Paarl Post – E-edition – 30 October 2025

Page 1


Huisbrand eis 3 vertrekke

’n Huisbrand in Paryskloof Estate, Paarl, is om 08:06 op Dinsdag (28 Oktober) by die Drakenstein-munisipaliteit se brandweerdiens aangemeld. Volgens Wynand Els, waarnemende uitvoerende direkteur van openbare veiligheid by die munisipaliteit, het brandbestryders vinnig op die toneel gereageer. Nadat die brand volledig geblus is, is vasgestel dat drie vertrekke van die huis vernietig is en dat die res van die woning deur rook en vlamme beskadig is. Els sê die oorsaak van die brand is nog onbekend Foto: Jana Scheepers

Amptenaar wil nie waai

Die Drakenstein-munisipaliteit het vandeesweek gerugte bevestig dat ’n afgedankte munisipale amptenaar steeds in ’n munisipale huis in Simondium woon en dat ’n inbraak onlangs by dié eiendom aangemeld is.

Ernest Saayman, ’n voormalige senior bestuurder in die gemeenskapsdienteafdeling, is in November verlede jaar afgedank en weier glo volgens die munisipaliteit om die eiendom te ontruim

Paarl Post het inligting bekom oor ’n inbraak wat glo sowat twee maande gelede by die groot plaashuis in Simondium plaasgevind het.

Die bron het vertel dat dit hoofsaaklik Saayman se persoonlike besittings is, waaronder elektroniese toestelle, wat gesteel is

Die eiendom is geleë op die grond waar die Simondium-behuisingsprojek onderweg is

Toe die koerant die eiendom vandeesweek gaan besoek het, was Saayman nie daar nie.

Daar was wel veiligheidswagte wat patrolliewerk op die plaas doen en toegangsbeheer toepas.

Seraj Johaar, die Drakenstein-munisipaliteit se uitvoerende direkteur vir korporatiewe en beplanningsdienste, het die gerugte vandeesweek by navraag bevestig.

“Ons bevestig dat mnr. Saayman in November 2024 uit die diens van die mu-

nisipaliteit ontslaan is. Hy ontvang geen salaris of enige voordele van die munisipaliteit nie.

“Ten tyde van sy ontslag het hy in ’n munisipale eiendom in Simondium gewoon, wat hy sedertdien geweier het om te ontruim, ten spyte van talle opdragte van die munisipaliteit om dit te doen

“Die munisipaliteit volg tans die nodige uitsettingsproses om hom van die eiendom af te laat verwyder,” het Johaar gesê

Volgens Johaar is geen koste tans vir die munisipaliteit aan dié betrokke eiendom verbonde nie.

“Daar is ook geen roerende bates van die munisipaliteit in die eiendom nie. Tydens die inbraak, wat deur die munisipaliteit bevestig kan word, is geen roerende bates van die munisipaliteit gesteel

nie,” het Johaar bygevoeg.

Saayman was die senior bestuurder vir parke, sport en begraafplase – 'n afdeling van die departement gemeenskapsdienste binne die munisipaliteit.

Hy is reeds in Maart verlede jaar geskors, waarna ’n tugverhoor plaasgevind het.

Die munisipaliteit het tot vandag toe nie aangedui waarvoor hy ondersoek en waaraan hy skuldig bevind is nie Saayman het vandeesweek by navraag gesê die skade na die inbraak beloop meer as R116 000.

Hy sê die uitsettingsprosesse is niks ander as verdere persoonlike aanslae nie.

“Wat maak vir my so spesiaal? Daar is sowat agtien ander voormalige munisipale werkers wat ook nog in munisipale eiendomme woon,” sê hy

Die munisipale plaashuis in Simondium, waar die afgedankte amptenaar Ernest Saayman steeds woon Foto: Rasaad Adams

Bergkwagga nog op vrye voet

JanaScheepers

’n Kaapse bergkwagga hardloop sedert Saterdagaand (25 Oktober) in die Franschhoekpas rond nadat dié jong vulletjie, waarskynlik vanuit CapeNature se HottentotsHolland-natuurreservaat ontsnap het

Volgens Juani Beukes, een van die direkteure van Safe Hands Animal Rescue Franschhoek, het sy en haar span die eerste oproep oor die verdwaalde kwagga Saterdagaand omstreeks 20:00 ontvang Hulle het daarna inderhaas, in donker en reënerige toestande, na die pas vertrek om die vulletjie – ’n merrie – op te spoor

toe wéér ’n oproep dat die kwagga op 'n ander plaas genaamd Middagkrans is, waarna sy weer teruggehardloop het na die Franschhoekpas Beukes het verduidelik dat CapeNature op dieselfde dag uiteindelik gekontak is om hulp te verleen, waarna van hul wildbewaarders die pas besoek het om Fransie oor die pas te kry, terug na die natuurreservaat Dit het ongelukkig nie vrugte afgewerp nie, en Maandag 27 Oktober is die kwagga weer hoog in die berg, bo die pas, gewaar, waarna van die bewaarders berg op is om haar te probeer “afdruk na die pad toe sodat hulle haar padlangs oor die pas kon kry na die natuurreservaat”

Wyn vir Hendriks se droom

Rasaad Adams

Die Cornal Hendricks-stigting het die afgelope Maandag (27 Oktober) ’n Cabernet Franc-rooiwyn ter viering van dié ontslape rugbylegende se lewe bekendgestel.

Die opbrengs van die wyn se verkope sal onder meer aangewend word om ’n rugby-akademie in Wellington op die been te bring.

Wat dit selfs nog meer spesiaal maak, is die feit dat hierdie wyn by die Diemersfontein-wynlandgoed in Wellington onder leiding van die wynmaker Lauren Hulsman gemaak en gebottel is.

Hendricks was ’n voormalige Springbok-vleuel wat voor sy afsterwe op 14Mei vanjaar ook vir die Bulle uitgedraf het.

Hy het in 2008 sy buiging in professionele rugby gemaak toe hy ’n kontrak met die Boland Kavaliers aangegaan het.

Voor dit het hy vir onder meer vir die plaaslike rugbyklub Roses United gespeel.

“Ons het sowat ’n week ná sy begrafnis uitgevind dat hy ‘tenke’ vol wyn het. Cornal is nou vyf maande nie meer met ons nie en dit het ons drie maande gevat om hierdie produk vandag voor te sit.

“Dié wat Cornal geken het, sal weet met hom was enige dag ’n rede vir feesviering met goeie wyn en goeie geselskap om die vuur,” het sy gesê

Shafiek Mouton, ook van die Cornal Hendricks-stigting, het op sy beurt gesê Hendricks sou trots wees om hierdie eerste stap in die stigting van die rugbyakademie te kon beleef.

