ligt namelijk rond de 9-10 gram per liter.4-5 Onderzoek naar HMO’s maakt duidelijk dat deze stoffen een rol spelen bij de ontwikkeling van de darmmicrobiota en zo invloed hebben op de opbouw van het immuunsysteem.2,6 HMO’s zorgen voor gunstige darmmicrobiota De HMO’s in moedermelk fungeren allemaal als voeGLQJVE  RGHPYRRUVSHFLæHNHEDFWHUL­QLQGHGDUPPLFUR 1,7,8 biota. 0HWQDPHELæGREDFWHUL­QHQODFWREDFLOOHQJHGLMHQ

RS+02ØVHQGDW]RUJWPHGHYRRUHHQELæGRJHQHGDUP PLFURELRWDGHGDUPPLFURELRWDGLH]RVSHFLæHNLVYRRU borstgevoede zuigelingen. Bij de ontwikkeling van deze darmmicrobiota ontstaan korteketenvetzuren, die belangrijk zijn voor de gezondheid van de darmwand. Ook laten de korteketenvetzuren de pH van de darminhoud dalen en dat is ongunstig voor ziekteverwekkende bacteriën.9-12 Maar HMO’s doen nog meer. Ze blijken een direct effect te hebben op immuuncellen.2,3,13 Ook kunnen ze een blokkade vormen voor pathogenen.13,14 Op die manier ondersteunen HMO’s het immuunsysteem nog meer. Werking HMO’s nabootsen Al met al zijn HMO’s dus belangrijke bestanddelen van moedermelk die men graag zou willen nabootsen in


çHVYRHGLQJ+HWPDNHQYDQ+02ØVLVFRPSOH[1XWULORQ PHW3URQXWUD$'9$1&(EHYDWDOMDDUHHQSUHELRWLVFKH YH]HOPL[GLHTXDZHUNLQJLQGHULFKWLQJNRPWYDQ+02ØV 'HYH]HOPL[*26OF)26EHVWDDWXLWNRUWH NHWHQJDODFWRROLJRVDFFKDULGHQ *26 HQODQJH NHWHQIUXFWRROLJRVDFFKDULGHQ )26 'HPHHUGDQ bYHUVFKLOOHQGHROLJRVDFFKDULGHQLQGH]HYH]HOPL[ benaderen de hoeveelheid, diversiteit en functionaliteit van HMO’s in moedermelk.15-18 Er zijn inmiddels meer dan 30 studies uitgevoerd, ZDDUXLWEOLMNWGDWGH]HYH]HOPL[GHJURHLYDQHHQ JXQVWLJHELæGRJHQHGDUPPLFURELRWDYDQçHVJHYRHGH baby’s stimuleert en daarmee de ontwikkeling van hun immuunsysteem ondersteunt.8,19-21

Natuuridentieke HMO 3’GL 1DDVWGH]HSUHELRWLVFKHYH]HOPL[EHYDW1XWULORQPHW 3URQXWUD$'9$1&(HHQVSHFLæHNH+02Ø*/'H]H HMO, die voluit HMO 3’- galactosesyllactose heet, heeft een beschermend effect op de darmbarrière.3,Q1XWULORQ ontstaat deze natuuridentieke HMO als postbiotica in het XQLHNHODFWRæGXVIHUPHQWDWLHSURFHV'RRUGHFRPELQDWLH YDQGHSUHELRWLVFKHYH]HOPL[*26OF)26HQGHSRVW ELRWLFD+02Ø*/ZRUGWHUQRJEHWHUELMJHGUDJHQDDQGH opbouw van de darmmicrobiota en de ontwikkeling van KHWLPPXXQV\VWHHPYDQçHVJHYRHGHEDE\ØV15-18 Meer lezen? 6FDQGH45FRGHRIJDQDDU www.nutriciavoorprofessionals.nl/ çHVYRHGLQJKPR

GUNSTIG VOOR DE DARMMICROBIOTA27 PROBIOTICA: goede bacteriën die in de darm kunnen groeien en de gezondheid van de darm stimuleren.28,29

POSTBIOTICA: stoffen die ontstaan bij de vertering van prebiotica. Die stoffen stimuleren de gezondheid van de darm.30-34

PREBIOTICA: vezels zoals HMO (human milk oligosachariden) die een goede YRHGLQJVERGHPYRUPHQYRRUJXQVWLJHELæGREDFWHUL­Q8,35

SYNBIOTICA: VRPPLJHFRPELQDWLHVYDQSUHHQSURELRWLFD]LMQH[WUDJXQVWLJ Die combinaties noemt men synbiotica.

Referenties: 1.%RGH/  7KHIXQFWLRQDOELRORJ\RIKXPDQPLONROLJRVDFFKDULGHVEarly Human Development 91. 619–622. 2.%RGH/  +XPDQPLONROLJRVDFFKDULGHVHYHU\EDE\QHHGVDVXJDUPDPDGlycobiology. 62. b9DUDVWHK6et al.  +XPDQPLONROLJRVDFFKDULGHØJDODFWRV\OODFWRVHFDQSURWHFWWKHLQWHVWLQDOEDUULHUWRFKDOOHQJHV3RVWHUSUHVHQWDWLHWLMGHQV(63*+$1FRQIHUHQFHMXQL*ODVJRZ6FRWODQG4. McVaegh P et al. (1997) +XPDQPLONROLJRVDFFKDULGHVRQO\WKHEUHDVWJ Pediatr Child Health5.7KXUO6et al.  6\VWHPDWLFUHYLHZRIWKHFRQFHQWUDWLRQVRIROLJRVDFFKDULGHVLQKXPDQPLONNutrition Reviews  (LZHJJHU7et al. (2004) +XPDQPLONGHULYHGROLJRVDFFKDULGHVDQGSODQWGHULYHGROLJRVDFFKDULGHVVWLPXODWHF\WRNLQHSURGXFWLRQRIFRUGEORRG7FHOOVLQYLWURPediatr Res  6. Walker W (2013) Initial intestinal colonization in the human infant and immune homeostasis. Ann Nutr Metab6XSSO7.5H]D±NL/et al.  $VSHFLæFPL[WXUHRIVF*26OF)26/&38)$LQFUHDVHVIDHFDOELæGREDFWHULDLQKHDOWK\\RXQJFKLOGUHQSRVWHU:&3*+$17DLSHL8.0RUR*et al. (2002) Dosage-related ELæGRJHQLFHIIHFWVRIJDODFWRDQGIUXFWRROLJRVDFFKDULGHVLQIRUPXODIHGLQIDQWVJPGN  9. 6]DMHZVND+et al.  )HUPHQWHGLQIDQWIRUPXODVZLWKRXWOLYHEDFWHULDDV\VWHPDWLFUHYLHZEur J Pediatr10. 0DUWLQ5et al.  (DUO\OLIHJXWPLFURELRWDDQGLPPXQHGHYHORSPHQWLQLQIDQF\Benef MicrobesÕ11. McDermott AJ et al.  7KHPLFURELRPHDQGUHJXODWLRQRIPXFRVDOLPPXQLW\ImmunologyÕ12.2R]HHU5et al.  *XW KHDOWKSUHGLFWLYHELRPDUNHUVIRUSUHYHQWLYHPHGLFLQHDQGGHYHORSPHQWRIIXQFWLRQDOIRRGVBr J NutrÕ13.%RHKP*et al. (2003) Prebiotic concept for infant nutrition, Acta Paediatr Suppl  14. Knol J et al. (2005) &RORQPLFURçRUDLQLQIDQWVIHGIRUPXODZLWKJDODFWRDQGIUXFWRROLJRVDFFKDULGHVPRUHOLNHEUHDVWIHGLQIDQWVJ Pediatr Gastroenterol Nutr 15.+XHW)et al.  3DUWO\IHUPHQWHGLQIDQWIRUPXODHZLWKVSHFLæFROLJRVDFFKDULGHV VXSSRUWDGHTXDWHLQIDQWJURZWKDQGDUHZHOOWROHUDWHGJ Pediatr Gastroenterol Nutr  H16.&DPSHRWWR)et al.  $IHUPHQWHGIRUPXODLQSUHWHUPLQIDQWVFOLQLFDOWROHUDQFHJXWPLFURELRWDGRZQUHJXODWLRQRIIDHFDOFDOSURWHFWLQ and up-regulation of faecal secretory IgA. Br J Nutr  17.7LPV6et al.  *XWPLFURELRWDFRPSRVLWLRQPRGXODWLRQE\SDUWO\IHUPHQWHGLQIDQWIRUPXODHVXSSOHPHQWHGZLWKSUHELRWLFVVF*26OF)26J Pediatr Gastroenterol Nutr18.5RGULJXH]+HUUHUD$et al.  $SDUWO\IHUPHQWHGLQIDQWIRUPXODZLWKSUHELRWLFVVF*26OF)26PRGXODWHVWKHJXWPLFURELRWDIXQFWLRQLQJWRZDUGVDPRUHEUHDVWIHGOLNHPLFURELRWD3UHVHQWHGRQ0D\DWWKH VW$QQXDO0HHWLQJ(63*+$1LQ*HQHYDb$UVODQRJOX6et al.  (DUO\GLHWDU\LQWHUYHQWLRQZLWKDPL[WXUHRISUHELRWLFROLJRVDFFKDULGHVUHGXFHVWKHLQFLGHQFHRIDOOHUJLFPDQLIHVWDWLRQVDQGLQIHFWLRQVGXULQJWKHæUVWWZR\HDUVRIOLIH J Nutr  20.6FKROWHQV3et al.  )HFDOVHFUHWRU\LPPXQRJOREXOLQ$LVLQFUHDVHGLQKHDOWK\LQIDQWVZKRUHFHLYHDIRUPXODZLWKVKRUWFKDLQJDODFWRROLJRVDFFKDULGHVDQGORQJFKDLQIUXFWRROLJRVDFFKDULGHVJ Nutr 21.0RUR*HWDO  $PL[WXUHRISUHELRWLFDROLJRVDFFKDULGHVUHGXFHVWKHLQFLGHQFHRIDWRSLFGHUPDWLWLVGXULQJWKHæUVWVLFPRQWKRIDJHArch Dis Child 91(10)814-8194. 22.KWWSWKRXVDQGGD\VRUJ23.%HONDLG  &HOO 24.9DQKHHV  &0/6Õ25. :HVW  -$&,  26.9LJKL  -&(, 6 Õ27.0DUWLQ  %0LFUREHVÕ28.9DQGHQSODV  $FWD3Õ29.+XQW  3/26  H 30.$JXLODU  7L)6 7  Õ31.7KLEDXOW  -3*1Õ32.,QGULR  35HVÕ33.&ROODGR  %0LFUREHV  Õ34.7VLOLQJLUL  %0LFUREHV  35. Vandenplas (2015) %-1Ý%RUVWYRHGLQJLVGHEHVWHYRHGLQJYRRUEDE\ØV'H]HLQIRUPDWLHLVXLWVOXLWHQGEHVWHPGYRRU SDUD PHGLFLÝ1XWULFLD1HGHUODQG%93RVWEXV$.=RHWHUPHHUÝ)HEUXDUL


