Star Weekly - Melton Moorabool - 28th October 2025
A day to remember
Aintree residents will pause to remember the men and women who gave their lives fighting for their country during a Remembrance Day service on Sunday 2 November.
The event is organised by the Melton and Caroline Springs RSL sub-branches to provide Woodlea estate residents and the broader Woodlea community with the opportunity to mark Remembrance Day close to home.
Aintree does not have an RSL sub-branch.
Melton RSL Sub-branch secretary Sam Welham said the ceremony will include a guard of honour performed by the Australian Air Force Cadets 425 Squadron from Ballarat and Students from Bacchus Marsh Grammar’s Rockbank campus will share personal reflections about what Remembrance Day means to them.
Current and former veterans will be invited to the stage for a moment of recognition.
A Remembrance Day service will also be held at the Melton cenotaph at 10am on Tuesday 11 November.
Start the engine
By Oscar Parry
The state government is being urged to create a priority precinct in Cobblebank to boost housing and local jobs.
Last week, the West of Melbourne Economic Development Alliance (WoMEDA)releasedapaper titled‘Western Growth:UnlockingMelbourne’sEconomic Engine’, which aims to provide strategic principles on ‘supercharging’ economic and social future of Melbourne’s west.
Thepaperdescribesthatacorechallenge of Melbourne’s west is that “that too high a proportion of workers from the west commute out of the region to work, which in turn places intense pressure on the region’s transport infrastructure”.
According to WoMEDA, two main solutions are more public and private
investments in the west’s ‘employment precincts’togrowlocaljobsandinvestment in public transport – aiming to reduce the significant commuting times out of the region that many face.
The organisation called on the state government to give ‘serious consideration’ to the establishment of a new ‘priority precinct’ in Cobblebank – along with committing to the ongoing development of priority precinct plans for East Werribee, Footscray, and Sunshine.
A priority precinct is an area earmarked bythestatetoreceiveahighconcentration of new jobs and homes.
WoMEDA stated that Cobblebank is growing at “breakneck speed” and is already home to large live initiatives including the future Melton Hospital and a new TAFE.
Thornhill Park resident Matt Pearse said he supports growth for Cobblebank.
“Obviously, with over 75 per cent of the residents of Melton having to leave the [municipality] … to get to work each day, having a … central commercial centre that supports … local jobs, local communities as well as the economic development of [Melton] is a win,” Mr Pearse said.
He believes Cobblebank will become the municipality’s new ‘CBD’.
“Any calls for investment is good … and investing in the Cobblebank precinct is a win for [Melton] and a win for local residents,” he said.
Melton mayor Steve Abboushi said the council supports the call to the state.
“[Cobblebank] will not only be a key centre for health services, education, retail andcommercialinvestment,italsohasthe
capacity to act as a major employment hub that links Melbourne’s west with Ballarat and peri-urban regions including Bacchus Marsh,” Cr Abboushi said.
“[It] must therefore be a place that is capable of significant public and private investmenttocreatethousandsofnewjobs for Melbourne’s booming western growth corridor.”
A state government spokesperson said businesses in Melbourne’s west are thriving, with employment growth in the area outpacing the average and “more jobs in emerging industries being created including at Amazon’s new data centre in Cobblebank”.
According to the state, total employment increased by 5.1 per cent in Melbourne’s west in 2024–25, with more than 5000 new businesses created.
Melton RSL Sub-branch president Reginald Cooke and secretary Sam Welham at the Woodlea Walk of Honour. (Damjan Janevski) 511641_01
Mayor’s message
Cr Steve Abboushi
Serving as Mayor over the past year has been an incredible honour and as I wrap up my term, it’s nice to reflect not only on what we’ve achieved, but what still lies ahead for our City.
From day one, I set out with a clear goal to amplify the voices of young people and am so proud of what we’ve been able to achieve. Not only did we host a Youth Forum and Summit, but we also launched the Mayoral Youth Leadership Program, reflecting our commitment to strengthening youth leadership and inclusion. We continued to deliver the infrastructure and services needed to keep up with our booming population, including Plumpton Children’s and Community Centre, upgrades to Melton Recycling Facility, Bridge Road Community Hub and Caroline Springs Town Centre Recreation Reserve Oval 2 redevelopment.
It was a particular highlight to see Council’s advocacy pay off when the Australian Government committed $1 billion to upgrade the Western Highway, between Melton and Caroline Springs, and $300 million for the Calder Park interchange. I was also especially proud to lead the community engagement process to develop our new Council and Wellbeing Plan, which outlines our shared vision for this Council term. Shaped by meaningful consultation with residents and stakeholders, this deliberative engagement ensured that our community is at the centre of Council decision making.
Thank you to my fellow Councillors, and my family, especially my wife and sons, for their support during my time as Mayor. I leave the role full of pride and gratitude, knowing we’ve made lasting progress for our community.
You’re welcome to contact me regarding Council matters at Steve.Abboushi@melton.vic. gov.au or on 0437 231 680.
It’s almost Djerriwarrh Festival time!
The countdown to the Djerriwarrh Festival is on!
Come along on Saturday 8 November 2025 and experience a day of activities for the whole family.
The Street Parade will kick off at 11.30am along High Street (between Station Road and Smith Street).
From 12pm, High Street will be a hive of activity with market stalls, food
Melbourne Cup Public Holiday operating hours
Our offices will be closed on Tuesday 4 November 2025 for the Melbourne Cup Public Holiday. This includes City of Melton Libraries and the Animal Pound. There is no change to kerbside bin collections, so please put your bin out Monday night for Tuesday collection.
The Melton Recycling Facility will be open 8am - 4.30pm. For information, to report an issue or pay online visit melton.vic.gov.au
trucks, a pet expo and vibrant intercultural performances on the Main Stage.
The Main Stage will continue pumping into the evening with live acts including You Am I, Simply West, Horns of Leroy, Charlie Collins and Mika James from 5pm.
Fireworks will cap off the festival with a dazzling display set for 9pm (weather permitting).
WHEN: Saturday 8 November 2025
WHERE: High Street Melton, between Smith Street & Hannah Watts Park
TIME: 12pm– 9pm, with the Street Parade starting at 11.30am.
To view the program, visit melton.vic. gov.au/djerriwarrhfestival
Cambrian Ward with Cr Bob Turner
We’re heading into one of my favourite times of year when there are many opportunities to come together to demonstrate our shared values and celebrate our strong and connected community.
Saturday 8 November brings one of the highlights of our local event calendar, the Djerriwarrh Festival. This has always been one of my favourite events, and will feature family-friendly activities, live music, great food, and much more set in a fun and inclusive atmosphere.
I’m especially looking forward to seeing Aria Award winners, You Am I, on the main stage, capping off an incredible day of performances.
This year’s Street Parade theme is ‘Melton in colour: Colour on every corner’. Applications close on 31 October.
Visit melton.vic.gov.au/ djerriwarrhfestival for more
information about the festival and mainstage program.
On Sunday 9 November, I’ll be attending a special event to celebrate 100 years of community service by Toolern Vale CFA. That’s a century of courage and commitment by local volunteers who give their time and put themselves at risk to keep our community safe. It’s an incredible milestone, and one I’m proud to support.
In the lead up to Remembrance Day, I’ll be attending a service in Aintree on Sunday 2 November to honour the brave men and women who served in defence of our nation, values and the freedoms we enjoy today.
As always, I look forward to seeing many of you at these events.
You can contact me regarding Cambrian Ward or Council related issues by calling 0412 584 224 or emailing bob.turner@melton. vic.gov.au
Mayor Cr Steve Abboushi
Deputy Mayor Cr Lara Carli Cr Kathy Majdlik Cr Brandi Morris Cr Sophie Ramsey Cr Julie Shannon Cr Bob Turner Cr Ashleigh Vandenberg Cr John Verdon Cr Dr Phillip Zada
Help shape Mt Atkinson
Feedback is sought on a draft planning document for the Mt Atkinson Major Town Centre,withresidentsnowabletoinfluence its future.
According to Melton council, a vibrant new town centre for shopping, dining, services, and entertainment is being planned – with the council inviting feedback on its urban design framework (UDF) over a four-week period until Wednesday 19 November.
The draft UDF was developed by Mesh Planning on behalf of Mt Atkinson Holdings through consultation with council
and outlines a vision for a new town centre adjacent to a proposed new train station, aimed at providing a place where residents can shop, work and enjoy recreational opportunitieswithincloseproximitytohome.
Some of the elements included in the UDF include grocery stores, shops and offices, parks, a community centre, and homes.
Melton mayor Steve Abboushi said the Mt Atkinson area is fast-growing, and with an increasing population, there is emerging demand for local services close to home.
“It is important that we make sure the UDF reflects the needs and expectations of our community,” Cr Abboushi said.
“I encourage residents to view the draft UDF,andletusknowwhattheylike,what’s mostimportanttothemandwhatcouldbe improved.”
Hard copies of the draft UDF are available to view at council’s civic centre, the Caroline Springs Library and the Mt Atkinson Children’s and Community Centre.
Community members can also view the plan, ask questions and find out more at drop-in sessions being held at Mt Atkin-
Grant a ‘morale boost’ for club volunteers
Caroline Springs tennis club said it is “over the moon” after receiving a volunteer grant last month.
The federal government grants aim to help volunteers in community groups stay safe, connected and supported.
Vice president Maria Fraietta said club members “lit up with excitement” when they found out about the grant.
“It’s a huge morale boost and a testamenttothehardworkofourcommittee and members. We’re all thrilled to see
the positive impact this funding offered by our Gorton MP Alice Jordan-Baird will have on our club,” Ms Fraietta said.
The grant will go towards upgrading club facilities and the installation of three new premium scoreboards.
Ms Fraietta said community grants are “vital” to clubs.
“Without grants, many clubs would struggletosurvive,letalonethrive.This funding allows us to focus on what we do best – providing a welcoming and inclusive environment for our mem-
Group offers support to Melton women
Aiming to support women through uniting those with similar experiences,a Melton-based support group is welcoming new members.
