Page 1

Friday, April 27, 2012

A Star News Group publication

FINALLY FRIDAY PAGE 22

Phone: 5249 6700 Trades and Classifieds: 1300 666 808

BUCKETS & BOUQUETS PAGE 15

ON THE BITE PAGE 53

Merged clubs celebrate first Anzac Day together

RSL’s marching on Family Anzac Day: Hughan Kennedy and son Patrick at Ocean Grove, above, and Donald Richardson and daughter Sarah Sacks at Barwon Heads.

members were paid up for 2012 but he expected a final membership similar to last year’s 112. “A couple of young service people are joining up. That’s where we really want it.” He hoped Anzac Day would encourage younger people to become affiliate members. Queenscliff-Point Lonsdale RSL president Allan Went said the group of about 130 was gaining about the same number of members as it lost each year. “We’re doing pretty well and keeping our heads above water. The community’s pretty active.”

Proud day: Stan Brice takes his place in the Barwon Heads march. To see more of Tommy Ritchie’s Anzac Day photos from Barwon Heads and Ocean Grove enter ID numbers 80469 and 80593 at starphotos.com.au.

Catalogue out now! 480 CCA!

Shell Helix HX3 20W50 5LT s&ORMULATEDWITH CLEANSINGTECHNOLOGY TOSTOPDIRT SLUDGEBUILD UP s0ARTICULARLYSUITABLE FOROLDERVEHICLES

Y*

MONTHS

$99

WARRAN T NT

SAVE 40~

Maintenance Free Silver Battery s3UITS#OMMODORE6" 6:ALL&ORD&ALCONSS s%XCEPTIONALCRANKINGRESERVECAPACITY SMF57 SKU EL03541, SMF58 SKU EL03544, SMF58EB SKU EL03548, SMF58VT SKU EL03566 566

limit 3 per customer

$1499

no rainchecks

~

save 11

GEELONG 82 SEPARATION ST PH: 5278 52 278 1200 120 120 200 0

Sale Ends May 13

Personal shoppers only. ~Savings off regular ticketed price. AUTOVICN05205

1031110-KS17-12

PLACEME RE

24 M O

SKU OA00326 HS FULL NT

24

• Full Range of Paper Products • Environmentally Friendly Cleaning Solutions • Expert Cleaning Advice Instore • Best Prices in Geelong • Domestic and Commercial Supplies • Quotes Available Upon Request, We Will Not Be Beaten On Price - Bring In Your Current Cleaning Supply Invoice & See How Much We Can Save You!

RANGE RANG RA NGE E | SE SERVICE SERV RVIC ICE E | VA VALU VALUE LUE E Trade Enquiries Welcome

Hours: Mon-Fri 9-5pm, Sat 9.30-2.30pm 1300 650 277 32A Gordon Ave, Geelong West

www.candscleaningsupplies.com.au

READY WITH CA H. Cash from $300 to $3,000 now! (with affordable repayments)

Geelong 5274 9811 1300 FINANCE cityfinance.com.au ACL No: 390546

1026749-JF11-12

march in Barwon Heads.” Other RSLs on the Bellarine Peninsula were unlikely to merge, members said in the lead-up to Anzac Day. Drysdale RSL president Robert Wisbey said his branch was secure even though many of the town’s servicemen had joined Geelong’s club. He believed they were attracted to Geelong’s gaming machines. Mr Wisbey said Drysdale’s 76member club was trying to encourage more Vietnam veterans to join. Portarlington St Leonards RSL’s Noel Moreland said about 98

1031424-TB17-12

BY MICHELLE HERBISON OCEAN Grove and Barwon Heads have celebrated the first Anzac Day since amalgamation of their RSL branches. Ocean Grove Barwon Heads RSL’s John Dickinson said members were working cooperatively after “throwing rocks at each other for so many years”. But each town still had its own march on Wednesday, he said. “The Barwon Heads community was a little bit worried that with their members coming across to us they’d lose their Anzac Day march.” Barwon Heads members marched at 9am and their Ocean Grove counterparts began marching an hour later, with some veterans joining both parades. Mr Dickinson said Barwon Heads’ dwindling membership of 49 with an average age of 83 forced the amalgamation. The combined group now had 203 members between 30 and 97. A small number of ex-Barwon Heads members joined Geelong RSL instead of amalgamating, Mr Dickinson said. They might have resented a breakaway group of Barwon Heads members who formed the Ocean Grove club in 1962, he said. But former Barwon Heads RSL president Tony Wheal thought the members who transferred to Geelong lived outside Barwon Heads. “No one who lived in Barwon Heads has transferred to any other RSL than Ocean Grove.” Mr Wheal said the clubs merged “extremely well” but Barwon Heads would continue running separate ceremonies for Anzac and Remembrance days. “The support Barwon Heads veterans receive from the community is just tremendous. While we get that support we would be crazy not to hold an Anzac day


CARPET, VINYL, BAMBOO, CLICK SYSTEM FLOORING 800 METRES OF CARPET HAS JUST ARRIVED. DON’T PAY RETAIL

GET IN TODAARYS Bells bid held AND SAVE BIG DOLL for buses trial FREE MEASURE & QUOTE

171 WEST FYANS ST, NEWTOWN PH: 5229 2083 (Shannon Ave End)

www.hmcarpets.com.au

1030855-KS17-12

Trading Hours: Mon-Fri 9am-5.30pm, Sat 9am-1pm

Deferral: Libby Coker.

Concerned: Maurice Cole.

Charge: Simon Northeast.

BY CHERIE DONNELLAN SURF Coast councillors have put their controversial plan to redevelop Bells Beach “on hold” to trial a new bus licensing system. They voted on Tuesday night in favour of Cr Libby Coker’s motion to “defer the management plan for 12 months”. “We need to evaluate the effects of the new bus licensing agreement,” she said. The licensing system would charge buses visiting Bells $2 for each passenger, while students and children would pay $1.35. Councillors agreed to apply a “cap” on the charges of $10,000 for each tour operator. Council initially planned lower rates for the charges and caps but Cr Simon Northeast successfully proposed increases. He suggested that council cap bus numbers “by issuing licences

through a competitive allocation process”. Councillors agreed the revenue from licensing fees should go to maintaining Bells Beach Surfing Reserve. Cr Dean Webster said tour operators had enjoyed a “free-forall for a long time”. Cr Libby Mears said “people who make money out of public land should contribute to the maintenance of the land”. Bells Beach Preservation Society president Maurice Cole said the council’s decision was a “knee-jerk reaction” to community pressure. Council had yet to run a proper assessment of how bus licensing and its associated fees will work, he said. “The council hasn’t implemented a feasibility study or business plan for the licensing system. They’re just going to trial and

error for a year.” Mr Cole said he was concerned tour operators might be able to avoid to sign licensing agreements. “We believe that buses should not be allowed back into the reserve until operators have a licence. “We’re still concerned that unlicensed buses may hurt someone and that there’s no insurance to cover the damage but we’re seeking legal advice on that.” Mr Cole welcomed council deferring the management plan until after local government elections. “We’re very happy we got a year.” Mr Cole and preservation society members have been battling the management plan for the past year, fearing it would turn Bells into a “theme park”.

“You can have it all” The Highest Quality Mattresses at Wholesale Prices. Support Geelong Made here on site! Manufacturing! Come in & compare

m Furniture Furnitu ure e • Huge Showroom • Bedroom • Linen, Pillows & Doonas

GEELONG’S NO. 1 G SPECIALIST FOR:

D O N ’ T PAY R E TA I L - W H O L E S A L E P R I C E S E V E R Y DAY. DAY . . TRADING HOURS MONDAY-FRIDAY: 9.00AM - 5.30PM SATURDAY: 9.00AM - 4.30PM SUNDAY: 11.00AM - 4.00PM

“We know Mattresses… because we make them…!”

132 Torquay Road, Grovedale 5241 1108 2

The Independent, Friday April 27, 2012

SUPERIOR QUALITY MATTRESSES & BEDDING

NEXT TO BP

1 1027489-TB15 1027489-TB15-12 5-12

SAME DAY MATTRESS DELIVERY


$130m bungle ‘could cause water bill pain’ BY JOHN VAN KLAVEREN MORE rates pain could be in the pipeline after a $130 million bungle at Barwon Water, Essential Services Commission has warned. The commission said Barwon Water would need a “strong” case to seek further price rises to cover the unfunded infrastructure spending. Barwon Water failed to include the $130 million as part of a five-year plan in an application to the commission for price rises. The commission discovered the bungle when granting Barwon Water draft approval for a three per cent rise next financial year to pay for a Melbourne-Geelong pipeline.

The $15 rise on average residential bills would be on top of a previously approved hike of seven per cent. The increase equates to $127 for average business customers and $11 for tenants. The commission said Barwon Water exceeded price approval benchmarks by around $130 million. “This expenditure exceeding the benchmark combined with Barwon Water’s forecast operating expenditure may produce an upward impact on its prices in the next regulatory period,” the commission said. “We have not assessed the prudence and efficiency of Barwon Water’s actual or forecast expenditure. “This expenditure will require strong justification in Barwon Water’s

water plan should it seek to recover these costs through customer prices in the next regulatory period. “Nothing in this draft decision should be taken as our approval or otherwise of the prudence or efficiency of expenditure undertaken or planned by Barwon Water or taken as any approval of its prices for the next regulatory period.” Chairman Michael King said Barwon Water spent the $130 million on infrastruture projects including Armstrong Creek, Black Rock treatment plant and Torquay. The expenditure should have been included in Barwon Water’s five-year plan, Mr King said. Barwon Water was as yet unable to determine whether it would have to

scale back other projects, he said. “We have a number of projects coming up for determination over the next six months and we’ll make those decisions as they arrive. “As a board we are aware of the cost-of-living pressures in the community and our focus is to manage debt and keep rate rises to a minimum. “We have commissioned an efficiency and effectiveness report to look at all our costs.” Mr King said government grants of $25.5 million had partially offset the unfunded spending. State Water Minister Peter Walsh said Geelong families would suffer price increases to pay for the mistakes of the previous Labor government.

in brief Roads charge RATEPAYERS in two Barwon Heads streets face charges of up to $17,275 for road sealing. Ward councillor Andy Richards said council planned a special charge scheme on properties in Colite and Margate Sts “in partnership with residents” after fielding “a number of enquiries and complaints” about road surfaces.

River flush A THIRD flush of 380 million litres of reservoir water will benefit Moorabool River fish and platypus, according to Corangamite Catchment Management Authority. The authority said the final “summer fresh” allocation would begin this Friday in time for an autumn dispersal of juvenile platypus in the river.

Toilet talk GEELONG’S council wants to hear what residents have to say about public toilets. Council announced this week it was seeking public feedback on a review of the municipality’s 115 public toilets, which cost more than $1 million a year in upgrades and maintenance.

Festival funding A $52,500 funding injection is set to promote Portarlington’s 2012 National Celtic Festival in Melbourne and interstate. Tourism and Major Events Minister Louise Asher said the money would also support its “economic and potential job creation impacts”.

View protection A PLANNING scheme amendment could prevent construction of homes over 7.5-metres high to protect views in “key suburbs” of Geelong, according to council. Councillors voted this week to seek approval of the amendment to remove the height restriction in residential areas of 15 suburbs and towns while retaining it elsewhere in City of Greater Geelong.

Peak deliveries HELICOPTERS will deliver materials to help “fasttrack” a reopening of a popular lookout in You Yangs Regional Park, Parks Victoria has announced. A spokesperson said the gravel deliveries would restore a track washed away amid heavy rain in 2010 and 2011.

Concerned with your dental health? Contact us now for your

Complimentary Consultation!

Numbers up: Andrew King, Matthew Sun and Neighbourhood Watch’s Rhonda Rotherham show the new texting service number. Picture: Tommy Ritchie 80383

5221 6610

Text ‘first’ keeping watch on neighbourhood crime ed the service as a latest initiative to bring Neighbourhood Watch into the “technological era”. “We launched our Eyewatch Facebook page last month and the texting service was another initiative to modernise the program.” Sen Const King said the combination of Eyewatch and texting service would help Neighbourhood Watch reach a wider audience. He praised Geelong’s BCC Group for developing the technology.

Sen Const King said he approached BCC Group to help because of director Matthew Sun’s knowledge of technology and community involvement. “It was important we found someone who was interested in actively helping the community and Matthew was the perfect fit.” Mr Sun said he was “excited” to have helped Neighbourhood Watch. “I like to get involved with community projects, so working with Neighbourhood Watch has been great.”

info@smilestudio.com.au

Mr Sun said he ran a survey finding older respondents were limited users of social media, such as Facebook, but people of all ages had mobile phones. BCC Group designed the service to be simple and easy to use, Mr Sun said. Users could text NHW Reg to 0409 129 988 for “instant registration”. “The service is completely anonymous and you’ll only receive texts from Neighbourhood Watch,” Mr Sun said.

General and children’s dentistry, Implants, Cosmetic, Preventive,TMJ, Veneers, Snoring & Sleep Solutions, Neuromuscular dentistry.

1021930-SH7-12

BY CHERIE DONNELLAN AN AUSTRALIAN-FIRST texting service will keep the region’s residents up to date with neighbourhood crime statistics, according to one of its founders. Geelong Neighbourhood Watch police liaison officer Senior Constable Andrew King said the free service also provided registered users with information including tips on crime prevention and road closures. Sen Const King said Geelong pilot-

BUY ANY MOUNTAIN BIKE AND RECEIVE A FREE GIFT PACK VALUED $100 Mountain Bikes from $399

HURRY LIMITED OFFER MUST END SOON 1031345-TB17-12

190 Latrobe Terrace, Geelong PH: 5224 1900 berettas.bikehub.com.au

SALES, SERVICE, EXPERT ADVICE & REPAIRS The Independent, Friday April 27, 2012

3


‘New blow’ to port cars plan

THANK YOU TO ALL OUR LOYAL CUSTOMERS

INFURNITURE 3/20 Pakington Street, Geelong West

LEAVE A GIFT OF HOPE A legal Will to protect and provide for your loved ones is essential. ation Army By including a bequest to The Salvation in your Will you help ensure their work among those in need can continue. Call 1800 337 082 or visit www.salvationarmy.org.au/wills to find out more or to receive FREE information booklet Your Will,, y Your Family and The Salvation Army

1031314-JM17-12 314-JM17-1 - 2

A

LIA

G

TO A U S T R

R

55

E

FO

Opposition leader Daniel Andrews said the Geelong plan was already dead. “The problem is they don’t have the courage to look the people of Geelong in the eye and say they have ditched this plan.” Mr Andrews said the Webb Dock redevelopment would also mean traffic chaos between Melbourne and Geelong with thousands more trucks. Shipping Australia chief Llew Russell said the industry was anxious to hear the Government decision on shifting the car trade. “Our view is that Geelong has a whole lot of issues to be addressed, such as distance, the one-way shipping channel and lack of land.”

BY JOHN VAN KLAVEREN GEELONG will be the base for a new national sports network to commercialise elite sports technology, officials have announced. Australian Sports Technologies Network interim chair James Demetriou said the network had wideranging support. Mr Demetriou, brother of AFL chief Andrew, said Geelong’s cluster of university and research organisations and sports technology businesses helped clinch the deal. “The $600 billion global sports market is the third biggest industry in the world and Australia enjoys a high level reputation internationally,” he said. “We have a high level of sports participation but the sports industry in Australia is fragmented, so we

need to work together. “We will introduce a multi-media showcase of our capabilities on a national and global basis. We will also initiate a sports technology market study so we understand the size of market and its opportunities.” The network had the support of the AFL as well as councils stategic group G21 Regional Alliance and City of Greater Geelong. CSIRO and tertiary institutions including Deakin University would participate, Mr Demetriou said. The network had also attracted Federal Government funding. “ASTN will run an annual conference to enable members to share information and we’ll run a boot camp for sports technologists,” Mr Demetriou said. “Developing an export plan for trade shows and trade missions will be another key component.”

You can depend on your LOCAL Kleenheat Gas supplier to provide all the LPG you need for your home or business. We are right here in your community, and ready to keep your LPG coming with the right advice and a reliable supply. CONVENIENT DELIVERY

NORTH GEELONG....Gas & Industrial Supplies .........5278 8999 ST LEONARDS .........Brennans Gas & Bin Hire..........5257 1951 WINCHELSEA ..........Winchelsea Trading Company ..5267 2092

Scan here to order your LPG online Kleenheat Gas is proud to be part of The Salvation Army Regional Care Services, providing support and help to those who need it throughout regional Australia.

Another reason to keep it

A

SUP

RS

NS

P LY I N G

AS

announcement we can add that final piece to our study. We’ll be able to make that announcement shortly. “We’ll be talking to the car industry and we’ll be examining where it’s best to locate the car trade. “There are two clear choices: they can either go to Geelong or they can be located on the other side of Webb Dock. “There’s no doubt the car trade has indicated it would prefer to stay in Melbourne and there are some issues with land availability in Geelong.” Dr Napthine announced the car trade feasibility study early in 2010, saying it would generate up to 1000 jobs and $200 million for the city’s economy.

City base for new sports network

Please send the coupon below to: Wills & Bequests, uest sts s, Th The S Sal Salvation alva lvatio i nA Army Army, rmy, G GPO PO Box Box 98 9888 9888, 88, iin 88 n yo your ur cap capit capital itall cit ita c city. ity. ity ❏ Please send me a free copy of your 24-page Wills booklet. ❏ I am interested in including The Salvation Army my in my Will. ❏ I have already included The Salvation Army in my Will. Mr/Mrs/Miss/Ms/Other.................................................................................................................................................... Name............................................................................................................................................................................... Address............................................................................................................................................Postcode................ GA12 Phone..............................................................................................................................................................................

LOW PRICE GAS!

BY JOHN VAN KLAVEREN PLANS for a new container port in Melbourne have cast further doubt over a proposal to relocate car shipping to Geelong. Ports Minister Denis Napthine said the $1.2 billion container port at Webb Dock was the “final piece in the jigsaw” for the Geelong proposal. Dr Napthine repeatedly said he did not want to pre-empt an announcement on the proposal. “Currently the export import car trade operates on both sides of Webb Dock. With this new development, containers are going onto this (larger) section of Webb Dock (and) the cars will need a new home. “Now that we have this

Y

kleenheat.com.au

C1028689-KG17-12

4

The Independent, Friday April 27, 2012

1031215-PJ17-12

ALL STOCK MUST GO NO REASONABLE OFFER REFUSED.

1030427-JF16-12

CLOSING DOWN SALE


GORDON AVE. ACCIDENT

Council Crown cash ‘strange’

REPAIR CENTRE

C1029701-KG17-12

• APPROVED SMASH REPAIR CENTRE • ALL MAKES & MODELS • FULL REPAIR SERVICE • ALL INSURANCE COMPANIES • 24 HOUR TOWING SERVICE • HIRE CARS & COURTESY CARS • STATE OF THE ART WORKSHOP • CALL US TODAY FOR YOUR NO OBLIGATION QUOTE 26-30 Gordon Ave, Geelong West VIC 3218 Mobile: 0420 997 416 Phone: 03 5221 1900 Fax: 03 5221 1633 email: nick@gaarc.com.au web: www.gaarc.com.au 1031179-TB1 1031179-TB17-12

Funds furore: St Leonards’ Paul Sproule, Karen Reiter and Bob Hynes outside their town’s memorial hall, also desperate for upgrade funding. Picture: Tommy Ritchie 80586

Rat’s: Tom O’Connor.

Good: Lisa Neville. the hall to its former glory in memory of those in the district who have served in wars since.” Council recently granted St Leonards $5000 for heating and cooling facilities at the hall. Mr Sproule said residents supported the Indented Head hall

upgrade. Indented Head residents had also “worked hard for their facility”, he said. “It’s not about St Leonards-versus-Indented Head, it’s actually completely the opposite. No one’s trying to outdo each other; we’re just trying to provide a service.” Committee for Bellarine’s Tom O’Connor supported council partly funding the Indented Head hall upgrade. “The land is owned by the Crown on behalf of the community. Who gives a rat’s who manages it?” State Member for Bellarine Lisa Neville labelled the plan for council to fund the Indented Head project “good progress”. Council rarely funded facilities on Crown Land, she said. “It’s good council is starting to think about its responsibility to ratepayers and not use a technicality.” Ms Neville said State Government grant applications often required an initial commitment from council. “I don’t think there’s anything funny about this. Now council needs to be putting in a formal proposal to State Government, which is not unusual.” – Letters, page 18

Bookcases from $49

4x2 Student Desks from $129

Robes was $299 NOW $149 Lamp Table was $129 NOW $99

1900 Lowline was $649 NOW $399 Coffee Table was $179 NOW $139

Brandon QS Bed was $499 NOW $199

WE STOCK LAZBOY, BELLA HOUSE, LANFRANCO, MATARO

OTHER UNBEATABLE OFFERS ACROSS THE STORE! OF S E! RE TUR ER AC I IV 2 URN DEL F E W

BY MICHELLE HERBISON ST LEONARDS Progress Association has criticised a councillor’s pledge to seek $150,000 for upgrading the Indented Head community hall. Association president Paul Sproule said Cr John Doull’s support for the hall was “strange” because it was on Crown land. Bellarine Bayside Foreshore Committee was responsible for the site, not council, Mr Spoule said. “It doesn’t seem right that he’s got $150,000 for a State Government-owned and operated hall when there’s no indication State Government has it on their agenda.” The Independent reported last week that Cr Doull would encourage Geelong councillors to include in this year’s budget $150,000 to upgrade Indented Head’s hall. Cr Doull said Bellarine Bayside and State Government would have to contribute additional funding for the $600,000 project. Mr Sproule said the progress association had been fundraising for about 12 months for a $90,000 upgrade of the 86-year-old St Leonards Memorial Hall. “The progress association and the wider community are working very hard to raise funds to restore

BARGAINS GALORE

Corner Carr & Fitzroy Streets, South Geelong

5229 9844 & 5221 1864

D LI ON’ M T IT M ED IS ST S O OC UT K! !

Group attacks hall funds bid

C1028970-KG17-12

The Independent, Friday April 27, 2012

5


NTIA

BEST CRUISE OPERATOR

2011 International Based Operation

Vietnam & Cambodia 2012 THE APT DIFFERENCE

12 DAYS FROM $4,295* per person, twin share. Travel 28 July, 11 & 18 August, 1 September 2012. Includes: 7 night luxury Mekong -‰ÜjÁËWÁ։ÄjËVË|˙‰~†ÍÄ˝ÖÍÄÍ?™a‰™~ ?WW””a?͉™ËVË Þ¬ÁjË͆jË magnificent Angkor Wat & ͆jË ÖË †‰Ë0֙™jÄËV˝W?Ë݉™jË with all on-board lunches & dinners V˝W?ËMjjÁ^ËĬ‰Á‰ÍÄËFËĝwÍËaÁ‰™Ë ?ÍË?Ë͉”jÄ˝™ËWÁ։ÄjËVËÏå˔j?Ä ENJOY EXCLUSIVE DINING EXPERIENCES BY LUKE NGUYEN

Angkor

7

SIEM REAP 2 MEKONG Tonle Sap RIVER CRUISE VIETNAM Kampong Chhnang Phnom Penh CAMBODIA My Tho 2 SAIGON Tan Chau (Ho Chi Sa Dec Cai Be Minh City) ASK ABOUT OUR 8 DAY CRUISE WITH LUKE NGUYEN ONBOARD! HURRY, CRUISE DEPARTS 9 JULY 2012!

7 -¤Ô

FLY FREE*

Ha Long

HANOI 2

19 DAYS FROM $7,295* per person, twin share. Travel June 2012 to April 2013. Includes: 7 night luxury Mekong -‰ÜjÁËWÁ։ÄjËVËÔËa?ßËWÁ։Äj˝™Ë͆jË World Heritage-listed Ha Long Bay VË Þ¬ÁjË͆jˉ™WÁja‰MjË™~ÁË 8?ÍËFË ÖË †‰Ë0֙™jÄËV˝W?Ë݉™jË with all on-board lunches & dinners V˝W?ËMjjÁ^ËĬ‰Á‰ÍÄËFËĝwÍËaÁ‰™Ë ?ÍË?Ë͉”jÄ˝™ËWÁ։ÄjËVË|É˔j?Ä ENJOY EXCLUSIVE DINING EXPERIENCES BY LUKE NGUYEN

LAOS

1

AY N Y 2 D ISE O BA U G CR LON HA

FLY FREE*

BEST OF VIETNAM & CAMBODIA – MEKONG RIVER CRUISE & TOUR

S SE L UI AL TU CR THE ALO M ON RV A W NE

9 Newest ship on the Mekong, the luxury RV AMALOTUS, with exclusive twin balconies in over 90% of suites 9 Gourmet dining experiences, including Dine Around Dinners, degustation event in Saigon, and exclusive on-board dining event – hand crafted by renowned chef and APT ambassador, Luke Nguyen 9 Iconic & luxurious hotel accommodation 9 APT Signature Experiences 9 Freedom of Choice Touring 9 All internal flights, port charges, airport transfers & tipping 9 Small group shore excursions with expert local guides 9 Dedicated APT Tour Director

VIETNAM & CAMBODIA HIGHLIGHTS – MEKONG RIVER CRUISE & TOUR

HA LONG BAY CRUISE

2

Da Nang

HUE Lang Co Beach 2 HOI AN

Angkor 7 VIETNAM SIEM REAP 2 MEKONG Tonle Sap RIVER CRUISE Kampong Chhnang Phnom Penh CAMBODIA My Tho 2 SAIGON Tan Chau (Ho Chi Sa Dec Cai Be Minh City)

VEMR19

EXPERIENCE OUR EXPERIENCES

CALL 5244 3666

Cnr High & Regent Streets, Belmont Stuart

Belinda

Kylee

Gail

Rita

Helen

David

Loretta

*Conditions apply. See in store for details. Holiday Corner trading as Jetset Belmont Lic no. 30370

20 BROC 13 OUT NHURE OW!

South America 2013

EXCLUSIVE SMALL GROUP JOURNEYS – MAXIMUM 28 PASSENGERS S THE VERY BEST OF SOUTH AMERICA COLOMBIA

SPECTACULAR EXTENSIONS AVAILABLE

ECUADOR

EX HIRAMCLUSIVE! RAIL BINGHAM JOUR NEY

AMAZON

MACHU PERU RAINFOREST PICCHU 1 LIMA 2 SACRED VALLEY 2 2 CUSCO 2 BOLIVIA BRAZIL LAKE TITICACA (PUNO) PARAGUAY CHILE

“Each country was so unique, it really felt like we were travelling into different worlds. To see South America in such comfort was brilliant... I wouldn’t hesitate going back with APT – thank you,” J Kennedy

INFORMATION A SESSIONS

FREE

JJoin oin one of our free information sessions to learn more about our 2013 program, including exciting NEW experiences.

REGISTER NOW!

LIMITED SPACES SPA P CES AV A AVAILABLE VAILABLE

RETURN LIMO TRANSFERS 6.00 PM 10.30 AM, 2.00 PM ORWITH Registration is free but seats are limited. Pre-booking is essential. EVERY BOOKING www.aptouring.com.au/infosession RYDGES HOTEL MELBOURNE TUESDAY AY 24 APRIL 2012

RIO DE JANEIRO 3

2 IGUASSU FALLS

Pacific Ocean

Atlantic Ocean

SANTIAGO 2 ARGENTINA

URUGUAY 3 BUENOS AIRES IS20

COMPANION MP PANIO PA PANIO A O FLY FREE

GALAPAGOS CRUISE

AMAZON RAINFOREST

COMP CO COMPANION MPAN MP ANIO AN ION IO N FL FLY Y FR FREE FREE* EE* EE

COMP CO COMPANION MPAN MP ANIO AN ION IO N FLY FLY FREE* FREE FR EE* EE

Þ¬ÁjË͆jËw?ÄW‰™?͉™~Ë??¬?~ÄË Đ?™aÄ^Ë݉͆Ë?ËwÖÁ˙‰~†ÍːÖÞÖÁßËWÁ։ÄjË ?M?ÁaË͆jË 7Ë??¬?~ÄË Þ¬ÁjÁË±Ë 0?jˉ™Ë͆jˆÖ~jË?ÁÁ?ß˝wË֙‰¶Öj˙?͉ÜjË Ý‰a‰wjË͆?Íˉ™†?M‰ÍË͆jÄjˉ™WÁja‰MjË ‰Ä?™aÄ^Ë?ËwÁ”ËߝÖÁË jÖÞjË ?W™ßË .։ÍjËrË ÞWÖĉÜjË͝Ë+0± 27 DAYS FROM $17,995* pp

ÞÍj™aËߝÖÁˎÖÁ™jßË݉͆Ë?™Ë‰™ˆaj¬Í†Ë a‰ÄWÜjÁß˝wË͆jË”?㝙Ë-?‰™wÁjÄÍ±Ë .Í?ßËwÁËÔ˙‰~†ÍÄË?ÍË͆jË™?ÍjÁÁ?Ë -jÄjÁÜ?ËjWˆa~jË#-Ëj™ŽßË?ËxÜjË a?ßË”?㝙Ë-‰ÜjÁËWÁ։ÄjË?™aËwÖÁË a?ßË??¬?~ÄËĐ?™aÄËWÁ։Äj±Ë LODGE: 22 DAYS FROM $12,995* pp CRUISE: 30 DAYS FROM $20,495* pp

PATAGONIAN LAKES

ANTARCTICA CRUISE

*

20 DAYS FROM $11,995* per person, twin share Travel January to November 2013 Includes: ¤šË™‰~†ÍÄːÖÞÖÁßË?WW””a?͉™ËVË™Ëaj¬Í†Ë͝ÖÁ˝wË Öj™ÄˉÁjÄ VË.Í?ßËÔ˙‰~†ÍÄË?ÍË ?ÄË ?Í?Á?Í?ÄËMßË#Á‰j™Íˆ Þ¬ÁjÄÄ^Ë?ÍË~Ö?ÄÄÖË?ÄË VË0Á?ÜjËMßË7‰ÄÍ?a”jËÍÁ?‰™ËÍË ?W†ÖË+‰WW†ÖËVË Á։ÄjË?jË0‰Í‰W?W?ËVËÏÉ˔j?ÄË APT EXCLUSIVE EXPERIENCES – INCLUDED AT NO EXTRA COST: VË ”¬jÍjËߝÖÁË ?W†ÖË+‰WW†ÖËjÞ¬jÁ‰j™Wj˝™ËM?ÁaË#Á‰j™ÍË Þ¬ÁjľˉÁ?”Ë ‰™~†?”ËÍÁ?‰™Ë݉͆Ë|ËWÖÁÄjËa‰™™jÁËrËܝÍjaË͆jËݝÁa¾ÄË!±Ë¤ËÍÁ?‰™ËjÞ¬jÁ‰j™WjuË VË.Í?ßË?ÍË͆jË ‰Á?wÁjÄË+?ÁËÍjËMßË#Á‰j™Íˆ Þ¬ÁjÄÄˉ™Ë‰”?ËVËÔ˙‰~†ÍÄË?ÍË͆jË -‰Í㈠?ÁÍ™Ë.?™Í‰?~ËVË™ÍÁaÖW͝ÁßË.¬?™‰Ä†ËjÄĝ™Ë?ÍË͆jËw?”jaË ?wkË0Á͝™‰Ë VË Þ¬jÁ‰j™WjËÁ~j™Í‰™?¾ÄË֐͉”?ÍjËÍ?™~ËƝÝËVË8?Ë?”™~ÄÍË͝ÖW?™Ä˙j?ÁË ~Ö?ÄÄÖË?ÄËVË ‰™j˝ÜjÁ‰™~Ë?ˤyååËßj?ÁˆaË+ßÁ?”‰aˉ™Ë‰”?ËVË ‰™jËÝ‰Í†Ë ?ːW?Ë+jÁÖ܉?™Ëw?”‰ßˉ™Ë͆j‰Áˆ”jËVË ,Ë?™aË+jÁÖ܉?™Ë+?ĝˆÁÄjËƝÝ

ASK ABOUT FLYING BUSINESS CLASS FOR JUST $4,495* PP

COMP CO COMPANION MPAN MP ANIO AN ION IO N FLY FLY FREE* FREE FR EE* EE

COMP CO COMPANION MPAN MP ANIO AN ION IO N FL FLY Y FR FREE FREE* EE* EE

™ŽßË?™ËjÞÍj™Ä‰™Ë͆?ÍËÍ?jÄËߝÖË ÜjÁË͆jË+?Í?~™‰?™Ë™ajÄË?™aË Í†ÁÖ~†Ë¬Á‰Ä͉™jËÁ~j™Í‰™jË?jÄË

‰ÄÍÁ‰WͱË-j?ÞË?ÍË͆jː?Ë?ËÍjË FË-jĝÁÍ˙j?ÁË ?Á‰W†jËMjwÁjË Ž‰™‰™~ËߝÖÁË.Ö͆Ë”jÁ‰W?ˎÖÁ™jß±Ë 26 DAYS FROM $15,295* pp

!jÝËwÁËÔå¤Ï^ËWÁ։ÄjËwÁËjjÜj™Ë™‰~†ÍÄË jÞ¬Á‰™~ËMÁj?͆Í?‰™~Ë™Í?ÁW͉W?±Ë.jÍË wÍ˝™Ë͆jË~Áj?ÍË݆‰ÍjËW™Í‰™j™ÍË?™aË ÄjjË+j™~։™Ë-WjÁ‰jÄ^Ë?ÄËߝÖËWÁ։ÄjË ‰™ËߝÖÁËWÖÄ͝”ËM։ÍËjÞ¬ja‰Í‰™ËƉ¬^Ë Ý‰Í†ËjÄÄË͆?™Ë¤ååˬ?ÄÄj™~jÁı 32 DAYS FROM $22,595* pp

CALL 5244 3666

Cnr High & Regent Streets, Belmont Stuart

*Conditions apply. See in store for details. Holiday Corner trading as Jetset Belmont Lic no. 30370

6

The Independent, Friday April 27, 2012

Belinda

Kylee

Gail

Rita

Helen

David

Loretta

1031287-KS17-12

EXPERIENCE OUR EXPERIENCES


Acquiring Property via a Self Managed Superannuation Fund & Economic & Property Update

‘Dummies’ discouraged

• What are the options to acquire property through an SMSF?

7.30pm – 8.45pm Geelong Football Club

• Economic and Interest Rate Update • Property Market Update

By Monday 30th April 2012

For further information contact Sue and the team at Banksia Geelong located at:

199 Moorabool Street, Geelong VIC 3220 Tel: 03 5221 7599

270412

Gigabyte/Asus DDR3 M/B 4GB DDR3 - 500GB SATA LG DVDRW - ATX Case Intel Duocore G620 $309 Intel Core i3 2100 $370 Intel Core i5 2400 $455 Intel Core i5 2500K $499

LED

$569 Intel Core i3 2100 4GB RAM, 500G Hard drive Samsung 22” Led/ DVDRW Windows 7 Home Premium

Smart Starter

BOX

GA/Asr H61-USB3 M/B 8G DDR3 - 1TB SATA HDD LG DVDRW - Thermaltake case Windows 7 Home Premium GA HD 6770 1G D5 Graphics

Smart Core i5

Intel Core i7 3820 LGA2011 Built for Video/GamerGigabyte X79 UD3 Mainboard

$1490 $14909

$699 $839 $890

Workstation

Business

.Intel Core i5 2400 .Gigabyte H61M MB .8G Ram, DDR3 .Seagate 1TB Hard drive .Lg DVDRW Writer .Acer 22” W/ screen .MS Window7 Prfessional Ms Keyboard & Mouse

HP

$789 $1169

Intel Core i5 2500K 8GB RAM, 2TB Hard drive Samsung 22” LED , DVDRW Windows 7 Home Premium ATI 5750 d5 1G Graphics

Computer Service Package

Spyware And Virus Removal Trojan & Keyloggers 16G DDR3 1333Mhz e c rman Removes All hidden rookits LG blueray Writer Perfo Hardware & Software Clean Up WD 2tb Black Edition Gigabyte GTX560 OC 1.2 Graphic FREE One YRS Antivirus Special Antispyware+Antimalware Ms Window 7 Premium Fully Service , Updates Thermaltake level 10 GTS

$59

TERMINATOR NETWORKING & COMPUTER REPAIR VIRUS Spyware Analyse, design, install, commission and manage. Internet, Security solutions

Intel Core i7 2700K 16GB RAM, Gigabyte Z68p ds3 Seagate 1TB Hard drive Acer 24” LED, DVDRW Writer Smart ATI 6850 1G d5 Graphics Core i7SE Window 7 , Thermaltake case

SB Free 16G U

Intel Core i5 2450M ,WEB 8G RAM, Intel HD 3000 Graphic 500G, DVDRW WIFI, HDMI, 15.6” LED Win7 H Premium,

$639 $449

2 YRS Warranty

$699

SMART E6300

LED

www.pcdi.com.au

geelong@pcdi.com.au

Performance

Intel Core i5 2500 Intel Core i7 2600K Intel Core i7 2700K

03 5222 5189

Intel Core I7 2670 8G RAM -640G HD GT540 2G Graphic Graphic Mobility WIFI - WEB - HDMI 15.6” LED HD DVDRW Burner Windows 7 Home Premium 64bit

2 YRS Warranty

$849

2 YRS Warranty

$699

$949

Intel Duo Core B960 ,WEB 4G RAM, Intel HD Graphic 320G, DVDRW WIFI, HDMI, 15.6” LED Win7 H Premium, USB3.0 , Numberic Keyboard

Intel i7-2670QM 6G RAM -640G HD NVIDIA GT525 1G DDR3 Graphic WIFI - WEB - HDMI 15.6” LED Screen DVDRW Burner Windows 7 Professional

Intel i5-2450M, (2.5) 8G RAM -500G HD Rock Solid HD Protection NV GT540 2G Graphic WIFI - WEB - HDMI Gigabyte 15.6 LED Screen DVDRW Burner HD7970 Windows7 Home Premium 64bit 3G Graphic

$599

Asus Bundle

Intel B960 ,WEB 4G RAM, 320G, DVDRW WIFI, HDMI, 15.6’ LED, USB3.0 Win7 H Premium, MS Office Home & Student 2010, Word Excel, Powerpoint One Note, Carry Bag

$549

C1031283-KG17-12

BOX

1030126-KG17-12

Banksia Securities Limited (BSL) ABN 45 004 736 458 AFSL 227837 offers investments in secured notes. BSL is not a bank. All investments involve risk and investors risk losing some or all of their principal investment. BSL secured notes do not have a credit rating. Before investing in these products you should read the current disclosure documents. A prospectus and application form is available from any branch, by calling our administration centre on 1800 333 114 or from the website www.banksiagroup.com.au. Continuous disclosure is also available from this website. Rates are current as at 13 April 2012 and are subject to change.