Beukes verduidelik dat sy en haar span op daardie oomblik gedink het “Fransie,” soos hulle die kwagga gedoop het, het aan 'n nabye plaas behoort.

Dus het Beukes en haar span vir die kwagga stelselmatig probeer “afdruk” van die pas waar sy op die pad gewaar is, na die plaas wat destyds sebras besit het, maar wat, volgens Beukes, intussen nie meer dié diere aanhou nie

Die kwagga is “Fransie” genoem omdat sy glo gereeld naby die Franschhoek-teken wat met klippe op die berg naby die pas uitgepak is, gewandel het

Die volgende oggend (26 Oktober) omstreeks 08:00 kry Beukes en haar span

Dit blyk die kwagga speel ’n kat-en-muisspeletjie, want sy het toe wéér die bewaarders ontwyk en hoër op teen die berg gehardloop.

Beukes het Maandag (27 Oktober) ongeveer 18:00 weer ’n oproep ontvang dat sy op die plaas is waarheen sy en haar span die kwagga oorspronklik gelei het, en waar sy oornag het

Dinsdagoggend (28 Oktober) het CapeNature en ’n veearts reggestaan by dié plaas om die kwagga met verdowing in te spuit, maar sy is toe weer skoonveld

Volgens Beukes hou sy en haar span aanhou soek na dié vulletjie sodat sy veilig terugbesorg kan word aan CapeNature

“Cornal se droom was altyd om ’n sport-akademie in Wellington op die been te bring – nêrens anders nie; net in Wellington.

“Die groot rede agter hierdie CH14wyn is dus vir ons om genoeg geld in te samel en nuwe terrein vir die akademie in Wellington te ontgin,” het Hanri van Wyk, wat aan die Cornal Hendricks-stigting verbonde is, by Maandag se bekendstelling in Stellenbosch gesê.

’n Emosionele Stephaney Hendricks, sy weduwee, kon Maandagaand nie haar trane terughou toe sy vertel oor wat die oomblik vir haar ontslape man sou beteken het nie.

“Hierdie seun van die Payton het vandag ’n wyn, wat na hom vernoem is, met sy handtekening op. En as ons sy nalenskap wil vereer, kan ons nie net daaroor wil praat nie.

“Vir Cornal was wyn, musiek en vuur die perfekte kombinasie. Die musiek het regtig alles goed saamgebring “Kom ons gaan versprei die woord oor hierdie inisiatief om sodoende sy droom te verwensenlik.”

Die wyn, wat as CH14 bekendstaan, is op Diemersfontein se webtuiste te koop.

Die CH verwys natuurlik na Cornal Hendricks en die 14 is ’n verwysing na die nommer14-rugbytrui en Hendricks se posisie as regtervleuel.

Q1: How do you feel about being selected asAdcock Ingram OTC’s Pharmacy of The Week?

A1: Being selected for the 3rd time byAdcock Ingram OTC is a true honour At Paarl East Pharmacy at SPAR we are committed to serving our customers with excellence and care.

This recognition reaffirms that we are on the right path, continuously striving to deliver the best service and value to our community

Q2: What keeps your pharmacy dedicated to the community?

A2: The smiles, feedback and appreciation we receive from our customers motivates us to keep doing more. Our greatest joy comes from seeing our customers happy Our goal is to give the best service we can to our customers.

Q3: How has your partnership withAdcock Ingram OTC helped?

A3: Our top priority is ensuring our customers’happiness.The diverse range of products offered byAdcock Ingram OTC allows us to achieve this goal by providing quality and value.Affordability is important to our customers andAdcock Ingram OTC supports us in meeting their needs effectively

’n Kaapse bergkwagga, dwaal tans in Franschhoekpas rond.
Die 2023 CH14-rooiwyn vereer Cornal Hendricks en is by die Diemersfontein-wynlandgoed in Wellington gemaak en gebottel Foto: Rasaad Adams
Paarl East Pharmacy

Voorkoming van misdaad by Paarl-Oos se imbizo bespreek

Die Paarl-Oos-polisie, in samewerking met die Paarl-Oos-gemeenskapspolisiëringsforum (GPF), het op 23Oktober ’n imbizo in Magnolia, Paarl-Oos, aangebied om bewustheid onder inwoners te skep oor die belangrikheid daarvan om in die voorkoming van misdaad in die gebied verantwoordelikheid te neem

Coke-vrag ‘gereeld’ geteiken

Die bestuurder van ’n Coca-Cola-afleweringsvragmotor is verlede Donderdag (23 Oktober) beseer toe hy in Groendal, Franschhoek, aangeval is.

Volgens Kurt Maske, ’n plaaslike paramedikus, het die voorval omstreeks 17:00 in Skoolstraat gebeur.

Maske sê hy het op die toneel verneem dat soortgelyke aanvalle op hierdie afleweringsvragmotor gereeld plaasvind – veral op Dinsdae en Donderdae.

“Hierdie ouens steel van die vragmotor af. So, gister (23 Oktober) het drie mans, soos wat ek verstaan, goedere van die vragmotor af probeer steel

Die bestuuder het toe probeer ingryp Hulle het hom toe in die arm gesteek. Ek is ontbied om mediese hulp aan die drywer te verleen, waarna hy met ’n private voertuig hospitaal toe geneem is Volgens omstanders op die toneel is dié drie mans in Groendal daarvoor bekend dat hulle mense steek.”

Paarl Post het ’n navraag aan die Franschhoek-polisie gerig

“Daar is een saak geopen, maar dit het Dinsdag (21 Oktober) plaasgevind Daar is geen rekord dat daar Donderdag (23 Oktober) ’n klagte [aangemeld] is nie.

’n Bestuurder van ’n Coca-Cola-afleweringsvragmotor is verlede Donderdag in Franschhoek aangeval Foto: Franschhoek First Responders

Die Franschhoek-polisie dra ook nie kennis dat afleweringsvragmotors van CocaCola voordurend deur misdadigers in die Groendal-gebied geteiken word nie,” het sers Muriel Sitzer, ’n woordvoerder vir dié polisiekantoor, geantwoord.

OPENBARE DEELNAME PROSES

Wellington:Vier veediewe gevang

ChantélleHartebeestenJanaScheepers

Altesaam vier veediewe en twee kabeldiewe is die afgelope naweek in Wellington deur wagte van Bolkvest, ’n veiligheidsmaatskappy in Wellington, vasgetrek en deur die Wellington-polisie in hegtenis geneem.