Founded 12 years ago, the group meets each Monday, from 1–2.30pm – except public holidays – at the Djerriwarrh Neighbourhood House, aiming to provide peer support in a relaxed environment.
Founder and group leader Val Fisher, who has a diploma in counselling, said that she formed the group through having an interest in mental health.
“It’s good to have a … group where people can support one another … I’ve got people who have been in the group from the start,” Ms Fisher said.
“I have a few women every week who sayifitwasn’tforthegroup,theycouldn’t get through the week.
“They need that vent.”
Ms Fisher said the group unites women with similar experiences who are able to understand the challenges each other are facing and share support.
She said that the meetings tend to attract 10–12 attendees – with about six members attending every week –and there is no pressure to attend each meeting.
The meetings are a balance be tween structured and unstructured conversation, and Ms Fisher aims to give each attendee the opportunity to speak if they would like to.
There are also optional coffee catch ups and an annual Christmas break-up.
Details: ow.ly/QVwJ50Q5g42
bers to enjoy tennis,” she said.
She also described volunteers as being the “lifeblood” of the tennis club.
“From coaching and umpiring to committee roles and event organisation, our volunteers are essential to our operations,” Ms Fraietta said.
“They donate their time and expertise to help us deliver programs and services to our members. Without them, we’d struggle to function, so we’re incredibly grateful for their contributions.”
son Children’s and Community Centre from 6–8pm on Wednesday 29 October or 10.30am–12.30pm on Saturday 15 November. Following the consultation period, councilwillreviewfeedbackandmakeany required amendments to the UDF before it is presented at a future council meeting for consideration.
The draft UDF can be viewed online, and feedback can be submitted via a short survey.
Australia’s largest mental health and fitness event, The Push-Up Challenge, is calling on students passionate about mentalhealthtoapplyforits2026Student Ambassador program.
Student ambassadors will lead their school friends, teachers and school community in The Push-Up Challenge by cheering them on to get active, have fun and learn about mental health.
Students completing year 10, 11 and Year 12 in 2026 anywhere in Australia can apply to become a student ambassador and make a difference to the mental health of their school community.
Mental health promotion manager at The Push-Up Challenge, Amberlee Nicholas, said that the Student Ambassador Program is one of the organisation’s proudest achievements to date.
“It’s inspiring to see students from across the country uniting their communities through fun and fitness. School groups remain some of our most passionate participants, wholeheartedly embracing the opportunity to learn about mental health while coming together to achieve a shared goal.”
Ambassadors benefit by developing skills to have conversations about mental health with confidence, learning more about mental wellbeing, and bringing their school community together to push for a good cause.
The program offers successful applicants mental health awareness training facilitated by a clinical psychologist, practical strategies to boost their own mental fitness, exclusive merchandise, workshops and event resources to support mental health education at their school.
Details: thepushupchallenge.com.au
Club head coach Chris Singh, Xavier (12), Jonah (14), vice president Maria Fraietta and Sherridan Long (Itennis Coaching Academy). (Damjan Janevski). 502920_02
Summit to tackle dumping
Mayors, chief executives and senior staff from councils across the state will travel to Moorabool for an illegal dumping summit later this month.
Moorabool council will host the 30 October summit off the back of its dispute with the Environment Protection Authority (EPA) over the clean-up of toxic waste on a property near Bacchus Marsh and ongoing illegal dumping of rubbish throughout the shire.
As reported by Star Weekly, council was forced to spend about $500,000 to re-
move about 1000 to 1250 dissolved acetylene cylinders on pallets in two trailers parked on the nature strip of 210 Lerderderg Park Road, Merrimu.
An EPA clean-up notice was issued to council, requiring it to remove the waste by 25 July, but council applied to the Victorian Civil and Administrative Tribunal (VCAT) for a stay on the order.
The tribunal refused the request on 16 July, ruling that it was in community interest to address the matter urgently.
The council alleges the EPA had the
property the trailers originated from under surveillance for at least a year and did not act until the trailers turned up on council-managed land
Mayor Paul Tatchell said Moorabool will share its experience with other council and lead discussions on illegally dumped rubbish, which he said costs hundreds of thousands of dollars every year to clean up;
“We have decided to host a summit with representatives from other councils to determine a collaborative approach
511675_01
Model club aids veterans’ wellbeing
A selection of models built by local veterans are on display at Melton Library.
The models, including Bushmaster protected mobility vehicle or Royal Australian Navy vessel replicas, were created as part of the Melton RSL Sub-branch’s veterans’ scale model building club.
Award-winning model builder Michael Bradshaw volunteer his time each month to run workshops and share his expertise with the club, which has about 25 members.
Melton RSL Sub-branch secretary
Sam Welham said the club was the idea of immediate past president Stephen Cook as part of the sub-branch’s commitment to veteran wellbeing.
“The initiative offers veterans a creative, social, and mindful outlet that encourages focus, connection, and positive mental health – particularly for those managing post-service challenges such as PTSD [post-traumatic stress disorder],” he said. “Programs like this play
a vital role in veteran wellness and community connection.”
Participants were provided with a starter kit which included a model of their choice, paint, tools and accessories.
“These models often hold deep personal significance and provide an avenue for storytelling, reflection, and pride,” Mr Welham said.
The models will be on display at the library util early December.
Little Angler Kits designed to help get kids hooked
Grade 5 students will have the chance to become hooked on fishing, with free Little Angler Kits to be rolled out in schools next year.
On 20 October, Outdoor Recreation Minister Steve Dimopoulos announced the tender for the second batch of Little Angler Kits, which will be distributed to almost 1900 schools in time for the 2026 September school holidays.
The state government said the Little Angler Kits have everything a first-time fishing enthusiast needs to get started
including a fishing rod and reel with line, tackle box with tackle, and an eight-page Kids’ Guide to Fishing outlining the basics of fishing safety, knots and rigs.
The Kids’ Guide to Fishing also provides advice on the best baits to use, peak fishing seasons and hot spots across Victoria as well as colour illustrations of freshwater and saltwater species likely to be caught.
The initiative is funded by recreational fishing licence fees.
The Victorian Fisheries Authority
and drive shared solutions for this issue,”
Cr Tatchell said.
“We’re looking forward to hearing what other councils are experiencing with illegal dumping and what measures they are putting in place to combat this widespread issue.”
Cr Tatchell said council is also continuing to run a campaign targeting illegal dumping in the shire, particularly by builders and contractors coming into the area for work.
Police make 230 arrests during blitz
A police blitz targeting recidivist family violence perpetrators in the north-west resulted in 230 arrests.
The offenders were tracked down and apprehended by police across multiple days throughout September and October in Victoria Police’s north-west metro region.
Detectives from the Westgate Family Violence Investigation Unit and Broadmeadows Family Violence Investigation Unit teamed up to lead the blitz, with the Family Violence Command Taskforce and the Public Order Response Team.
Those arrested have allegedly committed multiple violent crimes against current and former partners and their children, police said.
The blitz focussed on repeat family violence perpetrators who are known to offend on multiple occasions across a 12-month period and specialist support services were also engaged, helping to disrupt patterns of violence.
Those arrested included a 42-year-old man who was wanted by police after failing to appear in court for serious family violence offending; a 35-year-old man who allegedly committed a family violence-related aggravated burglary; a 42-year-old woman who allegedly assaulted another woman at a shopping centre.; an 18-year-old man who allegedly committed multiple counts of deception and damaged his parents property; and a 37-year-old man who allegedly persistently contravened a family violence intervention order.
Police also served 187 family violence intervention orders and executed more than 120 outstanding warrants throughout the blitz.
Westgate Family Violence Investigation Unit Detective Acting Senior Sergeant Fiona Waters said police were serious about ensuring recidivist family violence perpetrators are held responsible for their actions.
“Family violence is completely unacceptable – which is why we will continue to work tirelessly to target and apprehend offenders and keep victims safe,” she said,
on fishing
(VFA) is leading the Little Angler Kit rolloutandhascreatedaseriesofinformative tutorial videos presented by VFA ambassador Lee Rayner and Michelle Brittain from the Women in Recreational Fishing and Boating Network with step-by-step instructions on how to get started.
Translated versions of the Kids’ Guide to Fishing, available in Vietnamese, Arabic, Hindi, Punjabi and simplified Chinese, complement the videos and are available from a kid-friendly web page at www.vfa.vic.gov.au/littleanglerkit
Broadmeadows Family Violence Investigation Unit Detective Sergeant Chris Couacaud said, “Whether it’s committing violent assaults against their loved ones, breaching a family violence intervention order or using technology to stalk or harass – those that choose to engage in this behaviour should think again. They will be tracked down by police and held to account”.
If you are concerned about your own or someone else’s behaviour support services are available.
No to Violence runs a Men’s Referral Service which helps men who use violence to change their behaviour and can be contacted on 1300 766 491.
Supportisavailable24hoursadaythrough Safe Steps by calling 1800 015 188 or emailing safesteps@safesteps.org.au
In an emergency call triple-0. If you can’t get to a phone, ask someone else to do it for you.
Melton RSL Sub-branch president Reginald Cooke with members Russel Pettis, Wayne Reeves, Clinton Hall, Stephen Cook, Meredith Welham and Michael Bradshaw. (Damjan Janevski)
MP’s bittersweet decision
By Sam Porter
Sydenham MP and Government Services, Treaty and First Peoples, Prevention of Family Violence and Women’s Minister Natalie Hutchins announced this month she would not seek re-election in 2026.
While Ms Hutchins still has another year serving the Sydenham electorate, the Labor politician told StarWeekly the announcement had been bittersweet.
“Certainly it’s been an absolute privilege to serve the people of Sydenham,” Ms Hutchins said.
“When I was pre-selected and started campaigning, before I got elected, my son was in grade prep at a school in Keilor and he’s now in third year uni. It kind of shows the time that you put in, what that means to your family. And of course along the way I lost my husband to cancer. That was a big challenge as well.”