PCD International Pty Ltd Standard

To reserve your seat phone Lesley on 5244 6820

The disciplines of working hard and being the best you can be is the passion that drives us to achieve the same goals for you. Good old fashioned values, where all funds stay in Australia, personal service and Aussie know-how.

statewide council elections on October 27. Ms Powell’s spokesperson said the mayoral vote would run in conjuction with ward councillor elections. “The councillors will be elected as they were last time, as 12 single-member wards with no change to their voting system. “The difference this time will be that voters get two ballot papers, one for their ward and one for the mayor.” The spokesperson said State Government was still considering the pay scale for Geelong’s new mayor. “The minister has said the pay rate for Melbourne’s mayor would be considered in the determination of the Geelong mayor.” Mr Doyle earns about $150,000 a year as Melbourne’s mayor. Incumbent Geelong Mayor John Mitchell was unsurprised the Government had chosed a preferential system. “We’ll work within the rules they put down. The preferential system is used at state and federal level.”

78 Mercer St, Geelong

Alex Popescu Room (South End)

Get on the all Australian Team

Preference for mayor BY JOHN VAN KLAVEREN PREFERRENTIAL voting will choose Geelong’s first directly elected mayor, State Government has revealed. A spokesperson for Local Government minister Jeanette Powell said the system was unlikely to encourage dummy nominations standing only to direct preferences to particular candidates. “The laws were changed before the 2008 elections to require all candidates to nominate in person. This makes it that much more difficult for so-called dummy candidates to run,” the spokesperson said. The alternative to preferences would have been a first-past-the-post system in which residents would have voted only for the candidate of their choice. Geelong will be the second municipality in Victoria to have a directly elected mayor, with Robert Doyle presiding over City of Melbourne. Geelong residents will elect their mayor to a four-year term during

THURSDAY 3RD MAY 2012

1029746-KS15-12

Cold comfort: Bacchus Marsh sisters Kelly, 11, and Louise Pettifer, 21, cuddle for warmth as wintry weather chills Geelong’s waterfront this week. Picture: Tommy Ritchie 80555

Davidsons Accountants invite you to attend this free superannuation session on:

D.I.Y Computer Parts Mainboard

CPU intel G620 Intel i3 2100 Intel i3 2120 Intel i5 2400 Intel i5 2500 Intel i5 2500K Intel i7 2600 Intel i7 2600K Intel i7 2700K intel i7 3820 AMD A6 3500

$ 66 $116 $125 $182 $202 $210 $287 $295 $325 $298 $103

Intel DP55WG $105 rock h61m-usb3 $79 GA-z68x-ud3h-b3 $179 GA-z68p-dsp3 $110 GA-H61m-s2pV $ 59 GA-H61M-D2V $79 ga-z68M-d2h $120 GA-A55M-S2H $ 88 Asus M5a78L-Mlx $85 GA-Z77Mx-D3H $115 GA-Z77X-D3H $169 GA-X79-UD3 $232

RAM

RAM Cosair 1024M DDR Cosair 2G D2 Cosair VENg 8GB King 8G Kit D3 Sto 4GB DDR3

$35 $29 $75 $55 $23

Hard Drive

$ 22 LG SATA DVDRW $ 45 Asus Ext Slim USB SAM Blueray Combo RET$ 69 $ 29 Pioneer 219L LG Bluray Writer LS38 $ 90 Pioneer Bluray writer $110

WD 320G ATA $85 S/W 500G SATA $75 External Hard Drive S/W 1TB SATA $96 WD 750G 2.5’ USB3 S/W 2TB SATA $125 SAM 1TB 2.5’ USB2 OCZ 60G SSD SATA3 $ 95 SAM 1TB 2.5 USB3 SAM G3 1TB 3.5 USB2 Fujitsu 240G SSD3 $359 SAM G3 2TB 3.5 USB2 Seag 1Tb 3.5’ Goflex

$109 $119 $125 $89 $129 $95

Gigabyte GTX680 2G Graphic Limited Stock

$669

8G SDHC $10 16G Sdhc $19 Netgear 32G Sdhc $45 Media Server 8G Micro SD $10 16G Micro SD $19 Support 2x HD 32G Micro SD $45

$75

Advertised Prices are for Cash or Bank Cheque only. A 2% Surcharge will apply for Visa & Mastercard. Prices & Specification are subject to change without notice. Pictures are for illustrative purposes only. All Systems come with 3 yr Labour & 1 yr Parts R.T.B Warranty

The Independent, Friday April 27, 2012

7


1800 500 501

1031604-KS17-12

European Exchange Students Arriving July scceaust@scce.com.au www.scce.com.au

Target ‘scans’ bodies

Pair’s on run with support of golfers

Bellarine Peninsula Families Needed

JAMES STREET DENTAL CENTRE Welcomes Dr Safdar Devji Saturdays available by appointment

NEW PATIENTS WELCOME COMPREHENSIVE DENTAL CARE INCLUDING IMPLANTS AND ORTHODONTICS. Dr Darren Thrift Dr Patrick Puckett Dr Erin Callahan

6 James Street, Geelong Ph 5229 8721

1015851-JM48-11

A pair of young Surf Coast athletes will run through Central Australia to raise money for children at the other end of the continent. Airey’s Inlet’s Ben Watts, 25, and Bellbrae’s Sarah Bredebusch, 17, will take on the harsh terrain around Uluru in an Australian Outback Marathon on July 28. The pair will use their outback challenge as a fundraiser for Cathy Freeman Foundation, which helps pay for the education of 500 children on Far North Queensland’s Palm Island. The remote community is regarded as the fourth mostdisadvantaged in Australia. Another island will be the setting for an additional fundraiser to help Watts and Bredebusch support the foundation. A Queenscliff Golf Club spokesperson said the club’s Swan Island course would host a charity event on May 19 to “assist Ben and Sarah’s fundraising”. The day of social and competition golf would have teeoffs at 7.30am and 12.30pm, with a barbecue and bar refreshments available. “All proceeds of the day will benefit the work of the Cathy

Runners: Sarah Bredebusch and Ben Watts practise their barbecue skills for the golf day fundraiser. Freeman Foundation,” the spokesperson said. “Work group teams and families are encouraged to come and enjoy what’s on offer at the clubhouse in this most beautiful of settings.” Entry for non-members will

cost $20. The spokesperson said entries were available until May 16 by phoning the club on 5258 4344. More information was available at cathyfreemanfoundation.org.au.

BY JOHN VAN KLAVEREN GEELONG-BASED national retailer Target has embarked on a $1 million study to determine Australian sizes. Managing director Dene Rogers said Target would run Australia’s first national sizing study using 3D scanning technology. A state-of-the-art AlvaScan machine would circulate in key metropolitan Target stores to measure consumers’ bodies in less than 60 seconds, he said. The sophisticated scan would provide them with a take-home print out of their exact measurements. Mr Rogers hoped more than 20,000 customers would participate as the scanner travelled around Australia in the next five weeks. “Sizing inconsistencies are a major cause of customer frustration across the retail industry and the leading contributor of return rates for clothing both instore and online,” he said. “The study (is) designed to improve the fit and consistency of Target’s sizing range. By taking 60 seconds to be scanned consumers will not only find out their exact measurements, they’ll help Target find out what size Australians really are today. “We know Australian customers are confused and frustrated by inconsistent size labels on clothing items.” The scanner used latest radio wave technology to collect 200,000 data points on consumers standing fully clothed in a booth. The Alvanon scanner extracts 55 technical measurements from the 3D body shape for use in Target’s garment design and manufacturing processes. Target revealed the initiative to the Indpendent three weeks after another Geelong-based national retailer, Cotton On, announced “musical changerooms” for its stores.

SUZANNE CORY High School Selective Entry School

Co-Educational

Years 9-12

Melbourne’s West

Year 9 Enrolments 2013 Information Session for 2013 will be held at 7pm Thursday 10th May 2012. A presession school tour commencing at 6pm. School Tours, Bookings are essential: Thursday 19th April 2012 at 9am Tuesday 24th April 2012 at 3pm Thursday 26th April 2012 at 6pm

Apply now to sit the entrance examination at: www.education.vic.gov.au/selentry Applications close 18th May 2012. Call 8734 2800 or email suzanne.cory.hs@edumail.vic.gov.au

respect aspiration contribution For further information about the school please visit www.suzannecoryhs.vic.edu.au or call us on 8734 2800. Location 255 Hoppers Lane, Werribee

C1031067-KG17-12

You decide on your speed. The physics decides whether you live or die.

8

The Independent, Friday April 27, 2012


&$5((56$77+(&,7<

38%/,&127,&(6

-2,121(2)*((/21*·6/$5*(67 (03/2<(56

(03/2<(56321625('9,6$5()2506 ,1)250$7,216(66,21

:HRIIHUH[FHOOHQWHPSOR\PHQWFRQGLWLRQVDQGRSSRUWXQLWLHVWRIXUWKHU \RXUFDUHHU7RYLHZDYDLODEOHSRVLWLRQVDSSO\RUREWDLQDSRVLWLRQ GHVFULSWLRQYLVLWRXUZHEVLWHZZZJHHORQJDXVWUDOLDFRPDX

78(6'$<0$<$0

38%/,&0((7,1*6 127,&(2)&281&,/0((7,1* 7KHQH[WPHHWLQJRIWKH*UHDWHU*HHORQJ&LW\&RXQFLOZLOOEHKHOGDWWKH &RXQFLO&RQIHUHQFHDQG5HFHSWLRQ&HQWUH&LW\+DOO/LWWOH0DORS6WUHHW HQWUDQFH*HHORQJRQ7XHVGD\0D\FRPPHQFLQJDWSP

:20(1*(7(/(&7(' $:25.6+23)25:20(1 &$1','$7(6

&,7<+$//*+(5,1*+$367*((/21*

021'$<0$<307230 &,7<+$///,77/(0$/23675((7 *((/21*

7KH'HSDUWPHQWRI,PPLJUDWLRQDQG&LWL]HQVKLS ',$& DUHKRVWLQJ DQLQIRUPDWLRQVHVVLRQIRUHPSOR\HUVDQGRWKHUNH\VWDNHKROGHUVRQ FKDQJHVWR(PSOR\HU6SRQVRUHG9LVDV 5606(16 

:LWKORFDOJRYHUQPHQWHOHFWLRQVMXVWVL[ PRQWKVDZD\PRUHZRPHQDUHEHLQJ HQFRXUDJHGWRUXQIRUFRXQFLO&XUUHQWO\ RQO\SHUFHQWRI&LW\RI*UHDWHU *HHORQJ&RXQFLOORUVDUHZRPHQDQGWKH VWDWHDYHUDJHLVMXVWXQGHUSHUFHQW

7KLVVHVVLRQLVLPSRUWDQWIRUWKRVHZKRFXUUHQWO\HPSOR\RUDUH FRQVLGHULQJHPSOR\LQJRYHUVHDVSURIHVVLRQDOV 5693WR$OLVRQ6WHHOHRUHPDLO DVWHHOH#JHHORQJFLW\YLFJRYDXE\)ULGD\0D\

'HWDLOVRILVVXHVWREHFRQVLGHUHGZLOOEHDYDLODEOHRQWKH&LW\·VZHEVLWH ZZZJHHORQJDXVWUDOLDFRPDX 7KHPHHWLQJLVRSHQWRWKHSXEOLF

+$9(<2856$< 632576)2580*5$176)2563257,1* &/8%6 :('1(6'$<0$<307230 $/(;323(6&85220632576+286(0225$%22/ 675((7*((/21* 632576)2580LVD&LW\RI*UHDWHU*HHORQJLQLWLDWLYHIRFXVHGRQSURYLGLQJ LQIRUPDWLRQDQGVXSSRUWWRORFDOVSRUWLQJFOXEVDQGFRPPXQLW\JURXSV

7KH:RPHQ*HW(OHFWHG$:RUNVKRS IRU:RPHQ&DQGLGDWHVZLOOSURYLGH LQIRUPDWLRQDERXWZKDWLVUHTXLUHG WREHFRPHDFDQGLGDWHLQWKHORFDO JRYHUQPHQWHOHFWLRQVLQ2FWREHU $OLJKWVXSSHUZLOOEHSURYLGHG

%,15(029$/ 2Q0RQGD\$SULOZHZLOOEHUHPRYLQJWKHPRELOHJDUEDJHELQV ORFDWHGDW Â&#x2021; $3&26HUYLFH6WDWLRQFQU%DUZRQ+HDGVDQG*ROI/LQNV5RDGV  %DUZRQ+HDGV Â&#x2021; 0RUWLPHU·V6HUYLFH6WDWLRQLQ+LJK6WUHHW'U\VGDOH $OWHUQDWLYHGLVSRVDOIDFLOLWLHVDUHDYDLODEOHDWERWKWKH*HHORQJDQG 'U\VGDOH5HVRXUFH5HFRYHU\&HQWUHV)HHVPD\DSSO\ 7KHELQVDUHEHLQJUHPRYHGWRHOLPLQDWHRQJRLQJLOOHJDOGXPSLQJDW WKHVHORFDWLRQV$Q\HQTXLULHVFRQWDFWXVRQ

:HDUHKRVWLQJWKHIUHHZRUNVKRSZLWKVXSSRUWIURP9LFWRULDQ/RFDO *RYHUQDQFH$VVRFLDWLRQ 9/*$ DQG6WDWH*RYHUQPHQW YLDDJUDQW IURPWKH2IILFHRI:RPHQ /RFDOO\WKH*HHORQJ:RPHQLQ/RFDO 'HPRFUDF\ :,/' JURXSLVFRPPLWWHGWRLQFUHDVLQJWKHQXPEHURI ZRPHQ&RXQFLOORUVLQWKH*UHJLRQ 7RUHJLVWHUIRUWKHZRUNVKRSFRQWDFW/LQGD%HQQHWWDWWKH9/*$RQ RUHPDLOOLQGD#YOJDRUJDX )RUPRUHLQIRUPDWLRQRQWKH*HHORQJ:,/'JURXSFRQWDFW-HQQ\:LOOV RQRUHPDLOMHQZLOOV#YWRZQFRPDX

6SHDNHUVIURPDUDQJHRIIXQGLQJDJHQFLHVZLOOEHSUHVHQWLQJ LQIRUPDWLRQRQDUDQJHRIJUDQWSURJUDPVDQGDGYLFHRQHIIHFWLYHJUDQW ZULWLQJ632576)2580SURYLGHVFOXEVDQGFRPPXQLW\JURXSVZLWK Â&#x2021;*UDQWDQGIXQGLQJDVVLVWDQFH Â&#x2021;8SWRGDWHUHOLDEOHLQIRUPDWLRQ Â&#x2021;2SSRUWXQLWLHVWRQHWZRUNZLWKNH\VXSSRUWDJHQFLHV

<285/2&$/6(1,256&/8%,6&/26(5 7+$1<287+,1.

)RUPRUHLQIRUPDWLRQYLVLWZZZJHHORQJDXVWUDOLDFRPDXOHLVXUHRU HPDLOVSRUW#JHHORQJFLW\YLFJRYDX

7KHUHDUHRYHU6HQLRU&LWL]HQV&OXEVLQWKH*HHORQJDUHDWKDW SURYLGHDZHOFRPLQJHQYLURQPHQWDQGDUDQJHRIDFWLYLWLHVDQGVRFLDO RSSRUWXQLWLHV7RILQGRXWPRUHDERXW\RXUORFDO6HQLRU&LWL]HQV&OXE FDOOXVRQ

127,&(2)$33529$/2)$0(1'0(176

7KH0LQLVWHUIRU3ODQQLQJKDVDSSURYHG$PHQGPHQW&WRWKH *UHDWHU*HHORQJ3ODQQLQJ6FKHPH 7KH$PHQGPHQWFDPHLQWRRSHUDWLRQRQ$SULOZKHQWKH QRWLFHRIDSSURYDOZDVSXEOLVKHGLQWKH*RYHUQPHQW*D]HWWH 7KHDPHQGPHQWUH]RQHVODQGDWDQG3DNLQJWRQ 6WUHHWDQG0HUY\Q6WUHHW1HZWRZQIURP5HVLGHQWLDO=RQHWR %XVLQHVV=RQHDQGUHPRYHV'HVLJQDQG'HYHORSPHQW2YHUOD\ 6FKHGXOHIURPWKHODQG 7KH0LQLVWHUKDVJUDQWHGWKHIROORZLQJSHUPLWXQGHU'LYLVLRQ 3DUWRIWKH$FW3HUPLW1R 'HVFULSWLRQRIODQG 3DNLQJWRQ6WUHHWDQG0HUY\Q6WUHHW1HZWRZQ

$0(1'0(17&/$5$72:1&(175((;3$16,21 3/$11,1*$1'(19,5210(17$&7 *5($7(5*((/21*3/$11,1*6&+(0( 7KH0LQLVWHUIRU3ODQQLQJKDVDSSURYHG$PHQGPHQW&WRWKH *UHDWHU*HHORQJ3ODQQLQJ6FKHPH 7KH$PHQGPHQWFDPHLQWRRSHUDWLRQRQ$SULOZKHQWKH QRWLFHRIDSSURYDOZDVSXEOLVKHGLQWKH*RYHUQPHQW*D]HWWH 7KHDPHQGPHQWDSSOLHVWRDQG6WDWLRQ/DNH5RDG/DUD NQRZQDV$XVWLQ3DUN LQFOXGLQJDSRUWLRQRIWKHURDGUHVHUYH DQGUH]RQHVWKHODQGIURP3XEOLF3DUNDQG5HFUHDWLRQ=RQHDQG 5RDG=RQH&DWHJRU\WRSDUW%XVLQHVV]RQHSDUW5RDG=RQH &DWHJRU\DQGSDUW3XEOLF3DUNDQG5HFUHDWLRQ]RQHDQG LQWURGXFHVD6FKHGXOHWRWKH'HVLJQDQG'HYHORSPHQW2YHUOD\ &RSLHVRIWKHVHDPHQGPHQWVFDQEHLQVSHFWHGIUHHRIFKDUJHDW

&,5

Â&#x2021; 7KH'HSDUWPHQWRI3ODQQLQJDQG&RPPXQLW\'HYHORSPHQWZHEVLWH  ZZZGSFGYLFJRYDXSODQQLQJSXEOLFLQVSHFWLRQ Â&#x2021; 0\HU6WUHHW&XVWRPHU6HUYLFH0\HUV6WUHHW*HHORQJ  0RQGD\WR)ULGD\DPWRSP 3HWHU$OOHQ([HFXWLYH'LUHFWRURI6WDWXWRU\3ODQQLQJ6\VWHPV5HIRUP 'HSDUWPHQWRI3ODQQLQJDQG&RPPXQLW\'HYHORSPHQW

/($51723/$<,1'225632576:,7+ 6:,063257 /(,685(

6XEVFULEHWRRXUHQHZVOHWWHUVRQJHQHUDO &LW\RI*UHDWHU*HHORQJQHZVDUWVSURMHFWV 1DWLRQDO:RRO0XVHXPDQGPDQ\PRUH

%DUZRQ9DOOH\$FWLYLW\&HQWUHDQG/HLVXUHWLPH&HQWUHKDYHWKUHH H[FLWLQJVSRUWV3URJUDPVIRUFKLOGUHQWRWU\QHZVSRUWVJDLQH[WUDVNLOOV PDNHIULHQGVDQGPRVWLPSRUWDQWO\KDYHVWDFNVRIIXQ

<RXFDQFKRRVHWKHW\SHRIQHZV\RXZDQW WRUHFHLYH6FDQWKH45FRGHRUJRWR ZZZJHHORQJDXVWUDOLDFRPDX FWP\JHHORQJQHZVOHWWHUDVS[

/($51723/$<63257=0,1, 7+5((72),9(<($56

,QWURGXFHVGLIIHUHQWVSRUWVHDFKZHHNLQFOXGLQJVRFFHUEDVNHWEDOO DWKOHWLFVFULFNHWDQGPLQLJDPHV&KLOGUHQZLOOGHYHORSEDODQFHDQG FRRUGLQDWLRQDQGKDYHKHDSVRIIXQ /($51723/$<62&&(50,1, 7+5((72),9(<($56

7KLVSURJUDPRIIHUVDVWUXFWXUHGFODVVZKHUH\RXUFKLOGZLOOEH LQWURGXFHGWRWKHZRUOGJDPH²6RFFHU3DUWLFLSDQWVZLOOOHDUQWKHVNLOOV RIWKHJDPHLPSURYHEDODQFH EXLOGWHDPVSLULW 632576&/8% ),9(72<($56

7KLVIXQSURJUDPLQWURGXFHVDGLIIHUHQWVSRUWHDFKZHHNLQFOXGLQJ VRFFHUEDVNHWEDOODWKOHWLFVEDGPLQWRQDQGYROOH\EDOO7KHHPSKDVLV LVRQIXQDQGSK\VLFDODFWLYLW\VRWKDWFKLOGUHQFDQGHYHORSWKHLUVNLOOV LQDIULHQGO\HQYLURQPHQWDQGFUHDWLQJDSDWKZD\LQWRUHJXODUVSRUWLQJ FRPSHWLWLRQV SURJUDPV /($51723/$<)876$/,1'22562&&(5 ),9(72<($56

7KLVSURJUDPRIIHUVDVWUXFWXUHGFODVVZKHUH\RXUFKLOGZLOOEH LQWURGXFHGWRWKHJDPHDQGVNLOOVRI)XWVDO)XWVDOGHYHORSVDZLGH YDULHW\RIVNLOOVDVVRFLDWHGZLWK6RFFHUDQGEHFDXVHRIWKHWLJKWVSDFH WKHJDPHLVSOD\HGRQDUHGXFHGILHOGSOD\HUVOHDUQWRPDNHTXLFN GHFLVLRQVDQGH[HFXWHSUHFLVHSDVVHV 1RZWDNLQJHQUROPHQWVIRU7HUP,7·6127722/$7( )RUIXUWKHULQIRUPDWLRQRUWRHQUROLQSURJUDPVIRUWHUPWZRSOHDVHYLVLW ZZZJHHORQJDXVWUDOLDFRPDXOHLVXUHYHQXHV /HLVXUHWLPH&HQWUH $QDNLH5RDG1RUODQH:HVW  %DUZRQ9DOOH\$FWLYLW\&HQWUH %DUZRQ+HDGV5RDG%HOPRQW 

3(75(*,675$7,21 5(1(:$ 5(1(:$/6:(5('8($35,/     

-XVWDUHPLQGHUXQGHUWKH'RPHVWLF  $QLPDOV$FWDOOFDWVDQGGRJV UHVLGLQJLQWKHPXQLFLSDOLW\PXVW EHUHJLVWHUHGZLWKWKH&LW\RI*UHDWHU *HHORQJIURPWKUHHPRQWKVRIDJH

  

7RHQDEOH\RXWRUHJLVWHU\RXU  DQLPDO\RXUSHWPXVWEH PLFURFKLSSHGILUVW

$OOSUHYLRXVO\UHJLVWHUHGGRJVDQGFDWV\RXUUHJLVWUDWLRQUHQHZDO IRUZDVGXH7XHVGD\$SULO $VSHWUHJLVWUDWLRQFKHFNVDUHQRZEHLQJFRQGXFWHGLQ\RXU DUHDPDNHVXUH\RXUHJLVWHU\RXUSHWQRZ 7KLVZD\\RXFDQDYRLGDSHQDOW\IRUKDYLQJ DSHQDOW\IRUKDYLQJ XQUHJLVWHUHGSHWV 7KHEHVWQHZVLVLI\RXUSHWJHWVORVWVWROHQ XUSHWJHWVORVWVWROHQ RUMXVWJRHVPLVVLQJRQFH FH ORFDWHGE\EHLQJUHJLVWHUHG WHUHG DQGPLFURFKLSSHG\RXU IRXUOHJJHGIXUU\IULHQG FDQTXLFNO\EHUHXQLWHG ZLWK\RXDQG\RXU IDPLO\

1031438-KS17-12

$0(1'0(17&0(59<1675((71(:72:1 3/$11,1*$1'(19,5210(17$&7 *5($7(5*((/21*3/$11,1*6&+(0(

),1'287),567

ZZZVVOJHHORQJDXVWUDOLDFRPDX

The Independent, Friday April 27, 2012

9


ATMs at venues under scrutiny

Imogen in steps of star Higgins

City pokie study BY JOHN VAN KLAVEREN GEELONG will play a key role in a statewide gambling research project into the removal of ATMs from pokie venues. Research team leader Dr Anna Thomas said the number of pokies in Geelong made it an important region. The project would conduct surveys with people leaving Geelong region venues, she said. “We’re trying to get as broad a representation from metropolitan and regional areas as possible.” State Government has commissioned the project to evaluate removal of ATMs from Victorian gaming venues.

Dr Thomas said the study, running until next year, was seeking survey recruits. Each participants would receive a $50 Coles-Myer gift card. Dr Thomas said the Swinburne University-led study would evaluate the effectiveness of prohibiting ATMs in gaming venues. The study would investigate ATM removal on problem gambling and consumer protection for recreational gamblers as well as costs and unintended consequences. The study coincides with Geelong councillors rejecting plans for 40 poker machines at Fyansford Hotel. Geelong Gambling Advisory

Committee chair Cr Jan Farrell wanted the ATMs study findings made available to the public. “It’s important that any initiative is evaluated but the findings have to be made public in a timely manner without any censorship.” Removing ATMs from gambling venues had become a “Clayton’s solution”, Cr Farrell said. “The policy has morphed into patrons only having cash access if they leave the gaming room and go to the bar or dining area. “In fact, they can access more cash across the counter than they could from an ATM.”

Audition: Imogen Brough.

IMOGEN Brough hopes to follow in the steps of pop star Missy Higgins in this year’s Powercor Star Search. The former Matthew Flinders College student and aspiring singer/songwriter is aiming to emulate Higgins’ victory in the vocal category of the 2000 talent quest. Ms Brough performed one of her own works, The Celtic Song, at auditions for the Star Search grand final last week. Instrumental audition entries are still open at starsearch.net.au. Young vocalists, instrumentalists and groups will compete for a cash prize pool of $7000 at the Rotary Club of Highton event. Deakin University’s waterfront Costa Hall will host the Star Search grand final on May 11. Tickets cost $25 for adults, $20 for concession card holders and $55 for families from Geelong Performing Arts Centre. The Independent is a sponsor of Star Search.

Premium quality, modern style and flexible design options Call Ziggy on 06 0417 434 3 or call s David Bayli 1 0 5 1 0488 22

AT SEE US SHOW E DING IA HOM THE H BITION BUIL EXHI 9/4. AT THE M 26/4 TO 2 AKE O FR TOCKT

S /6 PRE OFF OUR 5 2 4 / 16 25% SALE! RE RANGE! ENTInditions apply. ilsSe. e Co for deta instore

Wardrobes

1031366-TB17-12

ing Now servic Geelong

Shower Screens Sh

Splashbacks acks

1300 664 150 - www.premiumoz.com.au emiumoz.com.au 91 Pakington Street, Geelong West Ph. Fax. 5221 1 1276 h 5221 1275 Fax 10 Foxley Court, Derrimut Vic 3030 (Cnr West Park Drive). Ph: 1300 664 150 - Ph: 9394 0700 Fax: 9394 0770 1339 Toorak Rd, Camberwell Vic. Ph: 9889 5566 Fax: 9889 6094 68 Beischer Street, Bendigo Vic 3550. Ph: 5442 7799 Fax: 5442 6800 531 Whitehorse Rd, Mitcham Vic 3132. Ph: 9873 3433 Fax: 9873 3444 1/841 Princes Highway, Springvale Vic 3171 Ph: 9540 3162 Fax: 9540 3192

COMPETITION

Design a logo for VI2 ION! Can you create a logo to symbolise the aims of VI2 ION and the importance of the community? $500 is up for grabs by the winning designer! Check out the VI2 ION website for more information (Closing date - 11 May 2012).

Remember Vision I? The project that redeveloped the waterfront (among other things) and transformed the area from an industrial and maritime precinct into a vibrant recreational waterfront? The City of Greater Geelong has partnered with the Committee for Geelong, Department of Planning and Community Development, and Deakin University to develop dynamic and innovative scenarios for change in central Geelong. VI2 ION is the foundation of a ‘conversation’ between industry professionals, 1030662-PJ17-12

state and local government, and the local community to focus the central Geelong debate on the question - ‘Wouldn’t it be great if…?’

EVENTS

2 May 2012 VI2 ION Gallery opens its doors to the public. Lecture by Will Alsop (see right), a controversial and distinctive British architect. 7.15pm in the Percy Baxter lecture theatre, Deakin University

JOIN THE DEBATE

VI2 ION is live on Facebook and Twitter at Vision2geelong or comment online at the VI2 ION website. Sharp Centre for Design in downtown Toronto designed by Alsop Architects

For more information on events, ways to get involved and project information visit www.vision2geelong.net

AUTUMN SPECIALS SAVE $$$ SAVE UP TO 20%-40% OFF SELECTED DISPLAY & NEW STOCK

SAVE $200 OFF ALL WASHERS

• 6.5kg load • Made in Germany • 2 Year Warranty • W1712 Was $1,699 NOW from

$1,499

Double Wall Oven • Side Opening • 92 litre main oven • catalytic self clean • 8700100RS Was $5,649

NOW $4,124

900mm Upright Cooker • S69F-6 Was $7,995 SAVE 40% OFF

Dishwasher

SAVE $200

NOW $4,499

• 12 place settings • Sensor wash • Anti flood device • G4101 (white)

Was $1,099

$899

NOW

RYRIE STREET

TRADING HOURS MONDAY - FRIDAY 9-5PM, SATURDAY 9-1PM 10

The Independent, Friday April 27, 2012

EXTENSIVE SHOWROOM DISPLAYS

GE HO ELON SPIT G AL

SYD

NE

Bell

YP

arin

eH

wy

this

wa

y

GI

19 Ormond Road, East Geelong Ph: 5221 1642

DE

GARDEN STREET

GREAT LAUNDRY OFFERS Washing Machine

1030641-JM17-12

COOKTOPS DISHWASHERS FRIDGES OVENS SINKS UPRIGHT COOKERS RANGEHOODS WASHING MACHINES

WE ARE HERE

OR

MO

ND

RD


)6(&

'3*%": 4"563% " :    4 6 /%":  0

& $ * 3 1  Z  B  EBZ E 0 / :     U V P LOPDL

9 * 9 * . .   , $, /*563& 1 1**$ 8/'63 :0630 &-&$53*$"-1"$,"(&

E F D J QS FBS M $  UP  578*5)#-63":

R

G GG P  PG   P UP QU V VQ VSF

V U J O S V G

 5PBTUFS ,FUUMF 1BDLBHF

 T J I U  G BMMP

 U T KV

1999

$

501.06/5 '3*%(&-

.JDSPXBWF

."64576/*5 "7"-0/1*&$&5"#-&$)"*34 ."3(05

)05 #6:

2VFFOTJ[FCFE

#&55"$"3& 26&&/4*;&."553&44

##$$$$##FFU

BCC Betta Home Living 8-12 Pakington St, GEELONG WEST PH: 5222 4890

C1031376-KG17-12

0/-:"U5B U UB

5PQMPBEJOH XBTIFS

betta.com.au

The Independent, Friday April 27, 2012

11


G TO N I M O C S I

G N O L GEE

1031564-PJ17-12

Victoriaâ&#x20AC;&#x2122;s largest Real Estate Agency are coming to Geelong & Bannockburn.

Watch this space....

stockdaleleggo.com.au stockdaleleggo.com.au

riverdance road

batesford

Geelongâ&#x20AC;&#x2122;s finest location Designed to make the most of the natural environment, river stone at Batesford is a boutique master planned community with extensive green open spaces along the picturesque Moorabool River. The design covenants will ensure your new home maintains the harmony of attractive design and a strong sense of neighbourhood pride. It also ensures your investment is protected for years to come. Proudly developed by the Ramsey property group who select land endowed with natural beauty and designs the most interesting layout possible in order to take advantage of the natural aspects and qualities of each development. Their understanding of planning enables each block to be positioned with the best aspect possible for sustainable living. River Stone at Batesford offers a quality lifestyle along with quick access to Geelong and the new Geelong ring road. Stage 2 For sale now off the plan with lots ranging in size from 1 acre to 2.5 acres.

price inspection

| $360,000 | saturday 1-2pm - Enter via Midland Hwy

24 church street, geeelong north 12

The Independent, Friday April 27, 2012

mark mayfield I 0414 818 574

5272 1288

www.mayfieldrealestate.com.au 1031609-TB17-12


 Â&#x201A;~   8

COME SAILING WITH

GEELONG TRAILABLE YACHT CLUB vvv~Â&#x201A;Â&#x201A;   SUNDAY 6TH MAY 2PM - 4:30PM Phone: 0422 131 582 email: commodore@gtyc.com.au

Hamming it up: Geelong amateur radio enthusiasts Bill Husin and Graham Day. Picture: Tommy Ritchie

visit our website www.gtyc.com.au 80098

C1031347-KG17-12

ST. HELENS BOAT RAMP Swinburne St, Nth Geelong

Radio daze of 8JOEPX'JMNT the old â&#x20AC;&#x2DC;hamsâ&#x20AC;&#x2122;

%FDPSBUJWF 4BGFUZ4FDVSJUZ 4PMBS'JMNT

WELL BEFORE Facebook, Twitter and You Tube, amateur radio was the worldâ&#x20AC;&#x2122;s first social network. And far from being replaced by the internet, amateur radio uses the world wide web to enhance its reach. Amateur radio enables people to make contact with other enthusiasts across town, around the world, make new friends, pass on news or simply spend time chatting. The romance of radio is still alive and well in the region thanks to the efforts of Geelong Radio and Electronics Society and its parent, Geelong Amateur Radio Club. Long-time member and former GRES secretary Keith Stickland said amateur radio operators, also known as hams, loved sharing their experience and knowledge. â&#x20AC;&#x153;All radio operators develop knowledge of electronics but weâ&#x20AC;&#x2122;ve also branched out into computers and even amateur television,â&#x20AC;? Keith said. â&#x20AC;&#x153;We teach school groups, scout groups, adult classes, anyone

Join the club JOHN VAN KLAVEREN whoâ&#x20AC;&#x2122;d like to learn about radio and electronics.â&#x20AC;? Keith said the contemporary amateur radio community included members experimenting with latest electronics and advanced technologies such as wireless digital communications, software defined radios (SDR) and long-distance digital and image transmissions. Radio also had a serious side, Keith said, acting as an alternative communications network when telephone systems or internet communications fail. In times of disaster radio amateurs could provide emergency communications support to rescue, relief and recovery efforts. Keith said ham operators were vital during earthquakes and tsunamis in recent years, including

disasters in Japan and Indonesia. In Australia, emergency communications were provided in response to 2009â&#x20AC;&#x2122;s Black Saturday bushfire disaster. Australia has more than 16,000 radio amateurs, with over two million around the world. Keith said the Geelong club ran radio field days, taking membersâ&#x20AC;&#x2122; equipment to various country locations and running a competition to see who could contact another ham the greatest distance away. The club won a national amateur radio competition, the John Moyle Field Day, a few years back. Keith said the club maintained a historic radio museum at Old Geelong Gaol, restoring valve radios and other early equipment. The club would run a demonstration and display at Steampacket Gardens on May 13 as part of this yearâ&#x20AC;&#x2122;s heritage festival, he said. Members would attend so patrons could get on the radio, find a ham operator and have a chat. Keith said more information about the club was available at vk3anr.org or by phoning Graham Day on 5282 1174.

Stephen Griffin

r &MJNJOBUFT IPUTQPUT

r 'MFYJCJMJUZ JOEFTJHO

r 1SPWJEFTBTFDVSF XPSLQMBDF

r 1SPWJEFTQSPUFDUJPO GSPN67SBZT

Decorative Flims

Newtown 241 Pakington Street VIC 3220 Showroom 9am-5pm Weekdays 9am-12pm Saturday Ph: 5241 1111

Ph: 13 13 99 victoryblinds.com.au 1029674-KC15-12

$$ SAVE NOW $$ BEAT THE SOARING POWER PRICES 1.52kw

from

$2â&#x20AC;&#x2122;200* 4.56kw

1800 554 488 www.chssolar.com.au

Decorative Flims

Solar Films

8702-GI-PACE

reduction strategies regardless of the impacts of the carbon taxâ&#x20AC;?. The Victorian Government last month announced it would dump the stateâ&#x20AC;&#x2122;s emissions reduction target to save $2 billion. A Government review had found that having both state and national emissions reduction schemes would impose additional cost burdens on households and businesses.

r *OWJTJCMFCBSSJFS BHBJOTUJOUSVTJPO

Safety & Security

Tax strategies devised, targets stay CITY OF Greater Geelong will reveal â&#x20AC;&#x153;strategiesâ&#x20AC;? to deal with the Gillard Governmentâ&#x20AC;&#x2122;s carbon tax in next monthâ&#x20AC;&#x2122;s budget, according to chief executive officer Stephen Griffin. The budget and its carbon tax strategies will be public when the budget goes before council on May 8. Mr Griffin said council remained â&#x20AC;&#x153;committed to retaining its emissions

r 4UVOOJOHWJTVBM FÄ&#x201E;FDUT

from

$9â&#x20AC;&#x2122;990* Conditions apply

HURRY!!! REBATES CHANGE

JULY 1ST GET IN NOW TO SECURE MAXIMUM SAVINGS 1028978-KS14-12

The Independent, Friday April 27, 2012

13


NE

experience boutique style retirement

VE

R

living...