INTERVIEW

2021 #51 - 14

‘We vragen nu standaard naar de aardbevingen’ Ja! magazine


15 - 2021 #51

INTERVIEW

Jeugdarts Bianca van Vreeswijk woont en werkt in het aardbevingsgebied in Groningen. Met enige regelmaat gaat ze op huisbezoek bij gezinnen waar kinderen problemen ervaren door (gevolgen van) de aardbevingen. “Er is stress, verdriet en angst.” Tekst: Bureau Bax Beeld: Dirk Jansen

Nog niet zo lang geleden had Bianca een moeder met haar jongste

wijk. “Met een verhaal in het dorpsblad of de lokale krant, vestigen

zoon op haar spreekuur. Ze had ook haar oudste dochter bij zich en ver-

we de aandacht even op het werk van de JGZ. We hangen posters

telde en passant dat haar dochter veel last had van de aardbevingen.

op en plaatsen berichten op sociale media. We vinden het belang-

“Ik stelde het meisje wat vragen, maar ze was heel teruggetrokken en

rijk dat ouders en kinderen weten dat ze bij ons terecht kunnen. We

gesloten,” vertelt Bianca. “Ik heb toen met haar moeder afgesproken dat

zijn daarom aanwezig bij informatieavonden op scholen of in de

ik nog eens bij ze thuis langs zou komen om erover te praten.”

wijk over thema’s waar wij iets in kunnen betekenen. Zo hebben we

De middag dat Bianca bij het gezin op huisbezoek ging, trof ze een

tijdens dat soort avonden voorlichting gegeven over de problemen

heel ander meisje aan. “Ze was veel opener. Ze liet me foto’s zien

die kinderen kunnen ervaren door de aardbevingen. Zichtbaarheid

van haar oude huis en haar oude kamer. Ze moest huilen toen ze

en preventie zijn daarbij onze belangrijkste doelen.”

vertelde over de sloop. Al pratend kwamen er allerlei dingen naar boven, die soms ook voor de ouders nieuw waren.”

Theatermakers en bouwvakkers Op het gebied van preventie werkt de JGZ-afdeling van de GGD

Gradaties

Groningen niet alleen samen met de gebruikelijke professionals,

“We hebben de aardbevingen tot onderwerp van gesprek gemaakt

zoals kindercoaches, jeugdconsulenten en GGZ-professionals, maar

in de spreekkamer,” vertelt Bianca. “De aardbevingen zijn een heel

zijn er ook meer opvallende samenwerkingen. “We hebben contact

specifiek probleem in deze regio. We vragen er nu heel specifiek

met een groep theatermakers die op scholen in onze regio projecten

naar, ook op basisscholen waar we komen.”

rondom het aardbevingsthema organiseren. Daarbij is veel ruimte

De noodzaak blijkt uit verschillende casuïstiek; kinderen en jongeren

voor emoties. Op die manier kunnen de projecten een preventieve

in het gebied die problemen ervaren door de aardbevingen. Precieze

werking hebben, want op het moment dat je kunt praten over

aantallen kan Bianca niet noemen. “Er zijn veel gezinnen die te ma-

heftige gebeurtenissen, kan het de druk verminderen.” De jeugdarts

ken hebben met deze problematiek, maar daarin zijn gradaties aan

heeft voor de theatermakers een lijst gemaakt met punten waar ze

te brengen. Bijvoorbeeld in de schades.” Er zijn huizen met enkel-

op moeten letten bij de kinderen. “Zo weten ze wanneer ze aan de bel

voudige schades die gerepareerd kunnen worden. Er zijn woningen

moeten trekken. Als ze iets signaleren, schakelen ze ons in.”

die versterkt moeten worden, maar soms ook gesloopt en opnieuw

Een ander bijzonder contact is dat met de werklieden die in de

gebouwd zodat ze aardbevingbestendig zijn. “Zo’n sloop is natuurlijk

getroffen huizen werken. “Om preciezer te zijn, met de trainers van

heel impactvol. Ik heb het zelf ook meegemaakt. Als gezin moet je

deze vaklieden. Iedereen die in het aardbevingsgebied werkt aan

dan je woning verlaten, tijdelijk naar een wisselwoning, totdat er een

herstel of sloop van woningen, krijgt een speciale training. Wan-

nieuwe woning beschikbaar is. Dat kan tot enorm veel stress leiden.”

neer een aantal mannen over de vloer komt om werkzaamheden te

Maar, benadrukt Bianca, de ene persoon is weerbaarder dan de

verrichten na een aardbeving, kan dat voor kinderen beangstigend

andere. “Sommige kinderen hebben er nauwelijks last van.”

zijn. Wij hebben met de trainers het onderwerp ‘kinderen en aard-

Het kan ook een ander aspect zijn waar een kind last van heeft.

bevingen’ besproken. Zij nemen dit mee in hun trainingen.”

“Niet de stress en het verdriet van de sloop en de verhuizing, maar

Bianca herinnert zich hoe het was toen er werklieden bij haar gezin

de aardbevingen zelf kunnen kinderen in de problemen brengen.

over de vloer kwamen. “Dat deden ze erg goed. Een van de mannen

Ze kunnen daar angstig van worden.” De jeugdarts en haar collega’s

stelde zich even voor aan mijn dochter. Samen met haar heeft hij

bekijken per casus wat nodig is. “De ene keer helpt een aantal

haar kamer opgemeten. En later mochten mijn kinderen verhuisdo-

gesprekken, de andere keer gaan we een langer traject in. Als het

zen versieren. Dat soort aandacht helpt.”

specialistisch is, verwijzen we door.” Q

Wijkavonden Om ervoor te zorgen dat gezinnen de jeugdgezondheidszorg weten te vinden, proberen Bianca en haar collega’s zichtbaar te zijn in de

Ja! magazine


DILEMMA

‘In elk wijkteam hoort een jeugdarts!’

Oh ja, is dat zo? Moeten zij letterlijk aan de overlegtafel zitten of bereikt hun expertise ook wel op afstand het wijkteam? De meningen over deelname aan het wijkteam of een rol in de achterlinie zijn verdeeld.

2021 #51 - 16

UITDAGINGEN VOOR PREVENTIE

VOOR DE BREDE BLIK

“Het is niet nodig dat er in elk wijkteam een jeugdarts zit. Essentieel is dat er samengewerkt wordt tussen de wijkteams en de jeugdartsen. Wijkteams ondersteunen inwoners bij het voeren van regie over het eigen leven. Ze hebben daarbij zicht op hetgeen hierbij zou kunnen helpen. Én zij hebben de taak om dit vervolgens onderdeel te maken van het (begeleidings)plan van een inwoner. Dit plan kan zaken bevatten voor het hele gezin in het kader van 1-gezin-1-plan. Wijkteams kunnen in de volle breedte van een vraag, ondersteuning bieden of hulp inzetten als dit nodig is. Jeugdartsen hebben in de opgroeifase van een kind onder meer een belangrijke signalerende rol. Zij zien signalen die niet altijd zichtbaar worden bij andere professionals. De rol van jeugdartsen is daarmee complementair aan de rol van de wijkteams. Met name in de vroegsignalering van problemen in de opvoeding en bij het opgroeien van kinderen, is een kwalitatief goede samenwerking tussen de wijkteams en jeugdartsen onontbeerlijk. Het is hierin belangrijker om elkaars kwaliteiten te (h)erkennen en tijdig in te zetten, dan samen onderdeel uit te maken van één wijkteam. Een goede samenwerking gaat echter nooit vanzelf. Het is noodzakelijk om op alle niveaus van organisaties voorwaarden te scheppen voor samenwerking en dit te faciliteren. Dit kan binnen een wijkteam, maar kan zeker ook daarbuiten. Vanuit de Wijkteams Enschede, in bijzonder vanuit de schoolwijkcoaches, werken we in het onderwijs samen met alle partners in het onderwijs. De jeugdartsen van de GGD (JGZ) maken hier ook onderdeel vanuit. In het kader van ‘je hoeft niet ziek te zijn om beter te worden’, zien we zeker mogelijkheden om de samenwerking met de jeugdartsen te verbeteren. Het gaat hier met name om uitdagingen op het gebied van preventie. In Twente worden hierin mooie stappen gezet samen met de zorgverzekeraars, gemeenten, GGD Twente en de zorgaanbieders. De komende tijd zal verkend worden hoe de Wijkteams Enschede hier ook actief bij aan kunnen sluiten. Hierdoor zal de samenwerking met jeugdartsen meer vorm en inhoud krijgen.”

“Ik werk als jeugdarts bij de GGD Amsterdam en maak deel uit van het Ouder- en Kindteam Slotervaart. Als jeugdarts ben ik gekoppeld aan een vo-school en het bijbehorende zorgadviesteam (ZAT) van de school. Ik ben van mening dat in een wijkteam een jeugdarts hoort te zitten. Jeugdartsen hebben een brede blik, zowel op gezondheid als op het sociale domein. Zij weten wat het maatschappelijk werk doet, of wanneer je een orthopedagoog of een medisch specialist nodig hebt. Met mijn collega’s in het wijkteam werk ik veel samen. Zo nam ik laatst contact op met de jeugdpsycholoog over een meisje met een traumatische ervaring. Zij kon een dag later al langskomen. Geweldig, die snelle hulp! Het is de bedoeling dat wijkteams zélf met lichtere problematiek aan de slag gaan. Ook kijkt ons team naar maatschappelijke problemen in de wijk en bedenkt dan wat wij op wijkniveau kunnen inzetten. Wat wij aan expertise niet in het team hebben, zit er direct omheen. Denk aan jongerenwerkers, de huisarts, kinderarts en Veilig Thuis. De lijnen zijn kort. Een aantal collega’s schuift ook af en toe aan bij casuïstiekbesprekingen. Het functioneert prima zo. Af en toe is het wel lastig dat het wijkteam aan een school in de wijk gekoppeld is omdat leerlingen uit andere wijken kunnen komen. Als zij hulp nodig hebben, moet je soms bij een ander wijkteam aankloppen. Sommige hulp werkt nu eenmaal beter dicht bij huis.”