Volgens Eben Saunderson, die eienaar van Bolkvest Sekuriteit, doen die maatskappy onder meer plaasbeveiliging Hy sê plase in die Wellington-omgewing gaan al ’n geruime tyd onder veediewe gebuk, wat skape en beeste teiken, asook kabeldiefstal

Die eerste twee veediewe is Saterdag (25Oktober) ongeveer 01:30 op ’n plaas naby Hermon vasgetrek, waarna die veiligheidsmaatskappy se wagte Sondagaand (26Oktober) omstreeks 22:00 nóg twee op ’n plaas in die Agter-Groenberg-omgewing in hul spore gestuit het

Volgens Saunderson kon Bolkvest Saterdagoggend egter nie al die verdagtes vastrek nie en twee of drie het weggekom

Dié inhegtenisnemings volg nadat die maatskappy se wagte, wat hy sy “intellegensiediens” noem, op die onderskeie plase gepatrolleer het

Een vermeende kabeldief is ook Saterdagaand deur Bolkvest in ’n pomphuis op ’n plaas langs die Malanstasie-pad vasgetrek Volgens Saunderson is die Wellingtonpolisie in elke voorval kort nadat Bolkvest die verdagtes vasgetrek het, ontbied Bolkvest bedien die gebied tussen Wellington en Hermon en het opgelet dat veediefstal in dié gebied aan die toeneem is en die vee wat gesteel is, blykbaar vir “ruilhandel” vir dwelms gebruik word

“Die afgelope maand het hulle (veediewe) seker sowat 40 tot 50 skape en ses beeste gesteel Dit is in die Wellington- en Hermon-omgewing Ons is besig om die veediefstal te probeer hokslaan en het erns-

tige optredes asook patrollies in die veld “Ons gebruik ook voetspanne Ons het dit nou reggekry om twee van die vermeende veediewe vas te trek, maar daar is nog ’n hele groep veediewe,” het Saunderson gesê

“Ons kon darem twee van die gesoute manne tydens een van ons patrollies vastrek Ons is dankbaar en hulle is tans in die polisieselle [in Wellington]. Die veediefstaleenheid van die polisie neem die ondersoek oor Hopelik sal die twee verdagtes gevonnis word ” Hy het beklemtoon dat misdaadbekamping – veral met betrekking tot veeen kabeldiefstal – ’n “gemeenskapsprojek” moet wees en die gemeenskap moet saamwerk om hierdie probleem doeltreffend die hoof te bied Hy doen ’n beroep op inwoners, wat inligting oor veediewe het, om na vore te kom “Veediefstal maak die boere seer Dan sit ons ook nie net met veediefstal nie, maar ook kabeldiefstal – soos koperdrade wat gesteel word ’n Beraamde R50 miljoen se skade is net die afgelope ses maande op plase [in die gebied] aangerig ”

•Paarl Post het na die Wellington-polisie uitgereik, maar geen terugvoering ontvang nie

Vier vermeende veediewe is die afgelope naweek in Wellington in hegtenis geneem Foto: Wellington Aksiegroep/Stopmisdaad/ Facebook

Fund fails firms

JanaScheepers

Several businesses in the Drakenstein area, including Paarl-based construction companies, are struggling to operate due to ongoing delays at the national Compensation Fund, a state-run body responsible for assisting employees injured or made ill at work

The fund, established under the South African Compensation for Occupational Injuries and Diseases Act 130 of 1993, provides financial support to workers or their families in cases of work-related injury, illness or death

Employers are required to register their staff and pay annual contributions based on their payroll to ensure coverage

A Drakenstein resident who submits Compensation Fund applications on behalf of local companies said a number of his clients had been waiting over a year for their registrations and “letters of good standing” to be processed

The delay, they explained, has left at least three of his clients unable to operate legally, forcing them to close their doors and leave employees without any income

Under the Act a valid “letter of good standing” confirms that a company’s workforce is covered by the compensation fund and legally permitted to work Without it many local businesses are effectively brought to a standstill

According to the source, who requested anonymity to protect the identity of the businesses they represent, the registration process should ordinarily take between 21 and 30 days

However, since December 2023, they have faced persistent delays in getting applications approved Attempts to contact the Compensation Fund have been largely unsuccessful, with “telephone lines and emails not working or the system being offline,” the source said

They added they had handed in 100

businesses can register their employees through two channels, either directly via the Compensation Fund’s online platform or by using the services of an external specialist

Errors made during self-registration often require expert intervention, but it is at this stage or when new applications are submitted on behalf of clients, that delays most frequently occur

Paarl Post reached out to the department of labour regarding an enquiry about the Compensation Fund, but received no feedback.

The article “Fraud flagged at the Compensation Fund” , published by GroundUp on 17 February 2025, reports widespread dysfunction and suspected fraud within South Africa’s Compensation Fund

The Auditor-General’s office told Parliament in February that the fund has failed audits for 12 consecutive years, citing systemic breakdowns, weak internal controls and possible fraudulent payments

Businesses, workers and medical service providers face months- or years-long delays in claim approvals and payments, with many companies unable to obtain letters of good standing

Despite a Special Investigating Unit

Bejaarde gewurg en beroof

JanaScheepers

’n 76-jarige vrou van Denneburg in Paarl is Donderdagagaand (23 Oktober) in haar erf oorval, gewurg en vir ure buite gelaat nadat sy van haar aanvaller ontvlug het Volgens inligting wat aan Paarl Post bevestig is, het die voorval omstreeks 22:00 by die vrou se woning in Muskadelstraat plaasgevind Die slagoffer het, volgens ’n buurvrou en vriendin, buite in haar erf gesit en na die radio geluister toe sy deur ’n onbekende verdagte oorval is Sy woon glo alleen in die huis

Sers Welsey Twigg, ’n woordvoerder vir die provinsiale polisiekantoor, het die voorval bevestig Volgens hom ondersoek die Paarl-polisie ’n klagte van huisroof

Die buurvrou, wat anoniem wou bly, vertel dat die bejaarde iemand in haar erf hoor hardloop het voordat sy op die grond gestamp is en op haar maag beland het

Die aanvaller het glo op haar rug gaan sit, haar nek agteroor gebuig en haar gewurg

Die slagoffer het daarna voorgegee dat sy haar bewussyn verloor het

Die verdagte het toe sleutels geneem en toegang tot die huis gekry, waar hy die bejaarde se selfoon gesteel het Twigg het bevestig dat die verdagte glo ook klere gesteel het

Nadat die verdagte klaar was, het hy glo aan die bejaarde se nek vir ’n polsslag gevoel en op die vlug geslaan

As gevolg van ’n bestaande rugbesering, wat vererger is toe die aanvaller op haar rug gesit het, kon sy nie opstaan om hulp

te ontbied nie en moes sy die hele nag buite deurbring

Teen die oggend het sy op haar hande en knieë na binne gekruip en op haar voorstoep gaan sit, waar sy na haar buurvrou om hulp geroep het Die buurvrou het die Paarl-polisie omstreeks 08:00 ontbied