MO

VE

AG

AIN

Call Leanne Morrison Property Consultant 0447 779 361 Limited Unit Now Selling from

$215,000 Grovedale 6-12 Matthews St

OUE R 24 NH SITE CAR O

AVAILABLE

OTHER LOCATIONS: Vic: Mornington Peninsula, Melbourne & Bendigo NSW: Coffs Harbour & Forster/Tuncurry

Sunrise Supported Living is a simple, but unique concept that allows residents to purchase and live in their own homes with dignity, privacy and individuality.

Phone 1300 665 720 or 5244 2822 www.sunrisesupportedliving.com.au 1031349-JL17-12

14

The Independent, Friday April 27, 2012


buckets & bouquets BUCKETS to City of Greater Geelong for upsetting Portarlington residents over works on roads, curbs, channels, stormwater drainage and footpaths. I for one cannot afford $22,000 to $30,000. What about pensioners already worrying about the carbon tax? Bouquets to people objecting to this special charge scheme. Val Olerhead, Portarlington BUCKETS to paramedics who attended when my husband had a fall. The threehour delay might have been unavoidable but the arrogant, casual attitude was an insult. Bouquets to Ali, Sean and Jarrod for their invaluable help. Elizabeth, Herne Hill BUCKETS to a man who thinks he owns a reserve. Ratepayers own the reserve where kids like to play. His grumpy, bossy demeanour is unwanted and undeserved. My children value trees and the environment, so leave them alone. Grumpy, Herne Hill BOUQUETS to a considerate lady who paid the balance of my groceries at Woolworths Newtown before Easter when I ran out of money. Bouquets also to the checkout operator who consoled me as I began to cry over the kindness shown to me. Margaret, Geelong West BUCKETS to an employee at a coastal pharmacy who refused to help our eightyear-old son at 5pm on a Sunday after he had an allergic reaction to eggs. “You’ll have to go to Geelong”, she said as she shut the door. JLP, Strathmore BOUQUETS to motorists who stopped at a Shell Rd school crossing during holidays so my three grandchildren and I could enjoy a ride through town. We were able to safety walk our bikes across a road very busy with constant traffic. Grateful Nan, Ocean Grove BUCKETS to a rude old bloke who sat on my cushion at Readings Cinema. Partially disabled and on crutches, I asked him to move along one seat but he told me to sit elsewhere and too bad about my cushion. I had to grab my cushion away from his backside. 48 Today, Belmont BUCKETS to those on the other side. Acting for the betterment of the community means looking beyond one’s own interest. Boy, I’ve got vision and the rest of the world wears bifocals. Lil Bow Wow, St Leonards BOUQUETS to Harvey and staff at Des Munday & Son Engineering. Their knowledge and trouble-shooting skills allowed my machine to be repaired on the spot, saving me time, money and headaches. Oldschool service goes a long way. Happy Tradie, Geelong West BUCKETS to Norlane and Lara pools for closing during school holidays. Thank goodness for good old Eastern Beach. Disappointed Nan And Family, Lara

BOUQUETS to a lady in a small, white car for stopping on busy Pioneer Rd to collect my purse, cards and money, which must have fallen from the roof of my car. She delivered them to my front door before I was even aware I had lost them. Gwen, Grovedale BUCKETS to City of Greater Geelong for failing to enforce dog by-laws. Why is a particular owner allowed more than three dogs without the City taking action? How about coming out to enforce the by-laws. Still Waiting, Norlane BOUQUETS to a retired engraver and existing staff at Stan Wooton Locksmiths for generously engraving a perpetual Good Friday Appeal trophy auctioned each year for more than 10 years during Ocean Grove Bowls Club’s Good Friday fundraiser. Their efforts help raise valuable funds each year. Tina, Wandana Heights BOUQUETS to the kind people at Tasman Meats Newcomb, particularly butcher Paul for de-boning a leg of pork for me even though he was busy at the time on April 11. Customer, Bell Post Hill BOUQUETS to new Torquay Indian restaurant Taste of Spice. Your authentic cuisine tasted amazing and the friendly service was faultless. We will most definitely be back. Gilmore Family, Highton BUCKETS to Get Real (Buckets and Bouquets, April 20). If nature strips are ratepayer-owned assets then City of Greater Geelong should improve its maintenance of them. Nothing’s wrong with communityminded residents planting vegetable plots on their nature strips to feed neighbourhoods. Ratepayer, South Geelong BUCKETS to Get Real. Consider cheering up. Let people engage in their communities through creative communal vegetable gardens on nature strips. It’s a shame you can’t see the positives of these gardens, like how they bring people together to talk and share. I’d rather admire gardens than overgrown grass. Give It A Go, Geelong BUCKETS to Get Real. In our area people use nature strips for self-expression. If someone is happy to maintain it, it should be their right to use the space as they wish. We have a lovely rock garden nearby and it’s delightful. Move On, Brighton BUCKETS to Get Real. If you think being part of a community is hiding in your backyard then why bother coming out your front door. Root Vegetable, Highton

WRITE TO US Mail: PO Box 407, Geelong, 3220 Email: editorial@geelongindependent.com.au Fax: 5221 3823 Contributions must be less than 50 words and include the writer’s full name, address and phone number.

geelongCOSMETIC B E A U T Y tattoo

Is body hair a problem for you?

CLINIC

AMA ZI N G O FFER A M A Z I N G B O DY

Ford Discovery Centre

Freedom Bay Cruises

One5One Gallery

Valid for one complimentary general admission when another admission of equal or greater value is purchased! Not valid with Joint Tickets or any other offer. *Valid to 30/06/12

Purchase a standard 40min cruise and receive a complimentary cruise to equal or lesser value! Valid weekends and school holidays Sept - May, weather permitting. Not valid 1st Sunday of the month.

25% off our unique homewares and original artworks! Mention this promotion to receive your 25% discount.

Ph: 03 5227 8700 12 Gheringhap Street www.forddiscovery.com.au

Ph: 0418 522 328 Waterfront Geelong www.freedombaycruises.com.au

Ph: 03 5229 2757 151 Mercer St, Geelong www.one5one.com.au

Parkwood Motel

Geelong Getaway Tours

Present this coupon to receive a complimentary continental breakfast with any 3 night midweek stay! Ph: 03 5278 5477 Cnr Ballarat Rd & Shannon Ave, Nth Geelong www.parkwoodmotel.com.au

Book for 6 people and pay for 5 Otway Fly Tours - Save $120! 12 Apostles Tours - Save $100! Winery Tours đƫ .05ƫ,%'ġ1,ƫ* ƫ .+,ġ+ûƫ đƫ %.,+.0ƫ0.*/"!./ƫģƫ !(+1.*!Čƫ 2(+*ƫ,%'ġ1,ƫ* ƫ .+,ġ+ûƫ Ph: 03 5243 0397 or 0407 040 723

Mercure Hotel Geelong

Lonsdale Views

Summer Sensations Café

Receive 20% off food and beverages when dining with 2 or more people!

Purchase food and drink in our café to the value of $30 and receive a FREE strawberry sundae dessert!

Ph: 03 5223 6200 Cnr Gheringhap & Myers St, Geelong www.mercuregeelong.com.au

Relax, refresh and reconnect with 20% off your next reservation at Lonsdale Views! Discount taken from the full tariff. Excludes peak periods. Visit www.lonsdaleviews.com.au for current availability.*Valid until 30/06/12 Ph: 03 5258 2990 www.lonsdaleviews.com.au

Chifley Hotel & Apartments

Geelong Conference Centre

Buy 3 nights & the 4th night is FREE! .!/!*0ƫ+1,+*ƫ0+ƫ.!!%2!ƫƫą0$ƫ*%#$0ƫ ċƫ2%((!ƫ+*ƫ((ƫ.++)ƫ05,!/ċ Subject to availability. Cannot be used with any other offer or promotion. *Block out periods apply Ph: 03 5244 7700 13-15 The Esplanade, Geelong www.chifleyhotels.com.au/geelong

Stay in the heart of Eastern Park Gardens from only $109 per night!

Bellarine Estate / Bellarine Brewing Company

Bistro @ 310

Central Geelong Farmer’s Market

Four Points by Sheraton Geelong Waterfront Restaurant Saturday dinner buffet: $100 for two people (normally $134)! Cannot be used with any other offer. Maximum of 4 people. Coupon must be presented. Subject to availability. Ph: 03 5273 5460 10 – 14 Eastern Beach Road, Geelong www.fourpoints.com/geelong

* Valid for breakfast or dinner.

Present this coupon to receive a FREE drink with any meal purchased over $10!

Ph: 03 5221 0000 310 Moorabool Street, Geelong www.bistro310.com.au

Prendergast and Grace Bakery Cafe Buy a glass of wine and get one of equal or lesser value FREE! Relaxed cafe atmosphere with full menu including daily house specialties, superb coffee and boutique wine list. Ph: 03 5229 0029 20 Bellerine St, Geelong

Collect your half price VIP parking pass from the Farmers Market manager’s marquee! Held the second Saturday of each month. *Discount applies to the first 4 hours parking at Market Square. Valid market days only. Little Malop Street, Central Geelong www.centralgeelong.com.au

Mercure Hotel Geelong FREE breakfast with any stay of 2 nights or more! * Minimum booking of 2 adults.

www.summersensations.com.au

FREE glass of beer or wine with any gourmet wood fire pizza purchase! .!/!*0ƫ0$%/ƫ+1,+*ƫ0+ƫ.! !!)ƫ0$%/ƫ+ûƫ!.ċƫ Live music Sundays. Brewery Tour every Saturday (bookings essential). Ph: 03 5259 3310 www.bellarineestate.com.au

Vue Grand Hotel Full breakfast plus a complimentary upgrade to a room with balcony or spa. Rooms from $99pp twin share! *Valid Sun-Fri. Conditions apply. Ph: 03 5258 1544 46 Hesse Street, Queenscliff www.vuegrand.com.au

Barwon River Tourist Park Book 3 nights accommodation and receive 1 extra night FREE! *Subject to availability. Ph: 03 5243 3842 153 Barrabool Rd, Belmont www.barwoncaravanpark.com.au

Redox Jewellery Studio

BIG4 Beacon Resort

Saddle On Riding School

Spend over $250 at Redox Jewellery Studio and receive 20% off any piece in the Redox Jewellery Range!

Get a FREE $100 Voucher!

Present this coupon to receive

The perfect excuse to get the relo’s out from under your feet. Register at: www.beaconresort.com.au/matesrates We’ll send you as many as you need!

$15 entry per child in BMX, archery,

Ph: 03 5291 3064 The Wintergarden Shop 3/51 McKillop St, Geelong

Ph: 03 5258 1133 78 Bellarine Hwy, Queenscliff www.beaconresort.com.au

Ph: 0412 773 411

National Trust of Australia (Vic)

Sabina on Little Myers

Black Salt Restaurant

FREE entry when another entry of equal or greater value is purchased!

Receive a light continental breakfast and refreshments on arrival with every 2 night booking! Ph: 0427 785 404 90 Little Myers Street, Geelong stay@sabinaonlittlemyers.com.au

Present this coupon to receive 30% off your total food bill! Must order at least entree/main or main/dessert. Valid for lunch or dinner. Reservations recommended. *Cannot be used with any other offer or promotion. Ph: 03 5244 7790 13-15 The Esplanade, Geelong

National Wool Museum

WSUP: Stand Up Paddle Boards

FREE child entry to our Interactive Sports exhibition with every two adult concession entries purchased!

Book a stand up paddle board lesson for 3 people in 2011/12 and the person paddles for FREE! ƫ"*0/0%ƫ!4,!.%!*!ƫ"+.ƫ((ƫ#!/ƫ* ƫ abilities on the Geelong Waterfront and Ocean Grove. Mention this ad to receive your free lesson. Geelong & Barwon Heads Ph: 0439 113 457 www.wsup.com.au

Ph: 03 8663 7260 www.nattrust.com.au

• underarm hair and bikini line...driving you crazy

• permanent hair reduction

• in-grown hairs!!

• red vein reduction

Four Points by Sheraton Geelong

Come in and let us help you. 10 years experienced practitioners in permanent hair reduction. Excellent service is foremost.

• pigmentation/sun spot reduction

Waterfront Restaurant Free dessert when you order an entrée and main course for lunch!

• skin rejuvination

Cannot be used with any other offer. Maximum of 4 people. Coupon must be presented. Subject to availability.

Book in May and receive G-string bikini line and underarm $99 ptm

51 Gheringhap St, Geelong 1300 884 245 0438 507 009

Ph: 03 5273 5460 10 – 14 Eastern Beach Road, Geelong www.fourpoints.com/geelong 1031362-JJ17-12

Ph: 03 5226 2121 Eastern Park Gardens, East Geelong www.gcc.net.au

1440 Bannockburn-Shelford Rd, Teesdale

Ph: 03 5223 6200 Cnr Gheringhap & Myers St, Geelong www.mercuregeelong.com.au

Valid at the following National Trust ,.+,!.0%!/čƫ.3+*ƫ.'Čƫ.3+*ƫ .*#!Čƫ$!ƫ!%#$0/ƫ* ƫ+.0.(%*#0+*ƫ Mill. *Must present coupon.

• cosmetic tattoo for perfect eyebrows

Based on room only rate. Minimum 2 night stay. Subject to availability. Rooms accommodate two people.

Ph: 03 5281 5449

*Cannot be used with any other offer or promotion. *Valid until 13/05/12 Open Mon-Fri 9.30am to 5pm and weekends 10am to 5pm. Ph: 03 5272 4701 26 Moorabool St

and animal farm. Includes party food!

550 Elcho Road, Lovely Banks www.saddleon.com.au

Here are some great coupons to save you and your friends money! For more coupons and to win big, visit www.mygeelong.org.au! Geelong’s a great place to visit and we want you to tell us your favourite things to do and see in Geelong. Win a family holiday and other great prizes. Enter online now!

ġĉĆāĊ

1026939-JF14-12

facebook.com/indy.newspaper The Independent, Friday April 27, 2012

15


2

Offers available in store only.

50

up to

% off

50 months

Interest Free *1

* ON NOW! Ends 29/04/12

1030868-JF17-12

CARPET & FLOORING!

Carpet | Timber | Laminate | Rugs | Vinyl & Vinyl Tiles

Genuine Clearance Deals On: Cancelled Orders, Discontinued and Display Stock! CORIO Ends 29/04/12. Harvey Norman® stores are operated by independent franchisees. *Discounts are off the normal ticketed price.

WAURN PONDS

227800_GEE

420 Princes Hwy, Geelong 5272 9900 33 Princes Hwy, Geelong 5240 6200

*1. Conditions of No Deposit, No Interest for 50 months with monthly repayments: Available to approved customers on single or multiple transactions where the amount financed is $1,250 or more, on GO MasterCard, GO Business MasterCard, Buyer’s Edge and Gem Visa, or $2,000 on GE CreditLine, between 22/03/12 and 29/04/12. Offer available on purchases from Harvey Norman franchisees (excludes online purchases). Minimum monthly repayments must be made during the interest free period, and interest and repayments are payable after the interest free period. Paying only the minimum monthly repayment will not pay out the loan before the end of the interest free period. Offer available on advertised or ticketed price. This notice is given under each of the GO MasterCard, GO Business MasterCard, Buyer’s Edge, Gem Visa and GE CreditLine Conditions of Use (as applicable), which specify all other conditions for this offer. A $25.00 Establishment Fee for GO MasterCard and GE CreditLine applies to new applications. The GO Business MasterCard attracts a $40 Annual Fee. Account Service fee of $4.95 per month applies for GO MasterCard, GE CreditLine and Buyer’s Edge, and $2.95 per month for GO Business MasterCard, and other fees and charges are payable. Credit is provided by GE Capital Finance Australia (ABN 42 008 583 588), trading as GE Money. Australian Credit Licence number 392145. *2. Terms and conditions apply. See in store for details. 16

The Independent, Friday April 27, 2012


17

50

Interest Free

Interest Free

months

months

*1

*2

4/ RD/0OCT! ONURNROY,WE!NEDndS s329 H 12

!NSANE

SAV1NGS $TOR3WIDE

Ends 29 /0 4/12

> OUT W!TH TH3 OLD < 1N W1TH THE NEW! COMPUTERS C

1030869-JF17-12

ENDS THIS W’END

ON NOW! ! EX-DISPLAY ! EXCESS STOCK ! CANCELLED ORDERS ! DISCONTINUED MODELS

ELECTRICAL

BEDDIN G

FURNITURE

GEELONG

420 Princes Highway, Corio. 5272 9900 FOR THE BEST BRANDS, BEST ADVICE & BEST VALUE Ends 29/04/12. All offers are only available in store. Flooring is not available in all Harvey Norman® stores. Images are for illustrative purposes only. Harvey Norman® stores are operated by independent franchisees.

227771_WAU

YOU’D B. TOO CRA2Y TO MISS TH!S! WAURN PONDS

33 Princes Hwy (Homemakers Centre). 5240 6200

*1. Conditions of No Deposit, No Interest, No Repayments until August 2013: Available to approved customers on single or multiple transactions where the amount financed is $300 or more, on GO MasterCard, GO Business MasterCard, Buyer’s Edge, Gem Visa and GE CreditLine between 22/03/12 and 29/04/12. Offer available on purchases from Harvey Norman franchisees (excludes Apple and Miele products, and online purchases). Offer available on advertised or ticketed price. This notice is given under each of the GO MasterCard, GO Business MasterCard, Buyer’s Edge, Gem Visa and GE CreditLine Conditions of Use (as applicable), which specify all other conditions for this offer. A $25.00 Establishment Fee for GO MasterCard and GE CreditLine applies to new applications. The GO Business MasterCard attracts a $40 Annual Fee. Account Service fee of $4.95 per month applies for GO MasterCard, GE CreditLine and Buyer’s Edge, and $2.95 per month for GO Business MasterCard and other fees and charges are payable. Credit is provided by GE Capital Finance Australia (ABN 42 008 583 588), trading as GE Money. Australian Credit Licence number 392145. *2. Conditions of No Deposit, No Interest for 50 months with monthly repayments: Available to approved customers on single or multiple transactions where the amount financed is $1,250 or more, on GO MasterCard, GO Business MasterCard, Buyer’s Edge and Gem Visa, or $2,000 on GE CreditLine, between 22/03/12 and 29/04/12. Offer available on purchases from Harvey Norman franchisees (excludes online purchases). Minimum monthly repayments must be made during the interest free period, and interest and repayments are payable after the interest free period. Paying only the minimum monthly repayment will not pay out the loan before the end of the interest free period. Offer available on advertised or ticketed price. This notice is given under each of the GO MasterCard, GO Business MasterCard, Buyer’s Edge, Gem Visa and GE CreditLine Conditions of Use (as applicable), which specify all other conditions for this offer. A $25.00 Establishment Fee for GO MasterCard and GE CreditLine applies to new applications. The GO Business MasterCard attracts a $40 Annual Fee. Account Service fee of $4.95 per month applies for GO MasterCard, GE CreditLine and Buyer’s Edge, and $2.95 per month for GO Business MasterCard, and other fees and charges are payable. Credit is provided by GE Capital Finance Australia (ABN 42 008 583 588), trading as GE Money. Australian Credit Licence number 392145.

The Independent, Friday April 27, 2012

17


letters Our hero postie

MASSIVE

SAVINGS 3 DAYS ONLY 7Pce Timber Dining

Day Bed $799

$399

5Pce Wicker Outdoor Set was $1399 now $999

AS THE delivery operations manager of a busy North Geelong mail delivery centre, I understand the important role our posties play in the community. One postie who takes this role very seriously is Brendan Dempsey. When Brendan came across a house fire in Thompson Rd he pulled an elderly disabled woman he knew living there from the burning house. He was helped by another member of the public, further highlighting the strength of community in North Geelong. The local fire brigade was very impressed with Brendan and couldnâ&#x20AC;&#x2122;t believe he got back on his bike to continue delivering the mail. This isnâ&#x20AC;&#x2122;t the first time Brendan has been praised for his bravery â&#x20AC;&#x201D; he also pulled a dog from a burning house in 2010. We are very proud of Brendan and would like to publicly offer our congratulations and thank him for his customer focus and dedication. Simon Hill Australia Post North Geelong Delivery Centre

Critic shot down SUZANNE Roberts (Letters, April 13) misrepresented my March 31 defence of my right to hunt ducks. She wrote: â&#x20AC;&#x153;Mr Matchan stated that dying naturally of starvation would be worse than being shot out of the skyâ&#x20AC;?. I said no such thing. I explained the background to annual natural attrition rates and that in the short hunting season hunters harvested a miniscule percentage of this surplus. I made no comparison between dying a slow death from starvation versus being shot. But I will now that I have been misrepresented. I have legally hunted ducks for the past 46 years throughout Australia, New Zealand, USA, Mexico, Italy, Spain, Germany and the Czech republic. From my own experience, observations, discussions and participation in hunter surveys, I can say that the vast majority of harvested ducks are killed outright when shot. The smaller percentage of wounded birds are generally quickly recovered and immediately dispatched. One unfortunate exception is when protestors are first to a wounded duck and steal the hunterâ&#x20AC;&#x2122;s bird. A minute percentage of wounded birds are lost and either recover or die. Neither Ms Roberts nor I are can compare death by starvation, predation, disease or gunshot. It is apparent she has no firsthand experience or observations of recreational duck hunting. I respectfully suggest that she draw on facts and

experience rather than emotions based on illinformed advice when expressing her views. Gary Matchan Mount Doran

Puppy love I WOULD like to raise awareness of puppy farms. Some farms use parent dogs as expendable breeding machines and new-born puppies are just dollar signs. I donâ&#x20AC;&#x2122;t know why puppy farms would treat manâ&#x20AC;&#x2122;s best friend so poorly and without respect. Do the breeders lack feelings of guilt or responsibility for the innocent creatures in their care? It is appalling these farms introduce puppies to life in a cold, stone, lonely jail. Buyers of puppies should consider the industry they are supporting. Dean Cardigan Belmont

Stripped of promise IN CITY of Greater Geelongâ&#x20AC;&#x2122;s Around the Wards, Cr Richards crows about his achievements in spending ratepayersâ&#x20AC;&#x2122; money on sport, including two very expensive strips of psychedelic green rubber on Heyers Rd. His election material promised concrete footpaths on at least one side of every established street in Grovedale. How many footpaths have been installed? None. Coolabah Park is popular with all ages but anyone with babies or people with disabilities are forced to wheel prams and wheelchairs on the road. Is Cr Richards saying adult cyclists need protection from traffic but babies and people with disabilities donâ&#x20AC;&#x2122;t? Lee Gladwell Grovedale

One way to rorting THE BACKGROUND to the proposed aged care system is the evident rorting of aged care and social welfare. The effectiveness of government intervention to prevent or minimise is a function of doubtful competence of government systems, as exemplified in the ill-fated pink batts rorts and school building programs. To para phrase Darryl Huff, misinforming people by the use of statistical material may not be chicanery much of the time but incompetence. It is not certain that one is less offensive than the other to statisticians but as long as the mistakes are all one way it is hard to grant the guilty party the status of blundering innocent. Marion Jones Drysdale

9Pce Square Timber Dining $1199

7KH*5HJLRQDO*URZWK3ODQLVRQHRIHLJKWSODQVEHLQJGHYHORSHGDFURVV9LFWRULDWRUHVSRQGWRWKHFKDOOHQJHV DVVRFLDWHGZLWKJURZWK,WZLOOLGHQWLI\RSSRUWXQLWLHVIRUDFFRPPRGDWLQJIXWXUHUHVLGHQWLDOJURZWKHPSOR\PHQWDQG DVVRFLDWHGLQIUDVWUXFWXUHLQRXUUHJLRQ7KHGUDIW*5HJLRQDO*URZWK3ODQZKLFKLVEDVHGRQH[WHQVLYHFRPPXQLW\ LQSXWLVQRZUHDG\IRUSXEOLFFRPPHQW  7KHSXEOLFFRPPHQWSHULRGZLOOUXQXQWLO)ULGD\0D\

7Pce Wicker Bar Set 3 ONLY was $1999 now $999

<28$5(,19,7(' :HDUHLQYLWLQJ\RXWRWHOOXVZKDW\RXOLNHDERXWWKH'UDIW*URZWK3ODQDQGKRZLWFRXOGEHLPSURYHG<RX FDQSDUWLFLSDWHLQWKHIROORZLQJZD\V Â&#x2021;

Â&#x2021; 7DNHSDUWLQWKHRQOLQHFRQYHUVDWLRQRQRXUZHEVLWH

Corner Wicker Lounge was $2799 now $1699

Â&#x2021; 'URSLQGXULQJWKHQRPLQDWHGWLPHWRRQHRIRXU2SHQ+RXVHVWRVSHDNZLWKDPHPEHURI  RXUSURMHFWWHDPDQGILQGRXWPRUH

Next to Super Cheap Auto 1029977-JF15-12

18

The Independent, Friday April 27, 2012

 

 /DUD/DUD&RPPXQLW\&HQWUH:DYHUOH\5RDG  7KXUVGD\0D\SPWRSP

)RUIXUWKHULQIRUPDWLRQJRWRZZZ*UHJLRQDOJURZWKSODQFRPDX

Dunn St

',

1028638-KS17-12

6XPPDU\EURFKXUHVDUHDYDLODEOHIRUGRZQORDGIURPWKHZHEVLWHEHORZDWHDFKRIWKH* &RXQFLOV¡FXVWRPHUVHUYLFHFHQWUHVWKH**HHORQJ5HJLRQ$OOLDQFHRIILFHORFDWHGDW 0RRUDERRO6WUHHW*HHORQJDQGDWWKH2SHQ+RXVHV

Victor St

Princ es Hw y

324 Melbourne Road, North Geelong Enquiries Ph: 5272 1331

 *HHORQJ0DUNHW6TXDUH/LWWOH0DORS6WUHHW  6DWXUGD\$SULODPWRSP

*LVWKHIRUPDODOOLDQFHRIJRYHUQPHQWEXVLQHVVDQGFRPPXQLW\RUJDQLVDWLRQVZRUNLQJWRJHWKHUWR LPSURYHSHRSOH¡VOLYHVLQWKH*HHORQJUHJLRQ

t Separation S

OPEN 7 A D YS

 

)HHGEDFNRQWKHSODQFDQEHPDGHDWWKH2SHQ+RXVHVRQOLQHRULQZULWWHQIRUPWR Â&#x2021; ZZZ*UHJLRQDOJURZWKSODQFRPDX Â&#x2021; *5HJLRQDO*URZWK3ODQWHDP&LW\RI*UHDWHU*HHORQJ32%R[*HHORQJ9,& Â&#x2021; HPDLO*5*3#JHHORQJFLW\YLFJRYDX

TAKE HOME 4Pce Wicker Lounge was $1899 now $999 INTEREST FREE LAYBY AVAILABLE

LORENZO DESIGNS

5HYLHZWKH'UDIW5HJLRQDO*URZWK3ODQRQOLQHRQRXUZHEVLWH


letters

Hall cash a slap in face for Anzac Day

Funding: John Doull

I WAS appalled to read a story in last week’s Independent announcing that Cr John Doull was proposing use of ratepayer funds to restore Indented Head Hall. The hall is on Crown Land – it is not a council responsibility. This is a real smack in face for residents of St Leonards desperately trying to raise funds for the restoration of their community-

Dam coal mining ACCORDING to Allan Baron (Letters, April 20), coal is our only source of cheap power and thanks to the Greens “the family farm has been decimated by the arrogance of (Bob) Brown and his legion of ecowarriors”. Open-cut mining has destroyed 10 per cent of prime farmland in the Hunter Valley and pollutes the air for surrounding farming families. Victoria’s Liberals aim to expand the quarrying of brown coal in dairy farmland. Coal must be replaced by renewable energy to save the family farm. I would like to know how expanding coal mining won’t decimate farming in the long term. The Greens are right about ending coal. One area where the Greens are hard to understand is their no-dams policy. Dams can provide irrigation for family farms, hydropower for renewable energy, flood protection and environmental flow for rivers in times of drought. Kevin Guinane Gheringhap

Greens fighting CSG I HAVE just come from New South Wales’ north coast where farmers and councils are fighting coal seam gas (CSG) mining. CSG exploration in northern NSW came about because former Labor MP Ian Macdonald gave licences to explore the area. The Greens had nothing to do with it. I was living on the land at the time, had friends affected and went to many meetings about this issue. State and federal MPs were invited but never attended. Councillors and Greens were the only political attendees. Although most of us were National party voters

owned memorial hall. The announcement, in the leadup to Anzac Day, showed blatant lack of respect to the people who built the hall in 1926 as a permanent memorial to those of the district who lost their lives in fields of battle and complete disregard for the community of St Leonards. K Reiter St Leonards

our only choice for representation on this issue was the Greens. What would Alan Barron (Letters, April 20) have had us do? Most of us would rather have “loony Greens” in parliament than no one at all. Our state and federal governments seem no longer to represent the concerns of constituents. The NSW Liberal Government has put a moratorium on CSG mining. But one night after the moratorium I passed 18 trucks transporting mining equipment on the Pacific Hwy. Mr Barron should educate himself and stop blaming the Greens as the problem. Katherine Marchment Belmont

HOT PRICE SALE UP TO 50% OFF 3 DAYS ONLY Barstools FROM $39

Single White Beds (Slight White Queen Bed Only Seconds) was $499 was $1199 NOW $399 NOW $199

Courage of Brown IN HIS decades as an advocate for people and the environment, Bob Brown was shot at, beaten up, arrested, imprisoned and endured ceaseless insults and abuse from the ignorant. History, however, will judge him as a man of great conviction and tenacity who gave of himself unreservedly. At one point he stumped up $250,000 to save a man held hostage in Somalia. Under Mr Brown’s leadership the Greens forged a new way of seeing the world; a world where humans may live in harmony with nature and each other. Our world is under attack by the forces of greed like never before. The Greens don’t hold all the answers but more voters are hearing their message. Thank you, Bob Brown, for showing us we can be better people if only we had some of your courage. Leigh Adamson Belmont

3Pce Recliner Leather $1499

7Pce Dining Setting was $1299 NOW $599

CHESTERFIELD SOFAS UP TO 40% OFF

HAVE YOUR SAY Mail: Email: Fax:

Click Clack $199

PO Box 407, Geelong, 3220 editorial@geelongindependent.com.au 5221 3823

A Rare Treat for Music Lovers! The Firebird Trio and Friends Play Schubert’s ‘Trout’ Quintet

DEAL OF THE WEEK!

Sampson Queen Bed Only

3Pce Cosy Lounge was $1699 NOW $899

$199

Voted Number One in the ABC Classic’s 2008 survey as the piece of chamber music they ‘could not live without’. You can hear and see this evocative music performed live by the Firebird Trio and Friends on Friday 11 May at 7.30pm at McAuley Hall, Sacred Heart College, Aphrasia Street, Newtown. Leather lounges up to 40% off

Promo Chocolate Queen Bed $199

OPEN 7 A D YS

324 Melbourne Road, North Geelong Enquiries Ph: 5272 1331

Victor St

es Hw y

LORENZO DESIGNS

INTEREST FREE LAYBY AVAILABLE

Dunn St

Princ

This is the second concert in the Geelong Chamber Music Society’s 2012 series, and is supported by the City of Greater Geelong through its Community Arts Grants program.

Deluxe fabric corner was $2899 TAKE now $1999 HOME

t Separation S

Tickets: Adult (incl. Seniors) $40, Concession Card Holders $35, Students $12 available from GPAC, Ph: 5225 1200 or the Secretary, Ph: 5243 6931.

Large TV Units $299 1031310-TB17-12

Image by Keith Burrows

Bedside tables $59

Next to Super Cheap Auto 1030825-KS16-12

The Independent, Friday April 27, 2012

19


community calendar DONATIONS – Tea-cosies wanted for exhibitions in May. Contact Portarlington Neighbourhood House or 5259 1821 or 5259 1107. REUNION – Sea Lake High School celebrates 50 years 13-14 October at Tyrrell College. Expressions of interest to back2school@sealake.vic.au, 5070 2106. PLAYGROUP – Freshwater Creek Steiner playgroup meets weekly for baking, craft, singing, stories and play at The Honey House. Enq 0410 007 990. ART – inTRANSITION exhibition of six local artists at The Munro Room, 105 Little Malop St until May 4. Enquiries 0425 557 742 or 0400 623 592. HEALTH – Barwon Health six-week better health self-management course at Corio and Newcomb. Enquiries 1300 715 673.

Friday

%

OFF ALL FOUNTAINS & OUTDOOR FURNITURE Until Close Sunday 6th May 2012

Cnr Shannon Ave & Aberdeen St, Geelong West Ph: 5222 8822 or 0417 997 954 TRADING HOURS: Mon-Fri: 9:30-5:30pm, Sat: 9:30-5:30pm, Sun: 10-5pm

www. decorimpact.com.au

Wednesday

You be the Judge

Congratulations to the following venues that have been nominated this week • Ebony and Ivory • Elkhorn Roadhouse • Shiraaz •Cafe Go • James St Bakery • Khan Curry Hut • Mr Hyde • Empire Grill • Sawyers Arms • Rushbrooks Cafe • Baveras • Black Salt • Coffee Cartel • Riviera on Yarra • Vue Grand • Custome House • Dish Cafe • Bottle of Milk Lorne • Fig and Wine Deli • Carrington Hotel •Van Loons Wallington • St Leonards Pizza and Past

1031326-KG17-12

20

Club. Also Wednesday and Saturday. Enq 5244 2258. PHILOSOPHY – Free discussion evening 79.30pm at Grovedale. Enquiries 5254 7484. DANCE – Ballroom dancing community practice night 7.30-9.30pm Uniting Church Hall, Newcombe St, Portarlington. Entry $3. Enq 5259 1776. KITCHEN – Vines Road Community Kitchen session 9.30am at Vines Rd Community Centre, 49 Vines Rd, Hamlyn Heights. Entry $5 includes ingredients. Enquiries 5277 9027. YOUTH – Big Brothers Big Sisters meets 12.30pm and 6pm at Barwon Youth, 12-14 Halstead Plc, Geelong West. Volunteer to make a difference to a young person’s life. Enquiries 5221 3218.

DANCE – Social ballroom dancing 7.30-10.30pm DANCE – Country tap dancing beginners class 12pm, intermediates 2-4pm at Grovedale Memorial at Leopold Public Hall. Enquiries 5243 5306. BLIND – Blind Citizens Australia Geelong Hall, Reserve Rd. For all ages. Wear flat-soled branch meets 10.30am at The Carrington Hotel, cnr shoes. Enquiries 0414 708 271. Myers and Yarra Sts. Guest speaker Travellers Aid. Saturday Family and friends welcome. Stay for lunch. DANCING – Ballroom dancing 8pm-midnight at Enquiries 5248 7407. Leopold Hall. Music by New Ritz. Entry $8. HISTORY – Geelong Historical Society meets Enquiries 5250 1333. 8pm at Morrow Theatrette, 51 Little Malop St. Rob DANCE – Social ballroom dancing with Puff’s dancing music 8-11.30pm at The Ballroom, Nicols talk on Mission to Seafarers. Enq 5278 3530. SUPPORT – Gateways’ interchange program inforBayview Pde, Hamlyn Heights. Entry $7 includes light supper. All welcome. Enquiries 5282 1813 or mation night 6pm at Gateways Support Services, 10 Albert St, Geelong West. Enq 5221 2984. 5281 1312. DINNER – Zonta Club of Geelong dinner meetCROQUET – Free croquet lessons 1pm at Eastern Park, 51 Garden St, East Geelong. Also Wednesday. ing 6pm at Dromoland House, 258 Pakington St, Geelong West. Guest speaker Senator Michaelia Enquiries 5278 2546. ANTIQUES – Treasures from the Attic antique Cash on her work, paid parental leave, domestic viovaluation day 11am-4pm at Barwon Park, 105 lence and the status of women. Entry $30. Enquiries Inverleigh Rd, Winchelsea. Adults $17, concession 5241 6001 or zontaclubgeelong@yahoo.com.au. $12, National Trust members $12. Enquiries 5267 Thursday 2209 or barwon.park1@bigpond.com. ENGLISH – Free English language program MARKET – Barwon Heads Community Market 8am-1pm at Community Hall, Hitchcock Ave. 10am-midday at Waterfront Christian Church, 35 Corio St Geelong. Enquiries 5229 5799. Enquiries 0402 642 357. ORCHIDS – Geelong Orchid and Indoor Plant FOOD – Food swap 9-10.30am at Rosewall Neighbourhood Centre, 36 Sharland Rd, Corio. Club meets 7.30pm at meeting room, Botanic Swap home-grown garden produce, eggs, honey and Gardens, Eastern Beach. Enquiries 5243 0330. DANCE – Dancing 7.30-10.30pm at Leopold preserves. Enquiries 5275 4415. Sportsman’s Club, Kensington Rd. Entry $3 Monday includes supper. Enquiries 5250 1937. HEALTH – Springs TOWN club meets 9.15MEDIATION – Meditation and philosophy dis11am at rear hall, Drysdale Uniting Church, High St, Drysdale. Group discussion for positive lifestyle cussion 10am-midday at TOPS, 18 Price St, change and healthy weight control. New members Torquay. Entry by gold coin. Enquiries 5264 7484. PHILOSOPHY – Philosophy cafe 2-4.30pm at welcome. Enquiries 5251 3763. DANCE – Social ballroom dancing with Puff’s Pear Tree Cafe, Torquay. Enquiries 5264 7484. dancing music 8-11pm at The Ballroom, Bayview Friday Pde, Hamlyn Heights. Entry $7 includes light supDANCE – Country tap dancing beginners class 1per. All welcome. Enq 5282 1813 or 5281 1312. 2pm, intermediates 2-4pm at Grovedale Memorial Tuesday Hall, Reserve Rd. For all ages. Wear flat-soled BOWLS – Carpet bowls 1-3.30pm Highton Seniors shoes. Enquiries 0414 708 271.

1031567-JF17-12

W O N

also on

TO NOMINATE YOUR FAVOURITE VENUE TEXT 0417 150 709

www.goldenplateawards.com.au 20

The Independent, Friday April 27, 2012


MAY SALE fro m $ 9 9

*

make the most of your outdoors.

