Vol 16 Issue 50

Page 1

pivotgroup.nyc BORO PARK Sock Exchange 4509 13th Ave 718 633 1371 BORO PARK Hosiery Boutique 5209 13th Ave 718.854 1230 HosieryFLATBUSHPlus 1378 Coney Island Ave 718 338 0046 SockFLATBUSHExchange 1318 Ave M 718 375.5108 HosieryLAKEWOODPlus 195 E Kennedy Blvd 732 367 5373 HosieryLAKEWOODPlus II 150 James St 732.987.5695 PurpleLAKEWOODOrchid 1328 River Ave 732 415.8588 HosieryLAKEWOODPlus 12 American Ave 732.961 2000 CEDARHURST Tiptoe Boutique 416 Central Ave 516 374 1100 classwith class Put your best foot forward.

youDrivinghappy!Ready to somewhere?go 718.600.6666 Not a diagnosis.BoroPark 1530 43rd St. 718.851.3000 5902 18th Ave. 718.621.1000 5520 13th Ave. 718.499.1000 Williamsburg 569 Marcy Ave. 718.348.1000 667 Myrtle Ave. 718.871.1111 Monticello Monticello,357845.419.1000EBroadwayNY12701 Lakewood 939 River 732.391.1000Ave. Maybe is for an RSVP. The car wash that comes to you. 718.831.2323 book@goswash.comwww.goswash.comservicingthegreaterNewYork and New Jersey areas get your fully detailed interior and exterior swash today! FLEET WASHING OUR SPECIALTY swashmobilecarwash TowelMicrofiberSwashgetthisMentionadtoaFREE SMIRNOFFVODKA 1.75 LITER $17.99 TOPS WINE & LIQUOR 2812 Ave. U 09-06-2022EXP. PageSee54 WHITEDEWARSLABELSCOTCH 1.75 LITER $32.99 SPRING VALLEY 268 W ROUTE 845.425.790059 MONROE 386 ROUTE 845.738.300117M LAKEWOOD 202 MAIN STREET 732.RENT.A.CAR7368227 BORO PARK 4919 20TH 347.704.3000AVE. BAY RIDGE 8901 4TH 347.704.3000AVE WILLIAMSBURG 547 PARK 347.704.3000AVE. www.ezrentacarny.com

Browse our vast selection of decor, supplies and prizes, all in one spot! 781 Kent Ave - 718.702.8161 - SKOOLKRAFTS.COM WE’RE THROWING A SUPPLIES PARTY! backpacks buetin boards crafts and kits stickersloads more!loadssuppliesprizesmore! WE HAVE A FULL SELECTION OF CLASSROOM POSTERS, INCLUDING THE ‘VIVID’ LINE!Exciting! APRENTS, YOUR’LLLOVEOU99¢!ELSIA

dartmedia.us ת״פג םויל דומע ה-א ימיב ה-א ימיב ת״פג םויל דומע םינורחאהו םינושארה תוטיש ירקיע םעק"בןיכישממתכסמבןיליחתמו'דקרפתעכ שדוח לכ ולבקתי תומוקמ יארמ א לולסמב לולסמ 888.5-DIRSHU | INFO@DIRSHUNJ.ORG

.הרותב ולמעש ימ ירשא ושרדןויערועישטימ!'ה בוט יכ וארו ומעט !טימ ךייא טפאכ

In time for YOM TOV 1548 44TH STREET • 718.853.8253 HOURS: SUNDAY-THURSDAY 11:00-5:30

Looking forward to a great school year. Give your child the confidence to start the year with the right pair. And why compromise on style while you're at it? The perfect fit, style, and prescription, are what they need for a successful year ahead! 718 435 3839 // 4820 14th ave (Corner 49th St.) // info@greateroptics.com vision therapy • contact lenses • all brands of glasses • lab on premises

ANOTHER REFUAH HELPLINE RESULT! Every day, dozens of experienced case workers dedicate themselves to Cholei Yisroel — with lifesaving results THE WONDERFUL RESULTS SPEAK FOR THEMSELVES — ALL MADE POSSIBLE AS A RESULT OF KLAL YISROEL’S GENEROUS SUPPORT

VOLVY IS BACK CHEDER!IN The littlecrushedaccidenthisbodybut The initial word from the doctors was devastating: Volvy’s organs suffered significant trauma and his leg was damaged beyond repair; he was at risk for needing an amputation. Refuah Helpline refused to give up or give in. They researched, networked and moved heaven and earth to get his scans reviewed by a world-renowned specialists and an orthopedic surgeon known for his limb-saving efforts. Working in unison and with unparalleled urgency, they were able to schedule immediate surgeries to repair the damage and save Volvy’s leg and enable him to live a healthy life. The results are in: Volvy is back on his feet! 845.606.9222CHARIDY.COM/REFUAH אובת ךאווטימ ןוא גאטסניד SEPTEMBER 13-14

The perfect pair draws success. There’s a reason our students make so much progress. NOW OFFERING SETSS | ABA | Related Services Call for your child’s evaluation: 718 975 4949 | alphasupport.org 1225 McDonald Avenue, Brooklyn, NY 11230 Servicing the Five Boroughs of NYC The Alpha team worked all summer to ensure the perfect student-provider match in skills & personality for each student for the school year.

LIQUIDATION EVENT! 2360 BEDFORD AVE, BROOKLYN NY SEP 4 — SEP 11 COME EARLY FOR BEST PICK First come first served. No reserves, no limits on purchase quantity. SUKKAHS OF ALL TYPES, PLUS: • Spare panels and extensions • Windows, doors, accessories • Schach NEW, PRODUCTSPRISTINE Factory overstocks, warehouse liquidations, slightly imperfect packaging (perfect inside) PARKING FOR 400 CARS! SINCE 1969 +MORE SUKKAH BOTTOM LINE FACTORY PRICINGS-TH 10AM - 8PM FRI 10AM - 1PM FOR MORE INFORMATION CALL: (838) 895 1632 UP 50%TOOFF

kvitel@kerentosfesyomtov.comkerentosfesyomtov.com/kvitel :ךרוד שודקה ןויצ םוצ הלבק רעייא טקיש :וינפל ועימשה וינפל וריכזה ידןוא,הלבקןגילייהםעדןעמענוצרעטנואךיזןייראטפאכ 'קהןויצןפיואלטיווקרעייאןייזריכזמןלעוושדוקהיחולש .לולא'וק"שע-אשידקאלוליהדאמויב ,וניֵתובֲאךרֵּבֶשיִמ ,בקֲעיְוקָחְצִיםָהָרְבא דִוָד,ןרֲהאְוהֶשמ תֶאךֵרָבְיאוה,המלְשו ויִפרֵמושֶשיִמלָּכ רֵּבדְלאלֶשונושְלו ה"ָּבקה,הָלִפְתהתֵעְּב הָרָצלָּכִמוהֵרְמְשִי ,הָלֲחמועגֶנלָּכִמוהקוצְו תוכָרְּבהלָּכויָלָעולוחָיְו תרותרֶפֵסְּבתובותְּכה יֵרְפִסלָכְבווניֵּברהֶשמ ,םיִבותְּכהְוםיִאיִבְּנה םיִיחםיִנָּבתואְרִלהֶּכְזִיְו הָרותְלםֵלְדגיִוםיִמָיקְו םיִשֲעמְלוהָפֻחְלו הָוהְיתֶאדובֲעיְו,םיִבוט תֶמֱאֶּבדיִמָתוניֵהלֱא :ןֵמָארמאנְוםיִמָתְבו

םוצ אקארק ןייק טראפ'מ םייהא ט"וי 'סות ןגילייה תועושי ןופ קעז ןעגנערב!הלבקה ילבקמ יד ראפ ס׳טוג סעלא ט׳לעופ׳עג

לולא ’ה זיב טקישעגניירא ןרעוו ןפראד סעיצאקילפא ג”פשת ירשת רעפטנע ןא ןטלאהרע טעוו’מ ןוא ב”פשת dartmedia.us ןוא ראי 25 ןופ טיילעגניא ראפ דחוימ .רעטלע ןוא 30 ראפ המידק ןיד ,רעטלע ליצ םוצ ןעמוקנא טפלעה תרגסמ יד .הכימס\שומיש םוקמב טשינ טניד רעבא תוכלה ןביוהנא טייג ןעמ ג”פשת ןושח ח”ר תבש הכלה ןינק ושרד.ןטיילגאב ךייא טעוו ראי עכילטע ןיוש ריא טציז ביוא טכיז ריא ןוא הרות לש הלהאב ,הארוהב ןייז וצ םילשמ ךיז דניצא רעייא ”הכלה ןינק ושרד“ זיא .רעפטנעןאד סאוו תרגסמ א זיא ”הכלה ןינק“ זיא ןוא ,ראי בלאה א ןוא ףניפ טרעיודעג ילודג יד ךרוד ןראוועג טלעטשעגקעווא םאבצ לעו מ”גבנ רבעה רודמ םיקסופה טנייה טייטש ןוא ל”צז רענזאוו ש”רגה השמ יבר לודגה ןואגה ןופ וחוקיפ תחת .א”טילש ןיילק לואש שומישו הכימס תינכת לע םינמנ םניא םגו הכימס וא שומיש םהל ןיאש דבלב םיאושנל ןתינ םינחבמה לע רכש KINYANHALACHA@DIRSHUNJ.ORG

A Welcome Sight Celebrating one year at our state-of-the-art showroom 25OFFwith% P 718.437.8772 F 347.230.5992 A 5511 New Utrecht Ave. E thelenscenter@yahoo.com AN EXTENSIVE SELECTION AT A GREAT PRICE. THERE’S NO OTHER WAY TO FRAME IT. SALE DATES: AUG. 31 - SEP. 9 All Frames Sale applies to a complete pair of glasses pivotgroup.nyc

המל˘ רע‚רעב„ל‡‚‚רעבנעז‡ר'יבוטסלעזיימברהברהברהיבˆל‡יחיינחורלהנמברהןועמ˘ןייט˘נעכיי‡להנמן‚סןרה‡ברהל‡ומ˘ן‡מרע‚רי‡מברהרעביוטן˙נלווייפברהלעפמעטסםיטרפ רעמ ןרעה וˆ ףיו‡ ןו‡ ,ןרעטלע עטריסרעטני‡ר‡פ ‡"טיל˘ להנמ ןטימ ן„ניבר‡פ ךיז ןעמ ןע˜ ,הבי˘י י„ רעבי‡ ט"לעבה לול‡ ˘„וח ןמז םעיינ םענופ לעוו˘ םייב ‚י„נעייט˘ ‡ימ˘„ ‡˙עייס ןו‡ החלˆה להיפ טימ רה‡י ‡ ך‡נ ‚י„נעטל‡ה ןו‡ הרו˙ה ˜˘ח הנט˜ הבי˘י ˜ר‡פ ‡ר‡ב ט‚יילע‚וˆ רימ ןב‡הןי‡ רעˆעלפ ענלעˆניי‡ ך‡נ 718.400.8364 '‡ רועי˘'ב רועי˘ ןו‡ ב‡ז ןימינב יבר ‚"הרה ייב ˙וריפה ˙כרב ˙וכלה ךיז ןרעהר‡פ הבי˘יה י„ימל˙ıינ˘זיוו ˜"˜ב ı"מו„ו ˜חˆי רו‡מ לה˜„ בר ‡"טיל˘ רע˘יילפ „״סב רעבוט˘ עכילרע ןופ םירוחב ע˘'י„יסח עלע„יי‡ ר‡פ ˙ובוט ˙ו„ימ ןו‡ םימ˘ ˙‡רי ,ה„ובעו הרו˙ ןי‡ ן‚ייט˘ וˆ ןכוז ס‡וו הבי˘י י„ ןופ יובע‚ ע‚יטר‡נע‚יי‡ י„ ןופ ןייז וˆ הנהנ ןו‡ םי„ימל˙ה ˙לעו˙ל „ומיל יר„ס עטלעט˘ע‚סיו‡ לעיˆעפס ןו‡ ןס‡ל˜ ערענעל˜ טימ .ב‡ט˘ על‡נ‡יסעפ‡רפ ןו‡ ענעבע‚ע‚רעבי‡ עמיר‡וו רעזנו‡ ןופ טיר˘ ןו‡ טירט ףיו‡ ‚נוטייל‚‡ב טימ ‚רובסמ‡יליוו ןופ טלעט˘ע‚וˆ עיˆ‡טר‡פסנ‡רט

We listened We listened We listened We listened We listened We listened You called 7,836 pre-launch callers You gave input... 2,204 survey responses

TeenPower is the hotline that celebrates TeenSibs, siblings of individuals with special needs. TP is the place to go to connect with other girls like yourself, get a dose of heartwarming chizzuk, and enjoy a program that’s empowering, practical, and oh-so-fun! September 12th 8:30 PMMonday Be a part of the community Featuring: Inspiring TeenPower theme song Popular speaker Mrs. Jackie Bitton shares her personal story of having a brother with special needs Exciting game show Join the Live Interactive Kicko Event! TeenPower is established with oversight and encouragement by leading Rabbonim and Mechanchos. PROMPT 8 Call 718.863.1111

Armon is the hotel experience created for you. Savor includingaccommodationsdeluxegourmetkosher meals, a fully-outfitted shul, and an mikvah.on-site A SHABBOS OF YOUR DREAMS GET AWAY FOR A SHABBOS TO RELAX AND RECHARGE LUXURY HOTEL, WARM ATMOSPHERE ENJOY A ELEGANTATMOSPHEREBEAUTIFULINANHOTELSETTING RESERVETODAY! HOTEL CONFERENCE 2701 Summer St Stamford, CT 06905 armonstamford.com203.359.1300 $999 per couple Fully catered with gourmet food by West Wing Sunday breakfast included Exclusive Shabbos Package Revel in exquisite kosher dining. West Wing Steakhouse is open from 4:30-10:00 PM An elevated kosher dining experience

Distinctive.Chic.Exclusive. 1205 50 STREET • 718.506.1610 Sun-Thurs 11:00-6:45 Fri 11:00-1:30 www.perseshoes.com • perseshoe

CLASSES IN PERSON OR VIA ZOOM LIMITED SCHOLARSHIPS AVAILABLE Cope Institute’s Jr. Accounting/Business Essentials: Complete in just 31/2 Months 21 Credits Recommended by the American Council on Education Upon completion enter the CES Accelerated CPA track enables you to sit for the CPA exams. Complete in just 22 Months STARTCAREERSSUCCESSFULWITH A Division of Agudath Israel of America 718-506-0500 EXT. 208 info@copeeducation.com copeeducation.com Text COPE to 718.578.4558 Pursue a career in accounting or bookkeeping. In today’s crowded work force, get the tools you need to start a business or expand your business skills.COPENEW COURSES BEGIN SOON! 9.13.22 MENS NIGHT CLASS 11.7.22 MENS DAY CLASS 9.12.22 WOMENS DAY CLASS WOMENS NIGHT CLASS

classanotheropeningWe’reDuetotheoverwhelmingdemand,wearepleasedtoannouncethatwe’veopenedanotherclasstoaccommodateadditionaltalmidimfortheupcomingyear.Welookforwardtoprovidingayearofshiningprogressandcontinuedgrowthtoeverychild.718.972.7348|info@yohrtorah.org461514thAvenue,BrooklynNY Today:Enroll More Ohr. More Torah. Limited slots available • 20+ years of expertise • Holistic education • Customized curriculums for each child • Handpicked team of certified professionals pivotgroup.nyc

NO ARTIFICIAL GROWTH HORMONES* *No significant difference has been shown between milk derived from rbST-treated and non-rbST-treated cows Similac On-the-go® Ready-to-Feed, is convenient, portable, and ready for you and your baby. Perfect for travel and late-night feeding Simply attach nipple and feed Easy to use: No mixing or measuring THE PERFECT BOTTLE ® anywhere, anytime.READYMILK-BASEDTOFEED INFANT 0-12 MONTHS formula with iron KOSHER DAIRY UNDERCHOLOVSUPERVISIONRABBINICALGATHHABOSEMDATZD’KHALYISROELKOSHER CONSUMEFORACCEPTABLEITNIYOTDTHOSEWHOKITNIYOTONPASSOVER CERTIFIEDFIRSTANDTHEONLYBADATZLiquid Infant Formula Registered for Sale in the US Sim ac com HOVER W TH YOUR CAMERA TO EARN MORE ABOU OUR PROM SE DEVELOPMENTBRAINEYE+CERTIFIEDFIRSTANDTHEONLYBADATZLiquid Infant Formula Registered for Sale in the US EASY DIGESTTOCERTIFIEDFIRSTANDTHEONLYBADATZLiquid Infant Formula Registered for Sale in the US Sim ac com HOVER W TH YOUR CAMERA TO EARN MORE ABOUT OUR PROM SE NO PALM OLEIN OIL FORMULAINFANTBRAND C H O LO V YI S R O E L CERTIFIEDFIRSTANDTHEONLYBADATZLiquid Infant Formula Registered for Sale in the US Simi ac com HOVER W TH YOUR C A MER A TO LE ARN MORE ABOUT OUR PROM SE

2 AUG 31, 2022 PARKING!FREE Right Next Door to Our Store 1333 39th St. BORO 32CROWNFLATBUSHPARK&HEIGHTShoursbeforeclosinghoursbeforeclosingDELIVERY HOURS minumim)$10thetowardscountedbenotwilldepartmentmeattheinitem(Any Sale items limited to 3 per family with $10 non-sale purchase. Any items from meat department, eggs, grape juice, newspapers or Oh Nuts are not included in the $10. Not responsible for errors. No rain checks. TAKEOUTCHICKENCOMBO Main + 2 Side Dishes $12.99 MEATBALLS$12.99 lb. $GARLICGREENBEANS5.99lb. NUGGETSCHICKENSESAME$12.99 lb. WED, THUR & FRI ONLY JALAPEÑO DIP 8 Oz. $3.99ea. WED, THUR & FRI ONLY TOMATO DIP Orig. Spicy or Garlic 8 Oz. $2.99ea. WED, THUR & FRI ONLY LEVI’SSALADEGGPLANT 8 Oz. $3.99ea. WED, THUR & FRI ONLY SPINACH DIP 8 Oz. $3.99ea. WED, THUR & FRI CUCUMBERONLYSALAD Reg & Diet / 16 Oz. $3.99ea. BAKERY MEAT DEPT. Reismans MINI BARSBROWNIE 15 Oz. $4.99 Greens CHOC or LOAFCINN 14 Oz. $4.99 Rebbe's FLATBREADKICHEL 6 Oz. / Original $4.49 Beigels WHOLEBREADWHEAT Mezones or Hamotzi $2.39 Yossi’s PITA Reg. or WW / 6 Pk. $1.99 STORE HOURS Sunday: Friday:Thursday:Wednesday:Tuesday:Monday:8:00am-8:00pm8:00am-8:00pm8:00am-8:00pm8:00am-11:00pm7:30am-12:00am7:30am-3:30pmSharp! ·SPECIALSWEEK’STHIS·SPECIALSWEEK’STHIS·SPECIALSWEEK’STHIS· WELCOME BACK!!! SUPER SALES!!! MARVID-HISACHDUS Dark Chicken Cutlets (Family Pack) $5 99lb *Wed-Thurs Only! Dark Chicken Capons $5 99lb *Wed-Thurs Only! TEVYA’S RANCH-WEISSMANDL London Broil Grain Finished $6 99lb Silver Tip Roast Grain Finished $6 99lb Ground Shoulder *Super Lean (Family Pack) Grain Finished $6 99lb Premium Pepper Steak Grain Finished..................................... $7.99lb Flank Steak ........................................................................................ $9.99lb Rib Eye Steak (Family Pack) Grain Finished ...................................... $14.99lb Rib Eye Roast Grain Finished ........................................................... $14.99lb Rib Eye Patties & Sliders Grain Finished ........................................ $10.99lb Fillet Mignon Grain Finished ........................................................... $16.99lb Surprise Steak Grain Finished ......................................................... $34.99lb GOURMET OVEN READY! Pickled Corned Beef Small-Med Top Of The Rib .............. $8.99lb Pastrami Small-Med Top Of The Rib .................................. $9.99lb Seasoned Rib Eye Steaks *Assorted Varieties .......................... $15.99lb Marinated London Broil ............................................................... $8.99lb Breaded Dark Chicken Cutlets $8 99lb Baby Chicken Shwarmah $8 99lb Cornflake Crumbs Chicken Fingers $8 99lb *WE NOW CARRY USA CERTIFIED ORGANIC MEAT CHK!!!* DAVID ELLIOT Dark Chicken Cutlets (Family Pack) $5 99lb *Wed-Thurs Only! Dark Chicken Capons $5 99lb *Wed-Thurs Only! CHK London Broil Grain Finished ..................................................... $6.99lb Silver Tip Roast Grain Finished ................................................. $6.99lb Ground Shoulder *Super Lean (Family Pack) Grain Finished.... $6.99lb Premium Pepper Steak Grain Finished..................................... $7.99lb Flank Steak ........................................................................................ $9.99lb Rib Eye Steak (Family Pack) Grain Finished ...................................... $14.99lb Rib Eye Roast Grain Finished ........................................................... $14.99lb Boneless Short Rib Flanken Grain Finished $12 99lb Boneless Short Rib Flanken Roast Grain Finished $12 99lb Boneless Spare Ribs Grain Finished $14 99lb Pickled Corned Beef Small-Med Top Of The Rib $8 99lb Pastrami Small-Med Top Of The Rib $9 99lb Seasoned Rib Eye Steaks *Assorted Varieties $15 99lb Marinated London Broil $8 99lb Breaded Dark Chicken Cutlets $8 99lb Baby Chicken Shwarmah $8 99lb Cornflake Crumbs Chicken Fingers ................................................. $8.99lb GLATTS LUBAVITCH-MONTREAL Flanken Points $5 99lb Beef Neck Bones................................................................................ $1.79lb BELZ-ECKSTIEN Flanken Points $5 99lb Beef Neck Bones $1 79lb

3WeeklyLink.com Specials Valid Wed. 8.31.22 - Tues. 9.6.22 1325 39th St. • 718.436.7701 follow us on InstagramPRODUCEkrmsupermarket GROCERY EGGPLANTPURPLE.59¢ lb. CARROTSBABY.99¢ ea. TOMATOESGRAPE.99¢ ea. New Crop HONEYCRISPAPPLES$1.19 lb. “Jumbo” Peacock CANTALOUPE$2.99 ea. Haddar HONEY 5 lb. $10.79 TIDE LIQUID Original HE 165 Oz. / 131 Loads $19.99 PH KITCHEN GARBAGE BAGS 13 Gallon / 80 Ct. Black or White Drawstring $7.99 Case of 48 $1.89 $89.99 Dagim SOLID WHITE TUNA IN WATER 6 Oz. Case of 400 $4.79 $18.99 Supreme 9" PLASTIC PLATES 100 Ct. Case of 1200 $1.09 $11.99 Plastic House 7 OZ. PLASTIC CUPS 100 Ct. Case of 80 4/.99¢ $18.99 Blooms POTATO CHIPS .75 Oz. / Original, Rippled, Honey BBQ Or Onion Solomons BEEF FRANKS 40 Oz. $15.99 Macabee PIZZA BAGELS 6 Pk. $2.79 Mehadrin CHOC LEBEN 6 Oz. / 12 Pk. $10.49 Essicata BEEF JERKY 2 Oz. / All Flavors $4.49 Kitchen Collection GRIP N' SANDWICHZIPBAGS 150 Ct. $1.99 Taamti BOUREKAS 12-14 Pc. Cheese or Potato $3.89 Gefen WHIPPEDTOPPING 16 Oz. $1.89 Liebers VANILLA SUGAR 12 Oz. $1.99 Haddar BABY CORN 15 Oz. Whole or Nuggets $1.39 Dee Best STRAWBERRYSOURCUBES$3.99 lb. Bnei Darom CUCUMBERSINBRINE 19.8 Oz. Can Size 18-25 Mini $2.79 Sleek BABY WIPES 72 Ct. / Scented or Unscented $1.29 Taster's Choice COFFEE STICKS 16-18 Ct. Original or Decaf $2.99 Kravy WONTONCHIPS 5 Oz. $2.19 Gefen TOMATO SAUCE 15 Oz. .89¢ Absolutely POTATO CRISPS 4.9 Oz. / Gluten Free Original, BBQ or Onion $1.69 Gefen APPLESAUCECUPS 6 Pk. / Natural or Strawberry $2.29 Oola GRANOLA BARS 5-6 Pk. / All Flavors Original or Sugar Free CRUNCHY NOT ON SALE $2.49 Materna BABY FORMULA 700 Gr. / All Varieties $23.75 Liebers DAINTIESSTRIPED 10.2 Oz. $2.29 Meal Mart KISHKE 16 Oz. $3.49 Kineret CHOC CHIP COOKIE DOUGH 24 Oz. $3.79 Shibolim WHOLEKNOCKERSWHEAT 6 Oz. / Everything or Sesame $1.99 Pereg PANKO CRUMBS 9 Oz. / Coarse or Fine $2.49 Tovers STRAWBERRYFILLEDBITES 5.5 Oz. $3.29 Liebers DUCK SUACE 28 Oz. / Sweet N Sour $2.99 Haddar FRUIT BARS 10 Pk. / Raspberry or Strawberry $2.79

Every Monday & Wednesday till 1O:00pm 1302 37 ST. / 718.400.8869 SUN. TUE. THURS. 11:30AM-7:30PM • MON. WED. 11:30AM-10:00PM shop to be cool!ENJOY FREE ICE CREAM AT THE ICE CREAM HOUSE With purchase of $150+ BORO PARKS BIGGEST UNIFORM SHOP

5WeeklyLink.com FULL TIME PART TIME OR TOATIME.ANY-JOBCATEREDYOURNEEDS. Working at Yeled V’Yalda means working at a place that puts your needs first. The first organization of its kind, we know what makes an employee happy and will work with the hours that work for you. HOURS? LOCATION?CREDENTIALS? #Jobs_Should_Be_Flexible See why you should apply? Para@yeled.org718.686.2376 Locations: Boro Park I Far Rockaway I Flatbush I Crown Heights I Linden I Staten Island • BCBA Supervision • Great Pay • Full Benefits Package • Males and Females • Training Provided • Specialty rate for evening and weekend cases

6 AUG 31, 2022 Ezra Medical 60th Street is RubinDr.welcomingDuvi A doctor with years of expertisepracticedouble in pediatric and adult care. He will care for your family’s health with dedication and competence. Free Parking + No wait time 1278 60th Street Brooklyn NY 11219 718.741.7100 ezramedical.org

bonjourweekendwear.com

Lakewood: Juvenile Planet A Childs Choice Garage Chic Also available in: Linden, Chicago, Cedarhurst, Bal�more, Cleveland, Monteal, London, Manchester, Antwerp, Israel

floral bycampaign @sarafinkphotography

Fantasy Bou�que Dave & Bella

7

Shop Bonjour online:

With the best combination of quality and comfort, it’s a no-brainer choice for kids.

Shop Bonjour local: Boro Williamsburg:TinyAllLingeriepark:shopinoneTown

RobeMonsey:Gallery Li�le Lad and Lady Monroe: Unique Reflec�ons Dave & Bella

3617 13th Avenue Order on WhatsApp: 718.540.4042 SHIRTS / POLOS / PANTS / SWEATERS / PJ'S ןיא קירוצ א יוו !סאבעלאבטאטש Classic / Slim / Strech ALL PANTS IN STOCK BLACK & CHARCOAL COMINGSOON

וניבא ונכלמ ונלןיאךלמ אלא התא BORO PARK: 5309 13TH 718.480.5532AVE BORO PARK: 3720 14TH 718.480.7538AVE WILLIAMSBURG: 801 BEDFORD AVE 718.298.2014 LAKEWOOD: 12 AMERICA 732.678.9250AVE CROWN HEIGHTS: 260 KINGSTON AVE 718.298.4555 This הנשה שאר, crown the םיכלמה יכלמ ךלמ by wrapping the הרות עגילייה in an exquisite cover that matches it's glory. Choose from various different designs and materials to create a masterpiece befitting the scroll it covers. ORDER TODAY TO HAVE IN TIME FOR YOM TOV

Oif Simchas,Miri 1315 51ST ST. • 917.291.5324 BUSINESS HOURS: HOURS 11:30-6:00 (PREFERRED BY APPOINTMENT) THE NEW AW22JustArrivedFromParisCoats,Knits,Sweatersandmuchmore... EXPERIENCEDSALESLADYWANTED

WWW.HAZORFIM.COM // 1800.551.8068 BORO PARK: 4424 13TH 718.480.0270AVE. 718.387.044567WILLIAMSBURG:LEEAVE. 718.480.0270SEAGULLLAKEWOOD:SQUARE HANDCRAFTEDADDBEAUTYTOYOURYOMTOV 11WeeklyLink.com

א ןעק רעדעי.עטכישעג עכילרעדיוש .טירש ןעמענ וצ טייצ'ס רימ טייצ'ססע טלעווןלייצראפידראפ ןופ ץיילפ יד וצ ןעמאנ רעייא וצ טגייל ןוא סיוא ןפור עכלעוו סעמיטש רעטנעזיוט !ןאשיטעפ םעד טע׳מתח וצ טייצ זיא סע !סעדינאמיאמ ןעוועטאר ךרודא טייג'מ סאוו ראמשאק רעד יד וצ ןעמוקנא רעדייל ףראד'מ ןעוו זיא ,םור יסנעשזדרעמע סעדינאמיאמ ךילגעמוא זיא סאוו שינעבעלרעביא ןא ןוא טייקיסעלכאנ סאד .ןסעגראפ וצ טימ םוא ךיז טייג ןעמ סאוו טימ טאפש ןוא ,דנעיירש-למיה זיא ןטנעיצאפ יד ע"ל ןיוש ןבאה ןעגנוטראוו עזאלנע יד תונברק עגילאצמוא טסאקעג רעמ !ןגייוושןעק'מטשינ.עמיטשןייא.סעמיטשרעטנעזיוט mmcpetitions.org

13WeeklyLink.com 13 SUPER SPECIALS13 SUPER SPECIALS13 SUPER SPECIALS 13 SUPER SPECIALS13 SUPER SPECIALS SUPER SPECIALSSUPER SPECIALS13 SUPER SPECIALS 13 SUPER SPECIALSSUPER SPECIALS errors.typographicalforresponsibleNot 12/6/16uesdayTthru1/30/161ednesdayWstartspecialsAlleshOnlyoz.z. 100% NEWITEMNEWITEM NEWITEM os Cherryanillaz.& BAKEDAFTERPESACH Flavors 13 13$3.59$2.69Reg. Rice 12 12 דובכלט - WEEKLY SUPER SPECIALS - WEEKLY SUPER SPECIALS - WEEKLY SUPER SPECIALSPhone Orders: 718.633.1600 Fax Orders: 718.633.1601 Email Orders: mysuper13order@gmail.com| | 5214 13th 718.633.1600Ave.We are under the Hashgacha of : CH 4 4 5 5 6 6 7 7 8 8 9 9 10 10 11 11 2 2 3 13 1 Kitov Corn Pops Reg or Light 8 Inch AluminumSquarePans With Covers / 5 pk Mehadrin Cottage Cheese Simple Lev Canola Oil 96 Oz Noam New York Soft Pretzels 6 pk. Gross & Co Choco Go Chocolate Biscuit Streits Matzahs Reg, Whole Wheat Spelt Haddar Duck Sauce Telma Kariot Cereal Haddar Fruit Bars 2/$1 $8.99 Reg. $10.99$3.89 Reg. $5.49 $1.29 Reg. $1.69 $2.89 UngersCan Corn 2/$2.49 Reg. $1.69ea.$6.99 Reg. $9.99 $2.69 Reg. $3.39 Haddar CookiesDuplex $2.99 Reg. $4.09 Carrots 1 lb. Bag $2.99$.79 Reg. $3.99 $4.69 Reg. $5.89 $3.69 Reg. $5.29 9/6/22Tuesdaythru8/31/22TuesdaystartspecialsAll $3.89 Reg. $5.29 Krunchy Sour Pickles 32 Oz

15WeeklyLink.com 4809 13th Avenue • 718.972.3850 • littleloungers.com Shop New A ivals

17WeeklyLink.com CASH & CHECKS ONLY 1145 53RD STREET 929.378.6026 • 347.240.1571 HATS & BANDS WE'RE BACK TO REGULAR HOURS STARTING FROM SUNDAY SEPTEMBER 4 SUN. 1-6 • MON. TUE. THUR. 11-3 • WED. NIGHT 8:30-10 AW22 NEW NEWCOLLECTIONGORGEOUSARRIVALSDAILY

םעד ו"ח ןענעק תומשנ ליפיוזא ןרעוו טנערבראפ רעבמעטפעס ראי-לוקס םעיינ םוצ לוקס-קילבופ ןיא ןייג ןיירא ן'טימ ןא טרעסנאפס דניק ירטנעמעלע ןא טרעסנאפס דניק ןסקאוורע $100 שדוחל $150 שדוחל 718.851.0340 1338 41 Street Brooklyn, NY nechomasyisroel@yeshivanet.com11218 עטַאר טעוו לוקס קילבופ ןיוש ךיז טבייה ןא טעמכ

STEP SuccessINTO KICK IT 718.599.2850167 Rodney St. kick it by I&R kids @kickitshoe New Arrivals Daily irkidsshoes@gmail.com

Mrs. Mindy Blumenfeld, LCSW "It's like when you pull one cup out of the pyramid and the whole tower shifts, that is how teenage social dynamics are."

Project by

"All that is normal. I will just give words to what you're feeling and experiencing so you know you're okay."

20 AUG 31, 2022 Listen. Learn. Connect. 351.9900Enjoy!845718

Mrs. Shifra Miriam Ehrlich HeartRings option 3 > selection 2 Heartrings option 3 > selection 4 You had a wonderful summer and are looking forwardto another great school year. But there's that nigglingvoicein your brain, that mildpitin your stomach. When you stop to tunein,you can identify it as the feeling of stress that comes along with challenges of having a sibling with special needs. Hey, There are questions you wish to ask but cannot verbalize,and feelings you wish could be validated but cannot express. Here's your chance! Tune into HeartRings for WORDS OF WISDOM from therapists, mentors and sometimes comedians;) and know that you are never alone. Because we're in it together.

sisters:)

21WeeklyLink.com 5124 12TH AVENUE 718.435.2678 718.435.1980 202206.SeptemberendsSpecialsquantity.limitMayerrors.typographicalforresponsibleNotlassupplieswhileitemsnonsaleofpurchace$10minimumwithspecialsAll t SPECIAL PRICE : $ 8.99 BAKINGSHWARTZSPRAY WITH FLOUR MEAL TURKEYMARTROLL 6 OZ SPECIAL PRICE : $ 4.99 NER CANDLEMITZVAHHOLDERS 40 PACK JOHNSON ' S SHAMPOOBABY 16 OZ SPECIAL PRICE : $ 3.99 FRIEDONEG ONIONS 10 OZ GOLDEN TASTE TUNA DELUXE 7 OZ SPECIAL PRICE : $ 1.99 GEFENCASE INSTANT SOUP 12 CUPS GEFEN 5ROASTEDCHESTNUTSOZ WE E K LY S PEC IAL S SPECIAL PRICE : $ 4.99 SPECIAL PRICE : $ 3.49 SPECIAL PRICE : $ 3.99 SPECIAL PRICE : $ 2.99 SPECIAL PRICE : $ 2.99 SPECIAL PRICE : $ 2.99 SPECIAL PRICE : $ 3.99 SPECIAL PRICE : $ 17.99 SPECIAL PRICE4/$1: SPECIAL PRICE : $ 21.99 SPECIAL PRICE : $ 4.99 SPECIAL PRICE : $ 3.99 8" WIPESCLOROXDEEPPANSALUMINUMROUND 75 COUNT OATSTOASTEDHONEYTAANUGNUT TABLEHOUSEPLASTICCOVERS 66” WIDTH SHAMPOOPERT 25 OZ ICEGEFENBITESFILLEDSTRAWBERRYTOVERLICORICEPOPS 8 PACK SYRUPNOCORNEXTRAHEAVYOUR LOW PRICE:$5.99 OUR LOW PRICE:$5.29OUR LOW PRICE:$4.99 OUR LOW PRICE:$3.49OUR LOW PRICE:$2.69 OUR LOW PRICE:$4.59 OUR LOW PRICE:$5.99OUR LOW PRICE:$12.99 OUR LOW PRICE:.$4.99 OUR LOW PRICE:$6.99 OUR LOW PRICE:$3.49 OUR LOW PRICE:$3.99 OUR LOW PRICE:$4.69 OUR LOW PRICE:$1.79 ULTRACASE SOFT TISSUES

22 AUG 31, 2022 29 SALVATORE DRIVE, LAKEWOOD NJ THISSEPTEMBERSUNDAY!4TH2pm-4pm Efraim Feder // Logo & Icon O: 732.905.5511 Ext. 480 C: 347.628.6565 E: efeder@imperialnj.com W: www.imperialnj.com @efraimfeder.realtor A: 212 2nd St, Suite 405 Lakewood NJ Beconnected to htwalldailyupdatesontheni !doowek To be added to my whatsapp status, text me at 347.628.6565 Efraim Feder // Logo & Icon

23WeeklyLink.com new location G E T R E A DY W I L L I A M S B U RG ! &WILLIAMSBURG: 166 HARRISON AVE. MONSEY: 27 ORCHARD ST. LILYANDTODDNY.COM WILLIAMSBURG: 267 WALLABOUT ST. MONSEY: 27 ORCHARD ST. MONROE: 52 BAKERTOWN RD. SOCKSHOPPENY.COM CA N ' T WA I T TO S H O P ? CHECK OUT THE L I LY & TO D D S O F T O P E N I N G S TA RT I N G T H U R S. S E P 1 ST LOCATED AT 166 HARRISON AVE. FOR A FULL SELECTION OF AW23 NEW ARRIVALS ENTRANCES ON 166 HARRISON AVE. & 267 WALLABOUT ST. G R A N D O P E N I N G ! coming soon

The Weekly Link 1303 53rd Street #125 Brooklyn, NY 11219 Telephone: 1 347-787-1838 Fax: 1 347-787-4018 Email: info@weeklylink.com Website: www.weeklylink.com The Weekly Link reserves the right to edit or reject any advertisement or advertisers at its discretion. Weekly Link is not liable for typeset errors. Weekly Link does not assume responsibility for the Kashrus of any advertisements, ads, products or articles in its pages. Reproductions in whole or part without permission from Weekly Link is strictly prohibited. Table of Contents EnglishRecipesOlamLocalCalendarBoggleNewsHayehudiParshaPuzzleRealEstateSectionSerialYiddishSerial sos Tzippy'sSudoku Tidbits Kids Section Cer TzeeporKidsKidsCreativetificatesCornerLinkKreateMemoryLinkPassport Deadline: Please note our new deadline for camera ready ads. Next Deadline: Volume 16/lssue 51 Full Page Cover Stock: Monday 09/05, at 3 P.M. Premium And Regular Full Page: Tuesday 09/06, at 12 P.M. Classifieds: Monday 09/05, at 3 P.M. SEE CATSKILLSOURADSAFTERTHECLASSIFIEDS

$850 Uniquely Yours fine silver jewelry 1310 48th st brooklyn, ny UniquelyYoursOnline.com718-871-754011219

Doors Open at 6:30 Young Israel Beth El of Boro Park 4802 15th Ave. • Brooklyn, NY THE BPJCC, IN PARTNERSHIP WITH ZICHARON PRESENT An Alzheimer’s and Dementia Event that will Educate, Empower, and Ease the Burden DavidFeaturing:Troxel, M.P.H. Renowned Author and Dementia Care Trainer, A Dignified Life: The Best Friends™ Approach to Alzheimer's Care: A Guide for Care Partners An opportunity to join hundreds of caregivers to hear from an expert on topics such as: • Dealing with Challenging Behaviors • Repetitive Conversations • Slowing Down Progression • Communication Tips Pre-registration necessary to ensure availability Call 718-972-6600 Ext. 4603 Or Register Online www.BPJCC.orgAt ACCESS HEALTH A C ty H th In ti P ed by BPJCC ZICHARON SUPPORT • CARE • GUIDANCE www.zicharon.org Mark calendar.theTUESDAY Sept. 13 7:00 – 9:00 PM FREE EVENT This event was facilitated by the BPJCC Senior Department We will be raffling off Ten of David Troxel’s books

TUV TAAM BABAGANUSHEGGPLANT$2.89 TUV TAAM OLIVE$2.89SPREAD GOLDEN TASTE EGGPLANTCREAMYDIP$2.59 GALIL CAFENATO$5.99COFFEE COLLECTIONKITCHEN 400 CUTLERY 4 KINDS $3.99 PANTENE SLEEK & SHAMPOOSMOOTH 300 ML $2.39 Weekly DISCOUNTS At NO MINIMUM PURCHASE REQUIRED FOR SALE ITEMS 4909 13th Avenue | 718.854.4949 Open daily: 7 AM - 11 PM | many more in store specials 12/15-12/21Valid: Weekly Specials SHEFA SPICY$2.99OLIVES PINEAPPLE$2.99 HADDAR SOFT COOKIES 3 KINDS $3.49 POP TIME POP CORN 2 FLAVORS, LG $1.59 HADDAR WAFERS 40 PK $4.99 SUNSHINE GRANOLA REG, CHOC $3.29 GOLDEN TASTE PEPPERCRUNCHYDIP MILD, HOT $2.59 QUALITY CHOICE CROUTONS ONIONCAESARGARLIC, $3.59 SUNKIST3/$1.00ORANGESMINI$1.59PEPPERS$0.59/LBSQUASH GRAPE$1.39TOMATOES AVOCADO$1.49 HADDAR TUNA IN 5/$6.00WATER GLICK’S TOMATO SAUCE 15 OZ $0.99 ATLANTIC SALMON IN CAN, 2 KINDS 2/$5.00 KEMACH CORN$1.99FLAKES FRESCORTI MARINARA$2.99SAUCE DAGIM EGGPLANTCUTLETS$3.59 LIEBER’S CHOCRICECOVEREDCAKE MILKY $1.49 errors.typographicalforresponsible-NotquantitylimittorightthereserveWe-lastsuppliesWhile LIEBER’S POTATO CHIPS REG 4/$1.00 GLICK’S KETCHUP 24 OZ $1.99 GLICK’S GREEN$1.99BEANS PAS WW WRAPS 6 PK $1.99 SERVING 9” PLASTIC$4.99PLATES PESEK ZMAN CHOCOLATE5/$4.00 NEW NEW Weekly DISCOUNTS At: NO MINIMUM PURCHASE REQUIRED FOR SALE ITEMS 4909 13th Avenue | 718.854.4949 08/31Valid:-09/06 errors.typographicalforresponsible-NotquantitylimittorightthereserveWe-lastsuppliesWhile GEFENCASE NOODLECHICKENSOUP$16.99 NOSHERSCHOICE MINY FLATS 4 KINDS $2.49 GOLDENTASTE ONION DIP 3 KINDS $2.59 BLOOMS POTATO CHIPS REG, RIPPLE 3/.89¢ EGGPLANT.69¢LB COLLECTIONDINING CUTLERY 4 KINDS, 400 CT 2/$6.99 TOMATOESSTEM.99¢LB PASKESZ INSNACKSFRUITBAGS 2 KINDS $5.49 .99¢TOMATOESGRAPEEACH PLASTICCASEHOUSE $14.99CUPS TASTERS CHOICE COFFEE 14 OZ $13.49 BLUEBERRIESJUMBO$2.99 SHIBOLEM KNOCKERS 2 KINDS $2.39 FLAUMS LOX TRAY 6 OZ 6.99 FOIL9X13PANS5/$1.49 Welcome Back Specials Open daily: 7 AM - 11 PM | many more in store specials Fresh oh nuts platters and popcorn back in stock!!

28 AUG 31, 2022 718.435.23725213 13th Ave. Lanes is your full back to headquartersschool Loads of more in store specials. New comingarrivalsindailyFullSelection of Shana Tova Cards Huge Selection of Message and Name SpiralsPens70Ct99¢CrayolaCrayons24Ct.99¢ElmersSchoolGlue4oz.99¢ SPECIALS

29 Welcome Back! re e! 4117 14th 718.431.0551Avenue MON-THURS 11:30-6:30 Closed Sunday & Fridays in the summer New selection of Linen YomEverythingfortheTovTable. Manyspecials!in-store

30 AUG 31, 2022 Seeking Secretary For Hamaspik’s women’s day program Full time Great pay Warm, environmenthappy Fullpackagebenefits Boro Park Email resume to Hlang@hamaspikkings.org Or call 718.302.3333 ext. 5218 Requirements Organized � Excellent communication skills • Compassionate � Passionate about working with the special needs population Fill your day with meaning פ"ב ןיא ת"ת א, יבר סאב א טכוז טפור טלאצאב ךילטייצ ןוא ןייפ טפור עטיב 929.564.4770 MATERNICHICMaternity SUNDAYOPEN 11-5LABORMONDAY&DAY 1334 Coney Island Ave (bet. I &J) • 718.258.6193 SUN 11-6 • MON-THURS 10:30-6 • FRI BY APPOINTMENT SALE RACK HOLIDAY CASUAL

31WeeklyLink.com •HATS • BANDS • BERETS •CHILDREN HAIR ACCESSORIES Mega Selection HATS FOR COVERED BACK & SHPITZLACH 4203 13TH AVENUE TEL: 718.438.8522 Designs with Style & Class AW 23

32 AUG 31, 2022 Specials CINNAMONBUNS MANDELBREAD Weekly $4.99 REG. $7.50 $3.99 REG. $6.50 SPECIALS FROM 8/31-9/6 5115 13TH AVE / 718.851.7728

NEW ARRIVALS DAILY 5314718.972.3975NewUtrecht Ave, Brooklyn NY 11219 HEADWEAR BASICS SLEEPWEAR DRESSWEAR sale deals We carry size XS-4X PLUS SUPER

929.254.0080 info@yesodeibina.org 1363 46th Street Brooklyn N.Y. 11219 skymediaco.co It’s yearourof changing school experiences child at a time 7th one Individualized Approach Mainstream EnvironmentElementary and High School Professional Support Services 1 1ONEissoMANY At Yesodei Bina, our students come first. We have years of expertise behind us and a structured school setting that drives success. With an adaptable curriculum that focuses on your child, we are committed to helping your child thrive.

54 VARIETIES Follow us on @siegelmancakesInstagram CALL TO ODRER: 347.864.0747 NATIONWIDESHIPPINGNOWKOSHER PARVE עווראפ רשכ WWW.SIEGELMANSCAKES.COM NEW FULL LINE OF EXQUISITE AND HEAVENLY MINIATURES & COOKIES! ISN’T A WITHOUTSIMCHA’EM DESSERTS CORPORATE GIFTING DELIVERIESDAILY WILLIAMSBURGTO

37WeeklyLink.com OP L RA Y UG P Tiny Tots Back for Dueincredibleanotheryear!totheoverwhelmingsuccessweareopeninganotherbranch! FACILITY!BRANDNEW LIMITED EARLYAVAILABLESLOTSCALLTORESERVEYOURSLOT! GORGEOUS OUTDOOR PLAY HOT NUTRITIOUS LUNCHES GREAT ENVIRONMENT WARM LOVING TRANSPORTATIONTEACHERSAVAILABLE 917.538.1878tinytotsei@gmail.comMorahLeahEiger • VENT CLEANING • REPAIRS • INSTALLATION • DRYER MAINTENANCE Why Weight? Get on the Balls... The BALLS DIET Revolutionary accupressure weight loss system Attack The Fat • No Pills, 100% Natural • Feel No Hunger • Guaranteed 1-2.5 Lb. Loss Daily CALL: (516)616-3009 “In just 7 weeks, The Balls Diet got me down from size 20 to a size 12 for my son’s wedding. The Balls Diet really works. I am beyond thrilled. I lost even more INCHES than the scale showed!” -Sara Hencha, Williamsburg "I lost 15.2lb the first session, I'm down 40.2lb in 6 weeks. Even chanukah was easy, I'm so energized its a miracle!" -Moishe W, Williamsburg LOSE 18 LB-20 LB BY YOM TOV!

Gitty Rosenberg, grosenberg@eislaasois.org917.821.6864OTR/LReachoutto: Now Hiring YIDDISH-SPEAKING SLP’S NEEDED

39WeeklyLink.com BROOKLYN 718-438-7204 / 4601 16th Ave • MONSEY 845-352-1738 / 3 Morris Rd. MONROE 845-783-6175 / 52 Bakertown Rd. • LAKEWOOD 848-290-9199 / 6730 Route 9 S Howell NJ Build your maternity wardrobe with heritage pieces that always have your back. From pared-down pieces to lavish looks, create your capsule from our collection. ESSENTIAL LUXURIES. fashion, reborn.

40 AUG 31, 2022 Th Professional Development For Teachers • Curriculum development with a focus on what is REALLY asked on the regent. • Tips and techniques for teaching challenging topics College Math • Crash courses or private tutoring • College Algebra, Pre-calculus, Statistics and more • Specializing in NYSTCE Mathematics (CST) High School Preparing girls for common core regents • Private tutoring throughout the year • Crash courses in the spring MATH TUTOR AND COACH Mrs. Friedman (917) 570-8591 (718) 436-4489 Coping Transitionwith. An teleconferenceinteractiveeducational,moderatedbySparks. Host Miriam Yerushalmi, MA Conference Number 712.775.7031 Enter Pin 292831 Contact us @ 718-2-SPARKS www.sparkscenter.org(77-2757) Mon | Sept | 5 Invite all your friends! 9:00 PM – 10:00 PM Serving Pre & post-natal women and families with Awareness, Relief, Knowledge and Support. ? for great prices for more info please azamrutours@gmail.comazamrutours.com718.569.6925call by calling Azamru tours for all your needs. Cell Phones, etc. and everything else in between › Apartments / Villas in Yerushalayim & in Tzfas › Hotels at discounted rates › Customized trip planning › Vip services › Proffesional Drivers with cars, vans, mini bus › Cell phones starting $5 per day › Travel Insurance › Heimishe American style food delivered to your apt. UOHONEYMOONTRIPSRSPECIALTYHave it Goingeasyto Israelfor the summer or Sukkos ד"סב

41WeeklyLink.com T | 929.430.4848 A | 1031-46 ST BROOKLYN NY 11219 PLEASE CALL FOR HOURS FREE KEYCHAIN SQUISHY WITH PURCHASE OF EVERYSTATION1@PERSONALIZATION_BACKPACK! INCLUDEDPERSONALIZATIONINPRICE! YOUR DREAM IS OUR CREATION TM MAKE YOUR “BACK TO SCHOOL” school days TRENDING2022 ITGLAMUP ADDSPARKLESOME&SAUVESLEEK *WHILE SUPPLY LASTS Free Gift! moshe ימיש R ESTY IDY View our full line of gift items! TWICE AS F UN .