Die slagoffer se keel en ’n deel van haar gesig is glo potblou soos sy gewurg is, het die bron gesê

Volgens haar was dit die eerste ernstige gewelddadige voorval in dié deel van Denneburg Sy en die slagoffer woon al sowat 40 jaar in die buurt

Die buurvrou sê die bejaarde het aangedui dat sy moontlik haar aanvaller ken Sy sê die aanvaller het nie ’n woord gepraat nie – moontlik om te keer dat sy sy stem herken Hy het ook blykbaar geweet watter sleutels watter deure oopsluit – veral die sydeur na die motorhuis

Die feit dat die bejaarde se aanvaller haar nie vasgebind het nie, beteken dat hy moontlik kon geweet het sy slagoffer het ’n rugprobleem en moeilik sou kon opstaan en stap

Toe Paarl Post omstreeks 11:30 by die toneel aankom, was die metro-ambulanspersoneel besig om die vrou op ’n draagbaar te laai en na die hospitaal te neem

Volgens die buurvrou is die bejaarde slagoffer nog dieselfde dag uit die hospitaal ontslaan, maar haar lyf is nog seer en sy is steeds getraumatiseer ná die voorval •Enigiemand met inligting oor hierdie voorval kan die Misdaad-hulplyn by 08600 10111 skakel

Construction companies are among those struggling to operate due to delays at the national Compensation Fund Illustration photo: Gabiel Bouys/ AFP

Whistleblower in court

A female administrator and whistleblower at Drakenstein prison said she was undeterred by attempts to silence her after the prison head had her charged with harassment, among other charges.

Early last year Drakenstein’s prison head Ntomboxolo Kungune came under fire over allegations levelled against her of abuse of power, malfeasance and fruitless and wasteful expenditure.

Makaba-Ngayo, who appeared in the Paarl Magistrates' Court on Monday (27 October), said the “frivolous” charges by her boss had caught her by surprise.

“In her court papers she alleges I had arranged to have her taken out,” she told the media outside the court. “She said she is not safe with me. There are a total of five allegations.

“She claimed I had been harassing her for two years. If that were the case I do not understand why she never reported it or addressed me personally on this alleged harassment.

“There is a lot going on here There is obviously the internal investigation going on that I cannot talk about at this moment.”

The matter was postponed to 8 December for Kungune to make representation.

“She was not in court today (Monday). Her lawyer attended on her behalf,” Makaba-Ngayo pointed out. “The court, however, said she must attend and hence, the matter was postponed.”

On Monday, EFF political-party members picketed outside court in support of Makaba-Ngayo calling for the removal of Kungune.

In February last year Paarl Post reported on the shocking allegations levelled against Kungune.

A group of wardens in January last year penned a letter to then-Minister of Correctional Services Ronald Lamola, accusing the prison head of abuse of power, malfeasance and fruitless and wasteful expenditure.

The allegations ranged from administrative to housing complaints.

Officials accused Kungune of abusing her power by removing competent staff who disagreed with her and replacing them with junior, compliant officials.

She is alleged to have suspended an unusually high number of staff, double the amount recorded over the last five years, and to treat misconduct by her close associates leniently while harshly disciplining others.

Her leadership style was described as autocratic and intimidating Kungune was further accused of dismantling the housing committee that had allocated staff accommodation within the prison precincts and personally assigned houses to favoured officials, disregarding established criteria.

Some families were allegedly evicted unfairly.

She reportedly renovated a departmental house without approval from Public Works, which funded the changes, and the house now stood vacant.

The wardens also alleged that the prison’s abattoir, which supplied meat to correctional facilities nationwide, was in disarray

They claimed experienced staff were replaced by untrained workers, causing severe production delays.

Chickens and pigs were kept far beyond normal slaughtering ages, increasing feed costs and driving production prices up.

The Department of Correctional Services, meanwhile, confirmed it was aware of the allegations in question

“These allegations were previously brought to the department’s attention,” said the department’s spokesperson Singabakho Nxumalo “The claims were thoroughly assessed and found to have no basis.

“Accordingly, there is no internal investigation underway against the Area Commissioner of Drakenstein

“The department therefore dismisses the renewed allegations as unfounded and reiterates the matter has previously been dealt with in full ”

Baby’s body in Drommedaris

Police have launched an investigation after the body of a baby was discovered in a dustbin in Lingelethu Street, Drommedaris on 23 October around 11:45. According to Capt Frederick van Wyk, a provincial police spokesperson, the baby’s gender was unknown and a case of concealment of birth had been opened for investigation No arrest had been made at the time of going to print An enquiry was conducted at Paarl Hospital in an attempt to identify the person responsible and DNA samples from the baby had been collected for future reference

Facebook

Nokuthula Makaba addresses the media outside Paarl Magistrates’ Court on Monday (27 October). Photo: Rasaad Adams
Photo: Charlton Manfred Jantjies/

Redaksionele kommentaar

Paarl Post

‘n Glimlag hier en daar bied hoop

Die lig word op verskeie gesondheidstoestande geskyn in die maande van September tot November, met onderskeidelik kinderkanker-, borskanker-, geestesgesondheids- en prostaatkankermaand, wat met verskillende bewusmakingsveldtogte aandag geniet Paarl Post het ook in dié tyd met ’n handjievol oorwinnaars gepraat en hul inspirasiestories gedeel om ander te motiveer en aan te moedig, maar spesifiek ook om die klem te lê op die

Ons hoor graag van jou! Paarl Post nooi al ons lesers om hul gedagtes, terugvoer en storie-idees met ons te deel. Of jy nou ’n mening wil lug, kommentaar oor plaaslike kwessies wil lewer, of weet van iets nuuswaardigs wat in jou gemeenskap gebeur – ons hoor graag van jou! Stuur ’n WhatsApp-boodskap na 0664843728 of stuur jou brief per e-pos na paarlpost@novusmedia.co.za. Jou stem maak saak.

We'd love to hear from you! Paarl Post invites all our readers to share their thoughts, feedback and story ideas with us. Whether you have an opinion, want to comment on local issues, or know of something newsworthy in your community – we'd love to hear from you! Send us a WhatsApp on 0664843728 or email your letter to paarlpost@novusmedia.co za. Your voice matters.

Mobility gives out 44 bicycles

The Methodist Church in Wellington is among several organisations that received bicycles from the Western Cape's Mobility Department on Saturday (25 October).