Ms Hutchins was first elected as the Keilor MP in 2010, and later became the Sydenham MP when the electorate was formed after a boundary redistribution in 2014.
“We’ve had so much growth … places like Taylors Hill were just taking off when I became the MP and Deanside, Fraser Rise, Bonnybrook, they were not even suburbs,” Ms Hutchins said. “We’ve seen all these new suburbs develop. We’ve seen new communitycentresgoup.We’veseenareal change in diversity and we’ve seen a real growth in the number of families.”
One of Ms Hutchins’ highlights was
Exploring Eynesbury Woodland
EynesburyEnvironmentGroupwelcomeda “record” number of participants to its most recent bird walk, many of whom had not been in the bush before, according to the group’s Daryl Akers.
The walk, led by Mr Akers and fellow environment group member Lorraine Jolly, toured the Eynesbury Woodland.
Mr Akers said participants came from Eynesbury,localsuburbsandfurtherafield, all to go bird watching in the bush.
He said the woodland provides refuge to many birds and animals, such as mature Grey Box eucalyptus trees provide important habitat for hollow dwelling birds and mammals, as well as nesting birds, including
He said that during the walk, he noticed that almost every tree hollow appeared to have birds nesting in them, especially Galahs, Tree Martins and Brown Treecreepers.
“Wood Ducks were also investigating hollows,” he said. “We saw several Dusky Woodswallows that appeared to be nesting also. These birds migrate from warmer areas,arrivinginMeltonusuallyinOctober. They breed here then return to their winter quarters in warmer climes.
“Curiously the only bird of prey sighted was a single Black Kite.“
He said overall, the group saw 32 native bird species in the bush and by the lake.
Mr Akers said 180 bird species have been found in Eynesbury Forest to date
The group’s next bird walk – and last for 2025– will be on Saturday 15 November in Long Forest Mallee. Meet in the reserve carpark opposite Sundew Avenue at 9am.
Details: eynesbury.environment.group@ gmail.com
the removal of the Melton Highway level crossing in 2018.
“That was such a dangerous and congested area … [the level crossing
removal] has been a gamechanger,” she said.
Another highlight for Ms Hutchins was the opening of Orange Door services in the
area — outreach facilities offering support to those experiencing family violence.
“We’ve done a lot in the family violence space. When I came into Parliament it really hit me hard how much it affects my electorate,” Ms Hutchins said.
“I’m really proud that we’ve opened up the Orange Door facilities — one in Melton and we’ve got one in Sunshine and one now in Footscray. Those services didn’t exist 10 years ago or 15 years ago.”
ForMsHutchins,helpingindividualsand local families has been the most rewarding part of the job.
“To know that we’re making a difference and helping people in their lives, whether it’shelpingthemwritefundingapplications … or helping an individual who’s facing homelessness … the feedback that you get from helping those individuals is pretty rewarding and pretty satisfying,” Ms Hutchins said.
“This is when you’re really changing people’s lives and helping them.”
Ms Hutchins cited health reasons for stepping down from her role.
“It’s been a challenge to work the hours I’ve got to work and balance that, and I think I probably need to step back from the ministry sooner rather than later,” Ms Hutchins said.
She said she’s confident she can serve the Sydenham electorate for the next 12 months.
Ms Hutchins will continue in her role as Sydenham MP until the next election and will remain in Cabinet until 22 December.
Sydenham MP Natalie Hutchins with Brimbank mayor Thuy Dang. (Damjan Janevski) 476705_01
Dusky Woodswallows have made their way to the area.
The walk recorded a record turnout.(Pictures: Supplied)
A Wood Duck explores the forest.
A Red-rumped Parrot spotted in the woodland.
Second-hand treasure hunt
Bargain hunters should mark Saturday 15 November in their diaries, with the annual Garage Sale Trail arriving in Darley.
Garage Sale Trail is Australia’s biggest second-hand treasure hunt, with more than 300,000 people visiting a garage sale aroundthecountryovertwoweekendslast year.
The trail began in 2010 with the aim of making second-hand second nature, to protecttheearth’sfiniteresourcesandgive the things we buy a longer life.
Darley Neighbourhood House will host a car boot sale featuring 12 stalls on the day.
Neighbourhood house manager Amber Gordon said the house decided to host a sale to encourage the community to take
Celebrating Diwali at Vision Centre
Mt Atkinson residents brought the spirit of Diwali to life with a local celebration of India’sbiggestandmostimportantfestival.
Held at the Mt Atkinson Vision Centre Park on Saturday 18 October, the Diwali event featured colour, music, children’s activities, traditional dancers and food trucks.
Diwali, known for its dazzling lights and cultural richness, is a five-day festival celebrated around the world that brings together communities in a celebration of light triumphing over darkness, of good triumphing over evil, and of knowledge triumphing over ignorance.
Stockland development director Jackie Kent said vibrant events like Diwali served
as a platform for residents to experience andappreciatedifferentculturaltraditions while deepening their connection to their neighbours.
“Stockland Diwali events have quickly become a community favourite and each year we see more and more residents as well as their friends and family joining in the festivities,” Ms Kent said.
“We’re proud to host events like Diwali thatbringtogetherthediversebackgrounds within our community. It’s important to us that residents come together, share in each other’s traditions, and celebrate what makesusunique.Ithelpsfosterarealsense ofcommunityandhasapositiveimpacton all of our residents.”
part in the trail.
Our Marsh Mender Repair Café encourages people to fix things that are broken, but what about the things you no longer need? A car boot sale is the perfect way for locals to get involved in the Garage Sale Trail without having people come to their home,“ she said..
Ms Gordon said there are still stall spaces available and attendees can expect a fun community vibe, unique finds and something for the whole family to enjoy.
Car boot stalls can be booked for $20 at www.bit.ly/DNHgaragesaletrail25
To find other local Garage Sale Trail events, visit: www.garagesaletrail.com.au/ sales
Briefs
Extortion charge
A 45-year-old Hillside man has been charged, along with two other Melbourne men, as part of an investigation into an alleged $6.6 million extortion of a Melbourne construction company in October last year. Investigators will allege those involved falsely claimed to have acted as mediators between the company and union officials. The company was then sent an invoice for $6.6M and allegedly extorted. The trio were charged with extortion and refusing to comply with a data access order.
Melton business masterclasses
Melton is launching a new program aimed at turning your business ideas into business success. Whether you are at the ’idea stage’, in the early stages of setting up your business, or further advanced and already testing or carving out your market, the council’s Start-Up Academy is aimed at taking you to the next level. There will be four webinar classes from this month until March.
FOR BREAKING NEWS, VISIT Web: starweekly.com.au
Melton & Moorabool Star Weekly @starweeklynews @star_weekly
be a vibrant hub for residents and visitors to shop, work and play. It will feature shops, supermarkets, restaurants, offices, community facility and open spaces.
We want to hear your thoughts on what you like about the Mt Atkinson Urban Design Framework (UDF), what could be improved, what’s most important and what’s missing.
What is a UDF?
A UDF is a detailed planning and design document that sets a vision for the area to guide its development and provides the framework for assessing planning applications.
Have your say Drop-in sessions
Mt Atkinson Children’s and Community Centre
• Wednesday 29 October, 6pm–8pm
• Saturday 15 November, 10:30am–12:30pm
Complete the survey
Closes: 9am, Wednesday 19 November 2025.
Visit: conversations.melton.gov.au/mtatkinsonUDF
Darley Neighbourhood House manager Amber Gordon manager and volunteers Liz Warby and Josephine Gunstone are gearing up for the Garage Sale Trail. (Damjan Janevski) 511651_01
A Diwali celebration in Mt Atkinson featured traditional dancers. (Supplied)
Tree change plea heard
By Oscar Parry
A Gordon landowner’s plea to build a home on his fruit farm was heard by Moorabool council when he was granted a permit against a council officer’s recommendation.
At Moorabool’s October 15 development assessment committee meeting, farmer Mehmet Filiz addressed councillors for the second time, requesting a permit to develop and use a dwelling on his small-scale Gordon fruit farm.
At the previous meeting on September 17, Mr Filiz said that he has been travelling betweenthenorthernsuburbsofMelbourne
and his Gordon property to farm it for the last 14 years.
“My wife and I met later in life, and we have a daughter who’s under two years of age. I think it would be nice for my daughter to grow up in a rural environment, to have life experiences that city people do not experience,” Mr Filiz said.
“For example, we have kookaburras that reside in our gum trees. We’ve got ducks that swim in our dam … to be involved in local events can sometimes build meaningful connections, contribute positively, and feel more rooted in a township.
“Maybe growing up in a rural setting may
lead to my daughter, one day, taking up a local career path in the township.”
The officer recommendation to the planning application was to issue a refusal, where officers stated building a home does not align with the purpose of the farming zone and not consistent with the orderly planning of agricultural land.
Cr Rod Ward said he felt Mr Filiz’s intent does in fact align with the purpose of this zone, as the landowner predicted living on the property could increase his productivity by about 60 per cent.
Cr Jarrod Bingham said he could see the merit in the application.
Lifestyle Brookfield milestone marked
Cake, bouquets, live music, and a buffet lunch were enjoyed by about 150 homeowners of Lifestyle Communities Brookfield to mark its 20th anniversary.
Hosted by the Brookfield Homeowners Committee, Social Committee, and the Lifestyle Communities organisation on Monday 20 October, the event honoured 20 years since its clubhouse opened – a space with a range of resort-style amenities including a gym, indoor heated pool and spa, bowling green, billiards room, library, and outdoor entertaining area.
Two residents who have lived at Lifestyle Brookfield for the whole 20 years –Jean Clarke, 102, and Sylvia Whitehead, 87, received certificates and a bouquet of
Singapore orchids each at the event.
Homeowners Committee vice president Teresa Butcher said “All the feedback has been very positive … we’ve had nothing but congratulations from the homeowners on the event. They said it was fantastic.”