$2.29 Twizzlers Strawberry Twist LIMIT 3 PER FAMILY WITH $10 NON SALE PURCHASE VALID WETHRU:09/06/22AREOPEN DAILY FROM 7:00 AM TILL 11:00 PM P$4.89izzaBagels$3.99 Saladmate $12Dressingoz./assorted2.29 Paskesz Teenyy Teddy Honey 7 oz. / assorted $2.79 Crystal Geyser 8 Pk. Sports Water 8 oz. $3.49 Klein’s Craisons $3.99 3 Lb $Clementine3.49 Kitchen Collection Cutlery400ct $ Cookie sheets$3.99Pineapple2.29 Strawberry 16 oz. 4.89 Dagim Pizza14Bagelsoz. $ 3.49Lb . Natural $1.19 Bgan Lemon Juice 32 oz. $Spelt Matzo 2 /$.99 Lieber’s Peanut Butter Pretzels 1.75 oz. $4.49 Golden Taste Nova Lox Salad 7 oz. $Beef Franks $.69 Jetfloil 3.99 Size 6 Pineapple $1.49 Kitchen collection Zip lock Challah Bags 15 oz $ Rosemarie Cookies 4 /$.99lemons $$1.19 Captain Cool Ice8Popsct. $3.49 Gefen Spelt Matzo 11 oz. $5.39 Solomon's Beef12Franksoz. $3.99 Baker’s Best Cookies 12 oz $1.49 Grape Tomatoes

The Ultimate in Sunday Fun! E.L.C. ProgramSundayForGirlsMusicArtDancing/AerobicsFooddecorating/CraftsP3/SETSS for Eligible ParticipantsJoin the Fun! 718-483-8448 5225 New Utrect center@gmail.comeducationallearningAve.ProvidedTransportationMath&Reading Track

4421-14TH AVE. 718.633.5767

Learn. Grow. Succeed. Afternoon English Program ForProvidedTransportationEnvironmentHeimisheBoysTechniquesMultisensoryReading,Writing,MathScienceetc. P3/SETSS718-483-84485225NewUtrectAve.educationallearningcenter@gmail.comWeekend Program for Kita “Ches” and “Tes”

46 AUG 31, 2022 3003 AVENUE K, BROOKLYN, NY 11210 718.338.8881 @TOETALLYYOU Fall Styles All New Arriving Daily In store and online Visit our redesigned website for a better shopping experience TOETALLYYOU.COM F R E E S H I P PI N G O N O R D E R S O F $ 7 5 + V I A G R O U N D

47WeeklyLink.com One small step for you, One giant leap for your feet. LIF E C HANGING 180 Skillman Street · 718-504-1115 CustomOrthoticsArchCompressionStockings SupportMaternityWear Socks can do more than keep your feet warm and dry - compression stockings can improve and prevent many health conditions And ultimately keep you on your feet without the aches and pains. Comfortable fitting experience // Covered by most Insurances (Neil Armstrong, 1969)

The Plaay sch ool s T he pro fessional playgroup experie nce Due to po pular demand we now ha ve vo ucher & non-vo ucher slots available in 2 locations 347-699- 5349 Call for info on all our locations for 16 months th ru 3 years F/T and P/T StaffAvailablePositions

WeeklyLink.com SPRING SUMMER Closing our Boro Park SaleLocation. Everything must go! Come & grab a bargain! Prices you won't believe! GIRLS & TEEN GOWNS. BABIES & BOYS SUITS & OUTFITS (THINK YOM TOV!) Cuts and Blows Call:otegemoC917-685-2396yurhaircutbeforethenewschooyearbegins Wiesner Dry Goods 312 Roebling St. OUR FAMOUS UNIFORM SKIRTS AND JUMPERS navy black and gray are avail B"H. WE DELIVER TO BORO PARK & ALL OVER! Call or fax your order: Call: 718-384-0649 Fax: 718-486-8558 funbetweenschoolschoolanddaycamp!Monday August 29 Tuesday August 30 Wednesday August 31 Thursday September 1 Monday September 5 Tuesday September 6 Optional Extended Hours 9-10 & 3-4 Lunch Served Play Center Crafts & Baking Cotton Candy & Slush Girls ages 3-9 Boys age 3 845.517.5000DesignMode Pre - School A fun Packed Program 10-3 Hours:$8Add.hr. 10:00-3:00 Price: $35 LOCATION: 1182 42nd St. last door CONTACT: Pre-registration718.619.2757Required

50 AUG 31, 2022 At Both Locations: ..creative teaching materials 4704 18th 718-435-1940Ave. 5216 New Utr echt Ave. 718-633-5462 Simplified-Functional-Quality-Class NO MATTER THE “MARKET”... Always PEAK PERFORMANCE because it’s an “ELESAC” good “OLD SCHOOL” IN-STORE SHOPPING BEAUTIFUL “new school” 2022 line Arriving ה”יא August 29th!

51WeeklyLink.com ךלמ א וצ ךלמ ןב א ןופ טרעוו 5019 New Utrecht Ave. | 718.297.5000 Introducing a new line of custom and luxurious Shtreimlech starting at $3,000 ןצנאלג | ןבראפ | ןסערפ | יינ יוו ןכאמרעביא UPGRADED CHOSSONSHTREIMELPACKAGE 2 SHTREIMLECH $4,000 REGULAR SHTREIMELECH STARTING AT $900

Main office: 2338 - 60 st. Brooklyn N. Y. 11204T: 718.972.1515 | F: 646.968.8484 עיצארטסיגער ירעסונ ירפ ןוא ירעסונ ראפ !גנואווש ןל+ופ ןיא דניצא זיא הרות דומל_ת רזעיל_א תשודק א"טילשעיל_אקסר"ומדאןרמק"כתואישנב ןפאירעסונירעסרונירפןואטצעיןיושה"בזיא ךיוא יוזא גאטנוז עדעי רעדניק ערעייז ןבירשעגנייא ןיוש ןבאה עכלעוו 'יחיש ןרעטלע עבושח ןופ עגארפכענ עסיורג יד ךאנ זא ןייז עידומ רימ ןליוו ,ףעטס ענעבעגרעביא ענעפורעגסיוא ריא טימ ,הרות דומלת רעזנוא ןיא !הצוחנ העדומ ןסאלק ערענעלק ךוניח רעשידיסח טראדנאטס רעכעה א ראפ טלעטש רדח עילאקס ,רעדנוזאב דימלת ןדעי ראפ טייקמאזקרעמפיוא עלעודיווידניא ןוא ךיז ןריפ רעכלעוו רעביטש עגיד'הרות עשידיסח ןופ רעדניק ראפ גיסאפ זיא דסומ רעזנוא .הרות תעד יפ לע אלש עיגאלאנכעט ןופ תורזנתה רעכילצנעג א טימ לארשי ילודג תארוה יפ לע טצעי טייצ יד זיא עיצאקילפארעייאןבעגוצניירא!גנירגןואלענשןייגלאזסעזא םידימלת עיינ ןא ןעמענ רימ :סיפא יד טימ ךייא 718.972.1515טדניבראפ ןסאלק עלא ה"יא ןגאפנא ךיז ןלעוו ירפוצ רעגייזא 9:00 )גאטיירפ - גאטנאמ( עיצאטראפסנארט יבר סאב עיירטעג א ךרוד טיילגאב .סרעוויירד עשימייה טימ ,ריט וצ ריט ןופ Talmud Torah Kedushas Eliezer Skolye

Talk & Txt for $6 per per$9&withPhoneper$7txtSimDaytalkdatadayemailwaysdayper day included unlimited talk to the US and Israel with local US number Phones for Europe $13 per day - Minimum rental-a week - Convenient pickup locations in Williamsburg and Boro Park DUE TO HIGH DEMAND PLEASE RESERVE IN ADVANCE ECDemo™ is a free trial session designed for clients who 'want to know what they're getting into.' A trained technician will walk you through our advanced and researched process of high end laser technology and answer all the questions you may have. Expect minimum pain, maximum results and top notch personalized service. A experiencepersonalizedawaits. UNVEILING BEAUTY WITH CONFIDENCE™ Ruchy Gubitz, CLEP Laser + Electrolysis Call or Text 646.478.6663 Brooklyn: 48th St & 12th Ave | Lakewood: Oak & VineCertified Laser Specialist since 2015 6IncludesSessions AHIRLINE PACKAGE $300

2812 Avenue U • 718.648.7590 • 718.648.7300 • Fax: 718.648.7737 ITEMS SUBJECT TO INVENTORY DEPLETION • CANNOT BE COMBINED WITH OTHER OFFERS. • WE RESERVETHE RIGHT TO LIMIT QUANTITIES. • NOT RESPONSIBLE FOR TYPOGROPHICAL. • NOT VALID ON PRIOR PURCHASES. YOU CAN'T TOP THIS!!! PAY ANYWAY YOU WANT!!! CASH &CREDIT: SAME PRICE ALL MAJOR CREDIT CARDS ACCEPTED AT NO ADDITIONAL CHARGE! BY THE CASE BY THE CASE BY THE CASE BY THE CASE BY THE CASE MOSCATOZION OR RED MOSCATO 750 ML. BY THE CASE OF 12 $799 EXP. 09-06-2022 CLARETRASHI 750 ML. BY THE CASE OF 12 $699 EXP. 09-06-2022 BARTENURAMOSCATO 750 ML. BY THE CASE OF 12 $999 EXP. 09-06-2022 RASHIREDJOYVINORWHITE 750 ML. BY THE CASE OF 12 $599 EXP. 09-06-2022 BARON HERZOG WHITE ZINFANDEL OR CHENIN BLANC 750 ML. BY • THE CASE OF 12 $599EXP. 09-09-2022

55WeeklyLink.com All candies & dried fruits are repacked under the hashgacha of Rabbi Sommers. WE NOW ACCEPT EBT CARDS We make ShabbosPlattersSushiforandalloccasions Sushi SandwichSushi$14.95 3 LB Cello Onions $1.99 Each Eggplant.79¢LB RainbowRoll$12.95 Red$2.49PeppersLb TomatoesGrape2/$3SpicyCucumberRoll$5.50SalmonRoll$7.95 To receive our weekly specials by email, Email us at: specials@kosherpalaceonline.com follow us on Instagram@Kosherpalacesupermarket Hours: Sun.8am-8pm • Mon. Tues.7am -8pm • Wed. 7am -8pm • Thurs.7am-10pm • Fri. 7am - 1 hr. before zman FAX ORDERS: 718.743.0181 / 9am-5pm EMAIL ORDERS: orders@kosherpalaceonline.com $5 NOTCHARGE.DELIVERY$75MIN.INCLUDINGSALEITEMS. GROCERY • DAIRY • FRESH MEATS • POULTRY • BAKERY • TAKE-OUT • FRESH FRUITS & VEGETABLES • SUSHI CREDIT CARD ONLY2818 AVENUE U • DELIVERY AVAILABLE Sale Starts: Wednesday August 31 Sale Ends: Tuesday September 6 Meats All in-store cutting & repackaging at our meat department is under the strict Hashgacha of Rabbi Weissmandl (Nitra-Monsey) We carry a full line of Bet Yosef Glatt meats. Our meat department is managed by Moshe: 718.743.1112 any inquiries or questions feel free to reach out Takeout TUESDAY SPECIAL half price off side dishes & salads min. 1lb of the showcase and of the pre-pack. excluding deli. WE MAKE DELI PLATTERS AND WRAPS FOR ALL OCASSIONS Bakery Brownie Bites 10 Count $7.99 SpongeCakeChiffon 14 oz $7.99 Chocolate Chip Cookies 12 oz $6.49 Boneless short rib flanken grain finished...................................... $12.99 lb Boneless short rib flanken roast grain finished ........................... $12.99 lb Boneless spare ribs grain finished .................................................. $14.99 lb Wow! london broil grain finished....................................................... $6.99 lb Wow! silver tip roast grain finished................................................... $6.99 lb Wow! premium pepper steak grain finished ................................... $7.99 lb Wow! ground shoulder super lean family pack grain finished $6.99 lb Rib eye steak family pack grain finished........................................ $14.99 lb Rib eye roast grain finished............................................................... $14.99 lb Rib eye patties & sliders grain finished .......................................... $10.99 lb Fillet mignon grain finished .............................................................. $16.99 lb Surprise steak grain finished ........................................................... $34.99 lb Flank steak grain finished ................................................................... $9.99 lb Wow! pickled corned beef sml-med top of the rib weissmandl-Bet Yosef Glatt ...........................................................................$8.99 lb Wow! pastrami sml-med top of the rib weissmandl-Bet Yosef Glatt ..... $9.99 lb Seasoned rib eye steaks assorted varieties weissmandl-Bet Yosef Glatt .. $15.99 lb Marinated london broil weissmandl-Bet Yosef Glatt.................................$8.99 lb Breaded dark chicken cutlets Hisachdus ..............................................$8.99 lb Baby chicken shwarmah Hisachdus ......................................................$8.99 lb Cornflake crumb chicken fingers Hisachdus........................................$8.99 lb Wow! flanken points ........................................................................... $5.99 lb Wow! dark chicken cutlets family pack-Wed/Thurs only ......... $5.99 lb Wow! dark chicked capons-Wed/Thurs only................................. $5.99 lb Fried Chicken....................................................................................... $9.99 lb Plain Grilled Chicken ....................................................................... $14.99 lb Chinese Rice ........................................................................................ $6.99 lb Chicken Nuggets .............................................................................. $14.99 lb Bologna ( min 1 lb) ............................................................................ $10.99 lb Smoked Turkey ( min 1 lb) ............................................................... $13.99 lb CELEBRATING 20 YEARS OF SERVING THE COMMUNITY as the only Shomer Shabbos Supermarket on Avenue U Quaker Life Cereal 13 oz, Original Only $3.49 Kedem Grape juice 64 oz, Regular Only $4.99 Sensible Veggie Wavy Chips Cheddar Sour Cream 4.25 oz .99¢ Osem Mini Croutons 14 oz $2.99 Kinder .99¢Eggs Banner Smoked Salmon 12 oz $12.99 9” Plastic Plates 100 Count $4.99 Frescorti Marinara Sauce 26 oz 2/$6 Nafiska MozzerellaShredded 7.5 oz $2.99 Liebers Tomato Sauce 15 oz .99¢ Produce Gourmet Oven Ready MK Marvid-HisachdusMontreal CHK-Bet Yosef Tevyas Ranch Weissmandl Bet Yosef Glatt

56 AUG 31, 2022 become who they really want to be. Nefesh High School is the warm Torah environment with top quality education, where you can fit in. You CAN be happy in school! Mrs. Esti Margulies is available to answer any of your questions. 347.243.0074 BottomLineMG.com Nefesh High School | 2005 East 17th Street, Brooklyn, NY 11229 | 718.339.9880 • N e fesh h i g h scho o l • theschool that’s more ryone shouldswim

$65 WE ARE LOCATED AT 4403-14 AVE SUNDAY-THURSDAY: 11am-6pm TEXT/WHATSAPP 732.806.5785 • RAYBELLESHOES@GMAIL.COM

For endless possibilities await when your child is showered with warmth and love, in a comfortable environment that is suited to his needs. At Cloud 9, we put your mind at ease with the knowledge that your child is enveloped in a cozy cloud of entertainment, attention and unsurpassed care after hours. Ages: Boys & Girls 5+ Hours: Sunday 10-4, Monday - Thursday 3:30 - 7 For inquires please call 718-946-7700 ext. 312 or email eglancz@rayim.org/chanik@rayim.org &EntertainmentArtsBakingSportsnCraftsmore... Build my skills. Help me shine. See me climb. At Cloud 9! Reach up

For a hurt little child that still lives on inside me, who gets catharsis from seeing the trendy supplies that I pick out for my daughter.

BY: CHAYA BLUSTEIN

ofSchoolLife

60 AUG 31, 2022

“Did you survive?” Miri asks me, only half-jokingly. “I survived, and I even have the medals to show for it,” I say. “Two shiny leather loafers, size 26, sitting in my little princess’s closet, all ready for the big day.” My voice shakes just a little as I describe my “medals.” It’s the disbelief that this is actually me, talking about my little princess and her first day of school. “I don’t know why we all do these crazy things,” Miri grouses, not mentioning the quiver in my words that she surely hears. Miri’s tactful like that, even without knowing the backstory of my life. “Like, what law of nature dictates that a child may not go to school unless they have brandnew shoes bought just a few days before through waiting on the most insane lines?” “I know,” I commiserate. “A kid could totally not have his supplies for the first day of school, but shoes? Forget it, that’s yehareg v’al yaavor.”

Miri sighs theatrically. “And this is when we have just one kid to prepare for school! What in the world do mothers of big families “Wedo?” should find out their secrets,” I agree. As I talk to Miri, my mind is only halfway focused. The other half of me is focused on my miracle. Lines in the shoes and supplies stores notwithstanding, every part of Toby’s wardrobe and paraphernalia has been handpicked with loving care. From her briefcase to her uniforms and hair accessories, each item has to be just right. Not because Toby cares. She’s happy with whatever I buy her, capering around the house in childish glee with every single one of our purchases. Whichever briefcase I pick delights her, she’s just thrilled to be getting all of this in honor of her very first day of school. Toby is easygoing. She takes after my husband, Shalom, in that way. No, if I’m honest, all the care and devotion I’ve been investing in these shopping trips are for me.

Twenty years ago, when I started school, the picture looked very different. *** “Thank you for taking her shopping,” Tatty says to our upstairs neighbor. I cling to Tatty’s hand and clutch the shopping bag in the other. “My pleasure,” Mrs. Tepper says with a harried smile, then disappears behind her own door. Tatty takes the bag from my hand as we walk into our own apartment. It’s small and dingy, but with only me, Tatty, and Dovi living here, it isn’t too crowded.

Rosalyn Muller, Co-Director MS, SP 917-929-9307rozmuller@gmail.comED Terry Watson, Co-Director MS, SP 917-848-7620watson6138@comcast.netED Jean Sabel, Asst. Principal JeanLeBec60@gmail.com917-309-2304SAS

*** I give my head a resolute shake as I finish sorting the toys in my playroom. No, there’s no reason to go back to those painful memories now. I just want to focus on helping Toby’s initiation into school go smoothly. The house is quiet, and now it’s neat too. I peek in on my sleeping angels, feel the familiar rush and swell of pride. Toby sleeps on her stomach, her face mushed into her pillow. Zevi is curled up on his side, clutching his blanket tightly. And baby Mutty in the crib has the most cherubic expression on his upturned face. In just 36 hours, Toby is going to board a big yellow school bus. And I’m going to send her off with a tight hug, a kiss, a squeeze, and a ton of pent-up emotion in me. The mixer hums as I throw together a muffin batter. I want Toby to take along a little piece of home and warmth in the snack I prepare for the big day. I push away the memory of my own first recess. Tatty didn’t know to pack his daughter snacks. My churning stomach stayed empty. The muffins get carefully packed into Ziploc bags. I pull out a little butterfly notepad from the drawer. Toby can’t read yet, so I draw a huge smiley instead. My eyes blur for a moment as I look at the smiley I drew. I must be tired already. Time to go to sleep. *** “I’m going to go on the yellow school bus all by myself!” Toby starts her rendition as I tuck in the blanket around her. “Tomorrow is the first day of school!”

62 AUG 31, 2022

I smile at my little girl. My throat feels full. “And you’ll wave to Mommy from the window, right?” I ask. “Yes!” Toby is so excited, she hugs her pillow. “And I’m going to wear my new bow, and new shoes and new briefcase, and new uniform!”

“Raizy Shiner,” she says. I don’t get Mrs.up.Klein looks at me. Her expression is annoyed.

Mrs. Klein calls every girl’s name, and each girl brings up her admission card to the desk. My eyes go wide. Tatty didn’t give me an admission card! I blink furiously, as the lump in my throat gets bigger and more pronounced. Mrs. Klein keeps calling names, all the way until she gets to mine.

“I – don’t have a card,” I croak, and suddenly, to my absolute horror, the lump spills out of my eyes and runs down my cheeks in rivulets. My stomach clenches terribly tight.

“Exactly!” I give her a little hug. Her stiff new briefcase is carefully packed with supplies, snacks and my smiley note. All the new clothing has been laid out neatly to await the big day.

She’s sparkling in delight.

The little me shifts uncomfortably in the hard seat given to all first graders. I push back the scary lump in my throat.

I’m “Tatty,confuseddon’t you like my uniform shirts?” I ask desperately. He gives me a distracted smile. “Of course I do,” he says, but his eyes are looking elsewhere. Tatty buys me all the supplies on the supplies list from Staples, and he picks out my briefcase too. I wanted a Hello Kitty one, but Tatty didn’t know. I hate the plaid design on my new briefcase, but I know Tatty will be upset if I say so. So I swallow my tears, and bury the briefcase behind my new Theuniforms.supplies list doesn’t say anything about pencil cases or pretty designs on folders, so I don’t get any of those.

“Mrs. Tepper is waiting for the bus outside already,” Tatty comes to get me. “She said it should be coming any minute.” He sends me off with a wave, while my stomach churns frantically inside me at the sight of the big yellow school bus. There are so many big kids on the bus, talking Theloudly.teacher standing behind the big wooden desk looks terribly strict. Her eyes don’t sparkle or dance like my preschool teacher’s did. They’re focused and still. And her voice isn’t cheerful and happy. It’s modulated and firm.

“Mommy,” Toby looks up at me. Her eyes cloud over a bit. “Mommy, is it scary for me to go on the bus without you?” she asks, her thin voice making her sound very tiny and vulnerable. I squeeze her hand tight. “Are you scared to go on the bus yourself?”

On my very first day of school, I brush and braid my hair on my own. Tatty doesn’t know how to do it, and there’s no one else around to do it for me.

He shakes out the uniforms Mrs. Tepper bought me onto the table, then takes out the receipt, his eyebrows drawing into a straight line as he looks at it.

BORO PARK: 4309 14TH AVE WILLIAMSBURG: 210 WALLABOUT ST 718.437.3400 WWW.MEGABABIESUSA.COM 15%OFF ALL STROLLERSJOOLZ 15%OFF ALL TILLSTROLLERSJOOLZTHURSSEPT1WEDSEPT7 0FF$100 SILVER CROSS DUNE + BASSINET 0FF$100 SILVER CROSS DUNE + LIMITED TIME ONLY REEF + BASSINETREEF + BASSINET ORIG $949. NOW $711.75 ALUMINUM ORIG $1049. NOW $786.75 BLACK BUY A BUGABOO LYNX STROLLER AT 25% 0FF AND GET THE LYNX BASSINET BUY A BUGABOO LYNX STROLLER AT 25% 0FF AND GET THE LYNX BASSINET FREE!FREE! THROUGH MONDAY, SEPT. 5TH SUPER LABOR SUPERPROMOTIONDAYLABORDAYPROMOTION ORIG.$250 FREENOW

64 AUG 31, 2022

Toby nods slightly. “It might be a little scary the first time that Mommy’s not with you,” I say softly. “But even when you don’t see Mommy with you, Mommy is going to be home, thinking about you and worrying about you. And Mommy’s going to be waiting for you to come home, and you’ll tell me everything that happened in school.”

I listened to every word of Mrs. Friedman’s description, though my face remained impassive. No one could tell how deeply her words touched me, affecting the wounded part of my soul.

“How would you feel, knowing that there was such a person looking out for you?” She paused, giving us a moment to ponder her question. She nodded approvingly to the responses of, “confident,” “secure,” and “taken care of.”

“That is how bitachon feels,” Mrs. Friedman explained passionately “It means knowing that there’s someone looking out for you, worrying about you, always. And He wants only that you should be happy.” *** Not always did she portray the lesson in such stark words. But somehow or other, her lessons’ underlying themes often revolved around reminding us that there was Someone looking out for us. I internalized the lesson. And subtly, it changed my life. Silly mother, I thought to myself now as I recalled the reassurance I’d given Toby earlier. Of course, I would be worrying about her and waiting for her, but there was only so much a human mother could Whatdo. a gift I could have given her with the awareness that Someone else was worrying about her, would accompany her on the big yellow school bus and be with her throughout the day, through the learning and recess and lunch. Someone Who could ensure her success in school, unlike her mother who could only ply her with material goods and hope it would help her feel good in Quietly,school. I headed for the closet where Toby’s briefcase awaited her. I opened the zippered pocket where we’d carefully placed her siddur, and took it out. The warmth of its pages caressed me, feeling like the squeeze I’d given Toby. And a soundless prayer rises from my heart, pleading for my daughter’s success. please, help me to teach her that You are always looking out for her. Help her to feel it, too.

Toby is smiling again, the cloud of worry lifted from her eyes. “I’m going to have to remember ev-ery-thing that happens,” she says, voice tinkling again, “so I should be able to tell you about it.” I nod. “Do you think you can do it?” I ask Toby seriously. She giggles, and I fluff her blanket once again. Toby must be sensing my overflowing emotions in the importance I attach to her upcoming milestone. That’s probably why she’s starting to wonder if the long-awaited day might be a bit scary for her. It’s about time I reined in my feelings, instead of letting them spill out where Toby can feel them.

In five minutes, Toby is sound asleep, secure in my reassurances and love. I tiptoe out of her room, and wander restlessly around the house. There’s nothing left to do, but the nervous energy in me won’t let me unwind and settle Idown.want so badly for Toby’s school experience to be as different from mine as possible. That’s all I’ve been focused on in the last few days of hectic shopping and arranging. I want to protect her, to make sure she never feels as lost and alone as I did. A picture of my little girl boarding a school bus full of eighth graders, looking up at their shirttails fearfully, enters my mind. I imagine a stern Mrs. Klein walking into her first grade classroom, and my exuberant Toby shriveling in her seat. Will Toby really be able to sit still? Will she make friends? Will she learn to learn? My throat tightens again. Toby’s right. It might be a bit scary for her to be on her own, taking her first steps into the real world. I’m just her mother. There’s no way I can truly protect her and ensure that the future she faces is Andthorn-free.thenanother memory comes to me. *** Mrs. Friedman taught tenth-grade Navi. Officially. On the side, she taught us the truest principles of “Imaginelife. you knew there was someone looking out for you, always, all the time,” she said. “Imagine someone who is always thinking about you and how to make you happy. They’re constantly doing things to make your life better and easier, and you know that anything that is hard for you bothers them too.”

Any Job, we will Handle it... Professional and quick service 1-866-426-3421 www.gethandi.com

68 AUG 31, 2022

A frum-owned and operated venue, Sleepy Hollow has everything you need for a stress-free simcha: a magnificent Grand Ballroom that accommodates 750 for dinner and 1,000 for reception and dancing, and a separate chuppah room with a skylight. We’re with you every step of the way. ANSIMCHAEXQUISITE Y OUR D ESTI N ATION FOR . . . 20 M INUTES F R OM M ONSE Y | 1 H O UR F R O M BROO K LY N | 1.5 H O URS F R OM L AKE W O O D 914.631.5700 | USHI SIM A N O V I T C H 845 . 499.709 6 COMPLIMENTARY ROOMS FOR CHOSSON AND KALLAH'S FAMILIES. SHABBOS SHEVA BRACHOS | AUFRUFS | FAMILY WEEKENDS | BAR MITZVAHS C ALL FOR SPECIAL GRO U P R ATES AND PA CK A GE S S LE E PY HOLLOW H O T E L + C ONFERENC E GONCEGSSULTIN RENNEWLYOVATEDBANQUETSPACE TarnopolKashrus GOCGSENSULTIN

70 AUG 31, 2022 Friendly Farm Animals and Children’s Fun In 718-470-0224Brooklyn!AviatorSportsCenter 3159 Flatbush Ave. Brooklyn, NY 11234 Sunday & Monday September 4 & 5 11:00am-5:00pmFOR$14PERPERSON YOU GET TO ENJOY THE FOLLOWING: • VISIT WITH ALPACAS • SHEEP • GOATS • RABBITS • CHICKENS • POT BELLY PIGS • SHADED PICNIC AREAS • MILK OUR COW • HAY RIDE • OPERATE OUR BULLDOZER • SLIDE DOWN OUR HAYWAGON AND ROLLER SLIDES • SIT ON OUR 10 TRACTORS Bounce Houses & Pony Rides for Labor Day Weekend special SUNDAY & MONDAY SEPT 4 & 5

WeeklyLink.com • State of the art equipment: alex & Yag • gift certificateS available • can remove anY hair anYwhere - all Skin tYpeS • call for free conSultation

INTEREST-FREE SMALL BUSINESS LOANS FOR NY CITY, LONG ISLAND AND WESTCHESTER The Hebrew Free Loan Society provides interest-free business loans to moderate-incomelow-andresidents of New York City, Long Island, and Westchester. Get a loan up to Startups • Expanding Businesses • Storefronts • Home-Based • Men/Women Owned No Interest. No Fees. Ever. $50,000 Restrictions apply. Two qualified guarantors required. Find out what HFLS can do for you: 212.692.9023 • biz@hfls.org WWW.HFLS.ORG SOMETIMES ALL A BUSINESS OWNER NEEDS TO SUCCEED IS A HELPING HAND. LET US LEND YOU A HAND. An initiative of the Hebrew Free Loan Society in partnership with Mishkan Yecheskel

Exclusive םירועיש thought provoking and life enriching tailored for graduates teachers and working girls Enjoy the friendly, social הביבס, and events designed for inspiration, elevation and transformationEndorsedbyםינבר & Principals NIGHT WELLSPRINGSEMINARYOF REGISTRATION IS NOW ON FOR INFORMATION AND REGISTRATION CALL OUR INFOLINE 929.552.5520@ Mrs. Rifky Kaff DIRECTOR M347.451.2297rs.Bruchie Binet תלהנמ 917.825.9820 FOCUSTHEISONYOU TAKE PART IN EMPOWERINGTHISEXPERIENCE

LAKEWOOD 115 CLIFTON FRISUN-THURS732.961,6006AVE10:30-610-2 BORO PARK 3903 13TH FRISUN-THURS718.484.4115AVE10:30-6:3010:30-2LADIES & KIDS BOUTIQUE

A spectacular 2nd year, for post-seminary girls of all Aagesrich, inspirational and empowering experience awaitsEndorsed by םינבר & Principals NIGHT SEMINARY REGISTRATION IS NOW ON JOIN US AND INVITE YOUR FRIEND! FOR MORE INFORMATION & REGISTRATION CALL OUR INFOLINE 929.552.5520@ Mrs. Bruchie Binet תלהנמ 917.825.9820 Mrs. Rifky Kaff DIRECTOR 347.451.2297 2 WELLSPRING OF TAKINGITTOTHENEXTLEVEL ‘CAUSE WE KNOW YOU ASPIRE TO HEIGHTSGREATER

Raizy begins reading the autobiography Gila Batsheva has lent her, fascinated by her therapist’s description of her life with the Inuits. At the G&D Group’s offices, every employee has received an individualized threatening email, telling them to either drop the ProMedical investment or quit. If not, each message warns, they are in danger.

“Don’t ask me why, after six years of teaching, I’m still doing this a few minutes before I have to walk into class,” Gitty grumbled as she meticulously began counting the paper clips. “You would think I’d have it all prepared in advance by now, just waiting in my drawer for the right moment.” Esther Mindy sympathetically,smiledthough she couldn’t really relate. Her own efficient nature meant she really did plan things in advance. She’d never understood last-minute Thepeople.bustle of activity in the hallway made it hard for Esther Mindy to concentrate on any focused task, as all the students streamed in to the classrooms. But within just a few minutes, as the clock struck 9, the entire building quieted down. Every student and teacher was in their classroom now, and the hallways were silent and Anotherstill. little smile appeared on Esther Mindy’s lips. She loved the humming quiet of the school building during class hours, a quiet that mostly only she was privy to. The hustle of students coming and going was a sight she enjoyed, but her most peaceful time was when the whole school was holed up learning, and only she wandered

Recap: Glacier plans his next steps in taking out the stick on ProMedical and the G&D Group.

Chapter 22

If she had been able to, Esther Mindy would have whistled as she walked up the steps of the school building. After a couple of days at the job, she had fallen into a smooth, pleasant routine. Walking into her office, as tiny as it had seemed when she first saw it, now felt like sinking into the embrace of comfortable couch cushions. It tasted like home. And home, for Esther Mindy, meant she could let down her pretenses. Wear the adorable, but totally unclassy comfort shoes she’d ordered without Peshy’s help, because she had a long walk to school and it made so much more sense to put on these supportive shoes every morning. “Good morning!” she sang from her chair as the first of the teachers began to arrive. Gitty Grossman, the sixth grade teacher, came to the office first. “And good morning to you, too,” Gitty said, her tone amused. Esther Mindy didn’t mind. She was too happy to mind. “Do you have paper clips for me? Twenty five little colored ones?”

By: Chaya Blustein

ICE STORMS

“Check the third drawer near the door,” Esther Mindy instructed, grateful for her solid memory that allowed her to recall the exact supplies placement with ease.

77WeeklyLink.com Appointments available • Gift certificates available HOURS: SUN. THRU THURS. 11:30-5:00 • MON. THRU WED. 9-10 IN THE EVENING 1520 54th Street • Brooklyn NY • 347.756.0133 new winter arrivals daily

“Why were you in Greenmarket?” Bruchy interrupted. It was a

Bruchy was used to her mother’s drama, after all the months of the engagement that had put her mother into a tizzy every few hours. But the sinking feeling she experienced now as her mother spoke was unfamiliar to her. Mrs. Grossman sighed deeply. “She just does whatever she wants. Doesn’t give a hoot to the fact that she might be embarrassing us.”

around the building taking care of Clomping feet on the stairs rudely interrupted Esther Mindy’s train of thought. A sullen thundercloud of a sixth grader approached her “How can I help you?” Esther Mindy asked politely. She’d hardly had reason to interact with the students until now. “My teacher needs some stupid copies,” the frizzy-haired girl muttered. Her bangles jingled as she put both elbows up on the window, sending a flash of irritation through Esther Mindy. She smiled extra-sweetly to the student. “Which copies would those be?” she asked. The girl shrugged. “She said she left them on the table in the teachers’ room.” Her tone was Esthersneering.Mindy got up from her chair and walked quickly over to the door of the teachers’ room, turning the key in the lock with a fluid motion. The pile of copies was neatly arranged on the table. A pity Gitty Grossman hadn’t taken them with her. “Here you go,” Esther Mindy said, handing the student the pile of sheets. The girl took it reluctantly. “Hey,” she said, as she turned to go, “your shoes are super-cool.”

Really, did Esther Mindy have to take a job in Bnos Rina when she knew so many tongues would wag about it?

“Does she have to go out a few short weeks after her wedding with one of her chessed friends?” Mrs. Grossman sighed. “I mean, I know she’s a super caring girl, and she’s friends with practically her whole grade. Fine, wonderful. That doesn’t mean she needs to be seen in public with a girl who wears a bright orange jacket!”

Bruchy cringed picturing the scene. “Did you see her yourself?” she asked apprehensively. “No. Tante Ahuva saw her,” Mrs. Grossman shot out. Bruchy concealed her gasp with a cough. That was truly bad. Her father’s sister would definitely have made sure to rub the encounter in her mother’s face. “She took this girl out for lunch in Valencia, no less.” The most upscale café in town, it was the perfect place for a Grossman to frequent. In the right

Esther Mindy looked back up, taken by surprise. Of all the accessories she wore, her no-brand shoes were getting complimented! “Why, thank you,” she said affectedly. “That’s kind of you.” She wiggled her toes, ensconced in trendy, unbranded comfort. “Yeah,” the girl said awkwardly. “I wanted to get those too, but this stupid school has a list of colors school shoes are allowed to be.” Stupid seemed to be this girl’s favorite word. Esther Mindy clucked in sympathy. “What’s your name?” Esther Mindy “Shana,”asked. she answered, averting her eyes from Esther Mindy’s. “Shana “NiceCheshin.”tomeet you, Shana. I like that name!” Esther Mindy said. “Enjoy your day!” Shana flushed and bolted back up the steps. It looked like she regretted opening her mouth. Esther Mindy smiled to herself. She had experience, from her high school years, how easy it was for her to make someone’s day with a little interest and a compliment or two. But in high school, it hadn’t been her, Esther Mindy, who got to make the difference. It was her Prada shoes and Ferragamo boots that made the girls happy. Here in Bnos Rina, she was in an alternate reality. Here, her funky, bold spirit was allowed expression, and it was even appreciated. The worshipful look from a frizzyhaired girl like Shana meant a whole lot more to Esther Mindy than all the admiring glances she’d ever gotten from her polished high school

“Butcompany.don’t think I’m only relying on what Tante Ahuva sees,” Mrs. Grossman hastened to add. She described the conversation she’d had with Esther Mindy about her personal shopper. “I hate being the interfering mother-in-law,” Mrs. Grossman said, not sounding like she hated it very much at all, “but Avrumi is clueless in these things, and it sounds like Esther Mindy could care less. You should have seen what she was wearing this morning in Greenmarket.”

Turningclassmates.backtoher work, Esther Mindy let herself whistle under her “Bruchy,***breath.

I’m telling you, I’m not calm these days,” Mrs. Grossman said darkly. “I can never know what this girl is going to do next. She’s really stretching my nerves to the breaking point.”

Bruchy usually rushed to her sisterin-law’s defense at this point in the conversation. Subtly reminded her mother of all Esther Mindy’s sterling qualities and impressive reputation. But the reassuring words remained stuck on her tongue, as she remembered the conversation in her teacher’s room.

79WeeklyLink.com Make the Impossible, Possible TestingAndTraining.cominfo@consulttti.com 877.RING.TTI OTBecomean RATINGSEXCELLENT CHOOSE THE CAREER PATH OF AN OCCUPATIONAL THERAPIST Well-paid + flexible career perfect for the working mom Begin Your Bachelor’s with Pre-requisites NOW & Begin Your Master’s in Spring of 2023 All ClassesWomen's Scheduled Around the Yomim Tovim Professors trained to be sensitive to Jewish culture Experienced. Caring. Available. Supportive. RANKED 5 STARS BY OUR GRADUATES UNPARALLELED GUIDANCE

“Oh, really?” Mrs. Grossman asked coolly. “Did you speak to Esther Mindy too?”

“We had Reina over,” Mrs. Grossman prattled, “and she picked out gorgeous dresses for the family. It should be nice, the Raizywedding.”didn’t say anything.

“I hear you, Ma” Bruchy said, noncommittal. “My lunch break is almost over, and I want to get a chance to eat before my next class. Call you later, okay?” Before Mrs. Grossman could protest, she found herself Withoutdisconnected.anyone around to vent to, Mrs. Grossman was left to continue stewing in her indignation. Usually, talking to Bruchy or another daughter was enough to diffuse her annoyance at her daughter-in-law. Not today. She stared into her coffee cup, feeling morose. Just then, the phone rang. She snatched it, answering before she could check the “Hi,screen.Mommy,” a soft voice said on the other line. It was Raizy, her daughter who lived abroad. “Hi, sweetie,” Mrs. Grossman said, her voice coming out brusque. “How are you feeling?”

Raizy couldn’t figure out what was behind her mother’s tone of voice. With the feeling of stepping into a minefield, she said carefully, “Yes, I “Anddid.”she’s also so happy, isn’t she? So happy to be working in that stupid school, and so happy that now that she’s married to a Grossman she can do as she pleases to the Grossman name! Just like you, huh? You must be really happy that there’s someone else now who doesn’t care about our family or our standards. I don’t know if Avrumi or his wife are happy, but it sure sounds like they’re making you happy!”

Raizy was absolutely shocked at the venom that spewed together with her mother’s furious words. Anger directed at her, she was used to, but what had happened to her mother’s enchantment with Esther Mindy and her favorite son? Mrs. Grossman breathed heavily, regretting the speech she’d let out in her “Whatever,”rage. she said abruptly.

“Thanks for calling, darling. We’ll be in touch.”

“Good, baruch Hashem,” Raizy said. “How are you?” Mrs. Grossman wasn’t feeling very good at all, but she wasn’t about to admit it to Raizy. “Busy with the upcoming wedding,” she said. For which Esther Mindy wanted to use her own personal shopper, the nerve of her. “What a pity you’re not being Mrs.there.”Grossman didn’t even realize how facetious her tone was, but to Raizy it came through like a slash of a whip. Raizy cringed.

She’d just remembered that Avrumi had his lunch break now, too. It was time she spoke to her son directly.

grocery located at the end of town, near Esther Mindy’s new apartment but not very close to Mrs. Grossman’s house.

“Did you finish shopping for your winter wardrobe?” Mrs. Grossman asked. “I’ve always told you not to leave these things for the last “Yes,minute.”Ifound everything I needed,” Raizy said, her voice timid. “Good,” Mrs. Grossman said, her annoyance growing at Raizy’s pathetic nervousness. Raizy cast about for something neutral to speak about. “I spoke to Avrumi yesterday,” she said after a few seconds. “He sounded really Mrs.happy.”Grossman’s annoyance flared up into anger. So Raizy thought that Avrumi was happy with that whippersnapper of a girl who did as she pleased and expected the world to smile back at her ingratiating cheerfulness?

“I always shop in Greenmarket,” Mrs. Grossman said defensively. “I like their butcher department, and they deliver really quickly. But anyway, Esther Mindy didn’t see me. She was on her way to work and she just stopped in to pick up something for breakfast.” Bruchy didn’t say anything. She tried to imagine her own motherin-law scoping out her corner grocery store every morning, behind her back. The thought made her stomach turn. It was a good thing her husband came from a large family of boys, and she knew her mother-in-law was far too busy with her own life to worry about her daughter-in-law’s life.

“She was wearing these shoes that looked almost like sneakers, you know, really comfortable shoes. Not a brand name in sight, and let me tell you, they didn’t look like they were very good quality. That’s how she goes to work every Bruchymorning?!”kept quiet. Honestly, it sounded perfectly excusable to her. After all, Esther Mindy had a long walk to Bnos Rina every morning. But she wasn’t in the mood of sticking up for her right now.

81WeeklyLink.com ParkBoroSt.38th-1463 851-8393(718)FAX:(718)851-8392 Ave.IslandConey1482 252-9527(718)FAX:(718)252-9537 EMAIL ORDERSBP@PAPERIFIC.COMPARK:BOROORDERSCIA@PAPERIFIC.COMFLATBUSH: SUPERMARKET 20226,SEPTEMBERTUESDAY,ENDSSALE20226,SEPTEMBERTUESDAY,ENDSSALEAND14THBET.STREET37THONBACKYARDOURFROMENTRANCEANDPARKINGEXTRA15THAVE. STORE HOURS ERRORS.TYPOGRAPHICALFORRESPONSIBLENOT FAMILY.PER4LIMITSPECIALSALL LAST.SUPPLIESWHILE $15ININCLUDEDNOTARENEWSPAPERS&JUICEGRAPEEGGS,DEPT.,MEATFROMITEMSANYEXCLUDING 1PM.BYINBEMUSTDELIVERY.DAYSAMEFORORDERSFAXOREMAIL APPLYRESTRICTIONS MinimumWithItemsSaleAll $15Non-SalePurchase ACCEPTWE MASTERCARDVISA, FOODSTAMPS& REPACKAGING UNDER 31AugustWed. 7:308:002Sept.Fri. 2:008:003Sept.Sun. 6:009:001Sept.Thurs. 8:00-7:30 6Sept.Tues. 6:008:004Sept.Mon. 6:008:00DEPT.FRUIT4/5SEPT.MON.&SUN.THISOPEN4/5SEPT.MON.&SUN.THISOPENFIGHTERPRICETHE DEPT.MEAT K W h o l e c h c k e n c u t n 1 / 4 o r 1 / 8 . $ 2 . 9 9 l b K G r o u n d C h i c k e n . . . . . . . . . . . . $ 6 . 9 9 l b K C h c k e n F i i n g e r s / S t r p s . . . . . $ 7 . 9 9 l b K C h c k e n N u g g e t s . . . . . . . . . . . $ 8 . 4 9 l b S o o m o n s A m e r c a n M e a t s F r e s h G r o u n d b e e f F / p k . . . . . . . $ 5 . 9 9 l b B e e f N e c k B o n e . . . . . . . . . . . . . . $ 7 . 9 9 l b W h o l e B r i s k e t . . . . . . . . . . . . . . . $ 8 . 4 9 l b B e e f S t e w F / p k . . . . . . . . . . . . . . $ 9 . 9 9 l b B o n e i n C h u l e n t M e a t . . . . . . . . $ 1 0 . 9 9 l b LUVS DIAPERS SUPER BOUNTY SIZEASELECT12=27 2LIMIT $2250CT.112#4 CT.92#5CT.132#3 CT.80#6 CT.64#7 $499NESCAFE VANILLAFRENCH COFFEE GRAMS100$399GLICK’S HONEY LB.2 JETFOIL PANS9X13 DUTYHEAVYPACK10 $499 ךְירֹצהלֹּיבט ןיא CREST TOOTHPASTE OZ.8.2$199$479CLEANMR. FREAKCLEAN SPRAYW/REMOVABLE$199SELECT NAPKINSLUNCH $429CHEERIOS OZ.18 OZ.16CLEANMR. OZ.128•CITRUS $699$999TIDE SIMPLY CLEAN&FRESH 128OZ. SCOPE MOUTHWASH OUTLAST•CLASSIC LITER1•$399 ARRID OZ.6 CLEANMORNING $299 $269SOFTCHARMIN ESSENTIALS 4=9ROLLSGIANT SCRUBSOFT BLEACHLEMON,OROXI•24OZ.$329 REFLECTIONS CUTLERY CT.80 K20SP,20F,40$$2999FOR249MILAN WHITEHW PLATESALAD CT.16 LIMITNO DUTYHEAVY CLEAR10” PLATES CT.40 $899 DUTYHEAVY CLEAR7” PLATES CT.40$699NOLIMITNOLIMIT HANDI WIPES CT.36$69999¢GLADE ADJUSTABLE OZ.6 RibSteakSteakepperSteakOysterCheekMeatMeatMozartMiamiShortRibsstCutBrisket enBone-inFlankTipsenFlankShoulderSteakREyeChuckoastBroilLondonMushRSquareoastRibsSpare RChuckoastDeckBeefelFischelalichelalichelSkirtSteakSteakSandwich EyeRibSteakRibSteakClubBonesMarrowGroundBeefFlankBonelessen KJJPoultry!linefullacarryalsoeW offreshK TAUSDSATAMEA Solomon’withDept.MeatedExtendeourFeaturingsAmericaanA v o c a d o . . . . . . . . . . . . . . . . . . . . . . . . . 9 9 ¢ e a G o l d e n A p p l e ( n o w a x ) . . . . . . . 9 9 ¢ l b E g g p l a n t . . . . . . . . . . . . . . . . . . . . . . . . . . 9 9 ¢ l b C o r t l a n d A p p l e ( n o w a x ) . . $ 1 . 1 9 l b G r e e n o r R e d G r a p e s . . . . $ 1 . 9 9 l b G r a p e T o m a t o . . . . . . . . . . . 2 $ 3 . 0 0 F O R $1999 2LIMIT PURCHASEW/$75 ITEMSNON-SALEOF GEFEN LIGHTEXTRA OILOLIVE33.8OZ. $699 HELLMAN’S REGULAR MAYO28oz. $399 NORMANS LIGHTGREEK YOGURT $OZ.5.3129 FLAUM’S PICKLESSOUR OZ.52 $459FAMILYPACK $999HAOLAM CHEESESTRING CT.18 $599BELEAF CAULIFLOWER FLORETS24OZ. GEFEN WHITESOLID TUNAALBACORE OPENEZOZ.6WATERIN $19948LIMIT $369 GEFEN FLAKECORN CRUMBS LB.1•ORIGINAL $279 2LIMIT CT.250+50BONUS GEFEN YEASTDRY LB.1

82 AUG 31, 2022 Write down 5 things you are grateful favoriteDeclutterDoDoself-talk.Practicefor.positivesomethingniceforyourself.somethingwithyourhands.yourspace.Usefidgettoys. Go for a +EaEliminatewalk.sugartprotein&vegetablesPracticedeepbreathing.Cuddlewithaweightedblanket.Drinkherbaltea.Plana10minuteworrytime. Meditate. Daven yourConnectPayJournal.attentiontomicromomentsofhappiness.Giveyourselftimeout.withafriend.Spendtimeinnature.Scratchsomethingoffto-dolist. to30GoEliminatecaffeine.tosleepmin.earlierthanusual.Doacreativeactivitytodistractyourself.Useamantratalkyourselfoutofit.Goonadigitaldetox.(offalldevi ces) for 10 minutes. Find something to laugh about. calmingListenExerciseorstretch.tomusic.Drinkcoldwater.Identify3triggers.Takeahotshowerorbath.Setupadailyroutine. Day 1 Day 6 Day 11 Day 16 Day 21 Day 26 Day 2 Day 7 Day 12 Day 17 Day 22 Day 27 Day 3 Day 8 Day 13 Day 18 Day 23 Day 28 Day 4 Day 9 Day 14 Day 19 Day 24 Day 29 Day 5 Day 10 Day 15 Day 20 Day 25 Day 30 ph 718.382.5437 e info@rifkaschonfeld.com  www.rifkaschonfeld.com This 30 Day Anxiety Challenge calendar was mistakenly omitted last week.

83WeeklyLink.com 5314 13th Ave. Brooklyn NY WEEKLY SPECIALS P. 718.436.5353 F. 718.871.7128 53MEGA@GMAIL errorstypographicalanyforresponsiblenotare*We Valid: 8/31-9/6 9" $4.99PLATES Gefen KIWI STRAW BOX DRINK 4pk 2/$3 Reisman RUGELACHCHOC 18oz $5.99 Gefen $3.99CREAMYPEANUTBUTTER Reisman $5.99BROWNIEBARS Haddar Tirosh HALF$1.59COOKIESMOON Liebers MAPLE$7.49SYRUP Kirkland WIPES 100 Ct $2.69 Gefen MUSHROOMS Stems & 8ozPieces 2/$3.29 Pro Grade GLOVES All Sizes $4.99 Lerner UNSCENTEDTEALIGHTS 50ct $3.39 Streits MATZO Lightly Unsalted,Salted,Ww,WwEverything $3.19 Givat 5/$4.49ASSORTEDYOGURT $2.99GRAPESORGREENRED 8/$1.99LEMONS Krunchy $3.99PICKLESSOUR Case Gefen NOODLECHICKENSOUP$16.99 Plastic House CONTAINERS 8oz,16oz 24ct And 32oz 15ct $3.99 Gefen EXTRAOLIVELIGHTOIL 101oz EGGPLANT$24.99$.79TOMATOESVINE$1.29 Meal Mart PASTRAMI$5.99 Gefen TOMATO SAUCE 15oz 2/$2.59 Pert Plus 2 IN SHAMPOO1 33.8 Oz $5.99 Tasters Choice HOUSECOFFEEBLEND 14oz $2.99COLORED$13.99PEPPERS 3/$2.99AVOCADOS WOW!WOW! WOW! WOW!

TEACH, WE

Q: What’s the connection between women and shame? Why does it seem like women have so much more guilt than men?