WILLEM LOUPATTY

RAQUEL ABRAHAMS

Directeur-bestuurder, SMD / Wijkteams Enschede

Jeugdarts GGD Amsterdam

Ja! magazine


17 - 2021 #51

VASTE CONTACTPERSONEN

SAMEN VERSCHIL MAKEN

“Hoewel het natuurlijk ontzettend fijn zou zijn om de expertise van een jeugdarts in je team te hebben, ben ik er geen voorstander van om een jeugdarts vast aan elk wijkteam te koppelen. Als ik kijk naar hoe de constructie van de wijkteams nu geregeld is in Nijmegen bijvoorbeeld, zou dit er voor zorgen dat de jeugdartsen wekelijks meerdere uren bezig zijn met overleggen over casussen in plaats van daadwerkelijk kinderen te zien of spreken. Daar komt bij dat het gros van de aanmeldingen geen of minimale deskundigheid van een jeugdarts vraagt. Ook is een constructie met een vaste persoon gekoppeld aan een team kwetsbaar met betrekking tot continuïteit en is de kwaliteit erg afhankelijk van de samenwerking. Waar wat mij betreft winst te behalen valt, is betere afspraken maken tussen verschillende partijen waardoor we elkaar eenvoudiger kunnen vinden op het moment dat we elkaar nodig hebben of ruggespraak wenselijk is. Hierbij valt te denken aan vaste contactpersonen voor vragen, spreekuren voor verwijzers of netwerktafels waarbij meerdere disciplines (bijvoorbeeld jeugdarts, jeugd GGZ, jongerenwerk, jeugdbescherming en Veilig Thuis) aansluiten om casuïstiek anoniem bespreken. De netwerktafel is iets waar ze bijvoorbeeld in Wijchen mee werken en waar positieve ervaringen mee zijn. Vanuit het wijkteam werken we nu samen met consultatiebureaus, huisartsen en jeugdartsen die gekoppeld zijn aan scholen. Daar is een directe lijn met schoolmaatschappelijk werk die aansluiten bij Zorg Advies Teams. Op die manier is beschikbaarheid van kennis over fysieke en psychische ontwikkeling evenals medische kennis geborgd. Helaas wordt daar niet altijd gebruik van gemaakt dus daar ligt absoluut ruimte voor verbetering.”

“Ik vind dat elk wijkteam nauwe samenwerkingsafspraken zou moeten hebben met de jeugdarts. De ambitie van de gemeenten regio IJsselland is dat kinderen in een veilige en gezonde leefomgeving opgroeien. Ouders voelen zich gesteund in de opvoeding, de jeugdgezondheidszorg is goed en nabij georganiseerd. Een jeugdarts maakt hier vanzelfsprekend onderdeel van uit. In IJsselland willen we een cultuurverandering in de keten bereiken: een beweging op gang brengen die zich primair richt op de versterking van eigen regie van mensen: Het gesprek voeren over wat normaal is en wat er nodig is, als het anders loopt en even niet lukt. Dit vraagt samenwerking in de keten van het sociale domein: jeugdgezondheidszorg, kinderopvang, onderwijs, jongerenwerk en sportverenigingen. De jeugdarts is bij uitstek opgeleid om te onderzoeken of er sprake is van kindfactoren zoals ontwikkelingsstoornissen waarvoor ondersteuning en verwijzing noodzakelijk is, of dat het gaat om een reactie op omgevingsfactoren zoals gezinsproblemen (armoede, ouderschap-competenties, kindermishandeling) of niet passend onderwijs. In de gemeente Raalte starten we dit jaar met de wijkaanpak. Samen met verschillende partners zoeken we actief de verbinding met de inwoners om informatie op te halen. Hoe beleven zij het wonen in hun wijk? Wat gaat goed en waar is verbetering mogelijk? Het centrum voor jeugd en gezin (CJG) sluit als één van de partners aan. Door de sociaal-medische specialisatie die de jeugdarts inbrengt in het wijkteam of CJG, kan er ten aanzien van de problematiek van het kind vaker worden genormaliseerd en gedemedicaliseerd. Er wordt een beroep gedaan op het sociale wijkteam of CJG om de problemen in de context aan te pakken, waarmee voor het kind en het gezin uiteindelijk duurzamere oplossingen worden gevonden. Samenwerking met verschillende partijen en het kijken vanuit verschillende perspectieven maken hierin het verschil!”

RICHARD DIJKEMA

GERRIA TOETER-AALDERINK

Medewerker sociaal Wijkteam Nijmegen (West) - Team Jeugd bij sterker sociaal werk

Wethouder sociaal domein, gemeente Raalte

Ja! magazine

DILEMMA

Doorpraten over de stelling? Dat kan in de app van de AJN (Forum). Liever mailen? Stuur je bericht naar: ja@ajnjeugdartsen.nl


Geaccrediteerd voor jeugdartsen

Gezonde voeding is belangrijk voor de groei en ontwikkeling van het jonge kind en legt een stevig fundament voor de gezondheid op latere leeftijd. Een gevarieerde voeding met hoofdzakelijk basisvoedingsmiddelen levert hiervoor de benodigde voedingsstoffen. Al op jonge leeftijd ontwikkelen kinderen voedingsgewoonten die bepalend zijn voor hun voedingspatroon later in het leven. E-learning: Jong geleerd is oud gedaan In de e-learning leer je meer over smaakontwikkeling bij kinderen, goede voeding voor kinderen, hoe om te gaan met kinderen die moeilijk eten en de rol van de ouder. • Ontwikkeld en geaccrediteerd voor (kinder)diëtisten, jeugdverpleegkundigen en jeugdartsen (jeugdarts KNMG of arts Maatschappij en Gezondheid, profiel Jeugdgezondheidszorg) • Relevante onderwerpen over goede voeding voor kinderen vanaf 1 jaar • Volg de e-learning wanneer het jou uitkomt

Meer informatie en aanmelden www.fci-academy.nl

Ben je een voedings- of gezondheidsprofessional en wil je meer weten over zuivel, voeding en gezondheid? Bezoek dan onze website en schrijf je in voor onze nieuwsbrief. www.frieslandcampinainstitute.com/nl institute.nl@frieslandcampina.com Facebook: /FrieslandCampina Institute Twitter: FCInstitute_NL


Column

19 - 2021 #51

Nukkige puber Met een moeder als leerkracht en een vader als bedrijfsarts was het misschien alleen maar logisch om jeugdarts te worden. Ruim acht jaar werk ik nu als jeugdarts bij de GGD Zuid Limburg. In deze periode heb ik al diverse standplaatsen gehad, meestal buiten mijn eigen woonplaats. Uiteraard woon ik in één van de mooiste regio’s in Nederland, dus reizen is meestal geen bezwaar. In de eerste jaren als jeugdarts ging mijn aandacht vooral naar het werk in de spreekkamer. Op het moment dat ik dit meer onder de knie kreeg, ging mijn blik meer naar buiten. Vooral als ik op ‘mijn scholen’ kom: ik proef de sfeer in en om school. Het is de plek waar kinderen zich moeten ontwikkelen. Zo’n school voelt als mijn wijk, al is het soms juist wijk-overstijgend, vooral bij het voortgezet onderwijs. Graag zou ik willen dat adolescenten beter in beeld zijn. Het lijkt alsof er vergeten wordt dat ook zij faciliteiten nodig hebben, en dat samenwerking buiten gemeentegrenzen nodig is. Een community is niet altijd scherp te omlijnen op een kaart. Ik zie vaak kwetsbare jongeren die de acties van hun handelen nog niet kunnen overzien, die uitdagingen gaan zoeken op verkeerde plekken. Zo vond een tijd geleden een flinke escalatie plaats tussen twee jongerengroepen. De ene groep beschikte over een vuurwapen. In de andere groep werd iemand totaal in elkaar geslagen en werd een gezin bedreigd met molotovcocktails. Zo’n groep, dat klinkt misschien onpersoonlijk, maar voor mij was het dat niet. Ik ken een aantal van deze jongeren. Ik weet welke impact dit heeft op hun leven en dat van het gezin waar ze toe behoren. Toekomstplannen worden overhoop gehaald, motivatie waar hard naar is gezocht, gaat in rook op. Hoe kan dit gekeerd worden, of nog belangrijker, hoe kan dit in de toekomst voorkomen worden? Ik zorg voor een puber én zijn hele groep, daar wil ik voor staan in ‘mijn wijk’. Het netwerk dat ik daarbij nodig heb, is soms net een nukkige puber. Het vraagt investering in de vertrouwensrelatie, out-off-the box denken en volhouden. Gelukkig heb ik hiervoor in de spreekkamer de competenties geleerd.

Nicky Platte jeugdarts

Ja! magazine


Expertise

2021 #51 - 20

Ja! magazine


21 - 2021 #51

Expertise

‘Elk kind heeft recht op een individuele aanpak’ “Een goede leefomgeving is van grote waarde voor de ontwikkeling van kinderen”, aldus Margrite Kalverboer, Kinderombudsvrouw en hoogleraar Kind, (Ortho)pedagogiek, Kinderrechten en Vreemdelingenrecht. Een gesprek, midden in de tweede lockdown, over kinderrechten, de invloed van schoolsluitingen en de gevolgen van de lockdown.

Tekst: Roselin van der Torren Beeld: Kinderombudsman.nl

Welke invloed hebben schoolsluitingen op kinderen?

wie thuis ruzie of geweld is, goed in beeld te hebben of te krijgen en

“Uit wetenschappelijk onderzoek naar de impact van de schoolslui-

voor fysiek onderwijs te zorgen.”

ting tijdens de eerste lockdown in maart 2020, blijkt dat er leerachterstanden zijn ontstaan en met name een groeiende kansenonge-

Zitten er ook goede kanten aan een lockdown?

lijkheid. Ook was er een toename van het aantal kinderen dat fysiek

“We vroegen kinderen in hetzelfde onderzoek een cijfer te geven

of emotioneel geweld ervoer in de thuissituatie. Daarvan weten

aan hun leven. Wat mij in positieve zin opviel, is dat het cijfer in

we dat het enorme impact heeft op de ontwikkeling van kinderen.

coronatijd hetzelfde bleef. Kinderen blijken dus veerkrachtig. Veel

Al met al een zorgelijke situatie. En hoe langer een schoolsluiting

van hen beschrijven ook voordelen van de lockdown; ze kunnen

duurt, hoe groter de groep kwetsbare kinderen wordt.”

hun eigen leertempo bepalen, ze hebben meer contact met hun ouders en ze ervaren minder stress. Echter de al bekende verschil-

Hoe ervaren kinderen een lockdown?

len in ervaren kwaliteit van leven tussen groepen kinderen blijven

“Tussen april en oktober vorig jaar hebben we met een vragenlijst

bestaan.”

tweeduizend kinderen gevraagd naar wat ze belangrijk vonden als er een volgende lockdown zou komen. Ze gaven toen aan dat ze

Zijn die verschillen groot?

hun vrienden misten, dat (eventueel online) onderwijs kwalitatief

“Ja, er bestaan grote verschillen in de cijfers die kinderen hun leven

goed moest zijn en dat er gezamenlijke kinderactiviteiten moes-

geven. Elke twee jaar doen we de enquête Als je het ons vraagt. Daar

ten blijven plaatsvinden. Ook kwam heel duidelijk naar voren dat

komt uit dat kinderen die opgroeien zonder grote problemen hun

de groep kinderen die in de thuissituatie geweld ervaart, fysiek

leven een 8,3 geven, een hoog cijfer. Echter als een kind in een gezin

onderwijs op school wil krijgen. Andere kinderen waar problemen

opgroeit waar een enkelvoudig probleem speelt, dan zakt dat cijfer

spelen, zoals armoede of een complexe scheiding, wilden vooral

naar een 7,2. Bij kinderen die opgroeien in een thuissituatie waar

goed online onderwijs. Het is dus heel belangrijk om kinderen bij

geweld plaatsvindt, is dat een 6,7. En kinderen in gesloten instel-

Ja! magazine


Expertise

2021 #51 - 22

lingen geven hun leven slechts een 5,6. De verschillen zijn dus groot

de leefomgeving rondom het kind, zoals huisvesting, school, zorg

en geven aan dat de omgeving van een kind van grote invloed is op

voor de ouders, enzovoorts.”

de kwaliteit van leven.” Wordt er bij de coronamaatregelen ook rekening gehouden met Welke factoren zijn nog meer van invloed?

deze zaken?