“It was something that needed to be done, it needed to be organised … because we’ve got a change in management, it was better that we did it and it didn’t get overlooked,” she said.
The event also involved speeches and a sit down buffet lunch with champagne.
According to Lifestyle Communities, the clubhouse at Brookfield is muchloved by residents and is its “beating
heart” – with homeowners enjoying activities including swimming, socialising, enjoying long lunches, and playing bowls.
“Brookfield set the standard for every community that followed,” said Simone de la Harpe, executive general manager-experience at Lifestyle Communities.
“It’s where our journey began, and it continues to embody everything Lifestyle Communities stands for — belonging, connection, and a better way to live.”
There are currently 292 homeowners living within 231 homes, and a small number of homes are available from $369,000 for those looking to join this vibrant community.
“Ultimately, he wants to come and live in this great part of the world – so I think he should,” he said.
Cr John Keogh raised concerns about the application being in contravention of planning strategy clauses.
He said the property is in an area with the “highest productive land for commercial-scale agriculture,” and that approving the application to build a house on this land would set a “very dangerous precedent”.
In response to this, Cr Tom Sullivan said planning is an art – not a science – and that he felt it could alternatively set a “good precedent”.
Competition to help save lives
The state government and the Transport Accident Commission (TAC) are offering young Victorians the chance to use their creative skills to spread the road safety message and save lives.
The Split Second Competition, which invites Victorian creatives aged 18 to 30 to submit their attention-grabbing concepts for road safety campaigns aimed at young drivers.
This year the competition is open to filmmakers and content creators and will include two winning entries, each to receive a $5,000 cash prize and a production budget of $45,000 with a focus on low-level speeding or not wearing a seatbelt.
The two winners will also receive mentorship from Truce Films and creative agency TABOO.
Seatbelts are a focus of the competition for the second consecutive year, with road trauma data showing around a quarter of young drivers and passengers killed on the roads in the past decade were not wearing a seatbelt.
For the second time, one of the competition winners will be selected from a culturally and linguistically diverse community to ensure critical road safety messages are being tailored to engage as many young road users as possible across our multicultural state.
Entries are open until 9 November.
Melton councillor Phillip Zada, and Lifestyle Communities Brookfield residents Jean Clarke and Sylvia Whitehead received certificates and flowers at the event. (Glenn Wilson).
The Victorian Government is delivering real help, right now with over 90 different savings benefits. Like free public transport for everyone under 18 with a Youth myki from January, with savings of up to $755 per child.
Find out what you’re eligible for on the Service Victoria Savings Finder today.
Authorised by the Victorian Government, 1 Treasury Place, Melbourne
Pickleball for seniors
Moorabool seniors made their way to MARC Stadium on 22 October to give pickleball a try. The session was just one of many Victorian Seniors Festival events held locally throughout October. Another pickleball session will be held on 29 October, with a workshop about online scams, a line dancing class and a workshoponbladderhealthalsoplanned for the same day. The festival wraps up on 31 October with a diabetes workshop. Star Weekly photographer Damjan Janevski stopped by MARC Stadium last weektocheckoutthepickleballfun. Details:www.moorabool.vic.gov.au/
Celebrating kids
A National Children’s Week celebration was held in Melton on 22 October, giving families a chance to recognise the talents, skills,achievementsandrightsofchildren. The event at Melton Community Hall included a butterfly tent, giant bubble show, art, craft and sensory activities and an opportunity to meet local emergency services. Star Weekly photographer DamjanJanevskicapturedthesepictures.
Anne Dodman. 512185_05
Doug Soden. 512185_01
David Cook. 512185_08
Jeff Teady. 512185_03
Ron Richardson. 512185_07
Len Casey. 512185_02
Far left: Darien, 5, and Dustin, 3, with mum MJ Aguilar. 511892_05
Left: Carissa West and her kids Darcy, 4, and Audrey, 1. 511892_03
Below: Becky Bubble and Aston, 5. 511892_01
Swati Bhatia and Lexie, 2. 511892_06
Jacob Sergeant and his daughter Isabelle, 3. 511892_02
Dao Nguyen and son Martin, 2. 511892_04
From Hume to centrestage
Victoria Mantynen has skills in music performance, dancing and circus training, but it’s juggling all that with running her own production company that proves the most inspiring part of her story. Mantynen talks performing arts and its place in the world with Jack O’Shea-Ayres.
For former Hume local Victoria Mantynen, there has never been a time when the performing arts weren’t part of her life.
“I couldn’t even tell you a time where I wasn’t involved in music, arts and creativity,” Mantynen said. “It was always encouraged, always there.”
Today, Mantynen, 33, is a full-time performer, musician and creative director, balancing acting, singing, dance and even circus work with running her own production company, Little Pine Tree Productions,thenameanodtoherFinnish heritage.
Her surname “Mantynen” translates to “little pine tree” and the company has quickly established itself as a platform for bold original works which combine music, storytelling and theatrical flair.
But for Mantynen, creating her own company wasn’t just a passion project. It was a necessity.
“Inthisindustry,ifyou’rewaitingaround for someone to give you an opportunity, you’llbewaitingalongtime,”sheexplained “At a certain point, you just have to make your own work. I was finally at a stage where I had the skills, the confidence and the community around me to produce high-quality work myself.”
I don’t sing just for the sake of it. There has to be a reason, a journey, a connection
- Victoria Mantynen
Mantynen’s artistic roots run deep in Melbourne’s north. She grew up in the Hume region, moving through suburbs like Tullamarine, Greenvale, Craigieburn and Roxburgh Park as she delved deeper into her creative endeavours.
“Most of my childhood memories are tied to those areas,” she reflected.
“It’s changed a lot since I grew up, but that sense of connection is still there. Hume was the backdrop for my first steps into performance and creativity.”
Mantynen’s family was central to nurturing her love for the arts.
“Everyone in my family has always been musical or artistic in some way,” she said. “My family really exposed me to the arts, plus the fact that they really valued and encouraged it was a huge influence.”
Education played a major role too. Mantynen attended schools which placed strong emphasis on the arts, providing access to music, theatre and creative opportunities many students only dream of, later sharpening her skills with a Bachelor in Musical Theatre.
Unlike many who find themselves stumbling into the artistic and creative realm, Mantynen has never considered an alternative career path. For Mantynen, it’s all about the music, dancing and acting, and using the skills she’s honed over the years to give back to her community.
“There was never a time I thought it was normal to not sing or perform,” she said.
“It wasn’t even a choice, it was part of who I was. Once you’ve got the bug, there’s nothing you can do about it.”
Her philosophy is one of openness: never close doors, say yes to almost every opportunity you can and keep learning every day, advice she credits to an early mentor who warned her not to narrow her career options.
“If you only ever want to do Shakespeare and turn down everything else, you might end up with no career at all,” she mused.
“That stuck with me. I’ve always tried to stay adaptable and build a wide skill set.”
Which is exactly what Mantynen has done over her years as a stage performer.
Not only does she write and produce her own original works, but she goes the extra mile in all her acting, music performances as well as working with other musicians, circus and dance performances and even gazelle and burlesque shows.
It’s an approach which has paid off.
Mantynen has worked across stage productions, musical theatre, circus and festivals, developing a reputation as a versatile and dependable performer.
Highlights include appearing in Melbourne Shakespeare Company’s ‘A MidsummerNight’sDream’and‘Tempest’, playing Princess Aurora in ‘Sleeping Beauty’ and even as multiple characters in ‘The Living Museum of Erotic Women’, to name just a few of Mantynen’s long list of accomplishments.
“The more you can do, the more opportunities open up. People are looking for performers who can sing, act, move, and bring something extra. That breadth of skills is what makes it possible to work full-time in this industry,“ she said.
It goes without saying running a production company is no small feat, especially when coupled with being constantly cast in work all over the place and taking every opportunity life throws at you.
Mantynen writes the shows, manages the musicians, designs posters, handles ticketing and liaises with venues.
“I do everything,” she laughed.
“It’s exhausting but rewarding. You just do it because if you don’t, no one else will.”
She acknowledges the challenges of sustainingacareerinthearts-especiallyin the wake of a tough period felt throughout the industry during and following the Covid-19 pandemic.
“A lot of people older than me say this is the hardest time they’ve ever seen in terms of scarcity of work. Venues are closing, funding is tight. But at the same time, I don’t know anything different. I came into the industry when it was already hard, so I expected it to be that way,” she said.
For her, the answer lies in resilience, adaptability and community.
“Supportiscrucial,whetherit’scouncils, governments, or just people showing up and buying tickets. The artists thrive when people invest in them. Without that, it’s difficult. But artists are resourceful, we make it work.”
When asked about her inspirations, Mantynenresistsnarrowingitdowntoone figure.
“It’s never been about one person I wanted to copy. Inspiration comes from so many places - family, colleagues, teachers, othermusicians.Evenpeoplewhodon’tget public recognition can have an enormous influence on your path.”
At her core, Mantynen sees herself as a singer.
“That’s my first identity, but singing is always tied to storytelling,” she says.
“I don’t sing just for the sake of it. There hastobeareason,ajourney,aconnection.”
Mantynen’s training in musical theatre shines through in her performances, which are often described as equal parts
music and narrative.
Dance and movement also play a major role, though sometimes by happy accident.
“People often mistake me for a dancer,” she laughed.
“It’s not my main skill, but it’s something I’ve picked up along the way.”
Even circus performance has become part of her repertoire. A chance encounter with another performer introduced her to aerial work, which she went on to study.
“That’s how it happens. Someone sees you perform and says ‘You’d be great at this,’ you give it a try, and suddenly you’ve added another string to your bow.”
For Mantynen, the future is filled with possibilities. With Little Pine Tree Productions,shehopestocontinuebuilding original shows which showcase both her talents and those of her collaborators. The company’s work, she said, is about more than entertainment - it’s about creating community and connection.