BETWEEN

THE

A: Brene Brown, the author of Daring Greatly, explains that women have a particularly difficult time with shame because there are different (often stricter) societal expectations for women as mothers, fashion figures, and careerists. Therefore, it’s really important to recognize the negative effects of shame on your life and to transform yourself in an effort to control it. • Courage. Shame is an emotion that tunnels inside of us – it cannot survive being shared. The most damaging thing we can do when we experience shame is to bury the story and hide it from everyone around us. Instead, it’s important to have courage and share the story with someone you trust. The root of the word courage actually comes from the Latin word for heart (cor). In that sense, courage can be about sharing your heart with someone else. • Compassion. While it is important to share the story, it is equally (if not more) essential to share the shame story with the right person. There are multiple ways that well-intentioned friends can react that will not help assuage the shame. Some of those responses could be: anger at the person who did this to you, feeling bad for you, or only wants to make it better without really listening. Instead, you need to look for a friend who will demonstrate IF THEY DON'T LEARN WAY WE MUST TEACH THEM THE WAY THEY LEARN Rifka Schonfeld,Director 1542 East 19th St Brooklyn, NY rifkaschonfeldsos.com718.382.543711230 CONNECTION WOMEN AND GUILT

S S STRATEGIES FOR OPTIMUM SUCCESS THE

Designer Eveningwear 718-438-3463 (FIND) All major credit cards accepted By appointment TREMENDOUS MOVING SALE CONTINUES! BACKWE’REWITHGORGEOUSGOWNS!

AUG 31, 2022

An acclaimed educator and education consultant, Mrs. Rifka Schonfeld has served the Jewish community for close to thirty years. She founded and directs the widely acclaimed educational program, SOS, servicing all grade levels in secular as well as Hebrew studies. A kriah and reading specialist, she has given dynamic workshops and has set up reading labs in many schools. In addition, she offers evaluations G.E.D. preparation, social skills training and shidduch coaching, focusing on building self-esteem and selfawareness. She can be reached at 718-382-5437 or at rifkaschonfeld@ gmail.com. You can view the web at rifkaschonfeldsos.com.

compassion – someone who will answer, “Oh, man, that sounds terrible. I am so sorry. I’ve definitely been there. I can’t stand when I feel that way.” • Connection. Through your courage in sharing and your friend’s compassion, you have created a powerful connection to somebody outside of your shame. You can feel exposed to your shame, but also completely loved and accepted – which are the true antidotes to shameful thoughts. Remember, the definition of shame is “the intensely painful feeling or experience of believing we are flawed and therefore unworthy of acceptance and belonging.” Once you forge a connection, you feel you belong.

ד"סב OPEN LATE HOURS / CALL OR 347.878.7445TEXT: Located in Boro Park (10 minutes from Flatbush) Delivery available in BP, Flatbush & Wmbsg for additional fee Shavy Scher WE HAVE ALL KIND OF HELIUM FILLED BALLOONS HAPPY BIRTHDAY / GET WELL / CHARACTERS ANNIVERSARY / BABY BOY / BABY GIRL CONGRATULATIONS / GOOD LUCK WELCOME HOME / SMILEY / LCHAIM MAZEL TOV / AND MANY MORE GET YOUR GIFT WRAPPED IN A BALLOON! WE ALSO CARRY 13 DIFFERENT COLOR LATEX BALLOONS GET YOUR GIFT WRAPPED IN A BALLOON! Balloons say It

87WeeklyLink.com 4118 13TH 718.436.4280AVE. Hours: Mon-Thurs 10am to 5pm, closed Friday ALL R’HECHSHERWITHWIGSOFMORDECHAIGROSSSHLITA HOWPRIVATECOURSE;LEARNTOADDBABYHAIR! YAFFA WIGS LABOR DAY SALE HUNDREDS OF DEALS GOING NOW AT YAFFA WIGS SYNTHETIC100% HAIRHUMANBLEND HUMAN100%HAIR

WatermelonWhole Lieber’s Corn or RiceThinsCake 2/ 99¢ Each PattiesBeef $6.49 lb. $7.99 GeneralMills Cheerios 18 oz. Mehadrin LIMITS APPLY Norman’s WholeSqueezeMilkYogurt Gefen YeastDry 1 lb. Dawn LotionDish Original 18 oz. or Clear 16.2 oz. $2.79 Sunday Monday Limits apply $1.99 49¢ lb. $7.99 lb. ChickenStuffedCapon Poland Spring SportsWater24oz.Cap CASE OF 24 $6.99 All HE StainPodsLifter 4 in 1 39 ct. Whole Hearts of Palm 14.1 oz. Can $2.29 Ronzoni Elbows 16 oz. 99¢ Krasdale Sugar 10 lb. $6.99 Galil MandarinOranges Whole Segments 11 oz. 89¢ $4.99 Gefen SesameSeeds 8 oz. $1.49 PotatoesSweet 59¢ lb. Kirbies 69¢ lb. PeppersRed $1.99 lb. 69¢ lb. Eggplant Peaches $1.29 lb. SpanishOnions 69¢ lb. TomatoesCherubGrape $1.59 Gefen Sweet & Sour Duck Sauce 40 oz. $3.29 $2.69 Haddar CookiesDuplex 25 oz. $4.99 Quick or Old Fashioned 42 oz. $3.99 LemonJuice 32 oz. $1.49 Spot Black KitchenTallBags 45 ct. $4.69 Arm & Hammer HEBurstClean 75 oz. Liquid $$4.99 2.79 Dagim Blueback or Honey SalmonMustard 3.75-4.2 oz. Lieber’s Wyler’s Italian Freeze Pops Pink or Green 40 ct. Since 1983 5005-5025 18th Av e • T. 718.435.7177 F. 718 . 854.5090 • Goldbergsf reshmarket@gmail.com We accept Food Stamps, WIC and Credit Cards. Call Your Order In To 718-435-7177 Or Fax To 718-854-5090 • Daily From 9am - 4pm And Friday From 8:30 To 11:30 EFFECTIVE 8/31/22-9/6/22 – WHILE SUPPLIES LAST. WITH $10 NON-SALE PURCHASE. WE RESERVE THE RIGHT TO LIMIT QUANTITIES. NOT RESPONSIBLE FOR TYPOGRAPHICAL ERRORS Mehadrin RegularLebenorLight 6 oz. $7.99 $1.79 $2.99 Lieber’s Semi Sweet RealChipsChocolate 9 oz. $1.49 $3.99 Lieber’s Pineapple Crushed, Tidbits, Sliced or Chunks 20 oz. WatermelonCut 59¢ lb.

$ 2299 $ Goldberg’s MatbuchaMoroccan 1.59 8 oz. cont. No Preservatives Goldberg’s Hot Pepper Dip $1.49 No GoldbePreservativesrg’s OnionRoastedDip 8 oz. Cont. 1.59 Golden Taste WhitefishSalad 7.5 oz. $ 2.99 2.69 Taamti PicklesOlivesor 22 oz. $ 2.29 $ $ 8 oz. cont. No Preservatives Goldberg’s OnionRoastedDip 8 oz. Container $ 2.29 No Preservatives $ $2.992.49 3.99 $ Goulash Since 1983 5005-5025 18th Av e • T. 718.435.7177 F. 718 . 854.5090 • Goldbergsf reshmarket@gmail.com We accept Food Stamps, WIC and Credit Cards. Call Your Order In To 718-435-7177 Or Fax To 718-854-5090 • Daily From 9am - 4pm And Friday From 8:30 To 11:30 EFFECTIVE 8/31/22-9/6/22 – WHILE SUPPLIES LAST. WITH $10 NON-SALE PURCHASE. WE RESERVE THE RIGHT TO LIMIT QUANTITIES. NOT RESPONSIBLE FOR TYPOGRAPHICAL ERRORS Flaum’s Sour Pickles Family Pack Container 52 oz. HeimisheKokosh 16 oz. $5.89 OnionBuns 6 pk. $3.39 $9 49 LB Tender Chuck StewBeef RibChickenSteak ChickenStrips $ 8 99 LB $6 99 LB Sesame Teriyaki ChickenStrips $9 99 LB LB KielbasaSliced $11 99 LB Marinated Kids Rib Steak $5 99 EA $9 99 KJ Poultry Frozen ChickenBreadedNuggets 2 lb. SquareRoastCut $10 99 LB HomestyleYapchik10 pc Southern Fried Chicken + 2 Side Dishes AvocadoRoll $4.95 ScottishAtlanticSalmonSteaks $ 8.99 $ 1299 $2.59 lb. FAMILY PACK Klein's JellyChocolateRings $ 5.89 lb. FAMILY PACK Paskesz CoffeeCandy $2.69 lb. FAMILY PACK Setton FruitCherrySlices $ 1299 Golden Taste TunaHealthyDeluxe 7 oz. Meal Mart PastramiTurkey Goldberg’s HerringCream 8 oz. Container $ 2.89 No Preservatives Goldberg’s 1000DressingIsland 10 oz. Container $ 2.29 NoSonnyPreservatives&Joe MatbuchaDip 7 oz. lb. $ 999 LET US CATER YOUR SIMCHA AT HOME OR ANY LOCATION OF YOUR CHOICE SERVING 35 PEOPLE • SEUDA CHALLA • HEIMISHE BILKELECH • APPETIZER • SOUP • MAIN DISH • 3 SIDE DISHES • 2 SALADS FOR ONLY $ 500 lb. lb. GroundBeef ChickenGround $ 7 $99 7 49 LB LB lb. LB LB LB LB

91WeeklyLink.com PROJECT COORDINATOR Busy BP office seeks full-time capable coordinator to join our team. Must be computer proficient, have the ability to multi-task and have a great attitude. Great opportunity for growth. Email resume to hr@smsny.net and write Project Coordinator in subject line. Kindershpiel Playgroup To register call: Teacher Miriam 718.972.1938 Area of 50 & 12 Deep cleaning all types of AC units Window, split units, and central *Get your coils, condensers, and blowers clean *Get rid of dust and mold *Lower your energy bills *Obtain quality air *Preserve your unit *We also clean bathroom fans *Mikvahs ventilation systems “Keep It Clean” 347-585-5477 Yidel Weisfeld YES...WE DELIVER! YIDEL’S EXPRESS efficient | reliable | reasonable MESSENGER SERVICE | LAKEWOOD – BROOKLYN | RESIDENTIAL- COMMERCIAL link 3.5 x 2.25 732.595.2010yidelsexpress@gmail.com THIS MONDAY! SERVING MONSEY, MONROE & THERENOVATIONSWECATSKILLSDOYOURWHILEYOUAREINTHECITY. A TALMUD TORAH IN BP IS LOOKING FOR A SECRETARY Please email your resume to secretariesjob@gmail.com

92 AUG 31, 2022 This job is for you if you’re: Detail oriented Highly organized A peoples person Why you’ll love it here: Heimishe work enviroment Opportunity for growth Great benefits packages Impact your future with the right CRingel@hamaspikkings.orgchoice. Email your resume to: Joining workforce?the Get a job where you feel satisfaction daily knowing you’re making a difference while working in the #1 rated workplace (ask around). Join Hamaspik as an FI coordinator. Help clients receive customized services through a Self-Direction budget of their choice. וצ יעמעזער א טקיש NURSERYASSIST@GMAIL.COM ת"ת עשידיסח א א טכוז פ"ב ןוא ASSISTANTNURSERYTEACHER ADMINISTRATIVEASSISTANT Busy BP firm seeks full-time capable administrative assistant to join our team. Must be computer proficient, have the ability to multi-task and have a great attitude. Great opportunity for growth. Email resume to hr@rothcocpa.com and write Admin Position in subject line.

93WeeklyLink.com Warm loving caring place for yourlittlepreciousone! Located 14 & 56 Extended Hours Warm Lunches 929.545.1141 Seamless training process Multiple growth opportunities Fast-paced, supportive environment Join Comfort Health as an HCBS coordinator and help children acquire the services they need to gain daily living and coping skills; while ensuring their ongoing success. Why you’ll love it here: Boro Park: 4102 14th Avenue, Brooklyn, NY 11219 Williamsburg: 295 Division Avenue, Brooklyn, NY 11211 A project of Hamaspikof Kings County It’s not about coordinating services; it’s about creating real impact. Organizational CommunicationSkillsandInterpersonalSkillsNodegreerequired Requirements: Email your resume to: Williamsburg stessler@comforthealthny.orgpositions: Boro Park cgreenfeld@comforthealthny.orgpositions: Five Towns positions: glipschitz@comforthealthny.org Ready to make a difference? 718.998.6043 829 E. 15 11230BrooklynStreetNY www.claireswigstudio.com We go back a long way... Creating masterpiece wigs since 1960 Timeless craftsmanship, Latest fashions New stock in the Modesty line Order today and have a new wig for Yom tov. We are open on Labor Day

94 AUG 31, 2022 315 AVE M ○ BROOKLYN NY ○ 718.336.7563 ○ @moishassupermarket DietSaladBroccoli 15oz FOLLOW US ON INSTAGRAM @THECUTABOVE.MOISHAS MEAT DEPARTMENT We Make Beautiful Mazza Platters For All Occasions, Lots Of Different Sizes. Please Call 718.336.7563 Ext 230 - Ask for Chaim or Shia MARVID - HISACHDUS WOW! Dark Chicken Cutlets (Family Pack) *Wed-Thurs Only! ............................. $5.99lb WOW! Dark Chicken Capons (Family Pack) *Wed-Thurs Only! ............................. $5.99lb TEVYA’S RANCH WEISSMANDL BET YOSEF GLATT WOW! London Broil Grain Finished ...................................................................... $6.99lb WOW! Silver Tip Roast Grain Finished ................................................................. $6.99lb WOW! Premium Pepper Steak Grain Finished ...................................................... $7.99lb WOW! Ground Shoulder *Super Lean (Family Pack) Grain Finished $6.99lb Flank Steak Grain Finished .................................................................................. $9.99lb Rib Eye Steak (Family Pack) Grain Finished ..................................................... $14.99lb Rib Eye Roast Grain Finished ............................................................................. $14.99lb Rib Eye Patties & Sliders Grain Finished .......................................................... $10.99lb Fillet Mignon Grain Finished .............................................................................. $16.99lb Surprise Steak Grain Finished ........................................................................... $34.99lb GOURMET OVEN READY! WOW! Pickled Corned Beef Small-Med Top Of The Rib (Weissmandl-Bet Yosef) ... $8.99lb WOW! Pastrami Small-Med Top Of The Rib (Weissmandl-Bet Yosef) ...................... $9.99lb Seasoned Rib Eye Steaks *Assorted Varieties (Weissmandl-Bet Yosef) ................ $15.99lb Marinated London Broil (Weissmandl-Bet Yosef) $8.99lb Breaded Dark Chicken Cutlets (Hisachdus) ....................................................... $8.99lb Baby Chicken Shwarmah (Hisachdus) ............................................................... $8.99lb Cornflake Crumbs Chicken Fingers (Hisachdus) ............................................... $8.99lb CHK - BET YOSEF Boneless Short Rib Flanken Grain Finished ...................................................... $12.99lb Boneless Short Rib Flanken Roast Grain Finished ........................................... $12.99lb Boneless Spare Ribs Grain Finished $14.99lb SOLOMON’S - SKVER WOW! Meaty Beef Neck Bones ........................................................................ $2.19lb BYL New Item! WOW! Fried Bbq Wontons $7.99 Per Dozen FISHSUSHI WE (mustBEAUTIFULMAKEFISHPLATTERSorderinadvance)For your Events,Simchas,PartiesandShabbosSushiPlatters,calloursushiexpert929.379.6628 BAKERY WE NOW CARRY A LARGE VARIETY OF GLUTEN FREE BAKERY PRODUCTS We now carry Fresh Baked Sourdough Breads and Challahs $1 OFF VegetableMixedRoll $2 OFF Alaska Roll $3 OFF King Bin Roll SPECIALLUNCH Daily from 12pm-2pm Your Choice of Select$9.99RollsCombo CANDY $5.99 lb Kleins HoneyCashewsGlazed $7.99lb Kleins Viennese Crunch $3.29lb Setton Craisins $3.99lb Zweet WatermelonSourGummies $6.99 BAKED ON MandelPREMISESBread $2.79 Pas Hot Dog HamburgerorBuns Hamotzei $4.99 Reismmans PastriesIndividuallyWrapped Value Pack $11.99 lb SeasonedTilapia .89¢ TomatoesGrape $2.79 Cantalopes .59¢ lb Eggplants .99¢ CarrotsBaby $12.99lb ChickenNuggets $7.99lb Stir VegetablesFry $3.99 Red PotatoSkinSalad 15 oz. $19.99lb Meal Mart Corned Beef Min 1/2lb Purchase $6.99lb ChickenTeriyakiLegs $1.79 lb Red, Orange or Yellow Peppers $1.49 Cello Onions 3lb $4.99lb RoastedPotatoesSweet $3.99 Garlic Dip 7.5oz $12.99lb Meal Mart SmokedBreastTurkey Min 1/2lb Purchase WE NOW CARRY A FULL LINE OF FRESH VACUUM PACKED SBD DELI PRODUCE WELCOME BACK!!! SUPER SALES!!!

95WeeklyLink.com 315 AVE M ○ BROOKLYN NY ○ 718.336.7563 Tues 7am-8pm Delivery till 6pm Fri 4:00pm7amDelivery till 1pm Sat Closed Thurs Midnight7amDelivery till 8pm Wed 11pm7amDelivery till 8pm Sun 8am-8pm Delivery till 5pm Mon 7am-8pm Delivery till 6pm ERRORS.TYPOGRAPHICALFORRESPONSIBLENOTONLY.PURCHASENON-SALE$15WITHITEMSSALEALLONLY.STOREINAVAILABLEAREITEMSSALEALLCHECKS.RAINNOLAST.SUPPLIESWHILEQUANITITIESLIMITTORIGHTTHERESERVEWENOTTOBECOMBINEDWITHANYOTHEROFFER7:08 CANDLE LIGHTING: FRIDAY, SEPTEMBER 2, • םיטפוש 'פ ק"שרע WE NOW CARRY A FULL LINE OF WIC APPROVED BABY FORMULA STORE HOURS WEEKLY SPECIALS MINIMUM $15.00 PURCHASES WE ACCEPT WIC & EBT/SNAP SALE PRICES VALID FROM 8.24.22 8.30.22HOUSEHOLD CASETHEBUYFRIDGEFREEZERGROCERY Shwartz Cooking Spray 5oz Salad Mate Caesar Dressing Regular or Light Kitchen Collection Food Storage Bags 1 Gallon 75 count Serving 9" Plastic Plates Microwaveable case of 400 (4x100pk) Plastic House 7oz Plastic Cups case of 1200 (12 x 100pk) B&B Nish Nosh Crackers 10.6oz Liebers Health on The Go Rice Cakes .63oz x Hersheys4pk Cocoa 8oz Elite Must Gum Cubes Bazooka, Spearmint or Peppermint 2oz Crystal Geyser Mini Waters 8pkcase of 32 (4x8pk) Goldbaums Quinoa Red or White 12oz Solomons Pastrami Birds6ozEye Steam Fresh Peas 10oz Haddar Cucumbers in Brine 7/9'zDagim19ozChunk Light Tuna in Water 6oz Haddar Honey Wheat Pretzel Barrels Paskesz Thinny Minnies Sea Salt, Everything, Hot Spicy, Heart Sea Salt, Spelt Sea Salt and Spelt Everything 6oz - 7oz Tnuva Goat Cheese Hoffmans7.05oz Pizza Balls 18oz Simply Lev Pasta Elbows, Spirals, Penne or Shells 16oz Gefen Olive Oil Extra Ligth, Extra Virgin or Extra Mild 1 Liter Paskesz Marshmallows Original White or Mini White 8oz 6Limit eachof6Limit 6Limit 2Limit 2Limit 6Limit 6Limit6Limit eachof6Limit 2csLimit 6Limit 6Limit6Limit 2csLimit6Limit 4Limit eachof6Limit 6Limit6Limit eachof6Limiteachof14Limit eachof6Limit Gefen Apricot Preserves Haolam15.25oz SlicedCheeseMuenster Regular or Sandwich 6oz Ungars Gerfilte Fish 20oz Case of 48 Liebers Panko Bread Crumbs Original or Seasoned 8oz Mr Dipz Sweet Onion Dip Tuscanini7oz Classico Pizza 14.1oz Haddar - Baracka Tahina Paste Original Only Kelloggs15.9ozFruit Loops 10.1oz or Frosted Flakes 13.5oz Liebers Chewy Chocolate Chip Cookies 13oz Haddar Honey Kedem32oz WholeCrackersWheat Original, Garlic or Sesame 6Limit eachof6LimitLimit6 eachof6Limit 6Limit6Limit 6LimitLimit6ofeach 6Limit 6Limit eachof6Limit $2.29 $3.79 $1.39 $14.49 $11.99 $2.99 $2.69 $1.99 $1.59$5.49 $1.59 $4.69 $2.49 $6.79$4.79 7/$6 2/$3 $6.99 $2.29 $1.79 $2.49 $9.49 $4/$5 $58.99 $5.99$2.49$1.99 $1.49 $4.49$3.79$2.99$3.99$2.99$1.69$4.69

עבאגסיוא רעדליב עשידיא עטפַּאכעגפיוא-טסרעמ יד #575 9/2/22|ק"ּפל ב''פשת םיטפוש ׳רפ NYC(ONLY)/NJ:$7.99 CANADA $6.99 UK £8.00 ח״ש י"רא January 2022 NEW BARCODES AH BLICK RETAILWEEKLY$7.99 Wholesale $6.80 AH BLICK YOM TOV RETAIL $10.99 Wholesale $9.30 25071 38457 25072 5 לולא ח''ר בובאב'ד המלש םרכ הנחמ ןיא יקסוועשטנעלםיחא :דליב !האנה טאה רעדעי ןואטלופעגנאןכותטימראפהאנהעצנאגידהחפשמ קילב אלקעפ אגעמ

only helped somewhat. Since she's on the Thrive Stress Support, she's a new person! Thanks so much!” -Leah, Suffern, NY “Thrive’s Advanced Stress Support replaces my 1 p.m. cup of coffee, giving me the power of coffee without the jitters. I feel calm, focused, alert, and less frazzled and distracted.” -Yossi, Brooklyn NY “As a working mom with many responsibilities, I often find myself at my wit's end. My friend Chany introduced me to Thrive Gentle Calm and it has tremendously eased my stressful edge!” -Adina, Brooklyn NY Thrive’s Advanced Stress Support and Gentle Calm formula instantly create a sense of calm and focus. Feel relaxed within the hour. Improves focus, attention, mental clarity and learning performance. Contains all natural ingredients, primarily the powerhouse suntheanine. Safe, non-addictive formula Relax and ease stress and anxiety Induce an overall feeling of calm yet remain mentally alert. Promotes better sleep quality Safe for kids and pregnant women byOverwhelmedstress? Get fast relief with our gentle all-natural stress supplements

97WeeklyLink.com Exclusively at: 718. 1267871.077750thSreet

After they passed the three towers of the power station, Zevi fell silent, and then cleared his throat and said, “I’m happy that Penina had where to go, because my mother had seriously planned to host us. A lot of her angst is because she knows that we didn’t really have where else to go after the “I’mbirth…”sure it was very hard for your mother,” Hinda said warmly, trying to remember in her mind how her “machateineste” looked. Zevi’s parents had been invited to their wedding, because Dov had a close relationship with them. But she could not envision a particular face in her mind. “B’ezras Hashem, she’ll get better, and then she’ll make up what she “Right,”missed.”Zevi agreed. “And we really appreciate your hospitality. I travel to Bnei Brak with yishuv hada’as because of what you are doing for us.” His expressions of gratitude were made at a much slower tempo than his regular speed-talking habit, and Hinda noticed the unease and awkwardness with which he made them. That made her appreciate them even more. “We did it gladly, Hinda laughed, and decided not to respond. Always found the good? Perhaps it was because they were on their way to Michoel that she was feeling all the criticism she had accumulated for him over the years suddenly rising. It wasn’t

Recap: With the onset of Shabbos, the computer in Mr. Perl’s house shuts down. Martin decides to light Shabbos candles and make Kiddush in memory of Grandma, who would do so each week. Baruch joins Hinda for Shabbos.

CHAPTER TWENTY FOUR On Sunday morning, Dov and Hinda set out for Yerushalayim, as planned. Penina waved goodbye from the doorway of the house and wished them good luck. Hinda, who had wondered earlier if Penina would be nervous to stay alone in a strange house, was happy to see the confidence with which the younger woman closed the door behind them and then locked it.

OUTSIDE BUBBLE

Zevi, Penina’s husband, was also joining them. It would be a much shorter and more comfortable trip for him than traveling by bus, he’d said, and he was grateful that they were willing to pass through Bnei Brak for him. After he strapped his seatbelt and thanked them another two times, Zevi told Dov about the replacement of his rosh kollel; it had been talked about for years but no one believed it would actually happen. Then he changed the subject to his father’s retirees’ kollel, and then his mother’s retirement, and the natural continuation was the latest slippeddisc incident. And by then they were already passing Hadera.

99WeeklyLink.com I N THEIR OWN WORDS MY EXPERIENCE IN THE EMERGENCY ROOM AT MAIMONIDES WAS OUTSTANDING... I AM HERE TO STAND WITH YOU Rabbi Leib Kelman Dean of Bnos Leah Prospect Park Yeshiva August 2022 � One of many such stories we hear every day from the 300,000+ patients who trust us with their care each year. M Y STORY: “My father su ered with ill health towards his later years and was a “regular” in Maimonides… I witnessed the consideration the sta displayed in very high-stress situations. And yes - it has been crowded, especially during the height of Covid, but we always were seen, treated, and given respect. A while later, when I was the emergency patient, the quick and on-point diagnosis of the ER doctor had me set up in an OR immediately… The cardiac sta from the surgeons to the nurses are recognized as top in the field for good reason… They are truly outstanding!”

“Uncle Michoel, I’m getting the key, Aokay?”male voice murmured something, and right after that, the intercom kicked in. Martin smiled, expectantly. The voice message should work as normal. The night before, half an hour after Shabbos ended, the timer went back to its normal setting, and all the systems began to work on their weekday schedule. Mr. Perl sure had a religious house. “Good morning. Who is it?”

“Sorry, I can’t come to the door.”

THE BUBBLE only the candlesticks that she had remembered about on Shabbos. He’d often been right, and she didn’t like that. Even after Shmuel had passed away, and Michoel would land in her house every so often with no advance notice, he’d always have comments, some of them justified.

Michoel always knew what was important and what wasn’t, what was appropriate and what was bad. On the rare occasion, he’d offered her money, but each time she’d refused to take it. At first, she still had a parttime job as a secretary for the Haifa Municipality, but a year after Shmuel’s passing, there were layoffs, and she found herself unemployed.

“Just for a few minutes, Michoel. We won’t bother you for long, really!”

“I’m sorry, I can’t speak to you right now.” Michoel’s voice sounded very matter-of-fact, as if he wasn’t refusing to welcome his niece and her husband who had traveled all the way to his house from Haifa. “If you don’t mind, try to come back in another week.”

Initially, she didn’t worry. The months after Shmuel’s passing were hard, and dealing with the children was so complex that she’d been happy not to have the added burden of working out of the house. A month later, Michoel had come with a job offer, and she knew she’d have to accept it. Her empty bank account and wallet— not metaphorically empty, literally empty – made that very clear. She’d agreed to work for his organization and was happy with the work. It was a noble job, in her view, and she could adapt the hours to her own schedule. And then Michoel had uttered the most insulting sentence she’d ever heard from another person… “Hinda? We’re here at the German Colony. Can you direct me to your uncle’s house?” Dov asked as he stopped at a right light. “Sure.” Hinda shook off the thoughts.

Hinda looked at Dov, hurt. Michoel was going too far, by all accounts. She wasn’t one to be easily offended, but now she felt awful, for herself and for her husband. Apparently, Michoel had something against Dov. She should have realized that when he didn’t come to the wedding. It wasn’t clear what his reason was, and it did not change the unpleasant reality: Her – dear – uncle – could – not –stand – her – new – husband.

“Uncle Michoel, it’s Hinda! We came from Haifa, Dov and I. I wanted—”

“What?” Hinda gaped at the door. “He’s probably talking to me, not

Someone was knocking at the door. He bit his lips and hurried to the staircase, ready to make a hasty escape upstairs. The visitor continued to “Uncleknock.Michoel? Uncle Michoel, are you Martinhome?”was quiet. Now they were trying to open the door. Which was locked, obviously.

“Continue straight here, and at the next intersection make a left.” He followed her directions, and less than five minutes later, he was parking in front of Uncle Michoel’s house. Michoel’s car was not there, and Hinda began to worry that they’d made the effort for naught, despite her having informed him of their visit. Michoel was a special person, and very kindhearted, but his manners left what to be desired. Was it possible that he didn’t like her new husband so much that he’d decided to cut off contact with her and her family? It didn’t make sense.*** Martin returned the two candlesticks to the china closet, trying to position them more or less where they had been before Shabbos, near the menorah. Grandma had never lit a menorah, but they’d lit one in the dorm this year, and one of the staff members had explained a bit about the occupation of the land by the Greeks. He didn’t remember the whole story; he’d always been better at computers than history. But there’d been a victory, and the weak Jews had managed to defeat the foreign Heinvaders.gently closed the glass door. He was thinking about defeat versus victory, and the fact that he’d always excelled at computer sciences, and that maybe it was time to crack the access code that was preventing the computer from connecting with the outside world. Otherwise, he’d need to speak with Dan by phone. And that would be terrible. Perhaps one day he’d sneak outside and purchase a prepaid phone, with no identifying markers. Then he would be able to switch to telephone communication… Rap, rap, rap.

“You can’t let Avigdor wear those pants. They’re too small on him.” Or, “What, you have an appointment for the well-baby clinic and you didn’t go? It’s important for the baby’s development, isn’t it?” Or another time: “They eat too much candy, your children, and I also notice that they are not good about brushing their teeth. Hinda! Do you want them to grow up to be neglected orphans? I won’t let that happen!”

OUTSIDE

Email: sales@tristateawnings.com www tristateawnings.com www.theinstantsukkah.com 845-357-5718 Serving New York, New Jersey, Pennsylvania, Chicago and Connecticut metropolitan area.

“Do you mean dementia, chalilah, or something like that?”

“No. Just go!”

Hinda looked at the empty windowsill for another moment, and then turned around in a near run and dashed back to the front of the house. She ran up the stairs in a way that Dov, who

“About what?” she asked, walking briskly across the sand. “I am collecting the donations as normal, the bank account is being managed perfectly, and the receipts are in order. I did nothing unusual.”

“Should…should I pay you for the broken intercom?” Dov bent closer.

“He is devoted to your children, right?” Dov asked. “That’s right.” She stopped in front of the last window, which was very dusty. “Maybe“Why?”something about Yosef’s visit last week irritated him?”

“It doesn’t matter.” The intercom was croaking more and more with every passing moment, until it seemed ready to fall silent forever. “When I want to see you, I’ll call you.”

OUTSIDE THE BUBBLE you,” Dov said in a low voice. He bent toward the intercom. “Mr. Perl! I’m leaving, okay? Only Hinda will come in. I’ll stay in the car. Feel good and—”

“He’s not alright,” Dov said quietly. “Something happened to him, that is clear. Not that I know him personally, but from your stories about him, this is not the same man.” “Not at all.” “I’m afraid that something bad is happening to him.”

“Have a good day.”

“Maybe,” Dov affirmed. “Where’s the key you were talking about? Is it a key to the house?”

“Uncle Michoel, I’m sorry, but this is not okay,” Hinda said, and then caught herself. She would let her feelings of humiliation overwhelm her afterward; now she had to deal with this very unpleasant situation. “I ask that you open the door for us. It’s going to be a very short visit. I want to make sure you’re alright; we haven’t seen you in a long time, and you still don’t know “IDov.”ask that you don’t leave anything at the door.” “I have no intentions of leaving anything here,” Hinda said calmly. “But I ask that you allow us to come in. I think you were the one who once noted to my children that they were not well-mannered enough…”

“It’s not like him to behave this way, not like him at all! You know they say that sometimes people begin to suspect their own relatives of stealing or deceiving them, or of wanting to do something bad to them…? Do you think that’s why Michoel doesn’t want to see us? A dull voice suddenly sounded from the metal rectangle, replacing the strange beeps. “It’s not about that at all.” It was a staccato sound, and the words were cut off, but they could still understand what he was saying. “And your wild pressing of the buttons has ruined my intercom! I’m young, and I don’t have dementia. I just don’t want you to come to my house now, okay?”

“I’m very sorry, Uncle Michoel,” Hinda said. She shook her head decisively even though she knew he did not see her from inside his closed house. “But you will please open the door for me. I’m worried about you, and I’m not planning to leave this way.” Dov was quiet. He already had one foot on the bottom step. “I’m going again to look for the key,” she said to him. “You’re right, Dov; this is not his normal behavior.” Dov followed her. “Maybe he really is angry about something?”

“I’m afraid this is the beginning of a process that is not a good one, whether it’s aging or something else.” She leaned on the door, exhausted.

“There really was something funny there,” she said, as she felt around in the place where the key should have “Orbeen.maybe he’s angry about your estrangement from Mali. Maybe he thinks I’m to blame in some way.” Her hand, fumbling around on the windowsill, froze in midair. “The estrangement is hers, not mine. And it’s been going on for more than half a year already. It has nothing to do with “Theyou.” question is how Mali presents it, “Thatthough.”really is a question…” Hinda didn’t trust her hand anymore, and she bent to look at the windowsill more closely. “The biggest question right now is where the key is, because it’s not “Maybehere.”your uncle took it, because he didn’t want you to come inside.”

“B-b-but why not, Uncle Michoel?”

“I am asking that you don’t leave anything near the door.” Hinda looked at the white speaker on the wall. The blue light went off. She turned and looked at Dov, with myriad questions marks in her eyes.

“It’s in one of the back windows. I’ll go get “Great,”it.” Dov said. He raised his head, squinting in the late morning sunshine. It was a nice house; he liked the eastern style. He wondered how it looked inside. Hinda returned, puzzled. “The key isn’t there,” she said. “But Yosef told me that he put it in its place after his last visit.” She pressed her hand to her forehead. “Uncle Michoel!” She began to pound forcefully on the door, and twisted the knob repeatedly. “Uncle Michoel!” Now she pressed the bell of the intercom repeatedly, a whole bunch of times, in a most uncharacteristic fashion. The device began emitting funny beeps.

- DROP 3AW 22 - IN STORES NOW -

“It’s always better to laugh, of course.”

“I know,” she said, and sobbed harder. Dov shook his head. It was the first time he was seeing his wife cry this way. “Yes, something here is very strange,” he said. “More than strange. “AndIt’s—” this crazy accusation about the money!” she all but gasped. “What do I “Fordo?”now, nothing. Let’s go to the Kosel, like we planned, and we’ll daven for everything. Then, when we get home, we’ll go over all the receipts and your lists, and we’ll see what’s going on there.”

Dovharassment.”shookhis

TO BE CONTINUED THE

OUTSIDE

And the names of your family members will be davened for every Erev Rosh Chodesh while reciting the ה"לשה תליפת at his Kever in הירבט UP AT FOR ONLY $18 A MONTH: 718.225.5824#5

“He thinks he found something,” Dov corrected her as he started the car.

“But does it make sense for him to react like this, even in such a case?”

“Then“No.” it doesn’t sound to me like this is the real problem. Now we are going to the Kosel, okay?”*** Martin quietly closed the doors to the electric box and passed a hand over his damp hair. That had not been pleasant. He didn’t think he would sound so…cruel. Poor people. He just hoped they wouldn’t call the police, but he should be on the alert, because they would surely come back. If he could have been more gentle, and not thrown that poor lady into such a traumatic state… He wondered if this was the “Hinda” from the email messages. Probably. And because she seemed to have a close relationship with Mr. Perl and this house, he had to keep her as far away as possible. When this whole crazy story was over, he’d find out her address and send her an apology letter.

“It’s not organized like your office, but it was always one hundred percent to Michoel’s satisfaction.” She shook her head. “I really don’t understand what is going on here. On the one hand, it seems like he’s going through some kind of medical crisis…but maybe he did find something that I did wrong?”

continued to trail behind her, could only describe as hysterical. “Uncle Michoel!” She pounded on the door, her eyes glistening. Someone on the sidewalk across the street stopped and stared at the scene with interest. “I“Michoel!”askedyou something,” the dull voice said. “Leave, both of you.” “Uncle Michoel!” She pressed again and again on the doorknob, her eyes, which were usually dry no matter what, dripping steadily. “If you don’t open up for me this minute, and I mean this minute, I’ll suspect that you were abducted, and an imposter is answering me in your place. And then I’m calling the police immediately!” No response. Maybe her uncle didn’t know how to handle his fifty-year-old niece’s uncharacteristic chutzpah. But after half a moment of shock, she heard him clearing his throat. “Wonderful. Okay, call the police— and I’ll file a complaint against you for head decisively. “This is not going to work,” he said, and descended the stairs. “Come on, Hinda, if he doesn’t want us, then we won’t force our way in. We need to think about what to do.” “But what’s wrong with him?” She was sobbing like a child, not caring about the open intercom. “What does he want from me? Is something wrong with the organization? With the Themoney?”intercom interjected. “That’s it, exactly,” it croaked. “The money. I discovered that you’re taking money from the…organization, for yourself. And don’t forget about what’s happening with…Mali. I should be filing a complaint on you! It’s only because I am your uncle that I’m not doing it. But if you stay here one more minute, I’m going to get sick of it all, and I will call the police.” Hinda stared at the door for one more minute. Then she turned around and went down the stairs. She walked to the car without another word, entered, and slammed the door behind her. “It must be a stroke, for sure,” she said hoarsely, out of breath. She groped around in the glove compartment for a package of tissues. “Something about the way he was talking seems off—did you notice? He stopped a few times to find a word…and he wasn’t always able to. Doesn’t he know that you file a complaint against someone, not on someone? He wasn’t talking like his regular self. And he also didn’t remember Mali’s name…oy, I don’t know if I should laugh or cry!”

BUBBLE

SIGN

105WeeklyLink.com $150per60minutesession Call me today to schedule your appointment and I will make sure that you have the best experience. YOU DESERVE A GOOD MASSAGE do you have any aches, pain, sore muscle or you just want to relax? WOMENONLY Reflexology, Deep Tissue or just a Relaxing Massage at our convenient location in the heart of Boropark, 1269 50th street Come and check it out for yourself! DEBBIE’S MASSAGES OFFERS Debbie, Frum licensed Massage Therapist To Book Call or 718-288-9924Text DEBBIE’S MASSAGES

106 AUG 31, 2022 Huge selection of beautifully Decorated Honey Bottles in all sizes, various shapes & designs customized to meet your needs. GREAT IDEA FOR: Yeshivos & Organizations, Simchas, Events, Your Supporters, Employees, Clients, Place Settings & Hostess Gifts, Gift Baskets, Guests & More. Place Your Order Now! Call: 718.913.9876 or Fax: 718.633.2037 www.BDDecorations.com • Email: elerner54@gmail.com GREAT NEWS FOR BAKERS Now Available! Edible Spray with a new metallic finish & Edible Luster Dust. Add color accent to cakes, cupcakes & cookies for a beautiful, shimmering look of: Gold, Silver or Pearl. Add your logo to anyof our Honey Bottles!SPECIAL DISCOUNTS! For our large selectionvisit our website www.BDDecorations.com

It’s back to school and back to early morning routine… Stock your freezer with these healthy treats for those days that breakfast ain’t happening. Even better, pack them up for your kids to enjoy as a nutritious snack.

GITTY NEUMAN

OATHEALTHYMUFFINS

INGREDIENTS: 2 cups instant oats 2 cups milk ¾ cup maple syrup or honey ½ cup oil 2 eggs 1 ½ cups flour 3 teaspoons baking powder ½ teaspoon baking soda 2 teaspoons cinnamon 2 teaspoons vanilla sugar ¼ teaspoon salt 1 cup craisins or chocolate chips

2. Add honey, oil and eggs and mix well. Then, add remaining ingredients and mix to 3.combine.Preheat oven to 350˚.

4. Fill muffin tins almost to the top with 5.batter.Bake for 20-25 minutes. The center of the muffin should be firm to the touch. Yield: 18-20 muffins

109WeeklyLink.com

FULL LINE OF SKIRTS IN STOCK Sk rt New Arrivals M O N A R C H M A T E R N I T Y 2 2 F W 2 2 F W 2 2 F W 2 2 E XCLUSIVE C OLLECTIO N 1402 43rd Street (718) 304 2234 Mon Tue 11:30 5:30 Wed Thu 11:30 2:30 MOM2B Down Jacket Collection Coming Soon!

1.DIRECTIONS:Combineoats and milk in a bowl. If using craisins, add them to the bowl as well. Let sit for 20-30 minutes. (If you are not using craisins 10 minutes will suffice.)

111WeeklyLink.com INGREDIENTS: 2 cups instant oats ½ cup flour ½ cup brown sugar ½ teaspoon baking soda ½ teaspoon vanilla sugar ½ teaspoon cinnamon ¼ teaspoon salt ½ cup oil ¼ cup honey Topping: 1 pack mini chocolate chips Craisins and mixed nuts 1.DIRECTIONS:Preheatovento 350˚. Line a 9x13 with parchment paper or grease well with oil spray. 2. Combine dry ingredients in a large bowl. Add oil and honey and mix well. 3. Press mixture firmly into the 9x13 pan (using wet hands). Bake for 20 minutes. 4. Lower heat to 300˚ and bake an additional 30 minutes. 5. Sprinkle a layer of chocolate chips over the granola. Return to oven for approximately 5 minutes to allow the chips to melt. 6. Use a spoon to spread melted chips over the granola. If necessary, drizzle a little oil over the chips to help them spread more smoothly. 7. Sprinkle with desired toppings. Any leftover chocolate chips can be melted and drizzled over the bars. 8. Freeze for 2 hours. Crack granola into Enjoypieces.the bark straight from the freezer. BARKGRANOLA 848 . 245 . 5077 WE PAY TOP $$$ FOR ALL YOUR JUNK CARS. FREE TOWING ANY YEAR, ANY MODEL DEAD OR WORKING SPECIAL HIGHER $ PAYOUT FOR NEWER MODEL CARS HANDYMANPROFESSIONALSERVICES • Electrical-outlets, switches, spotlights, etc. • Plumbing-hot water, washer/dryer installation, sinks/faucet replacements, we fix all toilets, also install & replace water filters. • Carpentry-walls/closets, shelving, sheetrocking, etc. • Shabbos locks & shabbos clocks. • Locks, plaster, painting, A/C window units. • Flooring, windows, we install shades. • Renovate basements & bathrooms. • Holes-we patch, fix & paint all holes SAME DAY! We fix everything like a PRO! Small or big job. Call: 718.951.0090

For bebes that know what’s good. (THEY GET IT FROM THEIR MAMA.) ELEVATED BABY FASHION + GIFTS STUDIO bebe kan g aro o (929) 930-0947bebekangaroo.com S H O P OUR STU NNING WE B S I T E

A meal replacement in every way; NatureMAX Energize™ satisfies your cravings for something delicious, satiates and fills you, and packs a punch of nutrition for your internal Onesystems.serving of NatureMAX Energize™ provides your body with every essential vitamin, mineral, and mainly, the protein calories that it needs. It delivers a mix of benefits stemming from amino acids, enzymes, and antioxidants, all components that contribute to your overall energy and health. Won’t you drink to that?

- Also available in soy and pea protein in vanilla, chocolate, and strawberry flavors. AMINOTHEACIDS IN YOUR ENERGYDRINKNATUREMAXPROVIDEANDASSISTTHEBODYINBURNINGFAT. e s a e s i d y n a e r u c r o t n e v e r p t a e r t e s o n g a d o t d e d n e t n t o n e r a s t c u d o r p e s e h T A D F e h t by d e t a u l a v e n e e b t o n e v a h s t n e m e t a t s e s e h T

IF YOU THINK DIETS DON’T WORK,

Sale Dates: August 31st - September 6th 2022 Fresh ProducePremium Meat & Poultry imported beefamerican beef $1399lb.1st Cut Brisket poultry CHICKEN THIGHS Family Pack $299 lb. Pepper Steak Boneless Flanken $1499lb. ................... $229lb. $1049lb. Chicken Drumsticks Family Pack $339lb. Shoulder London Broil Chicken Wings Family Pack ................... $1099lb. Silver Tip Roast $1099lb. BONELESS RIB EYE STEAK $1299 lb. ................... Beef Stew Family Pack $799lb. Chicken Breast $319lb. Mediterranean Beef or Lamb Kabobs $1449lb. Thin Sliced Chicken Bones $139lb. ................... Nature Sweet Cherub Grape Tomatoes 10 oz 2/$5 Grape Tomatoes 2/$4 Corn on the Cob 4/$2 Hass Avocado 5/$5seasoned ready to bake or grill ................... Seasoned Beef or Chicken Patties $949lb. Seasoned Spatchcock Chicken $549lb. All Varieties Beef Deckel Roast ................... $1099lb. Family Pack No Wing Rib Steak Family Pack $1199lb. Boneless Rib Eye Roast ................... $1199lb. Sweet Potatoes 69 ¢ lb. Red or Black Plout $299lb.BreadedTilapia$ 699lb. SHOP ONLINE GOURMETGLATTONLINE.COM!AT sunday monday & tuesday until 2 pm; wednesday & thursday until 5 pm; friday until 11 am ONLINE STORE HOURS SUNDAY, MONDAY & TUESDAY NO MINIMUM PURCHASE FOR ONLINE ORDERS WITH PROCESSING FEE WEDNESDAY, THURSDAY & FRIDAY Small Salt & Pepper Kugel $299 Classic Tomato Dip $199 Jalapeno Deluxe Dip $199 Gourmet Creamy Olive Dip $199 Super Deals! SIM NsaysO NOBODYGOURMET!BEATS GETNON-SALEAUGUSTWEDNESDAY,31ONLY6PM-11PMSPEND$150ONITEMS&A$10GIFTCARDFREE! SPENDSEPTEMBERTHURSDAY,1ONLY6PM-11PM$150ONNON-SALEITEMS&GET19X13POTATOKUGELFREE!limit 1 PER CUSTOMER Gourmet Glatt Deli limit 1 PER CUSTOMER Call us: 718-437-3000 | 1274 39th Street, Brooklyn, NY 11218 | www.gourmetglattmarket.com STORE HOURS: SUNDAY 9 AM-8 PM | MONDAY 8 AM-8 PM | TUESDAY 8 AM-8 PM | WEDNESDAY 8 AM-11 PM | THURSDAY 7:30 AM-12 AM | FRIDAY 7:30 AM - 2 HRS BEFORE SHABBOS NEW! ................... Sandwich Steak $1199lb. ................... Seasoned Beef or Chicken Sliders $999lb. All Varieties seasoned ready to bake or grill FlounderFresh$ 1399lb.

Sale Dates: August 31st - September 6th 2022 Call us: 718-437-3000 | 1274 39th Street, Brooklyn, NY 11218 | www.gourmetglattmarket.com While supplies last. We reserve the right to limit quantities. No rain checks. Not responsible for typographical errors. Weekly Sales NO MINIMUM PURCHASE ON SALE ITEMS! Welcome Back Super Sales! Pereg Organic White Quinoa 16 oz $339 Broadway J2 Pizza 8 Slice $799 Pro Grade Latex Gloves All Sizes - 100 Pack $379 Beit Hashita 18-25 Cucumbers in Brine 18.3 oz $199 Glick’s All Purpose Flour 5 lb $299 Jet Foil 9 x 13 Half Size Deep Pans 10 Pack $359 Kedem Crunchee Cereal Bars Assorted - 4.8 oz $299 Norman’s Whipped Cream Cheese 8 oz $249 Quaker Oats Old Fashioned or Quick 42 oz $359 Simply Lev Canola Oil 96 oz $779 Post Cocoa & Fruity Pebbles 11 oz $299 Mr. Clean Summer Citrus 128 oz $699 Silktouch Napkins 500 Pack $259 Ha’olam MuensterSliced 6 oz $269 Pardes Broccoli Florets 24 oz $499 Shibolim Whole Wheat K’nockers All Varieties - 6 oz $199 Glick’s Mayonnaise Regular or Light 32 oz $429 Kedem Grape Juice Regular or Light 64 oz $399 Wyler’s Italian Ices Assorted - 70 Pack $799 Mehadrin Family Pack LebenChocolate 12 Pack $1099 Palmolive Dish Soap Original Only - 28 oz $219 Heinz Ketchup 38 oz $349 Lieber’s DaintiesStripedCookies 10.2 oz $159 Tide DetergentLiquid Original Only - 165 oz $1999 limit 3 Green Ribbon Cauli ower Florets 32 oz $499 Givat Cottage Cheese Assorted - 16 oz $299 Simply Lev Pearl Barley 16 oz 89¢ Gefen Applesauce Natural Only - 46 oz $319 Quaker Life Cereal Original or Cinnamon 13 oz $299 Plastico Drawstring Trash Bags 90 Pack $1399 limit 6 limit 4 limit 4 limit 4 limit 2 limit 4 limit 4 limit 4limit 4 limit 4 limit 4 limit 4 limit 6 limit 6 limit 3 limit 6 limit 6 limit 3 limit 12 limit 6 limit 6 limit 8 limit 2 limit 4 limit 2 limit 4 limit 6 B & B Cour Cream & Onion Crackers (Nish Nosh) 10.6 oz $319 Norman’s Taste Yogurts Assorted - oz 45¢ Flaum’s Sour Pickles 28 oz $299 B & G Kosher Dill Gherkins 32 oz $259 Mazon G Chunk Lite Tuna in Water 6 oz 99¢ Windex Re ll 128 oz $649 limit 3 Poland Spring Sports Cap Water 24 Pack $699 Super Sip 7 oz Plastic Cups 100 Pack $1199 Be’er Mayim Seltzer 1 Liter $599 Kleenex 100 Count Tissues 16 Pack $1399 Servings 9 Inch Plastic Plates 100 Pack $1399 Case Super Sales! limit 2 limit 2 limit 2 limit 2 limit 2 limit 3 Plenty Paper Towels 15 Pack $1199 STORE HOURS: SUNDAY 9 AM-8 PM | MONDAY 8 AM-8 PM | TUESDAY 8 AM-8 PM | WEDNESDAY 8 AM-11 PM | THURSDAY 7:30 AM-12 AM | FRIDAY 7:30 AM - 2 HRS BEFORE SHABBOS

116 AUG 31, 2022 Call us: 718-437-3000 | 1274 39th Street, Brooklyn, NY 11218 | www.gourmetglattmarket.com WELCOME BACK SUPER SPECIALS! WE DELIVER TO YOUR HOME OR OFFICE! To Order 347-425-2710 email: deli@gourmetglattbrooklyn.comCURBSIDEAVAILABLE!PICK-UP MEAT SANDWICH BAR BEEF BURGER & FRENCH FRIES 2 HOT SHWARMADOGSPITA & FRENCH BABYPASTRAMIPERSONALFRIESPIEPIZZACHICKENPITA GRILLEDTACOSPULLEDBAGUETTESCHNITZELBEEFSALAMI & OMELETTE ON PITA $699 $699 $999 $699 $500 GRILLED CHICKEN SALAD & CAN SODA$599 $599 $799 $999 MEAT DELI STORE HOURS: SUNDAY 9 AM-8 PM | MONDAY 8 AM-8 PM | TUESDAY 8 AM-8 PM | WEDNESDAY 8 AM-11 PM | THURSDAY 7:30 AM-12 AM | FRIDAY 7:30 AM - 2 HRS BEFORE SHABBOS

117WeeklyLink.com Call us: 718-437-3000 | 1274 39th Street, Brooklyn, NY 11218 | www.gourmetglattmarket.com WELCOME BACK SUPER SPECIALS! WE DELIVER TO YOUR HOME OR OFFICE!To Order 347-425-2710 email: SANDWICH$2.99deli@gourmetglattbrooklyn.comCURBSIDEPICK-UPAVAILABLE!SPECIALS Omelette Sandwich Tuna Sandwich Egg Salad Sandwich Hard Boiled Sandwich Falafel AmericanSourdoughSandwichToastCheeseSandwichCreamCheeseSandwich SUPER$5.00SPECIALS Breakfast BreakfastPersonalShakshukaPlatePieTacoCheesePanini $1.00 12 OZ DRINKS Hot Co ee Iced Co Lemonadeee STOP BY FOR BREAKFAST, LUNCH OR DINNER! STORE HOURS: SUNDAY 9 AM-8 PM | MONDAY 8 AM-8 PM | TUESDAY 8 AM-8 PM | WEDNESDAY 8 AM-11 PM | THURSDAY 7:30 AM-12 AM | FRIDAY 7:30 AM - 2 HRS BEFORE SHABBOS

119WeeklyLink.com www.theteklink.com NEEDWHENSUPPORTYOUIT.