“Samen met Elianne Zijlstra heb ik in het zogenaamde BIC-model

“We zijn verplicht volgens het VN-kinderrechtenverdrag om bij alle

(‘belang van het kind en voorwaarden voor ontwikkeling’-model)

besluitvorming af te wegen wat dit betekent voor kinderen en de

veertien condities beschreven die goed genoeg moeten zijn om te

belangen van kinderen als eerste overweging mee te nemen. Daar-

leiden tot een fijne kindertijd en een optimale ontwikkeling van het

om hebben we het kabinet opgeroepen om fysiek onderwijs als

kind. Een deel van deze factoren bevindt zich in de gezinssituatie,

primair uitgangspunt te nemen bij de belangenafweging rondom

zoals bijvoorbeeld veiligheid, verzorging, een affectieve opvoed-

de schoolsluiting. Ik pleit ook voor extra ondersteuning voor herstel

stijl, interesse van ouders in het kind en continuïteit en stabiliteit.

in de periode hierna om leerachterstanden weg te werken.”

Maar de andere helft van deze factoren speelt zich af in de directe leefomgeving van het kind en in de samenleving, zoals een veilige

Hoe kunnen we kwetsbare kinderen het beste helpen?

buurt, respectvolle omgang met buurtgenoten, sociaal vangnet,

“Ik heb de toolkit Het beste besluit ontwikkeld, die individuele

school en voorleefgedrag vanuit de samenleving. De buurt waarin

hulpverleners en organisaties helpt het belang van het kind te

een kind opgroeit en de school spelen dus ook een grote rol.”

onderzoeken en voorop te zetten en zo tot goede besluitvorming te komen. Het bestaat uit een stappenplan waarbij het belang van het

Houden we hier rekening mee in de zorg rondom kwetsbare

kind methodisch onderzocht wordt. Pas daarna worden eventuele

kinderen?

andere belangen in kaart gebracht en een afweging gemaakt. Er

“Helaas is het huidige zorgsysteem erg verkokerd. Dat maakt

is ook een vragenlijst om het kind te helpen de eigen mening over

het moeilijk om adequaat te verwijzen of een integraal plan van

zijn/haar situatie te vormen.”

aanpak te maken, terwijl we weten dat problemen stapelen en vaak meerdere domeinen omvatten. Soms is de oorzaak niet eens

Is het lastig voor organisaties om de belangen van kinderen

zo van belang, maar de impact is wel groot en breed. Kinderen in

voorop te stellen?

zulke situaties vragen zelf ook om een integrale aanpak. Neem

“Te vaak denken organisaties onbedoeld vanuit eigen perspectief

bijvoorbeeld armoede. Kinderen die in armoede opgroeien, wonen

en maken praktische overwegingen in plaats van naar het indivi-

vaak in een onveilige buurt. Daarnaast benoemen ze dat school

duele kind te kijken. Ik gebruik daarvoor als voorbeeld een casus,

niet goed meer gaat, dat er thuis veel stress is en dat hun ouders

waarbij een kind vier jaar geleden met een OTS (onder-toezicht-

geen interesse meer in hen tonen. Al deze condities beïnvloeden de

stelling) uit huis geplaatst was in verband met ouderproblematiek.

ontwikkeling van het kind. Precies daarom moeten we de kwaliteit

Vier jaar later had de ouder werk en huisvesting, was schuldenvrij,

van deze condities kennen. Als we het belang van het kind in kaart

en woonde in een buurt met een school om de hoek. Soms kijken

brengen bij beslissingen die ook impact hebben op de kwaliteit van

hulpverleners dan naar de praktische randvoorwaarden en concluderen direct dat het kind terug naar huis kan. De toolkit helpt om eerst te onderzoeken wat het beste besluit voor dit specifieke kind zou zijn (rekening houdend met bijvoorbeeld de eigen identiteit, wensen en rechten van het kind), en pas daarna de verdere belangenafweging te maken.”

Meer informatie Hoe kunnen we deze kennis gebruiken in de JGZ? https://www.dekinderombudsman.nl/toolkit-

“De JGZ kent ieder kind goed en heeft zicht op veel factoren die

beste-besluit

de kwaliteit van leven van kinderen beïnvloeden. Het is belangrijk

https://nidosineurope.eu/wp-content/

om naast de gezinssituatie ook de leefomgeving goed in de gaten

uploads/2016/10/BIC-Model.pdf

te houden. Dus ga op pad, ken de wijk waarin een kind woont, ga naar de school toe. Elk kind heeft recht op een individuele aanpak, waarbij niet alleen naar kwetsbaarheden van kinderen gekeken wordt, maar juist ook naar potenties en mogelijkheden!” Q

Ja! magazine


23 - 2021 #51

Expertise

Wie is Margrite Kalverboer? Margrite Kalverboer (geboren in 1960) is sinds 2016 Kinderombudsvrouw en bevordert naleving van kinderrechten zoals vastgelegd in het Verenigde Naties-kinderrechtenverdrag. Na de studies Nederlands recht, orthopedagogiek en de kunstacademie, promoveerde Margrite Kalverboer in 1996 op onderzoek naar de rapportages van de Raad voor de Kinderbescherming over zeer ernstige opvoedings- en verzorgingsproblematiek. Daarna werkte ze als hoofd zorg bij ‘t Poortje, de jeugddetentie in Groningen en later als gedragswetenschapper bij de Universiteit Groningen. Ze combineert de functie van Kinderombudsvrouw met een bijzonder hoogleraarschap Kind, (Ortho)pedagogiek, Kinderrechten en Vreemdelingenrecht, een leerstoel van de Stichting Groninger Universiteitsfonds. Ze woont in de binnenstad van Groningen met haar hond en haar kinderen als buren. Ze verblijft ook regelmatig op haar woonboot in Amsterdam.

Ja! magazine


Extensief gehydrolyseerde formules ZIJN NIET ALLEMAAL HETZELFDE Althéra® is de enige eHF met een werkzaamheid, verdraagbaarheid en veiligheid vergelijkbaar met een AAF, zoals aangetoond in een RCT.

Proportion of peptides in different infant formulas with MW>1200 Da (%)

"-=;|‹-m7;L1-1‹o=-m;‰;Š|;mvbˆ;Ѵ‹_‹7uoѴ‹Œ;7=oul†Ѵ- =oubm=-m|v‰b|_1o‰ĽvlbѴhruo|;bm-ѴѴ;u]‹Őb]];l-mm;|-Ѵĺķ "-=;|‹-m7;L1-1‹o=-m;‰;Š|;mvbˆ;Ѵ‹_‹7uoѴ‹Œ;7=oul†Ѵ- =oubm=-m|v‰b|_1o‰ĽvlbѴhruo|;bm-ѴѴ;u]‹ĺ;7b-|uѴѴ;u]‹ ll†moѴƑƏƏѶĺƐƖĹƒƓѶŊƒƔƓĺő

27

ƑƔ 20 ƐƔ 10 ƒ

Ɣ 0 Concurrent AAF

100

80 ѵѵ ѵƏ 47 40

20

0 Concurrent AAF Type formule

Type formule

35

0.150

HIGH DEGREE OF HYDROLYSIS <3% of peptides with MW>1200 Da

30

3%–15% of peptides with MW>1200 Da

>15% of peptides with MW >1200 Da

0.130 0.110

25

0.090 20 0.070 15 0.050 10

0.030

Residual protein allergen (mg/kg)

Althéra®-gebruik wordt geassocieerd l;|;;mvb]mbC1-m|_o];u;=u;t†;mঞ; ˆ-mŒ-1_|;om|Ѵ-vঞm]ŐrƺƏķƏƔőķ;m lbm7;uˆ--h0u-h;mŐrƺƏķƏƐőbm vergelijking met een AAF van een andere fabrikant (n=66).

ƒƏ

;u1;m|-];Œ†b];Ѵbm];ml;|Œ-1_|;om|Ѵ-vঞm]Őѷő

Percentage zuigelingen dat moet overgeven (%)

ŎƐƏƏѷˆ-m-ѴѴ;Œ†b];Ѵbm];mŐmƷѵѵő verdragen zowel Althéra® en een  bm;;m1uovvŊoˆ;u  ol _‹ro-ѴѴ;u];mb1b|;b||;0;ˆ;vঞ];mĺ Ŏ(;uѴb1_ঞm]ˆ-m Ŋv‹lr|ol;m vergelijkbaar met een AAF. Ŏ;;mvb]mbC1-m|ˆ;uv1_bѴbm"!  scores versus een AAF

5

0.010 QUANTIFICATION

0

−0.010

LIMIT FOR PROTEIN ALLERGEN

Brand 1 (n>2)

Brand 2 (n=1)

Brand 3 (n=4)

Brand 4 (n=2)

Brand 5 (n=1)

Brand 6 (n=4)

Brand 7 (n=5)

Different brands of eHF

Brand 8a (n=2)

Brand 9a (n=2)

Brand 10 (n=5)

Brand 11 (n=8)

Brand 8b (n=1)

Brand 12a (n=2)

Brand 9b (n=1)

Brand 12b (n=3)

Brand 13 (n=7)

Residual protein allergen, ß-lactoglobulin (mg/kg)

Kuslys, M., Not all extensively hydrolyzed formulas intended for cow’s milk protein allergy are the same. Symposium held at the EAACI Congress 2017. EMJ Allergy & Immunol, 2017: p. 48-49. oѴ;|Œhoķ"ĺķ;|-Ѵĺķ b-]movঞ1-rruo-1_-m7l-m-];l;m|o=1o‰ĽvŊlbѴhruo|;bm-ѴѴ;u]‹bmbm=-m|v-m71_bѴ7u;mĹ "ollb‚;;ru-1ঞ1-Ѵ]†b7;Ѵbm;vĺ;7b-|u-v|uo;m|;uoѴ†|uķƑƏƐƑĺƔƔŐƑőĹrĺƑƑƐŊƖĺ