Ziptrak

THE ULTIMATE IN OUTDOOR

- PATIO BLINDS. SAVE UP TO 40% OFF*

u p to H A

up to 40% OFF *

L F P R IC E

*

S e c u r i tsy D oupotor$150* SAV E

Our Products Awnings Roller Shutters Plantation Shutters Ziptrak

PH:

5277 0809

51 SEPARATION STREET STREET, GEELONG NORTH

The Independent, Friday April 27, 2012

1031265-KG17-12

Security Doors & Screens Patio Blinds & Solutions Roman Blinds Timber Venetian

21


Finally Friday •

Dining

Cinema

Television

Events

Activities

Theatre

Wigging out in Hairspray BY CHERIE DONNELLAN DONNING a wig and heels holds little trepidation for Geelong’s Lachy Joyce. But the high school drama teacher conceded playing the role of Edna in a local production of hit musical Hairspray would be a “challenge”. “It’d be easy to play her as a drag role but I think there’s so much more to Edna. “She’s a wife and mother...and there are a lot of nuances to her personality.” Joyce will be among local faces in the Geelong Lyric Theatre Society show next month. “We’ve tried to put our own spin on this classic musical and I think Geelong audiences will love it.” Joyce said his character had messages of acceptance, self-confidence and self-awareness. “I think her journey as an individual portrays some great morals.” Joyce said the Geelong production of Hairspray with a local cast was “great to promote the town and talent”. “We’ve got so many established Geelong actors in the show but we also have some fantastic new talent.” Joyce said theatre newcomer Charlotte Kavenagh would play Edna’s daughter, Tracy. “She’s fantastic in the role,” he enthused. The cast had enjoyed performing songs “so

well-known” to them. “It’s been great to bring these songs to life and put them on stage,” Joyce said. “There’s such an energy and buzz about the show. It’s catchy and captivating.” Joyce said his drama students had already bought tickets. “I’m so glad I can show my students that I can do it. “They put faith in me as an educator to know what I’m doing, so I want to keep up my skills as a performer. “If I can impart my passion to them and they’re keen to learn drama then I’m doing my job right.” Joyce said he had been putting in plenty of effort to nail Edna’s character. “During our rehearsals I’ve often been the first one there and the last one to leave. “In dress rehearsals I’ve had to put on the stockings, heels, dresses and fat suit. “Playing Edna requires lots of costumes and stage craft.” But Joyce wanted to stay away from “hammy” impressions. “You can’t just play Edna’s character for the cheap laughs. “I’ve tried so hard not to just be the man in the frock.” Hairspray will be at Geelong Performing Arts Centre from May 4 to 12.

Surfer minds in Surfworld DIRECTOR Justin Krumb will attend a “special season” screening of an awardwinning surf film in Torquay next week, according to a Surfworld Museum spokesperson. The spokesperson said Krumb would introduce Minds in the Water on May 3 and answer questions after the screening. Surfworld would screen the movie until May 6. The film follows professional surfer and environmentalist Dave Rastovich on a five-year international quest to protect dolphins, whales and ocean environments. Locations include Australia, Galapagos Islands, Tonga, California, Alaska and Japan. Surfers and artists appearing alongside Rastovich include Howie Cooke, Chris De Moro, Isabel Lucas, Joel Parkinson, Hannah Fraser, Kelly Slater and Jack Johnson. Johnson also joins Red Hot Chilli Peppers, Xavier Rudd and Ash Grundwald as a contributor to the soundtrack. Torquay’s 2012 Surfworld International Surf Festival gave Minds In The Water an inaugural Peter Troy Spirit Award.

Hairspray: Lachy Joyce as Edna.

Nevermind: Dave Rastovich.

l e t o H y a Gatew

LOCAL LIVE AT YOUR LOCAL.COM.AU WW W.LIVEATYOUR

FRI 25th MAY TICKETS FROM $32

TICKETS FROM $33

TICKETS FROM $12

TICKETS FROM $33

MORNING MELODIES: BRENDAN SCOTT 26TH APRIL $21.95 ALL YOU CAN EAT BUFFET Accommodation • Function Room • Kids Indoor Playroom

Gateway Hotel 218-230 Princes Hwy, Corio. Ph: 5275 1091

Geelong’s Newest Entertainment Venue!

22

The Independent, Friday April 27, 2012

480477-JF16-12

Live Music


Finally Friday ‘I'm still here, still breathing’

Stevens brings a mother lode

(Hey Hey it’s Saturday) performing April 27th from 9pm. $15 cover charge. Don’t miss out! Black Hatt 03 5221 4469

54 Lt Myers St, Geelong kylee@blackhatt.com.au Join us on facebook

1031175-JL17-12

Cafe Brioche Great coffee, Great food, Great service Outside catering for functions Open Mon - Fri 8.30 am - 5.00 pm

1030422-JM16-12

BY CHERIE DONNELLAN AS THE youngest of 11 siblings, Jon Stevens always made his voice heard as a child. The rock and stage star of Scottish and Maori heritage told the Independent that music surrounded him at home in New Zealand as a “wee lad”. “There was always music playing in the house. It was what we did as a family. “You don’t realise it, but you just soak it in unconsciously.” After leaving his Kiwi home Stevens’ raspy rock vocals and powerful stage presence put him in front of legendary Australian bands Noiseworks and INXS. He won over audiences on stage as Judas in a 1992 tour of Jesus Christ Superstar as part of an Australian cast including John Farnham and Kate Ceberano. Now Stevens said he would show a Geelong audience his “energetic” nature during a Mother’s Day gig at Deakin’s Waterfront Cafe next month. “I like to be interactive and I want to have a good time on stage. I hope my audience will have fun too.” Stevens said he loved growing up in an era of great music, listening to the likes of The Beatles and Led Zeppelin. Stevens joined his first band at the age of 12, playing school assemblies. “We were s...house but it was awesome to play to a real audience anyway.” Stevens encountered few problems performing despite being a “very shy kid”. He considered “surviving – literally” an achievement in his own career. “I’ve had quite an eclectic career but the main thing is I’m still here, still breathing.” Stevens reflected on the recent death of Men at Work’s Greg Ham in Melbourne.

The Giants with Wilbur Wilde

175 West Fyans Street, Newtown tel: 03 4208 0441 e: info@brioche.com.au

Dance Initiative Productions Presents

Survivor: Jon Stevens plays Geelong on Mother’s Day. “Musicians are often put on a pedestal and they’re expected to perform all the time...put on a face. “But we’re just people who want to create and be creative musically.” Stevens said Noiseworks’ creative juices were still flowing, with the band set to complete

another album. “We’re rocking better than ever.” Stevens believed that singing for Noiseworks made him a better performer. “As the years go by you get better at your craft. Not to blow my own horn but I think we’re pretty damn good,” he laughed.

THE HOME OF FIRST CLASS CINEMA SESSIONS UNTIL WED MAY 2

WAURN PONDS PRINCES HWY PH: 5249 2800 A Hosted Musical Floor Show of Dance, Piano & Song

AT THE: Separation St, Bell Park

THE BATTLE FOR EARTH BEGINS AT SEA

3D THE AVENGERS (M) DAILY: 12.00 1.30 3.00 6.00 7.30 9.00 NO FREE TIX 2D THE AVENGERS (M) NO FREE TIX DAILY: 10.30 11.30 2.30 4.30 5.30 8.30

NOW SHOWING THE LUCKY ONE (M) NO FREE TIX FRI MON - WED: 11.15 1.40 4.15 6.30 8.50 SAT SUN: 1.40 4.15 6.30 8.50 BATTLESHIP (M) DAILY: 1.00 3.45 6.25 9.05 AMERICAN PIE REUNION (MA 15+) FRI MON - WED: 1.15 4.10 6.45 9.15 SAT SUN: 4.10 6.45 9.15

A SEPERATION (PG) DAILY: 10.40 3.50 6.30 THE BEST EXOTIC MARIGOLD HOTEL (PG) DAILY: 10.45 1.20 6.45 THE HUNGER GAMES (M) DAILY: 1.10 4.00 9.05 SALMON FISHING IN THE YEMEN (M) DAILY: 11.00 9.15

THE LORAX (G) FRI MON - WED: 10.50 SAT SUN: 10.50 2.00 ADULTS AT KIDS PRICES

2D PIRATES: BAND OF MISFITS (G) SAT SUN: 11.15AM

ONLINE TICKETING AVAILABLE readingcinemas.com.au

C1031290-KG17-12

Table seating up to 10 people Drinks at bar prices & table platters by order All tickets $30.00 Bookings Ph: Danijela 0412 090 693 Sally 0418 179 871 Table platter orders via Danijela C1031452-KG17-12

The Independent, Friday April 27, 2012

35


Open Microphone Sunday 6 May from 1.30 to 6.00 pm

We are Open on Mother’s Day Sunday 13 May 2012 For Lunch & Dinner ~ Make your booking now

Ladies Day & Karaoke Night Saturday 19 May 2012 Free entry

We cater for all occasions: • Seminars • 21st • Birthdays • Weddings and more Destination worthwhile Must see & experience the Mt Moriac Hotel! Open daily for lunch and dinner

See you soon…

E: mountinn@bigpond.com

hat’s on W AT GEELONG RSL

GEELONG RSL MEMBERS DRAW $3000 WORTH OF OF PRIZES GIVEN TO OUR FINANCIAL MEMBERS 7 00PM OM 7: FRIDAY MAY 4TH – FR

Pot and Parmi Night Wednesdays $13

MEMBERSHIP IS ONLY $35

Steak Night Tuesdays $13

t 250g Scotch Fille

LIVE MUSIC EVERY SATURDAY

JAZZ MUSIC EVERY SUNDAY

IT’S SO EASY TO BECOME A MEMBER HERE, JUST ASK ONE OF OUR FRIENDLY STAFF 50 Barwon Heads Rd, Belmont Ph 5241 1766 36

The Independent, Friday April 27, 2012

1031111-JJ17-12

Ph: 5266 1372

1031346-KC17-12

1115 Princes Hwy, Mount Moriac


Finally Friday AROUND TOWN

Cabaret dazzles aiden Voyage – The Tour sails into Geelong Croatian Club for a dazzling night of cabaret entertainment. The production features a floor show of dancing girls set to entertain with fast-paced tap and swing jazz dancing in burlesque and ballroom routines with vocalist Jean-Paul on piano. Geelong’s Dance Initiative Productions is staging the shows with artistic director Sally Pearson who was behind 2011’s Bottoms Up! A Night of Cabaret, Trivia and Dance Entertainment. Maiden Voyage – the Tour will cruise throughout Victoria and Tasmania, stoping at the Croatian club in Bell Park’s Separation St this Saturday. Maiden Voyage performed to sell out crowds in Horsham last month and are bound for Castlemaine Theatre Royal in June before touring western Victoria and Tasmania’s north coast later in the year. The show is suitable for all ages, offering a fun night for lovers of dance, entertainment and great times. Maiden Voyage is presented in cabaret style, with table seating for up to 10 guests. Drinks will be available at bar prices, while table platters can be ordered through the Croatian club. The club’s dance floor will be open after the show. Doors open at 7.30pm, with the show beginning at 8pm. Tickets cost $30. Bookings are available by phoning Danijela 0412 090 693 or Sally 0418 179 871.

HIRE

M

Licensed to seat 28 passengers Hen’s/Buck’s Nights • Fishing Tours • Winery Tours

PICK UP & RETURN Stay safe on the roads... Hire our bus and driver with over 40 years of driving experience... Take the hassle out of your night out!

J & S Transport Geelong Maiden Voyage docks at the Croatian club this weekend. Danijela is also taking orders for table platters. Tickets will also be available at the door but bookings are advised.

1026571-SH11-12

Do you or someone you know have a problem with drugs or alcohol?

32 74

59 12

Conditions 12

P PHAROAHS BISTRO • TAB / SPORTS BAR

JOEY & MARIAS ITALIAN-AMERICAN WEDDING

OPEN 7 DAYS

21

TICKETS $69.50

5248 8777 5

THIS SATURDAY

54 Fellmongers Rd, Breakwater 7 31 62

2

47

38 18

71 74

81

31

9

88

23

55 90

480479-KG17-12

90

Please present this coupon to redeem offer Evenings only from 5.30pm - 8.30pm

Enquiries phone 0429 547 298

-

23

Purchase one main meal from our menu and receive a second meal of equal or lesser value for half price.

CHARTER

PARTY BUS

Bus & Driver for Hire

18

BUY ONE MEAL GET ONE FOR HALF PRICE

advertising feature

INCLUDES SHOW, 3-COURSE MEAL, COFFEE & CHAMPAGNE FOR TOASTING Come along and experience the wedding of a young Italian-American couple and their wacky family as you are transported into their very funny and sometimes very odd wedding day.

Help IS available

THE AUSTRALIAN ROCKY HORROR TRIBUTE SHOW

TREATMENT CAN HELP.

SATURDAY MAY 5TH MEAL & SHOW $62.50, SHOW ONLY $35

Find out more at ancd.org.au

MICK FLAVIN M

AUSTRALIAN NATIONAL COUNCIL ON DRUGS 524065-SH18-11

Not valid with specials or any other offers.

VALID UNTIL: 4/05/12

( (COUNTRY & WESTERN) S SATURDAY 2ND JUNE

Direct From Ireland

Meal & Show $75, Show only $49

THE AUSTRALIAN KATY & MICHAEL TRIBUTE SHOW

CLUB CATS, SIMONDS STADIUM Entry Via Kilgour Street

PH: 5225 2355

WEDNESDAY 11TH JULY @ 10:30AM. SCHOOL HOLIDAY ENTERTAINMENT!

1031288-PJ17-12

WORLD KARAOKE CHAMPIONSHIPS Enter for your chance to win your way to Finland & $50,000 worth of prizes! Local winner to receive $1,000!

MOTHERS DAY EVE DANCE

THIS FRIDAY HEAT 5 FROM 10PM @ THE CAZBAR

3 course meal, be clusive wine & soft drink in members $35 Members $30 non Featuring cool heat l • Bookings essentia

515 Bell Bellarine larine Hwy, Moolap Ph: 5250 2349 23 349 Mob: 0417 04 417 533 568 www.clubitalia.com clubitalia@bigpond.com

EVERY SUNDAY: Meal, Live Band & Dancing from 6pm. Visitors welcome

1030573-PJ17-12

AY

SATURDAY 12THerM ,

EVERY SATURDAY AY RETRO A GO-GO POKER |S BACK TUES NIGHT - FREE 6PM REGISTRATION 7PM START WED NIGHT - $10 BUY IN 6PM REGISTRATION 7PM START

FUNCTION ROOM FREE ROOM HIRE *Conditions Apply

Ideal for Weddings, Parties, Corporate Events or any Special Occasion. Catering 30-350 people.

2 Thompson Rd, North Geelong - 5278 2911 www.sphinxhotel.com.au ww w w w.s w sph hin nx xhote o ell.c co om m au m.a u info@sphinxhotel.com.au in nffo o@ @s sp ph hiinxh x ote o ell.c co om m au m.a u 1031117-JL17-12

480481-PJ17-12

The Independent, Friday April 27, 2012

37


Finally Friday TELEVISION GUIDE Friday 27

LETTERBOX DISTRIBUTION ABC

ContactColin us today onon Contact today

1300 654 343 910 0400 922 • Reliable distribution • Large network of walkers • Advanced auditing processes

Ph: 1300 654 910 www.fermax.com.au

479919-PJ7-12

Fermax currently deliver in excess of 1,500,000 items weekly comprising key community newspaper and advertising material.

Seven

60 DAY SALE ON NOW

Nine

Interested in hearing about paid parental leave and domestic violence? HAELIA CASH

Ten

WITH GUEST SPEAKER, SENATOR MIC

Who:

Senator Michaelia Cash Shadow Parliamentary Secretary for Immigration and the Shadow Parliamentary Secretary for the Status of Women

What: Zonta Club of Geelong Dinner Meeting

Why:

SBS

When: Wednesday 2nd May 2012 6:00pm for a 6:30pm start Guest Speaker: Senator Michaelia Cash from Western Australia commenced her term on 1st July 2008. She is also actively involved in the following committees: Joint Select Committee on Australia's Immigration Detention Network, Joint Standing Committee on Migration, Regulations and Ordinances Standing Committee, Legal and Constitutional Affairs References Committee, Joint Committee on the National Broadband Network. Senator Cash will be giving an overview of her life and commenting on topics such as paid parental leave, domestic violence and other issues relevant to her work as Shadow Parliamentary Secretary for the Status of Women.

facebook.com/indy.newspaper

FIND US ON

Where: Dromoland House 258 Pakington Street, Geelong West Cost:

$30 per person

1031565-KS17-12

RSVP: Noelle Ewing on 5241 6001 or zontaclubgeelong@yahoo.com.au (Preferably by 5:00pm 29/4/12)

38

The Independent, Friday April 27, 2012

Saturday 28

Sunday 29

6:00 rage (G) 10:00 rage: Guest Programmer (PG) 11:00 Spicks And Specks [s] 11:30 7.30 [s] 12:00 A Quiet Word... With Rob Brydon (PG) 12:30 Australian Story [s] 1:00 Football: VFL: Round 6 - Collingwood v Sandringham Zebras 4:00 The Wonder Years: The Phone Call 4:25 QI: Injustice And Inequality (PG) [s] 4:55 Billʼs Tasty Weekends: Norfolk [s] 5:40 Wild At Heart (PG) [s] 6:30 Gardening Australia [s] 7:00 ABC News [s] 7:30 New Tricks: Moving Target (PG) [s] – The UCOS team investigate the case of a cycle courier who was the victim of a hit and run in May 2006. 8:30 Whitechapel (M v) [s] – A fox runs through Whitechapel with a human arm in its mouth, and the team is called to investigate. 9:20 Five Days: Day 2 (M a,v) [s] – Laurie tries to uncover the connections between the dead man and the abandoned baby, until a new piece of evidence changes everything. 10:20 United States Of Tara (M l,s) 11:20 rage: Guest Programmer (MA15+ a,l,d,h,n,s,v) 6:00 Childrenʼs Programs 7:00 Weekend Sunrise [s] 9:00 The Morning Show - Weekends [s] 10:00 Childrenʼs Programs 12:00 V8 Xtra: A Day In The Life - Shane Van Gisbergen [s] 12:30 That ʼ70s Show (PG) [s] 1:30 Saturday Afternoon Movie: “The Scream Team” (PG v,h) (ʼ02) Stars: Eric Idle 3:30 Afternoon Movie: “The Shaggy Dog” (PG v) (ʼ06) Stars: Tim Allen & Robert Downey Jr 5:30 Coxyʼs Big Break [s] 6:00 Seven News [s] 6:30 2012 AFL Premiership Season: Rnd 5: Melbourne v St Kilda – St Kilda aims to extend its winning streak over the Demons to seven. All the action at the MCG. 11:00 Most Shocking: Top 20 (M s,v) [s] – This week, catch the Top 20 most shocking jokers gone wild! Who will make the list? 12:00 The Late Movie: “Fascination” (MA15+ s) (ʼ04) Stars: Jacqueline Bisset & Adam Garcia 2:05 The Charm Of Britain 4:00 Home Shopping 5:00 Dr Oz: Alzheimers Warning Signs (PG) 6:00 Childrenʼs News [s] 7:00 Weekend Today Saturday 9:00 Mornings - Saturday 10:00 Childrenʼs Programs 12:30 The Saddle Club 1:00 Horse Racing: Sydney Cup *Live 5:00 News: First At Five 5:30 Getaway (PG) – Natalie discovers a brilliant way to see New Caledonia - by yacht. 6:00 National News Saturday 6:30 Australiaʼs Funniest Home Videos Summer Series (PG) 7:40 The Voice: The Blind Auditions, Part 4 (PG) 9:40 Movie: “Ghosts Of Girl Friends Past” (M s) (ʼ09) – When he attends his younger brother's wedding, playboy Connor is troubled to discover that the ghosts of his many girlfriends have come to give him a piece of their mind and teach him a thing or two about true love. 11:50 Late Movie: “Secret Window” (M l,v) (ʼ04) Stars: Johnny Depp & John Turturro 1:50 Late Late Movie: “The Boogeyman” (M h) (ʼ05) Stars: Barry Watson. 3:30 Skippy - The Bush Kangaroo 4:00 Danoz 4:30 MCD - Home Shopping 6:00 Venom 7:00 Childrenʼs Programs [s] 8:30 Totally Wild [s] 9:00 Scope: Household Science [s] 9:30 Places We Go With Jennifer Adams 10:00 The Hot30 Countdown (PG) [s] 12:00 Radar (PG l,s,a) 12:30 The HitRater.com (PG l,s,a) 1:00 Coffee Culture 2:00 Saturday Afternoon Movie: “Bratz: The Movie” (G) (ʼ07) Stars: Logan Browning 4:00 Whatʼs Up Downunder [s] 4:30 All 4 Adventure 5:00 Ten News At Five [s] 6:00 Judge Judy (PG) 6:30 Program To Be Advised 7:00 Jamieʼs Thirty Minute Meals [s] 7:30 Good News Week - The Final Farewell Tour (PG) 9:30 The Graham Norton Show (PG) [s] 10:30 Saturday Night Movie: “The Truman Show” (PG l,a) (ʼ98) Stars: Jim Carrey & Laura Linney 12:40 Late Movie: “The Buried Secret Of M.Night Shyamalan” (M v,a) (ʼ05) Stars: Johnny Depp & Adrien Brody 3:00 Infomercials (PG) 5:05 Worldwatch 1:00 Masterpiece: Jascha Heifetz: Gods Fiddler 2:40 Masterpiece: Chroma 3:10 Masterpiece: Simon and Garfunkel: The Harmony Game 4:30 PBS Newshour [s] 5:30 Cracking the Colour Code: The Power of Colour [s] 6:30 World News Australia [s] 7:35 Big, Bigger, Biggest: Train [s] – The French train known as the TGV regularly reaches speeds exceeding 300 kilometres per hour. 8:30 RocKwiz: Lilith Lane & Tim Finn (PG) [s] – Melbourne-based singer/songwriter Lilith Lane and the legendary Tim Finn are Julia Zemiro and Brian Nankervisʼ special guests tonight. 9:15 Drama Movie: “Transamerica” (MA15+ a,d,s) (ʼ05) – Due for a sex-change operation, Bree receives a call from a 17-yearold identifying himself as her son. (From the US) 11:05 Horror Movie: “Cold Prey 2” (MA15+ v,h) (ʼ08) (In Norwegian) 12:45 Adventure Movie: “Warriors of Heaven & Earth” (M v,a) (ʼ03) (In Mandarin) 2:50 Weatherwatch Overnight

6:00 rage (G) 6:30 Childrenʼs Programs 9:00 Insiders [s] 10:00 Inside Business [s] 10:30 Offsiders [s] 11:00 Asia Pacific Focus [s] 11:30 Songs Of Praise 12:00 Landline [s] 1:00 Gardening Australia [s] 1:30 South Side Story (PG) 2:00 New Tricks: Moving Target (PG) 3:00 Cape Of Good Voices: South Africa Hooked On Opera [s] 3:55 William Kentridge: Anything Is Possible [s] 4:50 The Writers Room: Jack Marx [s] 5:00 Wonders of the Universe: Messengers [s] 6:00 Auction Room [s] 6:30 Compass: Hospital Chaplains [s] 7:00 ABC News [s] 7:30 Two On The Great Divide (PG) [s] 8:30 Waking the Dead: Waterloo (M v) [s] – DSI Boyd is being moved on from the Cold Case Unit. 10:15 Miss Fisherʼs Murder Mysteries: Death By Miss Adventure (M v) [s] 11:10 Movie: “The Conversation” (M v) (ʼ74) Stars: Gene Hackman & Cindy Williams 1:00 Waking the Dead: Waterloo (M v,a) 2:45 rage (PG) 4:00 The New Inventors [s] 6:00 Childrenʼs Programs 7:00 Weekend Sunrise [s] 10:00 AFL Game Day (PG) 11:30 Footy Flashbacks: 1999 Qualifying Final: Western Bulldogs v West Coast Eagles 1:00 Minute To Win It (PG) [s] 2:00 Breaking The Magicianʼs Code: Magicʼs Secrets Revealed (PG) [s] 3:00 2012 AFL Premiership Season: Rnd 5: Richmond v West Coast Eagles 6:00 Seven News [s] 6:30 Dancing With The Stars [s] – In this sizzling new season there will be glitz, glamour and as always a touch of unpredictability. 8:30 Bones: The Bump In The Road (M) [s] 9:30 Castle: Dial M For Mayor / Slice of Death (M) [s] – A woman is found dead in a car that is traced back to Castleʼs friend. 11:30 Forensic Investigators - Australiaʼs True Crimes: Park Family Murders (M v) 12:30 Alan Sugar: The Apprentice (M l) 1:40 Room For Improvement [s] 2:00 Home Shopping 3:00 NBC Today [s] 4:00 NBC Meet The Press [s] 6:00 Childrenʼs Programs 7:00 Weekend Today 10:00 Wide World Of Sports 11:00 Sunday Footy Show 1:00 On Display 1:30 Pyramid 2:00 The Apprentice (PG l) 4:00 Attenborough And The Giant Egg (PG) 5:00 News: First At Five [s] 5:30 Postcards 6:00 National News [s]ʼ 6:30 The Block: Room Reveal (PG) 7:40 60 Minutes 8:40 The Mentalist: His Thoughts Were Red Thoughts (M v) – In the wake of an anti-cult activist's homicide, the CBI question a cult leader who is Janeʼs old adversary. 9:40 Unforgettable: The Following Sea (M) – A key witness in a murder trial vanishes shortly before testifying, and Al desperately searches for her before the suspect goes free. 10:35 Harryʼs Law (M) . 11:30 Sunday Football: Parramatta Eels v Wests Tigers – From Parramatta Stadium. 1:30 Spyforce (PG) 2:30 Guthy Renker / MCD 3:30 Danoz 4:00 Good Morning America 5:00 Early Morning News 6:00 Religious Programs 7:00 Natural Connections 8:00 Saving Seals 9:00 The Hot30 Countdown (G) 10:00 The Hot30 Countdown (PG l,s,a) 12:00 Netball: ANZ Championship: Round 5: West Coast Fever v Adelaide Thunderbirds 2:00 Netball: ANZ Championship: Round 5: Melbourne Vixens v QLD Firebirds 4:00 Meet The Press [s] 4:30 The Bolt Report [s] 5:00 TEN News At Five [s] 6:00 The Project [s] 6:30 The Biggest Loser Singles [s] 7:30 Modern Family: Leap Day (PG) [s] – Mitchell tries to make Camʼs birthday special. 8:00 New Girl: Bully (PG) [s] – When Jess tries to intervene with a classroom bully she finds herself the target of the bad seed student. 8:30 Touch: 1+1=3 (M v,a) [s] – Jake is led to a pawn shop where a robbery triggers a sequence of unpredictable events that connect a group of people. 9:30 MotoGP 2012: Race 2 - Spain 12:00 Ally McBeal: The Obstacle Course (M) 1:00 Infomercial (PG) 5:00 Worldwatch 8:30 PopAsia 10:30 UEFA Europa League Highlights [s] 11:00 Les Murrays Football Feature - 2012 FA Cup: Semi-final highlights. 12:00 UEFA Champions League Magazine Program [s] 12:30 Speedweek [s] 2:00 World Superbike Championships 2012 2:30 Al Jazeera News [s] 3:30 ADbc (PG) [s] 4:00 Kick: Playing with Fire (PG) [s] 4:30 Living Black [s] 5:00 Cycling Central [s] 6:00 Lyndey and Blairʼs Taste of Greece: Inner Mani [s] 6:30 World News Australia [s] 7:30 Lost Worlds: Robinson Crusoes Treasure Island [s] 8:30 Prophets of Science Fiction: Philip K. Dick (PG) [s] – Literary genius and writer Philip K Dick lived a life of ever-shifting realities straight from the pages of his mind-bending scifi stories. 9:20 Drama Movie: “The Class” (M l) (ʼ08) (In French) 11:40 Movie: “American Visa” (M s,l,n,v) (ʼ05) (From Bolivia and Mexico, in Spanish) 1:25 Weatherwatch Overnight

This week’s winner

READER’S RECIPE INGREDIENTS (SERVES 4) > 30g unsalted butter > 4 bacon rashers, thinly sliced > 2 tbs pine nuts > 4 eggs, beaten > 300ml thickened cream > 3 garlic cloves, crushed > 1/3 cup (25g) finely grated parmesan,

plus extra to serve > 500g spaghetti > 2 cups (320g) shredded cooked turkey > 2 tbs chopped flat-leaf parsley, plus extra

TURKEY CARBONARA 1.Melt the butter in a deep frypan over medium-low heat. Add the bacon and cook until just starting to crisp. Add the pine nuts and cook, stirring, for a further minute or until they start to brown.

method

ADVERTISE YOUR BUSINESS TODAY!

6:00 ABC News Breakfast [s] 9:30 Business Today 10:05 Noah and Saskia [s] 10:30 What I Wrote [s] 11:00 Catalyst [s] 11:30 One Plus One [s] 12:00 Midday Report [s] 12:30 Dalziel And Pascoe 2:00 Monarch Of The Glen [s] 3:00 Childrenʼs Programs 6:00 Grand Designs Revisited: Peckham [s] 6:50 480: ANZAC 7:00 ABC News 7:30 7.30 [s] – Current affairs program. 8:00 QI: Injustice And Inequality (PG) – Stephen Fry is joined by Alan Davies, Sandi Toksvig, Clive Anderson and Henning Wehn in an episode all about ʻInjustice and Inequalityʼ. 8:30 Miss Fisherʼs Murder Mysteries: Death By Miss Adventure (M v) – Phryne sends Dot undercover to work in a factory to help solve the murder of one of its female employees. 9:30 The Shadow Line (MA15+v) – DI Gabriel uncovers some dark truths which implicate his colleagues. 10:30 Lateline [s] 11:10 Adam Hills In Gordon St Tonight (PG) 12:10 rage (MA15+a,l,d,h,n,s) 4:00 rage (MA15+a,l,d,h,n,s,v) 5:30 Seven Early News 6:00 Sunrise [s] 9:00 The Morning Show (PG) [s] 11:30 Seven Morning News [s] 12:00 Revenge: Charade / Treachery (M a) 2:00 Dr Oz: Superfoods For Super Beauty (PG d,a) [s] 3:00 Guide To The Good Life [s] 3:30 Toybox 4:00 Lab Rats [s] 4:30 Seven News At 4.30 5:30 Deal Or No Deal [s] 6:00 Seven News [s] 6:30 Today Tonight [s] 7:00 Home and Away (PG) [s] 7:30 Better Homes And Gardens [s] – Love the hit show 'Revenge'? Get the high-life Hamptonʼs look at your place. 8:30 2012 AFL Premiership Season: Rnd 5: Fremantle v Carlton 12:00 True Hollywood Story: The Kardashians (M a) 1:00 Auction Squad 2:00 Sunrise Over South Africa 3:00 Home Shopping 4:00 NBC Today [s] 5:30 Today *Live* [s] 9:00 Mornings (PG) 11:00 National Morning News 12:00 The Ellen DeGeneres Show (PG) 1:00 The View (PG) 2:00 Days Of Our Lives (PG) 3:00 ET [s] 3:30 Magical Tales 4:00 Kitchen Whiz 4:30 Afternoon News 5:30 Hot Seat 6:00 Nine News [s] 6:30 A Current Affair [s] 7:00 The Block (PG) 8:00 The Big Bang Theory (PG) 8:30 Friday Night Movie: “My Sisterʼs Keeper” (M l,a) (ʼ09) – Anna Fitzgerald was brought into the world to be a genetic match for her older sister, Kate, who suffers from acute promyelocytic leukemia. Stars: Cameron Diaz & Alec Baldwin 10:45 Persons of Interest: Foe (M) 11:35 Friday Night Football: Canterbury Bulldogs v Manly Sea Eagles – From ANZ Stadium. 1:35 Friday Night Football: Brisbane Broncos v Gold Coast Titans – From Suncorp Stadium, Brisbane. 3:30 Entertainment Tonight [s] 4:00 Guthy Renker 4:30 Good Morning America 6:00 Breakfast [s] 9:00 The Circle (PG) [s] 11:30 Wurrawhy [s] 12:00 Dr Phil: Tarnished Tiaras (PG) 1:00 The Doctors (PG) [s] . 2:00 Ready Steady Cook [s] 3:00 Judge Judy (PG) [s] 3:30 Everyday Gourmet With Justine Schofield [s] 4:00 H20 - Just Add Water [s] 4:30 The Bold & The Beautiful [s] 5:00 TEN News At Five [s] 6:00 The Project [s] 7:00 Young Talent Time [s] – Tonight the YTT talent quest brings back the viewer favourites with the final ʻWild Cardʼ semi final. 8:30 Friday Night Movie: “Never Been Kissed” (PG) – Josie Geller is desperate to become a reporter and her wish is granted when she is sent undercover at her old high school. She confronts painful memories of being a geek and falls for her new teacher. Stars: Drew Barrymore & David Arquette 10:40 Late Movie: “The Jewel Of The Nile” (PG l,v) Stars: Michael Douglas 1:00 The Late Show (PG) [s] 2:00 Ally McBeal (M) 3:00 Infomercials (PG) 4:45 UEFA Champions League: Semi-final (2nd Leg) *Live 9:10 Worldwatch 2:30 Living Black [s] 3:00 Letters and Numbers [s] 3:30 Al Jazeera News [s] 4:00 The Journal [s] 4:30 PBS Newshour [s] 5:30 Global Village: New Caledonia [s] 6:00 Letters and Numbers (PG) 6:30 World News Australia [s] 7:30 Coast: Lillesand to Svalbard [s] 8:35 Titanic: The Mission: Smoking Room (PG l) [s] – Focuses on the luxurious interiors of the Titanic, whose fittings were so expensive she was the 1912 equivalent in luxury to todayʼs Burj Al Arab hotel in Dubai. 9:30 As It Happened: The Long March to Freedom: Capture (PG) [s] – Tells, for the first time, the story of the thousands of British, American and Commonwealth POWs who were forced to march from Poland to Germany. 10:30 World News Australia Late [s] 11:00 Drama Movie: “The Final Gaze” (M l,a,n) (ʼ05) (In Spanish) 1:10 Crime Movie: “Kurt Wallander: The Photographer” (M v,l) (ʼ06) (In Swedish) 2:50 Weatherwatch & Music

2. In a bowl big enough to hold the cooked pasta, whisk together the eggs, cream, garlic and parmesan. Add bacon and pine nuts, and season with salt and pepper.