Shaindy Oberlander, BS, INHC is a certified integrative nutrition health coach in private practice in Lakewood NJ, in addition to many virtual clients worldwide. Shaindy caters to teens/adults and creates customized lifestyle and food plans geared towards overall wellness/nutrition, weight loss and hormonal balancing. Shaindy has specific tracks for pregnant/nursing mothers, tracks for gut health and tracks geared towards common intestinal issues and that can be healed with proper nutrition. Follow Shaindy on Instagram at benefithealtprogram or visit her website @www.benefithealthprogram.com. Shaindy can be reached at 347.228.1198 for appointments and questions.

Having a piece of fruit may help satisfy sugar cravings for some people. Bananas, apples, and oranges work great. Opt for lower glycemic index fruits. Avoid artificial sweeteners. If you feel that artificial sweeteners trigger cravings for you, you might want to avoid Sleepthem. well. Getting proper, refreshing sleep is important for overall health and may help prevent cravings. Avoid certain triggers. Try to avoid specific activities or places that give you cravings, such as walking past a bakery that you love. A while ago you ran an article on sugar cravings which was great. I feel like I need more support in this area. Your guidance is appreciated.

Great question! A few pointers: Listen to your body. When being hit with a sugar craving, think! What is my body trying to tell Perhapsme?you are feeling tired? Perhaps you are feeling lonely? Perhaps you are actually hungry? Take the time to process why you might be craving, and instead of reaching for that piece of chocolate, give your body what it really Understandneeds.that sugar cravings lead to more sugar cravings.

AQ

BE FIT WITH BENEFIT

Have any nutrition questions? Send email to: benefit@weeklylink.com

When doctors studied brain scans of people that consumed a lot of sugar and compared them to the brain scans of people on heroin, the imaging looked eerily similar. Sugar can be an addictive drug. Sugar gives us that high by getting our blood sugar levels to spike but then it dips low shortly thereafter resulting in that sugar craving feeling once It’sagain.important to realize that a craving is not the same as hunger. It’s not your body calling for energy, it’s your brain calling for something that releases dopamine in the reward system. When you get a craving when you’re hungry, the feeling is difficult to resist. In fact, a craving combined with hunger is a powerful drive that most people have a hard time overcoming. If you get a craving while hungry, one of the best tricks is to eat a healthy meal immediately. Stock your kitchen with healthy snacks. Protein-rich foods, such as meat, fish, and eggs are especially good for curbing Somehunger.people who experience sugar cravings have found that hot showers or baths provided relief. The water must be hot — not so hot that you burn your skin but hot enough that it feels slightly uncomfortable. Stay there for at least 5–10 minutes. By the time you step out of the shower, your craving will most likely be gone. Another thing that can work, is to go outside for a brisk walk.

120 AUG 31, 2022

This serves a two-fold purpose. First, you are distancing yourself from the food that you are craving. Second, the exercise will release endorphins, or “feel good” chemicals in your brain, which can help turn the craving off. Drink a glass of water. Dehydration can cause Eatcravings.afruit.

INFO @ BENEFITHEALTHPROGRAM.COM • 347.228.1198 • BENEFITHEALTHPROGRAM.COM you neEd to be hEalthy in oRder to lOse Weight WEIGHTTEENLOSSTRACK PRENATALHEALTHTRACK NURSINGMOMTRACK HEALTHGUTTRACK HORMONEHEALTHTRACK WEIGHTLOSSTRACK LONGEVITYTRACK JOIN SHAINDY OBERLANDER, BS, INHC ON THE TRACK THAT IS RIGHT FOR YOU! WEIGHT LOSS IS A JOURNEY THAT NEEDS TO BE UNDERSTOOD. THERE IS NO ONE SIZE FITS ALL APPROACH. YOU DON'T HAVE TO NAVIGATE THIS INTRICATE JOURNEY ON OUR OWN. JOIN THE BENEFIT HEALTH MOVEMENT AND GET THE SUPPORT YOUR MIND AND BODY NEEDS.

122 GET NURSINGMEDELAYOUR HASSLE FREE: WE WILL GET THE RX FOR YOU! NEXT DAY DELIVERY Call or Text: 718.486.6164 34 Franklin Ave Suite 309 · Brooklyn, NY 11205 Tel 718.486.6164 fax@baronmedical.com·

20 22 CedarhurstBrooklynwww.shopmezzo.com500516thAvenue426CentralAvenue 718.871.9402

124 AUG 31, 2022 OPEN ON MOTZEI SHABBOS 45 E34th Street • TEL. 212.481.4222 Between Park & Madison Ave. (Two Blocks from Macy’s) FULL CREPE BAR! ןשי חמק • לארשי בלח • ידימת חיגשמ FINE ITALIAN DINING AT THE HEART OF NYC HOURS: 12pm to midnight • MotzeI shabbos UNTIL 1am CHOLOV YISROEL • FISH • APPETIZERS • • SOUPS • SALADS • • PANINIS • PASTA • • PIZZA • SUSHI • • FULL SMOOTHIE & MILK SHAKES BAR • • WINE & BEER

125WeeklyLink.com We offer the LOWest Insurance rates when switching to A thru Z DMV TITLESPLATESSERVICES•REGISTRATIONS•DEFENSIVECOURSEwww.dmv-services.comlocaldmv@gmail.com BORO PARK: 4021 14t h 718-686-1405Ave. WILLIAMSBURG: 310 Roebling Ave. 718-599-4747 KIRYAS YOEL: 1 Strelisk 845-782-1201Ct.

AT-A-GLANCE

• Use ceramic knives to prevent browning, ceramic pots and pans to avoid exposure to toxins and dangerous metals, glass food storage containers to avoid plastic chemicals, and separate cutting boards for meat and produce to prevent pathogenic cross-contamination

By a famed nutritionist: Eating well and taking care of your health is easier when you have the right ingredients and utensils on hand at all times. Following are some top essentials with which to stock your kitchen — healthy fats, medicinal and healthpromoting spices that can be added to a wide variety of dishes, and nontoxic utensils to avoid unnecessary exposures to toxins and harmful pathogens.

• Homemade bone broth speeds healing and recuperation from illness, promotes gut health, fights inflammation, supports joint health, promotes weight loss, and improves sleep and brain function

• Apple cider vinegar is rich in bioactive components that give it potent antioxidant, antimicrobial and many other beneficial properties

EssentialKitchen

126 AUG 31, 2022

• Healthy cooking oils and dietary fats to stock your kitchen with include coconut oil, grass fed butter, organic foods and extra-virgin olive oil

1. Healthy Fats and Cooking Oils

While dietary fats are an incredibly important part of a healthy diet, it's crucial to understand which are healthy and which are not. Processed industrial vegetable oils are best avoided at all times, as they're typically made with genetically engineered grains contaminated with glyphosate, and are prone to oxidation and produce dangerous byproducts when heated. Instead, stock your kitchen with the following healthy cooking oils and dietary fats:•Coconut oil — This is what I believe is the best cooking oil. It has a number of valuable health benefits, including a positive effect on your heart and antimicrobial properties. It's also a great source of energy, thanks to its mediumchain fatty acids (MCFAs). When consumed, the MCFAs are digested and converted by your liver into energy that you can immediately use. Coconut oil also helps stimulate your metabolism to encourage a healthy weight profile. As an added boon, coconut oil has countless other uses besides cooking and eating, from topical beauty applications to first aid treatments, to general household cleaning. Make sure you choose an organic coconut oil that is unrefined, unbleached, made without heat processing

• Top spices for flavor and medicinal properties include Himalayan salt, Indian long pepper, turmeric, cumin, ginger and mustard seed

127WeeklyLink.com Goldie Klein gkleinway@gmail.comFax:718.854.9406L.C.718.854.1885 ATTENTION NEW MOTHERS: Schedule a ATTENTIONconsultationlactationinyourhome.EXPECTANTMOTHERS:Bepreparedbeforebirthwithourcomprehensivenursingclass.FREEPUMPTHROUGHINSURANCESHIPPEDTOYOU. MONSEY 214 route 59 Airmont NY(845) 547-2299 MANHATTAN 73 West 47th Street (212) 810-9935 BROOKLYN5303 12th Ave. front bsmt.(718) 928-7569 ד"סב Have an estate to sell? TURN YOUR PRECIOUS METALS INTO CASH! WHAT WE BUY: • Silver • Jewelry • Diamonds • Watches THOUSANDS OF SATISFIED CLIENTS SINCE 2005. Upgrade your Silver Collection! WE OFFER THE BEST VALUE FOR TRADE-INS. YANKY YABLONSKY - YONASON SCHWARTZ Brooklyn 5303 12TH AVE. FRONT BSMT. (718) 928-7569 Manhattan 73 WEST (212)STREET47TH810-9935 Monsey 214 ROUTE 59 AIRMONT NY (845) 547-2299 Yaakov Skovronsky SLP Is Patients.NewAcceptingNow • Vocal Cord Nodules • Vocal Cord Cyst Vocal Cord Polyp Chronic Hoarseness • Articulation • Pre/Post Vocal Cord Surgery • Stuttering • Articulation • Vocal Cord Nodules • Vocal Cord Cyst • Vocal Cord Polyp • Chronic Hoarseness • Pre/post-surgeryvoicetherapy • Vocal Cord paralysis Boro Park - 1317 46th Street • 718-851-1464 Williamsburg - 531 Bedford Ave. • 929-509-2323

128 AUG 31, 2022 or•Grasschemicals.fed

Longer simmering times result in a more complete release of gelatin, minerals and other nutrients from the bones, which is key to realizing the many health-giving benefits and restorative properties this broth has to offer. Making your own bone broth is extremely cost effective, as you can make use of leftover carcass bones that would otherwise be thrown away.One important caveat when making broth, whether you're using chicken or beef, is to make sure they're from organically-raised, pastured or grassfed animals.

3. Apple Cider Vinegar

butter — Raw, organic butter made from healthy grass fed cows' milk contains many valuable nutrients, including vitamins A, D, E and K2, along with minerals and antioxidants that support good health. Recent research has also noted that organic grass fed dairy has a "near-perfect" balance of omega-3 and omega-6 fats, as well as higher amounts of conjugated linoleic acid (CLA), which can help reduce your cardiovascular and metabolic disease risks.•Organic ghee — Ghee, also known as clarified butter, differs from regular butter in that it has fewer dairy proteins, making it a better choice for those with lactose sensitivity or intolerance. Starting with pure butter made from cow's milk, the gheemaking process involves heating and separating liquid fats from the milk solids, which become caramelized, and removing the milk solids, which also removes most of the lactose.

Ghee is darker and has a nuttier flavor than butter, and with a higher smoke point, it's a healthier option for sautéing. It also has a longer shelf life, lasting for around six months in the refrigerator or up to a year in the freezer. Ghee has been used in traditional cooking in India, Pakistan and Southeast Asia for many years. It's also an Ayurvedic go-to for herbal ointments, massage and as a medicinal to remedy rashes and burns.•Olive oil — This oil contains healthy fatty acids that can help lower your risk of heart disease. While the standard recommendation has been to avoid using olive oil for cooking and to only use it cold, recent research in which 10 popular cooking oils were compared contradicts this advice, showing extra-virgin olive oil actually scored best for both oxidative stability and lack of harmful compounds produced when heated. A word of caution is warranted, however. Fake olive oil abounds, so it's important to take the time to investigate your sources. Tests in 2010 suggested that much of the olive oils sold in American grocery stores and restaurants were adulterated with cheap vegetable oils or nonhumangrade olive oils, which are harmful to health in a number of ways. While this was more than a decade ago, clearly you still need to read labels and look for key certifications that assure the oil is pure.

Traditionally, apple cider vinegar is made through a long, slow fermentation process that renders it rich in bioactive components like acetic acid, gallic acid, catechin, epicatechin, caffeic acid and more, giving it potent antioxidant, antimicrobial and many other beneficial"Mother"properties.ofvinegar, a cobweblike amino acid-based substance found in unprocessed, unfiltered vinegar, indicates your vinegar is of the best quality. Most manufacturers pasteurize and filter their vinegar to prevent the mother from forming, but the "murky" kind is actually best, especially if you're planning to consume it. With its wide variety of health benefits, a jug of raw, unfiltered apple cider vinegar is easily one of the most economical and versatile remedies around. I recommend keeping it in your home at all times. Some of the health benefits associated with apple cider vinegar consumption include: Blood sugar control — Vinegar is said to be antiglycemic and has a beneficial effect on your blood sugar, likely due to its acetic acid content, which prevents the complete digestion of complex carbohydrates. Another theory is that vinegar helps inactivate digestive enzymes that break down carbohydrates into sugar, thus slowing the conversion of complex carbohydrate into sugar, preventing a spike by giving you more time to pull sugar out of your blood.

2. Homemade Broth Homemade bone broth is excellent for speeding healing and recuperation from illness, as it helps "heal and seal" your gut. Physicians harkening as far back as Hippocrates have associated bone broth with gut healing.Italso helps fight inflammation, supports joint health, promotes weight loss, improves sleep and brain function, and is a good source of not only healthy fat but also many important vitamins and minerals, including:CalciumMagnesiumPhosphorousSiliconSulfurTracemineralsChondroitinsulphatesGlucosamineBonebroth,initssimplest form, is made using animal bones, vinegar and spices. It is simmered in a pot or slow cooker at least overnight, or as long as 24 to 72 hours.

129WeeklyLink.com Custom Made Protect your valuable furniture & dining room tables For Easy Shop at Home Service Call Ushi Steinmetz (917) 776-7371 TABLE PADS & GLASS TOPS new! MAGNETIC LOCKINGSYSTEM WE NOW OFFER CLEAR CHAIR & SOFA SLIPCOVERS USPS STAMPSFOREVERFORSALE Coil (roll) of 100 stamps or 48 ¢ A STAMP Please Text: Best way to contact is by text if no answer please leave VM or 565israel@gmail.comemail: "FREE347.921.1729SHIPPING" QUANTITIESFORDISCOUNTLARGE "Moms Favorite" Pump By

• 2 tablespoons water • 1 tablespoon raw honey • 1/4 teaspoon ground ginger

4. Himalayan Salt Salt is essential for life, and your body needs it for optimal function. But it's important to realize that there are major differences between the refined and highly processed salt found in processed foods and regular table salt, and unrefined natural salt such as Himalayan salt. The latter is important to many biological processes, including: Being a major component of your blood plasma, lymphatic fluid, extracellular fluid and even amniotic fluidCarrying nutrients into and out of your cells, and helping maintain your acid base Increasingbalancethe glial cells in your

Polyphenols such as chlorogenic acid help inhibit oxidation of LDL cholesterol,6 while acetic acid helps lower blood pressure.

Sinus congestion — Apple cider vinegar's ability to break up and reduce mucus in your body can help clear your sinuses. It also has antibacterial properties, making it useful for infections. Here's what to do:Directions1.Addone-half

• Optional: 1/4 teaspoon cayenne pepperDigestive ailments — Acid reflux typically results from a lack of stomach acid. You can easily improve the acid content of your stomach by taking 1 tablespoon of raw unfiltered apple cider vinegar in a large glass of water daily. The pectin in apple cider vinegar may also help to soothe intestinal spasms. For everyday gut health, a mixture of 2 teaspoons of apple cider vinegar with 1 teaspoon of raw honey in 1 cup of warm water canSkinhelp.irritations and warts — Apple cider vinegar also works for a variety of skin ailments, from bug bites and poison ivy to sunburn and even warts. You can either apply it directly to the irritated area or try soaking in a bath with about 1 cup of vinegar added. For warts, soak a cotton ball in vinegar and apply it to the wart, covered, overnight. Repeat until the wartEnergydisappears.boost—

There are studies supporting the use of vinegar as a diabetic treatment as well. One study found vinegar treatment improved insulin sensitivity in 19% of individuals with type 2 diabetes and 34% of those withHeartprediabetes.health—

130 AUG 31, 2022

•Ingredients1tablespoon apple cider vinegar

Apple cider vinegar contains potassium and enzymes to help banish fatigue. Plus, its amino acids may help prevent the buildup of lactic acid in your body, further preventing fatigue.

2. Using a neti pot, pour the mixture into one nostril at a time, while plugging the other nostril with the other hand. Sore throat — The antibacterial properties of apple cider vinegar may be useful for sore throats as well. Gargle with a mixture of about onethird cup of apple cider vinegar mixed with warm water as needed. Apple cider vinegar with honey and ginger for a sore throat is also a popular and effective remedy. Another mixture for sore throat, recommended by Bonnie K. McMillen, a nurse from the University of Pittsburgh, includes:

Detox and immune support — Studies have shown apple cider vinegar can be beneficial for liver detoxification and helps cleanse your lymphatic system, which can contribute to improved immune system response. According to The Truth About Cancer: "Cider vinegar was … determined to be a strong antimicrobial agent … One of the most fatal bacterium, Mycobacterium tuberculosis, is resistant to disinfectants but is found to be killed by acetic acid. Especially in patients who are immunosuppressed, apple cider vinegar is an excellent natural antimicrobial tonic to rid of harmful bacteria and provide immuneCandidasupport."—Candida overgrowth in your gut has been linked to many different health issues, including yeast infections, fatigue, poor memory, depression, headaches and sugarCandidacravings.overgrowth usually happens when your body is too acidic from excessive consumption of processed foods or sugar, or if there are insufficient healthy bacteria in your system. Because apple cider vinegar is fermented with a beneficial yeast, it can serve as a prebiotic for healthy bacteria, essentially helping good bacteria grow.

teaspoon to 1 teaspoon of apple cider vinegar to a cup of warm filtered water. Stir until thoroughly mixed.

Vinegar has also been shown to lower triglyceride levels and VLDL (very low density lipoprotein) cholesterol in animals.Weight management — Vinegar may aid weight loss by increasing satiety, another effect attributed to acetic acid. For instance, when volunteers consumed a small amount of vinegar along with a high-carb meal (a bagel and juice) they consumed less food for the remainder of the day. The reduction equated to about 200 to 275 calories a day — an amount that would result in a monthly weight loss of up to 1.5 pounds.

131WeeklyLink.com SUN-THURS 6am-7pm FRI until 2 Hrs. Before Shabbos Business & Personal Rentals We Rent to 18 Years & up Our Insurance covers the Box as well! CALL MEILICH 347-897-6021718-474-7200 LOWEST RENTAL PRICES & NEWEST TRUCK FLEET 76-02 Beach Channel Dr. Arverne, NY 11692 3 MILES FROM FLATBUSH AVE.WE BEAT ANY PRICE pick up your truck in n anywherey in the usaWE DO H AVE TRUCKS! Cargo Vans • Trucks 10’ to 26’ Refrigerator/Freezer Trucks 16’ or 26’ Flatbeds Trucks Gr eat Rat e Van & Truck Rentals Local &OneRentalway HI-TOP VAN

6. Medicinal Spices

I recommend using a hand-held mill for grinding fresh peppercorn, as whole peppercorns have an almost indefinite shelf life. Ground pepper only retains optimum freshness for about three months, and is sometimes "adulterated" with something other than black pepper. When cooking, use it at the last moment to retain the full flavor of the essential oils.

Turmeric has been on the proverbial "top 10 superfoods" list in Chinese medicine for millennia and just as long in the Indian Ayurvedic healing tradition.Onecomponent in turmeric, curcumin, has been proven so effective as an anti-inflammatory that it's compared to prescription medications, without the toxic side effects such as ulcer formation, internal bleeding and a lowered white blood cell count. Its ability to cross the blood-brain barrier also makes it a valuable agent against dementia Alzheimer's.Antioxidants in turmeric also neutralize free radicals throughout your body, including your brain, kidney, liver, heart and gastrointestinal tract. In addition, curcumin has been shown to induce expression of phase II antioxidant enzymes, thereby aiding glutathione synthesis, which is important for detoxification.

•Ginger — Ginger has been used for millennia in areas of India and China for much more than adding a sweet/ spicy flavor to foods and drinks. It's proved over time to be a popular remedy to soothe away headaches, nausea — particularly motion sickness — and to treat several problems related to digestive health as well as pain and inflammation from arthritic conditions, to mention but a Morefew.recently, research shows ginger is a viable antidote and protective agent against fatal poisoning from such agents as pesticides, environmental pollutants, heavy metals, bacterial and fungal toxins and even some cosmetic products and medications.

Supporting the function of your adrenal glands, which produce dozens of vital hormones

While virtually all spices have medicinal qualities of some kind, the following stand out among the crowd:•Turmeric — The reasons to make turmeric part of your life (if it isn't already) are almost too numerous to count, especially when you consider its incredible restorative, diseasehealing and preventive capabilities.

•Cumin — Cumin is the second most popular spice in the world, second only to black pepper, and is considered by many "the secret sauce" in most savory dishes. Cumin seeds have been prized for many

Frontier organic black pepper is a tasty choice. Another, which is my personal preference, is Indian long pepper which, as so eloquently described by Serious Eats has a flavor that"[M]uchis: more complex than black pepper, reminiscent of spice blends like garam masala more than a single spice. It possesses black pepper's heat and musk, but in a less harsh, more nuanced way, tempered by sweet notes of nutmeg, cinnamon and cardamom. Its finish lingers on the tongue with a tobacco-like coolness; where black pepper stings, long pepper balms."

On hot days, or after exercising and sweating profusely, you can make a wholesome sports drink to replenish lost electrolytes and minerals by mixing a pinch of Himalayan salt and a dash of fresh lemon juice in a glass of water. Apart from culinary purposes, Himalayan salt can also be substituted for bath salts, which will allow your skin to absorb valuable minerals from the water.

Black pepper is another key staple few households would want to do without, and, like most spices, it has medicinal qualities that gives it value far beyond mere flavor. For example, Europeans have used black pepper for thousands of years in traditional medicine to treat inflammation and digestive problems. Its effectiveness is due in part to a compound known as piperine. Research suggest piperine's ability to inhibit new fat cells from forming, known as adipogenesis, helps reduce waist size and body fat, and optimizes cholesterol levels. Perhaps more importantly, research has shown growth of several types of pathogens are inhibited by black pepper, including Staph, E. coli, Helicobacter pylori (bacteria known to cause ulcers), and parasites. So, black pepper not only may have anti-inflammatory, antioxidant, antibacterial and fever-reducing actions, but immune systemenhancing properties as well.

132 AUG 31, 2022 brain, which are responsible for creative thinking and long-term planning. Both sodium and chloride are also necessary for the firing of neuronsMaintain and help regulate blood pressureHelping your brain communicate with your muscles, so that you can move on demand via sodiumpotassium ion exchange

While natural sea salt used to be a healthy source of salt, I shy away from it these days, as recent tests reveal 90% of sea salt is contaminated with microplastics. Himalayan salt is not plagued by this contamination.

5. Black Pepper

BATHiNG SHOWERiNG& in HALACHAH

Chasunah Secrets TheRevealedMysteries

Do you know why a kallahflowers?carries Or what kind of candle should be used when walking a chassan or kallah down the aisle? Or the importance of the type of veil worn by the kallah?

2VolumeSequel1Volume NEXTSERIES!NEWLEVEL-Two-Volumes!

By Rabbi Yisroel Moshe Sorotzkin Shabbos, Yom Tov, the Nine Days, and more. May one shower before davening? Is a hot shower permitted on Yom Tov? Is a cold shower permitted on Shabbos? Under what conditions may one shower during the Nine Days? May a shower be used as a substitute for Tevilas Ezra? This comprehensive sefer covers all angles of this fascinating and wide-ranging topic. Each chapter builds an elaborate edifice about the specific topic it discusses, beginning with the Gemara and Rishonim and ending with the most recent works of contemporary Poskim. All of this is presented coherently, providing the reader clear halachic guidance as well as a basic understanding of the fundamental sugya. Extensive footnotes and appendices are provided for the more scholarly reader. By Rabbi Menachem M. Abramson

NEW!NEW! NEW! NEW! www.israelbookshoppublications.com P: 732.901.3009 Tfutza Publications: 02.650.9400 Lehmanns: 0191.430.0333

BY AUTHORSAME When the Kiddie Kohns get heated up and begin to shout at each other, something interesting and not very fun happens... By Aliza Methal, BCBA Youngsters will delight in the fun repetition and rhymes as Mommy teaches Little Leah an important safety concept. By S. Kaufman

This book, which provides a glimpse into the traditions done at a Jewish wedding and the deep meanings behind them, is a wonderful tool to help chassanim, kallahs, and their families appreciate the value of each detail of the big event. By Rabbi Dovid Meisels

Current events within the process of the Geulah through the lens of Chazal. "Several years ago, shortly before publishing my first sefarim, entitled Keitz Meguleh, I had the zechus to bring a copy of the manuscript to Maran Rav Chaim Kanievsky zt"l. Before I even handed it to Rav Chaim, he said to me, 'Ihr vaist az mir halt shoin bei der Keitz Megulah? Do you Know that we are already at the Keitz Megulah? '" -excerpt from Chapter 28, The End Illuminated. What exactly is the Keitz Megulah (lit. Revealed or Illuminated End) and what did Rav Chaim mean when he said that we're already "at the Keitz Megulah "?

Disclaimer: The information in this article does not constitute medical advice and is not intended to be a substitute for proper medical care provided by a physician.

7. Essential Kitchen Tools

The Weekly Link assumes no responsibility for any circumstance arising out of the use, misuse, interpretation or application of information in this article.

years and are best known in their ground form as a spice added to curry dishes.Research reveals cumin helps stimulate secretion of pancreatic enzymes, which are necessary for proper digestion and nutrient assimilation. Cumin also has anticancer and antidiabetes properties, attributed to its active components, including terpens, phenols and flavonoids.

The enzyme myrosinase is critical for the conversion of glucosinolates into chemoprotective compounds known as isothiocyanates. While all cruciferous veggies contain some myrosinase, you significantly boost conversion by eating them together with a particularly myrosinase-rich food such as mustard seed powder.

Mustard seed powder can also be used to whip up homemade topical remedies, such as plasters and baths to relieve pain. Part of the painrelieving effect is due to the mustard seed's high magnesium and selenium content. In Ayurvedic medicine, it was used topically to improve blood circulation and detoxification. Taken internally, 1 teaspoon of mustard seed powder twice a day can be used as a remedy for constipation.

Lastly, the type of kitchen utensils you use during preparation and cooking can also have an effect on your health, for better or worse. To protect and support the health of your entire family, consider the following tips:

134 AUG 31, 2022

•Mustard seed — Mustard seed which, like broccoli, belongs to the brassica genus, contains compounds that inhibit cancer proliferation and metastasis. It also contains myrosinase — a compound that augments the cancer-fighting potential of other cruciferous veggies, delivering a double-punch when combined.

•Use ceramic knives for fastbrowning produce — Ceramic knives are chemically inert, and said to slow the browning process. Ceramic blades are best for slicing fruit, vegetables and boneless meat, but not frozen foods, meat with bones or cheese (because of its tendency to stick). Also avoid using a ceramic blade to crush foods like garlic.

•Switch to ceramic or other inert, nontoxic cookware — The slippery surfaces of nonstick pots and pans comes courtesy of poly- and perfluoroalkyl substances (PFAS), which the U.S. Environmental Protection Agency has found to be likelyWhencarcinogens.heated,nonstick cookware and bakeware release a related chemical, perfluorooctanoic acid (PFOA), linked to thyroid disease, infertility, organ damage, and developmental and reproductive problems in lab animals. Hazardous toxins are produced after only two to five minutes of heating the pan. At 464 degrees Fahrenheit, the coating on nonstick cookware begins to break down and release toxins into the air. Stainless steel, aluminum and cast iron pans also have their drawbacks, as the metals may not be entirely inert, resulting in potentially toxic metal exposure.Ceramic cookware circumvents all of these problems. A true ceramic pan or dish will be made only with water and inorganic materials and minerals from the earth's crust. Because it doesn't contain any metals, a ceramic pan is nonreactive and nontoxic. No odors or gases release into the air even when heated to extremely high temperatures.•Useglass containers for food storage — If you're still using plastic containers, bags and plastic wrap for food storage, consider switching to glassDependingcontainers.on what product you're using, your plastic might contain phthalates, bisphenol-A, bisphenol-S — endocrine-disrupting chemicals that are causing PVC and styrene, two carcinogens and more. Virtually all plastic chemicals carry some risk to health and are best avoided as much as possible, especially if you have children. Glass is completely inert and reusable indefinitely, provided it doesn't break, in which case it's recyclable.

• Use separate cutting boards for meat and veggies — Kitchens are notorious breeding grounds for disease-causing bacteria, courtesy of contaminated meat products, including antibiotic-resistant strains of E. coli. To avoid cross-contamination between foods, use a designated cutting board, preferably wood, not plastic, for raw meat and poultry, and never use this board for other food preparation, such as cutting up vegetables. Color coding your cutting boards is a simple way to distinguish between them.

In fact, cumin has been found to work better than the antidiabetes drug glibenclamide in treating diabetic rats and similar benefits were found in a human study.

bathroom,

135WeeklyLink.com Schick Rokeach Realty LICENSED REAL ESTATE BROKERS P: 718.258.4965 F: 718.377.5867 C: 917.903.7165 E: SchickRokeach@gmail.com Boro Park grt blk, 1 fam, detached, 5 beds, 4 baths, patio, central air, finished bsmt, for a lux buyer Boro Park 1st offering 2 fam 40x100 R6 zoning for a luxury buyer E 20's great block, 1 fam, side hall, 6 beds, 4 baths, won't last, price to sell E 20's Great block, 1 fam, detached, 47/100, Center Hall 5 bdrms, 5 baths , finished bsmnt, central air, price to sell E 20's First offering. 2 fam, 37.5 x 100, inside 22x52, detached, priv drvwy, 1st flr 2 bdrms, 2nd flr 3 bdrms, 2 bdrms in basement, excellent condition, asking 1.55. Must see! E 20's 1st offering 2 fam 50x 100 5 BDR, 4 baths, plus 2 incomes won't last. E 20's prime blk 1 fam 53/100 c/h 6 beds, 5 baths, den, mic E 20's Great blk 1 fam 40/100 approved plans available E 20's 70/100 c/h 5 beds priced right E 20's 80/100 approved plans avail for lux home HOUSES FOR SALE Ocean Parkway lux build 3 beds, 2 baths, mic priced right E 17's totally renovated 2 beds, 2 baths, patio, priced right E 20's lux bldg 5 beds, 4 baths, den, patio, doorman, pool E 20's 2 beds, patio, den, priced right CO-OP FOR SALE E 20's lux build 3 beds 2 baths, patio, priced right wont last change E 20's lux bldg. 2 beds. 2 baths. priced rights, won’t last CO-OP FOR RENT E 7th street, great block, 5 BDR, 2 baths, fin bsmt MIC.for luxury tenant. APARTMENT FOR RENT

apt.

19th Ave and 62nd St, for rent, approx 1200 sf very spacious 3 bedroom 1 lots Heat

included.

Behind everygreat deal, is agreat realtor. ostprorealty.com For the past few years we have been smoothening the process of buying and selling real estate in Brooklyn NY. With just one click to our website you can now easily view and inquire about our listings shown on the website. Sign up to our WhatsApp status and to our Email blast for exclusive deals Ostpro Realty David Ostreicher Call | 718.500.3445 631.829.2430 | Ostprorealty@gmail.com Looking for a good deal?

19th Ave and 59th St Beautiful gut renovated 2 bedroom apt for rent, new kitchen, NO painting and scraping needed. $2500 12th Ave and 46th St Luxury 2 bdrm apt for rent ideal for Chussen/Kallah. (No dining room) Large dinette, move right in. $1900 NY SKYVIEW REALTY 718 682 3660 EXT 202 House / Condo For Sale BP-11th & 43rd, 2 fam, semi-det, brick, finished bsmt, good cond, delivered vacant, R6 zoning, 20x100 lot size, 19x75 built, asking $1,7m. Call/Text Isaac Shmedra718-853-0202Landau: House / Condo For Sale BP-20th & 62nd, 4 fam, brk, sem idet, delivered vacant, 25x100 lot, 20x75 built, fin bsmt, w/sep ent needs some work, $1.899m. Call/Text Isaac Shmedra718-853-0202Landau: House / Condo For Sale BP-63rd / 21st Ave, 2 fam, semi-det, good cond, parking, fin bsmt w/ sep ent, nice backyard, 23x100 lot, 20x36 built, $1,4m. Call/Text Isaac Shmedra718-853-0202Landau: House / Condo For Sale Dahill Rd & 60th, 2 fam, semi-det, good cond, parking, 22x100 lot Sz, 16x68 built, delivered vacant, asking $1,299. Call/Text Isaac Shmedra718-853-0202Landau:

of closet, large deck.

MOVE-IN CONDITION HOUSE FOR SALE 11/50's 1 fam brk 20x50 on 20x100 lot ~ 1st flr: DR, kit, bth, office, porch 2nd flr: 4brs, 2 bths (1 in mstr), porch Bsmt: plyrm, bth, storage. Ask $2.2mil email lease.delivered13/57718-256-9595ERETZsloevy@eretzltd.comREALTYext139–NewExclusive8140SfvacantR5-C23zoning,multipurposeusecanbegreatforshul/office/multifametc..Nrtransp.Wontlastat$4mil.16/60s5500sfofficespacefor3rdflr+rooftop.Only$25/sfERETZREALTY718-256-9595ext12217/47Corner2fam+finbsmtapt&pvtparking&gar.CALL New on the market 13/36th st 4-Fam brk s.d. Lot 24x79, Hse 19x68 RR $4,400 MTM Ask Kensington$1.6milLux1fam det. On 40x100 lot. 5 bdrms, pvt parking. Brand new almost done. Only 917-648-6303Forzoningbuilt20/60th718-256-9595ERETZ$1,995,000REALTYext1224fambrks.d.25x7730x100LotAsk$2.3milMid40's16Ave2fambrkR6NeedsworkAsk$1.9mmmoredetailspleasecall/textemailari@eretzltd.comERETZREALTY718-256-9595Ext20057/HiAve.2,600sfcondo5bdrms,3fullbath,Playroom,PesachKit,laundryrm,storagerm,Asking$1,250,000.Callfordetails347-385-8171ERETZREALTY718-256-9595EXT111Greatinvestmentopportunity, Prime Boro Pk, 11,500 SF. Commercial space, Great Monthly income 5.5 Cap, + increases yearly, Call for details 347-385-8171 ERETZ 718-256-9595REALTYEXT 111 Mcdonald Ave. Corner 3 Story Mixed-Use Brk Bldg, Built 20x50 Only $1,2mm Call for details 347-385-8171 ERETZ 718-256-9595REALTYEXT 111 15/50’s 2 fam, owners dplx 2nd & 3rd flr 22’ blt, 5 bdrms, seforim room, lrg dining rm, fin bsmt, carport. 3 mil + 14/low 40's PRICES DROP!!! 2 FAM 2nd & 3rd flr owners duplex MIC 1st flr & bsmt collect rent for income. Only $2.4 mill wont last... 3 bdrm gorg spac condo nr Alesk E 2nd 32x40 Blt, 2nd Flr, Windows in all rms, Central A/C, Mstr bth, porch & more $930,000 For more info Call 646-543-1194 or email718-256-9595ERETZNhandler@eretzltd.comREALTYext125 גנירג יד זיוה ןייד פערטגעוו ע. ןיידזיוהןיאןטנעררעדאןפיוקראפ,וצןפיוקוטסכיז?רעשימייהיד929-430-0904

םירפס הרות ירועיש ןטייצראיסרעניד תוחמש חול

138 AUG 31, 2022Photo Credit: JDN E: info@jdnmail.com ןעלוקסמ םיר”ומדא ק”כ לצא ע”יז ןעלוקסמ רזעילא םעונ לעב ק”הרה תלוליה Yurtzeit of the Noam Eliezer of Skulen Zy”u by the Skulen Rebbes הלפכמה תרעמב הליפתב ןילראק קסניפמ ר”ומדא ק”כ Pinsk Karlin Rebbe davening at the Mearat Machpala םילשורי א”טילש גרובסלראק ד”באג צ”הגה ק”כ ךרוד הרהט תוכלה ףיוא רעהראפ ןגיטראסיורג םייב גרובסלראק הארוהל דומלת תיב ללוכ ןופ העד הרוי תרובח Farher by the Karlesburg Rov in Kolel Beis Talmud Lhourah Karlesburg

ד"סב 718.705.7174 Info@TehillimKollel.org !ןייא ןיוש ךייא טביירש ןייז וצ ןבילקעגסיוא באה ךיא סאווראפ ןלייצרעד טלאוועג באה ךיא ןצנאג םעד סיוא גאט ןדעי טגאז סאוו ׳ללוכ םילהת׳ ןיא רעבמעמ א ןיב ךיא .ע״יז ץינביר ןופ קידצ ןגילייה ןופ ןויצ םייב םילהת דימלת רעסיורג א זיא עטאט ןיימ ,בוטש ע׳בושח א ןיא ןסקאוועגפיוא חילצמ רעייז ךיוא ןבאה רעדורב ערעטלע עניימ ןוא ,בושח שיאו םכח תמאב באה ךיא .׳שרעדנא׳ ןעוועג רעבא ןיב ךיא .ןענרעל ןיא ןעוועג ןוא ןעגנאגעג טשינ רימ זיא סע רעבא ,קראטש רעייז טריבורפ .החפשמ רעד ןיא ןעזנא ןיימ טריטקעפא טאה סע ךיז טייטשראפ סע ןעמעוו רעטאפ ןיימ ןופ טייקנריולראפ יד טריפשעג גיבייא באה׳כ טשינ סע באה ךיא ןוא טירשראפ עכאווש ןיימ טרעדאבעג טאה יוו ןעז ןלאז ןרעטלע עניימ טלאוועג יוזא באה ךיא .ןטלאהעגסיוא .ןא רימ טמוק סע רעווש יוו ןוא ךיז גאלפ ךיא רעווש ןסיורג םייב ןכוזאב טפא ךיא געלפ ןטייצ ערעווש ענעי סיואכרוד קידצ רעצינביר רעד ןוא ,ע״יז ץינבירמ ק״הרה תועושי לעופו קידצ רימ טאה יבר רעד .ץראה ןיימ ןיא גנונפאה ןזאלבעגניירא טאה קידצ םעד ייב זא טליפעג גיבייא באה ךיא ןוא ,ןעוועג קזחמ גידנעטש ותריטפ רחאל ךיוא .ךימ טייטשראפ רע ןוא טסיירט ןיימ ךיא ףערט א ןגאז ןוא לטכיל א ןדניצ ןייגפיורא טייצ וצ טייצ ןופ ךיא געלפ קידצ םענופ תוכז רעד יוו ןריפש ןוא ,ןויצ ןייז ייב םילהת לטיפאק ץרא ףיוא ןענרעל ןראפעג ןיב ךיא ןעוו רעטעפש ךיוא .ךימ טיילגאב ןענרעל ךרוד קידצ ן׳טימ רשק א ןטלאהנא טריבורפ ךיא באה לארשי .ותמשנ יוליעל ן‘לבוט ךיז ןוא רשק ןכילנעזרעפ ןיימ ןופ טסואוועג טשינ לאמנייק טאה עטאט ןיימ עגארפ ןייז ןוא רעטאפ ןיימ ךימ טפור גאט ןייא .קידצ ןסיורג ןטימ ן‘טימ תוכייש א סעפע טסאה וד ,לאומש״ טשאררעביא ךימ טאה ןעמעוו טימ רבח עטנאנ א זא רימ טלייצרעד רע ןוא ״?ן׳יבר רעצינביר ראפ טדערעג טשינ ןיוש טאה רעבא ,הבישי ןיא ןענרעל טגעלפ רע ןעוו .לאומש ןוז א טאה רע ביוא ןגערפ ןפורעג םיא טאה ראי 20 רעביא ןכילרעדנואוו םעד רימ רע טלייצרעד ,אי טגאזעג םיא באה ךיא זיא ץינביר ןופ קידצ רעד יוו טאהעג סאווראנ טאה רע סאוו שינעעשעג םיא גאז ןוא ,םהרבא רבח ןייד ףור״ טגאזעג ןוא םולח ןיא ןעמוקעג םיא רע !דיא רעכילרע ןא ןסקאווסיוא ןוא ןגייטש טעוו לאומש ןוז ןייז זא ״!םיא ןופ תחנ ךאסא ראג ןעז ךאנ טעוו׳מ ןוא דניק ליואוו א זיא טאה רעצינביר רעגילייה רעד רעבא ךילביולגמוא שממ ךיז טרעה סע ךיז טאה קידצ רעכילביל רעד !ותריטפ רחאל ךיוא טעבראעג רימ ראפ ןוא ,קידצ םייב תוליפת עניימ ןופ תוכז ןיא רימ ראפ ןוט וצ טעימאב באה ראפרעד ןוא .ןייזליואוו ןיימ ראפ ןטאט ןיימ וצ חילש א טקישעג ןגילייה םייב טראד זיא סאוו ׳ללוכ םילהת׳ טימ פישרעבמעמ א ךיא ללכ ראפ םיחילש עגיטכיר יד ןייז ןלאז ייז ,גאט ןדעי ןויצ ס׳קידצ !קידצה תוכזב תועפשה ןוא תועושי ןעגנערב וצ לארשי !רימ ראפ טגראז קידצ רעד ןופ געט גיצרעפםוצ זיב לולא ו“ט אלוליהד אמוי !תוכוס גח ורסא

140 AUG 31, 2022Photo Credit: JDN E: info@jdnmail.com שהאטמ ר”ומדא ק”כ ונב לצב ע”יז שהאטמ ק”הרה תלוליה Yurtzeit of the Tosh Rebbe Zy”u by his son the Tosh Rebbe תפצב בוסאק שרדמה תיבב ק”שצומ בוסאקמ ר”ומדא ק”כ Kosov Rebbe Motzei Shabbos in Tzefas יולסאוומ ר”ומדא ק”כ דכנל ליפשראפה תחמש Furshpiel for Grandson of the Vosloi Rebbe

141WeeklyLink.com חהפשמרעצנאג רעדראפןכות3 עכיירסטלאהניאסעבאגסיוא 48 העש :ןיוש טפור ,טייהנגעלעג יד טשינ טסאפראפ 718.305.5863 ext. Subscriptions@DeeVoch.com2www.Deevoch.com

142 AUG 31, 2022Photo Credit: JDN E: info@jdnmail.com םילשוריב םחנמ תכרב ד”מהיבב רומח רטפ ןוידפ Pidyon Peter Chamor in The Birchas Menachem Shul in Yerishulayim ל”צז ןהכ םולש ’ר ןואגה תריטפ לע םילבא םוחינ Nichem Avelim by the sons of Hagaon Rabbi Shalom Cohen Zt”l

143WeeklyLink.com חהפשמרעצנאג רעדראפןכות3 עכיירסטלאהניאסעבאגסיוא !םניחב טביירקסבוס!טנייהךייא גנוע" רעייא טמוקאב רעד וצ לקעפ "תבש .סיוא ךאוו ןייא ךאוו ,ריט 48 העש :ןיוש טפור ,טייהנגעלעג יד טשינ טסאפראפ 718.305.5863 ext. Subscriptions@DeeVoch.com2www.Deevoch.com

144 AUG 31, 2022Photo Credit: JDN E: info@jdnmail.com טימ םענייאניא ןמזה םויס ןוא ארתב אבב תכסמ םויס א טעווארפעג טאה ןעמ יוו אירטס תבישי ןיא ןתשלש דמעמ עכילרעייפ עגיכאפיירד פמעק עיינ א ראפ תיבה תכונח א Siyum Mesechte, Siyum Hazman and Chanikas Habeyis in Yeshivas Horei Besomim Stree

עובשה חול Saturday םיטפוש ,תבש September 3 ז לולא 83°/71° 10:45 א"רג הליפת 5:12 תולע 1:33 'דג 'חנמ 5:24 החירז 5:24 ט"ק ח"נמ 9:03 ש"ק ז"וס 12:55 תוצח 9:40 א"רג ש"ק 7:24 העיקש 10:20 הליפת ז"וס 8:36 ק"שצומ א"פ תובא , טנ תובותכ Sunday אצת יכ ,גאטנוז September 4 ח לולא 88°/69° 10:45 א"רג הליפת 5:13 תולע 1:32 'דג 'חנמ 6:25 החירז 5:23 ט"ק ח"נמ 9:04 ש"ק ז"וס 12:54 תוצח 9:40 א"רג ש"ק 7:23 העיקש 10:20 הליפת ז"וס 88°/68° 10:44 א"רג הליפת 5:09 תולע 1:34 'דג 'חנמ 6:21 החירז 5:27 ט"ק ח"נמ 9:02 ש"ק ז"וס 12:56 תוצח 9:39 א"רג ש"ק 7:29 העיקש 10:20 הליפת ז"וס ונ תובותכ ס תובותכ Thursday םיטפוש ,גאטשרענאד September 1 ה לולא 85°/64° 10:44 א"רג הליפת 5:10 תולע 1:34 'דג 'חנמ 6:22 החירז 5:26 ט"ק ח"נמ 9:03 ש"ק ז"וס 12:55 תוצח 9:39 א"רג ש"ק 7:28 העיקש 10:20 הליפת ז"וס September 2 ו לולא 80°/67° 10:45 א"רג הליפת 5:11 תולע 1:33 'דג 'חנמ 6:23 החירז 5:25 ט"ק ח"נמ 9:03 ש"ק ז"וס 12:55 תוצח 9:39 א"רג ש"ק 7:26 העיקש 10:20 הליפת ז"וס 7:11 תורנ תקלדה חנ תובותכ Tuesday אצת יכ ,גאטסניד September 6 י לולא 84°/68° 10:45 א"רג הליפת 5:15 תולע 1:32 'דג 'חנמ 6:27 החירז 5:21 ט"ק ח"נמ 9:04 ש"ק ז"וס 12:54 תוצח 9:41 א"רג ש"ק 7:19 העיקש 10:21 הליפת ז"וס בס תובותכ 82°/66° 10:45 א"רג הליפת 5:14 תולע 1:32 'דג 'חנמ 6:26 החירז 5:22 ט"ק ח"נמ 9:04 ש"ק ז"וס 12:54 תוצח 9:40 א"רג ש"ק 7:21 העיקש 10:21 הליפת ז"וס אס תובותכ Friday םיטפוש ,גאטיירפ זנ תובותכ Monday אצת יכ ,גאטנאמ September 5 ט לולא Wednesday םיטפוש ,ךאווטימ August 31 ד לולא

146 AUG 31, 2022Photo Credit: JDN E: info@jdnmail.com לארשי רוא הנחמב ק”בש רגנלרא מ”ירגה לבוקמה Rabbi Yitzchok Moshe Erlanger Shabbos in Camp Ohr Yisroel אפאפ ידיסחד תיגהו תרגסמב ןראוועג טנערעלעג תובותכ תכסמ תלחתהו תומבי תכסמ םויס דמעמ Siyum Mesechte in the Pupa Chaburah Vehegisu 45-בובאב’ד אתביתמ הנחמב 45-בובאבמ ר”ומדא ק”כ לצא לולא שדוח שאר Rosh Choidesh Elul with the Bobov-45 Rebbe in Camp Mesivtah Bobov-45

147WeeklyLink.com 1751 -51st Street (718) 907-6451 הנוי"ת?יוו תראפת המלשת ינבד1751 – 51st Street ?רעווןופ רעדניק רעטלע9עלא ןוא ראי ?סאווòðééùèéî úåùøã,íéøåôéñ,øñåîúåøåú ù òãòé êàðøåòéà ïòî èîå÷àá ע רועיש א ןייז י"טעוו ר ךורב'ברה ריאמ א"טילשןייטש 8:00זיב7:00 טנעווא גאטימראפ ע רועיש א ןייז י"טעוו ר לאומש'ברה א"טילשםיובלא 4:30זיב5:30 ע רועיש א ןייז י"טעוו ר םייח'ברה א"טילשרענליוו 11:0012:00זיב ע רועיש א ןייז י"טעוו ר םולש'ברה סחניפ א"טילשגרעבנעטטאר 8:00זיב7:00 ע רועיש א ןייז י"טעוו ר ןועמש'ברה א"טילשןייטשדלאג 1:002:00זיב גאטשרענאדםיטפוש גאטיירפםיטפוש ע רועיש א ןייז י"טעוו ןתנ'רג"הרה עשוהי א"טילשרעפייפ 1:002:00זיב גאטנוזיכאצת ע רועיש א ןייז י"טעוו ר ןתנ'ברה א"טילשאריפש 8:00זיב7:00 ע רועיש א ןייז י"טעוו בושח טסאג'א ע א"טילשרענדער 1:002:00זיב גאטנאמיכאצת 0357.07.ץרא:לארשי 80208.806.1:דנאלגנע 845.951.-אקירעמאאדאנאקירופיס ריטסערעק תוישעמםענופלעופתועושי ק“הרה ןב ‘יעשי ןרמ יברהשמאשטנעהוםירמ ריטסערעקמ א“עיז ירופיס שהאט תוישעמםענופלעופתועושי ק“הרהןרמםלושמשייפןביבריכדדרמלריצו ר“ומדאשהאטמ א“עיז ירופיס ץינביר תוישעמםענופלעופתועושי ק“הרהןרמםייחליוונאז ןביברהשמאטויוהרופצ ר“ומדאץינבירמ א“עיז RIBNITZHASAENGLISHSECTION EstateRealForAdvisorpartyThirdYour/LifeInsurance/Investments/Contracts/Etc. 855.399.2223 info@hirdpartyadvice.com www.hirdpartyadvice.com By:Sponsored