$ & $"&$"&$  (! &   $! ! ""ĺ( (! " !&҃ !&  ! "$ ,$ĺ

NL ;v|Ѵ࣐;-Ѵ|_"1b;m1;ķo;ˆ;v|;bmƒѵķƓƖƏƒ"ov|;u_o†| $;ѴĺĹƏƑƏƔѵƖƖƔѶѶŎ‰‰‰ĺ;v|Ѵ;;-Ѵ|_"1b;m1;ĺmѴ


Schrijvers gezocht! JA! Ik doe mee! Wil je meedenken, meewerken, meeschrijven aan het volgende nummer van JA!? Meld je dan aan voor de redactie. Wil je niet in de redactie, maar wel af en toe een artikel schrijven? Geef dit dan door via ja@ajnjeugdartsen.nl. Voor meer informatie bel of app Louise Dijkmans: 0624916428. Q

Kabrita is gemaakt van de allerbeste Nederlandse geitenmelk en heeft en milde en zachte smaak. • Veilig en volledig Met 22 toegevoegde vitaminen en mineralen, DHA en AA, prebiotische vezels (GOS) en extra geitenwei-eiwit voor een complete en veilige flesvoeding.1

• Vertering De eiwitsamenstelling met een relatief lage hoeveelheid as1-caseïne eiwit zorgt ervoor dat er een zachtere massa in de maag wordt gevormd, die het lichaam makkelijker kan afbreken.2

• Comfort Kabrita bevat A2 melk en is daardoor makkelijker verteerbaar.3

• Oligosacharidenprofiel Van nature bevat geitenmelk significant meer en een grotere verscheidenheid aan oligosachariden, vergeleken met koemelk.4

Meer weten over de diversiteit van oligosachariden, dynamiek van eiwitvertering en vrije nucleotiden van Kabrita? Ga naar professionals.kabrita.com Borstvoeding is de beste voedingsbron voor jonge kinderen

1. Geitenmelk al basis voor flesvoeding is goedgekeurd door EFSA: ‘Het EFSA panel concludeert dat geitenmelk een geschikte eiwit basis vormt voor zuigelingen- en opvolgmelk’ – EFSA 2012. 2. Maathuis, A. et al. (2017). Protein Digestion and Quality of Goat and Cow Milk Infant Formula and Human Milk Under Simulated Infant Conditions. J Pediatr Gastroenterol Nutr, 65(6), 661-666. 3. Clarke, A., et al. “Bovine Beta Casein Variants: Implications to Human Nutrition and Health.” International Conference on Food Security and Nutrition. Singapore. 2014. 4. van Leeuwen, S.S., et al. Goat Milk Oligosaccharides: Their Diversity, Quantity, and Functional Properties in Comparison to Human Milk Oligosaccharides. J Agric Food Chem. 2020 Nov 3. doi: 10.1021/acs.jafc.0c03766.


VISIE

2021 #51 - 26

De AJN, dat zijn we samen! Vaak belicht JA! op deze plaats de activiteiten van de AJN: wat doet de vereniging om de positie van de jeugdarts te versterken? Jacqueline Deurloo, bestuurslid van de AJN, wil de vraag een keertje omdraaien: ‘Wat doe jij als AJN-lid om de vereniging en de positie van de jeugdarts te versterken?’ Ze pleit voor meer actieve leden. “Als bestuursleden kunnen wij het niet alleen! Vele handen maken licht werk.” In dit artikel zet Deurloo de verschillende taken op een rij. Tekst: Jacqueline Deurloo Beeld: AJN

“Om een actieve bijdrage te kunnen leveren aan de vereniging,

manier zorgen zij voor regionale verbinding en zijn zij als het ware

moet je natuurlijk wel weten wat er allemaal gebeurt. En dat is

de voorposten van het landelijk bestuur. Veel afdelingsbesturen

veel. Heel veel. Inmiddels zit ik ruim een jaar in het bestuur en ik

kunnen jouw ondersteuning gebruiken, als lid van het afdelings-

heb het gevoel dat ik nu pas een beetje inzicht begin te krijgen in

bestuur. Een mooie kans om bestuurservaring op te doen en te

alle activiteiten, commissies en taken die onderdeel zijn van onze

ervaren of dit iets voor jou is.

vereniging. Daarom wil ik in dit artikel een aantal mogelijkheden beschrijven om een actieve bijdrage te leveren. Activiteiten waarbij je jouw kennis en talenten kunt inzetten, of waarbij je juist nieuwe vaardigheden kunt leren en ontwikkelen. De acht AJN-bestuursleden worden ondersteund door het bedrijfsbureau. Onze taken zijn gegroepeerd rond vijf speerpunten die zijn vastgesteld tijdens ons jaarlijkse bestuursweekend: het Landelijk Opleidingsplan (LOP), de samenwerking AJN & KAMG, het Rijksvaccinatieprogramma (RVP), JGZ en Covid-19, en thema’s op het gebied van de Publieke Gezondheid. We combineren onze bestuursfunctie met onze werkzaamheden in de JGZ. Er is nog een vacature voor een nieuw bestuurslid!

‘We zoeken nog een nieuw bestuurslid’ In de regio De regionale AJN-afdelingen spelen een belangrijke rol binnen de vereniging. De afdelingen hebben contact met leden binnen de JGZ-organisaties via de contactpersonen van de AJN. Op deze

Ja! magazine


27 - 2021 #51

VISIE

Binnen de vereniging zijn er diverse commissies en werkgroepen

verzoeken om mee te lezen met richtlijnen en andere stukken. Laat

actief, zoals de werkgroep vluchtelingen en de wetenschappelijke

je horen via de app!

commissie. De commissies en werkgroepen zijn vaak gericht op het delen van ervaringen, knelpunten en kennis over onderwerpen

Schrijf mee aan JA!

die relevant zijn voor de JGZ. Daarnaast zorgen zij ervoor dat het

Lees jij ons tijdschrift JA! ook met veel plezier? En wil je graag je

onderwerp ook buiten de JGZ aandacht krijgt. Via een commissie

mening of kennis over een onderwerp delen met collega’s? De

of werkgroep kun je actief aan de slag met een onderwerp dat jouw

redactie staat altijd open voor ideeën voor artikelen. Ook is de

interesse heeft.

redactie altijd op zoek naar leden die een artikel willen schrijven. Een interview doen met bijvoorbeeld een onderzoeker of collega jeugdarts kan ongelooflijk leerzaam en inspirerend zijn. Tot slot heeft de AJN haar ambassadeurs: leden met aantoonbare

‘Ambassadeurs dragen bij aan de profilering van de jeugdarts’

belangstelling voor en kennis over een maatschappelijk relevant of actueel onderwerp dat nauw verbonden is met het vak van jeugdarts. De ambassadeurs dragen bij aan de profilering van de jeugdarts op hun specifieke aandachtsgebieden. Persoonlijke groei Hoe meer enthousiaste en actieve leden we hebben, hoe beter we

AJN-app

de jeugdarts op de kaart kunnen zetten. Al deze activiteiten bieden

Heb je de AJN-app al op je telefoon? Deze is gratis te downloaden

je de mogelijkheid om op een andere manier met je vak bezig

in de app-store. De app biedt je toegang tot het laatste nieuws, an-

te zijn, en het levert je de mogelijkheid tot persoonlijke groei en

dere AJN-leden en onze AJN-activiteiten in de agenda. Je kunt je via

ontwikkeling. Hou op onze website vooral de pagina met vacatures

de app makkelijk voor deze activiteiten aanmelden. Wist je dat je je

en oproepen in de gaten. En heb je vragen over activiteiten, of tips

collega jeugdartsen makkelijk terugvindt via ‘Leden zoeken leden’?

en ideeën hoe we jou als actief lid kunnen inzetten? Laat het ons

Je kunt hier ook je specifieke interesse of expertise aangeven, of

weten via secretariaat@ajnjeugdartsen.nl, we horen graag van je!”

juist collega’s vinden die met dezelfde onderwerpen bezig zijn. Ook biedt de app een besloten forum, met lees- en kijktips, maar ook

Q

Ja! magazine


INTERVIEW

2021 #51 - 30

‘Mensen in armoede herkennen eerder boze dan blije gezichten’ Ja! magazine


31 - 2021 #51

INTERVIEW

Mirjam Jobse, verpleegkundig specialist en stafverpleegkundige bij Santé Partners (voorheen STMR) komt regelmatig over de vloer bij gezinnen in Rivierenland. Het gaat om gezinnen waar bijvoorbeeld vermoedens zijn van een kind met een stoornis in het autistisch spectrum, of waar een baby bovenmatig huilt. Eenmaal achter de voordeur combineert ze hoog-complexe verpleegkundige zorg met laag-complexe medische zorg. Een handige combinatie. Tekst: Louise Dijkmans Beeld: Dirk Jansen

“Bij een huilbaby is de oorzaak in een klein aantal gevallen me-

Een ander signaal dat wijst op verborgen armoede, kan een jonge

disch, maar veel vaker heeft het te maken met de interactie tussen

moeder zijn die een medische verklaring wil voor hypoallergene

ouder(s) en kind,” vertelt Jobse. Als ze dan bij een gezin op de bank

voeding omdat de borstvoeding niet wil lukken. Daarmee bespaart

zit, kan ze twee vliegen in een klap slaan; zowel de sfeer proeven als

ze de kosten voor de dure blikken melkpoeder.”

aandacht geven aan het medische aspect. Onder het mom van ‘Nu ik hier toch ben, kijk ik dit meteen even na’. “Verpleegkundig speci-

Vraag ernaar

alisten hebben na de opleiding HBO Verpleegkunde de tweejarige

“Er is wel hulp voor gezinnen in armoede, maar vaak worden die re-

masteropleiding Advanced Nursing Practice afgerond. Ze staan niet

gelingen niet gevonden of aangevraagd. Ze willen wel, maar weten

alleen in het BIG-register geregistreerd, maar ook in het Register

niet hoe.” Praten over armoede is een taboe, maar dat betekent niet

voor Verpleegkundig Specialisten. Jobse voltooide haar master in

dat ouders er niet over willen praten, leerde Jobse tijdens haar on-

2018. “Dat wat geprotocolleerd is kan ik zelf doen; het biomedische,

derzoek. Ouders ondervinden dagelijks dat geld en opvoeden alles

in lijn met de NCJ-richtlijnen”, vertelt Jobse die als adviseur bij het

met elkaar te maken hebben. Jobse drukt collega’s daarom op het

NCJ ook twee jaar betrokken was bij de richtlijn-ontwikkeling. Wat

hart om te vragen naar het financiële. “Misschien aarzelt een ouder

haar toen al opviel, was dat armoede vaak als risicofactor genoemd

de eerste keer, maar daarna - zo leert de praktijk - komt het toch op

werd. Dat leidde ertoe dat ze tijdens haar master praktijkgericht

tafel.” Ze waarschuwt daarbij voor stigmatiseren: “Vraag er gewoon

onderzoek ging doen naar gezinnen in armoede, toen nog een

naar. Bij iedereen. Dat kan heel eenvoudig: ‘Komt het wel eens voor

onontgonnen terrein. Al bij de probleemanalyse (unseen childhood

dat je iets belangrijks voor je kind(eren) niet kunt betalen?’ Wij

poverty), zag ze vele taken liggen voor de JGZ en dat werden er

hebben het biomedische vaak voorop staan. De groeicurve, de ont-

alleen maar meer toen haar onderzoek zich toespitste op vroegsig-

wikkeling, maar ruim ook tijd in voor de psychosociale aspecten.”

nalering. Uiteindelijk haalde ze met haar onderzoek de landelijke pers, er kwam een hausse van aandacht voor het onderwerp.