Mobility MEC Isaac Sileku handed over the bicycles in Idas Valley, Stellenbosch, to the organisations in attendance According to the department, the gifting of the bicycles forms part of the Provincial Sustainable Transport Programme (PSTP)

This also forms part of the department's ongoing efforts to improve safe, affordable, and sustainable mobility across the Western Cape

"The Bicycle Distribution Project, one of the flagship initiatives under the PSTP, aims to empower communities by providing bicycles, safety training, and basic maintenance support to beneficiaries who have to walk long distances to school, work, or community activities "

The programme was launched in 2019 and over the course of six years, more than 2500 bicycles have been distributed across the Western Cape to learners, neighbourhood watches and community-based organisations

"A bicycle may look simple, but it represents freedom, dignity, and opportunity Through this programme, we are helping

learners get to school on time, supporting workers to save money on transport, and giving neighbourhood watches the means to patrol their communities more effectively," says Sileku.

"The handover is another example of what is possible when government, municipalities, and communities work together to make mobility safer and more accessible for everyone These bicycles will go a long way in strengthening community safety, promoting wellness, and creating opportunity "

In total, 44 bicycles were handed over at the event and will be distributed to local organisations, which include: Idas Valley Community Trails, Angels of Hope Community Development Organisation, Methodist Church of South Africa in Wellington Prochorus, Hillside Village Neighbourhood Watch and Juffernbrugh Street Neighbourhood Watch

Reginald Pheiffer, Stellenbosch Municipality councillor, said: "We are proud to partner with the Mobility Department on this initiative, which supports our vision of a connected and inclusive Stellenbosch Projects like this show how collaboration can bring real change, helping communities move more freely, improving safety on our roads, and encouraging healthy, sustainable living "

Maatskaplike dienste skuif

ChantélleHartebeest

Die gebou wat destyds die JJ du PreezLe Roux-kliniek in die Paarl gehuisves het, word tans opgeknap voordat dit binne die volgende paar maande deur die WesKaapse departement van maatskaplike ontwikkeling in gebruik geneem sal word Stephen Heyns, ’n woordvoerder vir die Wes-Kaapse departement van infrastruktuur, het die verwikkeling vandeesweek aan Paarl Post bevestig

Die gebou is op die hoek van Ambagsvalleistraat en Jan van Riebeeck-weg

“Die Wes-Kaapse departement van infrastruktuur is die bewaarder van die gebou en het dus instandhoudingsverantwoordelikhede Die Wes-Kaapse departement van maatskaplike ontwikkeling sal die gebruiker van die gebou wees en sal sekere gebruikersverantwoordelikhede hê ” Heyns sê omdat die gebou aan maatskaplike ontwikkeling toegewys is, word opknappings gedoen om aan dié departement se fasiliteitsvereistes te voldoen Hy voeg by dat die gebou nooit verhuur is nadat die kliniek sy deure gesluit het nie

“Die gebou was nooit leeg nie en totdat verbeterings vir die beplande gebruik vir die departement van maatskaplike ontwikkeling nou aan die einde van 2025 begin het, is dit as ’n stoorplek vir die departement van infrastruktuur en maatskaplike ontwikkeling gebruik Voor dit is dit deur die Wes-Kaapse departement van gesondheid en welstand gebruik ” Nadia Ferreira, ’n woordvoerder vir die

departement van gesondheid en welstand, sê die JJ du Preez- Le Roux-kliniek het sy deure reeds in 2016 gesluit

“Die rede was om dienste met die TCNewman-kliniek te konsolideer, aangesien JJ du Preez- Le Roux slegs voorkomende dienste gelewer het en nie ’n omvattende dienspakket nie

Die besluit is ook geneem omdat die twee fasiliteite slegs 1,3km uitmekaar geleë is Dit was meer sinvol om dienste by TC Newman te sentraliseer

“Dit stel ons in staat om beter sorg aan pasiënte te lewer en personeel meer doeltreffend aan te wend ”

Esther Lewis, ’n woordvoerder vir die departement van maatskaplike ontwikkeling, het die skuif van hul kantoor bevestig Sy sê die besluit is ook geneem om diegene in ag te neem wat van openbare vervoer gebruik maak

“Dieselfde dienste, wat onder meer kinderbeskerming, dienste aan gesinne en ouer mense asook psigososiale ondersteuning insluit, sal steeds vir die Paarl-gemeenskap in die nuwe perseel beskikbaar wees Dit is naby openbare vervoer, wat dienste meer toeganklik maak Neem kennis maatskaplike-ontwikkelingsdienste is ook by die Mbekweni- en Paarl-OosThusong-sentrums beskikbaar ” Lewis sê die plaaslike maatskaplikeontwikkelingstak sal van vroeg volgende jaar uit die nuwe gebou bedryf word Intussen werk hulle steeds uit hul huidige kantoorgebou by die Rembrandt Mall in die Paarl

Contact us on: 021 879 3550 or email: hello@thefirebird.co.za

At Firebird, we're passionate about helping our community build strong financial futures. From insurance and medical aid to retirement planning, investments, and short-term insurance, our expert financial planners offer guidance tailored to your goals.

"Let's help you protect what matters most and build lasting financial confidence"

The Western Cape Mobility Department handed over bicycles to a few organisations.
Back left: Chantelle Jordaan, Gerhard Conradie, Trenstin Jacobs, Shaun Lombard & Paul Fourie
Front left: Lynette Schäfer, Marina Conradie, Theresa Martin, Monique Sampson & Tarryn
Adonis

Golf Day for Sunfield Home

Businesses and individuals came out in their numbers to support the annual Golf Day fundraising event of Sunfield Home at the Paarl Golf Course

The event took place last Thursday (23 October) and was in aid of Sunfield Home, a centre for intellectual disabled adults. The goal of the Golf Day was to raise awareness and funds for the centre, which is situated in Wellington.

On the day of the event Elmarie van Schalkwyk, managing director at Sunfield Home, said she is very excited, especially after she saw how cheerful everyone looked.

“The people who are here at the Paarl Golf Club today are supporting Sunfield for a fundraising initiative by playing golf with us. The funds generated here will supplement our budget deficits. So, it could be for food, for the electricity to keep the place running, it could be to pay the staff, but, most importantly, for

the care of our residents to make sure they are perfectly looked after.”

Van Schalkwyk added: “Sunfield Home is a centre for intellectual disabled adults from the age of 18 years. We try to accommodate them as long as possible while they are still physically strong So, it is a home for them and then also a workplace for these people who cannot work in the wider market.

“We invite everyone to come and visit us so that we can show you what we do and that you can meet our residents and receive all the love they radiate.”

A dinner was held later that evening where everyone were thanked for their contributions. As part of the dinner there was a prize-giving as well as an auction of some of Sunfield Home residents’ artwork.