3. Cook the pasta according to packet instructions, then drain well. Immediately add the hot pasta to the egg mixture and toss for 1 minute, allowing the heat from the pasta to cook the sauce. Stir through the turkey and parsley, and serve topped with extra parmesan and parsley. by Mrs Venti of Jan Juc

to serve

WIN A $20 Cheesecake Shop voucher

1031291-PJ17-12

North Geelong: 135 Separation St • Ph: 5277 2662 Geelong: 112 Mt Pleasant Rd, Belmont • Ph: 5244 0300

For your chance to win a yummy cake to the value of $20 from The Cheesecake Shop send your recipe to: The Geelong Independent (marked “Recipe”) P.O. Box 407 Geelong 3220 or email: advertising@geelongindependent.com.au (Subject: Recipe)


Finally Friday TELEVISION GUIDE Tuesday 1

Wednesday 2

Thursday 3

5:30 Eggheads 6:00 ABC News Breakfast [s] 9:30 Business Today 10:00 Behind The News 10:30 Australiaʼs Prime Ministers 10:35 My Place / Big ideas [s] 12:00 Midday Report [s] 12:30 Q&A [s] 1:30 Compass [s] 2:00 Where Is The Wall? [s] 3:00 Childrenʼs Programs 6:00 Time Team: Dunwich [s] 7:00 ABC News [s] 7:30 7.30 [s] – Current affairs program. 8:00 Country Town Rescue (PG) [s] – As the year draws to a close four out of the five families have lasted the distance. 8:30 Agatha Christieʼs Miss Marple: By The Pricking Of My Thumbs (PG) [s] 10:05 First Tuesday Book Club With Jennifer Byrne: May [s] 10:35 Lateline [s] 11:10 The Business [s] 11:35 Four Corners [s] 12:20 Media Watch [s] 12:35 Hungry Beast: Death (PG) 1:05 The Last Word Monologues [s] 1:35 Time Team: Dunwich [s] 2:30 Football: VFL: Round 6: Collingwood v Sandringham Zebras 5:30 Seven Early News [s] 6:00 Sunrise [s] 9:00 The Morning Show (PG) [s] 11:30 Seven Morning News [s] 12:00 The Midday Movie: “The Breakfast Club” (M l,a) (ʼ85) Stars: Molly Ringwald 2:00 Dr Oz: Prevent The Disease You Fear The Most: Your Questions About Cancer (PG) [s] 3:00 Medical Emergency (PG a) [s] 3:30 Toybox [s] 4:00 Lab Rats [s] 4:30 Seven News At 4.30 5:30 Deal Or No Deal [s] 6:00 Seven News [s] 6:30 Today Tonight [s] 7:00 Home and Away (PG) [s] 7:30 Australiaʼs Got Talent [s] 8:30 Packed To The Rafters: The Power of Words (PG a) [s] 9:30 Program To Be Advised 10:40 Dual Suspects (M d) [s] 11:40 Royal Pains: Bottoms Up (M) [s] 12:40 Sons And Daughters [s] 1:00 Home Shopping 4:00 NBC Today [s] 5:30 Today *Live* 9:00 Mornings (PG) 11:00 National Morning News 12:00 The Ellen DeGeneres Show (PG) 1:00 The View (PG) [s] 2:00 Days Of Our Lives (PG) 3:00 ET [s] 3:30 Magical Tales 4:00 Kitchen Whiz 4:30 Afternoon News 5:30 Hot Seat 6:00 Nine News [s] 6:30 A Current Affair [s] 7:00 The Block (PG) 8:00 The Voice: Let The Battles Begin - Part 2 (PG) – Featuring three phases of competition, contestants battle to progress to the next phase. 10:00 2 Broke Girls: And The Reality Check (PG) 10:30 Survivor: One World: Two Tribes, One Camp, No Rules (PG l) – The 24th edition of the reality series strands 18 castaways on a single Samoan beach. 11:30 Kitchen Nightmares USA: Fleming (MA15+l) 12:30 Chase: Pilot (M v) 1:30 Danoz 2:00 Guthy Renker / Selfcare 3:00 Danoz 3:30 Good Morning America [s] 5:00 Early Morning News 6:00 Breakfast [s] 9:00 The Circle (PG) [s] 11:30 Wurrawhy [s] 12:00 Dr Phil: Teen Girls In The News (PG) 1:00 The Doctors (PG) [s] 2:00 Ready Steady Cook [s] 3:00 Judge Judy (PG) [s] 3:30 Everyday Gourmet With Justine Schofield [s] 4:00 Totally Wild [s] 4:30 The Bold & The Beautiful [s] 5:00 TEN News At Five [s] 6:00 The Project [s] 7:00 The Biggest Loser Singles (PG) [s] 8:00 Bondi Vet (PG) 8:30 NCIS: Need To Know (M a) [s] – The murder of a Chief Petty Officer with top-secret clearance leads the NCIS team to investigate an international arms dealer in the DC area. 9:30 NCIS: Patriot Down (M a) [s] – When a colleagueʼs murder sends shockwaves through the team, Gibbs uncovers a surprising link to the crime. 10:30 Law & Order: UK: Skeletons (M) [s] 11:30 The Late Show (PG) 12:30 Infomercials (PG) 5:05 Worldwatch 1:00 Drama Movie: “I Saw Ben Barka Get Killed” (M v,a,l) (ʼ05) (In French) 3:00 Letters and Numbers [s] 3:30 Al Jazeera News [s] 4:00 The Journal [s] 4:30 PBS Newshour 5:30 Global Village: Indian School [s] 6:00 Letters and Numbers [s] 6:30 World News Australia [s] 7:30 Who Do You Think You Are? John Wood (PG) [s] – Aboriginal footballer Michael OʼLoughlin returns to Adelaide to trace his family bloodlines. 8:30 Insight [s] – Tonight Insight looks at why more children are abducted by a parent each year in Australia than by a stranger, and whether the laws need to be toughened up. 9:30 Dateline 10:30 World News Australia Late [s] 11:05 Drama Movie: “Journey from the Fall” (M v,a) (ʼ06) – Inspired by the true stories of Vietnamese refugees who fled their country after the fall of Saigon. (From the US, in Vietnamese) 1:25 Drama Movie: “The Wedding Song” (MA15+a,n) (ʼ08) (In French & Arabic) 3:10 Weatherwatch Overnight

5:30 Eggheads 6:00 ABC News Breakfast [s] 9:30 Business Today 10:00 For The Juniors 10:15 Cyberchase / Our Animals 10:45 Behind The News / Big Ideas [s] 12:00 Midday Report [s] 12:30 National Press Club Address [s] 1:30 Can We Help 2:00 Iron Curtain: Ribbon of Life 3:00 Childrenʼs Programs 6:00 Country House Rescue [s] 6:50 Minuscule: Rascals! [s] 7:00 ABC News [s] 7:30 7.30 [s] – Current affairs program. 8:00 Wild Life At The Zoo [s] 8:30 Randling (PG) [s] – A furiously funny game show about words, hosted by Andrew Denton. 9:00 Laid [s] – Roo thinks sheʼs found the answer to all her problems. 9:30 Agony Aunts (M s) [s] 10:00 At The Movies [s] 10:30 Lateline [s] 11:05 The Business [s] 11:30 Review With Myles Barlow (M a,l,s) [s] 12:00 The Armstrong And Miller Show (M d,a,s) 12:30 Movie: “WUSA” (M d,v,s) (ʼ70) Stars: Paul Newman & Joanne Woodward 2:30 Football: SANFL: Round 6: South Adelaide Vs Port Adelaide 5:30 Seven Early News [s] 6:00 Sunrise [s] 9:00 The Morning Show (PG) [s] 11:30 Seven Morning News [s] 12:00 The Midday Movie: “Held Hostage” (M v,a,s) (ʼ10) [s] Stars: Julie Benz 2:00 Dr Oz: Dr Oz Investigates: Genetically Modified Foods (PG) [s] 3:00 Medical Emergency (PG a) [s] 3:30 Toybox [s] 4:00 Lab Rats [s] 4:30 Seven News At 4.30 5:30 Deal Or No Deal [s] 6:00 Seven News [s] 6:30 Today Tonight [s] 7:00 Home and Away (PG a) [s] 7:30 Program To Be Advised 8:30 Program To Be Advised 10:30 The Amazing Race (PG) [s] – Eleven teams of two race around the globe. 11:30 30 Rock: Standards and Practices (M) 12:00 Eastbound & Down (MA15+l,d,s) – Burned out and broke, former big-league pitcher Kenny Powers returns home to North Carolina to teach PE at the local middle school he once attended. 12:30 Sons And Daughters [s] 1:00 Home Shopping 4:00 NBC Today [s] 5:30 Today *Live* 9:00 Mornings (PG) 11:00 National Morning News 12:00 The Ellen DeGeneres Show (PG) 1:00 The View (PG) [s] 2:00 Days Of Our Lives (PG) 3:00 Entertainment Tonight [s] 3:30 Magical Tales 4:00 Kitchen Whiz 4:30 National Afternoon News 5:30 Hot Seat 6:00 Nine News [s] 6:30 A Current Affair [s] 7:00 The Block (PG) 8:00 Celebrity Apprentice: The Buzz (PG) 9:30 The Mentalist: Cheap Burgundy (M v) 10:30 CSI: Miami: On The Hook (M) – When a fisherman narrowly escapes death, the CSIs have to dodge bullets to keep him alive and find out whoʼs after him. 11:30 Weeds (MA15+l,s,d,a) 12:00 Eclipse (PG) 12:30 20/20 [s] 1:30 Danoz / Guthy Renker 2:30 Danoz 3:30 Good Morning America 5:00 Early Morning News 6:00 Breakfast [s] 9:00 The Circle (PG) [s] 11:30 Wurrawhy [s]] 12:00 Dr Phil: Thatʼs Outrageous! (PG) [s] 1:00 The Doctors (PG) [s] 2:00 Ready Steady Cook (PG) [s] 3:00 Judge Judy (PG) [s] 3:30 Everyday Gourmet With Justine Schofield [s] 4:00 Totally Wild [s] 4:30 The Bold & The Beautiful [s] 5:00 TEN News At Five [s] 6:00 The Project [s] 7:00 The Biggest Loser Singles (PG) [s] 8:30 Offspring (M l,s,d) [s] – Burying concerns over the identity of her biological father, Nina focuses on the hunt for a rental property with Patrick. Later, Ninaʼs forced to confront the issue when Billie reveals some answers. 9:30 The Good Wife: After The Fall (M) [s] – While Alicia defends a documentary filmmaker who may be involved in a college girlʼs suicide captured on video, three Lockhart Gardner employees try to capitalize on Willʼs absence. 10:30 Program To Be Advised 11:30 The Late Show (PG) 12:30 Infomercials (PG) 5:05 Worldwatch 1:00 Insight [s] 2:00 Dateline [s] 3:00 Letters and Numbers [s] 3:30 Al Jazeera News [s] 4:00 The Journal [s] 4:30 PBS Newshour [s] 5:30 Global Village: Hassan Baiake [s] 6:00 Letters and Numbers [s] 6:30 World News Australia [s] 7:30 Wildest India: Ganges: River of Life [s] – This episode features the River Ganges, lifeblood of India, which carves out a dramatic path as it flows right across the subcontinent. 8:30 Worlds Most Dangerous Roads: Peru (M l) [s] – Adventurer Ben Fogle and comedian Hugh Dennis drive a historic route from the Peruvian Andes to the depths of the Amazon. 9:35 Civilisation: Is the West History? Consumerism (PG) [s] – Historian Niall Ferguson looks at why the West has dominated the rest of the world for so long. 10:30 World News Australia [s] 11:00 Drama Movie: “Maria Full of Grace” (M d,l,a) (ʼ03) (From Columbia, in Spanish) 12:50 Drama Movie: “Looking for Cheyenne” (M s,l,n) (ʼ05) (In French) 2:25 Weatherwatch Overnight

5:30 Eggheads 6:00 ABC News Breakfast [s] 9:30 Business Today [s] 10:00 Being Spanish [s] 10:35 Behind The News [s] 11:00 Country House Rescue [s] 11:45 Big Ideas Sampler 12:00 Midday Report [s] 12:30 The Return Of Sherlock Holmes (PG) 1:30 At The Movies [s] 2:00 Surviving Extremes (PG) [s] 3:00 Childrenʼs Programs 6:00 River Cottage: Autumn [s] 7:00 ABC News [s] 7:30 7.30 [s] – Current affairs program. 8:00 Catalyst [s] 8:30 Silk (M d) [s] – Tough, smart and sharp legal drama. 9:30 Steve Jobs: Billion Dollar Hippy [s] – This portrait of Steve Jobs uncovers how Apple became the company it is today. 10:30 Lateline (PG) [s] 11:05 The Business [s] 11:30 Captain Cook: Obsession And Discovery: Taking Command (PG) [s] 12:25 The Clinic (M l) [s] 1:15 Silk (M d) [s] 2:15 At The Movies: Short Cuts [s] 2:30 Football: WAFL: Round 7: East Fremantle v South Fremantle 5:30 Seven Early News [s] 6:00 Sunrise [s] 9:00 The Morning Show (PG) [s] 11:30 Seven Morning News [s] 12:00 The Midday Movie: “The Net 2.0” (M v) (ʼ06) Stars: Nikki Deloach 2:00 Dr Oz: Dr Ozʼs 50ʼs Prevention Guide (PG) 3:00 Medical Emergency (PG a) [s] 3:30 Toybox [s] 4:00 Lab Rats [s] 4:30 Seven News At 4.30 5:30 Deal Or No Deal [s] 6:00 Seven News [s] 6:30 Today Tonight [s] 7:00 Home and Away (PG s,a) [s] 7:30 Better Homes And Gardens [s] 9:00 Greyʼs Anatomy: This Magic Moment (M) – The doctors split into teams for a risky surgery involving conjoined twins. 10:00 Desperate Housewives: Is This What You Call Love? (M) [s] – Susan is shocked when daughter Julie pays a visit and shows up six months pregnant. 11:00 Private Practice: The Standing Eight Count (M) – Pete, Violet, Sam and Addison adjust to their new, singles lives in different ways. 12:00 My Big Friggin Wedding (M) 1:00 Home Shopping 4:00 NBC Today [s] 5:30 Today *Live* 9:00 Mornings (PG) 11:00 National Morning News 12:00 The Ellen DeGeneres Show (PG) 1:00 The View (PG) 2:00 Days Of Our Lives (PG) 3:00 Entertainment Tonight [s] 3:30 Magical Tales 4:00 Kitchen Whiz 4:30 National Afternoon News 5:30 Hot Seat 6:00 Nine News [s] 6:30 A Current Affair [s] 7:00 The Block (PG) 8:00 Celebrity Apprentice: Run A Tight Ship (PG) – The celebrities must become the ʻWelcomingʼ party for the P&O Cruise Liner The Pacific Jewel. They must take charge of the turnaround service. 9:30 The AFL Footy Show (M) – Join the Logie Award winning footy show. 11:15 The NRL Footy Show (M) 1:00 Entertainment Tonight [s] 1:30 Skippy - The Bush Kangaroo 2:00 Guthy Renker / Trivita 3:00 Danoz 3:30 Good Morning America 6:00 Breakfast [s] 9:00 The Circle (PG) [s] 11:30 Wurrawhy [s] 12:00 Dr Phil: Under The Influence (PG) [s] 1:00 The Doctors (PG) [s] 2:00 Ready Steady Cook [s] 3:00 Judge Judy (PG) [s] 3:30 Everyday Gourmet With Justine Schofield [s] 4:00 Scope: Red [s] 4:30 The Bold & The Beautiful [s] 5:00 TEN News At Five [s] 6:00 The Project [s] 7:00 The Biggest Loser Singles (PG) 7:30 Glee: Choke (PG) [s] 8:30 Law & Order: SVU: Fatherʼs Shadow (M) [s] – The team investigates a producer after a woman is found in Central Park drugged and with evidence of a sexual assault. 9:30 Law & Order: SVU: Transitions (M v,a) [s] – Benson and Stabler investigate the case of a man who was found in the parking lot of a strip club, badly beaten. 10:30 A Gifted Man: In Case Of Co-Dependance (M v) [s] – The doctors team up to search for a common link when a pop star and a young girl both seek treatment for unusual symptoms. 11:30 The Late Show (PG) 12:30 Infomercials (PG) 5:05 Worldwatch 1:00 The Food Lovers Guide to Australia 1:30 Money: Why do We Take Risks? [s] 2:30 Here Comes the Neighbourhood [s] 3:00 Letters and Numbers [s] 3:30 Al Jazeera News [s] 4:00 The Journal [s] 4:30 PBS Newshour 5:30 Global Village: Masada [s] 6:00 Letters and Numbers [s] 6:30 World News Australia [s] 7:30 Food Safari: Persian [s] 8:00 How to Cook Like Heston: Potato [s] 8:30 Hestonʼs Feast: Victorian (M s) [s] – Heston cooks up extreme edibles inspired by the Victorians for his celebrity guests, 9:30 The Family UK: Daddy likes his Potatoes (PG) [s] – Until now Tejind has been silent on the topic of girlfriends, but with his parents looking for a bride for the ʻbabyʼ of the house, he comes clean on a night out. 10:30 World News Australia [s] 11:00 Hugh Hefner: Playboy, Activist & Rebel 1:10 Dave In The Life: Pensioner (M l) [s] 1:40 Action Adventure Movie: “A World Without Thieves” (M v,a) (ʼ04) (From China In Mandarin) 3:40 Weatherwatch Overnight

real people fast cash! Cash Loans & Cheques Cashed

WE BUY AND LOAN AGAINST GOLD

Fast approval Payday loans Loans $100-$2000

e pagn m a h C mums l l a r fo rival! on ar

CELEBRATE YOUR

Mother’s Day at

The Peninsula Experience for yourself why so many families spoil their mum year after year with a celebration of Mother’s Day in our fabulous family bistro.

3 COURSE LUNCH 12noon to 3pm p

BOOK NOW! Soup

• Potato, Pota Po tato to,, ba bac bacon con and leek soup • Pumpkin Soup • Seafood and avocado cocktail with seafood sauce

Mains

• Roast loin of pork served with apple sauce and crackle • Roast lamb topped with a mint flavoured jus • Half roast chicken served with red wine, demi glaze All meals served with Rosemary and garlic chats with seasonal vegetables or salad.

Desserts

• Sticky date pudding with butterscotch sauce • Pavlova served with passion fruit and fresh cream • Jelly and frog in the pond • Teas, coffee & after dinner mints

ADULTS $28.00pp CHILDREN up to 12 $12.50pp 2 COURSE SPECIAL Children under 4 eat FREE!

FOOTBALL See all the action on Fox Sports THIS SATURDAY NIGHT Geelong vs Brisbane LIVE on the Big Screen!

2 BIG SCREENS... Every match of every round of the AFL

Live every week

Australian Credit Licence #389433

Bistro Open 7 Days a Week. 12-4 & 5:30 until late

*Conditions Apply.

Call your nearest store or visit our website www.cashstop.com.au

5221 0900 146 Moorabool Street, Geelong

1019822-TB05-12

195 Bellarine Highway, Newcomb Ph: 5248 2606 • www.thepeninsula.com.au The Independent, Friday April 27, 2012

1031285-JL17-12

Monday 30

s 5:00 Gardening Australia [s] 5:30 Catalyst [s] 6:00 ABC News Breakfast [s] 9:30 Business Today [s] 0 10:00 Backyard Science / Science Clips [s] 10:35 h Ace Day Jobs / Inside Science [s] 11:00 Landline [s] ) 12:00 Midday Report [s] 12:30 Bloodlines (PG) [s] 1:30 The New Inventors [s] 2:00 Monarch Of The Glen [s] 3:00 Childrenʼs Programs 6:00 Grand Designs Revisited: Sussex 6:50 Minuscule: Spider Driver [s] 7:00 ABC News [s] 7:30 7.30 – ABCʼs current affairs program. 8:00 Australian Story [s] 8:30 Four Corners [s] 9:20 Media Watch [s] 9:35 Q&A [s] – Hosted by Tony Jones 10:35 Lateline [s] 11:10 The Business (M s) 11:35 Moses Jones (M v,l,s) [s] – A wave of violence threatens to get out hand. 12:25 Agatha Christieʼs Miss Marple: They Do It With Mirrors (M v) [s] 2:00 Mumbai Calling: My Mate Mumbai (PG) 2:25 rage (PG) 3:30 Rugby Union: Shute Shield: Rnd 3 [s] ] 5:30 Seven Early News [s] 6:00 Sunrise [s] 9:00 The Morning Show (PG) [s] 11:30 Seven Morning News [s] 12:00 Revenge: Suspicion / loyalty (M a) 2:00 Dr Oz: Ask Dr Oz: Why Does My Body Do That? (PG) [s] 3:00 Medical Emergency (PG a) [s] 3:30 Toybox [s] 4:00 Lab Rats [s] 4:30 Seven News At 4.30 5:30 Deal Or No Deal [s] 6:00 Seven News [s] 6:30 Today Tonight [s] 7:00 Home and Away (PG) 7:30 Program To Be Advised 8:30 Revenge: Duress (M) [s] – An unstable visitor makes a nightmare of Danielʼs intimate birthday celebration. 9:30 Pictures Of You (PG) [s] – A new interviewstyle series where well-known personalities open up their childhood photo albums. 10:15 Happy Endings (PG s) 11:15 30 Rock (M) 12:15 Picture This (PG) 1:00 Home Shopping 4:00 NBC Today [s] y 5:30 Today *Live* 9:00 Mornings (PG) 11:00 Brand y Developers 11:30 National Morning News 12:00 The Ellen DeGeneres Show (PG) 1:00 The View (PG) t 2:00 Days Of Our Lives (PG) 3:00 Entertainment s Tonight [s] 3:30 Magical Tales 4:00 Kitchen Whiz 4:30 Afternoon News 5:30 Hot Seat 6:00 9) Nine News [s] 6:30 A Current Affair [s] 7:00 The Block (PG) 7:30 The Voice: Let The Battles Begin - Part 1 (PG) – Featuring three phases of competition, contestants battle to progress to the next phase and ultimately secure a recording contract. 9:30 Persons Of Interest: Identity Crisis (M) – Reese and Finch must deal with a new Number who has very little electronic footprint. 10:30 Footy Classified (M) [s] 11:30 Super Rugby Extra Time 12:30 The Whole Truth (M a) 1:30 Entertainment Tonight [s] 2:00 Guthy Renker Australia 3:00 Danoz [s] 3:30 Good Morning America [s] 5:00 Early Morning News s 6:00 Breakfast [s] 9:00 The Circle (PG) [s] 11:30 Wurrawhy [s] 12:00 Dr Phil: New Dr. Phil Series: Marriage Meltdown Part 3: Who Will Stay Together? (PG) 1:00 The Doctors (PG) 2:00 Ready Steady Cook [s] 3:00 Judge Judy (PG) [s] 3:30 Everyday Gourmet With Justine Schofield [s] 4:00 Totally Wild [s] 4:30 The Bold & The Beautiful [s] 5:00 TEN News At Five [s] 6:00 The Project [s] 7:00 The Biggest Loser Singles (PG) 8:00 Bondi Rescue (PG l,n) [s] 8:30 NCIS: Los Angeles: Patriot Acts (M v) [s] – Nate Getz asks the NCIS team for help when the FBI looks at an ex-Marine alleged to have made a chemical bomb. 9:30 Hawaii Five-O: Kalele (M) [s] – McGarrett tracks down August March, a former diamond smuggler, to help clear his sister when sheʼs arrested for smuggling conflict diamonds. 10:30 Program To Be Advised 11:30 The Late Show (PG) 12:30 Infomercial (PG) a 5:05 Worldwatch 1:00 Drama Movie: “Delbaran” (PG) l (ʼ01) (In Farsi) 2:40 Spacefiles: Telescope: New Eyes 0 on the Cosmos [s] 3:00 Letters and Numbers [s] 3:30 Al Jazeera News [s] 4:00 The Journal [s] 4:30 FIFA e Futbol Mundial [s] 5:00 The Crew [s] 5:30 Living Black [s] 6:00 Letters and Numbers [s] 6:30 World News Australia [s] 7:30 Mythbusters: Location, Location, Location (PG) [s] 8:30 Bite Me with Dr Mike Leahy: Brazil (M a) [s] – In this episode Dr Mike embarks on a mission to meet some of Brazilʼs toughest inhabitants. From fire ants and invisible worms to vampire bats and the legendary candiru fish. 9:30 Shameless (MA15+l,s) [s] – Karen and Connor return hoping to start afresh, but on a routine visit to her psychiatric hospital Karen makes a shocking discovery. 10:30 World News Australia [s 11:00 The World Game 12:00 SOS (MA15+) – Australian short films. 1:00 Living Black [s] 1:30 Welcome to Lagos (M l,s) [s] 2:35 Weatherwatch Overnight

39


Finally Friday DINING OUT

WHITE EAGLE HOUSE

Entertainment Complex

Mother’s Day Lunch $30 2 courses, set menu

FRIDAY NIGHT ENTERTAINMENT IN SPORTS BAR

Book now to spoil mum We’re revamped and want to show you, so we’re still doing FREE Coffee!

April 27th: COOL HEAT May 4th: HORIZON May 12th: HEARTBEAT

1031245-MD17-12

Yes that’s right, free! 44 Corio Street, Geelong

SATURDAY NIGHT ENTERTAINMENT IN BISTRO FROM 6PM

(Just down from the TAC)

Phone 5222 2322

1031325-PJ17-12

1016819-JJ49-11

Chef Chris Hudich and an inviting interior welcome diners to Geelong’s Wool Exchange.

April 28th: BEN COSTANZO May 5th: Q GIRL May 13th: PETER PEREZ June Saturday 16th: The King of Pop: Michael Jackson Tribute tickets on sale now! Adults Meal & Show $55, Show Only $40, Children’s prices starting from $20.

Fellmongers Road, Breakwater Vic 3219 Ph: 5229 1009

advertising feature

Wooly buzzing Coffee-lovers are also in the he all-new Wool Exchange is abuzz with a delicious spotlight this month, with free new menu and owners in freshly ground brews still available all day. 2012. Whether patrons prefer a skinOpen five days from 7.30am for breakfast and lunch, the Wool ny soy latte, a full-cream twoExchange now offers fine dining sugar cappuccino or a simple flat white, the staff at the Wool at cafe prices. Head Chef Chris Hudich has a Exchange brews them up for free. The restaurant’s affordable special set menu planned for menu also caters for diners seekMother’s Day. For $30 a head mums can be ing a more-substantial hit. The breakfast menu offers wined and dined with the threecourse set lunch menu from morning favourites including cin11.30am on May 13. Bookings are namon French toast with maple syrup or eggs Benedict, both essential. “We’re also available for func- under $15. Hungry diners can also order a tions, so come in and have a Wooly Big Breakfast with bacon, look,” Chris says

T

two eggs, sticky Swiss brown mushrooms, spinach and tomato chutney. Diners seeking a lunchtime experience can order from a menu including free-range pork belly, calamari and chorizo salad and potato gnocchi with beetroot, all for less than $17. Cakes, pastries, slices and biscuits also adorn the open kitchen, which abuts split-level dining. The Wool Exchange is fullylicensed and also available for functions. More information is available by phoning 5222 2322 The Wool Exchange is at 44 Corio St, Geelong.

For your yo our chance cch hanc hanc ha nce e to win in a $100 Gift Voucher to Wool Exchange, simply text the word “Wool” and SMS it along with your full name to 19 19 18* Competition closes midnight Wednesday 2nd May 2012. *Winners will be notified via SMS. Premium SMS costs 55¢. SMS service provided by SL Interactive. See terms and conditions at: www.starnewsgroup.com.au

1031599-JL17-12

EXPRESS S

1026704-JF11-12

FOR QUALITY COFFEE AND FOOD... LOOK NO FURTHER!

&

SANDSTONE CAFE Food Wine Coffee Catering Functions

Open for breakfast and lunch from 9am every day Dinner, Friday and Saturday from 6pm 284 Torquay Road Grovedale Ph: 5244 2343

Book now for Mother’s Day We’re open from 8 am till 5 pm so spoil mum..... 40

The Independent, Friday April 27, 2012

21 Malop Street, Geelong Ph: 5229 1954 Don’t forget mum this Mother’s Day! We are open for lunch and dinner, call 5229 1954 to secure your booking. Tapas tasting plate; choose any 3 of our tapas for $18

Open Mon-Sat Lunch & Dinner

1028387-JL13-12

1029730-KG15-12

WESTFIELD PLAZA, GEELONG PH: 5222 8700

1031436-JM17-12


1031317-VH17-12

Entertainment Complex

Mother’s Day Lunch $30 2 courses, set menu

BOOK NOW TO SPOIL MUM

NEW AUTUMN/WINTER MENU OUT NOW We’re revamped and want to show you, so we’re still doing FREE Coffee!

Yes that’s right, free! 44 Corio Street, Geelong (Just down from the TAC) Phone 5222 2322

Heather Thomson at Bella Rose Belmont Florist.

Flowers power for every mum W

flowers in bright and eyecatching colours.” Heather says succulents and air plants are a popular overseas trend making its way to Australia. “An air plant is one you don’t have to plant it or put in water. They were so popular that our initial order has completely sold out. “We also have traditional chrysanthemums and popular lilies as well as the colourful tropical phalaenopsis orchid plants from Singapore. “These orchids flower for three to six months a year and each year after that and are very easy to look after.” Heather says anyone who ‘likes’ Bella Rose Belmont Florist’s Facebook page and Mother’s Day event will receive a discount on orders placed before May 11, 2012. Bella Rose Belmont Florist is at shop 5, 164 High St Belmont, in the Coles-BiLo carpark, phone 5245 7599.

Innovative I n n o va t i v e Indian I ndian R Restaurant estaurant

WIN $100 Gift Voucher this Mother’s Day! Please make your booking now call 5229 7777 Open for lunch & dinner for Mother’s Day!

1027004-JM12-12

ith flowers and Mother’s Day going hand in hand, Bella Rose Belmont Florist has a wide selection for all tastes and budgets. Bella Rose owner Heather Thomson said Mother’s Day arrangements are a speciality at her store. “Mums love flowers and we have a range of boxed, basket and ceramic arrangements ready to go,” Heather says. “We can also make up custom bouquets and even include a vase so mum doesn’t have to go searching for one to put her beautiful flowers into.” Heather says Bella Rose Belmont Florist uses Teleflora and Petals, Australia’s premier florist networks, to relay orders nationally and internationally. “We can often send flowers the same day, but it’s worth adding in a couple of days notice for Mother’s Day. “We always have lots of cut

Gift Vouchers Available

1031245-JM17-12

Some of the arrangements on display at Bella Rose.

✆ 5229 7777 www.shiraaz.net.au 48 Malop Street, Geelong Fully Licensed & BYO. Open 7 days 4.30pm to 10.00pm (Remember to use you Living Social Deal by 13th May) 1031336-JF17-12

the

ultimate

pamper for 2! session Sarah Jessica Parker Covet Pure Bloom Spa Heaven Gift Pack

$

95

19

EDP 50mL

Britney Spears Curious Heart EDP 50mL

Sale on 22 April — 13 May, 2012

$

20

ea

EDP 30mL

Marc Jacobs Lola Velvet Edition EDP 50mL

$

55

ea

Enter in store today¤ ¤ See in store or website for full terms & conditions.

Visit www.soulpattinson.com.au to find your nearest participating store. The Independent, Friday April 27, 2012

C1029741-KG17-12

Natio

Paco Rabanne Lady Million

41


1031444-KS17-12

1031317-VH17-12

Give mum the gift that’s extra special. We can make your next arrangement... It’s that easy! Shop 5 / 164 High St, Belmont

(Coles car park)

Ph: 5245 7599 The Shell Club will offer an elegant venue for dining on Mother’s Day.

Win! For your mum Dine in style Spoil your mum this Mother’s Day by winning her this bottle of top shelf GHMUMM Champagne thanks to Najda’s j Cellarbrations.

T 1031415-VH17-12

To enter simply text the word MUM along with your full name to 191918*

ONLY AT *Service provided by SL Interactive. Premium SMS costs 55¢. Winners notified via SMS. Competition closes 30/04/12.

220 Anakie Road, North Geelong VIC (next to Mitre 10)

Phone: 5278 2855

QUILTERS DARE TO DREAM zzzzzzzz AVANTE STUDIO PACKAGE

$13,990 SAVE $3000

18” long arm machine + frame

DESIGNER RUBY

$5990 SAVE $1500

BONUS IPOD DOCKING STATION

10” Sewing area, exclusive sensor system, 5 year warranty

SWEET SIXTEEN SIT DOWN PACKAGE $7990 $6990

$2299

EMERALD 203 $999 $799

32

shire

HEIGHTS SEWING CENTRE Est 1935

epp pped salad ard & P and greens, to niciose t a s p u to M a h d d Roaste pudding, mas Salmon serve e is c a i d t n mato, n a a ll f Atl dried to lini dill ho o n t & u s e n l l h o i F m brocco ffed wit with le Grilled east stu sweet potato & sto r B n e Chick pper pe roasted kinned ert, served on nut and red pe S y p s i ia Cr mb cream acadam & came t te Icebacon pped with a m r a e l s s o e c o D h to h by C ce & Deat te Baileys sau e ce t a l o la c o o tch sau c h o h in c ite C ttersco d u h e b r W h e it th m w smo Belgiu served Stack m udding ream P g le crea i F e- c d doub e& t n ic a a t & D s e y z on Stick ied lem $7.50 h cand it w t r under) a T & 2 s (1 u u Citr Chips ns Men Lemon Childre en Nuggets & Purnell Rd Chick Chips Fish & ips kles e & Ch & sprin n www.shellclub.com.au com.au g g a in s p p a L to oice of with ch e a 76 Purnell Rd, Corio d n am su Ice-cre B a c c h u s M a rs h R d

1031106-TB17-12

* FREE Machine Service after 12 months Valued at $125 * FREE Instructional Lesson with every machine

The Independent, Friday April 27, 2012

.90

ith York

BONUS WALKING FOOT & ¼” FOOT

176 Pakington St, Geelong West Ph 5229 3558

U M E N

Mains Fillet served w s with ju er Eye

16” long arm m/c + table

42

$

SAPPHIRE 875Q

ASK ABOUT OUR 875Q OPEN BOX STOCK SAVE $$$

daytime shows beginning 11am with lunch afterward. Steve Williamson will perform in his “Michael Bublé experience” from 11am on May 3 The show and lunch costs $15, with bookings essential. The Shell Club offers memberships for discounts on drinks and meals as well as use of the club’s entertainment facilities all year round. Membership costs $15 a year. The Shell Club is on the corner of Bacchus Marsh and Purnell Rds, Corio, phone 5275 4061.

y a D s r e h t o M C H N U L

BONUS RULER SET VALUED AT $333

BONUS DUAL FEED FOOT $120

salmon or chicken main dishes are available with a tantalising dessert for $32.90. Mums also receive a complimentary glass of bubbly. Children 12 and under can enjoy a lunch main and an icecream sundae for $7.50 with a free soft drink. Bookings are essential. In early May The Shell Club will unveil a new snooker room. Pool and snooker facilities provide great entertainment for patrons. Tennis courts are also available for hire. The Shell Club hosts regular

Ph 5275

1023553-KC8-12

$16,990

he Shell Club has found its inner pearl with recent renovations. The club’s refurbished sports and bistro bars have an inviting, open atmosphere with picturesque garden views. The Shell Club also has a new menu “proving very popular with patrons”, according to the club’s Barbara Foster. The new bistro and menu offer patrons a real dining experience, she says. A special lunch menu has been created for Mother’s Day from midday to 2pm on May 13. A choice of eye fillet, Atlantic

4061


1031317-VH17-12

Top acts set to rock any mums he secret to putting a genuine smile on mum’s face this Mother’s Day is to give her a gift she will long remember. Acorn Productions, Geelong’s leading provider of live entertainment, has a variety of sensational shows featuring the very best of Australian music. Whether their preferences run to the ’60s, ’70s, ’80s or ’90s music, Acorn has a show to delight any mum. Australia’s number-one AC/DC tribute show, Thunderstruck, will have mums rocking their socks off. Alternatively, sensational live performer Jon Stevens will feature in an intimate afternoon of music? The magic of Glenn Shorrock will come alive as he delves into his long list of classic hits, while the timeless classics of Cotton, Keays & Morris and Joe Camilleri are also on the way. Other acts on the Acorn Productions bill for Geelong include Australian Crawl legend James Reyne and Hunters and Collectors’ Mark Seymour. Mums can be spoiled this Mother’s Day with tickets to Geelong’s best live shows as gifts to be long remembered. Dads might like to go, too. Each show is at Deakin Waterfront Cafe, a beautifully restored woolstore overlooking

T

Spoil Mum this Mother’s Day at Winter’s Open from 8am for all day breakfast and lunch Bookings Essential

Geelong’s magnificent Corio Bay. Independent has show dates and For awesome shows and mem- ticket information. orable times, Acorn Productions’ For more information see: advertisement in today’s www.acornproductions.com.au.

Open from 8am 7 days for all day breakfast and lunch

Deakin Waterfront Cafe AUSTRALIA’S NO. 1 AC/DC SHOW

JON STEVENS

1031344-JM17-12

Joe Camilleri is just one of the top-name acts on the way to Geelong through Acorn Productions.

330 Pakington St, Newtown 3220 Ph: 5221 8832 www.winterscafe.com.au

GEELONG’S BEST LIVE MUSIC!

GLENN SHORROCK

JAMES REYNE

SUNDAY 27th May - 2:45pm

SUNDAY 10th June - 2:45pm

MARK SEYMOUR

MENTAL AS ANYTHING

SUNDAY 22nd July - 2:45pm

SUNDAY 5th August - 2:45pm

W SHO Y A D R’S E H MOT SATURDAY 12th May - 8pm

SUNDAY 13th May - 2:45pm

COTTON, KEAYS JOE CAMILLERI & & MORRIS THE BLACK SORROWS

SUNDAY 17th June - 2:45pm

1031195-KC17-12

SUNDAY 24th June - 2:45pm

Tickets and Group Table Bookings Phone 5247 1986 Visit www.acornproductions.com.au for all the latest The Independent, Friday April 27, 2012

43


fridaymotor Independent

Hyundai’s curvy SUV BY ERIC BLAIR yundai ix35 replaced the popular but conservatively-styled Tucson compact SUV. The newcomer is a more distinctive looking vehicle, more curvaceous with swooping lines, without being over the top in a manner that could frighten off potential buyers. The ix35 also launched the Hyundai family-look hexagonal grille that is being progressively used in all new Hyundai vehicles. It’s not only the body that looks ultra-modern, the interior design of the Hyundai ix35 is up to date. Style is what the new Hyundai ix35 is all about. But behind that futuristic face is a competent SUV that will suit many a family’s needs and

aspirations. The Hyundai ix35 has three trim levels: Active, Elite and Highlander, with a choice of three engines, two petrol and a turbo-diesel. Hyundai led the way when it created the Tucson City model with all the advantages of an SUV body styling, such as practicality and high driving position, but with the cost-saving of front-wheel drive. On the entertainment front the Hyundai ix35 has a quality audio system with auxiliary and USB ports and iPod compatibility. There are steering wheel mounted audio controls as well as buttons for the cruise control. With the seats up ix35 has a generous luggage capacity of 591 litres which increases to 1436 litres when the rear seat

H

Well rounded: Ultra modern, curvaceous styling is a big selling feature of the Hyundai ix35.

backrests are folded down. The turbo-diesel in our Highlander delivers effortless performance. The level of noise, vibration, harshness is acceptable although when pushed hard you certainly know there’s a diesel engine up there. Handling is pretty good for a relatively tall SUV. There’s a bit of body roll in corners if you push it moderately hard, but that’s acceptable in Asian SUVs. If you have a lot more to spend, we suggest trying the European competitors, though. As with the entire Hyundai range the ix35 comes with a fiveyear/unlimited distance warranty. This provides buyers with the option of selling their cars every three years with the attraction of a two-year warranty.