Kennis van de wijk “Omdat we zelf vaak niet uit de doelgroep komen, stellen we niet

Help ouders

altijd de juiste vragen en zien we niet wat we moeten zien.” Jobse

“Armoede is een veelkoppig monster. Het zit ’m niet alleen in gebrek

verwijst naar een proef met ervaringsdeskundigen die mee de

aan geld.” Als vanzelf somt ze een reeks feiten op. “Eén op de negen

wijk in gingen, op huisbezoek. Zij zagen zorgelijke dingen bij de

kinderen in Nederland leeft in armoede en de helft van deze kinde-

mensen thuis, die professionals niet opvielen. Jobse kan uren over

ren krijgt maar hulp. Lang niet alle kinderen zijn dus in beeld. Zestig

haar bevindingen vertellen. Zo treft armoede ook het brein, met

procent van deze kinderen heeft één of twee ouders die werken. Het

invloed op het geheugen, taal, plannen, concentratie en gedrag.

vermoeden van armoede is er dan minder snel. Ook het verschil in

“Wist je dat mensen in armoede boze gezichten eerder herkennen

levensverwachting is enorm. Mensen die opgroeien in armoede leven

dan blije? En daardoor het positieve gedrag van hun kind niet goed

zes jaar korter en hebben negentien jaar eerder last van serieuze

waarnemen? Daardoor reageren ze vaker afwijzend en straffen ze

gezondheidsklachten dan mensen die niet in armoede leven. De

sneller. Ze verdienen daarom onze hulp en steun bij de opvoeding.

kinderen zijn eerder ziek; zowel lichamelijk als psychisch. Wil je

Zorg voor goede contacten in de wijk, in de gemeente, met het

helpen? Help dan de ouders!”, stelt Jobse resoluut. “Stress bij ouders is

sociaal wijkteam, de verloskundige, de kinderarts. Niet vragen ‘Vind

enorm bepalend voor de leefomgeving van de kinderen en zorgt voor

je het goed dat ik je doorverwijs?’ , maar ‘Vind je het goed dat we er

early life stress. Als je dit weet, ga je heel anders naar ouders kijken en

een collega bij vragen?’ Dan voelt men zich niet weggestuurd. En

andere vragen stellen. En dan krijg je ook andere verhalen. Ouders

bied altijd concrete hulp, geen hoop. Kijk uit dat je niet de zoveelste

blijven soms weg van afspraken met het ziekenhuis. Dan denk je mis-

bent die hoop geeft en het niet waarmaakt. Dan haken ouders af.”

schien dat ze slordig zijn en geen agenda bijhouden, maar dan blijkt geld het probleem te zijn. Geen auto, geen geld voor bus of trein.

Q

Ja! magazine


mednet.nl/spierziekten

Herkent u een spierziekte bij uw patiënt? Deze webcast is door kijkers beoordeeld met een 8,3!

Nu on d deman r! kbaa i h c s e b In Nederland lijden er meer dan 200.000 mensen aan één van de ongeveer 600 verschillende spierziekten. Door de zeldzaamheid, de verschillende symptomen en het heterogene karakter hiervan, is het stellen van de diagnose vaak een ingewikkeld en langdurig traject. Deze webcast geeft u praktische handvatten die helpen bij het herkennen en het doorverwijzen van een patiënt met een spierziekte in de eerste lijn middels illustratieve casuïstiek.

Sprekers • Dr. Ludo van der Pol, neuromusculair neuroloog UMC Utrecht • Femke van Gennip, huisarts in Doorn • Bart Bartels, fysiotherapeut UMC Utrecht • Tom van ’t Hek, moderator

Voor wie? Deze nascholing is bedoeld voor huisartsen, fysiotherapeuten, jeugdartsen, neurologen en kinderartsen.

Accreditatie Geaccrediteerd voor 2 punten bij NVK, NVN en KNGF en voor 1,5 punt bij ABC1.

Vragen? Voor vragen over deze webcast uitzending kunt u terecht bij nascholing@springer.com

Gratis te bekijken U kunt deze uitzending kosteloos bekijken.

Deze uitzending wordt mede mogelijk gemaakt door:

Bekijk direct MAT-NL-2000995


We teach... OPLEIDING ARTS MAATSCHAPPIJ EN GEZONDHEID, PROFIEL JEUGDARTS Een Leven Lang Leren bij TNO: voor aios én praktijkopleiders Aios TNO leidt jeugdartsen op voor een sterke JGZ! Tijdens de opleiding ontwikkelen aios zich in de verschillende rollen van de jeugdarts variërend van de spreekkamer tot aan de wetenschap. Het leren vindt zo veel mogelijk plaats in en vanuit de praktijk, tijdens praktijkperiodes in de JGZ en tijdens stages. Daarnaast volgen aios cursorisch onderwijs in een eigen jaargroep. Dit leren en professionaliseren gaat door na de opleiding. Bij TNO wordt een stevige basis gelegd voor een Leven Lang Leren. Praktijkopleiders De praktijkopleider heeft een cruciale rol bij het leerproces van de aios: als coach, als begeleider en als rolmodel. Hij komt voor tal van uitdagingen te staan, zoals: Meer of juist minder sturing geven? Hoe organiseer ik de begeleiding vanuit mijn GGD? Hoe pas ik mijn begeleidingsstijl aan op de leerstijl van de aios? Over deze en andere uitdagingen organiseren TNO en NSPOH didactische scholingen voor opleiders. Uitgangspunten voor onderwijs en didactische scholingen bij TNO: - Competentiegericht - Leren met en van collega’s - Presentaties en praktische opdrachten wisselen elkaar af - Ervaren docenten uit wetenschap en praktijk - Aansluiting bij actueel onderzoek (binnen of buiten TNO) - Eigen inbreng (onderwerpen, werkvormen) wordt zeer gewaardeerd.

Meer dan 30 nieuwe titels en 160 modules voor professionals in de aan public ...een breed scala bij- en nascholing, en occupational health

veelal online: jaarlijks meer dan 30 nieuwe titels en 160 modules. Onze modules helpen je bij de ontwikkeling van je professionele vaardigheden. Maar de NSPOH biedt meer! Zoals onderwijs en training waardoor je met meer kennis en vaardigheden bijdraagt aan het verbeteren van de jeugdgezondheidszorg. Kies in 2021 bijvoorbeeld voor: NIEUW

• (Hoog)begaafdheid: herkennen en uitvragen in de spreekkamer • Baecke-Fassaert motoriek test (BFMT) • Basisdataset JGZ: betere registratie voor betere zorg • Capaciteitenprofiel voor kinderen met een aandoening • Communiceren met pubers • Focus op hechting • Impact in de eerste tien seconden

Starten en instromen Opleiding De opleiding start jaarlijks op twee momenten: in maart in Leiden en in september in Eindhoven Zie voor meer info: www.artsmg.nl www.tno.nl\onderwijs

• Introductiecursus Jeugdgezondheidszorg 0-18 • Medisch kijken in de jeugdgezondheidszorg • Signalen van autisme bij het jonge kind herkennen • Summer school public health • Top 10 kleine kwalen in de spreekkamer van de JGZ • WOKJA • Zindelijkheid

Bekijk onze actuele bij- en nascholingskalender op www.nspoh.nl Didactische scholingen Zie voor data en informatie: https://www.tno.nl/nl/ aandachtsgebieden/gezond-leven/roadmaps/youth/ didactische-scholingen-terugkomdagen-voor-opleiders/

“Door deze dag heb ik meer inzicht gekregen in hoe mijn aios en ik beter kunnen samenwerken!” “Deze docent maakt ingewikkelde theorie eenvoudig en toepasbaar in de praktijk!”

De NSPOH wil een waardevolle bijdrage leveren aan de verbetering van de volksgezondheid, de arbeidsomstandigheden en participatie in Nederland. Dit doen wij door professionals kwalitatief goed en vraaggestuurd op te leiden voor de hedendaagse praktijk van public en occupational health. Wij ontwikkelen en organiseren opleidingen, bij- en nascholing, in-company programma’s en symposia op academisch en post-hbo niveau.


INTERVIEW

2021 #51 - 34

‘We vonden elkaar snel bij problemen’ Ja! magazine


35 - 2021 #51

INTERVIEW

‘Wijkgericht werken’, Els Jonker, oud arts M+G, deed het al voordat de term werd uitgevonden. Bij de GGD in Deventer waar ze meer dan dertig jaar als jeugdarts dienst deed, werkte ze samen met onder meer welzijnswerkers, wijkagenten, gemeente en opvangorganisaties. “Hierdoor konden oplossingen gevonden worden voor gezinnen met problemen die anders vastgelopen waren.” Tekst: Bureau Bax Beeld: Dirk Jansen

Deventer was een van de gemeenten waar wijkaanpak werd toege-

Onvoldoende benut

past voordat het landelijk beleid werd. De aanpak ontstond vanuit

Natuurlijk moet je ook de ruimte en het vertrouwen van je organisa-

het welzijnswerk, herinnert Els zich. “Deventer had een paar ach-

tie krijgen, erkent ze. “Als ik in de lokale krant een aankondiging zag

terstandswijken waar een heel actieve buurtwerker werkzaam was.

over een wijkavond, dan zei ik ‘hier moeten we bij zijn’. Dan hoefde

Hij zocht de samenwerking op. Iedere zes weken hadden we overleg

ik niet altijd uit te leggen waarom en wat de winst daarvan was. Die

met de wijkagent, buurtwerkers, opbouwwerk, kinderopvang en de

vrijheid had ik toen.” Later zag Els dat veranderen. “Vanuit de organi-

jeugdgezondheidszorg.” De samenwerkingspartners leerden elkaar

satie was minder mogelijk. Waar ik eerder direct contact had met de

hierdoor goed kennen. “We wisten van elkaar hoe we tegen situaties

wethouder, werd dat later door de accountmanager overgenomen.

aankeken. Wanneer er problemen ontstonden binnen een gezin,

Dat was een van de redenen waardoor ik mijn werk niet meer zo

vonden we elkaar snel en wisten we wie welk stukje op kon pakken.

goed kon doen. Ook door fusies werden de werkzaamheden anders

Deze manier van werken, beviel Els erg goed. “De JGZ was hierdoor

georganiseerd, waardoor je als jeugdarts minder gelegenheid kreeg

voor ouders meer zichtbaar. Mensen zeiden tegen elkaar ‘joh, daar

om echt de wijk in te gaan. Daarmee werd een deel van het sociale

moet je eens met Els over praten’. We waren heel benaderbaar.

weggehaald; dan zie je minder als jeugdarts en kun je minder goed

Ouders hoefden geen zoektocht te starten naar hulp. De onderlinge

je bevindingen delen met ouders.” Els zegt niet dat de wijkgerichte

partners verwezen zo naar elkaar door. En ze hoefden niet steeds

aanpak die zij zo prettig heeft ervaren overal opgelegd moet worden.

hun problemen opnieuw toe te lichten, want als iemand toestem-

“Overal zijn verschillen, daar moet je geen eenheidsworst van willen

ming gaf, vertelden we zijn verhaal alvast aan de andere partij.”

maken. Het is vervelend als een werkwijze opgelegd wordt. Maar ik denk wel dat de kwaliteiten van jeugdartsen en jeugdverpleegkundi-

Buurtontbijt

gen soms onvoldoende benut worden door ze klein te houden.”