Sunfield Home welcomes donations and anyone who would like to make a donation can contact Elmarie van Schalkwyk via email at elmarie@sunfieldhome.co.za

Spaza workshop

ChantélleHartebeest

A workshop for spaza shop owners within the Paarl area took place last week at the Thusong Centre in Paarl East The session was spearheaded by the Cape Winelands District Municipality (CWDM)

“The training was conducted to help these small, but vital businesses follow the required standards in order to maintain their Certificate of Acceptability (COA),” says Stefnie Titus, chief environmental health practitioner for the CWDM

The information sessions for spaza shop owners were hosted by the Municipal Health Services of CWDM, together with the Department of Agriculture and Drakenstein Municipality’s Department of Local Economic Development

According to Titus the Municipal Health Services consists of 48 environmental health practitioners (EHP), stationed in the five main towns in the district

“The Municipal Health Services have nine main functions focused on managing environmental risks by assessing and addressing the physical, chemical, and biological factors that impact community well-being ”

She added that the Municipal Health Services ensure that all consumable products produced, sold and/or exported into or out of the district is safe for consumption

“The practical implications of this task include regular inspections at supermarkets, abattoirs, packing rooms, etc as well as monitoring of air and water quality

Even the water in public swimming pools is regularly tested to ensure that it complies to the regulated standards ”

Workshops for spaza shop owners have

been taking place throughout the Cape Winelands during September and October

“Forty-five business owners from Paarl East participated Although this may seem very few, bear in mind that one owner can have many shops and that there is more than one opportunity for the owners in the area to attend

“With the recent events surrounding food safety of products specifically bought at spaza shops, coupled with the joint operations done throughout the country involving municipal health, local municipalities, the police, Sars and department of home affairs, CWDM Municipal Health Services saw the need to educate spaza shop owners on the legalities of opening and running such businesses in order to become compliant and ensuring the safety of food products sold to the public ”

Some of the key points that were touched on, include – hygiene requirements and the importance of practicing good personal hygiene which includes frequent handwashing; safe storage and use of pesticides; and the registration and licensing process of spaza shops at Drakenstein Municipality Titus says CWDM will continue the need to offer such workshops as the need arises, because they committed to health education and training, and assisting businesses to become compliant.

Spaza shop owners within Drakenstein can contact their local environmental health practitioners at the office of the CWDM, 194 Main Road, Paarl or phone 021 871 1001 Alternatively, they can email Stefnie Titus at stefnie@capewinelands gov za Any spaza shop owner within the Cape Winelands in other municipal areas can contact the CWDM directly either via e-mail at admin@capewinelands gov za or sharecall, 0861 265 263 for information

· MainStreet(betweenMarketStreet&FaureStr MainStreetLaneclosures: Southboundlanewillbeclosedfrom10AMuntil Northbound lane will be closed from 1 23h30PM.

· Market-&FaureStreetwillbeaccessibletoloc · Detours will be clearly signposted, and tra�ic on-sitetoassistmotorist.

Thepositionsthatmustbefilledare: •

(Only persons with a

Rene Reece (far left) and Elmarie van Schalkwyk (in front) with participants in the annual Golf Day
Photo: Chantélle Hartebeest

Pietersen turns her pain into purpose

Taking the first steps towards your healing and choosing a better life for yourself may seem like the highest mountain to cross. Louise Pietersen, a qualified trauma counsellor, wanted to assure anybody in such a situation that they don’t have to make the ascent alone.

Pietersen recently launched a non-profit, Let’s Arise, and she is dedicated to helping everyone who comes knocking for help. The initiative was born from being faced with some of life’s biggest challenges, such as gender-based violence, drug abuse and having been molested as a child herself. She has turned her pain into power, rising above everything that was meant to break her.

“Guided by the inspiring slogan ‘Step Out to Step In’, Let’s Arise encourages individuals to step out of pain, fear and limitation, and step into healing, purpose and transformation.

“I had to step out to step in. Step out of pain, fear and brokenness, to step into healing, purpose and power. That’s what Let’s Arise NPC is about; giving others the chance to step out and step in.”

This year Pietersen also reached the milestone of being drug-free for ten years. She recalled the time in her life when she had to live in a shelter for

abused women.

“I stayed at a shelter and I saw how women are with one another It’s not easy to share your story I was privileged to go on a writing retreat during those years where I learnt to write my story That was the first step towards my healing to learn to write my story.”

Today she is also an ambassador of the 1 000 Women Trust, who stand against gender-based violence and femicide, while raising funds and awareness.

According to Pietersen the foundation of Let’s Arise is rooted in God who laid the mission on her heart.

DIVINEINTERVENTION

“Last year God spoke to me. I got different signs where God told me to step out [at my current job]. I have to close the door, because he wants to open a new door. February this year God just told me “you have stood still at this mountain for too long” On 26 March of this year I stepped out in faith as operational manager of Radio KC.

“This is where Let’s Arise slogan comes from and why I say Let’s Arise, because many times people are so stuck in something. They don’t realise they have to step out so they can step in. I had to step out of a lot of things to be able to step in. I was in mourning for almost two months after I left my job. I literally laid down and cried before God Then I recon-

nected with 1000 Women and I was reminded that I have been clean from drugs for 10 years. I thought what is it that the Lord wants me to do What is it that I can do in Drakenstein?”

One heartbreaking reason why Pietersen decided to establish Let’s Arise was when her son was also molested. She felt that the system had failed her child. “As a trauma counsellor

and GBV warrior I felt as if my hands were cut off when I was told my child has ADHD and he would not be able to testify in court.

STEPPINGINTOSYSTEM’SBREACH

His abuser’s case was based on forensics, the basis on which the uncle in question was arrested, and about two months ago he died.

“My child has not yet received trauma counselling or any help. He is now on ADHD medication, but the system failed my child, but I realised at some point this is one of the reasons the Lord has made me a qualified trauma counselor.”

Local motivational speaker Charlene Elliot, who also attended the opening of Let’s Arise, commented: “It reminded me once again of the power of unity and the incredible things that can happen when people come together with one purpose: to rise and to help others rise with them.”

Let’s Arise offers the following key services:

• Trauma counselling and psychosocial support.

A 24-48-hour emergency safe room for victims needing immediate protection.

• Affordable educational tours to give rural communities access to new opportunities and experiences

• Event planning and management for community-building initiatives.

• Affordable tutoring to help children from disadvantaged backgrounds access quality education.

• Building sustainable partnerships with schools, businesses, and community organisations across Drakenstein.

For more details contact Louise Pietersen on 079 179 6307 or 084 988 5849.Alternatively, email letsarisenpc@gmail.com

Charlene Elliott and Louise Pietersen at the launch of Let’s Arise NPC.