AUTO MASTER Car Sales For all your finance needs we use and recommend Southbank Finance Ph. 5221 6066

07 HOLDEN COMMODORE VE OMEGA

99 HOLDEN COMMODORE VT II SS

01 HOLDEN COMMODORE VX EXEC

02 TOYOTA ECHO

05 HOLDEN CALAIS VZ

06 HOLDEN VIVA JF EQUIPE

• Towbar • Tint • Lowered • ABS • Cruise • A/C • P/S • P/Windows • XWF-089

• Rear Spoiler • Alloys • P/Windows • Cruise • PUI-160

• 5 Speed Manual • ABS • A/C • P/S • CD • Immaculate • Airbags • QTI-142

• 5 Speed Manual • 4 Cylinder • P/S & A/C • Great Condition • RTW-860

• 6 Cyl Auto • Trip Computer • ABS • Airbags • Alloys • C/Locking • P/Windows • TWY-559

• Body Kit • Sports Seats • Mags • P/Windows • ABS • Airbags • CD • A/C • P/S • URA-513

NOW

NOW

$

14,990

$

CRUISE

DRIVEAWAY

NOW

6,990

NOW

$

8,490

MANUAL

DRIVEAWAY

$

5 SPEED

DRIVEAWAY

NOW

6,990

LEATHER

DRIVEAWAY

NOW

$

13,990

LEATHER

$

DRIVEAWAY

11,950 DRIVEAWAY

06 HYUNDAI GETZ

08 MAZDA 2

05 HOLDEN VZ SP UTE

01 HOLDEN CALAIS VX II

03 MITS MITSUBISHI OUTLANDER

06 BF FORD FALCON

• 5 Speed Manual • Low Kms • 4 Cylinder • Great First Car • TZX-438

• Immaculate Condition • Low kms • 4 Speaker stereo and more • WTT-746

• Alloys • Towbar • ABS • Cruise • Airbags • Lots more • XXM-410

• Immaculate Leather Seats • Climate Control • ABS • 10 Speaker Stereo • VXX-350

• Roof Racks • P/Windows • P/S • Dual Airbags • XJT-259

• Reverse Sensors • Alloys • ABS • Cruise • UCZ-952

NOW

NOW

$

7,490

LOW KMS

LOW KMS

$

DRIVEAWAY

NOW

11,490

NOW

$

15,950

V6

DRIVEAWAY

$

LEATHER

DRIVEAWAY

8,990 DRIVEAWAY

NOW

DUAL AIRBAGS

NOW

$

9,990

$

ABS

DRIVEAWAY

11,950 DRIVEAWAY

05 VOLKSWAGON GOLF GTI

03 HOLDEN VECTRA

06 HOLDEN ASTRA

08 HOLDEN CAPTIVA SX WAGON

01 DAEWOO LANOS SE HATCHBACK

01 SUBARU SUB OUTBACK AWD

• Leather • GTI • Alloys • Body Kit • Sunroof • Airbags • 89,000Kms • Will Impress • UMA-648

• Leather • Low Kms • Airbags • A/C • CD • Alloys • P/S • Immaculate • XTT-786

• 6 Speed Sports Auto • Alloys • Cruise • CD • P/Windows • A/C • P/S • UKK-987

• Auto • CD • Airbags • P/W • A/C • Long Reg • Alloys • ABS • Cruise • Test drive • WWL-336

• Long Rego • 100,000Kms • A/C • P/S • Auto • Don’t Miss Out • RHH-853

• Auto • A/C • P/S • Cruise • Immaculate • Cargo Barrier • Alloys • Climate Control • QWC-544

NOW

SPORTS

NOW

$

22,490

AUTO

DRIVEAWAY

$

10,990 DRIVEAWAY

TURBO DIESEL

NOW

$

13,990 DRIVEAWAY

TURBO DIESEL

NOW

$

NOW

17,990 DRIVEAWAY

NOW

5,490

ALLOYS

DRIVEAWAY

$

9,990

DRIVEAWAY

05 HYUNDAI ELANTRA

00 FORD LASER LXI SEDAN

98 NISSAN PATROL GU

99 NISSAN PATROL GU ST

01 TOYOTA LANDCRUISER PRADO

2002 HOLDEN ZAFIRA

• Airbags • P/Windows • Cruise • CD • Remote Central Locking • Tint • TSO-295

• A/C • P/S • 118,000Kms • Very Tidy •Test Drive Welcome • JKL-028

• 5 Speed Manual • Dual Fuel • 8 Seater • Towbar • PMX-267

• Bull Bar • Side Steps • Towbar • 8 Seater • A/C • P/S • P/Windows • RNR-814

• V6 • Auto • Side Steps • Immobiliser • Cruise • MP3 & More • RHC-921

• Auto • Low Kms • CD Player • P/S • A/C • ABS • Remote Central Locking • SDH-482

89,000 KMS

NOW

NOW

$

7,990

AUTO

DRIVEAWAY

$

NOW

6,490 DRIVEAWAY

8 SEATER

$

16,490 DRIVEAWAY

TURBO DIESEL

NOW

$

NOW

16,990

V6

DRIVEAWAY

AUTO MASTER Car Sales

147-149 FYANS ST GEELONG 3220 PH 5222 6858 View all of our cars online at www.automastercarsales.com.au The Independent, Friday April 27, 2012

NOW

$

17,950 DRIVEAWAY

LMCT 10278

44

$

AUTO

OPEN 7 DAYS

7 SEATER

$

9,888

DRIVEAWAY

NO FINANCE APPLICATION REFUSED!

1031116-JF17-12

20” PENTAGON ALLOYS


fridaymotor

BUILT

TOUGH! TINTED WINDOWS

TWIN AIRBAGS CRUISE CONTROL

ELECTRIC WINDOWS

KENWOOD PREMIUM SOUND

1

ENGINE IMMOBILIZER

02 VY SS COMMODORE UTE • Automatic • Air Conditioning • Power Steering • ABS • Service History • Only 140,000 Kms • RZA-457

$

46 .69 PER WEEK

2

3

$16,672.60 DRIVEAWAY

4

5

6

DUALGS AIRBABS &A

ONLY 22,00S0 KM

6 E PEOPL

ONLY 0 188,0S0 KM

08 SUZUKI SV650 SOLO MOTORBIKE

98 HONDA ODYSSEY 6 SEATER

97 LANDROVER DISCOVERY SE WAGON

01 HOLDEN VX II EXEC WAGON

08 NISSAN TIIDA ST SEDAN

• 6 Speed Manual • Only 22,000 Kms • Very Clean Motorbike • GS-510

• Auto • A/C • P/S • ABS • Dual Airbags • Alloys • RUJ-356

• Very Tidy • 188,000Kms • 5 Speed Manual • A/C • P/S • ABS • WNI-239

• Auto • A/C • P/S • ABS • Low Kms • TIK-179

• Auto • A/C • P/S • Dual Airbags • ABS • 1.8Ltr 4 Cyl • XMT-107

$

23 .36

PER WEEK

$

$6,272.60 DRIVEAWAY

7

30 .03

PER WEEK

$

$8,352.60 DRI RIVEA VEAWAY VEA W WA DRIVEAWAY

8

30 .03

PER WEEK

$8,352.60 DRI RIVEA VEAWAY VEA W WAY DRIVEAWAY

9

V8 L A MANU

7 R SEATE

$

33 .36

$9,392.60 DRI RIVEA VE WAY VEA WA DRIVEAWAY

PER WEEK

10

40 .02

PER WEEK

$11,472.60 DRIVEA EAWAY DRIVEAWAY

11

S

1.8L

S

ALLOY

$

S

ALLOY

ALLOY

99 FORD AU V8 ALLOY TRAY

05 RENAULT MEGANE EXPRESSION SEDAN

05 TOYOTA COROLLA ASCENT WAGON

07 HOLDEN VIVA WAGON

04 HYUNDAI TERRACAN HIGHLANDER WAGON

• 5 Spd Man • A/C • P/S • Driver Airbag • Only 112,000 Kms • PWM-093

• Auto • Climate Control • Side & Rear Airbags • Leather Trim • THX-996

• Auto • A/C • P/S • Rear Cargo Blind • CD Player • TTV-771

• Auto • A/C • P/S • P/Windows • Roof Rails • Airbags • WDM-043

• Auto • Climate • Cruise • ABS • Leather • Alloys • Tow Bar • TGM-533

$

$

46 .69

$

$

41.69

PER WEEK

$12,512.60 DRIVEA DRI VEAWAY VEA W DRIVEAWAY

12

41.69

PER WEEK

$12,512.60 DRI DRIVEAWAY

13

$

PER WEEK

$13,552.60 DRIVEA DRI VEA EAWAY WA WAY DRIVEAWAY

14

46 6 .69

$13,552.60 DRI RIVEA VEAWAY VEA W WA WAY DRIVEAWAY

PER WEEK

15

BUNKS BED

S

ALLOY

46 .69

PER WEEK

$13,552.60 DRIVEA VEAWAY W DRIVEAWAY

16

AUTO

AUTO

TED DEDICAAS G

06 PEUGEOT 307 HATCH

JAYCO POP TOP CARAVAN

00 ML 320 LUXURY WAGON

03 HONDA CRV SPORT

07 FORD FALCON WAGON

• Auto • P/S • ABS • Alloys • Climate Control • TYF-043

• Full Annex • Sleeps 5 • 3 Bunks • Double Bed at Back • Q15996

• Auto • A/C • P/S • ABS • Cruise • Leather • Alloys • QDY-892

• Auto • A/C • P/S • ABS • P/Windows • Alloys • Leather • SEY-487

• Dedicated Gas • Auto • A/C • P/S • Cruise • ABS • YTO-090

$

$

$

46 .69

PER WEEK

$13,552.60 DRIVEAWAY

17

ALL CARS

ABS BRAKES

$

28 .36

PER WEEK

$13,999 DRIVEAWAY

18

50 .03

PER WEEK

$14,592.60 DRIVEAWAY

19

LOW KMS

50 .03

$14,592.60 DRI DRIVEA VEAWAY VEA W DRIVEAWAY

PER WEEK

20

S

ALLOY

$

53 .36

PER WEEK

$15,632.60 DRIVEAWAY

21

ALLOY

S

7 R SEATE

AUTO

05 MAZDA 3 MAXX SPORT HATCH

05 HYUNDAI SANTE FE

MY06 VOLVO XC70 SE WAGON

01 MITSUBISHI PAJERO NM EXCEED

03 VOLVO XC 90 T6 WAGON

• 5 Spd Man • A/C • P/S • Airbags • Alloys • Low Kms • Spoiler • TRE-817

• Auto • A/C • P/S • ABS • Sunroof • Alloys • Only 66,000 Kms • TVK-503

• Auto • Climate Control • ABS • Cruise • Leather • Alloys • YVC-076

• Top Of The Range • Leather Trim • Sunroof • A/C • P/S • RGO-284

• Auto • ABS • Cruise • Curtain Airbags • Alloys • Leather • XEH-403

$

$

$

$

$

56 .69

PER WEEK

$16,672.60 DRIVEAWAY

46 .69

PER WEEK

$16,672.60 DRIVEAWAY

66 .69

PER WEEK

$19,792.60 DRIVEAWAY

66 .69

$19,792.60 DRIVEAWAY

PER WEEK

83 .35

PER WEEK

$24,992.60 DRIVEAWAY

APPROVED CARS

APPROVED CARS ALL CARS

K

car - its large, comfortable seats at just the right height, there’s need to climb up or crouch down. The tall, square body means that all but the tallest occupants will travel in comfort. Two equipment levels are offered. The 1.6litre petrol model is Soul, the 1.6-litre diesel and 2.0-litre petrol are both Soul+. Both models come standard with front, side and curtain airbags, ABS brakes with electronic brakeforce distribution and brake assist, electronic stability control, traction control, Bluetooth phone and audio streaming, hill-start assist and auxiliary / USB input sockets. Soul+ adds cruise control, leather wrapped steering wheel with audio controls, metal-look interior trim, roof rails, and ‘Soul’ embroidered seat and door trim. One noticeable difference between the two variants is in their wheels with the standard Soul having 15-inch steel wheels and the Soul+ jumping up to 18-inch alloys. The latter can reduce ride comfort on some roads so try for yourself before falling for their trendy looks. Both models come with a space-saver spare to improve luggage room. Kia Soul is something special. Not only is it visually stunning, it’s also a practical car at a modest price. Such is the nature of owners of funky cars that we feel it won’t be long before we see Soul car clubs (Soul mates?), and trendy souls driving their Souls on cruises with one another. As with all Kia models, Soul comes with a five year, unlimited kilometre warranty.

METALLIC PAINT

APPROVED CARS ALL CARS

BY ERIC BLAIR ia Soul is a car for those who want a sensible, practical small car but also want to be noticed. Those who would love to own a car that stands out from the crowd such as the Mini or VW Beetle or the now-discontinued Chrysler PT Cruiser, but without spending quite as much money. From the get-go Kia targeted the youth market, no doubt thinking that the head-turning looks of the Soul would appeal to them. But during our road test we were quite surprised by the number of our baby-boomer contemporaries that commented favourably on the car. The combination of ease of entry, great visibility and interior space, including plenty of room for the grandkids and their gear all struck a chord. Continuing the Hyundai/Kia practice of using the Greek alphabet for its engine names, the new engine is appropriately enough called Nu, though if you are superstitious it’s the 13th letter in Greece. Anyway, it produces a maximum 122 kW of power and 200 Nm of torque and the engineering technology seems certain to defy any bad omens. Also retained in the Soul is the impressive 1.6-litre CRDI diesel with 94 kW and 260 Nm. Fuel consumption figures range from 5.2 litres per 100 kilometres in a manual diesel up to 7.5 L/100 km from the 2.0-litre petrol. We averaged 7.7 L/100 km during our test of the petrol. The sensible nature of the Soul is clear the moment you go to get into the

17” ALLOYS

ALL CARS

Kia got soul

APPROVED CARS

Universal: Soul’s head-turning looks might attract all ages of buyers.

Mike Hanneysee Car Sales 47 YRS

in

ng

a

stil nd l

Lucky 13: The Soul’s new 122 kW engine is called Nu – it’s the 13th letter of the Greek alphabet.

LMCT 900

go

Some pics for www.hanneyseecarsales.com.au illustrative purposes 139 FYANS STREET, SOUTH GEELONG only. E & OE PH: 5221 8888 Justin: 0409 549 247 Metro Dzwonczyk: 0414 432 295

g stro

480484-KS17-12

PAYMENTS BASED ON 60 MONTHS WITH 35% DEPOSIT EXCLUDING ON ROAD COSTS @ 11.95% T.A.P. TOTAL REPAYMENTS 1. $NOT AVAILABLE. 2. $NOT AVAILABLE. 3. $NOT AVAILABLE. 4. $9,107.80. 5. $9,107.80. 6. $19,073.60. 7. $6,505.20. 8. $8,239.40. 9. $9,107.80. 10. $9,973.60. 11. $9,973.60. 12. $10,839.40. 13. $11,707.80. 14. $12,571.00. 15. $12,571.00. 16. $12,571.00. 17. $13,439.40 18. $14,305.20. 19. $16,471.00. 20. $17,3339.40. 21. $29,354.40. 22. $29,354.40. 23. $34,287.60

The Independent, Friday April 27, 2012

45


$6,990 PRICED TO SELL

96 VS 2 AUTO UTILITY

2002 AU FALCON UTILITY

NYM-451. In great cond. inside and out, has P/S, A/C, Alloy wheels, a super car to drive. Sold with RWC for only $3,990

RLM-879. This ute looks and drives superbly, has P/S, A/C, canopy, tub liner, full 12mths reg, RWC and mechanical warranty

$3,800

$2,800 NICE TO DRIVE

HAS P/S, A/C, CRUISE

1997 VS 2 COMMODORE AUTO SEDAN

96 EL FALCON AUTO SEDAN

QQE-250. This is one of the nice ones for sale in very original cond. throughout, sold with L/Reg & RW for only $3,800.

OUL-431. A nice neat clean car with L/Reg and RWC, new tyres, alloy wheels, P/S, A/C, good buying at only $2,800

New version: The new Jeep Compass looks like a scaled-down version of the company’s flagship model Grand Cherokee.

Finding direction BY ERIC BLAIR hen it comes to 4WD vehicles Jeep enjoys an almost iconic status. Since the production of the first Jeep back in 1941 the name has been synonymous for rugged, go-anywhere vehicles but in recent years the company has been faced with the dilemma of addressing the desire of modern motorists for increased comfort and luxury in their vehicles. While Jeep had joined the trend towards luxury off-roaders with vehicles like its Grand Cherokee it took until 2007 for it to move into the booming softroader SUV market with the launch of the Jeep Compass. Sadly, due to below average sales, the Compass was discontinued in early 2010 although Patriot remained on sale. Now the Jeep Compass is back in a new format, with a body that makes it look like a compact ver-

W

$2,200

$2,400

NO MORE TO PAY

PRICED RIGHT

90 NISAN PULSAR AUTO H/BACK

90 VN COMMODORE AUTO SEDAN

XTQ-927. This great little car looks and drives very nicely. Has A/C and RWC is supplied for only $2,200 driveaway.

WBP-914. Nice red duco, alloy wheels, P/S, A/C, L/Reg and RWC. This car looks and drives nicely only $2,400.

WEST COAST

Cnr Cadman Terrace & Holmes St, Nth Geelong

CAR SALES

LMCT 7012 Pics for illustrative purposes only.

www.frankburgecars.motorsm.com

YEARS

5278 4582

sion of the Grand Cherokee. From most angles the styling of Compass is fairly conservative however from the front it is clearly a Jeep with the traditional combination of a big, seven-slot grille and round headlights. Jeep buyers have made it clear over the years that they want to hold on to the distinctive look of the original World War II vehicle. So the stylists must tread a fine line to satisfy the Jeep purists yet attract a whole new group of younger buyers. While the new Compass looks like the Grand Cherokee it has Jeep Patriot running gear – Patriot having a classic Jeep shape, while the Compass is very 2012 in its styling. The current Compass is an improvement over the previous model. Compass comes in two equipment levels: Sport and Limited. Both have AWD and the Sport model also now comes with a 2WD variant running grunt through the front wheels.

28

e On Sit e Financ

IN T S FYANS

Pics for illustrative purposes only. Prices subject to change without notice

Sales Consultant Doug Lawson

LMCT 1433

2004 FORD FIESTA

2004 PROTON JUMBACK CANOPY

2004 FORD FALCON UTE 1 OWNER

5 Speed, A/C, P/S. TBD-074

DRIVEAWAY

$10,000

DRIVEAWAY

$10,000

DUAL FUEL

AUTO

BULL BAR

3 Door, A/C, P/S. TFY-873

1995 TOYOTA LANDCRUISER

DUAL FUEL

LOCAL IMMACULATE

480480-KS17-12

$3,990 PRICED TO SELL

1016766-TB49-11 1031142-JL17-12

6 PRICED TO SELL! QUALITY RWC cars

fridaymotor

Auto, A/C, P/S. TLO-373

DRIVEAWAY

$13,000

A/C, P/S. NHW-364

DRIVEAWAY

$15,000

LARGE VARIETY OF MAKES & MODELS - Wagons, Sedans, Utes, Autos & Manuals - LOTS OF LOW KM VEHICLES. ALL PRICES ARE DRIVEAWAY! SELECTED QUALITY HOLDENS

SELECTED QUALITY CARS

2001 RODEO LT SPORTS TWIN CAB, 5 Speed, A/C, P/S, Alloys. RDS-145 2001 VX CALAIS SEDAN, Auto, 5.7 Ltr V8, Long Rego. RKU-980 2003 HOLDEN RODEO UTILITY, 5spd A/C, P/S, Aluminium Tray. SNU-535 2005 VZ COMMODORE SEDAN, V6, Auto, A/C, Alloys. TKK-906 1992 VQ STATESMAN, V8, 4 Speed Auto, Local. RYB-511 2004 BARINA HATCH, 5Dr, 5 Speed, Mod Kms, A/C, P/S, Alloys. SZQ-709 1995 VS COMMODORE WAGON, V6 Auto, A/C, PS, OQQ-388 2001 VX EXECUTIVE COMMODORE, V6, Auto, A/C, Local. XBT-043

$13,000 $12,000 $11,000 $9,000 $8,000 $8,000 $5,000 $6,000

SELECTED QUALITY FORDS 2006 BF FALCON WAGON SERIES II, Auto, A/C, Dedicated Gas. UCI-436 2006 BF FALCON WAGON, 6 Cyl Auto, Long Rego. YZH-166 2005 BA FALCON WAGON, Auto, A/C, Service Books. TFQ-807 2004 FORD FOCUS SR SEDAN, Auto, A/C, P/S. TAZ-527 2003 BA FALCON, 6 Cyl, Auto, A/C, P/S. SQU-692 1991 FORD CORSAIR SEDAN, 5 Speed, A/C, Mod Kms. EXQ-775

PRESTIGE 2001 VX CALAIS SEDAN, V8 Auto, Alloys, Local. RKU-980 1992 VQ STATESMAN, V8 Auto, 1 Owner, Local. RYB-511

1999 HONDA CRV

$14,000 $13,000 $12,000 $10,000 $9,000 $3,000

2006 HYUNDAI ELANTRA SEDAN, Auto, A/C, P/S, Local, Mod Kms. UDX-620

$8,000 1995 TOYOTA LANDCRUSIER WAGON, Auto, Dual Fuel. NHW-364 2007 BF FALCON UTILITY, 6 Cyl Auto, 1 Owner, Service Books. UQJ-227 $16,000 2001 RODEO LT SPORTS TWIN CAB 4X4, 5 Speed, A/C, P/S, Alloys. RDS-145 2004 BA FALCON UTE, Auto, Dual Fuel. TLO-373 $13,000 2003 HOLDEN RODEO UTILITY, 5 Speed, A/C, P/S, Aluminium Tray. SNU-535 $11,000 2004 PROTON JUMBUCK UTE, 5 Speed, Canopy. TBD-074 2001 VS HOLDEN COMMODORE UTILITY, Auto, 6 Cyl. YBD-297 $11,000

2004 HYUNDAI ELANTRA, Auto, A/C, P/S. SYD-054

$10,000

2005 HOLDEN VIVA 5DR HATCH, Auto 1 Owner. YXM-089

$10,000

FOUR CYLINDER AUTOMATICS 2008 TOYOTA COROLLA ASCENT SEDAN, Auto, A/C, P/S, Local. WMH-120 2003 HONDA JAZZ VTIS HATCH, Auto, Alloys, Books, Long Rego. STJ-808 2001 GOLF VW HATCH, Auto, A/C, P/S, Mod Kms. RCA-780

2004 HOLDEN ASTRA 3DR HATCH, Auto, A/C, P/S. SYQ-690 1999 HOLDEN JS VECTRA HATCH, Auto, A/C, P/S, Alloys. PKT-872

Excellent Condition, A/C, P/S, DRIVEAWAY Electric’s. TJT-352 46

$11,000

The Independent, Friday April 27, 2012

$6,000 2004 BA FALCON UTE, Auto, Dual Fuel. TLO-373 1999 FAIRMONT GHIA V8, Auto, Alloys, A/C. POE-428

WAGONS & 4X4

2003 NISSAN X-TRAIL, Auto, A/C, P/S, Mod Kms. SHX-272 $12,000 2001 HOLDEN RODEO LT SPORTS TWIN CAB 4X4, Local. A/C, P/S. RDS-145 $8,000 1999 HONDA CRV WAGON, 5 Speed, A/C, P/S, Local. TJT-352

AUTO

3Dr, Service Books, A/C, P/S. SYQ-690

$8,500

AUTO

A/C, P/S, Electrics. STJ-808

$3,000 $1,000

2008 TOYOTA COROLLA AUTO

EXCELLENT CONDITION

ALLOYS

DRIVEAWAY

$4,000 $4,000 $3,000 $13,000 $8,000

AS TRADED - NO RWC $16,000 $13,000 1997 HOLDEN RODEO SPACECAB, Canopy, Dual Fuel. RQT-697 $11,000 1996 EL FAIRMONT SEDAN, 6 Cyl Auto. OTS-014

2003 HONDA JAZZ

ALLOYS

$13,000

CARS $4,000 AND UNDER

DUAL FUEL

1995 MAZDA 121 4 DOOR SEDAN, Auto, A/C, Low Kms. NIB-588

ALLOYS

$15,000 $14,000 $13,000 $13,000 $11,000 $10,000 $9,000

CAMPERS

1995 MAZDA E2000 CAMPER, 5Spd, P/S. YJY-455

$8,000 2001 HYUNDAI SONATA CLASSIQUE SEDAN, Auto, A/C, P/S. RCM-898 $7,000 1993 NISSAN MAXIMA SEDAN, V6 Auto, A/C, P/S, Alloys. FAZ-316 1991 FORD CORSAIR SEDAN, 5 Speed, A/C, Mod Kms. EXQ-775 $7,000

1998 TOYOTA COROLLA, Auto, Local, A/C, P/S. OWW-095

2004 HOLDEN ASTRA

SPORTS

COMMERCIALS AND UTES

2003 TOYOTA AVALON CONQUEST, Auto, Local, Mod Kms, A/c, P/S. WBM-789

DRIVEAWAY

$13,000

Airbags, Mod Kms, A/C, DRIVEAWAY P/S. WMH-120

$15,000


New premises, same level of service with experts at BJT

NEW WORKSHOP

Independent

413 Moorabool St, Geelong Ph. 5229 3884 • Locally owned & operated for 28 years

VW &Specialists AUDI A - Factory trained technicians - Factory level diagnostics

Ph: 5222 2555 43 Autumn St, Geelong West www.europeautomotive.com.au

Independent

BMW &

Mini

Specialists

Also specialising in Jaguar & Land Rover

s one of Geelong’s leading automotive servicing and repair workshops, BJT Automotive is a specialist in professional, personalised customer service combined with quality workmanship. Based in Belmont, BJT Automotive has recently moved into a brand new workshop just one shop down and featuring a modern workshop with the latest in diagnostic testing and tuning equipment. BJT’s Brett Turley says the workshop team remains focused on ensuring customers drive away happy every time. “We’re Geelong’s Ford specialist, with the team having extensive experience and knowledge of Ford vehicles, and we also service and repair other vehicle makes and models,” Brett says. “All our work is fully guaranteed and we offer a courtesy car drop off and pick up service to our clients.” New-vehicle warranties are not affected when cars are serviced at BJT Automotive. Brett and his team provide manufacturers’ handbook servicing, air-conditioning servicing and regassing, suspension, brake and clutch repairs, electronic diagnostic and tuning work, EFI servicing and repairs, used-car pre-purchase inspections, fleet management and maintenance and licensed roadworthy testing. BJT Automotive operates 8am to 5.30pm Monday to Friday at 8 Maxwell Avenue, Belmont. For more information phone BJT Automotive on 5244 3337.

1031115-MD17-12 7-12

- Factory trained technicians - Factory level diagnostics

9 Autumn St, Geelong West www.huntercuthill.com.au

Marine Breakwater Marine Trained in Yamaha & Honda outboard servicing & repairs, boat & trailer repairs, fitting of electronics (eg: sounders, GPS & radios, navigation lights). Servicing most brands of motors. 12 Wattlepark Avenue, Moolap Wayne Gibbons, Outboard Technician

Ph: 5248 8480 ABN - 33 723 369 889 1010239-JF41-11

BJT Automotive’s new Belmont premises.

• Custom mixed paint • From aerosol to 20lt

480466-JM15-12

Adam Guglielmi at Body Shop Paint Supplies.

Quality products and expert staff ready at Body Shop Paint store ody Shop Paint Supplies has the ideal way to finish off that automotive, industrial or marine job. Not only does Body Shop Paint Supplies service the trade sector, hobbyists and handymen can also drop in to discuss their projects with the knowledgeable and qualified staff. Owner Adam Guglielmi says the business offers a complete range of paints, tools and equipment. Body Shop Paint Supplies stocks Valspar and DeBeer Automotive Paints, House Of Kolor Custom Paints and LIC Industrial Coatings. Products include cleaners, putties, primers, 2K topcoats, basecoats, clears, auxiliaries, thinners and hardeners. “We can supply most Australian Standard Colours mixed to formulas and have a direct-to-metal application, a very cost affective paint system,” Adam says. “Our staff are all fully qualified painters and tradesman keen to provide a high level of service. “Our knowledge and experience ensures we always give great advice. “We’ve never had customer come back to say it didn’t work because we want to get it right the first time “We want to sell the best products we can find rather than inferior quality that lets you down. “We can sort out the bloke off the street with everything he needs, from fixing the bumper or a scratch on the paintwork to building a street hot rod, we’ve got them covered.” Body Shop Paint Supplies also offers free deliveries for trade customers. For more information about any of the products we distribute please email sales@bodyshopgeelong.com.au or phone 5229 1928.

B

C

A

R

B

O

N

N E W H Y B R I D N A N O T E C H N O L O G Y 472876-VH14-11

1027869-JL13-12

100788-VH37-11

9 Gordon Ave, Geelong West P. 5221 8877

European Vehicle Service Specialists

AUDI – MERCEDES VW – BMW

5224 1 1225 225 34 Autumn St, G’West europeanaffair.com.au

FORD OWNERS For servicing and repairs with manufacturer’s warranty not affected see Geelong’s Ford Specialist.

30AA301476

1003782-KC29-11

8 Maxwell Ave, Belmont 472880-RMB15-11

PARKING

BALLIANG ST

5244 3337

UNITED TOOLS PARKING

“The dealer alternative”

SWANSTON ST

FYANS ST

T J B

• Automotive • Industrial • Marine We can help with your next project!

WE ARE HERE

5/131 Fyans St, Geelong South PH: 5229 1928 Email: sales@bodyshopgeelong.com.au 1031523-JF17-12

The Independent, Friday April 27, 2012

47


Deadline: 5pm Tuesdays Photo Deadline: 4pm Tuesdays

TRAILERS, largest range, best prices, 1/56 Sun Street, Geelong. Phone 5248 6070. bigtrailerwarehouse.com.au

BOATS & MARINE TRAVELLER, poptop, 2005, 15.6’ x 7’, 2 single beds, annexe, 120L fridge, AC, many extras, as brand new. $18,500. 0411 440 255. Bell Park. CARAVANS WANTED, anything considered. Phone 5248 6070.

WINDSOR, 16ft poptop, December 2000, single beds, AC, rollout awning, centre kitchen, L shape lounge, microwave, $18,500neg. 5244-4368.

CARAVANS & TRAILERS CAMPER TRAILER, 4yo, registered, annexe, all extras included, microwave, cooker, tables. $3,600. 0466 998 406. Grovedale.

VISCOUNT, Vetra, lite, poptop, 14.6’, 2 single beds, annexe and cover, always garaged, many extras. $4,000. 0428 401 821. Newtown.

HOLDEN, Commodore, 2004, 73,000kms, reg. 03/13, air bags, cruise, alloys, many extras, as new. SRL-626. $11,700 ono. 5255-4368, 52504142. Ocean Grove.

HOLDEN, Commodore, VY, 2003, tray ute with sides and roll bar, auto, 6 cylinder with factory fitted gas, 153,000kms, RWC. WOE-787. $8,900ono. 0431 341 502.

MOTOR VEHICLES

JEEP, Grand Cherokee, Larado, no off road, low miles, EC, STL-939, must see. $11,000. 0407 438 623. Waurn Ponds.

NISSAN, Dualis, 2008, 45,000km, white, ST, 2wd, 12 month reg, EC, WUZ525, $17,000. 0408 754 843 or 5275-4842. Corio.

HYUNDAI, Tucson Elite, 2006, auto, V6, AWD, service history, immaculate, black, RWC, TZI-596. $15,700. 0417 354 299.

MOTORCYCLES

SUZUKI, GSX 1100, 1982, 12 months reg., GC, XN-775. $4,000ono. 0425 747 823. Ocean Grove. SUBARU, Outback, 2005, MY06 premium pack, 114,000kms, reg 11/12, RWC, 5 speed auto, champagne, 6 cylinder boxer engine, tinted windows, towbar, near new tyres, XSR-486. $18,000. 0418 386 796.

HOLDEN, Commodore, VY, Acclaim, 145,000kms, side airbags, reg. until 12/12, EC, RWC, TXI-977. $6,900. 0408 039 836. Geelong.

TOYOTA, Camry, Altise, gold, sedan, books. 52,600kms, reg. 03/13. bluetooth, EC, WIM-251. $15,740. LMCT 7532. Phone 0418 520 360. 5251-2082.

MOTORCYCLES MAZDA, 2, 2007, auto, AC, PS, EC, tinted windows, 70,000kms, service history, UXK-977. $11,900ono. 0409 175 344. Belmont.

YAMAHA, YZFR1, 2001, blue, RWC, 10 months reg., receipts, VGC, very quick bike. AN-773. 0406 250 657. $6,000. Waurn Ponds.

TRIUMPH, 2010 Sprint, ST1050, phantom, black, as new, only 2,100kms, IAIAX. $13,000ono. 0408 299 286.

AA FREE CAR REMOVAL Prompt, friendly service. 5248-1122, all hours. Portside Auto Wreckers. All makes and models. Open 6 days a week.

The Independent reaches... TEESDALE

la nd

BANNOCKBURN

LARA Pr

Hw y

HIGHTON

MOTOR VEHICLES

BELMONT ces Hwy Prin

FRESHWATER CREEK

REGAL, poptop, 1998, 14.5ft, rollout awning, many extras. $11,500. 0430 482 302. View at Torquay, or visit modart.com.au/for-sale.

STATESMAN, Poptop, 1988, 13ft, full annexe, 3 berth, full oven, 3 way fridge, microwave, electric brakes, storage boxes, new tyres, spare, extra’s. $7,000. 0418 517 722. Lara. TRAILER, 6’x4’, with new 8’x8’ tent, all new camping gear, new 9’ inflatable boat, new electric outboard with new batteries, $2,500. 5282-6162. Lara.

DAEWOO, Lanos, 2001, 3 door, manual, one owner, spoiler, mags, RWC, KR1281. $1,750. 0425 762 719. Belmont. GEMINI, diesel, 1984, mechanically VG, body needs work. FQU-502. $2,000ono. 5248-2997.

FORD, Falcon FG, ex govt. books, 59,600kms, phone kit, mudflaps, reg. 09/12, colour silk, YQS103. $16,400 drive away. LMCT 7532. Phone 0418 520 360. 5251-2082. FORD, Falcon, Futura, EL98, wagon, auto, many extras, reg. until 11/12, VGC, RWC, WAN-892. $5,000. 5275-0752. Corio.

PORTARLINGTON INDENTED HEAD ST LEONARDS

CLIFTON SPRINGS

GEELONG EAST LEOPOLD GEELONG

MORIAC BARWON HEADS

264 Thompsons Road North Geelong

TRAILER, wanted to buy 6x4, any condition. 0417 961 058.

5278 8588

ABC CAR REMOVALS CASH PAID  $50 - $500 

Cars, utes, trucks & vans. 25hrs 8 days/week Ph 0419 002 323 LMCT 10471W

Work

1300 666 808

1300 666 808

JAN JUC DEANS MARSH

ANGLESEA AIREYS INLET

classiÀeds

1300 666 808

Connecting people and communities Complete this form and lodge to First Floor, 78 Moorabool Street, Geelong 3220 by no later than 4pm Tuesdays Name and Address (not for publication) Name:............................................................

GBSC ONLY

Aireys Inlet, Deans Marsh

GEE ONLY

ALL PAPERS

s$RYSDALE #LIFTON3PRINGS 0ORTARLINGTON St Leonards, Ocean Grove, Barwon Heads

15 words

$29.07 ($33.22) ($41.53)

Address: ........................................................ .......................................Post Code:.............. Phone: ........................................................... Mobile: ..........................................................

GEE 20 words

$30.61 ($39.98) ($43.73)

25 words

$32.15 ($36.74) ($45.93)

30 words

$33.69 ($38.50) ($48.13)

s'EELONG %AST'EELONG .orth Geelong, Leopold, Lara, Little River, Moriac, Winchlesea, Bannockburn, Meredith, Teesdale, Inverleigh, Highton, Belmont SEND IN YOUR PHOTO! Photo to appear in Black and White - Free of charge Photo to appear in Colour for an extra $7.00

*This offer is made to private advertisers only. *Offer only available for items normally advertised in the Wheel and Deal section. All advertisements, must be pre-paid. For $29.07 you get a 15 word ONE ITEM ONLY advertisement with a black & white photo. Advertisements are restricted to “Wheel & Deal” items only for private advertisers, run for 6 weeks. Once your item is sold you have to call our office to cancel. *Sale price must be included in the advertisement. Alteration to PRICE ONLY to advertisements will be accepted. Not included in the offer are any business advertisements., rental hire etc., for the purpose of ongoing profit. The publisher reserves the right to decline any booking for the purpose of continuing gain. Regulations require the registration to be included, or if the car is unregistered, the engine number. Minimum 15 words (one item only) *Must include suburb at end of advert.

48

LMCT 1433

TORQUAY

s4ORQUAY *AN*UC -ORIAc, Anglesea,

advertisement to be published in.

Phone: 5222 1606

Top Prices

classiÀeds

GET THE NEXT from only $29.07 &6 WEEKS HALF PRICE

*Please tick which papers you require your

CORIO AUTO WRECKERS CAR REMOVAL

QUEENSCLIFF PT LONSDALE

N YES BELLARINE/SURF COAST GBSC

N YES GEELONG INDEPENDENT

CAR REMOVAL, $100 cash if complete. Prompt pick up, LMCT 7551. Call John 0430 446 730.

DRYSDALE

OCEAN GROVE

ADVERTISE "FOR SIX WEEKS"* in the

CASH FOR CARS & CAMPERVANS

advertise your trade business now!

wy

NORTH GEELONG

INVERLEIGH

WINCHLESEA

H es inc

AAA Mitch’s Car Removals and Towing. Cash paid for complete vehicles, also scrap metal and farm machinery. Phone 0420 671 711. LMCT 10724

Get results...

LITTLE RIVER d Mi

EVERNEW, caravan, 1996, 17’, dual axles, awning, annexe, flooring, oven, microwave, double bed, low mileage, cover. $19,500. 5241-1220. Leopold.

WINDSOR, Statesman, Royal, poptop, 1997, tandem, independent suspension, electric brakes, full annexe, lots more, travels well. $16,000ono. 0419 560 389. Altona Meadows.

WANTED TO BUY

LMCT 4464

WRECKING

MEREDITH

MOTOR HOME, Toyota, 2004, 5 speed, petrol, RWC, fully equipped, very clean, ready to travel. SQX-126. $23,500. 52554396 or 0408 054 783. Geoff. Ocean Grove.

WRECKING

The Independent, Friday April 27, 2012

I would like to pay by: N Cash N Cheque Visa* N Bankcard* N Mastercard*

N

My credit card number is:

NNNNNNNNNNNNNNNN *Credit Card handling fee of 1.5% applies Expiry date:NN/NN Signature:.................................................... Cash Paid: .................................................. Receipt: ...................... Paid at:....................

SELL YOUR CAR - GEELONG

STACER, aluminium, 3.8, Sea Sprite, inflatable pontoons fitted, floor, SS fuel tanks, captain’s chair, upholstered seats, reg. until 09/12, all safety equipment, 20HP Honda, electric start, trim, tilt, 16 hours, serviced, extendable drawbar. $6,000ono. 0419 198 191. Portarlington.

HOLDEN, Commodore, 1998, VT, Calaise, sedan, 3.8lt, Equipe, 4 speed auto, full service history, full electrics, EC, RWC and reg. supplied. PAE228, $6,250ono. 0432 469 353. Lara.