Een voorbeeld van goede samenwerking noemt Els de aanpak van kinderen die zonder ontbijt naar school gingen. “Wij merkten dat

AJN-ambassadeur

dit speelde, maar zochten een goede manier om hiermee om te

Nu ze gestopt is als jeugdarts, mist Els het contact met de kinde-

gaan. We hebben het toen ingebracht in het brede overleg. Met

ren en de ouders. En met de mensen met wie ze werkte. “Het is zo

hulp van de buurtsuper hebben we een buurtontbijt en lessen over

inspirerend om samen te bedenken hoe we iets voor een gezin voor

voeding op school georganiseerd. Het was een grootschalige actie

elkaar kunnen krijgen.” Wat ze niet mist is het gesjouw met spullen,

waaraan veel gezinnen meededen. Het was iets leuks, niet iets pro-

de administratie en ‘het gedoe’. “Wanneer het werken me soms

blematisch. Daarna konden wij het onderwerp veel makkelijker be-

onmogelijk werd gemaakt door managers met een nieuwe visie.”

spreekbaar maken door te vragen aan ouders of ze ook meegedaan

Jonker heeft haar carrière als jeugdarts afgesloten bij GGD Noord

hadden met de actie. Ouders konden zo over het onderwerp praten

en Oost Gelderland waar ze werkte met kinderen in het speciaal on-

zonder dat ze meteen het gevoel kregen dat ze tekortschoten.”

derwijs. “Heerlijke jaren,” noemt ze dat. “Maar het reizen en sjouwen

De oud-jeugdarts is ervan overtuigd dat door dit soort brede sa-

ernaartoe. Dat werd me te zwaar. Ik word toch ouder.”

menwerkingen veel creatiever gezocht wordt naar oplossingen. “Je

Drie jaar geleden is ze met pensioen gegaan. Wel is ze nog AJN-

hebt meer manieren om een probleem aan te pakken. Bovendien is

ambassadeur voor de jonge mantelzorger. “Na het aankomende

deze manier van werken een stuk efficiënter. Je weet beter aan wie

internationaal congres voor de jonge mantelzorger, ga ik stoppen

je iets moet vragen en kunt sneller doorverwijzen.”

als ambassadeur. Doordat ik niet meer op de werkvloer sta, ben ik

Om goed te weten wat er speelt in een wijk, moet je soms een

niet meer op de hoogte van alle wijzigingen. Dus weet niet of alles

stapje extra zetten, vindt Els. “Op de scholen waar ik kwam met de

nog klopt wat ik vertel. Dat kan natuurlijk niet.” Tijd om het rustig

doktersassistente, zagen wij om half negen het eerste kind. Maar wij

aan te doen, heeft Els voorlopig niet. Sinds eind januari werkt ze

waren er altijd om kwart voor acht, zodat we de verhalen hoorden en

een dag in de week als COVID-arts bij GGD IJsselland. Nu nog in

konden proeven wat er allemaal speelde. Ik ken ook collega’s die om

Zwolle, binnenkort in Deventer.

tien voor half negen komen, hun spullen klaarzetten en aan de slag gaan. Dat is legitiem, maar niet de manier waarop ik het wilde.”

Q

Ja! magazine


Stimuleer ouders om te gaan voorlezen en informeer aansluitend over het gratis BoekStartkoffertje.

Onderzoek heeft uitgewezen dat kinderen die als baby worden voorgelezen, later zelf sneller een boekje pakken en meer plezier aan lezen beleven. En als ze wat ouder zijn, plukken ze daar de vruchten van. Boeken zijn een middel bij uitstek om de taalomgeving van kinderen te verrijken, want boeken geven op een vanzelfsprekende manier aanleiding tot interactie tussen ouder en kind. Veel ouders realiseren zich alleen niet dat het heel zinvol is om baby’s voor te lezen. De gratis e-learning Taalstimulering door voorlezen helpt u bij het bespreken van het belang van voorlezen met ouders. De e-learning vindt u in de JGZ academie van het NCJ. Kijk op boekstartpro.nl voor informatie voor de jeugdgezondheidszorg.

De énige huidvriendelijke desinfectant. Desinfact is anders dan andere desifectanten en alcoholgels; het beschermt én verzorgt. Desinfact bevat een unieke, gepatenteerde formule op basis van waterstofperoxide. Een formule die al jaren succesvol wordt gebruikt in de medische wereld. De bewezen krachtige werking van 99,999% beschermt tegen virussen, bacteriën en schimmels terwijl het de huid niet uitdroogt, zoals alcohol gels. Desinfact bevat nauwelijks alcohol en werkt op waterstofperoxide, aangevuld met Pro vitamine B5 en Aloë Vera. Hierdoor maakt Desinfact de huid zachter, sterker en beschermd, zonder resistentie opbouw. Een sterke huid is beter beschermt tegen bacteriën. Gebruik Desinfact dagelijks voor een zachte, sterke en hygiënisch beschermde huid. Desinfact is aangemeld als biocide bij het CtgB onder nummer 14885N

www.desinfact.com

Verkrijgbaar bij Etos en DA.

Tips om aan ouders te geven • Laat je baby het boekje zelf ontdekken: grijpen, sabbelen, ermee zwaaien en gooien. • Kijk en volg wat je baby met het boekje doet, reageer daar enthousiast op! • Leg je baby zo neer dat je oogcontact kunt maken. Je baby kan dan zien wie er voorleest en jij kan zien wat je baby boeit. • Haal het gratis BoekStartkoffertje met boekjes voor je baby in de Bibliotheek. • Download de BoekStartapp voor boeken- en voorleestips.


recensies

37 - 2021 #51

Eenzaam tussen mensen We hebben vanda vandaag de dag meer manieren dan ooit om te communiceren en toch voelen steeds meer mensen zich eenzaam. Eenzaamheid Eenzaa blijkt even schadelijk als vijftien sigaretten per dag. De Antwerpse psychologe en journaliste Leslie Hodge schreef ha haar boek - met de subtitel De weg naar een meer verbonden leven - deels in coronatijd. Een tijd die ons leert dat we nooit de kracht krach van de echte ontmoeting en interacties - een stevige handdruk, een tedere kus - mogen onderschatten. Je leest en blade bladert het boek, doorspelt met wetenschappelijke inzichten, gemakkelijk door. Het kent een overzichtelijke structuur van va hoofdstukken waarin de schrijfster haar eigen tekst afwisselt met veelzeggende quotes, anekdotes van mensen en passages uit diverse media. Hodge zet de lezer aan het denken, want eenzaamheid biedt ook een weg naar persoonlijke persoo groei. Een kans om jezelf beter te leren kennen, om een nieuwe start te maken en om eindelijk bepaalde knop knopen door te hakken. Desondanks betoogt de schrijfster ook dat chronische eenzaamheid een probleem is dat hoog genoteerd genotee mag staan op de persoonlijke en maatschappelijke agenda. Ze pleit onder meer voor een steviger inzet op armoedebestrijding armoedebestr zodat de cohesie in de samenleving groter wordt. Buurtinitiatieven verdienen ook lof en Hodge eindigt haar boek met een call to action, ook voor de JA!-lezer: ‘wie ga jij vandaag aanspreken?’ (LD)

Schrijver: Leslie Hodge uitgever: Lannoo, 2021 prijs: € 14,99

Tommie in gesprek Vraag jij je wel eens af waarom je jeugdarts bent? Wat je precies zingeving brengt in je werk? De auteur, Tommie Niessen, is inmiddels een bekende verpleegkundige en deelt zijn ervaringen op sociale media en in podcasts. In zijn tweede boek gaat hij in gesprek met verschillende zorgverleners over hun vak en de liefd de voor hun werk. Actuele onderwerpen zoals de coronapandemie, maar ook tijdloze onderwerpen zoals de angst voor ziekte en pijn worden besproken vanuit verschillende invalshoeken. Een greep uit de gevarieerde grooep geïnterviewden: viroloog Marion Koopmans, minister Hugo de Jonge, psychiater Dirk de Wachter, spiritueeel leraar Jan Geurtz, verpleegkundigen, artsen en patiënten. Vijfentwintig persoonlijke verhalen die je aan het h denken zetten over je eigen bijdrage aan de zorg. (JH)

Schrijver: Tommie Niessen uitgever: Ambo Anthos, 2020 prijs: € 19,99

Van plek naar gedeelde WIJ~k Dit boek, dat verscheen in april 2020, focust op positief samenleven in een door stadsontwikkeling veranderende buurt. De vier auteurs zijn collega’s en verbonden aan de opleiding Sociaal Werk van de Hogeschool Gent (Hogent). Zij verrichtten drie jaar onderzoek naar stadsontwikk stadsontwikkeling in de Gentse wijk Rabot-Blaisantvest, een stadsdeel dat historisch met veel armoede kampt. Met het wijkontwikkelingsproje De Tondelier werden de afgelopen jaren ook veel middenklassers naar de wijk getrokken. Wat betekende wijkontwikkelingsproject dat voor de wijk en haar bewoners? Het boek biedt methodieken en acties (strategieën) waarmee een wijkteam direct aan de slag kan. En ervaringen met m deze methodieken in de genoemde wijk Rabot-Blaisantvest. Daarnaast staan in het boek (Internationale) praktijkvo tips en praktijkvoorbeelden en conceptuele kaders over verstedelijking en samenleven. Tijdens het onderzoek is ook een anpublicati verschenen, het Rabot Blaisantvest Wij~K Wandelboekje, in samenwerking met de bewoners van de wijk. dere publicatie Mensen die in de buurt komen wonen, kunnen via het boekwerkje kennismaken met belangrijke plekken in de wijk. Het onde meer verspreid via het buurtwerk. (LD) wordt onder

Schrijver: Cordu Cordula Rooijendijk uitgever: Atlas Contact, Conta 2020 prijs: € 21,99 prijs

Tekst: Louise Dijkmans, Jeanne-Marie Hament Ja! magazine


MARKANT

2021 #51 - 38

‘Preventie bestaat bij de gratie van een lange adem’ Laura van Hylckama Vlieg heeft zich voor de slotformule van haar opleiding tot jeugdarts bij de NSPOH verdiept in de IJslandse methode om het gebruik van drugs en alcohol tegen te gaan. De methode is zeer succesvol in IJsland en ook relevant voor de Nederlandse situatie. Vijf vragen over die IJslandse methode. Tekst: Jeanne-Marie Hament Beeld: eigen foto

Waarom is deze methode bedacht?