PUBLIC NOTICE CALLING FOR INSPECTION OF THE SECOND SUPPLEMENTARY VALUATION ROLL 2024 AND LODGING OF OBJECTIONS

No ce is hereby given in terms of Sec on 49(1)(a)(i) read together with Sec on 78(2) of the Local Government: Municipal Property Rates Act, 2004 (Act No 6 of 2004), hereina�er referred to as the “Act”, that the Second Supplementary Valua on Roll 2024 is open for public inspec on during office hours from 30 October 2025 ll 19 December2025atthevenuesasstatedbelow Inaddi on,thevalua onrollisavailableonthemunicipality'swebsite www.drakenstein.gov.za

In terms of Sec on 49(1)(a)(ii) of the Act, any property owner or other person who wishes so, may lodge an objec on with the city manager in respect of any ma er reflected in, or omi ed from the valua on roll during the period 30 October 2025 ll 19 December 2025. The prescribed forms for the lodging of objec ons are obtainable at the venues statedbelowaswellasonabovemen onedwebsite.

Objec ons may only be lodged in respect of proper es listed in the Second Supplementary Valua on Roll. The owners of these proper es will be no fied of their valua ons in wri ng at the postal address currently held on the municipality'sdatabase.

A en on is specifically drawn to the fact that in terms of Sec on 50(2) of the Act an objec on in terms of subsec on 50(1)(c) of the Act, must be in rela on to a specific individual property and not against the valua on roll as such. Pleasenotethatanobjec onformmustbecompletedperproperty

The completed objec on forms can be handed in at the objec on venues listed below or posted to: Drakenstein Municipality, For A en on: Valua on Sec on, P O Box 1, Paarl, 7620 or e-mailed to: CustomerCare@drakenstein.gov.za

Ob ec�on Venues: st Drakenstein Municipal Offices, 1 Floor Civic Centre, Berg River Boulevard, Paarl

Drakenstein Customer Care Centre, Mbekweni

Drakenstein Municipal Offices, Civic Centre, Pentz Street, Wellington Drakenstein Municipal Offices, Gouda

Drakenstein Municipal Offices, Saron

Please take note that, the closing date for the lodging of ob ec�ons is 19 December 2025 and under no circumstances will late ob ec�ons be accepted. For enquiries, please contact Mr I Fortuin (021 807 4534), Mr M Y Gaidien(0218074792)orMrJLawrence(0218074825).

DR J H LEIBBRANDT, CITY MANAGER Paarl Post 30/10/2025

Iindawo zezichaso:

g

DrakensteinMunicipalOffices,CivicCentre,BergRiverBoulevard,Paarl.

DrakensteinCustomerCareCentre,Mbekweni

DrakensteinMunicipalOffices,CivicCentre,PentzStreet,Wellington

DrakensteinMunicipalOffices,Gouda

DrakensteinMunicipalOffices,Saron

Nceda, qwalasela okokuba ukufakwa kwezichasi kuyaphelelwa ngomhla weshumi elinesithoba kweyoMnga 2025.Isichasoesingenisweemvenikwexeshaasisayikwamkelwanangasiphinaisizathu. Ukuba unemibuzo nceda udibane no Mnu.I Fortuin (021 807 4534) okanye Mnu. M Y Gaidien (021 807 4792) kunye no Mnu. J Lawrence (021 8074825). GQ JOHAN LEIBBRANDT, UMANEJAL WESIXEKO Paarl Post 30/10/2025 000000000-PL301025

Value of after school promoted

Learners across Paarl East attended the fun-filled activities of the Lights On After-School Day (LOAS) at Paarlzicht Primary in large numbers on Thursday (23 October).

LOAS is a worldwide campaign that was launched in 2000 in America by the After School Alliance organisation. It has become an annual event in South Africa over the past six years.

The main goal of the campaign is to raise awareness of the vital role after-school programmes play in supporting learners’ holistic development, says The Learning Trust, who drives this campaign in the Western Cape, Eastern Cape and Gauteng.

“Many of the young people we work with don’t always have the luxury of strong support systems at home Afterschool programmes step into that gap, not only to help with homework or academics, but to build confidence, provide encouragement, and model what it means to persevere and plan ahead,” says Charlene Peterson Voss, Executive Director at The Learning Trust.

The Learning Trust supports innovative, early-stage and community-based education nonprofits through the pro-

vision of funding and capacity support to after-school programmes. They drive the LOAS campaign in South Africa in partnership with YearBeyond, a flagship national youth service programme, that was the host of the LOAS activation in Paarl Many other local non-profit organisations with after-school programmes formed part of the activities, which included self-defence lessons, touch rugby, soccer, volleyball and rieldans.

Wayde Groep, Communications and Advocacy Manager at YearBeyond, says there were approximately 400 children. Local Partners included Drakenstein Municipality, Bully Busters, Magda se Sopkombuis and other primary schools.

“The Lights On After School celebration was a powerful reminder of what’s possible when we invest in our learners creating safe spaces filled with opportunity, mentorship, and joy,” said Groep.

“At YearBeyond, we believe these moments of connection and growth help shape brighter futures not only for learners, but for entire communities.

What often goes unnoticed is the vital role of the practitioners in our case, the YeBoneers, our youth in service. These hidden educators are the heartbeat of after-school learning. This celebration was as much about them as it was about the learners they inspired.”

Graad R-leerders maak op gradeplegtigheid litte los

Volgende jaar se leiers aangewys

Die Hoërskool Labori het onlangs sy skool se Verteenwoordigende Leerlingraad (VRL) vir 2026 bekend gemaak Op die foto bo staan die groep leerders trots en oorgehaal om hul taak aanstaande jaar te verrig

Meisies draai die krane oop in atletiek

Die Hoër Meisieskool Paarl is onlangs as die wenners van die meisiesafdeling van die Curro Podium-atletiekbyeenkoms aangewys Die byeenkoms is in die Daljosafat-stadion beslis Bo ontvang die deelnemers hul trofee Foto: Ernest Kilowan

Spelling Bee

A very competative volleyball game Photos: Chantélle Hartebeest
The young ones in action on the soccer field
Kieran September and Landon Cupido, both Grade 6 learners at William Lloyd Primary, participated in the recent WOW Spelling Bee Landon (left) was awarded 2nd in the Western
Ernest Kilowan

TV celebrates male spaces

A new television series explores the intimate relationship between South African men and their personal spaces.

What does a man’s living space really say about him? It’s a question that has fascinated interior designer and author Leoni Smit for years, leading her to create the acclaimed coffee-table book Masculus – The Male Domain

The book, which began as a serious exploration of interiors, masculinity and psychology, is a 7 kg statement on the architecture of male life, conceived and crafted by Smit over three years

Now, this passion project has an added dimension; it, in turn, has inspired a television series that gets up close and personal with men in their most private sanctuaries.