148 AUG 31, 2022Photo Credit: JDN E: info@jdnmail.com יסנאמב ךלמילא םעונ ת”תב הדועס שמוח Chumesh Seudah at Talmud Torah Noam Elimelech in Monsey בובאב המלש םרכ הנחמב בובאב שדוקה רצחב לולא שדוח שאר Rosh Choidesh Elul in Bobov קראפ אראב אזלעב ת”ת י”עש ”ןיביבח ןיעיבש הנחמ

149WeeklyLink.com ןייז טעוו לעפפאר דנערג יד וצ ףסונב ערעדנא 10 $180 ןופ סרעניוועג ח”הרה נ”על בדנתנ לעפפארה רעגנוי ה”ע החמש ר”רה ןב לארשי ׳ר טבשב ו”ט םויב וז הנשב רטפנ ב”פשת לעפפאר עטפעלעווצ טניוועג שעק #12 ת”ישהזעב 845.290.8686 לעפפארםעדוצטפורןייראןפיוק ראפ 1 $ 20 ראפ 3 $ 50 ראפ 10 $100 ראפ 25 $180 ראפ 40 $250 ראפ 72 $360 .תועטב ןריולראפ טרעוו סע ביוא ןייז לחומ זנוא עטיב ןיבי ימ תואיגש רעבא ןעמאנ עדעי ןגייל וצ ןיירא עטסעב סאד ןעוט רימ - רשעמ תועמ טימ לעפפאר יד ןפיוק ןעמ ןעק םינברה תארוה פ”ע - ב”פשת תוחילס 'א םע בורב ןעמוקראפ ה"יא טעוו לעפפאר יד

150 AUG 31, 2022Photo Credit: JDN E: info@jdnmail.com Woodbourne Shul אריצחובא לאותקי יבר ר”ומדא ק”כ ןבל הנותחה תחמש Wedding for son of Rabbi Yekutiel Abuchatzeirah

ו"מש - גארפ ימכחמ ל"צז ןפלח 'ילא ר"ב ירמ אבא יבר נ"קת - אנליוו ץ"מוד ל"צז ץפח יתבש ר"ב 'ילא יבר ט"כקת )בא 'לב א"יו( - ןילבול ד"בא ל"צז ןירפלייה םהרבא ר"ב םייח בקעי יבר ט"נקת - ש"ר רודיס ס"חמ - בוקשארמ ל"צז ןהכה )האנלופ( ףסוי בקעי ר"ב ןושמש םהרבא יבר ג"עקת - אנאדרוה ץ"מוד ל"צז דעירפ יכדרמ ר"ב החמש יבר ט"צקת - אלזאר ד"בא ל"צז יזנכשא ןושרג ר"ב הדוהי יבר ב"ירת - םירעש יחתפ ס"חמ - בוחטסנעשט ד"בא ל"צז טוגנייוו בייל הדוהי ר"ב רכששי יבר ג"ירת - ףסוי די ס"חמ - םידיסח רפס עזגמ - ל"טיי לש וסיג - בורדאח ד"בא ל"צז שטייד לאוי ףסוי יבר ב"מרת - ינאשטלאפאטב ד"באר ל"צז קניל סחנפ יבר ד"מרת - אפאפ ד"באר ,דנעמרעג ד"בא ל"צז יקצנאדאב ץג םוקילא ר"ב קיזייא קחצי יבר ד"נרת - עצוואנראז ד"בא ל"צז ןאמרעגאה המלש בקעי ר"ב לאוי השמ יבר ח"ערת - טסעפאדוב - שטאקנומ ילודגמ ל"צז רעבלעוו השמ גילעז רשא ר"ב 'יתתמ ןרהא יבר ח"ערת - בורדוח ד"בא ל"צז ןייטשנעכייא לישעה עשוהי ר"ב שירעב בוד רכשי יבר ו"צרת - הדוהי תיב ס"חמ - אנקיוו ד"בא ל"צז אריפש ןועמש םייח ר"ב אגרש םיקילא רטלא יבר כ"ש א"ב - ה-י יטבש ב"ימ ה"ע וניבא בקעי ןב ןד ד"פת - )י"תכב(ןתנ קח ס"חמ - ץאלפנעצאה ד"בא ל"צז קנומ םהרבא ר"ב לטייפ ןתנ יבר ז"סקת - שבד ףוצ ס"חמ - אנליוומ א"רגה יחא - אנליוומ ל"צז ןמלז המלש ר"ב בוד רכשי יבר א"צקת - עשוהי תלחנ ס"חמ - ס"תח דימלת - ל"צז רענאידאוו שיווייפ אגרש ר"ב ןמשאק עשוהי יבר כ"רת - ןועמש תלחנ ס"חמ - טדאטשבאקאי ד"בא ל"צז יחרז חרז ר"ב ןועמש יבר ד"מרת - טילאקס ד"בא ל"צז רעלוואק קחצי ר"ב אפיל רזעילא יבר ס"רת - יבצ תראפת ת"וש/קידצ ירפ ס"חמ - ןילבולמ ל"צז שטיוואניבאר ןהכה )גרובזיירק( בקעי ר"ב קודצ יבר ד"סרת - םחנמ תיראש ס"חמ - אקנאלאפ ,אטנאלאג ד"בא ל"צז שטייד לאקזחי ר"ב םחנמ יבר ג"צרת - עוואנישמ לאקזחי ירבדה תיבב לדגתנ -בולסארעימ ר"ומדא ל"צז םאל רטלא לאומש םהרבא ר"ב )יבר לארשי ץרא רעד( ךלמילא יבר ד"צרת - םחנמ חמצ ס"חמ - ןימזדארמ ר"ומדא ל"צז ןאמרעטטוג דוד עשוהי המלש ר"ב לדנעמ םחנמ ןרהא יבר ח"צרת - גאשלאפיא ד"בא ל"צז סייוו )לחר ןב( ןנחוי יבר ח"ישת -דועו ףייטש י"רהמ ת"וש ס"חמ ,ןעיוו םיארי תדע להק ד"באו טסעפ ד"באר ל"צז ףייטש יבצ ר"ב ןתנוי יבר ח"כשת - קחצי חיש ס"חמ - ןיטאיסוהמ ר"ומדא ל"צז ןאמדעירפ בקעי ר"ב קחצי יבר ט"קת - דארב ימכחמ ח"ר יבא - דארבמ ל"צז רעזנאצ םוחנ םחנמ יבר ז"מקת - אנליוו ץ"מוד ל"צז אדורב ןועמש ר"ב דוד יבר א"נקת - סחנפ שרדמ ס"חמ - ץיראקמ ל"צז אריפש אבא םהרבא ר"ב סחנפ יבר ג"מרת ףסוי ינב ס"חמ םילשורי םידרפסה ד"באר ל"צז ויראק םהרבא דוד ר"ב עשוהי ףסוי יבר ג"נרת - טוגיס ץ"מוד ל"צז ןרעטש ףסוי ר"ב לאומש םייח יבר ו"נרת - שוהובמ ר"ומדא ל"צז ןאמדעירפ )ןיזור( ףסוי םולש ר"ב קחצי יבר א"פרת - ץנימרטלב מ"ר ל"צז שטיוואלעקנאי ףסוי יבר ז"שת - השמ תכרב ס"חמ - ןאקשאפמ ר"ומדא ל"צז ןאמדעירפ )שוהוב( קחצי ר"ב בייל הדוהי השמ יבר א"כשת - 'ירא בל/הדוהי לוק ס"חמ - קסנימאוואנמ ר"ומדא ל"צז בולרעפ בקעי ר"ב 'ירא הדוהי יבר ב"עשת - ןרובלעמ ד"בא- ל"צז יזנכשא םייח רדנסכלא ר"ב ךלמילא יבר פ"ש - טרופקנארפ מ"ר ל"צז ךרכב םחנמ ר"ב השמ יבר ב"צש - - אניוו ילודגמ ל"צז ץיוורוה יולה )א"מר לש וסיג( סחנפ ר"ב דוד יבר ג"ת - שש ידומע ס"חמ - אוואקלאז ימכחמ ל"צז השמ ר"ב גילעז ןרהא יבר ט"צת - דארבמ ל"צז )בובל( ץריה ר"ב ]ףירח[ השמ יבר ב"נקת - הדוהי שפנ ס"חמ - אוואקלאזמ ל"צז לארשי ר"ב בייל הדוהי יבר ד"צקת -ןילבולב םירשימ דיגמו ןייד ,הזוחה דימלת ,יווארגנעוו ד"בא ל"צז אריפש םנורג לאומש ר"ב שריה יבצ לאפר יב ר א"רת - ילארק ץ"מוד ל"צז לעדנאמיס יניס ר"ב ףלאוו באז יבר י"רת - יקשאלב ד"בא ל"צז קיזייא ר"ב ]קידצה[ לדייז ףסוי יבר א"ירת - ארוגידאסמ ל"צז ןאמדעירפ )ןיזור( לארשי ר"ב ףסוי םולש יבר ג"מרת - ארוגידאסמ ל"צז ןאמדעירפ )ןיזור( לארשי ר"ב בקעי םהרבא יבר ויחאו ט"מרת - םילשורי ד"באר ל"צז יולה םהרבא ר"ב בייל הדוהי בקעי יבר נ"רת - ץמאינ-ארטאיפ ד"בא ל"צז יאטיק עשוהי ר"ב באז השמ יבר א"נרת - בהז רז ס"חמ - בוקירטסמ ר"ומדא ל"צז אדנאל )בונכעשט( םהרבא ר"ב ףלאוו באז יבר ע"רת - המלשהה תרות ס"חמ - זיראפ ינברמ ל"צז יקצעבול אביקע קחצי ר"ב הדוהי יבר ט"ערת - ןיידראווניילקמ ל"צז דלאוונירג )ב"הורע( השמ ר"ב ריאמ לארשי יבר ב"צרת - עשוהי רואמ ת"וש ס"חמ - דאסאנ ד"בא ל"צז דניירפ 'ירא השמ ר"ב עשוהי םהרבא יבר ז"צרת - יבצ רה ס"חמ - אדיאידאנ ד"בא ל"צז ןאמכייר והילא ר"ב שריה יבצ יבר 2 גאטסנידלולא'יךאווטימלולאא"יגאטנאמלולא'טגאטנוזלולא'ח

ד"נש - גארפמ ל"רהמ יחא - גרובסלקינ ד"בא ל"צז לאלצב ר"ב יניס יבר ג"עש - דוד חמצ ס"חמ - ל"צז זנאג המלש ר"ב דוד יבר א"פש - אניוו - גארפ ילודגמו ימכחמ ל"צז םימואת השמ ןרהא ר"ב ןמלז םלושמ יבר נ"ת - בובל ימכחמ ל"צז יולה ןימינב ר"ב ןרהא יבר א"קת - המלש יניגמ דכנ - אסיל ימכחמ ל"צז שריה יבצ ר"ב ]רעשידאר[ םירפא יבר ו"מקת - ק"הצרא ינברמ ל"צז ודאינאל לאומש ר"ב 'ילא יבר ג"עקת - אנדארוה ,זיוושענ ד"בא ל"צז יכדרמ ר"ב החמש יבר ד"עקת - ץינזאקמ דיגמ/א"עונ דימלת - ץינזאקמ ל"צז דוד ר"ב השנמ יבר ז"צקת - אשראוומ ל"צז ]דיסח[ ןמלק יבר ט"רת - יבצ תרטע ת"וש ס"חמ - שטירזעמ ד"באר ל"צז פ"לרח באז ר"ב שריה יבצ רזעילא םירפא יבר ב"ירת - אנראמאק ס"ר ןתח - אוואזאק ד"בא ל"צז גרעבנעטטאר בייל 'ירא ןרהא ר"ב ףסוי יבר ג"מרת - השמ ןורכז ס"חמ - ןאזערבמ ם"שרהמ יבא - ל"צז ןורדאווש ןהכה םולש ר"ב השמ יבר ד"נרת - השמ תראפת ס"חמ - אבר'ג ימכחמ ל"צז ןאדיע הפילכ ר"ב השמ יבר ח"ערת - םילשורי - בולעלמ יעיברה ר"ומדא ,ל"צז ןאמרעדיב לדנעמ םחנמ רזעלא ר"ב ) ל'דוד 'ר( המלש יבצ דוד יבר ט"ערת - המלש תלהק ס"חמ - ץיוואנסוס ד"בא ל"צז לצנעטש בוד םייח ר"ב המלש יבר ו"פרת - בידנ תיב ת"וש ס"חמ - אשיר ,ןיטהור ד"בא ל"צז ןיוועל הדוהי דוד ר"ב ןתנ יבר ו"פרת - וואנאודאב ד"בא ל"צז )אקפאשטונראשט( באז יבצ ר"ב דוד יבר ח"פרת - הלחנ לבח ס"חמ - אניווב מ"ר ל"צז ןאמדעירפ )יוברעוו( לארשי ר"ב 'ימחנ יבר ח"צרת - תובא תוכז/ןמאנ חרוא ס"חמ - ל"צז ךאברעיוא )ןישטנול( המלש ר"ב עטנ ןתנ םחנמ יבר א"שת - םייח תמשנ ,המלש תועירי ס"חמ ,ןאדייק - אנשקעוו ד"בא ל"צז רעבליזנייפ יולה ףסוי ןרהא ר"ב המלש יבר א"שת - ןילוואזמ א"שר ןתח - טדאטשיינמ ר"ומדא ל"צז ןייטשפע ריאמ םייח ר"ב דוד ןתנ יבר ד"ית - ט"וי תופסות ס"חמ - אקארק ד"בא ל"צז רילעה יולה ןתנ ר"ב ןאמפיל ט"וי ]לואש ןושרג[ יבר ז"כת - ןילבול ימכחמ ל"צז )אקארקמ לישעה יבר ןתח( שריה ילתפנ ר"ב בקעי יבר ז"קת - הקדצ חמצ ס"חמ - גרובשלקינ ,שטיבערט ,ץיטסיור ד"בא ל"צז )לאמכורק - קדצ חמצה ןתח( לרסיא דוד ר"ב לדנעמ םחנמ יבר ז"כקת - 'יאר תלוע ס"חמ - ץינכער ד"בא ל"צז באשאטס קחצי ר"ב בייל אדוי 'ירא יבר ט"לקת - ןושמש ערז ס"חמ - ל"צז ינמחנ לאכימ ןמחנ ר"ב םייח ןושמש יבר ט"עקת -)ץישבייא ןתנוי יברמ( הבוהא ינב היגמה ,ןעדזערד ץ"מוד ,ל"צז ירוא יבר פ"קת - םיחא תבש ס"חמ - אלרוא ד"בא ל"צז ץ"כ אקשיב ןימינב ר"ב יתבש יבר א"צקת - ץנימ ם"רהמ ת"וש ס"חמ - ןשי ןבוא ד"בא ל"צז ץנימ הדוהי ר"ב השמ יבר א"כרת - טומראי-רעהעפ ץ"מוד ל"צז יולב לארשי קחצי יבר ח"כרת - ל"צז טענב )גרובשלקינ( יכדרמ ר"ב )לרעבא( םהרבא בקעי יבר ב"מרת - םהרבא ךורב ס"חמ ןורבח-דדגב ימכחמ ל"צז ינמ ןאמילס והילא ר"ב ךורב םהרבא יבר ג"מרת - בל בטיי ס"חמ - טוגיס ד"בא ל"צז םיובלטייט ןסינ רזעלא ר"ב הדוהי לאיתוקי יבר ו"מרת - םישדקב ילבב דומלתב תצבוקמ הטישה היגמה ,םילשוריב ףוסבלו תפצב בולקשמ לארשי 'ר לש וניד תיבב רבח ל"צז ןייטשנעזייא שריה יבצ ר"ב םהרבא יבר ה"סרת - זאסגערעב ץ"מוד ,ל"צז ןאמדעירפ ןהכה ט"וי ר"ב ) ןייד- שרעה( יבצ יבר ד"ערת - אריצחובא דוד 'ר רבח ,הנוהכ יחרפ לעב יבא ,תאליפת ימכחמ ל"צז ןהכה והילא יבר ו"ערת - יסאי ,ץיוואקשאלמ ר"ומדא ל"צז ןאמסעטטאג יולה בייל הירא ןרהא ר"ב ריאמ יבר ה"פרת - אקארק ץ"מוד ל"צז אדנאל לאומש יבר א"צרת - ץירטסיב ד"בא ל"צז ןאמללוא השמ ר"ב ןמלז המלש יבר ה"צרת - ץלעש ד"בא ל"צז גרעבדלאג )ילתפנ לוק( ילתפנ ר"ב רזעלא ףסוי יבר ב"ישת - בבל ח"משי ס"חמ )וקורומ( ורפ'צ ד"באר ל"צז הידבוע דועסמ ר"ב)ח"משי(םייח ןועמש העושי יבר ו"משת - דארא ד"בא ל"צז רעללימ השמ יבצ ר"ב באז ןועמש יבר ה"ש - גארפ ילודגמ ל"צז ץיוורוה יולה והיעשי ר"ב ןמלז םלושמ ןרהא יבר ח"ת - ןילבול ימכחמ ל"צז רעב ר"ב םהרבא יבר ל"קת - אסיל ד"בא ל"צז ןאמליה לאומש ר"ב ליווייפ יבר ה"רת ןרהא תיב ס"חמ ,ליוק ד"בא ,ל"צז ןאמלעגנע ןושרג ר"ב ןרהא יבר ט"ירת– יח שא ןבה יבא– דאדגאב ימכחמ םייח השמ ר"ב והילא יבר כ"רת - םהרבא תיראש ס"חמ - ףסוי ירמא לש וניקז - 'ירבט ,שטאקנומ ץ"מוד ל"צז סייוו יבצ לאומש ר"ב םהרבא יבר ז"כרת - אנבאז ד"בא ל"צז ראגנוא )ווארבמאד( ףסוי ר"ב ךלמילא לארשי יבר ז"לרת - אליטסואמ ר"ומדא ל"צז אריפש-ןגיובלעניצאק ףסוי ר"ב יכדרמ יבר ג"סרת - העושי יניעמ ס"חמ הסינות ימכחמ ל"צז ןהכה )וינעה דיסחה( העושי יבר א"ערת - קילאמ ל"הר ןתח - יוואלודפ ,אצילוסמ ר"ומדא ל"צז שטיוואקסאמ )ץאש( לאוי ר"ב 'ירא ןרהא רתלא יבר ז"ערת - רפוס ם"רהמ ס"חמ - דערופ אסיט ד"בא ל"צז רפוס םולש בקעי ר"ב השמ יבר ו"צרת - ןירושי תליהק ד"באו ןוטסוב ללוכה בר - ל"צז תוילגרמ ןמלז המלש ר"ב ןולובז השמ יבר ךאוו יד ןופ ןטייצרהאי איקידצד אלוליה גאטיירפלולא'ו 1 גאטשרענאדלולא'הY ונילע ןגי םתוכז U לולא 'ד ךאווטימ ראפ !עבאגסיוא עגיראפ יד טקוק **** ןרעה טנעק ריא םיקידצ ינוגינו ירופיס רדס ןפיוא רדוסמ טייצרהאי רעייז ןופ 718-989-6844 #17 טפור תופסוהו תוהגה ראפ 718-388-3085 שדוקלולאתבש'ז

154 AUG 31, 2022 23 לטיפּ אק ןעכנימ ןייק קירוצ ןעכנימ-ץנאטסנאק | 1939 ,9 רעבמעוואנ סאד זא ןדערנייא טלאוועג ךיז באה ךיא רעד רעבא ,םולח רענראמשאק א זיא סעלא ןעמ .םינפּ ןיא טשטאפּעג רימ טאה תמא ןטשרעטנוא ן'פיוא רעמיצ א ןזיוועג רימ טאה ריפ יוו רעמ טשינראג טאה סאוו ,קאטש .ךורעג ןטפאהלקע ןא ןוא ראלפ א ,טנעוו טפראוו ריציפא-אפּאטסעג רעגנוי רעד ךיא ןיב רעכיז .לפּעט ןוא עקעד א רימ ןופ ךאז עגידנעמוק יד לייוו ,ןפאלשעגנייא ךיא ןעוו ןעוועג זיא טסואוועג באה ךיא סאוו ןבענ ןייטש ריציפא ןבלעז םעד ןעזעג באה טביג רע .ןטניה ןופ ןסיוטש גיד'החיצר ןוא רימ םעניא ןכיורבעג יד ראפ טייצ עלאמינימ רימ .סאג ןיא סיורא רימ רע טמענ ןאד ןוא לפּעט טרעדיילשעגניירא ךימ טאה פּוטש עדליוו א .ןיזומיל א ןופ ןציז עטשרעטניה יד ןיא ןפאלש ץנאטסנאק ןופ ןשטנעמ עטוג יד רימ סאוו טייצ רעד ןיא ,טעב ןיא גיאור ךאנ באה ךיא ואוו סאג רעד ןופ קע םעד ךרוד ןראפ ןיימ טימ רעמיצ עגיד'תופתושב א טאהעג טאה סאוו טסינומאק רעד ,גיבייפ עגעלאק רענעטאבראפ רעד ןיא טפּעלשעגניירא רימ .יב-ףע-רא יד ,עיצאזינאגרא ןייהר םעד רעבירא ןזיירפּש רימ לאמנייא ןסאג רעבירא ,טייז-ברעמ וצ רימ ןראפ ,ךייט יד ןופ תונורכז קירוצ רימ ןעגנערב עכלעוו יד .טאטש ןיא טעבראעג באה ךיא ןעוו ןראי ךיז ןגידנע ןפּמאל-ןסאג יד ןופ ןייש עמעראוו .ןשרעה ןא קירוצ טבייה טייקלקנוט יד ןוא ךיז ןגיוא עניימ ןבייה ,טפּעשרע ןוא דימ םעד עז ךיא זיב למירד ךיא .ןכאמראפ וצ ןא ןגראמירפ םעניא טצנאלג סאוו ,ךייט יסנעדאב קרעמאב ,ףיוא לסיבא ךיז פּאכ ךיא ןעוו .ןייש סאד .גרובסרימ רעבירא ןראפ רימ זא ךיא רעה ןטלא םענופ לאמאכאנ רימ טנאמרעד עכלעוו טימ ןלייט-רעגייז ענייז ןוא ,דנומטאר .בוח ןייז טלאצאב רימ טאה רע טכארט ךיא ןוא רעטייוו טפיול חומ רעד רעכיז טצעי ןענעז סאוו סרעגייז ייווצ יד ןופ -ריב יד ןופ לאז םעניא לענפּארש יוו טלציפּעצ ןעגנולעג זיא עיצקא ןיימ ביוא רעסיוא – רעלעק ןיא טרעטעמשעגניירא ןגיל ךעלקיטש יד ןוא !יאוולה ,יוא .פּאק ס'רעלטיה םעד ףיוא ןיירא ךיז טיירד רעוויירד רעד ןעוו ךיז ךיא רעדנואוו ,גרובסנעוואר ןייק זארטש .ןארבסגינעק ןייק םייהא ךימ טריפ ןעמ ביוא טגארט ןעמ זא רימ ןגאז ןטקניטסניא עניימ סאד ואוו ץאלפּ רעד – ןעכנימ ןייק קירוצ ךימ .ןעמוקעגראפ זיא ןכערבראפ ,רימ טלאפאב טייקדימ ןופ עילאווכ א ךאנ ןיימ .ןקראטש טשינ ךימ ןעק ךיא עכלעוו ףיוא לאפ ךיא ןוא ץיז םעניא ףיט טקניז רעפּרעק .ףאלש ןפיט א ןיא ןיירא *** ןפראש םעד רעה ךיא ןעוו ךיז קעוורע ךיא ןסלער יד טימ ןבייר ךיז רעדער ןופ רעדורעג .ןעכנימ ןופ טייז-ברעמ ףיוא ,ייוומארט םענופ זיא רעגייז-טנאה ןיימ .ירפוצ 9:15 זיא טייצ יד טאה ןעכנימ רעבא ,ןראוועג טריקסיפנאק רעה יוו סעדייבעג עריא ףיוא סרעגייז רעמ .קירבאפ-רעגייז ןייז ןיא דנומטאר ןעוו ,ןצעזוצפיוא לסיבא ךיז ריבורפּ ךיא קיפארט-ןגראמ יד בילוצ ךילעמאפּ ןראפ רימ ףיוא קילב א ןפּאכ וצ ,ןסאג רעכנימ יד ףיוא טפּיוה ס'נעכנימ רעבירא ןראפ רימ .סיורא ,עטמיראב ךאנ ןאד ןוא עיצנאטס-ןאב ףיורא ןעגנערב עכלעוו ,רעצעלפּ עשיראטסיה ד"סב :רעירפ ןופ ןצרוק ןיא םייב ,1939 ,8 רעבמעוואנ טראד טדער רעלטיה ןעוו ןסיירפיוא לאז סע זא רעגייז םעד ןא טלעטש רע .לאז רעלעק-ריב םעניא ליוז א ןיא עבמאב-טייצ א ןייא טצנאלפ רעסלע שזדראשזד :1# ענעצס .ןלאירעטאמ עטגיטכעדראפ טפערט ןוא םיא טשראפ אפּאטסעג יד ןוא טפּאכעג טרעוו רע .ץייווש ןייק ,ץנאטסנאק לטעטש םייב ,ץינערג יד ןפּאכוצרעבירא ךיז טריבורפּ רע .םוקמאצ ןשיצאנ ןכילרעי .ןצינערג עשטייד עלא ןסילשראפ שיטעמרעה לאז ןעמ ןוא ןעכנימ ןיא ןסירעגפיוא טאה עבמאב א זא טמוק גנודלעמ א עשטייד יד .טכאמרעוו םעניא ןראטאריפּסנאק טימ ןפערט וצ ךיז אלנעוו לטעטש-ץינערג םענופ קע םוצ ןראפ ,ןטנעגא-שזאנאיפּש עשילגנע עדייב ,סנעוויטס דראשטיר ןוא טסעב ןיעפּ :2# ענעצס ןלאפאב ייז ןרעוו ,ץינערג עשטייד-עשידנעלאה יד ןבענ טראה ,זיוה-עפאק א ייב ראק יד ןריקראפּ ן'כאנ .גירק ןרעטיב םעד ןגידנע ןוא לקנעב ןופ רעלטיה ןפראוואוצפּארא רענעלפּ ןבאה טיילרעטילימ .רעטיוט א טלאפ פּאלק קריד טנאנעטויל ןוא ןעילפ ןליוק ,ןעיירעסיש ךיז טרעה סע .ןטידנאב עטנפאוואב ןוא עטריקסאמראפ ןופ !גנונאפּש טימ רעטייוו טנייל

,טנעֶצאָרפּ טרעֶדנוּה ןטלאַהעגסיוֹא ןוּא ,טקאַלבּעג זיִא סֶע" ".טנעֶה ס'יִטאַט ןיִא ראָנ טְגנאַלאַבּ יִלכּ יִד זַא ,טְגאָזעגנָא טוּג רעֶדניִק יִד ,םַתּסַה ןִמ ,תוֹנַעט עֶשׁיגאָל ןייֵז ןעֶק סעֶלַא !םַס טיִמ ,רוּסיִא ןַא טיִמ ךְיִז טליִפּשׁ ןעֶמ ןעוֶו טשׁיִנ רעֶבָּא נ"על בדנתנ ףדה תכירע תב דבכוי לטענ תרמ ה”ע ריאמ עשוהי ןויצנב 845.351.9511 בדנל :י"ע בדנתנ פ"בב הצפה A project of: ריִא ,דִוָד ?טוּניִמטְגִדלוּשׁטנַאַאטאָהןייֵמרעֶּבָא,םיִלֵכּעֶנייֵמ ןלבוֹט אָד ליוִו ךְיִא ריִא ליוִו ךיִא ןוּא ,ראַק ןיִא טפאָלשׁ רעֶטכאָט ,ןציִה עֶכעֶלעֶזַא טיִמ ראַק ןיִא ןייֵלַא ןזאָל טׁשיִנ רֶשׁפֶא ,ןוֹפעֶלעֶט ןפיוֹא אָליֵממ טסעוּמשׁ יִד זַא ךְיִא זיִבּ ,ראַק ןייֵמ ןיִא ןייֵרַא לייוֵורעֶד ךיִז וּטצעֶז ?םיִלֵכּ עֶנייֵמ ןלבוֹט גיִדנֶע ?ןלבוֹט סֶע וּטסייג יוִו .אָד ךְייֵלְגןשׁיִדנאָקרֶע טסאָה וּד ?ראַק ןיִא !רעֶכיִז ,ןייֵטשׁראַפ ליִוו ךְיִא רעֶבָּא ,ןרעג סֶע הוּט ךְיִא ראָנ ןוּא אָד ךְייֵלְג ןבּייֵלבּ וּצ וּטסנאַלפּ בּיוֹא ריִמ וּטספראַד סאוָו ,םיִלֵּכ עֶנייֵד ן'לבוֹט !?ןוֹרָכִּז עֶכאַוושׁ אַזַא טסאָה ?ןּבאָה .ןסעגראַפ הָליִלָח אָי טסעוֶו וּליִפַא ןוּא יוֹזַא תוֹיִשַעַמ יִד ךְיִז ןְגיִדנֶע לאָמ עֶלַא טשׁיִנ ףוֹס םוּצ ןעֶמ טמוּק לאָמ בוֹר ...שיגאָרט ראָפַּא ןוּפ יִפּעָרעֶט ךאָנ לאָטיִפּשׁ ןוּפ סיוֹרַא ...םיִשָׁדַח !?ןלאַפעג פּאָק ןפיוֹא טסיִב ןוּא עֶטוּג רֶעייֵז סעֶלַא ןייֵז ןעֶק יוֹזַא יוִו רעֶבָּא ,תוֹנַעַט עֶשׁיגאָל ךְיִז טדעֶר סֶע ןעוֶו וּטסטדעֶר !רעֶדניִק ןוּפ סנבּעֶל ןוּפ עֶלַא יִד ייֵבּ זַא טסנייֵמ וּד זיִא ,סעֶידעגאַרט עֶכלעֶזַא עֶשׁיגאָל ןייֵק ןעוֶועג טשׁיִנ !?תוֹנַעט

156 AUG 31, 2022 .תונורכז עטייוו-טשינ קנאדעג ן'פיוא עסארטשנעקרוט רעבירא טראפ ןעמ ,רעלאמש רעד ףיוא קילב א פּאכ ךיא ןוא טלאפאב תונורכז ןופ ץיילפ א .סאג רעגנאל טראד באה ךיא יוו ךיז ןאמרעד ךיא ןעוו ,רימ יד ןופ טנעמטראפּא םעניא טבעלעג גיאור .סנאמהעל ,רעילאטס-רעטסיימ רעד זא ךיז טייטשראפ סיורא טשינ טייג ,גארב גראי רעיירטעג רעד םענופ ךיז ןאמרעד ךיא .קנאדעג ןיימ ןופ םעניא ןפארטעג םיא באה ךיא סאוו גאטנוז ,'לפּמיס רעטלא' עקזייה-עוואק םעניילק .עסארטשנעקרוט ףיוא אד עקאט טאה גארב סאוו ףיוא רימ טצילב חומ ןיא ,לשיט םעניילק םייב טלייצראפ ןאד רימ סאוו דאוואב סיראמ ןטיירדעצ םעד רעביא ןעכנימ ןיא רעלטיה ןסיש וצ טריבורפּ טאה םיא טאה ןעמ .שראמ-יצאנ ןכילרעי םייב ןאב א ףיוא ,שאט ןיא סקיב א טימ טפּאכעג .זיראפּ ןייק ןפיולטנא וצ טריבורפּ טאה רע ןעוו סאוו רימ ראפ עיצקעל א ןעוועג זיא סאד ,אי .טרעהרעד טשינ באה ךיא בייה ,ץאלפּסגינאק ןייק ןא ןעמוק רימ ןעוו ךימ טמענ ןעמ ביוא ןרעדנואוו וצ ןא ךיז ךיא רעצעלפּ-יצאנ יד רעביא רוט ןטאווירפּ א ףיוא ,רעוויירד רעד זא ןייז ראג ןעק .ןעכנימ ןיא ,ץנאטסנאק ןיא ןסקאוועגפיוא זיא רעכלעוו רע ןוא געוו ןייז ןריולראפ טושפּ .טעשזדנטאהאלב םייב יירד ןפראש א טכאמ רע ןעוו ,'רעריטראמ-טולב' יד ןופ עדייבעג-לאמקנעדעג יד ןלעוו לסיבא ךאנ .קנאדעג ןסיז א ךיא באה ןעמאזוצ – סיצאנ עשיטאנאפ ,עשיטסישאפ יד רעביא ךעל'השעמ-עקסבאב ערעייז טימ ,טליפּשעגסיוא ןצנאגניא ןייז – רעריטראמ !היחמ א .טיוט זיא רערהיפ רעד זא טצעי ךיז טציירק סע ואוו ,סאג קע םייב ,עסארטשסרענירב טימ עסארטשנעקרוט ןפראש א טימ פּא ןיזומיל יד ךיז טלעטש ןופ טנראפ ראק םעד טריקראפּ רע .שטיווק וצניירא לסיבא זיא סאוו ץאלאפּ-גנוטסעפ א רעגילדנעצ .טפעלפּעג ןיב ךיא .סאג רעד ןיא ןוא ,ץאלפּ םעד ףיוא רעבירא ךיא ןיב לאמ רעדא ,ןינב םעד טקרעמאב טשינ לאמנייק .ריא רעביא סטכעלש טרעהעג סעפּע .ןיירא ךימ ןפּעלש תויח עדליוו ייווצ רעוו ,ןריפּאפּ עלאמינימ ןביירשסיוא ן'כאנ רעגנערטש א .לעצ א ןיא טראפּשראפ ךיא ,טייצ ןצנאג א רימ רעביא טרעיוה רעטכעוו ןעוועג זיא עכלעוו ,רעטסנעפ םייב גידנקוקניירא .סעטאראג טימ טקעדעגרעביא םורא ךיא ריצאפּש תועש עגידנעמוק יד ןיימ ןיא ,רעגיט רעטעדנואווראפ ,רעדליוו א יוו ןעמ יוזאיוו ןרעה ךיא ןעק לעצ םענופ .גייטש ן'כאנ סנייא סאג ןופ ןשטנעמ ןיירא טפּעלש ןעמ טוט דנאלשטייד-רעלטיה ןיא .ןטייווצ ,ליפּשייב םוצ ,ןטייקגיניילק עשיראנ ראפ סאד וליפא רעדא רעלטיה ןופ ןובשח ן'פיוא ץיוו א .רערהיפ םעד ןגעק ןטכארט ן'ראפ ראנ סאוו ראלק טשינ ךאנ זיא פּאק ןיימ ךימ טעוו ןעמ ןעוו ןגאז לעוו ךיא ךילטקנופּ ןוא סיורא ךימ ןפּעלש רעטכעוו ייווצ .ןשראפ םענופ קע םייב רעמיצ א וצ ךימ ןטיילגאב רענייא .ןטראוו ןשטנעמ ייווצ ואוו ,ראדיראק טנאה ןיא ענעפּ ןוא לטערב-ביירש א טלאה ןכיוה א ןופ ןרידנומ טגארט רעטייווצ רעד ןוא .טנעגא-אפּאטסעג א ןופ טשינ רעבא ,גנאר רימ טלעפאב ןרידנומ יד טימ ןאמ רעד .לקנעב םענעגיובעג ן'פיוא ץיז א ןעמענ וצ ,רעסאוו עגידעניר ןופ רעדורעג םעד רעסיוא -שאוו ןגידנבענרעד םענופ טמוק סאוו יד ףיוא טירטסופ יד ךיוא ךיא רעה ,רעמיצ .סעגאלדאפּ ענעטנעמעצ סאוו טייצ רעד ןיא ,ןטראוו ךימ טזאל רע ןייז .קירוצ ןוא ןיהא רעמיצ םעניא טנאפּש רע ןעקנוזראפ טייצ וצ טייצ ןופ טרעוו זאנ עסיורג רע זא ביילג ךיא .עקעט רעניורב א ןיא רעגנוי רעד סאוו טכיראב םעד טראד טנעייל רימ רעביא ןבירשעג טאה ריציפא-אפּאטסעג ןעוו .טכאנ ןטכענ ץנאטסנאק ןיא ץינערג םייב ןוא פּא ךיז רע טלעטש ,ןענעייל טגידנע רע .רימ וצ סיוא ךיז טיירד ןופ רידנאמאק רעד ,עבענ סייה ךיא" ןייד זיא סאוו .ייצילאפּ לאנימירק יד"?ןעמ,אפּירקאנ ".רעסלע שזדראשזד ןאהאי" "?טרובעג ןופ םוטאד" ".1903 ,ןטרעפ םעד ראונאי" "?טרובעג ןופ ץאלפּ" ".ןעגניראמרעה""?עיצאפּוקא"".רעיוב-עפאש""?טראניואוו" דלאביוו ,ןרעפטנע ן'ראפעב טכארט ךיא ןיוש ךיא באה םייהרעדניא ןעניואוו ן'כאנ ייז ןעק ךיא .רעצעלפּ עכילטע ףיוא טניואוועג ,סרעדיומש יד ןופ סערדא םעד ןבעגרעביא רעטסעווש ןיימ ןופ סערדא רעד רעדא ןופ סערדא םעד ךיא ביג עדנע םייב .איראמ טעז ,ןיואוו ךיא ואוו ץאלפּ סאד .סנאמהעל יד .טנאסערעטניא סיוא טשינ "?ןרעטלע ענייד ןעניואוו ואוו" ".לפרעד עשיבאווש עניילק א ,ןארבסגינעק" ".ןפערט ייז ןלעוו רימ" "?סעלא סאד זיא" רעה .עגארפ ןייא ךאנ באה ךיא .ןיינ" טימ ןוט וצ סעפּע טאהעג וטסאה .רעסלע ןטכענ רעלעק-ריב יד ןופ גנורידראבמאב יד "?טכאנ .ץנאטסנאק ןיא ןעוועג ךיא ןיב טכאנ ןטכענ" "?ךילגעמ ללכב סאד זיא יוזאיוו רע טאה "?ןכאז יד ןענעז סאוו ,יוזא ביוא" עשיטסאלפּ א טנאה ןיא גידנטלאה טגערפעג עניימ ןגעלעג ןענעז סע עכלעוו ןיא ,לקעז סאוו ,ןפיורש ןוא ךעלקיטש ענרעזייא עשיראנ .שאט ןיימ ןיא ןפארטעג טאה ןעמ ץונ ךיא סאוו גייצעג ןענעז ןכאז עלא יד" טלייצראפ סעלא באה ךיא .ןטעברא םייב ךימ טאה סאוו ריציפא ןגנוי ן'ראפ יד .ץנאטסנאק ןיא טכאנ ןטכענ טגערפעגסיוא "?טכיראב ןייז ןיא טשינ טגיל עיצאמראפניא .טשינ טרעפטנע אפּירק ןופ ןאמ רעד ןוא פּארא ףיוא זאנ ןייז רע טלאה ,טאטשנא םעניא תורוש עכילטע יילב א טימ .עקעטטנכייצראפםעניורב ן'ראפ רע טגאז ",ןגידנעמוק םעד ןיירא ףור" .לטערב-ביירש ן'טימ ןאמ .לעצ ןיימ וצ קירוצ ךימ טריפ ןעמ יוו ןעיירפאב ךימ לאז ןעמ טראוו ךיא ןייק טשינ ןבאה ייז זא רעכיז גידנעייז ,רעירפ .רימ רעביא ןזייוואב עטסנרע ןא ךיז ןבייה רעדא םיא ייז ןעיירפאב ?רעסלע טימ טריסאפּ סאוו !ה"יא ,ךאוו עגידנעמוק טנעייל – ?ןעגנושראפסיוא עלופנייפּ

For comments or845.351.9511donations,

ה"ע רזעילא רתלא תב הרש תמשנ יוליעל The PerformanceBest תמשנ יוליעל םהרבא ןב ה"עיכדרמקחצי find us : ןוצרהו םימחרה ימי תארקל תוקזחתהו תוררועתה א רי י אלֹ י מ ג א ה י ר א • לולא ירועיש • לולא ח”ר האר תשרפא"טילשRabbi Aron Shain Mincha 6:00 • Shiur 6:15 םיערז ללוכ שאר םיטפוש תשרפ א"טילשRabbi Mordechai Gutfreund אנכש םולש הלודג הבישי תבישי שאר Mincha 6:00 • Shiur 6:15 אבת יכ תשרפ א"טילשRabbi Chanoch Levovitz Mincha 5:30 • Shiur 5:45 אנכש םולש אתביתמב מ"ר םיבצנ תשרפ א"טילשRabbi Zev Smith Mincha 5:30 • Shiur 5:45 האריו הרות יציברמ ילודגמ ךליו תשרפ השרד הבוש תבש א”טילש ארתאד ארמהמ 5:30 השרד - 5:15 החנמ אצת יכ תשרפ א"טילשRabbi Chaim Leib Perkowski Mincha 5:30 • Shiur 5:45 דומלתה תיב תבישי שאר Sponsored By The Gerber Family ה״ע רזעילא תב לדנימ השאה נ״על

“A flip-phone!” was the proud“Andreply.you? What about you? And what about that man in theTheback?”answers were quick, proud, and identical: “A flipphone! Flip-phone! Flipphone!”Atlast, the magician hit the jackpot. Someone had a Smart phone, and the magician pre pared to do his trick. But with in seconds, he realized that it wouldn’t“There’swork.nointernet on my Smartphone,” the Yid told him. The magician shelved the would-be trick, to a round of hearty and delighted applause. The crowd was enveloped in an aura of tremendous Kiddush Hashem.Butthat wasn’t all! A few minutes later, the magician asked for two volunteers. Boys of all ages raised their hands wildly in the air, and two can didates were chosen. “Sit down here, near me,” the magician told them. He then gave his own Smartphone to one of the boys, who took it gingerly.“Now, read what it says on my phone,” the magician said, his voice full of anticipation at the trick waiting to happen.

To hear more stories, experiences and thoughts, tune in to: 718.400.1111 (men) 718.400.1114 (women)

A Chol Hamoed perfor mance in Lakewood was a prime example of a Kiddush Hashem moment. There was a big magic show being per formed onstage, and the magi cian announced, “I need a phone! Anyone in this audi ence has a phone?”

The magician was shocked. “Well, well, what a good boy!” he said. “I think I’m actually being a bad influence here!”

157WeeklyLink.com תָבַּשַּׁה םַעֹנ תוֹמָׁשְנַּה יִעיִבְׁשַּהְו גֶנֹע ,תוֹחוּרָה ןֶדֵעְו ,תוֹשָׁפְנַּה ןֵדַּעְתִהְל ךְָתָבֲהַאְבּ ךֶָתָאְרִיְו ת"ישהזעב סעומש עכילרעה יד ןטלאה טימ טמוק טיילעגניא עגילדנעצ ואוו השרפ יד ףיוא טימ טיילגאב ,ךאוו עדעי האנה ןבאה איקידצד אלוליה ןוא םישרדמ עכילרעה םעט בוטב טנרעלעגראפ אלפנ ןפואב תעדו ג"הרה ךרוד ןייטש ךורב ריאמ א"טילש ישיש ליל עדעי ץינזיוו םייח תרות להקד ד"מהיב ןיא 5228 New Utrecht Avenue 9:00 העשב םכתשפנ תא יחתו ועמש ןושלה לוק ףיוא וו"ייל ןרעה ןעמ ןעק השרד יד 718-906-6420 ןקורד ךרוד ןרעה סע ןעמ ןעק רועיש יד ךאנ וינעמ ןיעמ יד ןופ 17 ךאנרעד1 הרות ירועיש דעוו ץינזיוו םייח תרות להקד YFdesign YFDESIGN Narratives andtrueReal-Life InspirationsAuthentic,Realistic&UndeniableConcerningourgeneration’schallenge:thebattleagainsttechnology154 Volume A projectof:

A ripple of laughter. A better question would have been, “Does anyone in the audience not have a phone?” But when the magician start ed pointing to random mem bers of the audience, he was in for a surprise. “You!” he point ed. “What phone do you have?”

It was unreal. The entire au dience clapped heartily for this young boy who had mustered all his strength and courage to stick to his Ashreinu!principles.Weare a nation unlike any other in the entire world! Can you imagine how much nachas Hashem derived from this double Kiddush Hashem?!

There are certain occasions when we get to witness a Kid dush Hashem that just takes our breath away. It makes us so proud to be part of Klal Yis roel, and we feel that Hashem is surely deriving such pleasure from His wonderful children.

There was a moment of stunned silence, and then an other round of applause, even louder and more festive than the first time around.

The boy looked up and firm ly shook his head. He gave back the Smartphone and said, “I don’t want to look at it.”

22

ןבירטראפ ןבירטראפ טאטש ןופ

Boggglle Boggle Boggle your mind (not your computer) • No adding “s” at end of a word. • All words must appear in the Merriam Webster Dictionary • Write 4, 5, & 6 letter words in separate columns. • No Abbreviations 4 letter word: 2 points 5 letter word: 3 points 6 letter word: 5 points 7 letter word: 7 points 8 letter word: 9 points 9 or more: 12 points PLEASE WRITE YOUR TOTAL POINTS SUBMISSIONS must be faxed or emailed by Sunday, 8 pm SEND ANSWERSYOURTO: F 347.787.4018 E info@weeklylink.com A 1303 53rd St. #I25 Brooklyn, New York 11219 WHNZV DALKI OSRBE MGCPF UYFKT SEE LAST WEEK’S WINNER ON PAGE: 172

win a reward for your award !הדועת ןייד ראפ טניולאב רעוו Fax, email or mail your award for a chance to win a gift certificate! Certificates should only be sent in once. Call to claim your prize. F | 347-787-4018 E | info@weeklylink.com M | 1303-53rd Street #125 B'klyn, NY 11219 T | 347-787-1838 לעגנע ירעפ ץטיוואסאק יסיז קישטליפ אגרש דעירפ גילעז רשא גאלשרעה לדיירפ יוואל ןרהא לאפר

163WeeklyLink.com

Parsha Puzzle ACROSS 1 Ping-____ 5 Ostentatious display 9 Caller ID listings 14 Purim month 15 Woodwind instrument 16 Entertain 17 Dollars and cents 20 Dashboard num. 21 Snoopy 22 Finish 24 Hallmark goods 27 Choice word 29 Close, as the door 32 Larger sizes 33 Proofread 34 Why? Because I ___ __ 35 Like flowers in May 37 Mexican chip 39 Put on a button 40 Delhi country 42 Devoted 44 Possess 46 Elevator name 48 Monkey fruit 51 Cell-phone predecessor 53 Decays 55 Little branch 56 Use a keyboard 57 Partner, in a war 58 Airplane seating option 59 Where you were, at crimetime 61 Leopard or panther 63 Who stole the cookies from the cookie ___? 65 Racquet sport field 70 Right __ ___ button! 72 Effortlessness 73 Oppressive ruler 74 Non-Jews 75 Stiff hair or bristle 76 Catch sight of DOWN 1 Buddy 2 Long poem 3 Nudge 4 Son of a son 5 Kettles and woks 6 Followed orders 7 It’s between Sun and Tue 8 Table base 9 Aromatic ointment 10 Morning hours 11 My line moves slowest, etc. 12 Extrasensory perception letters 13 Post high school, for short 18 ___ Angeles 19 LA-NY dir. 23 Home of the Stars and Stripes 24 Tax calculator 25 NYS capital 26 Ba’ath, in Saddam’s Iraq 28 Kindled Unscramble the circled letters to discover the "LINK" to Parshas Shoftim!! These poeple must be honest and true, To show all the Yidden the right things to do. 30 Utilize 31 Haul, like a broken car 33 Discharge 34 Tofu source 36 Scent 38 Corn holders 41 American Continentaland 43 Poison fighter 44 Choose 45 Path 47 Sun, to José 49 Nothingness 50 It gets larger every year 52 Electric fish 54 Microsoft Word user 57 Honest president 58 Rainbow shape 60 Article 62 Like a sailing sailboat 63 Get some exercise 64 It’s between an N and a P 66 Not, to a Scot 67 Battleship initials 68 Knock on the door 69 Attempt 71 Friendly greeting Parshas Shoftim Puzzle

http://www.dailysudoku.com/hardDaily Sudoku: Thu 14-Jun-2007 reserved.rightsAll2007.LtdSudokuDaily(c) 5 3 4 7 8 3 9 1 7 1 4 5 6 3 7 2 1 9 5 8 6 7 5 5 1 7 6 8 hardDaily Sudoku: Thu 14-Jun-2007 reserved.rightsAll2007.LtdSudokuDaily(c) 9 5 6 3 1 4 7 2 8 7 2 3 6 5 8 9 1 4 8 1 4 2 7 9 3 5 6 1 4 9 5 6 7 8 3 2 2 6 5 8 9 3 4 7 1 3 7 8 4 2 1 6 9 5 4 3 2 9 8 5 1 6 7 6 8 7 1 3 2 5 4 9 5 9 1 7 4 6 2 8 3 http://www.dailysudoku.com/hardDaily Sudoku for Kids: Tue 18-Apr-2017 reserved.rightsAll2022.LtdSudokuDaily(c) F D G I B C B E H D F D B F I G B E H H G C E A D F H C E G I B D F H B A C hardDaily Sudoku for Kids: Tue 18-Apr-2017 reserved.rightsAll2022.LtdSudokuDaily(c) E H F A D G I B C I A B E C H G D F G D C I B F H E A A I D F G B E C H F C E H I A D G B H B G C E D F A I B G I D F C A H E C E A G H I B F D D F H B A E C I G hardMonster Daily Sudoku: Tue 15-Aug-2006 reserved.rightsAll2022.LtdSudokuDaily(c) 3 1 B 6 A 9 5 E A 8 4 1 7 5 C 9 A B E D 1 5 O 1 3 F 9 4 D B 6 7 A F 1 1 D A 3 C B 9 3 6 9 F B O F E C 6 1 D A 5 F 6 5 E D B 2 9 8 O A 6 B 7 9 D 8 7 O 6 E 8 2 6 3 B C 7 A 2 O F E 6 4 8 4 3 9 E 5 B D 3 8 2 7 6 E A O 8 F 1 4 2 Monster Sudoku - Test your brains to solve this puzzle of A-F and numbers 0-9! Solutions to this week's puzzles can be found in this magazine. Numerical Sudoku - Having numbers 1-9 in any order, in every row, column and 3x3 cell. Alphabetical Sudoku - Having lettetrs A-I in any order, in every row, column and 3x3 cell.

creativecorner! Libby & Meilich Wieder, & Freida Ruchy LibbyWolkenfeldWeider5 Chaya’la Fisch 5 Moshe Gancfried 8 Leah Housman 7 Zissy Kasovitz

Mayer & Shloime Kleinman 10 & 6 Moishy Gancfried Bassy Friedman 6 Rivky Weinberger 8 Shmiel Duvid Taub 11 Yossi, Moshe & Sholme Rosenberger Elfer Family Duvid Hershy Portugal 4 Rachel Chaya Maleh Matti Goldberg 5 Family Pilchick Simcha Bunim 5 & Esty Knopfler 4

ד”סב Kraft it! page!coloredbeautifullyyourseetoloveWe’d info@weeklylink.comtopictureaSend

ד”סב Kraft it! Don’t forget to send a picture to info@weeklylink.comLast step: Step 1: Cut out all the pieces on the other page. Step 2: Put glue on the two red straps. Then stick them on as shown. Step 4: Unfold. Put glue as shown in the picture. Then close the pocket. It should look like this: Step 5: Put glue on the pocket.sticksquarewhiteandonthe You are ready for school! Put all the school supplies into your briefcase! Step 6: Step 3: Fold the pink pocket at the red dotted lines your own mini School bag! Let’s make

ד”סב Kraft it!