“You never know where the world will takeyou.Butthat’spartoftheappeal.Every project opens doors you didn’t expect. That’s why I keep creating my own work. It gives me control, and it gives me freedom.”
As for advice for aspiring performers, Mantynen doesn’t hesitate.
“Say yes. Stay curious. Keep learning. Never think you’re everything. And most importantly, don’t close doors. You never know which one might lead to your next stage.”
From her childhood in Hume to stages across Melbourne and beyond, Victoria Mantynen’s journey is proof of what can happen when passion, persistence and creativity collide. For her, the arts aren’t just a career - they’re a way of life.
Mantynen’s own Rosie Show, performing greats from the late Rosemary Clooney and her many collaborators. (Pictures: Supplied)
Performer, musician and creative director Victoria Mantynen.
Furlong 2025 gets underway over Melbourne Cup carnival
A statewide road policing activity called Operation Furlong 2025 will be conducted overtheMelbourneCuplongweekendfrom Friday 31 October to Tuesday 4 November. This has been identified as a period of potentially high risk in terms of exposure to road trauma to the Victorian community.
Focus on Road Safety
Operation Furlong 2025 aims to increase driverawarenessandencourageresponsible driving to reduce the exposure to road trauma on road users during this time of increasing road use. Police will target high risk driving that has been identified as the maincausesofliveslostandseriousinjuries in crashes, including:
• Speeding
• Distracted driving, especially involving mobile phones
• Driving under the influence of alcohol or drugs (impaired driving)
“We’ll be out in force to educate drivers and enforce the rules, with a view to preventing lives lost and serious injuries” says road policing advisor Senior Sergeant Fletcher Pearson. “Our goal is to prevent tragedies and keep everyone safe.“
Senior Sergeant Pearson, from Westgate Highway Patrol, said the operation will be conducted throughout all operational police regions and police service areas during the five days. Police will be out in force both to educate drivers and to enforce road rules, with a view to preventing lives lost and serious injuries.
The extra-long weekend provides an opportunity for families to free themselves from their usual commitments and it is
anticipated that large numbers of people will use Victorian roads, often driving long distances in unfamiliar driving conditions.
The times of highest risk are when people are leaving for holiday destinations and returning home
We’re watching your speed. Are you?
Motorists are requested to stay within the speed limit, don’t drink alcohol or take drugs and drive, leave your mobile phone out of reach, wear your seatbelt and make sure you are well rested.
Fatigue is one of the biggest killers and is a major cause of the loss of life on Victorian roads. Drivers are requested to plan their trip, be patient and ensure that you take at least a 15-minute break at least every two hours and don’t drive if you are tired.
Drivers planning to travel during this period can expect to see an increase in vehicles travelling on our major freeways and highways throughout the state.
Road trauma isn’t just about the lives that are lost – it’s about the enormous impact on the community, from the family members, to the emergency services workers who have to deal with these tragedies on a daily basis, to the police who have to deliver the devastating news to loved ones.
Community
Effort
RoadSafe Westgate Community Road
Safety Council chairman Jim Giddings said it has been demonstrated that speed is a contributing factor in most road crashes. Therefore stay within the speed limit and drive to suit the conditions.
Speeding affects both the risk of a crash happening and the severity of injuries sustained when a crash does happen.
Mr Giddings said to make sure you’re not putting yourself or others at risk on the roads, put your phone away where you can’t betemptedtouseit,forexampleintheglove box or in the boot to avoid being distracted.
He said the work of his group along with initiativesliketheOperationFurlongduring the Melbourne Cup long weekend would hopefully reduce the number of serious road crashes on our roads. He asked the community to report speeding drivers to Crime Stoppers on 1800 333 000.
Plan Your Trip, Stay Safe
Here are some key tips for a safe long weekend:
• Plan your trip: Check traffic conditions and plan rest stops to avoid fatigue
• Stick to the speed limit: Every km/h over the limit increases your crash risk
• Don’tdrinkanddrive: If you plantodrink, arrange alternative transport
• Put down your phone: Distracted driving is dangerous
• Wear your seatbelt: It’s the law and could save your life
• Get enough sleep: Fatigue impairs your driving ability
• Check your vehicle: Ensure tyres, brakes, lights, and windscreen washers are in good condition
Holiday driving has its challenges and drivers should drive in the hours they are normally awake, take regular breaks to reduce fatigue and allow extra space between vehicles.
Ifyouplantohaveadrinkthenplannotto drive,takingabigrisklikedrinkanddriving is just not worth endangering your live or the lives of other road users.
Before embarking on any driving trips driversshouldchecktheirtyres,windscreen washers, brakes and lights.
Remember, travel so that you arrive at your destination safely and enjoy your Melbourne Cup Holiday weekend.
Western suburbs resident and mother of three, Melissa, whose name has been changed, has lived through childhood trauma, domestic violence and years of addiction.
“My drinking escalated badly. It was my way of numbing everything. Everything around me shattered. I got out of the DV (domestic violence) but I kept struggling,” Melissa said.
Melissa then accessed IPC Health’s AOD (alcohol and other drug) service, which she said has transformed her life.
“My counsellor helped me through so much. I stayed with her for about six to eight months, and she gave me the
MY PLACE
confidence to get back out there.”
AccordingtoIPCHealth,thedemandfor community-based mental health services isincreasingrapidly.In2023–24,Victorian health services provided 1.8 million hours of community-based mental health care, and by 2036–37, demand is projected to reach between 3.4 and 8.9 million hours.
After initially accessing services, Melissa’s health began to deteriorate again.
“I had a lapse, became suicidal and tried to take my life. I re-engaged with IPC Health, and again, it was an incredible support. It felt like a reset,” Melissa said.
“My counsellor is non-judgmental, she
gets it. Between her and the gym, which I go to seven days a week now, I’ve found ways to cope. I feel stronger than I did before,” Melissa said.
Melissa said mental health support needs to be more accessible.
“There are so many people suffering in silence. I was lucky to survive my suicide attempt, but many aren’t. We need more services like IPC Health,” Melissa said.
IPC Health chief executive Jayne Nelson urged the government to increase investment into AOD and mental health services.
A state government spokesperson told Star Weekly the recent Victorian budget
focuses on frontline services.
“...including community-programs for priority groups, suicide prevention, support for children and young people and acute mental health services,” the spokesperson said.
Thestategovernmentsaidithasinvested over $590 million in mental health and wellbeing, and the AOD system, in 2025-26.
From this funding, two new locations will be established this year in Wyndham and Maribyrnong, as well as additional servicestoLocalsinMeltonandBrimbank.
Lifeline: 13 11 14
1800 RESPECT: 1800 737 732
Bacchus Marsh resident Edward Kays is the founder, director, and instructor of Neon Cowboy Bootscooters and has a long connection to the region. Oscar Parry spoke with Edward about what he likes most about Bacchus Marsh and line dancing.
What is your connection to Bacchus Marsh?
I’ve grown up here … I wouldn’t necessarily say born and bred, but I’ve spent probably about 36 of my 40 years in Bacchus Marsh. Wenttoschoolhere,nowdoinglinedancing here.
Whatdoyoulikeaboutwhereyoulive?
Probably the main thing about it is the fact thatwe’reliterallysmackbackinthemiddle of Ballarat, Melbourne, and Geelong. It’s far enough away from the city that you’re not having all the city issues but it is only like 45minutesintotown–innerMelbourne.So you’ve still got that country feel but it’s still close enough to do all the city stuff.
What, if anything, would you change aboutwhereyoulive?
I’m still partial to the older sort of country vibethatithad–it’sgettingalmostabitmore metronow...stillpartialtothecountryvibe that Bacchus Marsh used to have, and in some ways, does still have.
When did you first get into line dancing, and what are some of the things you enjoy mostaboutit?
I started line dancing, I would have been about six. Basically, my mum got me into it. Sheusedto[do]linedancingandtherewere days I was home from school, whether it be sick or pupil-free days, and she was like, ‘I’m notmissingoutonlinedancingjustbecause you’re home – you’re coming with me’. So, thefirstfewtimesIwent,Isortofdidmyown thing and sat on the side, but eventually,
got up, had a go, joined in – and, yeah, got hooked...therest,astheysay,ishistory!
The main reason I love line dancing –besides the fact that it’s exercise and good foryoubothmentallyandphysically–it’smy zentime,mymetimewheretheonlyperson I have to think about is me. I don’t need to think about what bills have to be paid, what’s happening here, what’s happening there, it’s literally in the moment. That’s
probably the biggest bit I love about it. On topofthat,you’vealsogot…thefriendships that you make … I’ve met people from all over Australia, I’ve met people from all over the world, all through line dancing.
If you had to pick your some of your favourite line dances, which would they beandwhy?
That’s a hard one … there are quite a few
... but a couple of old school ones that I’m still quite partial to – ‘Chill Factor’ is one. Another one would be ‘Badge of Honour’. And then a couple of the new ones that I’m really liking at the moment – one is ‘No Remorse,’ and the other I’m really liking at the moment is ‘Can’t Stop, Won’t Stop’ as well. They’d be my top two old school and my top two new school.
Bacchus Marsh resident and Neon Cowboy Boot
Scooters founder, director, and instructor Edward Kays. (Damjan Janevski) 505720_06
Spooky Halloween craft
Each month, Stephanie Martinez will share an exciting craft project designed to inspire and spark creativity.
Stephanie starred in the first season of Making It on Network 10, where she discovered and ignited herpassionforcrafting.
Join Stephanie as she explores the endless possibilities of crafting and turn everyday materials into somethingextraordinary.
Thismonth,Stephanieiscreating aspookyghosttassel.
Spooky ghost tassel
Step
Step
Held by the Victorian Turf Club, the first Melbourne Cup was run in which year?
2. The highest Melbourne Cup Day attendance of
3. And which horse won in that year?
4. This year the annual Melbourne Cup Trophy Tour commenced with a visit to which city?
The winning strapper is presented with what trophy?
What is the type and colour of the traditional buttonhole flower worn on Cup Day?