MOTOR VEHICLES

C753966-MD1-10

PET DIVIDER, for Falcon station wagon, GC. $250. 5298-1405. Hamlyn Heights. WALKOFF FRONT, Holden, Premier, suit HJ to HZ. $450. 0407 560 410. St Albans Park.

MOTOR VEHICLES

C753959-MD1-10

CARAVANS & TRAILERS

C826949-KK31-10

AUTO PARTS /ACCESSORIES


90,649 Newspapers• 145,038 Readers•• DEADLINE: 5PM MONDAY PHONE: 1300 666 808

Steve Pyle Antennas • Locally made digital antennas • Amplifiers • Digital set top boxes • TV, phone and data points • Latest digital test equipment • Home theatre systems • Free Quotes • 5 year guarantee

Free quotes 0449 181 975

C684939-BG2-9

Bricklayers

Tony 0417 350 435

Builders

FREE SHOP AT HOME SERVICE Expert laying of new and used carpet, restretching and repairs Carpet Cleaning Flood Restoration NO JOB TOO SMALL

Kim braiser 5254 2857 Mobile 0418 376 820

Cleaning Services

C780394-JL15-10

Pergolas, Extensions, Renovations, New Homes, Carports & More Competitive Prices

Please call Mark on 0438 525 962

Michael Kragh Builder/Carpenter 30 years’ experience

5278 6017 0400 559 677 C1023935-PJ17-12

NEW CARPET DIRECT FROM LAYER C966759-KK38-11

Bricklaying - Paving Maintenance & Repairs

T495375SG4906

Carpet Laying

Masonry & Green

DB/U 9844 HIA MEMBER

C851530-JL41-10

DBL 14390 C1024199-KG17-12

BARWON

C685021-SJ2-9

AFFORDABLE FENCING BY BASIC FENCING

0409 705 598 ASK FOR JOHN.

Concreting Concreting EZY

Specialising in • Paling • Colorbond • Merbau Free Quote with the right price advice

Call Charlie 0413 580 990 or 5255 5749

For all types of Fencing in the Geelong and Bellarine Peninsula area.

➤ Palings ➤ Pickets

➤ Gates ➤ Colorbond

All manufactured locally

➤ Powdercoated ➤ Balustrades Competitive Rates

Call for a free quote on 5253 1750, 0412 545 183, 0411 272 080

Driveways, Paths, Slabs, Carparks, Exposed, Coloured & Stencilled.

Sal 0410 272 917

TIMBER PALING FENCES

ezyconc@hotmail.com

• Picket Fences • Small Jobs & Repairs dzfencing@bigpond.com

N& J Concreting • Driveways • Crossovers • Paths Complete Domestic, Commercial (Business & School) Cleaning & Garden maintenance Services • Office Cleaning • Builders Cleans • Carpet Cleaning • High Pressure Cleaning • Window Cleaning • Rental property cleans (including end of lease & settlement cleans) • General house cleaning to complete house detail • Lawn Mowing, Edging, Weeding, Pruning, Hedging, Rubbish Removal, Grass Slashing Competitive rates with a quality guarantee Phone to arrange an obligation free quote Clearwater Property Care 145-147 Victoria Street NORTH GEELONG Email: clearwater@pathways.org.au www.clearwaterservices.org.au Ph: 5272 3123 1019417-PJ14-12

FENCING

Phone: 5255 4366 Fax: 5255 4388 Mobile: 0408 547 129

SPECIALISING IN: • Exposed • Footpath • Faux Brick • Crossovers • Colour • Layback • Plain • Curb PHONE FOR FREE QUOTE

FREE S QUOTE

RESIDENTIAL

Servicing Geelong, the Surf Coast & Bellarine Peninsula Quality workmanship Call Grant Finlayson

C780320-JL15-10

CALL

(REC 17122)

Fencing & Gates

C1013128-JL10-12

l y US NOW! n o s B a t h r o o m 0401 517 954

Carpets, Curtains, Lounge Suites Free deodorising. Quick dry method.

GEELONG 60 Little Ryrie St. Geelong 3220 03 5222 3058

Call Paul 0438 882 338

C780426-JL15-10

DRIVEWAYS ONLY C782916-SJ16-10

Tired of your outdated bathroom?

MELBOURNE Melbourne City Victoria 3000 1300 669 786

Domestic Electrical Specialist

• New homes • Extensions • Re-wires • Free Quotes • All types of maintenance & repairs • No Job too small

• Garage Floors • Extensions • House Slabs Specialising in exposed aggregate and colour concrete.

Prompt Service. No job too small

Nick 0403 496 007, Joe 0402 015 506

C958685-JL34-11

685014-JM2-9

the best COSTS LESS than you think

NEW WAVE ELECTRICS

Concrete Services

Andy’s Carpet Steam Clean

Bathroom & Kitchens

Want a FREE quote?

Rec No. 16943

0409 064 963

Carpet Cleaning

www.outsideconcepts.com.au

0404 022 952

reet Ryrie St 60 Little 3220 Geelong

Training is provided with Victorian & Commonwealth Government Funding. Conditions Apply © Investment Banking Institute Pty Ltd (ABN 45126400 824) RTO #22047, 2008 - 2012 All rights reserved.

1800 427193 C927182-JL20-11

All types of electrical work. No job too small. Free Quotes. Pensioner Discounts.

WEDNE Y 2ND MA 4:30 PM

Text your name & email address

tCarports tPergolas tVerandahstDecks tPatiostCafe Blinds tFixed price guarantee tYour satisfaction assured

GROVE ELECTRICAL

Government Funding available www.bookkeepingeducation.com.au

C684914-JM2-9

Ph KPS on 5221 1030

to use anyone but the best.

Electricians

IBIA002.5.3 - GI

For all types of asbestos products Type A & B. Prompt Service FREE QUOTES

0418 338 720

Improve your life Improve your lifestyle

FREE N SIO INFO SESSDAY

5222 3058 OR

APPROVED REMOVALISTS

Using Lysaght Colorbond Structural Beams or Timber Framework • Garages • Carports • Pergolas • Decking Ph/Fax 5255 5535

Life’s too short...

EASY FIX FOR YOUR BUSINESS

ASBESTOS REMOVALS AND CONSULTANTS

Outdoor living and Entertainment Areas

1300 666 808

RSVP YOUR PLACE TODAY!

ac A s b e s t o s C l e a r A w a y a Specialist in all types of Domestic and ac Commercial Asbestos removal a FREE QUOTES ac 5282 5099 / 0419 886 018 a

BUILDING & DEVELOPMENTS

Place your advert now...

Best Rates Guaranteed

Asbestos Removal

5253 2490

0423 427 764

• Home Renovations • Verandahs • Decks • Carports • Factory Fitouts • Office Fitouts • Shop Fitouts For free quotes call 0412 652 353 Email: gpvcarpentry@hotmail.com

Gimme Shelter

Di Pasquale Concreting ✔ All types of paving ✔ House Slabs and commercial work

Carpenters

If quality counts...  0425 873 021

C684934-JM2-9

1018079-KG13-12

BOOKKEEPING FOR TRADIES

www.jimsantennas.com.au

Ph: 0409 418 070 C974363-JL41-11

Quality Work Guaranteed

Carlo 0417 145 126

Decks Pergolas Screens LIVING SOLUTIONS Benches CALL DAVID AND ENJOY YOUR OUTDOOR LIVING! Fences

Decked ! Out

C753879-MD1-10

131 546

• All types • Domestic and Commercial • Prompt Service • Free quotes

C1023667-PJ17-12

JIMA002SNVICr

C945514-JL28-11

Same Day Response Local Technicians All 100% Guaranteed Home Theatre Installations FREE on-site Signal Test and Quote Government Endorsed Installers

Decks/Pergolas

Carlocal

G.P.V. Carpentry

DIGITAL TV SPECIALISTS

Ph: 0417 005 081

Friendly Service

C83328 C833280-JL33-10

CONCRETING

BELLARINE CARAVANS 5274 9670

• Sheds • Exposed Aggregate • Colour • Garages • Driveways • Paths • Crossovers • Quality Workmanship

ANY TYPE OF CONCRETING PHONE BRAD: 0412 623 683 | 5298 1366 bkgconcreting@hotmail.com | fax: 5298 1366

290A PRINCES HIGHWAY CORIO

Rob 0439 785 703      

Coloured • Plain • Exposed • Patterned • Spray On • Factories • Sheds

Domestic & Commercial Geelong Owned/Operated

C684994-SJ2-9

>Digital Reception >Free Quotes - Servicing all Areas > All work guaranteed >Satellite Installation >Wi fi Networks > Difficult Reception Areas >Home Theatre Systems >Telescopic Masting 20-50ft

• Re-seals • Re-clad NOW OPEN • All manner of insurance work 7 DAYS • Repair or replacement awnings • Comprehensive servicing FULLY • Water damage repair MOBILE • Window replacement • No job too big or too small We come to you or bring your caravan into our huge 1,000 sq mtr total care centre

PHILLIPSC O N C R E T E constructions pty ltd

Place your advert now... 1300 666 808

CALL DANIEL 0403 663 816

TOM’S FENCING C1023864-PJ17-12

C873328-JM48-10

C777654-JL14-10

0418 593 220

•FREE QUOTES & ADVICE •EXTRA POINTS •AMPLIFIERS (BOOSTERS) •DIGITAL ANTENNAS •LATEST DIGITAL TEST EQUIPMENT

BKG CONCRETING

C753870-SJ1-10 C684987-BG2-9

C740541-SJ45-9

Antennas

Concrete Services

C684982-BG2-9

BELLARINE CARAVANS TOTAL CARE CENTRE

Specialising in the sale and installation of • Hydronic heating • Unit changeovers • Evaporative Cooling • Split systems • Gas ducted heating • Nobo panels Please telephone or visit our new showroom for a no obligation free in home appraisal. Suite4, Level 1, 186-192 Latrobe Tce, Geelong 5224 2911

Ph: Ron

Concrete Services

269651-TJ45-4 C269651-KK26-8 C753886-MD1-10

Caravan Repairs

C749601-JL50-9

Air Conditioning

CAB Aug Net Distribution: Mar 11 - Sept 11 ••Publisher’s estimate

1017505-PJ14-12

Specialising in: I Paling I Picket I Merbau I Gates made to order I Demolition & Removal

0424 386 398

The Independent, Friday April 27, 2012

49


90,649 Newspapers• 145,038 Readers•• DEADLINE: 5PM MONDAY PHONE: 1300 666 808

Handymen c943541-kk28-11

Fencing & Gates

Skilled, courteous, trustworthy tradesmen trustworhy tradesmen

www.greyarmy.com.au

Ph/Fax 5250 4646 C780239-SJ15-10

GKM HOME MAINTENANCE • Gutters Cleared • Rubbish Removed

0419 894 442

or 5241 4889 AH

C685022-SJ2-9

• Painting • Bathroom Renovations • Pergolas

Good Old Fashion Home Maintenance Ph John 0408 194 926 / 5251 1448

• Paving • Retaining Walls • Decks • Pegolas • Turf • Garden Beds • Fences Prompt & Reliable Servince No job too small! Call Richard 0430 119 747

50

• Extensions • Renovations • Patch Ups

• No Job Too Small • Pensioner Discounts C685061-BG2-9

MENSFORTH PLASTERING

CRAIG 0439 811 867

The Independent, Friday April 27, 2012

EVERLASTING ROOFS 3 3 3 3 3

RELIABLE ROOFING

Qualified Roof Tiler Cement and Terracotta Restorations Re-bedding and Pointing De-mossing and High-pressure Cleaning All Roof Repairs

CALL CHRIS FOR YOUR FREE QUOTE!

0413 754 117

t Cement & terracotta restorations t Cleaning, pointing & rebedding t Re-coating t Moss removal treatment

Plumbing

t All roof repairs t Guttering & insurance quotes t 10 year guarantee t Free quotes

www.lookatthisroof.com.au

1 8 42 1 1 50205 00 0474 6

Ben Costin Plumbing & Gas

0412 594 991

C956280-KK34-11

FIRST LANDSCAPES • Paving • Retaining Walls • Stone Work • Garden Beds • Mulching • Turf

NO JOB TOO SMALL

• All general plumbing, drain blockages, burst pipes & hot water changeovers • Gas fitting, appliance installs, service & repairs • Air Conditioning installations • 24 hour emergency service

Ph: 0434 151 950 Lic 52353

LJ’S ROOFING

GARDEN REJUVENATIONS AND PRE SALE CLEAN UPS PAVING TURF LAYING ROCK WORK

Ph: 5229 2517

Decks, Feature Fences, Screens and Pergolas No job too small

Simon 0418 329 765

C1018674-PJ13-12

ALL TYPES OF CONCRETING Exposed AGG or Plain

• Repairs

QUOTES • Rebedding Recolouring Colorbond Roofs Competitive Prices. Pensioner Discounts • Repointing

☎ John 0417 505 234 - 5277 9248

Over 20 years’ experience Qualified Roof Tiler

brownplumbingservices Specialising in: New homes / Renovations Drainage / Stormwater Hot & cold water services Roofing and spouting Tanks & grey water systems

Leaking taps & toilets Blocked drains Burst water pipes Solar hot water installation

Phone 0418 352 657 Geelong & Drysdale Lic no. 45447

RETAINING WALLS GARDEN DESIGN

Mob: 0417 314 987

TILED OR TIN ROOFS CLEANED, FREE SEALED & PAINTED

RSN ROOFING

Phone Ian on 0434 092 517

DECKING

Roofing

• New Homes • Renovations • Extensions

PONDS PLUMBING & GASFITTING SPOUTING & DOWNPIPES REPLACED

C981421-JJ45-11

Tom 0423 149 508

Plastering

Phone Dave 0415 507 113 AH: 5243 5810

HANDYMAN Any job around the home, quality work. Prompt service. Competitive pricing

C1020997-KK16-12

C753934-SJ1-10 C685053-JM2-9

DB

CERTIFICATE IN LANDSCAPING C847650-KK39-10

Carpentry, tiling, painting and more. Affordable Prices.

27 years’ Experience Lic No. 28746 & D4038

PH

ALL AREAS & FULLY INSURED • CREDIT CARD FACILITIES • FREE QUOTES

Greg Meehan

• Vulcan •AquaMax • Rheem • Pyrox • Rinnai

• Landscaping & Garden Creations • Retaining Walls • Decking • Paving • Feature Screens • Brick & Garden Edging

• rental property repairs & maintenance • carpentry • tiling • pergolas • kitchen & bathroom renovations • locks/doors• plastering • painting • concreting • rubbish removal

• Carpentry • Kitchens • Tiling

Trained Technician • Bonaire • Celair • Brivis • Braemar

C765942-JL9-10

HOME MAINTENANCE

C1019414-PJ14-12

Service • Repairs • Seasonal Maintenance • Manufacturer

C913570-JL14-11

PETER

0425 729 603

Email: plumber@pipeline.com.au

Reblocking/Underpinning

DOM DIMASI LANDSCAPES

Handymen

Ph: Steve Kelly 5241 3141, 0408 525 181 or Bill (son) 0421 823 801

Plasterers

C1023764-PJ17-12

C941480-JM26-11

0405 117 313

Gateway

Start 10%Immediate OFF ALL JOBS

C988774-JL48-11

ODD JOBS

• Have your gas heating tested for carbon monoxide leakage • Blocked drains cleared • Hot water changeovers • Re-roofs & spouting

seaview Painting Services 0439 858 298

BUDGET LANDSCAPES

ONE-STOP MOWING

Lic 38798

Plumber & Gasfitter

13 11 98

Landscaping

131 546

PENSIONER DISCOUNTS

Mob: 0400 978 956

CALL PETER A.P. GAS SERVICES - 0418 375 605

MORE than just mowing!

RUBBISH REMOVAL

No job too big or too small

C1021925-PJ17-12

Gardening, Rubbish removal, Gutters cleared, landscaping, Expert pruning, Mulching, Ride-on mowing

MOWING

Painting & Plastering

• Lawn Mowing • Cabinet Makers • Rubbish Removal • Pergolas, Decks • Gutter Cleaning • Carpets Layed • Tilers-Pavers • Roof Repairs • Tree Lopping • Window Cleaners • Appliance Repairs

C999447-PJ3-12

138166

C999295-JL3-12

CLEAN UP AROUND THE HOME

www.jimsmowing.net

JLH

AIR CONDITIONING - Evaporative HEATING - Gas HOT WATER - Gas, Electric & Solar

Autumn!

C974081-JL41-11 C685026-JM2-9

Sam 0402 310 506 or 5275 3897

Heating

Ph: 5229 2517

Licence No 37785

❖ FREE quotes all area ❖ Pensioner Discount ❖ Quality Service

C953917-JL32-11

• SPECIALIST HEDGE TRIMMING • GARDEN REJUVENATIONS • PRE SALE CLEAN UPS

One call, all trades

1300 135 495

0408 0408 599 424 599 FREE424 CALL OUT

1012994-KG10-12

C999440-JM3-12

MAINTENANCE

FREE QUOTE

• Handymen • Painters • Gardeners • Electricians • Concreters • Carpenters • Plumbers • Pest Control • Bricklayers • Plasterers

CERTIFIC ATE IN L A N DS C A PING

es c hi s FranNow le il a b Ava

Interior & Exterior

• Hot water service change over • Leaking Taps & Toilets • New homes & Renovations, rainwater tank installations Gasfitting, repairs and service & all general plumbing

☎ David Lafranchi 0408 146 270 Prompt & Reliable Service

C922627-JJ18-11

LIC NO 49068

• Re-roofs & Extensions • Cleaning & De-mossing • Rebedding & Flexible Pointing & Painting • Storm Damage/Callouts • Insurance Work

FREE QUOTES Call Rory 0429 040 121 www.rsnroofing.com.au

C873528-JL48-10

Garden Services

CALL KEVIN 0417 263 624

C685019-SJ2-9

• FLOOR SANDING • POLISHING NEW AND OLD FLOORS • PARQUETRY • TIMBER DECKING • DUSTLESS TECHNOLOGY • SUPPLY & LAY

Mob: 0417 314 987

Highlight Painting

C968205-KK39-11

C753895-MD1-10

TRENNED PTY LTD TRADING AS

FOR ALL YOUR GARDENING NEEDS

Painters/Decorators

• For all those odd jobs around the house • Small Landscaping Jobs • Lawn Mowing • Gardening • Small Paving Jobs • Rubbish Removal

“For excellence in quality and professional service”

Allan: 0401 989 120 Kev: 0413 159 435

KEVIN MURRAY’S QuForetees HANDYMAN SERVICE

Mr. Tap Man • All Types of Maintenance Plumbing • Leaking Taps and Cisterns • Suppliers and fitters of Tapware and Water Filters • Hot water service change over LOCALLY OWNED MARK PODBURY

FREE High Pressure Driveway clean with every roof restoration

Lee’s

Roof

Treatment FREE QUOTES ROOF - PAINTING ROOF RESTORATION

Ph: 5244 4591 or 0418 714 674 LOCALLY OWNED & OPERATED

C753938-MD1-10

5278 4811 0408 662 687 147 100 4811,/ 0438

0405 507 806

925201-KS19-11

Acute Floors

C950126-JL30-11

Floor Services

341 967

C705287-KK17-9

Call David Morris on 5278 2827 or

Contact Dan Field 0402

C684910-JM2-9

email: thefencingpeople@gmail.com

Cutting Edge Garden Design and Construction Truck and Bobcat Hire.

943344-TB27-11

Mob: 0432 085 336 Office: 5248 0005

Lic. No. 42245

All Plumbing and Gas fitting • Sewer Blockages • “For good old fashioned service at affordable rates”

C812153-JL26-10

• Brickwork • Re-pointing • Plastering • Joint and Crack Repairs • Add/Remove Walls • Paving • Painting

Call Lisa for your free quotation on

Floor Sanding & Polishing

Precision Plumbing

30 years’ experience

Paling • Colorbond • Picket • Merbau

Dustless Machines New & Old Floors Free Quotes Quality Guaranteed

Plumbing

David Morris Handyman

C1002795-PJ5-12

The Fencing People

Landscaping

C1020376-KK15-12

For quality fencing and gates call

CAB Aug Net Distribution: Mar 11 - Sept 11 ••Publisher’s estimate

685054-JM2-9 C753933-SJ1-10


90,649 Newspapers• 145,038 Readers•• DEADLINE: 5PM MONDAY PHONE: 1300 666 808

Landscaping

PH

GKM HOME MAINTENANCE

0419 894 442

or 5241 4889 AH

Good Old Fashion Home Maintenance

Mob: 0432 085 336 Office: 5248 0005

Ph John 0408 194 926 / 5251 1448

GARDEN REJUVENATIONS AND PRE SALE CLEAN UPS PAVING TURF LAYING ROCK WORK

David Morris Handyman 30 years’ experience

“For excellence in quality and professional service”

• FLOOR SANDING • POLISHING NEW AND OLD FLOORS • PARQUETRY • TIMBER DECKING • DUSTLESS TECHNOLOGY • SUPPLY & LAY

0405 507 806

C950126-JL30-11

Any job around the home, quality work. Prompt service. Competitive pricing

5278 4811 0408 662 687 147 100 4811,/ 0438 Garden Services

Tom 0423 149 508

C981421-JJ45-11

HANDYMAN

C997453-JM2-12

Elijahs Lawn Mowing

• For all those odd jobs around the house • Small Landscaping Jobs • Lawn Mowing • Gardening • Small Paving Jobs • Rubbish Removal

CALL KEVIN 0417 263 624

Ph: 5229 2517

Autumn! CLEAN UP AROUND THE HOME Gardening, Rubbish removal, Gutters cleared, landscaping, Expert pruning, Mulching, Ride-on mowing

MORE than just mowing!

www.jimsmowing.net

Cutting Edge Garden Design and Construction Truck and Bobcat Hire.

131 546

The Independent, Friday April 27, 2012

www.greyarmy.com.au

One call, all trades

Lic. No. 42245

All Plumbing and Gas fitting • Sewer Blockages • “For good old fashioned service at affordable rates”

341 967

PONDS PLUMBING & GASFITTING SPOUTING & DOWNPIPES REPLACED

☎ David Lafranchi 0408 146 270

Painters/Decorators

Prompt & Reliable Service

Highlight Painting Interior & Exterior

brownplumbingservices

13 11 98

Mob: 0400 978 956

Leaking taps & toilets Blocked drains Burst water pipes Solar hot water installation

Phone 0418 352 657 Geelong & Drysdale Lic no. 45447

Painting & Plastering No job too big or too small

LIC NO 49068

C922627-JJ18-11

Specialising in: New homes / Renovations Drainage / Stormwater Hot & cold water services Roofing and spouting Tanks & grey water systems

943344-TB27-11

C1023913-PJ17-12

• Lawn Mowing • Cabinet Makers • Rubbish Removal • Pergolas, Decks • Gutter Cleaning • Carpets Layed • Tilers-Pavers • Roof Repairs • Tree Lopping • Window Cleaners • Appliance Repairs

Mr. Tap Man • All Types of Maintenance Plumbing • Leaking Taps and Cisterns • Suppliers and fitters of Tapware and Water Filters • Hot water service change over LOCALLY OWNED MARK PODBURY

1300 135 495

0408 0408 599 424 599 FREE424 CALL OUT

seaview Painting Services 0439 858 298 Start 10%Immediate OFF ALL JOBS

Licence No 37785

C974081-JL41-11 C685026-JM2-9

Plasterers

Landscaping

Lic 38798

BUDGET LANDSCAPES • Paving • Retaining Walls • Decks • Pegolas • Turf • Garden Beds • Fences Prompt & Reliable Servince No job too small! Call Richard 0430

Precision Plumbing Contact Dan Field 0402

JLH

Skilled, courteous, trustworthy tradesmen trustworhy tradesmen • Handymen • Painters • Gardeners • Electricians • Concreters • Carpenters • Plumbers • Pest Control • Bricklayers • Plasterers

C1019414-PJ14-12

C812153-JL26-10

Mob: 0417 314 987

C999440-JM3-12

• SPECIALIST HEDGE TRIMMING • GARDEN REJUVENATIONS • PRE SALE CLEAN UPS

138166

Phone 1300 727 262 (local call) GEELONG or 0438 910 502

C685019-SJ2-9

MAINTENANCE

50

Free Quotes

CERTIFIC ATE IN L A N DS C A PING

FOR ALL YOUR GARDENING NEEDS

es c hi s FranNow le il a b Ava

• Property maintenance • Carpentry • Kitchens • Concreting • Plastering • Tiling • Painting • Pergolas • Decks • Domestic and commercial builder

119 747

Reblocking/Underpinning C1023764-PJ17-12

Enjoy a Great Looking Lawn Today

Decks, Feature Fences, Screens and Pergolas No job too small

Sam 0402 310 506 or 5275 3897

1018832-KG14-12

FREE Quote

Email: plumber@pipeline.com.au ALL TYPES OF CONCRETING Exposed AGG or Plain

❖ FREE quotes all area ❖ Pensioner Discount ❖ Quality Service

Quality Lawn Care with a Smile - Mowing - Edging - Weeding & more - Ask about our Pensioner Discount Ph: 0431 799 299

Ph: Steve Kelly 5241 3141, 0408 525 181 or Bill (son) 0421 823 801

C953917-JL32-11

FULLY INSURED

Ph: 0434 151 950 Lic 52353

• Hot water service change over • Leaking Taps & Toilets • New homes & Renovations, rainwater tank installations Gasfitting, repairs and service & all general plumbing

KEVIN MURRAY’S QuForetees HANDYMAN SERVICE

• Lawn Mowing • General Garden Maintenance • Poisoning of weeds • Hard Rubbish Removal (Labour Inclusive) Call today to organise a free no obligation quote. Phone Scott on 0416 450 527 Servicing Corio, Norlane, Bell Park, North and West Geelong

• All general plumbing, drain blockages, burst pipes & hot water changeovers • Gas fitting, appliance installs, service & repairs • Air Conditioning installations • 24 hour emergency service

• Have your gas heating tested for carbon monoxide leakage • Blocked drains cleared • Hot water changeovers • Re-roofs & spouting

Ph: 5229 2517

Simon 0418 329 765

C1020376-KK15-12

Acute Floors

C1002795-PJ5-12

C753895-MD1-10

Call David Morris on 5278 2827 or

Ben Costin Plumbing & Gas

Plumber & Gasfitter

RETAINING WALLS GARDEN DESIGN

Mob: 0417 314 987

• Brickwork • Re-pointing • Plastering • Joint and Crack Repairs • Add/Remove Walls • Paving • Painting

TRENNED PTY LTD TRADING AS

Floor Sanding & Polishing

DECKING

Specialises in: .Renovations .Extensions .New homes

Plumbing

Phone Ian on 0434 092 517

email: thefencingpeople@gmail.com

Floor Services

• Paving • Retaining Walls • Stone Work • Garden Beds • Mulching • Turf

CERTIFICATE IN LANDSCAPING

PAUL’S PLASTERING

C913570-JL14-11

Carpentry, tiling, painting and more. Affordable Prices.

CRAIG 0439 811 867

C705287-KK17-9

Call Lisa for your free quotation on

Paling • Colorbond • Picket • Merbau

• New Homes • Renovations • Extensions

0400 820 158

FIRST LANDSCAPES NO JOB TOO SMALL

MENSFORTH PLASTERING

C753934-SJ1-10 C685053-JM2-9

Greg Meehan

c943541-kk28-11

The Fencing People

• Gutters Cleared • Rubbish Removed

Jeremy 0412 447 404

C999447-PJ3-12

0424 386 398

• Painting • Bathroom Renovations • Pergolas

Creating your perfect space

C1018674-PJ13-12

• Carpentry • Kitchens • Tiling

• retaining walls • paving • turf laying • complete garden makeovers • all aspects of landscaping C1020849-JJ17-12

• rental property repairs & maintenance • carpentry • tiling • pergolas • kitchen & bathroom renovations • locks/doors• plastering • painting • concreting • rubbish removal ALL AREAS & FULLY INSURED • CREDIT CARD FACILITIES • FREE QUOTES

Specialising in: I Paling I Picket I Merbau I Gates made to order I Demolition & Removal

For quality fencing and gates call

Ph/Fax 5250 4646

HOME MAINTENANCE

C780239-SJ15-10

1017505-PJ14-12

TOM’S FENCING

Dustless Machines New & Old Floors Free Quotes Quality Guaranteed

C956280-KK34-11

0425 729 603

Gateway

CALL DANIEL 0403 663 816

Allan: 0401 989 120 Kev: 0413 159 435

0412 594 991

PETER

• Picket Fences • Small Jobs & Repairs dzfencing@bigpond.com

C685061-BG2-9

1011808-KG10-12

0405 117 313

• No Job Too Small • Pensioner Discounts

• Landscaping & Garden Creations • Retaining Walls • Decking • Paving • Feature Screens • Brick & Garden Edging

Handymen

TIMBER PALING FENCES

C1023864-PJ17-12

PENSIONER DISCOUNTS

• Extensions • Renovations • Patch Ups

Phone Dave 0415 507 113 AH: 5243 5810

C1020997-KK16-12

FREE QUOTE

DOM DIMASI LANDSCAPES

C988774-JL48-11

5253 1750, 0412 545 183, 0411 272 080 Call for a free quote on

ODD JOBS

C685022-SJ2-9

All manufactured locally

➤ Powdercoated ➤ Balustrades Competitive Rates

C847650-KK39-10

➤ Gates ➤ Colorbond

269651-TJ45-4 C269651-KK26-8 C753886-MD1-10

➤ Palings ➤ Pickets

RUBBISH REMOVAL

C941480-JM26-11

MOWING

For all types of Fencing in the Geelong and Bellarine Peninsula area.

D B Plastering

685054-JM2-9 C753933-SJ1-10

ONE-STOP MOWING

Plasterers

925201-KS19-11

Garden Services

C684910-JM2-9

Fencing & Gates

CAB Aug Net Distribution: Mar 11 - Sept 11 ••Publisher’s estimate

C765942-JL9-10


Ph: 5249 6700 Deadline: 2pm Wednesdays

MINI BINS

Telephone: 1300 666 808

Servicing all areas 7 days a week. Household rubbish, renovators, builders 2, 3, 4 & 6 METRE BINS AVAILABLE Call to compare our prices

0408 521 806 bobcat also available

RUBBISH REMOVAL

Mail: Include your name, address

Email: Include your name,

0415 801 334

• Domestic Commercial Rubbish • Estate Clean Outs • Pre Sale Clean Ups • Shop Stripouts C820026-JL28-10

FREE QUOTES FREE PICKUP OF WHITEGOODS & SCRAP METAL THE NO FUSS SOLUTION TO RUBBISH REMOVAL

Skylights C753949-MD1-10

See our range of skylights & ventilation systems, visit

Geelong First Floor, 78 Moorabool St and phone number. Geelong Independent, Attn: Classified Advertising, P.O. Box 407, Geelong 3220

Junk -We Load It & Take It Away

Scotsco Skylights

Fax: 5945 0667, 5222 5320 In Person:

address and phone number classies@geelongindependent.com.au

ITS EASY TO PLACE - GELBTHEASY

C753942-MD1-10

(local call) 8.30am-6pm

Real Estate - Wednesday 1pm Trades Directory – Monday 5pm Classifieds – Wednesday 2pm Wheel & Deal – Tuesday 5pm WE ACCEPT PAYMENT BY

1.5% credit card processing fee applies. Cheques and money orders can be posted or hand delivered to our offices.

www.geelongindependent.com.au

experience

0418 524 416

PROFESSIONAL INSTALLATION 213340_VIM

C963277-JM36-11

Harvey Norman stores are operated by independent franchisees. Available only in NSW, VIC, QLD, ACT, SA & WA Metro areas. *1. Tech2Home Pty Limited ACN 105 020 906 is an independently owned and operated entity. Trademarks embodying the words “Harvey Norman” are owned by Harvey Norman Retailing ACN 010 542 524 and used under licence by Tech2Home Pty Limited ACN 105 020 906.

Tiling

Specialising in:

• All Types of Tile Laying • Domestic & Commercial • Quality Workmanship

Servicing: • Geelong, Bellarine Peninsula & Surfcoast

15 Years Experience - Call Andro

0417 677 300

C1019515-PJ14-12

C753948-MD1-10

Tree Lopping/Surgery

PROFESSIONAL TREE SERVICES FULLY INSURED, FREE QUOTES

Tree /Stump Removal, Pruning or Reductions Hedges, Cable Bracing, Root Barriers, Mulching

5243 7442

OTES

QU FREE

Ph:

131 546

www.jimstrees.net

• Tree Removal • Tree Pruning • Stump Grinding • Pensioner Discounts • Fully Insured

835909-KS34-10

Phone

Sell your furniture... 1300 666 808

ADVERTISERS PLEASE NOTE

EMBROIDERY MACHINE, Bernina, new still in box, less than ½ price. $959. 0458 742 313. Norlane.

SCOOTER, mobility, electric, 4 wheel, 40km range, brand new. $2,300. 0402 757 987. Lara.

ENTERTAINMENT UNIT, large with 80cm TV, EC. $250ono. 0419 399 134. Corio.

SECURITY DOOR, new. $120ono. 5278-9167. Bell Park.

FENCING POLE DIGGER, Hoger, very little use. $1,080. 0404 318 614. Bell Park.

FISH TANK, restored 60s TV, all new accessories, pump, light works. $1,300ono. 0408 398 617. Corio.

STAIR LIFT, Acorn, suit 3 steps, or can be adapted, EC, installation available. $900 ono. 5244-2097. Torquay.

FRIDGES, FREEZERS, W/M AND DRYERS

STOVE, gas, Chef Solitaire, 600mm, separate grill, as new. $300. 5257-3665.

GATES, double, steel frame/pickets, 1.75Hx 1.35W, special hinges, suit sloping drive way. $350 5244-1155 or 0407 442 422. Belmont.

CASIO, Classpad, OS and graphics, version 3.0 (suit VCE), with cover. $110ono. 5272-1392. Norlane.

GATES, spear and loop, powder coated aluminium, 2800x1250, with posts. $500ono. 5241-9269, 0430 144 070. Belmont.

ASSORTED, 5 piece black brass bedroom suite (no mattress), white bunk beds, metal (no mattress), 2 cream bedspreads, Sheridan, 3 pendant light fittings. $380 the lot. 0407 579 197. BAR FRIDGE, Cascade, new. $100. 5248-6641. St Albans Park.

BATTERY, Deep Cycle, 12V, 100Ah, gel battery, suit solar, marine and camping use, in carton with 2 year warranty. $398. 0400 238 731. Portarlington. BEANIE KIDS, EC, most with tags, set of 30. $100ono the lot. 0414 633 145. Geelong.

BED, single, iron frame, blue colour, 1900 x 900cm, arched headrest 780cm, new, includes mattress, $120ono. 52242735 or 0416 709 983. Geelong West. BEDROOM SUITE, timber, EC, 4 years old, QS bed, mattress, 2 bedside tables, 2 chest of drawers. $1,250 the lot. 0438 517 087. 0423 354 669. BIKE, brand new, Cyclops, boys/girls, accesories, less than half price, $80. 0434 831 012. Highton.

BIKE, mens’, Principia Ellipse, 55cm frame, campag, equipment, look pedals, other extras, VGC. Cost $2,200, sell $850ono. Phone 5224-2506 after hours. Newtown.

CHAIRS, approximately 35, GC. $525. 0422 875 738. Anglesea. CHAIRS, kitchen, colonial, wooden. $130. 5221-2501. Newtown.

DINING SETTING, pine stained, extension table, 8 chairs, suede upholstery, VGC. $600ono. 0438 782 022. Bell Park. DINING TABLE, extendable, 6 chairs, matching buffet unit, EC. $900ono. 5277-0046, 0413 287 001. Bell Post Hill. DINING TABLE, Travertine, 1950 x 1000, as new. $950. 5259-2625. Port Arlington.

HOUSE BRICKS, $220 for 1000. Phone James 0407 361 047. Norlane.

Solid timber, insulated Colorbond roof. Ex lge suit Shepherd $150 Lge suit big Lab $125 Med $90 Sm $50

WE DELIVER.

5241 3531

D R AW I N G / D R A F T I N G BOARD, timber base, green finish top, includes parallel line. $180. 52583535. Point Lonsdale.

DRESSER, Kauri pine, 2 door, 3 shelves, 120w x 160h, EC. $365. 52592546. Port Arlington.

KARDINIA COLLEGE, pinafores and kilts, GC, $60. 0413 244 428. Hamlyn Heights. LOUNGE SUITE, with matching dining setting, 7ft 6” extending table, Sumna, 6 chairs, EC. $500. 5261-2387. Torquay. LOUNGE, floral, wing back, two chairs, two seater settee. $140. 52212501. Newtown.

MEDICAL EQUIPMENT, electric patient hoist, manual wheelchair, adjustable bed rail, folding loading ramps suitable for wheelchair, $1,400 the lot. 0401 050 287. Grovedale.

TABLE LAMP, (art deco), blue, frilled, glass shade, unusual design. $100. 5251-1818. Clifton Springs.

TABLE, Malaysian hardwood, teak, 180Lx90W, 6 months old, EC, $350. 0414 969 543. Clifton Springs. TENT, 18’x12’, with generator, $190. Phone 52782283 for information.

TILES, 29, graphite 40cm x 40cm floor tiles, 110 white 20cm x 25cm wall tiles. $295 ono. 0408 599 673. Grovedale. TV LG, large, set top box, DVD player, EC, 2 remotes. $205ono. 52785756. North Geelong.

VACUUM CLEANER, Hoover Conquest, with power head an power brush, EC, has had little use. $45. 5256-2425. VACUUM CLEANER, Kirby Sentria, 3 months old, with shampoo, EC. $1,950ono. 0438 382 042.

WATCH, Gents, Tissot, unwanted prize, valued $1,550, sell $700ono. Urgent sale. 0421 025 341. North Geelong. WETSUIT, Rip Curl Steamer, chest zip, size large, 3/2, brand new. Retail $580, sell $375. 0424 065 525. Anglesea.