Sudoku Solutions hardDaily Sudoku: Thu 14-Jun-2007 reserved.rightsAll2007.LtdSudokuDaily(c) 4 7 8 9 3 1 9 5 6 7 5 5 1 7 6 8 9 5 6 3 1 4 7 2 8 7 2 3 6 5 8 9 1 4 hardDaily Sudoku for Kids: Tue 18-Apr-2017 reserved.rightsAll2022.LtdSudokuDaily(c) F D G I B C B E H D F D B F I G B E H H G C E A D F H C E G I B D F H B A C E H F A D G I B C I A B E C H G D F Monster Daily Sudoku: Tue 15-Aug-2006A43B28FA6 4 LETTER ITEMGESTGERMFUMEFETAFESTEMITDESKDAWNDATECHITCHIPBLIPBITE SMUGSEMISAWNSATERUMPRUEDRESTPITAOBITMITEMESALITELIMPLIME WIMPWADEVITATIMETERMTEMPTASKSWIMSWATSWANSTEM 5 LETTER REMITMITERMERCYLITERGUESTFUMEDFEMURDEMURCRUETCRESTCHIMPCHIMEBLIMPASTER WIMPYWATERWASTEWADERTIMERTIMEDSMITESKATESERUMSEDANSATED 6 LETTER WASTERWASTEDSKATERCHIMED 7 LETTER PREDAWN Note: The Weekly Link will automatically disqualify any submissions with any words that are not in the Webster’s Dictionary. Boggle Boggle Boggle your mind (not your computer) • No adding “s” at end word. • All words must appear in the Merriam Webster Dictionary • Write 4, 5, & 6 letter in separate columns. • No Abbreviations 4 letter word: 2 points 5 letter word: 3 points 6 letter word: 5 points 7 letter word: 7 points 8 letter word: 9 points 9 or more: 12 points PLEASETOTALWRITEPOINTS SUBMISSIONS must be faxed or emailed Sunday, 8 pm SEND ANSWERSYOURTO: F 347.787.4018 E info@weeklylink.com A 1303 53rd St. #I25 Brooklyn, New York 11219 HYLVJ OBCPI WMRTN AUESZ QGFDK SEE LAST WEEK’S WINNER ON PAGE: BOGGL E WINNER LASTWINNER:WEEK’S 180HorowitzFamilyPoints Attention Kids: --» up to ages 16 «-Are you a Master Mind? Show us your knowledge! Send in your list of words by fax: 347.787.4018 or email: info@weeklylink.com. The winner with the most words will be published in next week’s issue, Deadline: Sunday RULES: • When submitting words, must include age . • No proper nouns • The word needs to be found in the Merriam Webster’s dictionary • Three-letter words and up • No abbreviations • If there will be words that are not found in the Merriam Webster’s dictionary your game will be disqualified • Mastermind cannot be done with a computer • Must include amount of words to qualify Master Mind! How many words can you make with the letters in the word TELEPHONE WINNERWEEK'SLAST bowboarbinsbinbarsbarnsbarnbarbanair ranrainsrainbowrainnowbrowsbrowbrainsbrainbows soarsnowsnobsirsinsawrowsrowribsrib winwaswarswarnwarwanswanswabsonsob wins Word RuchyRAINBOWSSchwartz—12 years old (41words) Please contact our office to claim your prize

173WeeklyLink.com Classifieds Classified Rates: - To ensure placement of your classified ad you must pay for your ad. - ALL RATES ARE PER WEEK. 1 Week_ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ $22 5 Weeks_ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ $18 12 Weeks_ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _$15 25 Weeks_ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _$13 50 Weeks_ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _$10 Bold_ _ _ _ _ _ _ _ _ _ _ _ _ _ _ _Additional $3 - Deadline for classified placement is Monday, 5 PM. - Fax or email your classified ad to: Freeclassified@weeklylink.com347-787-4018Classifieds: - Placement is not guaranteed. - Must be faxed or emailed Wednesday or Thursday. Excluding service and business ads. Select a Category:  House for Sale  Apartments  Offices  Lost & Found  Merchandise  Apparel  Babysitting  Services  Job Opportunity  L’shem Mitzva  Vacation Rental  Other Credit Card Info: Name________________________Exp. Date: ___ Card #: ________________________ CVV: _____ Address: ______________________ Zip: ______

174 AUG 31, 2022 PROPERTY FOR SALE Property for Sale Swan Lake, beautiful house, big 5000 SF, garage Few acres can build lots of houses Call/Text Agent: 347 903 1072 HOUSE / CONDO FOR SALE House / Condo For Sale BP, high 50's, new condo, 2918 SF, double big sz D/R L/R, upgraded kitchen, taxes: $2500/yr Block has lots of kids Call/Text: 917 720 7152 House / Condo For Sale BP 43rd St, 2 BDR apt, 2 flights up, elevator building Leave Message: 718 388 5170 House / Condo For Sale BP MAPLE RESIDENCE Brand new gorgeous ready to move in apartments, 4+BDR Agent: 347 687 8455 House / Condo For Sale BP NU/50's, 2 story building, great cond, built 20x50 on 20x80 Only $999K Broker: 732 708 2004 House / Condo For Sale BP *18/high 40's, 1 fam, 2 stories + bsmt, 20x60 att Asking $1 4 *19/low 50's, low 2 fam, 2 stories, 20x50 brk Ready plans to build up Asking $1 175 *14/38, 2 fam brick 2 Flr + bsmt, 20x50 on 20x100, att R6 $1 175 *18/high 40's, 1 fam house, 30x50 on 50x65, driveway, MIC, $1 95 Call Broker: 732 708 2004 House / Condo For Sale BP 3 Fam brk house 3 flr+fin bsmt, built 26 wide (R6, can build up) Semi att, priv parking MIC 4 Fam brk det on 40 lot, vacant, R6 MCS Properties 718 686 8680x105 House / Condo For Sale Fallsburg Lake Forest, beautiful summer home, 2 flr, 7 BDR, 4 bath Near shul, pool, park Winterized, fireplace, C/H+A/C, shed, parquet flr, Jacuzzi, lg decks Sale, $480k 718 757 1552 House / Condo For Sale Monsey Calvert/306 area, brand new 5 BDR duplex upgraded condos, bright 347 628 2637 HOUSE / CONDO FOR RENT House / Condo For Rent Buy, sell, or rent your next home at JFINDER.COM, a real estate platform for the heimish communities HOUSE WANTED House Wanted Seeking to rent w/ option to buy any house, condo, or property Your terms $$. Have good credit. 646 904 1247 APARTMENT PROPERTY FOR SALE Property for Sale Swan Lake, beautiful house, big 5000 SF, garage Few acres can build lots of houses Call/Text Agent: 347 903 1072 HOUSE / CONDO FOR SALE House / Condo For Sale BP, high 50's, new condo, 2918 SF, double big sz D/R L/R, upgraded kitchen, taxes: $2500/yr. Block has lots of kids Call/Text: 917 720 7152 House / Condo For Sale BP-43rd St, 2 BDR apt, 2 flights up, elevator building Leave Message: 718 388 5170 House / Condo For Sale BP - MAPLE RESIDENCE Brand new gorgeous ready to move in apartments, 4+BDR Agent: 347 687 8455 House / Condo For Sale BP NU/50's, 2 story building, great cond, built 20x50 on 20x80 Only $999K Broker: 732 708 2004 House / Condo For Sale BP *18/high 40's, 1 fam, 2 stories + bsmt, 20x60 att Asking $1 4 *19/low 50's, low 2 fam, 2 stories, 20x50 brk. Ready plans to build up. Asking $1 175 *14/38, 2 fam brick 2 Flr + bsmt, 20x50 on 20x100, att R6 $1 175 *18/high 40's, 1 fam house, 30x50 on 50x65, driveway, MIC, $1.95. Call Broker: 732 708 2004 House / Condo For Sale BP 3 Fam brk house 3 flr+fin bsmt, built 26 wide (R6, can build up). Semi-att, priv parking MIC 4 Fam brk det on 40 lot, vacant, R6 MCS Properties 718 686 8680x105 House / Condo For Sale Fallsburg Lake Forest, beautiful summer home, 2 flr, 7 BDR, 4 bath Near shul, pool, park W interized, fireplace, C/H+A/C, shed, parquet flr, Jacuzzi, lg decks Sale, $480k 718 757 1552 House / Condo For Sale Monsey-Calvert/306 area, brand new 5 BDR duplex upgraded condos, bright 347 628 2637 HOUSE / CONDO FOR RENT House / Condo For Rent Buy, sell, or rent your next home at JFINDER.COM, a real estate platform for the heimish communities HOUSE WANTED House Wanted Seeking to rent w/ option to buy any house, condo, or property. Your terms $$. Have good credit. 646-904-1247 APARTMENT HOUSE / CONDO FOR RENT House / Condo For Rent Elmwood Ave Tiferes chynka area, 3 BDR, 2 baths, porch, attached garage, parking spot, W/D, ss appliances, split A/C incl Call/Text:646 926 3691 House / Condo For Rent ULTRA LUXURIOUS HOUSE FOR RENT IN CENTER OF MONSEY, MAGNIFICENT GROUNDS WITH MOUNTAINS VIEW CALL:845 459 5702 HOUSE / CONDO FOR SALE House / Condo For Sale BP 11th & 43rd, 2 fam, semi det, brick, finished bsmt, good cond, delivered vacant, R6 zoning, 20x100 lot size, 19x75 built, asking $1,7m Call/Text Isaac Shmedra Landau: 718 853 0202 House / Condo For Sale BP 14th & 41st, store plus 3 apts, great for user or investment, asking $1,8m Call/Text Isaac Shmedra Landau:718 853 0202 House / Condo For Sale BP 20th & 62nd, 4 fam, brk, semi det, delivered vacant, 25x100 lot, 20x75 built, fin bsmt, w/sep ent needs some work, $1 899m Call/Text Isaac Shmedra Landau: 718 853 0202 House / Condo For Sale BP 63rd / 21st Ave 2 fam APARTMENT UNFURNISHED Apartment Unfurnished A gorgeous, 2 room house, brand new, 4 BDR house, center of Monticello, near all shopping Call:718 801 1915 Apartment Unfurnished BP 11th & 53rd, 4 room apt, 2 flights up Ideal for choson/kallah 718 438 7961 or 718 926 6136 Apartment Unfurnished BP 12th & 40th, beautiful brand new 2 5 BDR apt, white kitchen, marble floors, split units, $2400 Call:347 731 8988 Apartment Unfurnished BP 14th & 55th, 1 BDR apt, in elevator building, W/D ok Call Agent:718 851 6259 Call:718 851 6529 Apartment Unfurnished BP 14th & 56th, spacious 3 BDR apt for rent, new kitchen Call:347 633 8256 Apartment Unfurnished Apartment Unfurnished Flatbush Ave K & E 31st, newly renov large 1 BDR bsmt New full bath, W/D hookup 718 437 1811 Apartment Unfurnished Linden 3 BDR house in central heimishe area, large backyard & basement, avail for long term Text: 908 443 1071 Apartment Unfurnished Ocean Parkway/Foster Large 3 BDR apt, 2 baths, eat in kitchen, large L/R, D/R, 2 porches, $2950, good credit only Call:917 653 3812 Apartment Unfurnished Ocean Pkwy & Parkville, 3 fam house, 3rd flr, 3 large BDR, 1 5 baths EIK, L/R, D/R, backyard, $2400 718 436 1897/718 938 8388 APARTMENT FURNISHED Apartment Furnished BP 12th ave Brand new 2 BDR bsmt, avail Sept 22 for the month, linen & towels incl, reasonable Call: 718 541 2829 Apartment Furnished BP 13th & 54th, new 1 & 2 BDR, 1 flight up, full kitchen, bath, A/C, W/D, linen Daily, Shabbos, weekly, monthly Day: 718 686 0909 Eve: 347 524 7686 Apartment Furnished BP 13 h & 55 h 2 BDR i 7/8 BP 14th & 41st, store plus 3 apts, great for user or investment, asking $1,8m Call/Text Isaac Shmedra Landau:718 853 0202 House / Condo For Sale BP 20th & 62nd, 4 fam, brk, semi det, delivered vacant, 25x100 lot, 20x75 built, fin bsmt, w/sep ent needs some work, $1 899m Call/Text Isaac Shmedra Landau: 718 853 0202 House / Condo For Sale BP 63rd / 21st Ave, 2 fam, semi detached, good cond, parking, finished bsmt w/ separate entrance, nice backyard, 23x100 lot, 20x36 built, asking $1,4m Call/Text, Isaac Shmedra Landau: 718 853 0202 House / Condo For Sale Dahill Rd & 60th, 2 fam, semi det, good cond, parking, 22x100 lot Sz, 16x68 built, delivered vacant, asking $1,299 Call/Text Isaac Shmedra Landau: 718 853 0202 House / Condo For Sale East 8/Ditmas, 2 family, 25x100 lot, 20x70, good cond, full fin bsmt, parking, asking $1,690m Call/Text Isaac Shmedra Landau: 718 853 0202 BP 14th & 55th, 1 BDR apt, in elevator building, W/D ok Call Agent:718 851 6259 Call:718 851 6529 Apartment Unfurnished BP 14th & 56th, spacious 3 BDR apt for rent, new kitchen Call:347 633 8256 Apartment Unfurnished BP 18/47, 3 BDR, 2 baths, EIK, DR/LR, sunny porch, New carpet, sec 8 OK 718 851 0825 Apartment Unfurnished BP 18th & 60th, bsmt room avail for weekends & month of Tishrei, fresh, clean, private entrance, all amenities, 2 4 beds Call/Lv Msg: 347 790 8692 Apartment Unfurnished BP18th & 47th, 2 BDR, big Kitchen dinette, util incl Call:917 202 4174 BP 12th ave Brand new 2 BDR bsmt, avail Sept 22 for the month, linen & towels incl, reasonable Call: 718 541 2829 Apartment Furnished BP 13th & 54th, new 1 & 2 BDR, 1 flight up, full kitchen, bath, A/C, W/D, linen Daily, Shabbos, weekly, monthly Day: 718 686 0909 Eve: 347 524 7686 Apartment Furnished BP 13th & 55th, 2 BDR attic 7/8 beds kit W/D G/E, inc linens porch, short/long term 347 224 7945 Apartment Furnished BP 15th & 50th, 3 BDR, 1 5 bath 1200 SF avail for short term Text:929 475 1558 Apartment Furnished BP 18th & 53rd, beautiful 1 BDR bsmt apt for rent, large kitchen dinette, A/C W/D Call:718 851 0626 Apartment Furnished BP 18th & 55th, beautiful 1 BDR bsmt apt, priv ent, kitchen/din, W/D 347 446 6114 Apartment Furnished Ellenville NY fully renov, 2 BDR Apt avail to rent for Shabbosim/weeks Call/Text:347 519 0625 Apartment Furnished Flatbush ave J & East 27, large1 BDR bsmt, util incl, near shopping & trans Call:917 734 4146 Apartment Furnished I Would like to rent out a room in my BP apt to a frum single girl(s) (out of town welcome), priv bed & bath, W/D, C/A incl, nr shopping/trans Avail immed, grt price, & location 718 755 8402/347 314 5040 SHORT TERM RENTALS Short Term Rentals 1 BDR furnished apt, good location or can be used as a small office space Call/Lv msg:929 269 6919 Short Term Rentals Are you looking for an apt to rent in Yerushalayim for Succos? Call Tivuch Yumim Tovim, we have apts in all sizes & areas, Call:0527 699 551 Beau to re c sh BP 1 Oct Call/L Hug sukk spac th Wo Ind Grou Toms 5 ba ov p li am da Yer apt, big la VA Ai HOUSE / CONDO FOR RENT House / Condo For Rent Elmwood Ave Tiferes chynka area, 3 BDR, 2 baths, porch, attached garage, parking spot, W/D, ss appliances, split A/C incl Call/Text:646 926 3691 House / Condo For Rent ULTRA LUXURIOUS HOUSE FOR RENT IN CENTER OF MONSEY, MAGNIFICENT GROUNDS WITH MOUNTAINS VIEW CALL:845 459 5702 HOUSE / CONDO FOR SALE House / Condo For Sale BP 11th & 43rd, 2 fam, semi det, brick, finished bsmt, good cond, delivered vacant, R6 zoning, 20x100 lot size, 19x75 built, asking $1,7m Call/Text Isaac Shmedra Landau: 718 853 0202 House / Condo For Sale BP 14th & 41st, store plus 3 apts, great for user or investment, asking $1,8m Call/Text Isaac Shmedra Landau:718 853 0202 House / Condo For Sale BP 20th & 62nd, 4 fam, brk, semi det, delivered vacant, 25x100 lot, 20x75 built, fin bsmt, w/sep ent needs some work, $1 899m Call/Text Isaac Shmedra Landau: 718 853 0202 House / Condo For Sale BP 63rd / 21st Ave 2 fam APARTMENT UNFURNISHED Apartment Unfurnished A gorgeous, 2 room house, brand new, 4 BDR house, center of Monticello, near all shopping Call:718 801 1915 Apartment Unfurnished BP 11th & 53rd, 4 room apt, 2 flights up Ideal for choson/kallah 718 438 7961 or 718 926 6136 Apartment Unfurnished BP-12th & 40th, beautiful brand new 2.5 BDR apt, white kitchen, marble floors, split units, $2400. Call:347-731-8988 Apartment Unfurnished BP 14th & 55th, 1 BDR apt, in elevator building, W/D ok Call Agent:718 851 6259 Call:718 851 6529 Apartment Unfurnished BP 14th & 56th, spacious 3 BDR apt for rent, new kitchen Call:347 633 8256 Apartment Unfurnished BP 18/47 3 BDR 2 b th EIK Apartment Unfurnished Flatbush Ave K & E 31st, newly renov large 1 BDR bsmt New full bath, W/D hookup 718 437 1811 Apartment Unfurnished Linden 3 BDR house in central heimishe area, large backyard & basement, avail for long term Text: 908 443 1071 Apartment Unfurnished Ocean Parkway/Foster Large 3 BDR apt, 2 baths, eat in kitchen, large L/R, D/R, 2 porches, $2950, good credit only Call:917 653 3812 Apartment Unfurnished Ocean Pkwy & Parkville, 3 fam house, 3rd flr, 3 large BDR, 1 5 baths EIK, L/R, D/R, backyard, $2400 718 436 1897/718 938 8388 APARTMENT FURNISHED Apartment Furnished BP 12th ave Brand new 2 BDR bsmt, avail Sept 22 for the month, linen & towels incl, reasonable Call: 718 541 2829 Apartment Furnished BP 13th & 54th, new 1 & 2 BDR, 1 flight up, full kitchen, bath, A/C, W/D, linen Daily, Shabbos, weekly, monthly Day: 718 686 0909 Eve: 347 524 7686 Apartment Furnished BP 13th & 55th 2 BDR tti 7/8 BP 14th & 41st, store plus 3 apts, great for user or investment, asking $1,8m Call/Text Isaac Shmedra Landau:718 853 0202 House / Condo For Sale BP 20th & 62nd, 4 fam, brk, semi det, delivered vacant, 25x100 lot, 20x75 built, fin bsmt, w/sep ent needs some work, $1 899m Call/Text Isaac Shmedra Landau: 718 853 0202 House / Condo For Sale BP 63rd / 21st Ave, 2 fam, semi detached, good cond, parking, finished bsmt w/ separate entrance, nice backyard, 23x100 lot, 20x36 built, asking $1,4m Call/Text, Isaac Shmedra Landau: 718 853 0202 House / Condo For Sale Dahill Rd & 60th, 2 fam, semi det, good cond, parking, 22x100 lot Sz, 16x68 built, delivered vacant, asking $1,299 Call/Text Isaac Shmedra Landau: 718 853 0202 House / Condo For Sale East 8/Ditmas, 2 family, 25x100 lot, 20x70, good cond, full fin bsmt, parking, asking $1,690m Call/Text Isaac Shmedra Landau: 718 853 0202 BP 14th & 55th, 1 BDR apt, in elevator building, W/D ok Call Agent:718 851 6259 Call:718 851 6529 Apartment Unfurnished BP 14th & 56th, spacious 3 BDR apt for rent, new kitchen Call:347 633 8256 Apartment Unfurnished BP 18/47, 3 BDR, 2 baths, EIK, DR/LR, sunny porch, New carpet, sec 8 OK 718 851 0825 Apartment Unfurnished BP 18th & 60th, bsmt room avail for weekends & month of Tishrei, fresh, clean, private entrance, all amenities, 2 4 beds Call/Lv Msg: 347 790 8692 Apartment Unfurnished BP18th & 47th, 2 BDR, big Kitchen dinette, util incl Call:917 202 4174 BP 12th ave Brand new 2 BDR bsmt, avail Sept 22 for the month, linen & towels incl, reasonable Call: 718 541 2829 Apartment Furnished BP 13th & 54th, new 1 & 2 BDR, 1 flight up, full kitchen, bath, A/C, W/D, linen Daily, Shabbos, weekly, monthly Day: 718 686 0909 Eve: 347 524 7686 Apartment Furnished BP 13th & 55th, 2 BDR attic 7/8 beds kit W/D G/E, inc linens porch, short/long term 347 224 7945 HOUSE / CONDO FOR RENT House / Condo For Rent Elmwood Ave Tiferes chynka area, 3 BDR, 2 baths, porch, attached garage, parking spot, W/D, ss appliances, split A/C incl Call/Text:646 926 3691 House / Condo For Rent ULTRA LUXURIOUS HOUSE FOR RENT IN CENTER OF MONSEY, MAGNIFICENT GROUNDS WITH MOUNTAINS VIEW CALL:845 459 5702 HOUSE / CONDO FOR SALE House / Condo For Sale BP 11th & 43rd, 2 fam, semi det, brick, finished bsmt, good cond, delivered vacant, R6 zoning, 20x100 lot size, 19x75 built, asking $1,7m Call/Text Isaac Shmedra Landau: 718 853 0202 House / Condo For Sale BP 14th & 41st, store plus 3 apts, great for user or investment, asking $1,8m Call/Text Isaac Shmedra Landau:718 853 0202 House / Condo For Sale BP 20th & 62nd, 4 fam, brk, semi det, delivered vacant, 25x100 lot, 20x75 built, fin bsmt, w/sep ent needs some work, $1 899m Call/Text Isaac Shmedra Landau: 718 853 0202 House / Condo For Sale APARTMENT UNFURNISHED Apartment Unfurnished A gorgeous, 2 room house, brand new, 4 BDR house, center of Monticello, near all shopping Call:718 801 1915 Apartment Unfurnished BP 11th & 53rd, 4 room apt, 2 flights up Ideal for choson/kallah 718 438 7961 or 718 926 6136 Apartment Unfurnished BP 12th & 40th, beautiful brand new 2 5 BDR apt, white kitchen, marble floors, split units, $2400 Call:347 731 8988 Apartment Unfurnished BP 14th & 55th, 1 BDR apt, in elevator building, W/D ok Call Agent:718 851 6259 Call:718 851 6529 Apartment Unfurnished BP 14th & 56th, spacious 3 BDR apt for rent, new kitchen Call:347 633 8256 Apartment Unfurnished Apartment Unfurnished Flatbush Ave K & E 31st, newly renov large 1 BDR bsmt New full bath, W/D hookup 718 437 1811 Apartment Unfurnished Linden 3 BDR house in central heimishe area, large backyard & basement, avail for long term Text: 908 443 1071 Apartment Unfurnished Ocean Parkway/Foster Large 3 BDR apt, 2 baths, eat in kitchen, large L/R, D/R, 2 porches, $2950, good credit only Call:917 653 3812 Apartment Unfurnished Ocean Pkwy & Parkville, 3 fam house, 3rd flr, 3 large BDR, 1 5 baths EIK, L/R, D/R, backyard, $2400 718 436 1897/718 938 8388 APARTMENT FURNISHED Apartment Furnished BP 12th ave Brand new 2 BDR bsmt, avail Sept 22 for the month, linen & towels incl, reasonable Call: 718 541 2829 Apartment Furnished BP 13th & 54th, new 1 & 2 BDR, 1 flight up, full kitchen, bath, A/C, W/D, linen Daily, Shabbos, weekly, monthly Day: 718 686 0909 Eve: 347 524 7686 Apartment Furnished BP 14th & 41st, store plus 3 apts, great for user or investment, asking $1,8m Call/Text Isaac Shmedra Landau:718 853 0202 House / Condo For Sale BP 20th & 62nd, 4 fam, brk, semi det, delivered vacant, 25x100 lot, 20x75 built, fin bsmt, w/sep ent needs some work, $1 899m Call/Text Isaac Shmedra Landau: 718 853 0202 House / Condo For Sale BP 63rd / 21st Ave, 2 fam, semi detached, good cond, parking, finished bsmt w/ separate entrance, nice backyard, 23x100 lot, 20x36 built, asking $1,4m Call/Text, Isaac Shmedra Landau: 718 853 0202 House / Condo For Sale Dahill Rd & 60th, 2 fam, semi det, good cond, parking, 22x100 lot Sz, 16x68 built, delivered vacant, asking $1,299 Call/Text Isaac Shmedra Landau: 718 853 0202 House / Condo For Sale East 8/Ditmas, 2 family, 25x100 lot, 20x70, good cond, full fin bsmt, parking, asking $1,690m Call/Text Isaac Shmedra Landau: 718 853 0202 BP 14th & 55th, 1 BDR apt, in elevator building, W/D ok Call Agent:718 851 6259 Call:718 851 6529 Apartment Unfurnished BP 14th & 56th, spacious 3 BDR apt for rent, new kitchen Call:347 633 8256 Apartment Unfurnished BP 18/47, 3 BDR, 2 baths, EIK, DR/LR, sunny porch, New carpet, sec 8 OK 718 851 0825 Apartment Unfurnished BP 18th & 60th, bsmt room avail for weekends & month of Tishrei, fresh, clean, private entrance, all amenities, 2 4 beds Call/Lv Msg: 347 790 8692 Apartment Unfurnished BP18th & 47th, 2 BDR, big Kitchen dinette, util incl Call:917 202 4174 BP 12th ave Brand new 2 BDR bsmt, avail Sept 22 for the month, linen & towels incl, reasonable Call: 718 541 2829 Apartment Furnished BP 13th & 54th, new 1 & 2 BDR, 1 flight up, full kitchen, bath, A/C, W/D, linen Daily, Shabbos, weekly, monthly Day: 718 686 0909 Eve: 347 524 7686 Apartment Furnished BP 13th & 55th, 2 BDR attic 7/8 beds kit W/D G/E, inc linens porch, short/long term 347 224 7945

175WeeklyLink.com Bloomingrove: 3 bedroom, 6 beds + cribs available for weekends. Please Call: 845-826-6247 ד"סב SUKKOS YERUSHALAYIMINFlightsCarApartment CALL NOW: 929.388.3895 OR EMAIL: koshereaze@gmail.com שדוקה ריע RENTALS Friendly helpful service TISHREIYERUSHALAYIMRENTAL Big apartment on Shamgar available for the month of Tishrei. 4 BDR, 10 beds. Stunning view. Most central location, near all Chassidishe shuls & shopping centers. $1800/night. Min 2 weeks. For Details & 5000844sr@gmail.comReservation:(Nomediation)

176 AUG 31, 2022

Job

Opportunity A busy construction office in Brooklyn is looking to hire a multi talented F/T or P/T secretary to do office work, willing to train Email resumes to: teamhr1377@gmail com Job Opportunity A Heimishe office in BP seeking F/T workers, grads welcome. Call:929 568 6372 Job Opportunity Amazon business looking to hire a F/T worker, basic computer & amazon skills a plus for interests, Email: amazonposition1@gmail com Job Opportunity Are you an exp secretary & looking to work in a yeshiva office? Email your resume to: yeshivaofficeposition@gmail com Job Opportunity Bais Yaakov of Boro Park is seeking upper elementary & middle school teacher, exp pref Email: eisnert@bjbp org/ Call: 718 436 7300 ext 308 Job Opportunity Beth Jacob daycare center is seeking assistant teachers, F/T from 8:45 4 & P/T from 8:45 1:00/12:30 4, no degree necessary Call Leah Mandel:718 435 5755 ext 263/ Email resume to:mandell@BJBP org Job Opportunity see Grea BP assis BP H female Em BP afterno p BP m g Em Fax BP Shou Vacation Rental MONSEY SHABBOS GETAWAY Spacious 7 BDR house in Concord for Shabbosim 19+ beds, XL deck & backyard, 3 flr Linens & Shabbos essentials prov Call:845 548 6478 Vacation Rental North Miami Beach, 4 BDR villa, large D/R L/R, 2 full bath, priv pool, towels/linen prov, kosher kitchen, walk to shul, beautiful grounds Avail weekday/weekend/Yom Tov Call: 845 662 6980 Vacation Rental Pl i Sh bb i M ? OFFICE / SPACE FOR RENT Office / Space for Rent BP 13th & 55, 2 rooms, front entrance, prime location bsmt, 260 SF, $1275 Call:347 224 7945 Office / Space for Rent BP *New Utrecht & mid 50's Car For Sale 2018 Toyota Sienna XLE 8 seats, mint condition, 20,500 miles only Asking 31,600 Call:718 724 3736 to shul, beautiful grounds Avail weekday/weekend/Yom Tov Call: 845 662 6980 Vacation Rental Planning a Shabbos in Monsey? 1 & 2 room suites, fully furnished, avail for Shabbosim in center of Monsey 845 352 8564 Vacation Rental Seagate Vacation Home Avail weekday/weekend/Yom Tov Fresh ocean air in beautiful resort 1, 2 & 3 BDR homes 718 946 1236 Vacation Rental Union, NJ 3 BDR house, 2 min walk to shul Large playground & deck in backyard Linen, towels & basic amenities Avail weekly/weekends 347 668 7840 BUNGALOW FOR RENT Bungalow For Rent Woodbourne, beautiful 2 BDR bung, nicely furnished, huge priv grnds, mikva, across bush & park gardens 347 304 1132 or 718 972 1749 SF, $1275 Call:347 224 7945 Office / Space for Rent BP *New Utrecht & mid 50's, prof office spaces, $350 $1500 *Mid 50's & NU office rm, $350 *Mid 50's & 12th bsmt rm, $675 *Office rms for females, $200+ Broker: 732 708 2004 Office / Space for Rent Brandnew small room office/storage 2 rent ground level 13 & 51 Call:718 801 1915 Office / Space for Rent Driveway for rent ave I east 16th Call:646 606 4894 Office / Space for Rent Office space 1200 SF, Ocean Parkway, Foster, $1775 Call:917 653 3812 CAR FOR SALE Car For Sale Car Donations Donate your vehicle. Receive $1500 tax deduction + $2400 in gift card. We buy cars too! 718 974 9428 Call:718 724 3736 JOB OPPORTUNITY Job Opportunity Co teacher for Yiddish speaking playgroup w/90 credits towards BA for Sep Small class! Call:646 413 2039 Job Opportunity Popular non profit seeking a F/T female customer service Rep, must have strong verbal & written, comm skills, be friendly, organized & tech savvy, Microsoft office is a must Email resume:office@chasdeilev org Job Opportunity Special Ed Yeshiva in Bklyn seeks Female Assistant Teachers for full or half day sessions, warm supportive environment, competitive pay Email resume: JCSE1760@gmail com 718 782 0064 x 103 Job Opportunity 12 ave & 47 Yiddish speaking play looking for co/teacher for the coming year (with no smartphone) Lv msg: 917 627 2146 Vacation Rental MONSEY SHABBOS GETAWAY Spacious 7 BDR house in Concord for Shabbosim 19+ beds, XL deck & backyard, 3 flr Linens & Shabbos essentials prov Call:845 548 6478 Vacation Rental North Miami Beach, 4 BDR villa, large D/R L/R, 2 full bath, priv pool, towels/linen prov, kosher kitchen, walk to shul, beautiful grounds Avail weekday/weekend/Yom Tov Call: 845 662 6980 Vacation Rental Planning a Shabbos in Monsey? 1 & 2 room suites, fully furnished, avail for Shabbosim in center of Monsey 845 352 8564 Vacation Rental Seagate Vacation Home Avail weekday/weekend/Yom Tov Fresh ocean air in beautiful resort 1, 2 & 3 BDR homes 718 946 1236 Vacation Rental Union, NJ 3 BDR house, 2 min walk to shul Large playground & deck in backyard Linen, towels & basic amenities Avail weekly/weekends 347 668 7840 BUNGALOW FOR RENT Bungalow For Rent Woodbourne, beautiful 2 BDR bung, nicely furnished, huge priv grnds, mikva, across bush & park gardens 347 304 1132 or 718 972 1749 OFFICE / SPACE FOR RENT Office / Space for Rent BP 13th & 55, 2 rooms, front entrance, prime location bsmt, 260 SF, $1275 Call:347 224 7945 Office / Space for Rent BP *New Utrecht & mid 50's, prof office spaces, $350 $1500 *Mid 50's & NU office rm, $350 *Mid 50's & 12th bsmt rm, $675 *Office rms for females, $200+ Broker: 732 708 2004 Office / Space for Rent Brandnew small room office/storage 2 rent ground level 13 & 51 Call:718 801 1915 Office / Space for Rent Driveway for rent ave I east 16th Call:646 606 4894 Office / Space for Rent Office space 1200 SF, Ocean Parkway, Foster, $1775 Call:917 653 3812 CAR FOR SALE Car For Sale Car Donations Donate your vehicle Receive $1500 tax deduction + $2400 in gift card We buy cars too! 718 974 9428 Car For Sale 2018 Toyota Sienna XLE 8 seats, mint condition, 20,500 miles only Asking 31,600 Call:718 724 3736 JOB OPPORTUNITY Job Opportunity Co teacher for Yiddish speaking playgroup w/90 credits towards BA for Sep. Small class! Call:646 413 2039 Job Opportunity Popular non profit seeking a F/T female customer service Rep, must have strong verbal & written, comm skills, be friendly, organized & tech savvy, Microsoft office is a must Email resume:office@chasdeilev org Job Opportunity Special Ed Yeshiva in Bklyn seeks Female Assistant Teachers for full or half day sessions, warm supportive environment, competitive pay Email resume: JCSE1760@gmail com 718 782 0064 x 103 Job Opportunity 12 ave & 47 Yiddish speaking play looking for co/teacher for the coming year (with no smartphone) Lv msg: 917 627 2146 Vacation Rental MONSEY SHABBOS GETAWAY Spacious 7 BDR house in Concord for Shabbosim 19+ beds, XL deck & backyard, 3 flr Linens & Shabbos essentials prov Call:845 548 6478 Vacation Rental North Miami Beach, 4 BDR villa, large D/R L/R, 2 full bath, priv pool, towels/linen prov, kosher kitchen, walk to shul, beautiful grounds Avail weekday/weekend/Yom Tov Call: 845 662 6980 Vacation Rental Planning a Shabbos in Monsey? 1 & 2 room suites, fully furnished, avail for Shabbosim in center of Monsey 845 352 8564 Vacation Rental Seagate Vacation Home Avail weekday/weekend/Yom Tov Fresh ocean air in beautiful resort 1, 2 & 3 BDR homes 718 946 1236 Vacation Rental Union, NJ 3 BDR house, 2 min walk to shul Large playground & deck in backyard Linen, towels & basic amenities Avail weekly/weekends 347 668 7840 OFFICE / SPACE FOR RENT Office / Space for Rent BP 13th & 55, 2 rooms, front entrance, prime location bsmt, 260 SF, $1275 Call:347 224 7945 Office / Space for Rent BP *New Utrecht & mid 50's, prof office spaces, $350 $1500 *Mid 50's & NU office rm, $350 *Mid 50's & 12th bsmt rm, $675 *Office rms for females, $200+ Broker: 732 708 2004 Office / Space for Rent Brandnew small room office/storage 2 rent ground level 13 & 51 Call:718 801 1915 Office / Space for Rent Driveway for rent ave I east 16th Call:646 606 4894 Office / Space for Rent Office space 1200 SF, Ocean Parkway, Foster, $1775 Call:917 653 3812 Car For Sale 2018 Toyota Sienna XLE 8 seats, mint condition, 20,500 miles only Asking 31,600 Call:718 724 3736 JOB OPPORTUNITY Job Opportunity Co teacher for Yiddish speaking playgroup w/90 credits towards BA for Sep Small class! Call:646 413 2039 Job Opportunity Popular non profit seeking a F/T female customer service Rep, must have strong verbal & written, comm skills, be friendly, organized & tech savvy, Microsoft office is a must Email resume:office@chasdeilev org Job Opportunity Special Ed Yeshiva in Bklyn seeks Female Assistant Teachers for full or half day sessions, warm supportive environment, competitive pay amenities Avail weekly/weekends 347 668 7840 BUNGALOW FOR RENT Bungalow For Rent Woodbourne, beautiful 2 BDR bung, nicely furnished, huge priv grnds, mikva, across bush & park gardens 347 304 1132 or 718 972 1749 Call:917 653 3812 CAR FOR SALE Car For Sale Car Donations Donate your vehicle Receive $1500 tax deduction + $2400 in gift card We buy cars too! 718-974-9428 half da envir J 12 ave looking yea L e, s, 29 h, 5 R, et or Vacation Rental Airmont, beautiful spacious vacation house, 5 BDR, 10 beds, 2 baths, deck, supersize playground avail for weekends & weekly close to shul, all amenities incl Call:347 485 4149/347 678 6565 Vacation Rental Beautiful suite on park like property in Airmont avail daily, weekly/ Shabbosim, all Linens, towels & shabbos essentials prov, 10 beds & expandable option Email:shabbosairmont@gmail com Vacation Rental Belle Harbor, corner beach block Shabbos, Yom Tov & mid wk Enjoy fresh ocean air 2 & 3 BDR apts Eruv, nr shuls, kosher, 20 min from BP Summer rentals avail 347 619 3525 Vacation Rental Apt eks e1 ng & n my ut of W/D, vail 0 on or ace nt in vuch all the month of Tishrei, 39th bet 15th/16th Call:718 438 4730 Short Term Rentals Newly renov, priv villa in Woodburn,15+ beds, L/R, fire pit, Indoor Jacuzzi, huge picnic area Group or family availability from Sep 8, & succos Call/Text:347 699 5192 Short Term Rentals Toms River-heimishe area, 6 BDR, 5 baths, sleeps 25+, Lg sukkah on oversized deck w/cots, heated pool, swing set, near shul, linen/towels, & all shabbos amenities, many extras, other dates Call/Text:917 923 1295 ISRAEL APARTMENTS Israel Apartments Yerushalayim, Kaduri area, 3 BDR apt, 6 beds, decent kosher sukkah, big large D/R, on 8th floor w/shabbos elevator, for more info Call: 972 5331 72717 VACATION RENTAL Vacation Rental Airmont, beautiful new suite for couples Nice grounds Shabbos & Yomim Tovim 845 352 4875 apts Eruv, nr shuls, kosher, 20 min from BP Summer rentals avail 347 619 3525 Vacation Rental Fully renovated 2 bdrm apt, avail to rent in Ellenville for Shabbosim/Weeks ideal for 2 couples or family Call/Text 347 519 0625 Vacation Rental Linden, 3 BDR, 2 bath vacation home, avail for the weekends Linen, towels, etc incl, lg backyard Please Text: 908 443 1071 Vacation Rental Miami Beach, newly renov 1 BDR apt, beautiful ocean view 347 760 0570 Vacation Rental Miami Beach, spacious 2 BDR, 2 bath condo, across Masada II. New kit, porch, beautiful view, heated pool, near shuls, shopping, beach. Avail weekly Opt of Shabbos food Call/Text: 347 247 4816 Vacation Rental Monsey House Magnificent, luxurious, 8 BDR, Lg dining/living room, Huge kitchens, bkyds, swing sets, etc. great for your Shabbosim getaways & Simchos Book now for Sukkas! Large sukkah inc. 347 831 6836 D pt & my of D, or e n ch l Short Term Rentals Beautiful 3 room, brand new house, to rent from Rosh Hoshana/Succos, center of Monticello, near all shopping, & colony’s, w/minyan Call:718 801 1915 Short Term Rentals BP 15th & 39th, house avail, Sep 29 Oct 24 thru Succos, 5 BDR, 3 bath, porches Call/Lv msg:347 224 5101/718 435 1170 Short Term Rentals Huge house, 5 BDR, 4 baths, D/R, sukkah w/awning, central a/c, closet space, parking, all conveniences, for the month of Tishrei, 39th bet 15th/16th Call:718 438 4730 Short Term Rentals Newly renov, priv villa in Woodburn,15+ beds, L/R, fire pit, Indoor Jacuzzi, huge picnic area Group or family availability from Sep 8, & succos Call/Text:347 699 5192 Short Term Rentals Toms River-heimishe area, 6 BDR, 5 baths, sleeps 25+, Lg sukkah on oversized deck w/cots, heated pool, swing set, near shul, linen/towels, & all shabbos amenities, many extras, other dates Call/Text:917-923-1295 ISRAEL APARTMENTS Israel Apartments Yerushalayim, Kaduri area, 3 BDR apt, 6 beds, decent kosher sukkah, big large D/R, on 8th floor w/shabbos elevator, for more info Call: 972 5331 72717 VACATION RENTAL Vacation Rental Airmont, beautiful new suite for couples Nice grounds Shabbos & Yomim Tovim 845 352 4875 Vacation Rental Airmont, beautiful spacious vacation house, 5 BDR, 10 beds, 2 baths, deck, supersize playground avail for weekends & weekly close to shul, all amenities incl Call:347 485 4149/347 678 6565 Vacation Rental Beautiful suite on park like property in Airmont avail daily, weekly/ Shabbosim, all Linens, towels & shabbos essentials prov, 10 beds & expandable option Email:shabbosairmont@gmail com Vacation Rental Belle Harbor, corner beach block Shabbos, Yom Tov & mid wk Enjoy fresh ocean air 2 & 3 BDR apts Eruv, nr shuls, kosher, 20 min from BP Summer rentals avail 347 619 3525 Vacation Rental Fully renovated 2 bdrm apt, avail to rent in Ellenville for Shabbosim/Weeks ideal for 2 couples or family Call/Text 347 519 0625 Vacation Rental Linden, 3 BDR, 2 bath vacation home, avail for the weekends Linen, towels, etc incl, lg backyard Please Text: 908 443 1071 Vacation Rental Miami Beach, newly renov 1 BDR apt, beautiful ocean view 347 760 0570 Vacation Rental Miami Beach, spacious 2 BDR, 2 bath condo, across Masada II. New kit, porch, beautiful view, heated pool, near shuls, shopping, beach. Avail weekly Opt of Shabbos food Call/Text: 347 247 4816 Vacation Rental Monsey House Magnificent, luxurious, 8 BDR, Lg dining/living room, Huge kitchens, bkyds, swing sets, etc. great for your Shabbosim getaways & Simchos Book now for Sukkas! Large sukkah inc. 347 831 6836

177WeeklyLink.com SPECIAL EDUCATION AGENCY SEEKING OFFICE EMPLOYEE PleasantComputerPart-timeskillsrequiredworkenvironmentBoroughPark email: hr@itstherapygroup.com Little Giants Child Center currently seeking: Classroom Teacher and instructors. Great hours & location (9:15-3:15)! ABA & Floortime training provided. Earn hours towards your license. BP & Williamsburg positions available.OurJoinTeam LittleGiants Child Center is Looking to Fill the Following Positions: • • • Email resume: info@littlegiantscc.com Join our team of professionals and enjoy our warm & collaborative work environment! New state of the facilityart requireddegreeNo Looking for 1:1 instructors for special needs school. Wonderful environment!!! Email resume to mkatz@mastermindsaba.org or call 718-370-3140 (inquire about our work experience hours towards your BA!) $500 BONUS IF YOU SIGN CONTRACT BEFORE JULY 15 SECRETARY F/T Position available in BP office for responsible, Organized individual that is able to multi task. Beginners welcome, willing to train. Excellent environment and opportunity for rapid growth! Email resumes Tehila@promont.nycto F N A N C A L M A N A G E M E N T T e a m @ r i n g e l c o . c o m We now have openings for additional talent to join our fabulous team and enjoy a pleasant work environment with great potential Want to enjoy what you do? Email resume to: Our team is for the books! ד"סב Sign up for a rewarding job while earning excellent pay and bonuses! Great com/hab opportunities available to work with males and females BORO PARK • KENSINGTON FLATBUSH • CROWN HEIGHTS CEDARHURST • QUEENS Weekends and after school at home and in the community 718-252-3365 ext 102 renay@specialcarefor.com 718-252-3365 ext 113 pessyl@specialcarefor.com MAKE SPECIAL’SDIFFERENCEAINSOMEONELIFE!

ABA Paras male & female to work with children in Flatbush, Crown Heights & Monsey [no degree is required] [nocoordinatorBillinggroupstoLicensedcollegeLBA'sCollectionsAccountant-Department&BCBA'sstudentswelcomeTeachersteach1:1andsmallinlocalyeshivosexperiencenecessary] ResumesEmail: @Lbaps.com Warm, supportive and workingenjoyableenvironment.Weofferhighlycompetitivesalaryandbonuses!!

ד”סב Chayeinu Academy is looking to fill the following positions: To join our experienced team and work in a warm, welcoming environment, email your resume to info@chayeinuacademy.org 1:1 FTInstructorsOccupational Therapist Areyou the perfectfit?