Wat maakt het precies duurzaam?

“Twintig jaar geleden waren de cijfers over middelenmisbruik

“De plannen worden over een politieke termijn heen getild. Hoe-

onder IJslandse jongeren zo zorgelijk, dat deze community-based

wel er soms een wisseling van regerende partijen is; het plan blijft.

aanpak samen met politiek, gemeentes, sport- en buurtinstellin-

De preventieaanpak bestaat al twintig jaar. Je hebt de politiek

gen en de zorg is vormgegeven. Het gaat om roken, cannabis- en

nodig als je iets wilt opzetten wat breed gedragen wordt door de

alcoholgebruik. In IJsland zijn met behulp van de methode indruk-

lokale partijen. Het mes snijdt natuurlijk aan twee kanten, want

wekkende successen geboekt: het middelengebruik in IJsland is nu

als de aanpak veel oplevert zoals in IJsland het geval is, dan zal de

het laagste van de hele EU.”

politiek dat blijven ondersteunen. Preventie bestaat bij de gratie van een lange adem.”

Wat houdt de methode precies in? “Het IJslandse preventiemodel is nadrukkelijk een lokale aanpak.

Wordt er bij het Nederlandse Preventieakkoord gekeken naar

Iedere gemeente maakt zijn eigen beleid dat op de actuele situatie

de IJslandse aanpak?

afgestemd is. Zo gaven jongeren in een aantal gemeenten ‘verveling’

“In het Preventieakkoord worden per middel doelen gesteld. Voor

als reden voor het middelengebruik en gebrek aan geld om bijvoor-

roken is het doel bijvoorbeeld dat er in 2040 geen jongere meer

beeld naar een sportschool te gaan. In deze gemeenten krijgen

rookt. Voor alcohol wil men ernaar toe dat een kwart van de jonge-

jongeren nu een gratis sportpas. In iedere gemeente wordt frequent

ren drank heeft geprobeerd tussen de 12 en 16 jaar in plaats van de

gekeken wat de situatie is en steeds opnieuw wordt bepaald wat er

huidige vijftig procent. Daar zijn we dus nog lang niet. Regionale

moet veranderen. Daardoor is het ook een duurzame aanpak.”

verschillen vragen om andere benaderingen. Op het platteland wordt bijvoorbeeld door jongeren meer gedronken dan in de stad. Dat zou zo maar met verveling te maken kunnen hebben. Daarom denk ik dat het IJslandse model als voorbeeld kan dienen, maar ik weet niet in hoeverre dat daadwerkelijk gebeurt. We zien wel dat een aanpak zoals JOGG, van origine Frans, in Nederland goed werkt. Die aanpak ziet er ook per gemeente iets anders uit, zelfs op wijkniveau wordt afgestemd wat nodig is. Ik zou het dus zeker aanbevelen om naar de IJslandse methode te kijken.” Wat heeft het bestuderen van deze aanpak jou opgeleverd? “Ik heb de opdracht samen met Irene Voesten-Mak gedaan. Aangezien ik alleen met kinderen van 0-4 jaar werk, vond ik het leerzaam om een onderwerp te kiezen dat buiten dit werkveld ligt. Uiteindelijk heeft het onderwerp me gegrepen. Ik heb gezien dan een brede aanpak tot duurzame resultaten kan leiden, die echt het verschil kunnen maken voor het welzijn van een generatie jongeren.” Q Ja! magazine


GEACCREDITEERD studieaanbod ONAFHANKELIJKE nascholing woensdag 12 mei

CONGRES Slaapproblemen en -stoornissen bij jongeren 6ODDSSUREOHPHQNXQQHQHHQVFKDGHOLMNH΍HFWKHEEHQRSOHUHQFRJQLWLHISUHVWHUHQ HQJHGUDJ2RNNODFKWHQYDQSV\FKLVFKHDDUG]RDOVDQJVWRIGZDQJVWRRUQLVVHQ zijn een mogelijke consequentie. 9HUGLHSXLQGHVSHFLȴHNHNHQQLVRYHUVODDSSUREOHPHQELMGH]HGRHOJURHS

6

3(SXQWHQ

Meer info: medilex.nl/slaapproblemen_jongeren

donderdag 20 en 27 mei

CURSUS Jeugdrecht voor zorgprofessionals Tijdens deze tweedaagse cursus leert u o.a. over: • Hoe werkt het jeugdzorgstelsel? • Wie is juridisch ouder van een kind en wat betekent dat in de praktijk? • Wat gebeurt er als ouders zelf niet meer goed voor hun kinderen kunnen zorgen?

10

3(SXQWHQ

Meer info medilex.nl/cursus_jeugdrecht

diverse startdata

CURSUS Gezondheidsrecht voor zorgprofessionals Tijdens deze driedaagse cursus wordt alle relevante wetgeving rondom de JH]RQGKHLGV]RUJEHVSURNHQNULMJWXWDOYDQKDQGYDWWHQHQZRUGHQYHHO praktijkvoorbeelden met u besproken. (ULVRRNHHQHGLWLHYRRUMXULGLVFKHSURIHVVLRQDOV

15

3(SXQWHQ

Meerdere edities per jaar.

Meer info: medilex.nl/gezondheidsrecht

dinsdag 22 juni

CONGRES Perinatale zorg Tijdens dit congres zullen verschillende deskundigen op het gebied van geboortezorg u volledig bijpraten over de laatste inzichten en een vertaalslag maken naar de praktijk. • Waar valt snel verbetering te behalen in de zorg voor zwangeren? • Wat kunnen we leren van onderzoek naar de placenta? • Ligt er een oplossing in prenatale screening?

Voor professionals uit de geboortezorg

Meer info: medilex.nl/perinatalezorg

woensdag 30 juni

CONGRES Jong & Depressief Ruim vier op de tien jongeren kampen met psychische klachten als somberheid en angst. Hoe weet en zorgt u dat piekeren niet verandert in depressief of zelfs suïcidaal gedrag?

Verdiepend

congres

+HUNHQHHQGHSUHVVLHELMHHQMRQJHUHHQZHHWZHONHKDQGHOLQJVPRJHOLMNKHGHQXKHHIW

7 septem

Meer info: medilex.nl/depressie_jongeren

30 november en 1 december

CURSUS Praten over seksueel misbruik 2-daagse cursus onder leiding van Aafke Scharloo; klinisch psycholoog met specialistische expertise in diagnostiek en behandeling na seksueel misbruik, (kinder)mishandeling en trauma.

Beoordeeld

met een 9-!

3UDWHQRYHUVHNVXHHOPLVEUXLNJHHIWNLQGHUHQJHHQWUDXPDGHVWLOWHZHO

Meer info: medilex.nl/pratenoverseksueelmisbruik 030-6933887 | info@medilex.nl | www.medilex.nl


NUTRILON MET PRONUTRA™ ADVANCE FORMULE ONDERSTEUNT HET IMMUUNSYSTEEM VANUIT DE DARM1-9 Met Human Milk Oligosaccharides

HMO 3’GL

DARMMICROBIOTA MEER GELIJK AAN DAT VAN BORSTGEVOEDE BABY’S10,11

BESCHERMEND EFFECT OP DE DARMBARRIÈRE1,12

VEILIG, WORDT GOED VERDRAGEN EN ONDERSTEUNT EEN NORMALE GROEI13,14

'DQN]LM 3UHELRWLVFKH2OLJRVDFFKDULGHQGOS:lcFOS 9:1  Human Milk Oligosaccharide (HMO) 3’GL  PostbioticaYHUNUHJHQYDQXLWRQVXQLHNH/DFWRæGXVäIHUPHQWDWLHSURFHV Referenties: 1.b9DUDVWHK6et al. (2019) J Pediatr Gastroenterol Nutr 68(S1);N-P-016:1049. 2.b5REHUIURLG0 et al. (2010) British Journal of Nutrition 104(S2):S1-S63. 3.b%RHKP*et al. (2002) Arch. Dis Child 86:F17881. 4.%UX]]HVH(et al. (2009) Clin Nutr 28(2):156-61. 5.b.QRO-et al. (2003) J Pediatr Gastronterol Nutr 36:566.32. 6.b.QRO-et al. (2005) British Journal of Nutrition 94:783–90. 7.b7LPV6et al. (2018) J Pediatr Gastroenterol Nutr 66(S2):1-1177;N-O-013:884. 8.0RUR*et al. (2002) J Pediatr Gastroenterol Nutr 34:2915. 9.b.QRO-et al. (2005) Acta Paediatr Suppl 94(449):31-3. 10.b7LPV6et al. (2018) poster presentation RQ0D\DWWKHVWH$QQXDO0HHWLQJ(63*+$1LQ*HQHYD11.b5RGULJXH]+HUUHUD$et al. (2018) 3UHVHQWHG RQ  0D\  DW WKH VW $QQXDO 0HHWLQJ (63*+$1 LQ *HQHYD 12.b 5HQHV et al. (2018) $FFHSWHGIRURUDOSUHVHQWDWLRQDWWKH(63*+$1FRQIHUHQFHLQ*HQHYD6ZLW]HUODQG13.b5RGULJXH]+HUUHUD $et al. (2019) Nutrients   14.b+XHW)et al. (2016) J Pediatr Gastroenterol Nutr 63(4):e43-53. %RUVWYRHGLQJLVGHEHVWHYRHGLQJYRRUHHQNLQG'H]HLQIRUPDWLHLVXLWVOXLWHQGEHVWHPGYRRU SDUD PHGLFL

www.nutriciavoorprofessionals.nl

Blijf up to date!

NUTRILON

Profile for AJN Jeugdartsen Nederland

JA! #51 Jeugdarts in de wijk, april 2021  

JA! is het ledenmagazine van AJN Jeugdartsen Nederland en verschijnt 3x per jaar.

JA! #51 Jeugdarts in de wijk, april 2021  

JA! is het ledenmagazine van AJN Jeugdartsen Nederland en verschijnt 3x per jaar.

Advertisement

Recommendations could not be loaded

Recommendations could not be loaded

Recommendations could not be loaded

Recommendations could not be loaded