WIG, ladies, short style, coffee shade with highlights, excellent quality, natural, products provided. $150ono. 5298-1123. Newtown.

MOBILITY SCOOTER, hardly used, battery operated, EC. $2,500. Gary 0418 504 231. Leopold.

ANTIQUES

MOUNTAIN BIKE, ladies, 24 gears, Sedona, hardly used, paid $720, sell $290. 5248-7029, 0425 703 798. St Albans Park.

BEDHEAD, and foot, with irons, double, antique, edwardian, inlaid bow and ribbons in main panels. $350. 5253-2410. Clifton Springs.

OUTDOOR DINING TABLE, hand crafted, professionally built, recycled black butt top with lots of feature, steel frame and legs, 186 x 87cm, $1,850 ono. 5241-9373. Grovedale. PAVING, crazy paving, blue stone, large quantity. $1,500ono. 0434 831 012. Highton.

POOL TABLE, 7’x3’6”, slate, maroon felt, 5 cues, pool balls, snooker balls, cue rack access, VGC. $900ono. 0417 899 914.

DRESSING TABLE, and sideboard, 1950/60s era, EC. $100 each ono. 0414 633 145. Geelong.

SURFBOARD, NSP, Surf Betty, 6’10’’, pink, VGC, carry bag. $420. 0433 364 680. Leopold.

TV, Voxson, HD, 22’’, DVD, and tuner, new in box, $290. 5224-2735 or 0416 709 983. Geelong West.

DOG KENNELS – ALL SIZES

BIKE, mens, Raleigh, 18 speed, 51.5cm, frame as new, EC. $250. 52825456. Lara.

CARPET RUNNER, (8m), matching rug (2mx3m), EC, attractive. $400. 52419269, 0430 144 070. Belmont.

GEELONG COLLEGE UNIFORM, complete including blazer, kilt, jumpers, dresses etc. Sizes range from 8 to 14, most items under 2 months old, $295. 0411 595 826.

CHICKEN COOP, Portable with 2 layers, suit back lawn. $350. 0429 637 543. Belmont.

COLORBOND ROOFING/ FENCING, 1.8m (6ft) $9.50 each, zinc and gal $8.50 each. 0421 523 490. Norlane.

SIDEBOARD, modern, dark timber, 4 yo, 1.5 M, EC, $800. 5243-4781. Highton.

SPINDLE SHAPING machine, 3 phase, with large range of cutters, retired cabinet maker. $5,000. 0422 058 120. Torquay.

CARPET, bold Axminster, best quality wool. 3 large rooms 3350cm x 4170cm, 5270cm x 3460cm, 4220 cm x 3220cm. All EC plus 2 free runners. $1,500. 0422 571 215. Torquay.

BAR FRIDGE, Westinghouse, 115 litre, SS, less than 2yo, reversible door, EC. $150 ono. 5251-5414. Clifton Springs.

Grovedale Tilers

Are You Having a Garage Sale?

ANY ITEM UNDER $50 can be placed for free as a Bargain Basement. See coupon, conditons and details on our website at www.geelongindependent.com.au

OF ALL HOME ENTERTAINMENT PRODUCTS • Fixed price jobs • Delivery and Installation • In-home demonstration • Removal of packaging • 12 month on-site warranty • Digital Antenna Installations

POOL/DINING TABLE, slate with 6 high back chairs plus accessories. $1,200ono. 0448 346 997.

FOR SALE

ASSORTED FURNITURE, Children`s bed, mattress, dressing table with mirror, bedside table and desk. All purple. GC. $1,800 ono. 0422 875 738. Geelong.

*1

DUCK PUNT, 16’ long, fibreglass over wood, GC. $150ono. 5281-2338, 0448 334 360. Bannockburn.

FOR SALE

AIR CONDITIONER, portable, Dimplex, under warranty, as new. $800. 5242-8338. St Albans Park.

Television/Video/Audio

PETS

Sales and service. Cheapest and best in town. Cool Cats Refrigeration. 18 Gordon Avenue, Geelong West. 5229-6246.

C962008-JL35-11

C753947-MD1-10

SKYLIGHTS

20 years’

GARAGE SALES

Deadlines

www.scotscoskylights.com.au Call Adrian on 0409 823 177 or 5261 7515

FOR SALE

POOL TABLE, 8’ x 4’, slate, EC, accessories included. $1,300. 0404 035 289. Geelong.

LOUNGE SUITE, 3 piece, Jacobean, carved, 1940’s. $1,000 ono. 5253-2786. Clifton Springs area.

TABLE, round cedar, Victorian, centre column. 120cm - 4ft, seats 6-8, VGC. $600. 5243-7517. Highton.

BABY GOODS

GRAB A GARAGE SALE SIGN PACK NOW FOR ONLY $9.00!

New rules apply to the advertising of dogs and cats for sale. It is now an offence to advertise the sale of a dog or cat unless the microchip identification number of the animal is included in the advertisement or notice. A registered domestic animal business may use its Council business registration number as an alternative.

The pack includes 4 x waterproof signs, a marker and tips to make your sale a success! Available at our Geelong Office. 1st Floor, 78 Moorabool Street.

For further information, call 136 186 or visit www.dpi.vic.gov.au/pets

WANTED FREE DISPOSAL of unused white goods, hot water services, scrap iron. Call Allan 0400 629 830.

GARDENING WANTED TO BUY

SYNTHETIC GRASS, off cuts, $25 per square metre. 0417 225 624.

TREES CUT, and pruned, lawns mowed. 5278-2320, 0431 152 031.

$$$ ATTENTION $$$ Working or not, fridges, freezers, washers, dryers. Not too old. Cash Paid. 5229-6246.

HOME SERVICES

BRIDAL & DEB WEAR

$60 CARPET CLEAN 3 rooms and hall. Phone Tony 0423 473 595.

MASSAGE THERAPISTS SWEDISH RELAXATION THERAPY, Werribee, 7 days. 10am-8.00pm. Cost $40p/h. Call 0425 805 090.

MUSIC PIANO, GC. $490. 0422 408 410. Geelong West.

PET ACCESSORIES /SERVICES FISH TANK, high quality, EC, 61cmH x 121cmW, includes blue and white lights, pump, filters. $900. 0425 822 613. Lara. FISH TANK, with stand/light, 4ft, extra thick glass. $280ono. 0400 419 015. Belmont.

BRIDAL GOWN, Essence, satin, ivory, size 8 (fit size 6 to 8), height 5' 3", bust 36", waist 25", hips 36", lace up back, extensive beading right hip, beaded detachable straps, worn once, includes gown bag, paid $280 to have professionally dry cleaned (certificate supplied), less than 2 years old. Must see. Paid $2,200. Sell $1000. Rebekah 0408 052 485, Berwick. WEDDING DRESS, size 12, long sleeves, pearl beadings, A line, train, exquisite design. $400 ono. 0418 502 068. Lara.

WEDDING DRESS, Wendy Makin designer, size 14-16, white silk, small train, lace beaded bodice top. $1,500ono. 0400 309 043. Geelong.

COMPUTER REPAIRS

Computer Repairs Repairs to both Laptop and Desktop systems. Data recovery and backup. Virus and Spyware removal.

We will fix it or it’s free! www.pcdi.com.au

C1001781-KK4-12

78 Mercer Street, Geelong

COMPUTER TUITION FIFTY-PLUS a speciality. Call Gillian 5244-5182 or 0427 003 422.

COMPUTERS

Aqua Computers ■ ■ ■ ■ ■ ■

1300 666 808

Sales Upgrades Onsite & Workshop Service & Repairs Networking Internet ph: 5229 1357 273a Myers St, East Geelong

C684493-JL2-9

BRETT’S

FOR SALE

Check out our

ASSORTED, cot, mattress, jogger pram, bassinet, bed rail, EC. $400. 0409 941 648. Belmont.

Trades and Services pages for more computer related adverts. The Independent, Friday April 27, 2012

C1020731-KK15-12

It's easy to place a classified advertisement in the

C993241-JM50-11

Rubbish Removal

1021249-PJ16-12

DEADLINE: 5PM MONDAY PHONE: 1300 666 808

51


Deadline: 2pm Wednesdays SITUATIONS VACANT

WANTED C1022954-KK17-12

Position Description available from www.grampianscommunityhealth.org.au Phone 5358 7400 or email gch@grampianscommunityhealth.org.au For further details contact Corrina Graham

• REGULAR, REPLACEMENT & RELIEF WORK AVAILABLE • GREAT EXERCISE • SUIT RETIRED, OR STAY AT HOME PARENT • ALL AGES WELCOME

Applications close 4th May 2012

If you are interested, please call

1300 558 348 EMAIL: fermax@fermax.com.au

WORK AT HOME

Catalogue Distributors & Collectors required.

All areas. Multi-national company requires 10 people to be trained as supervisors. OTE $1,000 per week, part time. For more information phone 0429 936 589.

PLANT OPERATORS

WALKERS

An understanding of the needs of homeless people and people experiencing Family Violence is essential. For consideration, applicants must specifically address the Key Selection Criteria. Previous applicants need not apply

SITUATIONS VACANT

Earth moving casual positions. Must hold appropriate licence and CIC. Transport and PPE required.

Call weekdays,

1300 904 477

CASH FOR YOU! Drop and collect the successful Homecare Shopping Catalogues and deliver orders. Geelong suburbs, North and South. Car and Phone essential.

Earn $100–$300 weekly for 8–14 hours. Supervisor opportunities. No outlay.

For information on all City of Greater Geelong Public Notices, see page 9 of today's paper.

TEL 1300 133 362

RESUMES /EMPLOYMENT SERVICES

SACKED?

0414 927 010

Just Relations Unfair Dismissal No Win - No Fee

9650 0735 www.justrelations.com C753770-SJ1-10

EXPERIENCED KNIFEHANDS CRF (Colac Otway) P/L, a world-class meat processing facility in Colac, Victoria has vacancies for experienced knife hands. CRF is an Industry leader employing 400 staff with a clear vision of achieving best practice. The successful candidates will be motivated self starters who have a positive and dedicated work ethic, along with previous experience as a knife hand in the meat processing industry. The hours of work are flexible with a minimum of 4 hours on each shift. Successful candidates will commence on a Level 2 wage. Opportunity for advancement after commencement will be subject to ongoing skill based assessments. If you are an enthusiastic, reliable person who is a team player and is willing to learn new skills, please apply by email, resume to jbird@crfco.com.au or filling out an application form, highlighting your knife hand skills, at: CQ RECRUITMENT, 111-113 Bromfield Street, Colac VIC 3250 Phone: 03 5232 2501 Applications also available online at: C1023661-KG17-12

C1023660-KG17-12

Audited Circulation 90,649 (Sep. 2011) Geelong’s largest circulating newspaper distributed in Geelong, the Bellarine Peninsula and the Surf Coast.

Get Results 1300 666 808

All advertising and editorial content of this issue is the copyright of Geelong Independent P/L and cannot be reproduced without the company’s permission. Terms and Conditions of Competitions and the Privacy statement are available at www.starnewsgroup.com.au

Complete this form and lodge to First Floor, 78 Moorabool St, Geelong 3220 No later then 2pm Wednesdays Name and Address (not for publication) Name:............................................................

GBSC ONLY

Aireys Inlet, Deans Marsh

GEE ONLY

ALL PAPERS

s$RYSDALE #LIFTON3PRINGS 0ORTARLINGTON

Address: ........................................................ .......................................Post Code:.............. Phone: ...........................................................

St Leonards, Ocean Grove, Barwon Heads

15 words

$27.10 ($30.98) ($38.72)

20 words

$28.64 ($32.74) ($40.92)

I would like to pay by: N Cash N Cheque N Visa* N Bankcard* N Mastercard*

25 words

$30.98 ($34.50) ($43.12)

My credit card number is:

30 words

$31.72 ($36.26) ($45.32)

GEE

s'EELONG %AST'EELONG .orth Geelong, Leopold, Lara, Little River, Moriac, Winchlesea, Bannockburn, Meredith, Teesdale, Inverleigh, Highton, Belmont SEND IN YOUR PHOTO! Photo to appear in Black and White - $11.00 Photo to appear in Colour for an extra $16.00

*This offer is made to private advertisers only. *Offer only available for items normally advertised in the For Sale section. All advertisements, must be pre-paid. For $27.10 you get a 15 word ONE ITEM ONLY advertisement. Advertisements are restricted to “For Sale” items only for private advertisers, run 'until sold' for a maximum of 3 months. You MUST call us after your advertisement has run for 4 weeks to renew for a further 4 weeks and then again to renew for the last 4 weeks. If we do not hear from you we will assume you have sold your item and your advertisement will not appear, *Sale price must be included in the advertisement. Alteration to PRICE ONLY to advertisements will be accepted. Not included in the offer are any business advertisements., rental hire etc., for the purpose of ongoing profit. The publisher reserves the right to decline any booking for the purpose of continuing gain. Minimum 15 words (one item only) *Must include suburb at end of advert.

52

Email: advertising@geelongindependent.com.au Managing Editor: Tony Galpin Sales Manager: Bernard Perry Production Manager: Chris Beale Managing Director: Paul Thomas

Connecting people and communities

s4ORQUAY *AN*UC -ORIAc, Anglesea,

advertisement to be published in.

Published by: Star News Group. Print Post 31027900004

1300 666 808

from only $27.10

*Please tick which papers you require your

P.O. Box 407, Geelong 3220 Ph: 5249 6700 Fax: 5249 6799

A regular advert in our trades section can bring you regular, ongoing work! Book now...

N YES BELLARINE/SURF COAST GBSC

N YES GEELONG INDEPENDENT

QUIT CIGARETTES, in 60 minutes, with a lifetime guarantee. In Geelong every Tuesday. Phone Joy 5342-4617 or 0400 573 369.

Reg. Office - 78 Moorabool St., Geelong 3220

We can help grow your business...

ADVERTISE "UNTIL IT'S SOLD"* in the

Proven methods. Anxiety specialist. Clinical Hypnotherapies. Health rebates available. Lorina Harris 0402 454 951.

The Independent, Friday April 27, 2012

Mobile: ..........................................................

NNNNNNNNNNNNNNNN *Credit Card handling fee of 1.5% applies Expiry date:NN/NN Signature:.................................................... Cash Paid: .................................................. Receipt: ...................... Paid at:....................

ADVERTISE - GEELONG

www.cqrecruitment.com.au

CRF (Colac Otway) P/L, a world-class meat processing facility in Colac, Victoria has vacancies for casual meat process workers. CRF is an industry leader employing 400 staff with a clear vision of achieving best practice. The successful candidates will be motivated self-starters who have a positive and dedicated work ethic. Previous experience would be advantageous however on and off the job training is provided. Part of the recruitment process includes a, drug test, and Q-Fever vaccination. If you are an enthusiastic, reliable person who is a team player and is willing to learn new tasks, please apply by email, resume to jbird@crfco. com.au or filling out an application form, at: CQ RECRUITMENT, 111-113 Bromfield Street, Colac VIC 3250 Phone: 03 5232 2501 Applications also available online at: www.cqrecruitment.com.au

LOSE WEIGHT NOW! STOP SMOKING NOW!!

Forced to resign Redundancy

 5274 9197 or

PROCESS WORKER

C978564-JL43-11

C1009463-PJ8-12

GCH is looking for an innovative & thoughtful health professional, to join the HFV team to deliver Homelessness and Family Violence related support services. The successful applicant will need to have demonstrated experience in case management & working with individuals, families, and welfare & health professionals.

SITUATIONS VACANT

CITY OF GREATER GEELONG PUBLIC NOTICES

PP281011

0.8eft (4 days per week) Ararat SACS Award Social Work Class 1 Level 1 to Level 6

PatAsh and Civil Pty Ltd have an urgent requirement for licensed and experienced; • Dump Truck Operators - 30-40 Tonne Moxi Operators • Semi Tipper Operators All applicants must have Red card & relevant tickets necessary. Please send application to clint@patashandcivil.com.au or fax 5283-1779

Please send your applications marked confidential to: Raiders Bingo Centre, P.O. Box 5075, East Geelong, 3219 or raidersbingo@tpg.com.au by 5pm, 10th May, 2012 C1023461-PJ17-12

C1023236-JJ17-12

READVERTISED Homelessness Support Worker

DUMP TRUCK OPERATORS & SEMI TIPPER OPERATORS

C1023384-KG17-12

SITUATIONS VACANT

BINGO CALLER

C1024401-JL17-12

The Victorian Equal Opportunity Act 1995 makes it unlawful for an advertiser to show any intention to discriminate on the basis of sex, pregnancy, race, age, marital status, political or religious belief or physical features, disability, lawful sexual activity/sexual orientation, HIV/AIDS status or on the basis of being associated with a person with one of the above characteristics, unless covered by an exception under the Act. As Star News Group could be legally liable if an unlawful advertisement is printed, Star News Group will not accept advertisements that appear to break the law. For more information about discrimination in advertising, contact your legal advisers or the Equal Opportunity Commission.

PUBLIC NOTICES

We are looking for a Bingo Caller with exceptional customer service skills. Gaming Licence preferred but not essential. Weekend work involved as well as flexibility to cover other shifts at short notice.

C793399-JL20-10

C1020245-JL15-12

DISCRIMINATION IN ADVERTISING IS UNLAWFUL

SITUATIONS VACANT

C1023989-KK17-12

PROFESSIONAL

Ph 5249 6700 Or Fax 5945 0667


sport Leopold to hold off St Mary’s ST MARY’S and Leopold will enter Geelong Football League’s game of the day at Kardinia West Oval on Saturday with perfect records. New St Mary’s coach Jason Orr will be ecstatic with the performance of his team after many pundits wrote it off as too old and too slow. The form of Daniel Jull, Matt Hebbard and Flinn Chisholm has made a mockery of those early predictions. The quality of St Mary’s opponents in the opening two games was questionable but Leopold presents as a side going places this year. The Lions defeated the fancied Newtown last Saturday and will now rate itself a chance to match anyone. Greg Harty, Jeremy Larcombe and Matt Miller are hitting the ball hard and if Jason Tom and Jye Bolton can get a leave-pass from Werribee to play again this week the side will look very strong. St Mary’s has much to prove and will enjoy playing on its home ground but expect Leopold to win a close one.

Local Footy FRANK MASON Other selections: BELL PARK v Lara, North Shore v COLAC, St Alban’s v NEWTOWN, WEST SAINTS v Grovedale (Sunday).

BFL Queenscliff is showing no signs of a premiership hangover as it sits on top of Bellarine Football League’s ladder after three rounds. New coach Tom Limb has the runs on the board, which must be a huge relief because it’s a pretty hard gig taking over a successful side. The loss of Dylan Chaplin-Birch hasn’t unsettled the side too much, with the likes of Daniel DeGois,

Luke Orvis and Dan Measures stepping up in the forward line. On Saturday the Coutas travel to Anglesea to take on the Roos in the game of the round. Anglesea is coming off a thumping victory over Portarlington when everything went right. Veteran David Mensch kicked 14 and Brock Shiels also showed age is yet to catch up with him. The Coutas won’t let Mensch repeat last weekend’s antics but will be wary of his marking ability. This is an important match for Anglesea because it sits in fourth spot and should play finals but has a question mark over whether it can match it with the very top sides. Anglesea will get close but not close enough to take the points. Other selections: Amateurs v MODEWARRE, TORQUAY v Barwon Heads, Newcomb v OCEAN GROVE, DRYSDALE v Portarlington.

three this weekend, with the pick of the games between Inverleigh and Werribee Centrals game at Inverleigh. These two have had shocking starts to the year and it’s hard to believe last year’s semi finalists sit winless on the bottom two rungs of the ladder. Inverleigh has lost on-ballers David Peel, Brent McConachy and Jason Quinlivian and failed to recruit anyone to replace them. The results aren’t good and plenty of work remains ahead at Hawkland after such a promising 2011 when all three sides played finals in a breakthrough year for the once-battling club. Werribee Centrals is also in the hot seat. The team has a new coach in Luke Phipps and plenty of recruits but the results just aren’t there. Both sides have plenty to play for but it will be Werribee that runs on victorious. Other selections: EAST GEELONG v Belmont Lions, Thomson v BELL POST HILL, Corio v NORTH GEELONG, Geelong West v BANNOCKGeelong and District Football League plays round BURN, ANAKIE v Winchelsea.

GDFL

Seek and ye shoal find: local anglers hale storm of salmon in surf

BRIAN LONG ALL TYPES of weather greeted anglers over the past week, with even a massive hailstorm catching me near Anglesea last weekend. The salmon were also biting a day earlier in calm seas with the sunshine warming at Fairhaven beach. Most anglers struggled along the coast in the clear, flat conditions. A number of moves was generally required to find a shoal of salmon, with good numbers taken on lure. Bernie Johnson fished Breamlea’s beach for salmon averaging around 1kg on high tide. Jan Juc produced similar-size fish. Tuna again rewarded anglers prepared to fish Portland and beyond. Most were 10kg to 16kg, with albacore ranging from 5kg to 15kg and stripey tuna of 3kg also common. Some big barrels were sighted off Portland in 400m to 500m but late in the afternoon when a hook-up would have resulted in a very late return. Hopefully some are landed in the coming days. Apollo Bay also produced small tuna in the same areas as this time last year. George Matthews fished the lead up to the flood tide at the entrance to Swan Bay twice, taking bag limits of whiting on both trips. His fish averaged 35cm but two beauties were 48cm. Paul Dickens also fishing the entrance to Swan Bay for his whiting bag limit along with a nice bag of flathead, the biggest 2.6kg. Paul reported that berley was the key to success on the flathead.

Turbo

Get reddie: Ellie Gibson with a brace of redfin from Lake Tooliorook. Stuart Campbell tried an after-dark session inside Swan Bay last weekend, catching an exceptional variety of species. By the time he packed up at 4am his tally included flathead, salmon, gummy shark, ling and two snapper better than 3kg. Soft plastics enthusiast Daniel Johnson struggled to find snapper while drifting Corio Bay’s outer-harbour spoil grounds. A move to Bird Rock changed his luck, with Daniel reaping a bag-limit catch of pinky snapper and one big fish over 3kg. Garfish were spread out but most of the inshore grass beds produced plenty of fish. A reasonable berley trail was required, with silverfish under a quill float successful. Anglers drifting with soft plastics over the Stingaree Bay spoil were rewarded with some fantastic rock flathead, many over 50cm. The area also produced snapper of around 1kg.

Perch ace: Ben Wentworth with a redfin from Lake Fyans. Land-based anglers caught some nice snapper at St Helens, with their fish generally between 30cm and 40cm. A variety of baits worked but squid and blue bait were best.

X200 4x4 Diesel

GEELONG

Only

Colac Road Waurn Ponds

5 Speed Automatic

$28990

(next to Bunnings)

p. 5249 0999 kingscars.com.au/greatwall LMCT9931

The Independent, Friday April 27, 2012

C1030364-KG16-12

On the bite

Freshwater reports were fantastic. Lismore’s Lake Tooliorook produced awesome captures of redfin, most from 400g to 700gram. Live minnow was the favoured bait, while trolling bibbed lures such as the small Stumpjumpers and SX 40s was also worthwhile. Wayne Gibson and six-year-old daughter Ellie caught a nice bag on the troll last weekend. Rainbow trout were also taken with Powerbait fished on a running sinker rig. Deep Lake also returned good numbers of trout, again on Powerbait as well as live minnow fished under a float. Terry Knott caught and released 16 fish in his past two sessions at Deep Lake. Geelong and District Angling Club had its Wanders Cup contest at Lake Bolac last weekend, with 25 trout landed. Harry Bateman caught the best, weighing 2.39kg. Paul Stirling made the trek to Bostock Reservoir where he caught four rainbow trout better than 1kg each. Powerbait bought all the success. Lake Fyans became a popular destination for trout. Harrison Welsh fished mudeye under a float with outstanding results, catching four trout over 2kg along with two nice redfin over 1kg. Stan Peterson also found redfin, landing a dozen around 1kg on lure. West Barwon Reservoir attracted little attention, Danny Forbes arriving to find he had the lake all to himself. Danny cast SX40s along the main wall for three nice trout up to 1.8kg. Redfin were still caught from the Barwon River in Geelong. Queen’s Park all the way up to the ring road produced results, with small, bibbed lures doing the trick. This weekend’s late-afternoon high tides should suit the surf if the water is clean. Freshwater anglers are advised to fish Lake Tooliorook for redfin and trout. Send reports and photos to info@raylongtackle.com.au or visit Brian at Ray Long’s Fishing World, 105 Shannon Ave, Manifold Heights.

53


1031068-KC17-11

THE ORIGINAL WEEK 5

They know business... what do they know about footy? Find out each week with Independent Tip Stars

24

23

29

24

26

26

27

29

LW 5

LW 5

LW 8

LW 6

LW 7

LW 7

LW 6

LW 7

Andrew Leach

Keith Burns

Tony Marruso

John Eren

Joel Morrison

Leigh Keen

Paul Beretta

Debbie Tabone

Oz Extreme

Peninsula Hotel

Harvey Norman Electrical

MP

Harvey Norman Flooring

Forty Winks

Beretta’s Bike Hub

Harvey Norman Bedding

Collingwood Carlton GWS Giants Gold Coast Suns St Kilda Geelong Hawthorn West Coast Adelaide

Collingwood Carlton Western Bulldogs North Melbourne St Kilda Brisbane Hawthorn West Coast Port Adelaide

Collingwood Fremantle Western Bulldogs North Melbourne St Kilda Brisbane Hawthorn West Coast Adelaide

Essendon Carlton Western Bulldogs North Melbourne St Kilda Geelong Hawthorn West Coast Adelaide

Essendon Carlton Western Bulldogs North Melbourne St Kilda Geelong Hawthorn Richmond Port Adelaide

Essendon Carlton Western Bulldogs North Melbourne St Kilda Brisbane Sydney West Coast Adelaide

Collingwood Carlton Western Bulldogs North Melbourne St Kilda Geelong Hawthorn West Coast Adelaide

Essendon Carlton Western Bulldogs North Melbourne St Kilda Geelong Hawthorn West Coast Adelaide

Phone: 5221 4399

Phone: 5224 1900

Phone: 5272 9900

The Peninsula Hotel

Phone: 5244 0111

Phone: 5248 2606

Corio

Phone: 5272 9900

STATE MEMBER FOR LARA Phone: 5275 3898

Corio

Corio

Phone: 5272 9900

28

26

28

27

25

25

28

27

LW 7

LW 6

LW 7

LW 6

LW 7

LW 5

LW 7

LW 7

Matt Loughnane

Coco Griffiths

Dave Lovell

Robert Keoylian

Geoff Baum

Jan Primmer

Jo Murphy-Hennig

Warren Pisano

Curlewis Golf Club

Diversitat Training

Reading Cinemas

Harvey Norman Computers

Home Makers Carpets

Slumber World

Awesome Playgrounds

Andrews & Parker

Collingwood Fremantle Western Bulldogs North Melbourne St Kilda Geelong Hawthorn West Coast Adelaide

Essendon Fremantle Western Bulldogs North Melbourne St Kilda Geelong Hawthorn West Coast Port Adelaide

Collingwood Fremantle Western Bulldogs North Melbourne St Kilda Geelong Hawthorn West Coast Adelaide

Collingwood Carlton Western Bulldogs North Melbourne St Kilda Geelong Hawthorn West Coast Adelaide

Essendon Fremantle Western Bulldogs North Melbourne St Kilda Geelong Hawthorn West Coast Adelaide

Collingwood Fremantle Western Bulldogs North Melbourne St Kilda Geelong Hawthorn West Coast Adelaide

Collingwood Carlton Western Bulldogs North Melbourne St Kilda Geelong Hawthorn West Coast Adelaide

Essendon Fremantle Western Bulldogs North Melbourne St Kilda Geelong Hawthorn West Coast Adelaide

Phone: 5229 2083

Phone: 5241 1108

Phone: 5222 4484

Phone: 5222 4583

Waurn Ponds

Phone: 5251 1111

Phone: 5224 2329

Phone: 5249 2800

Phone: 5240 6200

27

27

27

25

27

27

26

23

LW 7

LW 6

LW 6

LW 6

LW 7

LW 6

LW 7

LW 7

Jon Gilchrist

Joe Jakubowski

Steve Najda

Bunny & Ralph

John Northwood

Tony Galpin

Joe Marruso

Daniel Roach

Cash Converters

White Eagle

Najda’s Cellarbrations

Guest Tipstar

Harvey Norman Flooring

Managing Editor

Harvey Norman Electrical

Prestige Ink

Collingwood Fremantle Western Bulldogs North Melbourne St Kilda Geelong Hawthorn West Coast Adelaide

Collingwood Fremantle Western Bulldogs North Melbourne Melbourne Brisbane Sydney West Coast Adelaide

Collingwood Fremantle Western Bulldogs North Melbourne St Kilda Geelong Hawthorn West Coast Adelaide

Collingwood Fremantle Western Bulldogs North Melbourne St Kilda Geelong Sydney West Coast Port Adelaide

Essendon Carlton Western Bulldogs North Melbourne St Kilda Geelong Hawthorn West Coast Adelaide

Essendon Carlton Western Bulldogs North Melbourne St Kilda Geelong Hawthorn West Coast Adelaide

Collingwood Fremantle Western Bulldogs North Melbourne St Kilda Geelong Hawthorn West Coast Adelaide

Essendon Fremantle Western Bulldogs North Melbourne St Kilda Geelong Hawthorn West Coast Adelaide

Phone: 5221 5200

Phone: 5240 6200

WHITE EAGLE HOUSE

Phone: 5221 0244

Phone: 5229 1009

NAJDAS

Phone: 5278 2855

Friend of the Independent

Waurn Ponds

Waurn Ponds

Phone: 5240 6200

Phone: 5245 7117

190 Latrobe Terrace, Geelong PH: 5224 1900 berettas.bikehub.com.au

SALES, SERVICE, EXPERT ADVICE & REPAIRS Open 7 Days – Parking at rear 1031460-JM17-12

54

The Independent, Friday April 27, 2012


1031069-KC17-12

THE ORIGINAL WEEK 5

They know business... what do they know about footy? Find out each week with Independent Tip Stars

27

24

26

24

25

28 Round 5 Wednesday, April 25

LW 7

LW 4

LW 6

LW 6

LW 6

LW 6

John Mitchell

Vanessa Scarfone

Tom Mikac

Matthew Sun

Russell Enders

Ross Parke

Mayor

Harvey Norman Bedding

New Generation Solar

Betta Electrical

Raiders Bingo

The Good Guys

Collingwood Carlton Western Bulldogs North Melbourne St Kilda Geelong Hawthorn West Coast Adelaide

Collingwood Carlton Western Bulldogs North Melbourne St Kilda Geelong Sydney West Coast Port Adelaide

Collingwood Carlton Western Bulldogs North Melbourne St Kilda Geelong Hawthorn West Coast Adelaide

Essendon Fremantle Western Bulldogs Gold Coast Suns St Kilda Geelong Sydney West Coast Adelaide

Collingwood Fremantle Western Bulldogs North Melbourne St Kilda Geelong Hawthorn West Coast Adelaide

Collingwood Fremantle Western Bulldogs North Melbourne St Kilda Geelong Sydney West Coast Adelaide

Collingwood v Essendon MCG Friday, April 27 Fremantle v Carlton PS (N) Saturday, April 28 GWS GIANTS v Western Bulldogs MO North Melbourne v Gold Coast SUNS ES (T) Melbourne v St Kilda MCG (N) Brisbane Lions v Geelong Cats G (N) Sunday, April 29 Hawthorn v Sydney Swans AU (E) Richmond v West Coast Eagles ES

Waurn Ponds

Phone: 5272 4277

Phone: 5240 6200

27

Adelaide Crows v Port Adelaide AS (T)

Phone: 1300 320 227

26

Phone: 5222 4890

28

Phone: 5248 8777

29

Phone: 5221 1322

26

24 Leaders after Round 4

LW 7

LW 5

LW 7

LW 7

LW 5

LW 6

Ian Dunham

Tony Havis

Trevor Elsworthy

Shelly Dillon

Chris Goodhand

Chris Bennett

Harvey Norman Computers

Kennards Hire

Elsworthy Retravision

The Big Shed

Harvey Norman Furniture

Geelong RSL

Essendon Fremantle Western Bulldogs North Melbourne St Kilda Brisbane Sydney West Coast Adelaide

Collingwood Fremantle Western Bulldogs North Melbourne St Kilda Geelong Hawthorn West Coast Adelaide

Essendon Fremantle Western Bulldogs North Melbourne St Kilda Geelong Hawthorn West Coast Adelaide

Essendon Fremantle Western Bulldogs North Melbourne St Kilda Geelong Hawthorn West Coast Adelaide

Collingwood Fremantle Western Bulldogs North Melbourne St Kilda Geelong Hawthorn West Coast Port Adelaide

Collingwood Fremantle Western Bulldogs North Melbourne St Kilda Geelong Sydney West Coast Adelaide

Tony Marruso Harvey Norman Superstore Debbie Tabone Harvey Norman Superstore Shelley Dillon The Big Shed Matt Loughnane Curlewis Golf Club Dave Lovell Reading Jo Murphy-Hennig Awsome Playgrounds Ross Parke The Goodguys Trevor Elsworthy Elsworthys Retravision Paul(Chicken) Dyer K-Rock 95.5 Breakfast

29 29 29 28 28 28 28 28 28

Waurn Ponds

Phone: 5272 9900

Phone: 5243 5400

Phone: 5222 1533

Phone: 5229 9844

Phone: 5240 6200

Phone: 5241 1766

24

28

27

25

25

23

LW 5

LW 6

LW 5

LW 6

LW 7

LW 6

Brad Pederson

Paul (Chicken) Dyer

Simon Uridge

Robyn Reimers

Robyn Foy

Rob Sinclair

Boxfit Geelong

K-Rock Breakfast

Harvey Norman Furniture

Club Exec

Easyfinder

E&S Trading

Essendon Carlton Western Bulldogs North Melbourne St Kilda Geelong Hawthorn West Coast Adelaide

Collingwood Fremantle Western Bulldogs North Melbourne St Kilda Geelong Hawthorn West Coast Adelaide

Collingwood Carlton Western Bulldogs North Melbourne St Kilda Geelong Hawthorn West Coast Port Adelaide

Collingwood Carlton Western Bulldogs North Melbourne St Kilda Geelong Sydney West Coast Adelaide

Essendon Fremantle Western Bulldogs North Melbourne St Kilda Geelong Sydney Richmond Port Adelaide

Collingwood Carlton West Coast North Melbourne St Kilda Geelong Hawthorn Richmond Adelaide

Phone: 0417 344 813

Phone: 5223 1955

Phone: 5272 9900

Phone: 5221 1400

Phone: 5249 6710

Phone: 5228 2600

Corio

Carpet | Timber | Laminate | Rugs | Vinyl & Vinyl Tiles

Genuine Clearance Deals On: Cancelled Orders, Discontinued and Display Stock! CORIO - 420 Princes Hwy, Geelong 5272 9900 WAURN PONDS - 33 Princes Hwy, Geelong 5240 6200 Ends 29/04/12. Harvey Norman速 stores are operated by independent franchisees. *Discounts are off the normal ticketed price. 1031496-KS17-12

The Independent, Friday April 27, 2012

55


th BIRTHDAY ROSS PARKE THE GOOD GUYS will deal you the best price! SAMSUNG SERIES 6 55” LED TV

9

HISENSE 81CM FULL HD LCD TV

8

NAVMAN M Y80T GPS

UNBEATABLE VALUE

NEW MODEL 55” FULL HD TV UNDER $1600!

$

BONUS $100 STORE CREDIT*

25% OFF ALL NAVMAN GPS!

1 49 $ $ 29 329 HOT DEALS 4 PAY LESS PAY CASH

5

PAY LESS PAY CASH

SH PAY LESS PAY CA

9

7

1596

INDUCTION $ COOKTOPS SH PAY LESS PAY CA & ICE-CREAM MAKER DEMONSTR ATI SUNDAY ON ONS LY 11-2PM

GALAXY TABLET 10.1” 16GB WIFI BLACK

8

7

5

AYS! FINAL D SS OUT!

CANON IXUS 11 5 HS CAMERA

UNBEATABLE ON PRICE

2

PAY LESS PA Y CASH

3

KAMBROOK SNUGASABUG TIE-DOWN ELECTRIC BLANKET - FAMILY PACK

TOP BOSCH 456L T S MOUNT FRO E G FREE FRID

FINAL CHANCE AT THIS PRICE

COSY SLEEP FOR THE WHO LE FAMILY!

$

97

842

PAY CASH PAY LESS

$

11

4

36

PAY LESS PAY CASH

99

6 Find the 11 of Hearts in-store for a birthday surprise...

$

$

11

PAY LESS PAY CASH

6

2

REMINGTON HAIR DRYER PLATINUM PINK

3

4

DON’T MI

To celebrate our 11th b birthday irtthday we’r we’re giving away an

$11,000 HOME PACKAGE!

^

DROP INTO OUR STORE FOR FURTHER DETAILS AND GOOD LUCK!

1031105-JF17-12

On sale Thursday 26/04/2012 to Monday 30/04/2012 or while stocks last. % off discount is calculated against everyday ticketed price in store. Personal purchases only and not available in conjunction with any other offer. See in store for further conditions. Pictures for illustrative purposes only. *Bonus $100 The Store GGeelong the UA55EH6000M SSamsung SSeries $100 Store visit GGoodd GGuys St l CCredit dit PPromotion: ti AAvailable il bl until til 30/04/2012 only. l PPurchase h th i 6 55” LED TV in i one transaction t ti andd register i t online li to t redeem d St Credit. C dit Purchase P h mustt be b paid id in i full. f ll For F full f ll details d t il please l i it the th Geelong G l store t page att www.thegoodguys.com.au. th d ^Geelong 11th Birthday Giveaway subject to terms and conditions- see in store. Promotion commences 13/04/12 and ends 30/04/12. Vic Permit No: 12/642.

56

The Independent, Friday April 27, 2012

Bellarine_Indy_2012-04-27  

Family Anzac Day: Hughan Kennedy and son Patrick at Ocean Grove, above, and Donald Richardson and daughter Sarah Sacks at Barwon Heads. (wit...