435 5221 Job

Heimishe agency serving the special needs population seeks a highly organized team player with excellent communication skills, P/T 10 2 Email your resume to: mrsk@specialcarefor com Job

Heimishe BP multi girl CPA office seeking recent H/S grad F/T secretary/bookkeeper, will train

Heimishe

seeking female secretary, great working envir, great pay Call: 718-972-1016 Email resume: office@film581 com Heimis F/T fe atmo bpo Heimis lea Heimis hire preferre Mon T 12 5 Heimish for a re secretary sec Call:84 Heimish babysi Y Heimis 2nd gra h atm Kinderv wa assista envi grad rhaf Look (fema someon co inf Lookin in boys B se ooklyn o do king me ire a mazon m ing to com eking e 8 eeking 5 4 & no h 63/ P org er F/T few mputer sume: 646 or ping & + x /T st be n, com Job Opportunity BP Bookkeeping Office seeking F/T account managers Great environment, multi girl office We will train Team@ringelco com Job Opportunity BP Headstart seeking half day assistants, 1:00 3:30, excellent pay, warm atmosphere Email resume to: pjobopening@gmail com Job Opportunity BP Heimishe office seeks capable female for administrative duties, some exp necessary, will train, great oppor Email:joboffer1643@gmail com Job Opportunity BP heimish girls school seeking afternoon elementary assistants great pay ekbb1222@gmail com/ Fax 718 483 8392 Job Opportunity BP multi girl office has F/T position, great envir, filtered internet Email:hiringnowbp@gmail com Fax:718 943 0740/Call:718 414 1120 Job Opportunity BP office seeking a F/T secretary Should be computer efficient & have the ability to multitask Email: Chaim@pluginson13 com Job Opportunity BP preschool seeking capable assistant once a week, full day, nice pay Email resume to: preschooljobsbp@gmail com/ Call:347 930 8573 Job Opportunity Bright, detail oriented girl/woman to work F/T in busy BP office w/ solid communication, interpersonal, clerical, data entry & phone skills Email: emil@acimportexport com Call: 917 363 3681 Job Opportunity Busy heimishe BP office seeking F/T girl secretary, grad pref, efficient, detail oriented w/ good comm skills, option to start after summer job2021bp@gmail com Job Opportunity Busy heimishe office is looking for a billing rep, benefits incl great pay, health insurance, paid Yom Tov, vacation days & legal holidays Email resume to: sarah@royalcare nyc Job Opportunity Busy wig salon in bp looking for an exp stylist only Call:718 801 1914 Job Opportunity Career Institution in BP looking to hire a student support specialist, positive office envir, great phone & communication skills a must Email resume to: yy icany@gmail com Job Opportunity Career School seeking professional & organized coordinator to assist & manage students' schedules & courses, hours 9:30 5 pm, salary starting at $40k/year Email resume: resumes@careerlyny com Job Opportunity Chassidishe girls H S seeking teachers: bio, accounting, graphics, communication skills, excellent pay Call:646 267 6342 Job Opportunity Chassidishe preschool seeking full day & half day afternoon assistant, great envir! Call/Lv msg:347 670 4282 Job Opportunity Children's store in Willi looking for a sales lady 347 668 4188 Job Opportunity Comhab/Respite Coordinators Looking for F/T, resp & organized persons w/ excellent communication & comp skills to work w/ parents, workers & care managers Responsibilities include coordinating services, recordkeeping & collaborating with a team Email: jobs@hcsny org skills specifically excel Email resume: jobs@boneiolam org/ Lv msg:646 930 4882 Job Opportunity Bookkeeping position avail for Non Profit in BP, prior bookkeeping & QB exp a must, admire exp a + Email resume to: mosodjobs@gmail com/fax Fax:732 686 6499 Job Opportunity BP Accounting firm seeks F/T secretary, multi girl office, must be detail oriented & org, will train, great growth oppor Email Resume:cpa4job@gmail com Email resume to: preschooljobsbp@gmail com/ Call:347 930 8573 Job Opportunity Bright, detail oriented girl/woman to work F/T in busy BP office w/ solid communication, interpersonal, clerical, data entry & phone skills Email: emil@acimportexport com Call: 917 363 3681 Job Opportunity Busy heimishe BP office seeking F/T girl secretary, grad pref, efficient, detail oriented w/ good comm skills, option to start after summer job2021bp@gmail com 347 668 4188 Job Opportunity Comhab/Respite Coordinators Looking for F/T, resp & organized persons w/ excellent communication & comp skills to work w/ parents, workers & care managers Responsibilities include coordinating services, recordkeeping & collaborating with a team Email: jobs@hcsny org klyn do ng . a zon g to m ng ing 4 & o org F/T w uter me: 6 g & be Job Opportunity BP Bookkeeping Office seeking F/T account managers Great environment, multi girl office We will train Team@ringelco com Job Opportunity BP Headstart seeking half day assistants, 1:00 3:30, excellent pay, warm atmosphere Email resume to: pjobopening@gmail com Job Opportunity BP Heimishe office seeks capable female for administrative duties, some exp necessary, will train, great oppor Email:joboffer1643@gmail com Job Opportunity BP heimish girls school seeking afternoon elementary assistants great pay ekbb1222@gmail com/ Fax 718 483 8392 Job Opportunity BP multi girl office has F/T position, great envir, filtered internet Email:hiringnowbp@gmail com Fax:718 943 0740/Call:718 414 1120 Job Opportunity BP office seeking a F/T secretary Should be computer efficient & have the ability to multitask Email: Chaim@pluginson13 com Job Opportunity BP preschool seeking capable assistant once a week, full day, nice pay Email resume to: preschooljobsbp@gmail com/ Call:347 930 8573 Job Opportunity Bright, detail oriented girl/woman to work F/T in busy BP office w/ solid communication, interpersonal, clerical, data entry & phone skills Email: emil@acimportexport com Call: 917 363 3681 Job Opportunity Busy heimishe BP office seeking F/T girl secretary, grad pref, efficient, detail oriented w/ good comm skills, option to start Job Opportunity Busy heimishe office is looking for a billing rep, benefits incl great pay, health insurance, paid Yom Tov, vacation days & legal holidays Email resume to: sarah@royalcare nyc Job Opportunity Busy wig salon in bp looking for an exp stylist only Call:718 801 1914 Job Opportunity Career Institution in BP looking to hire a student support specialist, positive office envir, great phone & communication skills a must Email resume to: yy icany@gmail com Job Opportunity Career School seeking professional & organized coordinator to assist & manage students' schedules & courses, hours 9:30 5 pm, salary starting at $40k/year Email resume: resumes@careerlyny com Job Opportunity Chassidishe girls H S seeking teachers: bio, accounting, graphics, communication skills, excellent pay Call:646 267 6342 Job Opportunity Chassidishe preschool seeking full day & half day afternoon assistant, great envir! Call/Lv msg:347 670 4282 Job Opportunity Children's store in Willi looking for a sales lady 347 668 4188 Job Opportunity Comhab/Respite Coordinators Looking for F/T, resp & organized persons w/ excellent communication & comp skills to work w/ parents, workers & care managers Responsibilities include coordinating services, recordkeeping & collaborating with a team skills specifically excel Email resume: jobs@boneiolam org/ Lv msg:646 930 4882 Job Opportunity Bookkeeping position avail for Non Profit in BP, prior bookkeeping & QB exp a must, admire exp a + Email resume to: mosodjobs@gmail com/fax Fax:732 686 6499 Job Opportunity BP Accounting firm seeks F/T secretary, multi girl office, must be detail oriented & org, will train, great growth oppor Email Resume:cpa4job@gmail com Email resume to: preschooljobsbp@gmail com/ Call:347 930 8573 Job Opportunity Bright, detail oriented girl/woman to work F/T in busy BP office w/ solid communication, interpersonal, clerical, data entry & phone skills Email: emil@acimportexport com Call: 917 363 3681 Job Opportunity Busy heimishe BP office seeking F/T girl secretary, grad pref, efficient, detail oriented w/ good comm skills, option to start after summer job2021bp@gmail com y 347 668 4188 Job Opportunity Comhab/Respite Coordinators Looking for F/T, resp & organized persons w/ excellent communication & comp skills to work w/ parents, workers & care managers Responsibilities include coordinating services, recordkeeping & collaborating with a team Email: jobs@hcsny org YOUR AD HERE EMAIL: classified @weeklylink.com CALL: 347-787-1838

Job Opportunity Opportunity Call:718 Opportunity BP Office

degree necessary Call Leah Mandel:718 435 5755 ext 263/ Email resume to:mandell@BJBP org Job Opportunity Bonei Olam BP looking to higher F/T female admin assistant with a few years exp, proficient phone/ computer skills specifically excel Email resume: jobs@boneiolam org/ Lv msg:646 930 4882 Job Opportunity Bookkeeping position avail for Non Profit in BP, prior bookkeeping & QB exp a must, admire exp a + Email resume to: mosodjobs@gmail com/fax Fax:732 686 6499 Job Opportunity BP Accounting firm seeks F/T secretary, multi girl office, must be detail oriented & org, will train, great growth oppor Email Resume:cpa4job@gmail com y Email: Chaim@pluginson13 com Job Opportunity BP preschool seeking capable assistant once a week, full day, nice pay Email resume to: preschooljobsbp@gmail com/ Call:347 930 8573 Job Opportunity Bright, detail oriented girl/woman to work F/T in busy BP office w/ solid communication, interpersonal, clerical, data entry & phone skills Email: emil@acimportexport com Call: 917 363 3681 Job Opportunity Busy heimishe BP office seeking F/T girl secretary, grad pref, efficient, detail oriented w/ good comm skills, option to start after summer job2021bp@gmail com assistant, great envir! Call/Lv msg:347 670 4282 Job Opportunity Children's store in Willi looking for a sales lady 347 668 4188 Job Opportunity Comhab/Respite Coordinators Looking for F/T, resp & organized persons w/ excellent communication & comp skills to work w/ parents, workers & care managers Responsibilities include coordinating services, recordkeeping & collaborating with a team Email: jobs@hcsny org Job Opportunity Do you enjoy working with individuals with special needs? HCS is seeking energetic girls/young women to work at our afterschool program, share your talents & have a good time, hours are from 3 6 Job Opportunity Flatbush based heimishe agency looking for P/T bookkeeper Min 2 years exp, ability to multitask with good organizational skills strong teamworker Email mrsk@specialcarefor com Job Opportunity Growing agency in BP looking for P3 female provider in the afternoon hours for younger boys Job Opportunity Heimishe BP office seeking to hire F/T female secretary, heimishe atmosphere, top pay w/ great potential Email resume to: bpofficeopening@gmail com Job Opportunity Heimishe exp younger man avail to learn with your son/bachur Call:917 789 4288 Job Opportunity Heimish girls office in BP looking to hire a FT secretary, graduate preferred, NO INTERNET ACCESS Mon Thurs:10 5, every 2nd Sun 12 5, every 2nd Fri 10 12:30 Job Opportunity Do you enjoy working with individuals with special needs? HCS is seeking energetic girls/young women to work at our afterschool program, share your talents & have a good time, hours are from 3 6 Forward resume to:jobs@hcsny org Job Opportunity Early Interv Service Coordinator F/T P/T, great work envir, flex hrs, BA in psychology, sociology, social work human serv/related field req will train Fax:718 633 7726 Email:cpminfony@gmail com Job Opportunity Enhanced cases for p3 provider! #901 4th grade boy, Ave M & E 31 3hrs/wk, #1008: 9th gr boy, Ave S & E 23, 5 hrs/wk Email: yehudis@p3connect com Call:718 362 6086 Ext 104 Job Opportunity EXECUTIVE ASSISTANT : Large Non Profit org in BP Must have prior office exp, proficient in MS Word, & Excel Fax resume:718 438 5259 Email:nfischer@bicco org Job Opportunity F/T position in busy office, 2 hours on Sun needed, no Fridays, basic computer knowledge & excellent phone/customer service skills req Email resume to: eventsplus952@gmail com Job Opportunity Flatbush based heimishe agency looking for F/T qualified senior accountant, minimum 5 years exp, requirements incl: •Manage our Accounting dept •Ability to multi task with strong organizational skills •Full health & dental benefits Email resume to: mrsk@specialcarefor com Job Opportunity Flatbush based heimishe agency looking for P/T bookkeeper Min 2 years exp, ability to multitask with good organizational skills strong teamworker Email mrsk@specialcarefor com Job Opportunity Growing agency in BP looking for P3 female provider in the afternoon hours for younger boys Email Resume to: launchfwd123@gmail com Job Opportunity HCS is seeking an in house marketing specialist, must be able to handle large projects as well as have exp in graphics & copyright Forward your resume to: jobs@hcsny org Job Opportunity Heimish BP Office seeking a F/T female secretary for a busy eCommerce business, must have great interpersonal skills, computer skills a plus, willing to train, grads welcome, additional oppor avail for female with exp in Amazon priv label Email resume: Rivky@gimmeshades com Job Opportunity Heimishe agency serving the special needs population seeks a highly organized team player with excellent communication skills, P/T 10 2 Email your resume to: mrsk@specialcarefor com Job Opportunity Heimishe BP multi girl CPA office seeking recent H/S grad F/T secretary/bookkeeper, will train Call:718 435 5221 Job Opportunity Heimishe BP Office seeking female secretary, great working envir, great pay. Call: 718-972-1016 Email resume: office@film581.com Heim h prefe Mo 12 Heim for a secret s Call: Heim baby Heim 2nd g Kind assi en g rh Lo (fe some Look in bo Job Opportunity Do you enjoy working with individuals with special needs? HCS is seeking energetic girls/young women to work at our afterschool program, share your talents & have a good time, hours are from 3 6 Forward resume to:jobs@hcsny org Job Opportunity Early Interv Service Coordinator F/T P/T, great work envir, flex hrs, BA in psychology, sociology, social work human serv/related field req will train Fax:718 633 7726 Email:cpminfony@gmail com Job Opportunity Enhanced cases for p3 provider! #901 4th grade boy, Ave M & E 31 3hrs/wk, #1008: 9th gr boy, Ave S & E 23, 5 hrs/wk Email: yehudis@p3connect com Call:718 362 6086 Ext 104 Job Opportunity EXECUTIVE ASSISTANT : Large Non Profit org in BP Must have prior office exp, proficient in MS Word, & Excel Fax resume:718 438 5259 Email:nfischer@bicco org Job Opportunity F/T position in busy office, 2 hours on Sun needed, no Fridays, basic computer knowledge & excellent phone/customer service skills req Email resume to: eventsplus952@gmail com Job Opportunity Flatbush based heimishe agency looking for F/T qualified senior accountant, minimum 5 years exp, requirements incl: •Manage our Accounting dept •Ability to multi task with strong organizational skills •Full health & dental benefits Email resume to: mrsk@specialcarefor com Job Opportunity Flatbush based heimishe agency looking for P/T bookkeeper Min 2 years exp, ability to multitask with good organizational skills strong teamworker Email mrsk@specialcarefor com Job Opportunity Growing agency in BP looking for P3 female provider in the afternoon hours for younger boys Email Resume to: launchfwd123@gmail com Job Opportunity HCS is seeking an in house marketing specialist, must be able to handle large projects as well as have exp in graphics & copyright Forward your resume to: jobs@hcsny org Job Opportunity Heimish BP Office seeking a F/T female secretary for a busy eCommerce business, must have great interpersonal skills, computer skills a plus, willing to train, grads welcome, additional oppor avail for female with exp in Amazon priv label Email resume: Rivky@gimmeshades.com

181WeeklyLink.com Please call to apply 347.452.0897 1437 49 Street 4917 14 Avenue ןיא עקאמשעגטעבראארעפסאמטא skymediaco.co 1565 59 Street Heimishe office in BP seeking customer service reps full-time and part-time (2 pm - 6:30 pm Wednesday/Thursday flexible). Great environment, great pay. Email hr@tuvtaamfish.com TEACHER-22/23SCHOOLYEAR Harrison Daycare Williamsburg Must have 90 credits and working toward your BA Competitive Salary-Transportation provided Email resume: sgreenfeld@unitedacademyny.org Health Food Store in Boro Park seeking individual for customer service and register. Some knowledge in health required. Great Email:vitamanstorebp@gmail.compay.

182 AUG 31, 2022 JOB SECRETARIESOPENINGS&DAYCAREDIRECTOR REGISTRATIONSEPTEMBERNOWOPEN! Tailored to suit your special occasion Local references a T: 646-642-3623 E: MK C reative Photography by Mordechai Dov Mentionthisadfor 15% off! Should CreativeMordechairead:Dovphotography tailored to suit your special occasion Local refernces available upon request @instagramE:MKamornik@gmail.comT:646-642-3623 Weddings - Bar Mitz vas - Engagements Por traits - Commercial - Video @Mord Tailored to suit your special oc C reative Photography by Mordechai Dov Mentionthisadfor Weddings - Bar M Por traits - Commer Tailored to suit your special occasion C reative Photography by Mordechai Dov Mentionthisadfor 15% off! Weddings - Bar Mitz vas - Engagements Por traits - Commercial - Video Tailored to suit your special occasion Local references available upon request .T: 646-642-3623 E: MK amornik@gmail.com C reative Photography by Mordechai Dov Mentionthisadfor 15% off! Should CreativeMordechairead:Dovphotography tailored to suit your special occasion Local refernces available upon request @instagramE:MKamornik@gmail.comT:646-642-3623 Weddings - Bar Mitz vas - Engagements Por traits - Commercial - Video @MordyphotosAddressing123718.972.1873ComputerizedSystemBONUS: Get a free Upgraded Printout of your list

JoinTeam!our Become a Payroll Specialist at Attending Home Care. Position Large Brooklyn-based Home Care Agency is looking to hire an experienced payroll specialist to oversee our payroll department. Qualifications • Responsible and dedicated individual • Strong organizational ability and attention to detail • Excellent communication and interpersonal skills with a customer service orientation • Highly responsive • andFlexibleable to juggle competing priorities • Able to colleagueseffectivelyinteractwithacross all levels of organization. Benefits Competitive salary of $60$75K/year + benefits package, pleasant work environment, and excellent growth opportunities. Apply Today! Email your resume dinzlicht@attendingllc.comto:

Job Opportunity Seeking playgroup teacher & assistant for school year, Yiddish speaking Call:347 666 2758

set great envir, flex hours, exp strongly pref

184 AUG 31, 2022 YOUR AD HERE EMAIL: classified @weeklylink.com CALL: 347-787-1838 y sk m P3 ours e to ave ard g /T ve to al in cial y ent mail e male r, learn with your son/bachur Call:917 789 4288 Job Opportunity Heimish girls office in BP looking to hire a FT secretary, graduate preferred, NO INTERNET ACCESS Mon Thurs:10 5, every 2nd Sun 12 5, every 2nd Fri 10 12:30 Call:917 272 4282 Job Opportunity Heimish multi girl office in BP looking for a responsible & organized F/T secretary, great pay, Email resume to: secretarybp438@gmail com/ Call:845 871 2576 & Lv clear msg Job Opportunity Heimish school in BP is looking for a babysitter for the upcoming school Year, afternoon hours Call:646 943 2468 Job Opportunity Heimish school in BP seeking a 2nd grade assistant for afternoon hours, well paid, great atmosphere, perfect for fresh graduates Call:929 345 0845 Job Opportunity Kindervelt EHS seeks passionate, warm, loving teachers & assistants No degree req, great envir, well paid, competent graduates welcome Email resume: rhafner@kinderveltehs.org Job Opportunity Looking for an Office Admin (female pref) great oppor, for someone w/ambition, to grow in a company. Email resume info@nycdesignfile com Job Opportunity Looking for a preschool assistant in boys yeshiva, amazing envir, in BP Email resume to: secretary@yeshte com

335 4808 Job

853 4608 Job

Job Opportunity Seeking warm & devoted teachers & assistants for Sept for Yiddish speaking BP playgroup Great environment Great Message: 347 887

seeks female master teacher for pm sessions certification & experience required, warm supportive environment, competitive pay Email resume JCSE1760@gmail com 718 782 0064 x 103

Job Opportunity Yeled V Yalda Staten Island is seeking a Lead teacher for an early head start, 90 credits, BA/masters, competitive pay Email resume to: skahan@yeled org YVY is an EOE

Call/Text:347 844 3444

looking

worker

Job Opportunity Sheitel Macher in BP seeking to do wash & Call/Text:347 844

Job Opportunity St t

pay! Leave

JOB WANTED Job Wanted I il bl t k t P/T j b few

teacher,

para for a 1st grader in a heimishe school in BP, while assisting the teacher in the classroom, great pay

Job Opportunity Special Ed Yeshiva in Bklyn

5634

I l d Y hi l ki f

pay!

lefto M Armoir M Bea

Job

provider for the upcoming year Call/Text:347 645 2155 2022 2023 school year in Flatbush,

Job Opportunity Seeking playgroup assistant, Yiddish speaking, 10:30 3:00, can bring baby, also looking for a teacher 12:30 3:00 Call:718 438 2920

Job Opportunity Yiddish speaking playgroup looking Me A few br leftove Me A i hours, exp strongly pref

speaking playgroup, on 18 Ave, lower st

Job Opportunity Special Ed Yeshiva in Bklyn seeks female master teacher for pm sessions certification & experience required, warm supportive environment, competitive pay Opportunity TotSpot Opportunity Triumph ABA Yiddish Call/Lv msg:347 Opportunity Seeking a F/T Call:718 Opportunity Seeking jobs@hcsny org Opportunity Seeking a P3 great pay! Heimish envir! Trans prov resumes@yadyisroelschool org

an assistant to keep up w/ regulations, writing policies & to assist with audits when needed please forward resume to:

Job Opportunity Sheitel Macher in BP seeking worker to do wash & set great envir, flex hours, exp strongly pref Call/Text:347 844 3444

Job Opportunity S i l Ed Y hi i Bkl k

is seeking to hire female paras after school at home, cases located in BP, Flatbush & crown heights, competitive pay! Email your resume to: info@triumphaba com Job Opportunity Well established lighting company seeking a F/T female associate to work in our Heimishe beautiful office, seeking smart, organized, responsible, & quick learner that is proficient in computers, no exp necessary, will train, trans prov, in Brooklyn Call:929-468-9744 chaya.kaplan@expressivelighting com Job Opportunity Wig company in BP Seeking capable, organized female, multitasker with great PR skills, excellent pay with room for growth Contact:breindy z@bkwigs com Email Yiddis for a P for J I am to pi fundr C MER M $200 M Pare M 2 mat M 13 U IPLA $10 g M 39" be w Job Opportunity Looking for para job in BP during daytime hours in cheder/school Call/Text:347 320 2779 Job Opportunity Multiple positions avail in a billing office, F/T, female,10:00 4:45, grads welcome, option to start in September Email Resume to: hberger@ahavamedical com Job Opportunity Na'aseh Montessori Program is seeking a front desk secretary from 10:00 6:00, great pay & a great heimish environment Email your resume to: info@naaseh org/Call:718 500 3765 Job Opportunity Now Hiring! Girls for special needs kids' Sunday, program starting Sep, every Sun, from 1:30 4:30 pm, fun & exciting atmosphere, directed by Mrs Wolpin, Bay Pkwy & 80th St Email:Malkie@appliedabc com Job Opportunity Office Administrator/Secretary Commercial cleaning company in Brooklyn seeking a F/T Office Administrator/Secretary This position incl answering phones & emails, directing & managing various projects, & overall office day to day operations We are located in BP PAY: $18 $25 an hour, depending on qualifications & exp. Send us your resume: Shaya@kleenoh com Job Opportunity Professional office in BP looking for FT secretary in multi-girl office, no exp necessary, basic computer knowledge needed, will train. Email:hanna@atlantixco com Job Opportunity PT Secretary seeking P/T female secretary, afternoon hours, must be computer savvy & have personable phone skills with great customer service Email resume to: Lbank7006@gmail com Job Opportunity Receptionist, P/T, resp, efficient, busy office, highly org, comp skills, great work environ Fax: 718 633 7726 Email: cpminfony@gmail com Job Opportunity RESIDENTIAL MORTGAGE office looking for exp loan structures & processors, Heimsihe envir & lots of potential. Email resume to: bpmortgagejob@gmail.com Job Opportunity Secretary, busy real estate office, Good pay, no exp necessary, recent grad welcome Call:718 972 1163 Email:yides@mprealtyny com Job Opportunity Seeking a F/T Admin assistant, candidate must be computer savvy detail oriented & have great organizational & telephone skills Email resume: jobs@hcsny org Job Opportunity Seeking a F/T HR Coordinator Job duties include recruiting, employee relations, employee policies & assist in other HR initiatives, candidate must have knowledge of labor laws, be computer savvy & detail oriented Must have excellent organizational and communication skills Forward resume to: Jobs@hcsny org Job Opportunity Seeking a F/T or P/T morah in a Yiddish speaking playgroup, on 18 Ave, lower st Call/Lv msg:347 335 4808 Job Opportunity Seeking a F/T para for a 1st grader in a heimishe school in BP, while assisting the teacher in the classroom, great pay Call:718 853 4608 Job Opportunity Seeking an assistant to keep up w/ regulations, writing policies & to assist with audits when needed please forward resume to: jobs@hcsny org Job Opportunity Seeking a P3 provider for the upcoming year Call/Text:347 645 2155 Job Opportunity Seeking assistant graduate, F/T, to work in a toddler class, amazing training exp, fun envir, best pay Call:718-812-6575 Job Opportunity Seeking devoted heimishe teachers/babysitters for Yiddish speaking, daycare in BP for Sep, amazing work envir & great benefits! Call:718 701 6556 Ext 1 Job Opportunity Seeking F/T female yeshiva office workers, Exp in JL software a + , pleasant envir Email resume to: rwauction2020@gmail com Job Opportunity Seeking F/T paraprofessionals to work in a special education school for the 2022 2023 school year in Flatbush, great pay! Heimish envir! Trans prov resumes@yadyisroelschool org Job Opportunity Seeking p3 providers high ave high streets great pay! Call:929 376 3004/ Email:child1stservices@gmail com Job Opportunity Seeking playgroup assistant, Yiddish speaking, 10:30 3:00, can bring baby, also looking for a teacher 12:30 3:00 Call:718 438 2920 Job Opportunity Seeking playgroup teacher & assistant for school year, Yiddish speaking Call:347 666 2758 Job Opportunity Seeking warm & devoted female assistant for chassidish boys preschool Call/Lv msg:929 722 0012 Job Opportunity Seeking warm & devoted teachers & assistants for Sept for Yiddish speaking BP playgroup Great environment Great pay! Leave Message: 347 887 5634 Job Opportunity Looking for para job in BP during daytime hours in cheder/school Call/Text:347 320 2779 Job Opportunity Multiple positions avail in a billing office, F/T, female,10:00 4:45, grads welcome, option to start in September Email Resume to: hberger@ahavamedical com Job Opportunity Na'aseh Montessori Program is seeking a front desk secretary from 10:00 6:00, great pay & a great heimish environment Email your resume to: info@naaseh org/Call:718 500 3765 Job Opportunity Now Hiring! Girls for special needs kids' Sunday, program starting Sep, every Sun, from 1:30 4:30 pm, fun & exciting atmosphere, directed by Mrs Wolpin, Bay Pkwy & 80th St Email:Malkie@appliedabc com Job Opportunity Office Administrator/Secretary Commercial cleaning company in Brooklyn seeking a F/T Office Administrator/Secretary This position incl answering phones & emails, directing & managing various projects, & overall office day to day operations We are located in BP PAY: $18 $25 an hour, depending on qualifications & exp. Send us your resume: Shaya@kleenoh com Job Opportunity Professional office in BP looking for FT secretary in multi-girl office, no exp necessary, basic computer knowledge needed, will train. Email:hanna@atlantixco com Job Opportunity PT S t ki P/T f l Job Opportunity RESIDENTIAL MORTGAGE office looking for exp loan structures & processors, Heimsihe envir & lots of potential. Email resume to: bpmortgagejob@gmail.com Job Opportunity Secretary, busy real estate office, Good pay, no exp necessary, recent grad welcome Call:718 972 1163 Email:yides@mprealtyny com Job Opportunity Seeking a F/T Admin assistant, candidate must be computer savvy detail oriented & have great organizational & telephone skills Email resume: jobs@hcsny org Job Opportunity Seeking a F/T HR Coordinator Job duties include recruiting, employee relations, employee policies & assist in other HR initiatives, candidate must have knowledge of labor laws, be computer savvy & detail oriented Must have excellent organizational and communication skills Forward resume to: Jobs@hcsny org Job Opportunity Seeking a F/T or P/T morah in a Yiddish speaking playgroup, on 18 Ave, lower st Call/Lv msg:347 335 4808 Job Opportunity Seeking a F/T para for a 1st grader in a heimishe school in BP, while assisting the teacher in the classroom, great pay Call:718 853 4608 Job Opportunity S ki i t t t k / Job Opportunity Seeking assistant graduate, F/T, to work in a toddler class, amazing training exp, fun envir, best pay Call:718-812-6575 Job Opportunity Seeking devoted heimishe teachers/babysitters for Yiddish speaking, daycare in BP for Sep, amazing work envir & great benefits! Call:718 701 6556 Ext 1 Job Opportunity Seeking F/T female yeshiva office workers, Exp in JL software a + , pleasant envir Email resume to: rwauction2020@gmail com Job Opportunity Seeking F/T paraprofessionals to work in a special education school for the 2022 2023 school year in Flatbush, great pay! Heimish envir! Trans prov resumes@yadyisroelschool org Job Opportunity Seeking p3 providers high ave high streets great pay! Call:929 376 3004/ Email:child1stservices@gmail com Job Opportunity Seeking playgroup assistant, Yiddish speaking, 10:30 3:00, can bring baby, also looking for a teacher 12:30 3:00 Call:718 438 2920 Job Opportunity Seeking playgroup teacher & assistant for school year, Yiddish speaking Call:347 666 2758 Job Opportunity S ki & d t d f l no exp necessary, basic computer knowledge needed, will train Email:hanna@atlantixco com Job Opportunity PT Secretary seeking P/T female secretary, afternoon hours, must be computer savvy & have personable phone skills with great customer service Email resume to: Lbank7006@gmail com Job Opportunity Receptionist, P/T, resp, efficient, busy office, highly org, comp skills, great work environ Fax: 718 633 7726 Email: cpminfony@gmail com assisting the teacher in the classroom, great pay Call:718 853 4608 Job Opportunity Seeking an assistant to keep up w/ regulations, writing policies & to assist with audits when needed please forward resume to: jobs@hcsny org Job Opportunity Seeking a P3 provider for the upcoming year Call/Text:347 645 2155 Yiddish speaking Call:347 666 2758 Job Opportunity Seeking warm & devoted female assistant for chassidish boys preschool Call/Lv msg:929 722 0012 Job Opportunity Seeking warm & devoted teachers & assistants for Sept for Yiddish speaking BP playgroup Great environment Great pay! Leave Message: 347 887 5634 Job Opportunity Looking for para job in BP during daytime hours in cheder/school Call/Text:347 320 2779 Job Opportunity Multiple positions avail in a billing office, F/T, female,10:00 4:45, grads welcome, option to start in September Email Resume to: hberger@ahavamedical com Job Opportunity Na'aseh Montessori Program is seeking a front desk secretary from 10:00 6:00, great pay & a great heimish environment Email your resume to: info@naaseh org/Call:718 500 3765 Job Opportunity Now Hiring! Girls for special needs kids' Sunday, program starting Sep, every Sun, from 1:30 4:30 pm, fun & exciting atmosphere, directed by Mrs Wolpin, Bay Pkwy & 80th St Email:Malkie@appliedabc com Job Opportunity Office Administrator/Secretary Job Opportunity RESIDENTIAL MORTGAGE office looking for exp loan structures & processors, Heimsihe envir & lots of potential Email resume to: bpmortgagejob@gmail com Job Opportunity Secretary, busy real estate office, Good pay, no exp necessary, recent grad welcome Call:718 972 1163 Email:yides@mprealtyny com Job Opportunity Seeking a F/T Admin assistant, candidate must be computer savvy detail oriented & have great organizational & telephone skills Email resume: jobs@hcsny org Job Opportunity Seeking a F/T HR Coordinator Job duties include recruiting, employee relations, employee policies & assist in other HR initiatives, candidate must have knowledge of labor laws, be computer savvy & detail oriented Job Opportunity Seeking assistant-graduate, F/T, to work in a toddler class, amazing training exp, fun envir, best pay Call:718 812 6575 Job Opportunity Seeking devoted heimishe teachers/babysitters for Yiddish speaking, daycare in BP for Sep, amazing work envir & great benefits! Call:718 701 6556 Ext 1 Job Opportunity Seeking F/T female yeshiva office workers, Exp in JL software a + , pleasant envir Email resume to: rwauction2020@gmail com Job Opportunity Seeking F/T paraprofessionals to work in a special education school for the 2022 2023 school year in Flatbush, great pay! Heimish envir! Trans prov resumes@yadyisroelschool org Job Opportunity Seeking p3 providers high ave high exciting atmosphere, directed by Mrs Wolpin, Bay Pkwy & 80th St Email:Malkie@appliedabc com Job Opportunity Office Administrator/Secretary Commercial cleaning company in Brooklyn seeking a F/T Office Administrator/Secretary This position incl answering phones & emails, directing & managing various projects, & overall office day-to-day operations We are located in BP. PAY: $18 $25 an hour, depending on qualifications & exp Send us your resume: Shaya@kleenoh com Job Opportunity Professional office in BP looking for FT secretary in multi girl office, no exp necessary, basic computer knowledge needed, will train Email:hanna@atlantixco com Job Opportunity PT Secretary seeking P/T female secretary, afternoon hours, must be computer savvy & have personable phone skills with great customer service Email resume to: Lbank7006@gmail com Job Opportunity Receptionist, P/T, resp, efficient, busy office, highly org, comp skills, great work environ Fax: 718 633 7726 Email: cpminfony@gmail com relations, employee policies & assist in other HR initiatives, candidate must have knowledge of labor laws, be computer savvy & detail oriented Must have excellent organizational and communication skills Forward resume to: Jobs@hcsny org Job Opportunity Seeking a F/T or P/T morah in a

Job Opportunity Seeking p3 providers high ave high streets great Call:929 376 3004/ Email:child1stservices@gmail com

pay

3444

M A

Email resume JCSE1760@gmail com 718 782 0064 x 103 Job Opportunity Staten Island Yeshiva looking for middle school Rebbeim & Morot for the 2022 2023 school year. Email resumes to: rabbiwasser@jfssi org Job Opportunity Teachers assistants, for full day or am/pm for 1st & 2nd grades, excellent pay Call BYDG:718 338 5600 Ext 313 Job

Job Opportunity Seeking warm & devoted female assistant for chassidish boys preschool Call/Lv msg:929 722 0012

daycare looking for a teacher/assistant, seeking a warm & dedicated individual, great pay & envir Call:347 977 1304 Job

Job Opportunity Yeled V Yalda Staten Island is seeking a Lead teacher for an early head start, 90 credits, BA/masters, competitive Email resume to: skahan@yeled org YVY is an EOE Job Opportunity Yiddish speaking playgroup for a P/T teacher assistant/co for the upcoming Call:718 972 3867

school year

185WeeklyLink.com erience tive e pay gmail com 3 y king for & Morot l year : rg y l day or ades, Ext 313 y for a a warm & t pay & y to hire t home, bush & ay! Email m y company ociate to autiful ganized, er that is no exp s prov, in -9744 elighting y capable, ker with pay with s com for the upcoming school year Call:718 972 3867 JOB WANTED Job Wanted I am available to work at a P/T job, to pick up phones, telemarketing, fundraising, and other minor tasks Call/Lv Msg: 718 755 8402 MERCHANDISE FOR SALE Merchandise for Sale $200 gift certificate at the Raleigh Hotel, selling for $175 Call/Text:929 434 7152 Merchandise for Sale Parent's Choice Diapers Sz 4, 124 ct, $19 99 347 856 7061 Merchandise for Sale 2 44" Brand new cond onyx mattresses & beds, barely used, reasonable price Call:845 502 3880 Merchandise for Sale 13 Unlimited ride pass tickets to IPLAY America. Price: $25, free $10 game card incl w/ each ticket 347 787 1838 Merchandise for Sale 39" bed new with a brass headboard with box spring & matress Call:929 275 5428 Call/Text:347 564 8854 Merchandise for Sale Beautiful D&W BDR set in mint cond Call/Text:914-299-0058 Merchandise for Sale Beautiful D&W D/R breakfront, mint cond Call:914-299-0058 Merchandise for Sale Black chiffon & lace adult gown for rent, Sz 10 12, $250 Call:347 786 1821 Merchandise for Sale Brand new, with tag, Sz 5 adorable girls winter robe, Bonjour company, Orig $88 selling for $44 Call:718 436 2785 Merchandise for Sale Brand new little creative factory, cream & red girls bathing suits, Size 3 & 5 Call/Text 347 977 1348 Merchandise for Sale Brand new master BDR furniture for a good price Call:347 628 1481 Merchandise for Sale Brand new with tag, Tiffany & Fred genuine leather bag, originally $289, selling for $159 Call:718 438 1769 Merchandise for Sale Brother laser MFC 73620, decent cond Call/Text:917 723 5836 Merchandise for Sale Crib from the Pali Diamanté collection, good cond, 3 years old, was $1000, on sale for best offer Call/Text:917 231 6786 Merchandise for Sale Danby 8 cu, freezer in brand new cond, 24"w, 24''d, 59"h, great for small apt Call347 263 1259 Merchandise for Sale Evenflo infant car seat, brand new cond Call/Text:347 564 8854 Merchandise for Sale Feldman's Jewelry Credit $925 Selling for $875 Call:347 930 9120 Merchandise for Sale Foot massager, brand new in box, heated vibrating foot spa H&B model number FBM605, blue & white, $55/best offer, pick up in Midwood Call:718 252 5274 Merchandise for Sale Frigidaire A/C, 5000 BTU new in box, missing side fillers, $150 Call:718 436 0282 Merchandise for Sale FRUMFURNITURE COM The frum community's one stop for all furniture buying & selling! Merchandise for Sale Girls Nueces black velvet jumper Sz12, $75 Call/Text:718 974 2411 Merchandise for Sale Grey Doona in perfect condition, including base $325 Call 347 731 6923 Merchandise for Sale Italian breakfront, in excellent cond for best offer Call:347 853 9811 Merchandise for Sale Materna Soy $25/can, Neocate $36/can Call/Text:929 333 6625 Merchandise for Sale Mon Amie, New this season Floral dresses sz 8 & 12 with matching baby 2 piece 9 12 months $25 each 347 633 2932 Merchandise for Sale Neocate Nutra Call/Text:347 578 5088 Merchandise for Sale Pants, Sz 6 slim, long, 1 black& 1 navy, from Children's Place Call/Text: 718 974 2411 Merchandise for Sale Perroquet brand new black ballet shabbos shoes Sz 36 347 513 9548 Merchandise for Sale Samsung S10 phone to sell for $150 Please call 718 812 0616 Merchandise for Sale Set of 6 D/R chairs, $150 Call:347 528 1149 Merchandise for Sale Silver cross Jet travel carriage, great cond, asking $220, original price was $450 Call/Text:718 683 1227 Merchandise for Sale This season Parni taupe overall set Sz 4, new with tags Call/Text:929 387 0980 Merchandise for Sale Tickets available to Jewish Children Museum, $12/each Value $15/ticket 347 787 1838 Merchandise for Sale White bunk bed with high riser, in excellent cond, GREAT PRICE! Call:347 742 0127 APPAREL FOR SALE Apparel For Sale •Gorgeous custom made ivory and gold gowns Sizes 0, 2 •Mother of the bride cream gown with decorative beading Size 10 Call: 718 377 8484 Text: 929 545 1097 Apparel For Sale •Magnificent champagne pink w/ black beaded accent sis of bride gown Sz 4 6 •Beautiful mauve pink/black sis of bride gown Sz 12 very slenderizing Call:929 539 1557 Apparel For Sale 3 children's gowns Sz 5, 7 & 8, white & black Call:917 270 4624 Apparel For Sale 13 beautiful white children matching gowns, white tulle, just made, worn once, at a great price, Sizes 3 16 Call:347 831 9553 Apparel For Sale Adorable girls white tulle hi low wedding dress, Sz 3 Call:347 851 9633 Merchandise for Sale Brand new with tag, Tiffany & Fred genuine leather bag, originally $289, selling for $159 Call:718 438 1769 Merchandise for Sale Brother laser MFC 73620, decent cond Call/Text:917 723 5836 Merchandise for Sale Crib from the Pali Diamanté collection, good cond, 3 years old, was $1000, on sale for best offer Call/Text:917-231-6786 Merchandise for Sale Danby 8 cu, freezer in brand new cond, 24"w, 24''d, 59"h, great for small apt Call347 263 1259 Merchandise for Sale Evenflo infant car seat, brand new cond Call/Text:347 564 8854 Merchandise for Sale Feldman's Jewelry Credit $925 Selling for $875 Call:347 930 9120 Merchandise for Sale Foot massager, brand new in box, heated vibrating foot spa H&B model number FBM605, blue & white, $55/best offer, pick up in Midwood Call:718 252 5274 Merchandise for Sale Frigidaire A/C, 5000 BTU new in box, missing side fillers, $150 Call:718 436 0282 Merchandise for Sale Merchandise for Sale Grey Doona in perfect condition, including base $325 Call 347 731 6923 Merchandise for Sale Italian breakfront, in excellent cond for best offer Call:347 853 9811 Merchandise for Sale Materna Soy $25/can, Neocate $36/can Call/Text:929 333 6625 Merchandise for Sale Mon Amie, New this season Floral dresses sz 8 & 12 with matching baby 2 piece 9 12 months $25 each 347 633 2932 Merchandise for Sale Neocate Nutra Call/Text:347 578 5088 Merchandise for Sale Pants, Sz 6 slim, long, 1 black& 1 navy, from Children's Place Call/Text: 718 974 2411 Merchandise for Sale Perroquet brand new black ballet shabbos shoes Sz 36 347 513 9548 Merchandise for Sale Samsung S10 phone to sell for $150 Please call 718 812 0616 Merchandise for Sale Merchandise for Sale This season Parni taupe overall set Sz 4, new with tags Call/Text:929 387 0980 Merchandise for Sale Tickets available to Jewish Children Museum, $12/each Value $15/ticket 347-787-1838 Merchandise for Sale White bunk bed with high riser, in excellent cond, GREAT PRICE! Call:347 742 0127 APPAREL FOR SALE Apparel For Sale •Gorgeous custom made ivory and gold gowns Sizes 0, 2 •Mother of the bride cream gown with decorative beading Size 10 Call: 718 377 8484 Text: 929 545 1097 Apparel For Sale •Magnificent champagne pink w/ black beaded accent sis of bride gown Sz 4 6 •Beautiful mauve pink/black sis of bride gown Sz 12 very slenderizing Call:929 539 1557 Apparel For Sale 3 children's gowns Sz 5, 7 & 8, white & black Call:917 270 4624 Apparel For Sale g Call:718 436 0282 Merchandise for Sale FRUMFURNITURE COM The frum community's one stop for all furniture buying & selling! Merchandise for Sale Girls Nueces black velvet jumper Sz12, $75 Call/Text:718 974 2411 Please call 718 812 0616 Merchandise for Sale Set of 6 D/R chairs, $150 Call:347 528 1149 Merchandise for Sale Silver cross Jet travel carriage, great cond, asking $220, original price was $450 Call/Text:718 683 1227 13 be gown once Ad Merchandise for Sale Brand new with tag, Tiffany & Fred genuine leather bag, originally $289, selling for $159 Call:718 438 1769 Merchandise for Sale Brother laser MFC 73620, decent cond Call/Text:917 723 5836 Merchandise for Sale Crib from the Pali Diamanté collection, good cond, 3 years old, was $1000, on sale for best offer. Call/Text:917-231-6786 Merchandise for Sale Danby 8 cu, freezer in brand new cond, 24"w, 24''d, 59"h, great for small apt Call347 263 1259 Merchandise for Sale Evenflo infant car seat, brand new cond Call/Text:347 564 8854 Merchandise for Sale Feldman's Jewelry Credit $925 Selling for $875 Call:347 930 9120 Merchandise for Sale Foot massager brand new in box Merchandise for Sale Grey Doona in perfect condition, including base $325 Call 347 731 6923 Merchandise for Sale Italian breakfront, in excellent cond for best offer Call:347 853 9811 Merchandise for Sale Materna Soy $25/can, Neocate $36/can Call/Text:929 333 6625 Merchandise for Sale Mon Amie, New this season Floral dresses sz 8 & 12 with matching baby 2 piece 9 12 months $25 each 347 633 2932 Merchandise for Sale Neocate Nutra Call/Text:347 578 5088 Merchandise for Sale Pants, Sz 6 slim, long, 1 black& 1 navy, from Children's Place Call/Text: 718 974 2411 Merchandise for Sale P t b d bl k b ll t Merchandise for Sale This season Parni taupe overall set Sz 4, new with tags Call/Text:929 387 0980 Merchandise for Sale Tickets available to Jewish Children Museum, $12/each Value $15/ticket 347 787 1838 Merchandise for Sale White bunk bed with high riser, in excellent cond, GREAT PRICE! Call:347 742 0127 APPAREL FOR SALE Apparel For Sale •Gorgeous custom made ivory and gold gowns Sizes 0, 2 •Mother of the bride cream gown with decorative beading Size 10 Call: 718 377 8484 Text: 929 545 1097 Apparel For Sale •Magnificent champagne pink w/ Call:347 930 9120 Merchandise for Sale Foot massager, brand new in box, heated vibrating foot spa H&B model number FBM605, blue & white, $55/best offer, pick up in Midwood Call:718 252 5274 Merchandise for Sale Frigidaire A/C, 5000 BTU new in box, missing side fillers, $150 Call:718 436 0282 Merchandise for Sale FRUMFURNITURE COM The frum community's one stop for all furniture buying & selling! Merchandise for Sale Girls Nueces black velvet jumper Sz12, $75 Call/Text:718 974 2411 Call/Text: 718 974 2411 Merchandise for Sale Perroquet brand new black ballet shabbos shoes Sz 36 347 513 9548 Merchandise for Sale Samsung S10 phone to sell for $150 Please call 718 812 0616 Merchandise for Sale Set of 6 D/R chairs, $150 Call:347 528 1149 Merchandise for Sale Silver cross Jet travel carriage, great cond, asking $220, original price was $450 Call/Text:718 683 1227 dec •Magn black gown pink/bl 3 childre 13 beau gowns, once, Ador y and is an early masters, eled org y p looking o teacher, year ED P/T job, keting, or tasks 402 FOR Merchandise for Sale A few brand new synthetic sheitels, leftover from a salon that closed, $35 each 718 692 4187 Merchandise for Sale Armoire off white excellent, cond great price Call/Text:347 564 8854 Merchandise for Sale Beautiful D&W BDR set in mint cond Call/Text:914 299 0058 Merchandise for Sale to: org ity full day or grades, 0 Ext 313 ity ng for a a warm & eat pay & 04 ity g to hire l at home, atbush & e pay! Email : com ity g company ssociate to beautiful organized, rner that is s, no exp ns prov, in 68-9744 velighting ity ng capable, asker with t pay with wigs com fundraising, and other minor tasks Call/Lv Msg: 718 755 8402 MERCHANDISE FOR SALE Merchandise for Sale $200 gift certificate at the Raleigh Hotel, selling for $175 Call/Text:929 434 7152 Merchandise for Sale Parent's Choice Diapers Sz 4, 124 ct, $19 99 347 856 7061 Merchandise for Sale 2 44" Brand new cond onyx mattresses & beds, barely used, reasonable price Call:845 502 3880 Merchandise for Sale 13 Unlimited ride pass tickets to IPLAY America. Price: $25, free $10 game card incl w/ each ticket 347 787 1838 Merchandise for Sale 39" bed new with a brass headboard with box spring & matress Call:929 275 5428 Call/Text:914 299 0058 Merchandise for Sale Beautiful D&W D/R breakfront, mint cond Call:914-299-0058 Merchandise for Sale Black chiffon & lace adult gown for rent, Sz 10 12, $250 Call:347 786 1821 Merchandise for Sale Brand new, with tag, Sz 5 adorable girls winter robe, Bonjour company, Orig $88 selling for $44 Call:718 436 2785 Merchandise for Sale Brand new little creative factory, cream & red girls bathing suits, Size 3 & 5 Call/Text 347 977 1348 Merchandise for Sale Brand new master BDR furniture for a good price Call:347 628 1481