Bart Cummings holds the record for winning the Melbourne Cup how many times?
The silk colours of which famous Cupwinner featured the stars of the Southern Cross?
Sheila Laxon, joint trainer of 2024 winner Knight’s Choice also prepared which other Melbourne Cup winner?
10. Which owner was represented by six runners in the 2013 Cup?
11. Which Melbourne Cupwinning horse originally raced in New Zealand under the name Flash Guy?
12. The 2024 Cup winner Knight’s Choice was bred near which NSW country town?
13. In 1965 famous British supermodel Jean Shrimpton sparked controversy by wearing what at Flemington?
14. Which Melbourne Cup winner was trained in Germany?
15. Which famous Cup winner carried 66kg to victory?
16. Runners in the 2025 Melbourne Cup will compete for how much prize money?
17. What percentage of the prize money does the winning jockey receive?
18. A popular cocktail served at Flemington on Cup day is called what?
19. Which country did 2006 Cup winner Delta Blues represent?
20. Which champion Australian jockey of the modern era fell off at his first ride in the Melbourne Cup?
21. How many female jockeys have ridden in the Cup?
22. What has been the most successful barrier in Melbourne Cup history?
23. And who is the only horse to have won the Melbourne Cup from barrier 18?
24. Who was the last grey horse to win the Melbourne Cup?
25. The race is now run on the first Tuesday in November, but originally it was run on which day of the week?
26. Which horse was the first and only to win the ‘Spring Grand Slam’, winning the Caufield Cup, Cox Plate, and Melbourne Cup in the same year?
27. And which country did that horse come from?
28. Queen Elizabeth II’s only attempt at capturing Australia’s crown for stayers was with which horse?
29. Who was the last favourite to win the Cup?
30. Winning connections of the first Melbourne Cup received what?
1.
Stephanie Martinez.
Scan the QR code and follow the links for more creative ideas.
COMMUNITY CALENDAR
WANT YOUR EVENT LISTED? Community Calendar is made available free of charge to not-for-profit organisations to keep the public informed of special events and activities. Send item details to Star Weekly Community Calendar, Corner Thomsons Road and Keilor Park Drive, Keilor Park, 3042, or email to westeditorial@starweekly.com.au by 9am Wednesday the week prior to publication
Take weight off naturally
Struggling to lose weight? Struggling to get motivated? Want to try and do it in a friendly and less stressful atmosphere?
Come and join TOWN (Take Weight Off Naturally) every Tuesday at 6pm at the Darlingsford Barn, Darlingsford Boulevard, Melton.
Catherine, 0416 612 517, or Bob, 0411 824 739
Parkinson’s support group
The Melton Parkinson’s Support Group meets on the second Thursday of the month, 10.30am-12.30pm, at Kurunjang Community Centre, 33-35 Mowbray Crescent, Kurunjang. New members and carers are welcome.
Helen, 0409 186 576
Darley Neighbourhood House
The Darley Neighbourhood House and Learning Centre is at 33-35 Jonathan Drive, Darley. It offers free and low-cost activities for all. There is a monthly repair cafe, a community pantry, a fortnightly chatty cafe and venue hire is available.
www.bit.ly/DNHnow, or 5367 4390
Fishing club
Didyabringyarodalong Angling Club of Melton and Bacchus Marsh is a fishing club that welcomes and encourages people of all ages, genders and fishing abilities to partake in enjoying the outdoors in a relaxing and friendly environment. The club holds monthly fishing competitions at various locations, fresh and saltwater. New members are most welcome.
Andrew, 0407 303 438, or Wayne, 0414 785 366
Melton South Community Centre
Melton South Community Centre at 41 Exford Road, Melton South, is offering a range of computer classes, cooking classes, and lots more. All classes are starting soon. The program can be viewed on the community centre’s website.
9747 8576 or meltonsouth.org.au
Rose carers of Maddingley Park
The group meets every Wednesday from 10am-noon at the Commemorative Rose Garden, Maddingley Park on the corner of Taverner Street and Grant Streets, Bacchus Marsh. Volunteers maintain the two rose gardens at the park. Volunteers are welcome and no experience is necessary to join .
Elaine, 0400 052 857 or Judy, 0428 463 538
Bacchus Marsh Ladies Probus Club
Meets on the first Thursday of every month from 10am-noon at the Avenue Bowling Club on 254 Main Street, Bacchus Marsh Krystyna, bacchusmarshladiesprobus@ gmail.com
Melton Valley Ladies Probus
Melton Valley Ladies Probus Club meets on the second Friday each month at 10am at Melton Country Club. New members welcome.
Ann, 0425 705 150
Sewing in Melton
If you love sewing, head on down to the Melton South Community Centre. Bring along your machine and materials and make new friends as you swap tips and work on your own projects. 9.30am–3pm each Tuesday. Each session costs $5. 9747 8576
Melton South Community Singers
Singers of all levels are welcome at the Melton South Community Singers. This free and friendly group meets at the Melton South Community Centre and rehearses
This week’s photographer’s choice photo is of Brookfield resident Jacqueline Licitra’s elaborate Halloween decorations in her front yard. Pictured is Jacqueline with her grandsons Maddix, 3, and Zanon, 1. (Damjan Janevski) 511243_01
to perform at local venues and events. The group meets from 12.15-2pm on the first and third Tuesday of each month. No bookings are required.
Sue, 0400 082 413
Bacchus Marsh Senior Citizens
The Bacchus Marsh Senior Citizens look forward to meeting up with new members at the Andy Arnold Centre, 10 Bennett Street, Bacchus Marsh. hopem@optusnet.com.au
Melton Concert Band
Rehearsals are on Thursdays from 7.30-9.30pm at the Bridge Road Community Centre, Bridge Road, Melton South. Musicians of any age who are able to read music are welcome to come along with their instrument (oboe, bassoon, flute, clarinet, saxophone, trumpet, trombone, tuba, percussion). Please contact if you are intending to visit.
0401 474 582
Cancer Support Group
MelMarsh Prostate Cancer Support Group is for prostate cancer patients and their carers and meets on the first Thursday of the month, from 12.30-2pm, at Melton South Community Centre. Attendees are encouraged as members share their journeys through what could be a very traumatic time of their lives. Explanations of medical terminology used in the
treatment of this cancer are given in this group.
Grenville, 0412 741 865
Friendship Group
For all aged 60 and older – are you looking for some new friends? Then this group is for you. The Melton and Surrounding areas Friendship Group meets fortnightly for a coffee and chat night and organises affordable outings such as dinners, movie nights and many social events – plus occasional weekends away, and local or overseas holidays.
Shirley, 0419 006 525 or Vera, 0406 493 734
Over 50s games and cards
Melton Club 50+ runs a games and cards afternoon every Sunday from 2-4pm at Kurunjang Community Hub, 33 Mowbray Crescent, Kurunjang. Join this friendly group and make new friends over games and a cuppa.
Denise, 0403 840 241 or Sharon, 0407 461 069
Women’s Support Group
Women’s Support Group Melton is for any women who feel they would like to attend a peer support group which is relaxed, friendly and non-judgemental. The group meets weekly at 1pm on Mondays (except for public holidays) at Djerriwarrh Neighbourhood House, 239 Station Road,
Melton. The group can discuss most subjects that may be of help
https://ow.ly/QVwJ50Q5g42
Chatty Cafe Melton
Are you feeling lonely, isolated or just wanting to make some new friends? If so, Chatty Cafe is for you. The group meets on Friday mornings at 10am for delicious free coffee from Latin foods and wines at 10 Wallace Square, Melton.
The Rotary Club of Caroline Springs is inviting new guests to join its meetings in person or via Zoom. Meetings are held every Wednesday at the Western Emergency Relief Network in Ravenhall from 7pm.
rotarycarolinesprings@gmail.com
Melton Men’s Group
Melton Men’s Group meets every Thursday from 5-8pm at Arnolds Creek Children’s and Community Centre at 19 Claret Ash Boulevard, Harkness. Focusing on senior men’s mental and physical wellbeing. Join them for a cuppa and a chat, listen to guest speakers and participate in activities including, carpet bowls, pool, table tennis, cards and chess.
Trevor, 0404 494 649 or https://meltonmensgroup.home.blog/
Ribbons weave memories
Artist Yoonjung Kim records emotions and sensations through painting, drawn from personal memories and experiences, in a new exhibition opening in Brimbank this month.
‘Interwoven’ is Kim’s first solo exhibition since relocating from Seoul to Melbourne in 2020.
“Theworksexplorememoryandemotion through painterly gestures, inspired by decorative objects, plants, and animals discovered across Melbourne’s western suburbs,” Kim said.
A ribbon motif also features throughout works, which Kim said she uses to unfold
her inner narratives.
“The ribbon is a really familiar object to me. It seems to bring out all sorts of emotions. I wanted to use them as a structure to hold or wrap my emotions or memories,” Kim said.
For Kim the ribbon also evokes joy and celebration, love and friendship, while carrying the weight of social expectations and tension.
Kim said other objects in the paintings act as symbols for her emotions.
“Sometimes it’s nostalgia, very warm feelings in my childhood, and sometimes anxiety too,” she said.
Kim said she hopes audiences reflect on their own lives through her works.
“I want them to find their own memories through my paintings because my work is a bit symbolic, people can feel all different feelings and memories,” she said.
‘Interwoven’, supported by Brimbank council, is open from 24 October until 10 January at the Bowery Gallery, 33 Princess Street, St Albans.
The exhibition is free of charge and is available to view Monday to Friday from 9am-5pm and on Saturdays from 9am-12.30pm.
Details: creativebrimbank.com.au
Join Lucy Durack for a festive performance
Who said it was too early to start getting intothefestivespiritandspreadChristmas cheer?
Actress,singerandtelevisionpersonality
Lucy Durack will be bringing her voice and swagger to the Encore Events Centre in Hoppers Crossing on Tuesday 9 December.