Tussen mure emanates from that

Dagboek/Diary

Dagboekinskrywings kan per e-pos gestuur word na paarlpost@novusmedia co za teen Maandae 14:00

TUESDAY 28 OCTOBER TO SUNDAY 2 NOVEMBER

The Drakenstein Valley adds another jewel to its crown this October as KAMERS/Makers, South Africa’s leading artisan showcase, opens its doors at the renowned Allée Bleue Wine Estate (near Paarl) More than just a market, KAMERS / Makers is a six-day lifestyle event celebrating the very best of South African fashion, jewellery, homeware, décor and gifts, each piece handcrafted by local entrepreneurs With Christmas around the corner, shop for the best of SA fashion and design in the Winelands Visit kamers co za for tickets

SATURDAY 1 NOVEMBER

Pilgrimage to Israel in October 2026

A meeting will be held at 16:30 at Two Olives Ministries, 8 Spin Street, Wellington Contact Pastor Nico Mettler on WhatsApp on 060 559 1708 for more information

VRYDAG 7 NOVEMBER

Die ACVV-Oase-dienssentrum by Langstraat 14 hou Vrydag 7 November om 15:00 ’n Reënboogmarkdag Skakel 021 871 1518 vir nog inligting VRYDAG 7 tot 9 NOVEMBER

Moenie die Buitelewe-en-Avontuur-Ekspo in Grabouw misloop nie! Die ekspo is by die Elgin-Grabouw-sportklub langs die Eikenhoffdam Hierdie gewilde geleentheid bied alles vir die buitelug Die Buitelewe-en-Avontuur-Ekspo is ’n wonderlike dag-uitstappie vir die hele gesin Die kaartjies by die hek kos R80-R150 en kinders o 7 geniet gratis toegang Besoek www lrclassic com

world, even if it doesn’t quite reflect the book’s seriousness. The 13-part series, which premiered on kykNET on 5 October, is human, energetic and alive. It is a personality-driven exploration of men and the spaces they inhabit, capturing their gestures, their humour and quiet truths.

Director Elmi de Pauw brings this world to life. Energetic and intuitive, she lifts the mood in every room, revealing the small human moments that make each man visible. Through her lens interiors become stages and men reveal themselves without artifice.

Among the collaborators is co-presenter Eugene Coetzee, founder of Eugene Coetzee Décor & Design Consultants

A consummate connoisseur of books, he said: “The moment I purchased Masculus I thought it would be fascinating to share its spirit with a wider audi-

ence I do not even page my books; they are sacred They have colours, moods, identities. They are not only books; they are characters Film, to me, is pages in movement.”

His perspective complements Smit’s original vision without redefining it; the book remains sovereign and the series echoes and explores its human dimension.

“I created Masculus – The Male Domain because I love coffee-table books,” Smit reflected. “They are necessary. They live in the open, bold, large, unapologetic. Film does not replace the book. It breathes alongside it.”

Produced by Walla Films, with the financial support of IFX Brokers, Tussen mure reflects South Africa’s creative capacity to merge design, story, and character on screen.

Catch Tussen mure Sundays at 17:30 on kykNET (DStv Channel 144), or watch it on DStv Stream and Catch Up In the end, Tussen mure is about who survives within them, the laughter, the quiet, the stories which continue long after the final frame As poet and novelist Charles Bukowski might have said, these rooms are not places of comfort, but confession, imperfect, honest, human

Kokkedoor dek tafel tuis in sy nuwe reeks

Met Kupido wat binnekort sy laaste liefdespyle in die huidige seisoen van Boer soek ’n vrou skiet, kan kykNET-kykers solank hulle lippe begin aflek vir die geïnspireerde disse en liefde vir kosmaak wat 16 Suid-Afrikaners binnekort gaan deel.

Kokkedoor: Son & see is van Donderdag 20 November om 20:00 ’n hoofgereg op die kykNET-spyskaart.

Vir die tiende seisoen van Kokkedoor trek die program nie net ’n ander voorskoot aan nie, maar kry dit ook twee nuwe beoordelaars, die gerekende koskenners Herman Lensing en Yolani Abrahams.

Beide beoordelaars is bekende en gekwalifiseerde sjefs en het al diep spore in die Suid-Afrikaanse koslandskap en kombuise getrap.

In Kokkedoor: Son & see val die kollig op die nostalgiese rol wat kosmaak in ’n familieverband speel en die manier waarop kosmaak en familieresepte soos ’n goue draad tussen die deelnemers se verskillende generasies loop.

’n Hand vol unieke bestanddele onderskei dit van die vorige Kokkedoor-reekse, soos dat die deelnemers slegs huiskokke is wat meestal vir vriende en familie kook.

Daar is geen kinkelkokke (wat ’n professionele sjefsagtergrond het) nie.

Daar is agt spanne, wat elk uit twee familielede bestaan.

Spanlede het ’n generasiegaping van ten minste 20 jaar.

’n Pa en dogter van die Paarl, Frans (51) en Una-belle (18) van Wyk, is onder die agt spanne wat eersdaags in die nuwe Kokkedoor-seisoen sal meeding.

Frans, oorspronklik van Namibië, is die eienaar van ’n koffie- en blommewinkel in die Paarl en is ook ’n geleentheidsbeplanner.

Una-belle is ’n matriekleerling aan die Hoër Meisieskool Paarl.

Die ander deelnemers teen wie Frans

en Una-belle hul kosmaakstorie sal moet ken, sluit in:

• Anton (64) en Stefvan (37) Stemmet (pa en seun). Anton woon in Yzerfontein en Stefvan woon in die noordelike voorstede van Kaapstad.

• Yvette Malan (60) en Francisca (35) Momberg (ma en dogter) van ’n plaas 45km noord van Lephalale (Ellisras) in Limpopo.

• Marianne du Plessis (64) en Ronelle de Klerk (39) (tannie en susterskind) van Kuilsrivier en Ballito in KwaZulu-Natal.

• Shireen (50) en Reuven-Jon (21) Kadalie (ma en seun) van die noordelike voorstede van Kaapstad.

• Andrew Anderson (57) en Leoné Smit (30) (pa en dogter) van Mtunzini en Vryheid in KwaZulu-Natal

• Caroline Linde (55) en Anél van Niekerk (32) (ma en dogter) van Pretoria in Gauteng

• Hanna (58) en Dirk (29) van der Westhuizen (ma en seun) van Aberdeen in die Oos-Kaap.

Kokkedoor: Son & see bestaan uit agt episodes en begin op Donderdag 20November om 20:00 op kykNET (DStv-kanaal 144).

Die reeks sal ook op DStv Stream en Catch Up beskikbaar wees.

Muratie moon and mystery forest beckons

Frans en Una-belle van Wyk van die Paarl Foto: Gys Loubser
Leoni Smit and Eugene Coetzee.
PERSOONLIKE DIENSTE VOERTUIE

Turn static files into dynamic content formats.

Create a flipbook
Issuu converts static files into: digital portfolios, online yearbooks, online catalogs, digital photo albums and more. Sign up and create your flipbook.