186 AUG 31, 2022 Apparel For Rent or Sale Women's black gown Sz 8 10,worn once, to rent $245/sell $475, pic avail Call:347 628 1738 APPAREL FOR RENT Apparel For Rent Beautiful black maternity gown Call/Text: 347 578 1373 Apparel For Rent Beautiful black w/ colored beading maternity gown size 2-4 929 457 2614 Apparel For Rent Black maternity gown Sz 4, $350 Call:347 851 9633 Apparel For Rent Custom black lace married sister of bride gown size 4 6, $250 Call/Text:347 578 3384 Apparel For Rent Sz 0 2 black gown, & Sz 6 8 black & beige gown Call:347 534 6810 SERVICES Services All Electrical work outlets switches Services Electrician, plumber, sewer service, Carpentry, sheetrock, locks, etc 718 951 0090 Services General Construction Anthony Exterior/Interior •Plumbing •Bthrm •Electrical •Ceramic Tile •Extension •Door •Window •Molding •Cabinet •Painting lente1979@hotmail.com Antonio Urbina: 347 400 3009 Services Impeccable gift wrapping! Follow us on Instagram Tullegiftwrapping Email: Tullegiftwrapping@gmail com Call/Text: 347 977 1348 Services Light alterations Please Call: 718 450 4700 Services Need a passport renewal, 1st time passport/same day passport? Call now:718 400 9969 Services New Construction & Renovation Experts, new Bathrooms, kitchens, closets, decks, extensions, additions, Bsmts, electrical, plumbing, Carpentry Lowest prices, fastest service 718 951 0090 Services Small jobs our specialty! Plumbing electric, construction, locksmith, painting, plastering Shabbos clocks, outlets/switches Call: 347 275 5408 Services We fix hand knitted/crochet gartlech & make professional fringes Also, teaching how to knit/crochet Call: 917 414 3281 Do yo grea Small a plac Heim Mon -T He 18th M Driver long Heim to take leavin Frid We E F Apparel For Rent or Sale Women's black gown Sz 8 10,worn once, to rent $245/sell $475, pic avail Call:347 628 1738 APPAREL FOR RENT Apparel For Rent Beautiful black maternity gown Call/Text: 347 578 1373 Apparel For Rent Beautiful black w/ colored beading maternity gown size 2-4 929 457 2614 Apparel For Rent Black maternity gown Sz 4, $350 Call:347 851 9633 Apparel For Rent Custom black lace married sister of bride gown size 4 6, $250 Call/Text:347 578 3384 Apparel For Rent Services Electrician, plumber, sewer service, Carpentry, sheetrock, locks, etc 718 951 0090 Services General Construction Anthony Exterior/Interior •Plumbing •Bthrm •Electrical •Ceramic Tile •Extension •Door •Window •Molding •Cabinet •Painting lente1979@hotmail.com Antonio Urbina: 347 400 3009 Services Impeccable gift wrapping! Follow us on Instagram Tullegiftwrapping Email: Tullegiftwrapping@gmail com Call/Text: 347 977 1348 Services Light alterations Please Call: 718 450 4700 Services Need a passport renewal, 1st time passport/same day passport? Call now:718 400 9969 Services New Construction & Renovation Experts, new Bathrooms, kitchens, closets, decks, extensions, additions, Bsmts, electrical, plumbing, Carpentry Lowest prices, fastest service 718 951 0090 Services Do you w great b Small, h a place las Heimis Mon -Th Heim 18th & Mon O Driver w long d g , $ Call/Text:347 578 3384 Apparel For Rent Sz 0 2 black gown, & Sz 6 8 black & beige gown Call:347 534 6810 SERVICES Services All Electrical work, outlets, switches, fixtures,new lines for washer/dryer or a/c, shabbos clocks,circut breakers, small jobs or big jobs 24 hour emergency service 718 951 0090 Services Chair massage! book for your party or event! Women only Please Lv msg/Text:718-675-6093 B Car Smal elec paintin We fix & Also, B Heimi in area C e, pre Sz 2 ze L, 00 de Sz Apparel For Sale Magnificent machatainiste ivory gown Approx Sz 8 10 Call/Text:347 633 5129 Apparel For Sale Magnificent maternity gown, extremely slenderizing (size M) Please Call/Text: 347 798 3657 Apparel For Sale Magnificent Oscar de la Renta cocktail length gown, black & gold, Sz 6 8 Call/Text: 718 600 8266 Apparel For Sale Magnificent sis of bride gown champaign base & colored adorning beading, approx Sz 2, a must to see Call:646 629 3334 (no picture tex avail) Apparel For Sale Apparel For Sale Stunning black lace gown size 10 12 Call/Text: 347 731 6923 Apparel For Sale Teen Klade white & pink gown Sz 18 Call:347 314 5189 APPAREL FOR RENT OR SALE Apparel For Rent or Sale 2 Stunning custom white gowns for sister of bride, 8 & 10 year old girls Great price Call/Text: 347 423 2317 Apparel For Rent or Sale 8/10 Champagne/Ivory 718 207 2226 Apparel For Sale Custom Oscar de la Renta, cream/gold Sz 8/10 Call:718 207 2226 Apparel For Sale Gorgeous white dress, appropriate for own Tenoyim, Sz 2 4 Call/Text:917 586 9295 Apparel For Sale Gown, beautiful black & white Sz 4 worn once Call 347 263 4109 Apparel For Sale Gown, beautiful cream/gold dotted tulle top w/ cream tulle skirt Sz 14/16 preteen, only $150 Call/Text:347 760 0859 Apparel For Sale Gown, gorgeous girls, blush, Sz 5 6 &12 14, worn once, good price Call:347 581 8056 Apparel For Sale Gown, Pessy Miller, for mother of the bride, bush, approx Sz 10 Call/Text:347 675 5426 beading, approx Sz 2, a must to see Call:646 629 3334 (no picture tex avail) Apparel For Sale Magnificent sister of bride gown, custom made Sz 8, light pink with very elegant & eye catching Call:347 563 7837 Apparel For Sale Magnificent sister of bride gowns sizes 2 4, 6 8, & 14 16 Call:347 631 1745 Apparel For Sale Magnificent teen gowns for sister of bride, white/gold Sz 0 & 6 Call/Text: 718 600 8266 Apparel For Sale Magnificent white custom girls gowns for rent, Sz kids 8 10, preteen 18 20, & ladies Sz 2, pristine Cond Call:347 447 8689 Apparel For Sale One of a kind black velvet gown w/ multicolored beading Sz 10 12 gown Call/Text for pics: 347 527 9877 Apparel For Sale Stunning black dress for mother of bride, Sz 6 Call:347 675 6598 8 & 10 year old girls Great price Call/Text: 347 423 2317 Apparel For Rent or Sale 5 beautiful white sisters of bride gowns, for young adults/teens Call/Text:347 922 8749 Apparel For Rent or Sale Badgley Mischka designer gown, Sis of bride, pink, Sz 6 347 668 9870 Apparel For Rent or Sale Beautiful & elegant exquisite black & goldish beaded short gown/ evening dress, Sz 12, give an offer! Call/Text for pic:929 454 9500 Apparel For Rent or Sale Beautiful & elegant grey gown, sz 6 8, best offer Call/Text: 323 632 8623 Apparel For Rent or Sale Gorgeous black/white sis of bride/own tenoym gown, Sz 10/12, very slenderizing Call:347 446 6114 Apparel For Rent or Sale Machetenista Gown, Ivory w/Black Beading $1,000 to buy $700 to rent Sz 10 718 207 2226 pre 2 Apparel For Sale Magnificent machatainiste ivory gown Approx Sz 8 10 Call/Text:347 633 5129 Apparel For Sale Magnificent maternity gown, extremely slenderizing (size M) Please Call/Text: 347 798 3657 Apparel For Sale Apparel For Sale Stunning black lace gown size 10 12 Call/Text: 347 731 6923 Apparel For Sale Teen Klade white & pink gown Sz 18 Call:347 314 5189 y g Call/Text: 347 299 2257 Apparel For Sale Beautiful short elegant dress size L, perfect for own tenoyim, $1200 Paid over $2000 347 452 3657 Apparel For Sale Custom Designer Mother of Bride Sz 8/10 Champagne/Ivory 718 207 2226 Apparel For Sale Custom Oscar de la Renta, cream/gold Sz 8/10 Call:718 207 2226 Apparel For Sale Gorgeous white dress, appropriate for own Tenoyim, Sz 2 4 Call/Text:917 586 9295 Apparel For Sale Gown, beautiful black & white Sz 4 worn once Call 347 263 4109 Apparel For Sale Gown, beautiful cream/gold dotted tulle top w/ cream tulle skirt Sz 14/16 preteen, only $150 Call/Text:347 760 0859 Apparel For Sale Gown, gorgeous girls, blush, Sz 5 6 &12 14, worn once, good price Call:347 581 8056 Apparel For Sale Gown, Pessy Miller, for mother of the bride, bush, approx Sz 10 Call/Text:347 675 5426 y g ( ) Please Call/Text: 347 798 3657 Apparel For Sale Magnificent Oscar de la Renta cocktail length gown, black & gold, Sz 6 8 Call/Text: 718 600 8266 Apparel For Sale Magnificent sis of bride gown champaign base & colored adorning beading, approx Sz 2, a must to see Call:646 629 3334 (no picture tex avail) Apparel For Sale Magnificent sister of bride gown, custom made Sz 8, light pink with very elegant & eye catching Call:347 563 7837 Apparel For Sale Magnificent sister of bride gowns sizes 2 4, 6 8, & 14 16 Call:347 631 1745 Apparel For Sale Magnificent teen gowns for sister of bride, white/gold Sz 0 & 6 Call/Text: 718 600 8266 Apparel For Sale Magnificent white custom girls gowns for rent, Sz kids 8 10, preteen 18 20, & ladies Sz 2, pristine Cond Call:347 447 8689 Apparel For Sale One of a kind black velvet gown w/ multicolored beading Sz 10 12 gown Call/Text for pics: 347 527 9877 Apparel For Sale Stunning black dress for mother of bride, Sz 6 Call:347 675 6598 Call:347 314 5189 APPAREL FOR RENT OR SALE Apparel For Rent or Sale 2 Stunning custom white gowns for sister of bride, 8 & 10 year old girls Great price Call/Text: 347 423 2317 Apparel For Rent or Sale 5 beautiful white sisters of bride gowns, for young adults/teens Call/Text:347 922 8749 Apparel For Rent or Sale Badgley Mischka designer gown, Sis of bride, pink, Sz 6 347 668 9870 Apparel For Rent or Sale Beautiful & elegant exquisite black & goldish beaded short gown/ evening dress, Sz 12, give an offer! Call/Text for pic:929 454 9500 Apparel For Rent or Sale Beautiful & elegant grey gown, sz 6 8, best offer Call/Text: 323 632 8623 Apparel For Rent or Sale Gorgeous black/white sis of bride/own tenoym gown, Sz 10/12, very slenderizing Call:347 446 6114 Apparel For Rent or Sale Machetenista Gown, Ivory w/Black Beading $1,000 to buy $700 to rent Sz 10 718 207 2226 Apparel For Sale Beautiful black size 2 Sonia Rykiel gown 347 798 3657 Apparel For Sale Beautiful custom black & white, pre maternity, sister of bride gown Sz 2 Call/Text: 347 299 2257 Apparel For Sale Beautiful short elegant dress size L, perfect for own tenoyim, $1200 Paid over $2000 347 452 3657 Apparel For Sale Custom Designer Mother of Bride Sz 8/10 Champagne/Ivory 718 207 2226 Apparel For Sale Custom Oscar de la Renta, cream/gold Sz 8/10 Call:718 207 2226 Apparel For Sale Gorgeous white dress, appropriate for own Tenoyim, Sz 2 4 Call/Text:917 586 9295 Apparel For Sale Gown, beautiful black & white Sz 4 worn once Call 347 263 4109 Apparel For Sale Gown, beautiful cream/gold dotted tulle top w/ cream tulle skirt Sz 14/16 preteen, only $150 Call/Text:347 760 0859 Apparel For Sale Gown, gorgeous girls, blush, Sz 5 6 &12 14, worn once, good price Call:347 581 8056 Apparel For Sale Gown, Pessy Miller, for mother of the bride, bush, approx Sz 10 Call/Text:347 675 5426 Apparel For Sale Magnificent machatainiste ivory gown Approx Sz 8 10 Call/Text:347 633 5129 Apparel For Sale Magnificent maternity gown, extremely slenderizing (size M) Please Call/Text: 347 798 3657 Apparel For Sale Magnificent Oscar de la Renta cocktail length gown, black & gold, Sz 6 8 Call/Text: 718 600 8266 Apparel For Sale Magnificent sis of bride gown champaign base & colored adorning beading, approx Sz 2, a must to see Call:646 629 3334 (no picture tex avail) Apparel For Sale Magnificent sister of bride gown, custom made Sz 8, light pink with very elegant & eye catching Call:347 563 7837 Apparel For Sale Magnificent sister of bride gowns sizes 2 4, 6 8, & 14 16 Call:347 631 1745 Apparel For Sale Magnificent teen gowns for sister of bride, white/gold Sz 0 & 6 Call/Text: 718 600 8266 Apparel For Sale Magnificent white custom girls gowns for rent, Sz kids 8 10, preteen 18 20, & ladies Sz 2, pristine Cond Call:347 447 8689 Apparel For Sale One of a kind black velvet gown w/ multicolored beading Sz 10 12 gown Call/Text for pics: 347 527 9877 Apparel For Sale Stunning black dress for mother of bride, Sz 6 Call:347 675 6598 Apparel For Sale Stunning black lace gown size 10 12 Call/Text: 347 731 6923 Apparel For Sale Teen Klade white & pink gown Sz 18 Call:347 314 5189 APPAREL FOR RENT OR SALE Apparel For Rent or Sale 2 Stunning custom white gowns for sister of bride, 8 & 10 year old girls Great price Call/Text: 347 423 2317 Apparel For Rent or Sale 5 beautiful white sisters of bride gowns, for young adults/teens Call/Text:347 922 8749 Apparel For Rent or Sale Badgley Mischka designer gown, Sis of bride, pink, Sz 6 347 668 9870 Apparel For Rent or Sale Beautiful & elegant exquisite black & goldish beaded short gown/ evening dress, Sz 12, give an offer! Call/Text for pic:929 454 9500 Apparel For Rent or Sale Beautiful & elegant grey gown, sz 6 8, best offer Call/Text: 323 632 8623 Apparel For Rent or Sale Gorgeous black/white sis of bride/own tenoym gown, Sz 10/12, very slenderizing Call:347 446 6114 Apparel For Rent or Sale Machetenista Gown, Ivory w/Black Beading $1,000 to buy $700 to rent Sz 10 718 207 2226 Services All Electrical work, outlets, sw fixtures,new lines for washer/d a/c, shabbos clocks,circut bre small jobs or big jobs 24 hour emergency servi 718 951 0090 Services Chair massage! book for your party or ev Women only. Please Lv msg/Text:718 67 Apparel For Rent or Sale Women's black gown Sz 8 10,worn once, to rent $245/sell $475, pic avail Call:347 628 1738 APPAREL FOR RENT Apparel For Rent Beautiful black maternity gown Call/Text: 347 578 1373 Apparel For Rent Beautiful black w/ colored beading maternity gown size 2 4. 929 457 2614 Apparel For Rent Black maternity gown Sz 4, $350 Call:347 851 9633 Apparel For Rent Custom black lace married sister of bride gown size 4 6, $250 Call/Text:347 578 3384 Apparel For Rent Sz 0 2 black gown, & Sz 6 8 black & beige gown Call:347 534 6810 SERVICES Services All Electrical work, outlets, switches, fixtures,new lines for washer/dryer or a/c, shabbos clocks,circut breakers, small jobs or big jobs 24 hour emergency service 718 951 0090 Services Chair massage! book for your party or event! Women only Please Lv msg/Text:718 675 6093 Services Electrician, plumber, sewer s Carpentry, sheetrock, locks 718 951 0090 Services General Construction Ant Exterior/Interior •Plumbing •Electrical •Ceramic Ti •Extension •Door •Wind •Molding •Cabinet •Paint lente1979@hotmail co Antonio Urbina: 347 400 Services Impeccable gift wrappin Follow us on Instagram Tullegiftwrapping Email: Tullegiftwrapping@gm Call/Text: 347 977 134 Services Light alterations Please Call: 718 450 47 Services Need a passport renewal, 1s passport/same day passp Call now:718 400 9969 Services New Construction & Renov Experts, new Bathrooms, kit closets, decks, extensions, ad Bsmts, electrical, plumbi Carpentry Lowest prices, fa service 718 951 0090 Services Small jobs our specialty! Plu electric, construction, locks painting, plastering Shabbos outlets/switches Call: 347 275 5408 Services We fix hand knitted/crochet g & make professional fring Also, teaching how to knit/cr Call: 917 414 3281 BABYSITTING Babysitting Heimishe, exp lady willing to in area of 14th/15th Ave & 50 St, eve & night pref Call/Lv Msg: 718 755 84 j g j 24 hour emergency se 718 951 0090 Services Chair massage! book for your party or Women only Please Lv msg/Text:718

187WeeklyLink.com witches, dryer or eakers, ce ent! 5 6093 Also, teaching how to knit/crochet Call: 917 414 3281 BABYSITTING Babysitting Heimishe, exp lady willing to babysit in area of 14th/15th Ave & 50th 60th St, eve & night pref Call/Lv Msg: 718 755 8402 Electrician For all your electrical needs SPOTLIGHTS, Shabbos clocks, light fixtures, outlets, switches, breakers, & more Call/Text:845 274 5170 HANDYMAN Wig & Hair Wig wash & set! Free pickup & delivery avail upon request Also specializing in, hair wig cutting, wedding hairstyles, makeup, waxing Call/ Text 718 853 2875 WRITING Writing A Poem that hits home! English/Yiddish poems for any occasion from quirky to formal, we do it all, great prices Call/Text: 845 263 2984 Writing The Write Idea • Poems • Songs • Scripts English/Yiddish R Lowy: 914 299 5744 LOST Lost Ladies c C Man's rite M Nice c Handyman *Small or Big Jobs* Tile, Sheetrock, Plaster, Painting, Carpentry, Electrical, Plumbing, Cabinets, Assembly, Bathroom, Basement Renovation Call Jerry: 917 202 5524 Handyman Pay your professional handyman man by the hour Quick/exp & professional Get handi:1866 426 3421 Handyman Music Join now! priv quality music lessons by exp teacher (keyboard/piano), learn by ear, by note, chords, accompaniments, multi track recordings, sheet music, & classical music, free trial 646 509 4954 Music Professional Music Teachers offering keyboard, guitar & violin lessons, in BP & upsate Priv & grps welcome. Ask abt other string instruments, male & female structures avail Call: 718-799-6139 PHOTOGRAPHY Photography Tree Service Rite Price Tree & Landscaping Tree cutting, pruning, feeding, open lots, planting, lawn service, sukkah clearance, junk removal etc Free estimate: 718 705 2344 TUTOR / SPECIAL ED Tutor / Special Ed Looking for a tutor? Especially experienced with 1st & 2nd graders 929 214 3960 Tutor / Special Ed Quick/exp & professional Get handi:1866 426 3421 Handyman Professional Handyman No job too small Highly recommended Isaac: 347 417 0046 HOTLINE Hotline !תועושיה הוק will change your life! English:1 929 946 8566/ 1 929 946 8555 תירבע 1 929 946 8575:שידיא Ladies Pin# 72, & Girls 73! Hotline Ladies shiurim on Chovas Halvovos & Emunah/Bitachon Tue: 10:15 11 Find your inner Sipuk (Yiddish) Live: 605 313 5687 #314886 Recording: 605 313 4102 #314886 MAKE UP Make Up Makeup by Goldy Book your next simcha and get our special price offer, $40 per face References available 917 652 9554 MUSIC Photography Looking for newborn girl to model for photography ad, ages 7 12 days old Call/Text for details: 917 733 9283 SIMCHA SERVICES Simcha Services GOWNS WITH GLAMOUR Wedding Gown Rental Matching Boys collection. **New Spring/Summer line is in** Monsey: R Silber 845 445 5458 BP: M Halpert 347-385-2638 Simcha Services Heimishe singer for all occasions Call Shimon Rabinowitz, if no answer, leave a message 347 683 3696 TAILORING Tailoring Light Alterations 718 972 1704 TREE SERVICE with 1st & 2nd graders 929 214 3960 Tutor / Special Ed Math & Science Licensed Tutor All grade levels, specializing in test & regents preparation, over 20 yrs exp, at my place/yours Call/Text Esther Fishman:929 454 4869 WEIGHT LOSS Weight Loss There's only 1 way to lose weight in a quick, comfortable, convenient & discreet way in the heart of BP Slympha is the secret to inch loss in time for your upcoming family simcha! •••• Call:718 532 4701 today for more info & to schedule your appointment •special group slots avail for friends WIG & HAIR Wig & Hair Haircuts & hairstyles for a great price Center of BP Call:917 618 1174 Handyman *Small or Big Jobs* Tile, Sheetrock, Plaster, Painting, Carpentry, Electrical, Plumbing, Cabinets Assembly Bathroom Music Join now! priv quality music lessons by exp teacher (keyboard/piano), learn by ear, by note, chords, accompaniments, multi track recordings, sheet music, & classical music, free trial 646 509 4954 Music P f i l M i T h Tree Service Rite Price Tree & Landscaping Tree cutting, pruning, feeding, open lots, planting, lawn service, sukkah clearance, junk removal etc Free estimate: 718 705 2344 Tile, Sheetrock, Plaster, Painting, Carpentry, Electrical, Plumbing, Cabinets, Assembly, Bathroom, Basement Renovation Call Jerry: 917 202 5524 Handyman Pay your professional handyman man by the hour Quick/exp & professional Get handi:1866 426 3421 Handyman Professional Handyman No job too small Highly recommended Isaac: 347 417 0046 HOTLINE Hotline !תועושיה הוק will change your life! English:1 929 946 8566/ 1 929 946 8555 תירבע 1 929 946 8575:שידיא Ladies Pin# 72, & Girls 73! Hotline Ladies shiurim on Chovas Halvovos & Emunah/Bitachon Tue: 10:15 11 Find your inner Sipuk (Yiddish) Live: 605 313 5687 #314886 Recording: 605 313 4102 #314886 MAKE UP Make Up Makeup by Goldy Book your next simcha and get our special price offer, $40 per face References available 917 652 9554 MUSIC accompaniments, multi track recordings, sheet music, & classical music, free trial 646 509 4954 Music Professional Music Teachers offering keyboard, guitar & violin lessons, in BP & upsate Priv & grps welcome. Ask abt other string instruments, male & female structures avail Call: 718-799-6139 PHOTOGRAPHY Photography Looking for newborn girl to model for photography ad, ages 7 12 days old Call/Text for details: 917 733 9283 SIMCHA SERVICES Simcha Services GOWNS WITH GLAMOUR Wedding Gown Rental Matching Boys collection. **New Spring/Summer line is in** Monsey: R. Silber 845 445 5458 BP: M Halpert 347-385-2638 Simcha Services Heimishe singer for all occasions Call Shimon Rabinowitz, if no answer, leave a message 347 683 3696 TAILORING Tailoring Light Alterations 718 972 1704 TREE SERVICE clearance, junk removal etc Free estimate: 718 705 2344 TUTOR / SPECIAL ED Tutor / Special Ed Looking for a tutor? Especially experienced with 1st & 2nd graders 929 214 3960 Tutor / Special Ed Math & Science Licensed Tutor All grade levels, specializing in test & regents preparation, over 20 yrs exp, at my place/yours Call/Text Esther Fishman:929 454 4869 WEIGHT LOSS Weight Loss There's only 1 way to lose weight in a quick, comfortable, convenient & discreet way in the heart of BP Slympha is the secret to inch loss in time for your upcoming family simcha! •••• Call:718 532 4701 today for more info & to schedule your appointment •special group slots avail for friends WIG & HAIR Wig & Hair Haircuts & hairstyles for a great price Center of BP Call:917 618 1174 Handyman *Small or Big Jobs* Tile, Sheetrock, Plaster, Painting, Carpentry, Electrical, Plumbing, Cabinets, Assembly, Bathroom, Basement Renovation Call Jerry: 917 202 5524 Handyman Pay your professional handyman man by the hour Quick/exp & professional Get handi:1866 426 3421 Handyman Professional Handyman No job too small Highly recommended Isaac: 347 417 0046 HOTLINE Hotline !תועושיה הוק will change your life! English:1 929 946 8566/ 1 929 946 8555 תירבע 1 929 946 8575:שידיא Ladies Pin# 72, & Girls 73! Hotline Ladies shiurim on Chovas Halvovos & Emunah/Bitachon Tue: 10:15 11 Find your inner Sipuk (Yiddish) Live: 605 313 5687 #314886 Recording: 605 313 4102 #314886 MAKE UP Make Up Makeup by Goldy Book your next simcha and get our special price offer, $40 per face References available 917 652 9554 MUSIC Music Join now! priv quality music lessons by exp teacher (keyboard/piano), learn by ear, by note, chords, accompaniments, multi track recordings, sheet music, & classical music, free trial 646 509 4954 Music Professional Music Teachers offering keyboard, guitar & violin lessons, in BP & upsate. Priv & grps welcome Ask abt other string instruments, male & female structures avail. Call: 718 799 6139 PHOTOGRAPHY Photography Looking for newborn girl to model for photography ad, ages 7 12 days old Call/Text for details: 917 733 9283 SIMCHA SERVICES Simcha Services GOWNS WITH GLAMOUR Wedding Gown Rental Matching Boys collection **New Spring/Summer line is in** Monsey: R Silber 845 445 5458 BP: M. Halpert 347-385-2638 Simcha Services Heimishe singer for all occasions Call Shimon Rabinowitz, if no answer, leave a message 347 683 3696 TAILORING Tailoring Light Alterations 718 972 1704 TREE SERVICE Tree Service Rite Price Tree & Landscaping Tree cutting, pruning, feeding, open lots, planting, lawn service, sukkah clearance, junk removal etc Free estimate: 718 705 2344 TUTOR / SPECIAL ED Tutor / Special Ed Looking for a tutor? Especially experienced with 1st & 2nd graders 929 214 3960 Tutor / Special Ed Math & Science Licensed Tutor All grade levels, specializing in test & regents preparation, over 20 yrs exp, at my place/yours Call/Text Esther Fishman:929 454 4869 WEIGHT LOSS Weight Loss There's only 1 way to lose weight in a quick, comfortable, convenient & discreet way in the heart of BP Slympha is the secret to inch loss in time for your upcoming family simcha! •••• Call:718 532 4701 today for more info & to schedule your appointment •special group slots avail for friends WIG & HAIR Wig & Hair Haircuts & hairstyles for a great price Center of BP Call:917 618 1174 ervice, , etc hony •Bthrm ile ow ing m 3009 g! m ail com 8 00 st time ort? 9 ation chens, dditions, ng, astest mbing mith, clocks, artlech es ochet G babysit th 60th 02 Babysitting Do you want the convenience of a great babysitter in your house? Small, heimishe group looking for a place to host, 14th & 50th area, last slot for your baby 347 668 7840 Babysitting Heimishe exp babysitter avail Mon -Thur, from 8:50-2:45, located at 16th & 60th Call:718 871 0279 Babysitting Heimishe warm babysitter on 18th & 60th, drop ins welcome Monday Friday Hours: 9 5 Open all year round 718 232 3096 DRIVER Driver Driver w/ many years exp avail to do long distance trips w/ brand new minivan, reas rates 917 405 8469 Driver Steady Driver Heimishe man w/ mini van avail to take passenger from BP Monsey, leaving: 6:30am, returning: 5:45pm Friday leaving Monsey: 12:45 We deliver pkgs 917 363 0677 ELECTRICIAN Electrician For all your electrical needs SPOTLIGHTS, Shabbos clocks, light fixtures, outlets, switches, breakers, & more Call/Text:845 274 5170 HANDYMAN rvice event! 675 6093 Babysitting Heimishe, exp lady willing to babysit in area of 14th/15th Ave & 50th 60th St, eve & night pref Call/Lv Msg: 718 755 8402 more Call/Text:845 274 5170 HANDYMAN YOUR AD HERE EMAIL: classified @weeklylink.com CALL: 347-787-1838 YOUR AD HERE EMAIL: classified @weeklylink.com CALL: 347-787-1838

189WeeklyLink.com Are you a business earning over 300,000 Amex points monthly? We can still buy your Amex points for a great rate!Call, Text or WhatsApp: 845-354-6500 info@sellmypoints.com $71 Tel:PleaseTINFO@PLANFPLANS.718-384-4159COMel:718-384-4159visitWWW.PLANFPLANS.COM for the right guidance on 1. What not to buy 2. what to buy 3. How to buy with a minimum premium and still receive the maximum benefits Email:INFO@PLANFPLANS.COM Introducing our new site WWW.PLANFPLANS.COM SPECIAL: 4 POTATO KUGELS 50 SLICES EA. $100 845.659.7777 LOCATED IN THE MOUNTAINS BEST FOOD / LOWEST PRICES Shabbatons, Yeshiva Suppers, Weekends discountAcceptingcampsatprices!Specialnewdeliciousmenus! LESHEM MITZVE Schach to give 718.633.0404away.

190 AUG 31, 2022 R Lowy: 914 299 5744 LOST Lost Black arbii headband Call/Text:347 633 2301 FOUND Found Amex credit card on the Williamsburg/BP bus Call:347 501 0478 Found Brand name baby blanket on E2nd st, if lost, Email details to: foundblanket123@gmail com Found Casio watch with link, in Swan Lake If lost, Call/Text:929 271 6720 Nice children's bib on 18th Ave 347 564 5659 SEEKING Seeking If u have a fridge, (or an A C ) to give away for a shull Call (or text):718 809 2759 Seeking Looking for 2 green yellow panels for fiberglass sukkah If you have Contact:718 207 8011 Seeking Looking for a P/T job avail Sunday, Monday, Wednesday, & Friday Please Lv msg/Text:718 675 6093 Thank You Seeking Looking for night table only from BDR set Call:718 687 8409 Seeking Looking to buy last year's 1+ in the family top, Sz18 months, striped mock turtleneck Call:347 374 0661 727 731 6762 www tehillimonklaftefilah org L'SHEM MITZVAH L'shem Mitzvah •Blue background with green & white design, Maclaren stroller •Baby Bee green carriage Call after 9:00 pm:718 633 5657 L'shem Mitzvah 2 armchairs, upholstered excellent cond, BP, photo avail Call:718 871 2097 L'shem Mitzvah 2 good hi risers with mattresses to give away in PB, to pick up Call/Lv msg: 718 435 7619/347 967 7952 L'shem Mitzvah 4 door china closet, pick up in BP Call:646 853 4084 L'shem Mitzvah 4 door china closet, round sides, dark wood color, in good cond Call:718 926 4773 L'shem Mitzvah 7 seforim shank in great cond, due to moving, ready to be picked up Call:347 733 3083 L'shem Mitzvah 8 Gerber baby cereal, & support stockings, knee highs Call:718 435 5760 L'shem Mitzvah 18 similac infant formula expires Nov 22 Call:716 732 9224 L'shem Mitzvah Brand new chrome faucet for filter Text:347 423 0666 L'shem Mitzvah Children boot GEMACH looking for gently used children boots to donate 917 538 9162 L'shem Mitzvah Do you have a Medela pump you don’t use anymore? Donate it to Gemach in EY Call/Text For Pickup 347 271 1258 L'shem Mitzvah Gemach in Israel looking for pumps Call:718 207 2362 L'shem Mitzvah Help out almonu in desperate need!!! Accepting masser money etc, & get well rewarded! Call:929 276 2404 L'shem Mitzvah Nice new ladies clothing for needy only 646 904 1247 L'shem Mitzvah Seeking volunteers to do party planning on Friday afternoons Feel the satisfaction of helping others Call Gemach Simchas Rochel 347 385 9090 L'shem Mitzvah Wooden dinette set w/8 chairs & 3 stools, for more details Email: esteew1978@gmail com GEMACH Gemach "Flower Buds" Wreath Gemach (Linked w/ cap gemach) Magnificent wreaths for your princess 718 851 4256 Gemach Advocate for Impartial Hearing Gemach Receive all needed sessions of speech, OT, PT & P3 347 874 6152 Gemach Att parents & resource room directors: P3 exchange can help you find the right P3 provider p3exchange@gmail com Gemach Aufruf Gemach Pick your sachet color & we'll fill it all for min fee Please call a week in advance! 929 276 2404 Gemach Baby Bassinet Gemach Bassinet for newborns Text: 212 444 2546 Gemach Baby Bassinets Gemach Chana Zissel ה"ע םייח 'ר תב לסיז הנח נ"על Chasdei Yaakov Tzvi ה"ע 'ירא 'יעמש 'ר ןב יבצ בקעי נ"על 718 237 8715 Gemach Baby Carrier Gemach When a stroller just won't work Great for vacation, touring, steps etc 845 587 2449 Gemach Baby carrier Gemach Babybjorn great for vacation & touring 718 851 0946 Don B If you fo Leav Baby G & Go Baby Bar You c in Lo Be In ben Bent simcha Enjoy אשטנע Borrow moving L'shem Mitzvah 7 seforim shank in great cond, due to moving, ready to be picked up Call:347 733 3083 L'shem Mitzvah 8 Gerber baby cereal, & support stockings, knee highs Call:718 435 5760 L'shem Mitzvah 18 similac infant formula expires Nov 22 Call:716 732 9224 L'shem Mitzvah Brand new chrome faucet for filter Text:347 423 0666 L'shem Mitzvah Children boot GEMACH looking for gently used children boots to donate 917 538 9162 L'shem Mitzvah Do you have a Medela pump you don’t use anymore? Donate it to Gemach in EY Call/Text For Pickup 347 271 1258 L'shem Mitzvah Gemach in Israel looking for pumps Call:718 207 2362 L'shem Mitzvah Help out almonu in desperate need!!! Accepting masser money etc, & get well rewarded! Call:929 276 2404 L'shem Mitzvah Nice new ladies clothing for needy only. 646 904 1247 L'shem Mitzvah Seeking volunteers to do party planning on Friday afternoons Feel the satisfaction of helping others Call Gemach Simchas Rochel 347 385 9090 L'shem Mitzvah Wooden dinette set w/8 chairs & 3 stools, for more details Email: esteew1978@gmail com GEMACH Gemach "Flower Buds" Wreath Gemach (Linked w/ cap gemach) Magnificent wreaths for your princess 718 851 4256 Gemach Advocate for Impartial Hearing Gemach Receive all needed sessions of speech, OT, PT & P3 347 874 6152 Gemach Att parents & resource room directors: P3 exchange can help you find the right P3 provider p3exchange@gmail com Gemach Aufruf Gemach Pick your sachet color & we'll fill it all for min fee Please call a week in advance! 929 276 2404 Gemach Baby Bassinet Gemach Bassinet for newborns Text: 212 444 2546 Gemach Baby Bassinets Gemach Chana Zissel ה"ע םייח 'ר תב לסיז הנח נ"על Chasdei Yaakov Tzvi ה"ע 'ירא 'יעמש 'ר ןב יבצ בקעי נ"על 718 237 8715 Gemach Baby Carrier Gemach When a stroller just won't work Great for vacation, touring, steps etc 845 587 2449 Gemach Baby carrier Gemach Babybjorn great for vacation & touring 718 851 0946 Ba Donat Ba If you ar form Leave Baby Gem & Go s ba Baby sc Bar Mi You can in Y Long B Beau si In me bench Bentch simchas, B Enjoy fre אשטנעה Borrow up moving, 3 clo ya p & tting, axing ny al, gs • Found Gold ring Call:718 974 1200 Found Ladies coat, in Shemtov/Platinum hall last winter Call/Text:347 423 8399 Found Man's black hat (Ravazzi) by shop rite, on 8/21/2022 morning Call:917 699 0755 Found Nice baby blanket in Michael's Car Service Nice children's bib on 18th Ave 347 564 5659 SEEKING Seeking If u have a fridge, (or an A C ) to give away for a shull Call (or text):718 809 2759 Seeking Looking for 2 green yellow panels for fiberglass sukkah If you have Contact:718 207 8011 Seeking Looking for a P/T job avail Sunday, Monday, Wednesday, & Friday Please Lv msg/Text:718 675 6093 Thank You Seeking Seeking Looking to buy Petit Clair boys denim ombre short sleeve top, Sz 4/5, in good cond Call/text: 347 304 1749 Seeking To rent/buy a current Sz 0 sis of bride gown from Exquisite, for under $200 Call:718 216 6528 MISCELLANEOUS Miscellaneous Tehillim on klaf Tefilah, Tehillim for Cholim Sun Thurs, 1pm 727 731 6762 www tehillimonklaftefilah org L'SHEM MITZVAH L'shem Mitzvah •Blue background with green & white design, Maclaren stroller •Baby Bee green carriage Call after 9:00 pm:718 633 5657 L'shem Mitzvah 2 armchairs, upholstered excellent cond, BP, photo avail Call:718 871 2097 L'shem Mitzvah 2 good hi risers with mattresses to give away in PB, to pick up Call/Lv msg: 718 435 7619/347 967 7952 L'shem Mitzvah g Call:347 501 0478 Found Brand name baby blanket on E2nd st, if lost, Email details to: foundblanket123@gmail com Found Casio watch with link, in Swan Lake If lost, Call/Text:929 271 6720 Please Lv msg/Text:718 675 6093 Thank You Seeking Looking for night table only from BDR set Call:718 687 8409 Seeking Looking to buy last year's 1+ in the family top, Sz18 months, striped mock turtleneck Call:347 374 0661 Call/Lv msg: 718 435 7619/347 967 7952 L'shem Mitzvah 4 door china closet, pick up in BP Call:646 853 4084 L'shem Mitzvah 4 door china closet, round sides, dark wood color, in good cond Call:718 926 4773 ng, ng • Found Gold ring Call:718 974 1200 Found Ladies coat, in Shemtov/Platinum hall last winter Call/Text:347 423 8399 Found Man's black hat (Ravazzi) by shop rite, on 8/21/2022 morning Call:917 699 0755 Found Nice baby blanket in Michael's Car Service Nice children's bib on 18th Ave 347 564 5659 SEEKING Seeking If u have a fridge, (or an A C ) to give away for a shull Call (or text):718 809 2759 Seeking Seeking Looking to buy Petit Clair boys denim ombre short sleeve top, Sz 4/5, in good cond Call/text: 347 304 1749 Seeking To rent/buy a current Sz 0 sis of bride gown from Exquisite, for under $200 Call:718 216 6528 MISCELLANEOUS Miscellaneous Tehillim on klaf Tefilah, Tehillim for Cholim Sun Thurs, 1pm 727 731 6762 www tehillimonklaftefilah org L'SHEM MITZVAH L'shem Mitzvah •Blue background with green & white design, Maclaren stroller •Baby Bee green carriage Call after 9:00 pm:718 633 5657 L'shem Mitzvah Call/Text:347 633 2301 FOUND Found Amex credit card on the Williamsburg/BP bus Call:347 501 0478 Found Brand name baby blanket on E2nd st, if lost, Email details to: foundblanket123@gmail com Found Casio watch with link, in Swan Lake If lost, Call/Text:929 271 6720 Call (or text):718 809 2759 Seeking Looking for 2 green yellow panels for fiberglass sukkah If you have Contact:718 207 8011 Seeking Looking for a P/T job avail Sunday, Monday, Wednesday, & Friday Please Lv msg/Text:718 675 6093 Thank You Seeking Looking for night table only from BDR set Call:718 687 8409 Seeking Looking to buy last year's 1+ in the family top, Sz18 months, striped mock turtleneck Call:347 374 0661 •Baby Bee green carriage Call after 9:00 pm:718 633 5657 L'shem Mitzvah 2 armchairs, upholstered excellent cond, BP, photo avail Call:718 871 2097 L'shem Mitzvah 2 good hi risers with mattresses to give away in PB, to pick up Call/Lv msg: 718 435 7619/347 967 7952 L'shem Mitzvah 4 door china closet, pick up in BP Call:646 853 4084 L'shem Mitzvah 4 door china closet, round sides, dark wood color, in good cond Call:718 926 4773 CLASSIFIEDSNOTEPLEASEOURNEWPAID DEADLINE:MONDAY5PM.EMAIL: @weeklylink.comclassified CALL: 347-787-1838 POST YOUR ONLINE:ADS weeklylink.com

extra special price. לחר נ”על ה”ע םחנמ לאומש תב

Chair & Table Gemach םולש רוא ח”מג 7 Folding tables, 24 chairs, coat racks. 718-431-0851

הנח נ”על

Bridal Yom Hachupah Gemach BP, Seder Yom Hachupa for 718-972-1892Kallahs.

Baby Scale Gemach In Text:Williamsburg.347-675-9509 Baby Scale Gemach 718-435-5257 Baby Scale Gemach Located in 718-633-9266BP. or 718-473-5268

Monroe: 845-774-2425

Bridal Shoe/Sneaker Rental All sizes. Many styles. White/ 917-936-8997black.

הכלמ

Bridal Accessory Gemach Gorgeous headpieces, veils, dektichlach. Min cost. BP. 347-680-1701

Bris Gemach Complete package. Lv Msg/Text: 347-461-4925

Bris Gemach Nice poyas, pillows & suits for bris. 718-871-7902

Bris Gemach Free Mohel service for people in need. Lv msg will return call same day: 646-637-5092

Baby Gemach Segula for easy birth from the Kuznitzer Magid. 917-514-9461

Baby Formula Gemach Donate / receive baby formula. 718-782-5145

Bris Gemach Free Mohel 347-383-5696

Bris Gemach Cards w/ tefilah to be mispalel while baby cries which is ais ratzon. 718-510-5521

Doona Gemach Brklyn. Doona avail for medical reason/short period of time. Call: 260-366-6293

Bris Gemach Bris pillow from the holy Harav Kanievsky. 646-492-9952

Chavrusa Gemach Donate 10% of your time, volunteer to be a chavrusa w/ homebound 2898718-438-7871BP/Williamsburg/Flatbush.yid./Eve:718-692-

Bridal Cape Gemach White fur capes for chuppah. 718-218-8124

CCC Crohn’s Colitis Coalition A div of Chaim Medical Resource. Counseling, referrals, seminars, SCD food gemach & more. Free shiurim, chizuk, news, updates, valuable resources. 718-480-5555

Bridal Yom Hachupah -Kol Tefilos Gemach Beautiful tefilos pamphlet to rent for the Chuppah. Donations to Yad Batya L’kallah. Rochel: 718-258-0415 Chaya: 718-986-0594

Baby Gemach (BP) Car seats, Snap & Go stroller, Pack ‘n Play, white bassinet for 718-854-6829newborns. Baby Carrier Gemach Baby Bjorn-great for vacation & touring. 718-809-9707

Bridal Chuppah Tefillah Card Gemach Tehillim, techinos & special tefillah for chosson/kallah. Many Lvlocations.Msg/Text: 718-435-4246

Bris Gemach Bris outfits & pillow. Flatbush. 917-838-2191 Bris Gemach New bris pillow & outfit. 718-435-0664

Chocolate Mold Gemach BP: 718Williamsburg:972-4768718-522-3445

Front seat occupants & children under 16 in front/back seats must buckle up. Children under 8 must be buckled in appropriate child restrained system. It’s the law. דאמ םתרמשנו Williamsburg: 718-384-4622

Bentcher Gemach Bentchers for simchas, no charge. בקעי םהרבא ’ר תב ליטאמ אשאס נ”על 718-972-8181

Baby Bassinet Gemach Beautiful brass iron baby bassinet for your simcha. 646-493-4338

Briefcase Gemach Grt cond & washed clean. Drop off anytime: 940 45th St. יוליעל רסיא יבצ ןב המלש םייח תמשנ For P/U, Call: 718-436-0936

Bris Gemach Beautiful bris outfit, poya, pillow & tefillos. Delivery & P/U in BP Call/Text:only.347-244-2065

Bridal GemachHeadpiece/Shoe Crowns, veils, long veils & dektich, shoes, petticoats. Min fee. 718-551-8714

Bridal Headpiece Gemach Beautiful selection, Flatbush. 718-737-1844

Baby Bassinet Gemach Call for 347-228-9222availability.

Bridal Shoe Gemach White kallah shoes. Free. 718-435-1950 or 201-686-1764

Bridal Yom Hachupah Gemach Machzor Lyom Hachuppah. Nusach Sfard & Ashkenaz. 718-837-8853

Bris Gemach Poyas, pillows, bris outfits. BP: 718-435-7221-15th & 57th BP: 718-871-5467-12th & 41st Williamsburg: 718-599-5508

GEMACHIM

Clothing Gemach Seeking ladies clothing, linen, towels, wigs, cz jewelry etc. Helping out Almanos, Kallahs & all those in need! Please Call: 929-276-2404

Bridal Shoe Gemach Dance in comfort. White wedge sneakers. Free. Call/Text: 718-755-8105

Bridal Cape Gemach Beautiful mink capes. White for kallah. Black for mother. Free of BP:6400Willi:charge.718-387-7122/347-581-718-633-3659/917-683-5557

Box Gemach Borrow up to 100 cardboard boxes for moving. 3 sizes: for books, dishes & clothing. 347-962-1509 / yachnesy@ gmail.com

Chair-Up Gemach 10 Comfortable black folding chairs. No charge. Call: 718-853-4966

תב לטראצ המלש האופרל

Bridal Cape Gemach Brand new luxurious fur capes for chuppah. חספ 718-633-8261

Bris Gemach Chusheva Mohel. Free of charge. Will pay for seudas bris. 347-447-9947

Coat Rack Gemach Zichron Shlome Coat racks to lend for any 718-854-0900occasion.

Bed Gemach Having guests? Need extra bed? Luxury folding beds. Call for405-345-6831availability. Bilkelech Gemach Fresh heimishe bilkelech, הלח אשטנעה םירמ ת- לחר ש”פרל .ןעמונעג 347-228-9222

Boot Gemach Children boots. Donate gently used children’s boots. 718-4357848

Car Seat Gemach Zichron Gedalya השמ ן- ’ילדג נ”על Car, infants & booster seats. 718-438-5451

Bridal Chuppah Card Gemach Beautiful Tefillah cards for a Chuppah. Free. Kensington. 347-675-0096

Doula - Dona Certified Min fee. רתסא 917-627-3282 Doula Services Exp, Call: 718-781-5385

Bris Gemach Chasdei Zev Bris outfit & pillow free of charge. 917-607-3914

Clothing Gemach Donate clothes, shoes, linens. Great cond Call/Text/WhatsApp:only. 347-8166406

Bridal Cape Gemach Cape & headcover set for chuppah & mitzvah tanz. Lace & fur, 718-438-6250$20.

Chair Gemach 12 Chairs to lend. Williamsburg. 718-802-9755

LAIBEL’S GEMACH BRAND NEW PACK & PLAYS FOR NEWBORNS בייל הירא הדוהי תמשנ יולעל ל״ז לשיפ םחורי ןב TEXT 212-444-2546

Advocacy Therapy Services Gemach Advocate to assist w/ obtaining P3, SETSS, SEIT or related therapy 551-236-3578services.

Chair & Table Gemach Call or Text: 347-452-0442

ןב יבצ בקעי נ”על

Baby Bassinet Gemach Chana Zissel םייח ’ר תב לסיז ה”ע Chasdei Yaakov Tzvi ה”ע ’ירא ’יעמש ’ר Williamsburg. 718-237-8715

Car Seat Gemach לדניירבו יבצ ןורכז ח”מג

Bridal Cape Gemach Lace (x fur), white & off-white capes for chuppah / mitzvah Williamsburg:BP:tantz.718-782-2869718-599-0224

Baby Formula Gemach Donate / receive Neocate baby Leaveformula.Message: 347-385-9188

Bridal Yom Hachupah Gemach Seder Yom Hachuppah in Yiddish now avail in BP. 718-435-3492

BP: 917-468-7557

Bridal Cape Gemach Luxurious white fur capes, fresh for Blackchuppah.furcapes avail for mother. 718-437-2873

Bris Zichron Mordechai Gemach Bris outfit w/ pillow. Tefillah for bris. Pidyon Haben outfit. Much more. Call/Text: 347-794-1278 Bris Gemach Take away yellowness of baby before bris, Segula stone avail to be used 4 days before bris. 718-710-8483

Bris Gemach Beautiful bris set. Washed & clean. Stunning vach nacht 718-633-3659outfit. or 917-683-5557

’ר ןב ’ירא ’ר ח”הרה נ”על הבצנת השמ ר”רה תב רתסא ’וזו

Shtreimel Gemach Shtreimel avail, short term. Refundable deposit requested. Leave Message: 718-851-2790

Mother’s Milk Gemach Donate/receive mother’s milk. Leave Message: 718-258-0532

Pidyan Haben Coin Gemach 5 - 1oz pure silver dollars. Yachov 646-419-0782Friedman:

Twin Baby Clothing Gemach Receive / donate baby clothing, newborn - sz 2, brand new cond. (Specializing in layette). Call/Text R. Bornstein: 347-7427189

Tefilin Gemach 917-337-7484

Tutor Gemach Chasdei Chaim Discount tutoring for all subjects & gmail.com347-962-1509levels./yachnesy@

Wedding Boys Suit Gemach Yismach Yisrael • Sz 9M-8 yrs • 1943 50th 347-462-4596St.

Suppers For Kimpeturins Fresh hot suppers for kimpeturins & family, delivered by 3:00 in BP, 4:00 in Willi. Min fee. 718-964-8057Hashgacha.

Hairstyling Gemach All occasions. Free. Lv Msg/Text: 347-948-5701 Hair Styling Gemach Professional. For kallah & family. Min Henny:cost.718-851-9058

Tichel Gemach Silk Tichlech. Donate / receive tichlech in good cond. 718-854-1514

Laptop Gemach Donate an old yet functioning laptop to help build skills of special needs laptopgemach@gmail.com646-543-6224kids.

Linen Gemach Having company & short on 718-853-4934linen?

Hospital Gown Gemach Tznius hospital nightgowns in compliance w/ hospital 718-625-0161/347-998-8455requirements.

Wedding Cap Gemach Huge selection & variety of colors & styles. Sun, 4-6 pm. 718-633-1084

Projector Gemach Projectors for simchos, parties & gatherings. Min fee. Call Only: 1718abcdefg@gmail.com347-631-1768

Shalom Bayis MP3 Gemach Beautiful speeches in Yiddish on shalom bayis & chinuch on MP3. 718-871-4506

Rabbi Avigdor Miller Gemach BP. Borrow any Rabbi Miller sefer, torasAvigdor.org/732-844-3670TorasAvigdor.org/info@free!

Shadchan - Matchmaker Zivug Shainee Only. Strictly Rabbiconfidential.Goldstein Rav of Onod: 718-384-5812 or 917-747-0964

Simcha Accessories Gemach Challah deklach, linen napkins, napkin Gemachrings.Zichron Freida Call/Text: 347-558-6050

Wedding Wreath GemachFlower Buds (Linked w/ cap gemach). Magnificent wreaths for your princess. 718-633-1084

Wheelchair Gemach Wheelchair avail short term. 718-633-7708

Robe Gemach Donate robes in perfect cond. 718-645-6715 or 718-866-5878

Wedding Kit Gemach All accessories for kallah/ chosson’s family for wedding night. L”N Perel Gela Bas R’ BP:Shloima718-633-0510 or 718-435Monsey:5193 845-425-2036 or 347351-2947

Dr. Sarno Book Gemach Book has helped thousands heal from backache, eczema, stomach issues, etc. 347-461-7330

Pump Gemach Long/short term electric pumps & hospital grade pumps. 718-436-3919 Pump Gemach Gemach in Eretz Yisroel looking for 718-207-2362pumps.

Simcha Gemach Glass bowls & trays to lend. No fee. l”n Shprintza bas Sara Nechuma 718-871-0860

Glassware Gemach יולה ךורב ן- ףסוי רזעילא השמו והילא נ”על Fruit & salad bowls, cake trays, mirror trays, vases, tea lights, candy dishes, cookie jars & plates. Glass 718-854-3017shelves.

Sheitel Gemach Donate wigs to a gemach in Eretz Yisroel. 347-675-6526

Mezuzos Gemach 718-666-7222

Pidyan Haben Gemach Zichron Meir V’Liba All Pidyan Haben needs incl coins & organza bags. 718-252-1517

Simcha Challah Cover Gemach םהרבא ידסח ח”מג

Sheitel Gemach Donate sheitels to gemach in Eretz Yisroel. 718-837-5091

Wedding Shtick Gemach Arches & other shtick. Min fee. Lv Msg; 347-939-2916

Haircut Gemach Beautiful haircuts for girls. Min fee. 929-290-6568

Simcha Flower Gemach Donate/receive fresh flowers to enhance another simcha. 347-907-0450

Furniture & Appliance Gemach Menadvim - donate & receive furniture, appliances, toys & 718-MENADVImmore. (636-2384)

Power Tool Gemach Call/Text: 718-813-3479

Hospital Gown Gemach Chasdei Miriam. 2 hospital gown styles. 15th & 51st: 718-853-3187

Maternity Coat Gemach New/gently used maternity coats, $50. Deposit returned. Accepting Call/Textcommaternitycoatgemach@gmail.donations.7-9PM:718-635-1710

Relationship Gemach Communication w/ direction with you, family & friends. 347-753-1071

Hat Gemach Beautiful, updated hats for simchas, small fee. Donate elegant hats. 347-351-1604

Proposal Gemach Props: Table, chairs, red carpet, champagne flutes. Brooklyn: Lakewood:347-628-6079347-933-3399

Hospital Gown Gemach רתסא ידגב Tznius hospital gowns in compliance w/ hosp req. 718-851-2418

Song Gemach Listen daily to the songs of tzadikim listed in order of yartzeit on Kol Dodi 718-989-6844/845-351-1115Dofeik.

x17

Water Pump Gemach Flood? Water pump, 50’ hose. (No solids.) 718-633-1850

Wedding Gown Gemach Crown Heights, for teens/adults. By Appt comQuickCall/Text:Only.347-770-4136Scheduling:gowngmach.

Pidyan Haben Gemach Custom design Pidyan Haben box. Frilly w/ blanket & pillow 718-633-3659/917-683-5557incl.

Wedding Machteiniste Gown Gemach Gowns in beautiful cond. Donate/book an appt. 646-250-9755 or 917-588-6377

Invitation Gemach We’ll email-blast your wedding invitation to your email list on the day of the wedding. 646450-4608

Wedding Shtick Gemach Kallah Tumblers. Personalized kallah 631-861-4536cups. or kallahtumblers@gmail.com347-846-8276

Beautiful challah covers for your simcha. 718-802-9755Williamsburg. Simcha Gemach Bechers, challah covers for Simchas. 718-435-4844

Flood Gemach Dehumidifiers & commercial wet vacs. Flatbush. Call/Text: 347-628-3109

Seuda Challah Fresh seuda challah for bris seuda/seudas mitzvah. 718-871-3020

Hospital Bed Capes To be worn over a hospital Williamsburg:gown. 718-852-7477 BP: 718-438-1882 Hospital Gown Gemach 718-259-0143Bensonhurst.

Wedding Shtick GemachMesamchim Exquisite & unique designs! Call/Text: 347-407-1964

Lighting Gemach Lighting bars avail to greatly enhance your event. Min fee. 929-276-2404

Mezuzos / Tefilin Gemach Hasofer of BP 1640-49 / 718-437-7078

Music Gemach – Simchas Freida Music & sound equipment. Keyboard, speaker, mike & mixer. 845-459-4226

Hospital Tznius Nightgown Gemach 347-786-2330

Infant Massage Gemach Lessons on how to perform skilled massage to soothe & calm babies. 347-753-1071

Tehillim Hachida Gemach Segulah for parnassah, zivug & all yeshuos. Get Tehillim Hachida for 40 days. 718-435-8789

12th & 54th: 718-871-3741 13th & 38th: 718-633-2392 19th & 50th: 718-951-1892

Sheitel Gemach Wigs wash & set, repairs, cut & recut, half 718-256-0979price. Sheitel Gemach Accepting/donating wigs in good 314-780-4583condition.

Twin Carriage Gemach Lend / rent a twin carriage for week, season or yr. Mint cond only. 718-522-3891

Oz Vehadar Levusha Gemach Segula Nifla for any Yeshuah: Oz Vehadar Levusha, 40 booklets for 40 days. Call/Text: 347-372-5115 Pack ‘n’ play Gemach (BP) Call in the eve: 718-851-1017

Pidyon Haben Gemach Baskets for garlic & pillow, tray, etc. 718-851-7964

Pump Gemach New Medela pumps avail short term. 718-853-2382

Working Papers Gemach Free, for Youth Corp. 718-854-0961

Party Planning Gemach Simchas Rochel. Party planning for your Shabbos simcha, free. 347-385-9090

Project Hour Blessing Volunteer to assist mothers of multiples w/ baby care. 718-438-9013

Maternity Simcha Gemach Gowns/dresses. Call for appt. Also, looking to buy current, elegant maternity gowns/ 1325dresses.56th • 718-871-2005 Medical Gemach Donate/receive. Pediatric wheelchairs, walker-shower seat, cast cover for shower, crutches. 718-388-3079 Medical Gemach Medical Advice & Support Call: Email:646-239-7319Mybobbi2@Yahoo.com

Ladies Clothing/Shoes Gemach New ladies clothing & shoes for needy 718-974-9428ladies.

Musical Kumzitz Gemach Treat your friends/talmidos to a musical kumzitz. Nashir 347-543-2195B’yachad: Nursing Lingerie Conversions Gemach Min Fee. B. Estersohn: 718-437-0428

Simcha Gemach White cubbies for miniature cakes, white ceramic square cake stand & 2 rose bowls, etc for sweet table. דוד השמ ןב ךורב נ”על 917-536-1742

Tablecloth Gemach 6 Crushed velvet pretty blue tablecloths for upsherin/party. 347-598-2927

Otzer Haseforim Gemach Free copies of seforim דועו הרותה רצוא ,המכחה רצוא 718-388-3085

Simcha Gemach YBZ Beautiful bechers & challah 718-972-1873covers.

Reflector Belt Gemach Stay safe while walking or Leavebiking.Message: 718-853-4966

Wedding Shtick Gemach Beautiful arches & more. Min fee & deposit 917-862-6087req.

BORO PARK 3919 13TH AVE. WILLIAMSBURG 500 FLUSHING AVE. LAKEWOOD 939 RIVER AVE.718.436.0707

pivotgroup.nyc BORO PARK 3919 13TH AVE WILLIAMSBURG 500 FLUSHING AVE LAKEWOOD 939 RIVER AVE MEFOARJUDAICA.COM 718.436.0707 Available in multiple designs & colors

Turn static files into dynamic content formats.

Create a flipbook
Issuu converts static files into: digital portfolios, online yearbooks, online catalogs, digital photo albums and more. Sign up and create your flipbook.