Running from 2.30-4pm, the joy of the festive season will be on full display with a show of much-loved Christmas classics for the whole family to sing along to.
A music theatre and carols sensation, Durack will ring in the holiday season with all-time favourites like ‘Silent Night’, ‘All I
Want for Christmas’, and ‘O Holy Night.’?
If Durack’s name is unfamiliar you are bound to have seen– or heard– her sometime in the last two decades.
Some of her most notable roles have been playing Glinda in the Australian production of Wicked, and Elle Woods in the Australian production of Legally Blonde.
MorningMelodiesisafeel-goodmorning music series held on the second Tuesday of each month.
It’s a chance for friends to come together and experience great music, sing and
dance along to many iconic hits from an Aussie icon.
Whileitisapopularstapleamongretired members of the Wyndham community and from elsewhere in the west, everyone is invited to come and bring those closest to them.
It may only be October, but it is never too early to start making preparations for the silly season.
Tickets are $14 and include a morning tea. Details: https://www.wyndham.vic. gov.au/whats-on/morning-melodies-lucydurack-christmas-show-0
DJ series set to bring summer vibes to Yarraville
It’s going to be all pink flamingos, postcard-perfect palm trees and tropical cocktails at Kindred Bandroom in Yarraville as it hosts a new summer DJ series, Del Boca Vista.
Set to become a new Sunday ritual in the inner west, Del Boca Vista will offer music, community, nostalgia, and that laid-back banana lounge energy where everyone’s welcome to catch a groove, sip something cold, and keep the weekend going.
Each week, a rotating line-up of the city’s best selectors will get you moving and grooving, spinning funky selections from the arvo to golden hour as part of this free series that is family and dog friendly.
It begins on Sunday 26 October with cosmic-dancegroupMildlifeDJsalongside 6-piece groove unit Steppers (live) and DJ Colette.
From then on, weekly line-ups will be posted on Kindred Bandroom’s Instagram page, but regardless of who’s on the decks,
Halloween creeps into Moorabool
Jack-o’-lanterns will light up Moorabool this week as residents prepare to celebrate Halloween –with several events held across the municipality marking the spooky occasion.
Younger residents aged 11–17 are invited to the council’s ‘Youth Spookaball’ event at the Darley Civic Hub Pavilion on Thursday 30 October for an evening packed with games, activities, music, and dancing.
Attendees are encouraged to come dressed in their best Halloween costumes for the chance to win a prize.
The event will run from 6–8pm and registration is essential, with details available on Moorabool’s website.
Another opportunity to dress up in your scariest attire is the Halloween Fun Fest, which will be hosted at Rotary Park in Bacchus Marsh from 4–10pm on 31 October.
Itwillincludeananimalfarm,large format games, market stalls, food trucks,dancingfun,andcompetitions with prizes.
There will also be a screening of the 2019 animated supernatural comedy ‘The Addams Family,’ following the quirkyandmuch-lovedfamilycreated by cartoonist Charles Addams.
Entryis$5atthegate,andtheevent is hosted by MooraFun.
MooraFun event coordinator Dotty Hazel said this will be the third year of running the event, with previous festivals attracting positive feedback.
She said that attendees could leave the event to do some trick-or-treating andthenreturn,aswristbandswillbe supplied upon entry.
Pets are welcome if kept on a short leash.
Further details and contact information for this event can also be found on the Moorabool website.
funky groovers, vintage-themed cocktails and an unreasonable amount of flamingo content is guaranteed.
So grab your cabana wear, come and chill by the alligator infested shell pool, let your hair down, and get down to Del Boca Vista where it’s always Sunday.
The unadulterated good times are at Kindred Bandroom, 3 Harris Street, Yarraville, every Sunday afternoon from 2pm.
Details: https://kindredstudios.com.au/
DJ Colette is playing at Del Boca Vista, a new Sunday DJ series at Kindred Bandroom. (Supplied)
Lucy Durack. (Supplied)
Artist Yoonjung Kim. (Supplied)
Due
For all enquiries, please call the Melton City Council events Team on 9747 7200
Star Weekly seeks an enthusiastic Full or Part time Sales Executive to work across our print, digital, social and online platforms.
Star Weekly is an independently owned company which prides itself on its long history of community experience but also its investment in the future.
The successful applicant will need to possess good people skills to enable them to meet with local businesses to sell solutions through our advertising platforms to help promote their business.
Applicants will need their own reliable vehicle for which we will provide an allowance.
The position is salaried, plus we offer an open ended commission scheme.
Send your application letter and resume to: Advertising Sales Manager, Mandy Clark mandy.clark@starnewsgroup.com.au www.starnewsgroup.com.au
PUZZLES
To solve a Sudoku puzzle, every number from 1 to 9 must appear in: each of the nine vertical columns, each of the nine horizontal rows and each of the nine 3 x 3 boxes. Remember, no number can occur more than once in any row, column or box.
Banish (5) 8 Perilous (9) 9 Lazy (4) 14 Combination into a whole (9) 16 Across the region 17 Variety of hot drink (5,3) 19 Free time (7)
22 Dividing walls (5)
23 Aid (4)
25 Passageway between seats (5)
26 Small duck (4)
1. Linen is made from the cellulose fibres of which plant?
2 How many points is the letter Y worth in a game of scrabble?
3 A common dessert component, frangipane is made primarily from what ingredient?
4 CanneryRow is a 1945 novel by which American author?
5 The nicknames ‘Satchmo’, ‘Satch’ and ‘Pops’ belonged to which influential Jazz singer and trumpeter?
6 Morel, lion’s mane, oyster and enoki are all types of what?
7 What spirit is used to make Irish coffee?
8 On February 3, 1959, which three American musicians were killed in a plane crash near Clear Lake, Iowa?
9 In what year did Ireland join the European Union?
10 What was Amy Winehouse's (pictured) last studio recording before her death in 2011?
Rear view in Forester focus
By Derek Ogden, Marque Motoring
ThenewForester:Ah,thattakesmeback.
While Subaru’s most popular model has taken up with the hybrid age, changes are mostly cosmetic, including cabin layouts that have not changed much over the past four years, no impediment to the many Foresterfans,ofwhichtherearemany.
Needless to say, there is an impressive list of standard equipment in the Forester, right down to the bargain basement. Things such as Subaru Intelligent Drive (IntelligentandSportmodes),X-Modewith hill descent, front cornering lamps and steering responsive headlights, dual zone air-con, six-speaker audio and EyeSight DriverAssistareonhanddependingonthe model.
Prices start at $43,490 for the entry-level Forester and includes seven variants, four petrol only and three hybrids, featuring Subaru’s Symmetrical All-Wheel Drive sendingconstanttractiontoallfourwheels.
ATouringvariant,thetestvehicle,comes in at $50,990, while the range is topped off by the Forester Hybrid Touring at $55,990. Additions include gloss black radiator grille, leather and suede upholstery and 10-speakersoundsystem.
Making a debut in the new Forester is Subaru’s next generation Hybrid e-Boxer system mating a 2.5-litre horizontally opposed ICE with 90kW electric motor and 1.1kWhbattery,givingthevehicleaclaimed rangeofmorethan1000kmonafulltank.
Forester petrol and hybrid models are covered by Subaru’s five-year unlimited kilometre warranty and 12 months roadsideassist.
Styling
Subaru says the new SUV shows off a ‘bold evolution’ in Forester design that’s wider, more athletic and purpose-built for Australian conditions, with C-shaped LED headlamps, incorporating LED daytime running lights and cornering lamps for bettervisibilityatintersections.
While aerodynamics was a major consideration in shaping the vehicle –sleeker door mirrors mounted lower, for example – there’s still more than a nod to theoriginalruggedSUVshape.
All models have 18- or 19-inch alloy wheels, depending on the grade. The Touring rolls on the latter and is singled out for gloss black front grille, front and rearbumperaccents,plussidemirrorsand low-profileroofrails.
Every Forester sports an aluminium bonnet – reducing weight but adding strength with a view to enhancing pedestrian protection – while maintaining asolidSUVidentity.
Interior
Seatinghascomeinforparticularattention, with Subaru engineers working with anatomy experts to develop better support for the lower back and hips, helping keep the spine aligned and reduce tiredness on longjourneys.
Seat rails are mounted directly on to the chassis to minimise sway and absorb vibration giving a smoother ride, while safety is enhanced by a new side bolster design that helps reduce whiplash in a collision.
The Touring takes up leather and suede upholstery in black or brown with brown interiorstitchingandheatedandventilated frontseats.
Infotainment
Inside, the Forester has been revamped to lift comfort, connectivity and cabin
refinement. At the centre of the dash is an 11.6-inch full-HD infotainment touchscreen, designed for ease of use for wireless Apple CarPlay and wired and wirelessAndroidAuto.
An on-screen digital multi-function display and a second information screen arepositionedtoreducedriverdistraction. Belowisawirelessphonechargepad.
Front and rear USB ports include high-output USB-A and USB-C connectionsforfastercharging.Frontports offer convenient access for both device connectivity and power delivery, with rear ports enabling passenger charging, keeping tablets and smartphones powered upandreadythroughoutlongerjourneys.
The 10-speaker Harman/Kardon sound system with subwoofer supplies audio of a standard far beyond that expected in a mid-rangemarketvehicle.
Engines/transmissions
Petrol-only Foresters are powered by Subaru’s tried-and-true 2.5-litre Boxer engine developed for improved reliability andresponsewithlessnoise,vibrationand harshness.
Petrol-powered models feature Subaru’s latest-generation Lineartronic CVT, re-tuned for sharper performance and improved efficiency. A broader gear ratio range (now 8.1, up from 7.0) allows for stronger take-off acceleration and more relaxed highway cruising. Lower first and reverse gears aid hill climbing – even in reverse – while a new eight-speed manual modeenhancesdriverengagement.
ThisCVTispairedwithSubaru’supdated Active Torque Split AWD system, which
dynamically adjusts torque distribution –optimised to the vehicle’s weight balance – to deliver better steering response and more confident handling across varying surfaces.
Safety
One thing that has changed dramatically over the years since the first Forester made landfall Down Under is protection of passengers and pedestrians. For a start, new-generation vehicles, across the board, are fitted with nine airbags, including far-sideandfrontpassengercushion.
Featured are a new wide-angle monocularcameradisplayingawiderfield of view, and the new emergency driving stop system, Subaru vision assist, and drivermonitoring.
Active systems include adaptive cruise control, autonomous emergency braking (front and rear), active torque vectoring, autonomousemergencysteeringandblind spotmonitoring.
The above is backed by emergency lane-keep assist, front side radar, lane centring,lanechangeandlane-keepassist.
Slow manoeuvres, including parking, is helped by rear cross-traffic alert, rear parking sensors, while traffic sign recognition and tyre pressure monitoring playtheirpartinsafedriving.
Driving
The2.5-litrepetrolengineproduces136kW of power at 5800rpm and 247Nm of torque at 3700rpm, its broad, flat torque curve ensuring smooth acceleration and strong
performanceacrossawiderangeofdriving conditions, particularly when overtaking orcarryingafullload.
A broader gear ratio range (now 8.1, up from 7.0) allows for stronger take-off acceleration and more relaxed highway cruising. Lower first and reverse gears aid hillclimbing–eveninreverse–whileanew eight-speedmanualmodeenhancesdriver engagement.
ThisCVTispairedwithSubaru’supdated Active Torque Split AWD system, which dynamically adjusts torque distribution –optimised to the vehicle’s weight balance – to deliver better steering response and more confident handling across varying surfaces.
Subaru rates Forester Touring fuel consumption at 7.9 litres per 100km on the combined urban/highway cycle with 180g/km carbon dioxide emissions. The test Touring recorded a tad over 10 litres per 100km around city and suburbs and less than six litres per 100 kilometres at motorwayspeeds.
Enhancedcabininsulationandvibration dampinghavereducedinteriornoise,while 360-degree Surround View Monitor has increased visibility and hence a pleasing on-andoff-roaddrivingexperience.
And with Subaru’s Symmetrical All-Wheel Drive system, enhanced Australiansuspensiontuning,plus220mm ground clearance, the Forester Touring is purpose built for local on- and off-road conditions.
Summary
No worries, the New Age Subaru Forester stillhasitsSUVchops.
Forester Touring is purpose built for local on- and off-road conditions. (Pictures: Supplied)
It took until week four of the summer season for the rain to impact matches across Melbourne’s north-west. However,
StarWeeklyphotographer Ljubica Vrankovic still managed to capture some of the action among the wet on Saturday.
Heavens open up on play
Taylors Lakes’ Arjun Upadhyay. 512547_10
Altona Roosters’ Thanuj Thisakuttige and Aiden Elkington. 512549_05
Melton’s Joel Mitchener. 512547_03
Sunshine United. 512549_01
One let slip for Bacchus Marsh. 512545_07
Shanin Silva bowls for Bacchus Marsh. 512545_25
Some of the crowd at the first turf game at Bacchus Marsh Racecourse. 512545_15
Some of the crowd at the first turf game at Bacchus Marsh Racecourse. 512545_17
Some of the crowd at the first turf game at Bacchus Marsh Racecourse. 512545_20
Taylors Lakes batters. 512547_07
Buzz of confidence is growing at Melton Centrals
After some tough years, things are slowly starting to build for Melton Centrals in the Riddell District Football League.
With a new coach, Ben Chapman in place, and some key signings having been announced, there’s a buzz around the club that hasn’t been for a long time.
While only new to the club, Chapman said he can feel there’s an excitement among those who have been around the past few years.
“When you’re a club that hasn’t had a lot of success, it can be hard to generate that,” he said.
“At the moment there’s genuine excitement around the place.
“The fact we’ve got players who want to be part of it, part of the club and part of what we’re building helps generate that.
“The club just wants success, naturally. Our supporters deserve it, it’s been a long time.”
Chapman said the amount of players that had bought in showed what there was a real excitement of what the club was trying to do.
The club’s recruits range from locals who have decided to call Centrals home, to some players who have played in the Victorian Football League.
“The ability to recruit from outside and players who have played at a fairly high level of experience and experienced successes, is something that’s really pleasing,” Chapman said.
“It means the message that we are selling people, they want to be part of which is the most pleasing thing.”
A number of players who have come across have played at Sunshine when Chapman was coach.
He said he was hoping that those who were part of Sunshine’s premiership and had success elsewhere, would impart that
on the rest of the playing group.
“Hopefullytheycanhelpdrivestandards and fast track the development of some of the players.”
Among the signings for Centrals include Nathan Carroll, who kicked 100 goals for Sunshine in 2024, Roxburgh Park’s leading goalkicker Cooper McPharlane, Buckley Chapman, Lane Tucker, Dylan Appleby and Paul Tomely.
Bulls pull off a great win
By Tara Murray
There was a little bit of everything as Bacchus Marsh kicked off life at Bacchus Marsh Racecourse Recreation Reserve with a win on Saturday.
The Bulls had been eagerly anticipating its clash with Wendouree, which marked the move to the turf wicket the club had been wanting for years.
Both sides entered the match without a win and when the rain started to fall it looked like there might be no result.
But the two teams managed to get on the ground with four minutes to spare before the cut off time and the Bulls were able to come away with the win on a day they won’t forget.
“Wewantedtogetthewinasthepressure was mounting up, it was a really good win,” coach Sam Crea said.
“Wehadafewplayersstandupduringthe game. It was more of a team performance.”
Crea said finally making the move to the Racecourse Reserve for games was something that had been years in the
making.
He said they made sure that it was a special occasion.
“Wehad10lifememberscomedownand spoke about what it meant to the club and past players,” he said.
“The committee have fought for this for the last 30 to 40 years to play on a turf wicket. The support of them made us stand a little taller.”
Wendoureemanagedtomake8-148from 48 overs as rain hovered around.
Crea said it rained the last half hour of Wendouree’s innings.
Bradley Croxford took 5-24 for the Bulls to be the pick of the bowlers.
The covers were quickly on and being a new ground, Crea said they thought that it would drain quick,
Crea said they always thought they would get back on before the 5.05pm cut off time, but it was a matter of if it started raining again.
The two sides got back out at 5.01pm and the Bulls needed 97 off 21 overs to get the win.
The biggest signing so far is Deer Park’s William Krithararis.
HewastheLionsvice-captainthisyearin Essendon District Football League premier division and has won several premierships at the club. He has also played VFL. Chapman said he would help set the standards.
While Centrals has been busy, Chapman said they still had a few more signings to unveil.
Chapman said one thing they spoke about as a club that in the past they were almost“thepoorcousin”toacertainextent among the Melton-based clubs.
“Payers have gone to Melton or Melton South and they really haven’t given a lot of thought to Centrals.
“The fact we’ve been able to generate from the local pool is really encouraging. We want to be a destination club.”
Tara Murray
Briefs
EDFL
Burnside Heights has announced its first new signing for next year’s Essendon District Football League division 2 season. James Elamarly has signed with the Bears for the next two seasons. “James is a tough, hard-working inside midfielder who loves the contest and never takes a backward step,” the Bears said on social media. “Renowned for his strength around the ball, clean hands, and ability to push forward and hit the scoreboard, he’ll add real depth and determination to our midfield group.”
Ballarat FL
Joel Freeman is returning to Bacchus Marsh for next year’s Ballarat Football League season. Freeman has had a stint away from the club, playing with North Ballarat and Newport but is now returning to the Cobras for next year. “Joel’s size and aerial strength make him a difficult match-up for any defence and he will be a be a great addition to our forward line,” the Cobras said on social media. “Joel has already played 46 games of senior footy, as well as two seasons with the Western Jets in the Coates Talent League.”
Netball
Crea said they felt like they could get it done.
“Weneededoneguytomakeagoodscore toget97,”hesaid.“ThatwasIanSpiteriwho in quick time, got a run a ball 50 and there were a few others around him.
“He’s 41 and he just keeps going.”
The win now gets the Bulls title defence up and going as they sit 1-2.
Crea said they already knew this year would be different to 12 months ago.
“Last year was just about being competitive,” he said. “Winning the grand final, the mind shifts and you now go out to win every game.
“We get the best of every team and we’ve seen that already. We can’t take anyone lightly.
“If we’re slightly off we can be beaten by any side.
“It’s been a bit of a wake up call [the first two weeks].”
Meanwhile, Darley’s match with Buninyong was abandoned.
The Lions were 3-148 off 35 overs when the match was called off.
Western Warriors’ Mia Lavis will be a Melbourne Vixens training partner for a second straight Suncorp Super Netball season. Lavis will look to build on her first season in the Vixens program, having made the move to Melbourne from her hometown of Howlong on the Victoria-NSW border ahead of the 2025 season. She joins the Warriors this season.
VTCA
Rain ruined the second day of play in the Victorian Turf Cricket Association on Saturday. In senior division, Sydenham-Hillside wasn’t able to add to the first innings points it earned on day one of the clash against Altona North, while in the Roy Picone Shield, Caroline Springs fell two wickets short of victory and Melton South Royals last to Kingsville.
FOR BREAKING NEWS, VISIT Web: starweekly.com.au
William Krithararis. (Jacob Pattison) 360908_21
William Krithararis. (Jacob Pattison) 360908_21
Leap To Fame cruises across the line as NZ beckons
New Zealand harness racing officials would have been delighted with the way champion pacer Leap To Fame cruised to the line in the Mimosa Homes Free For All at Melton on Saturday night.
Previous uncertainty surrounding the pacer’s trip across the Tasman to take his place in the biggest race day in this part of the world appears to have cleared.
In the aftermath of Leap To Fame’s comfortable victory over his nemesis from a fortnight ago Bulletproof Boy, trainer-driver Grant Dixon served notice that the $2 favorite for the New Zealand Trotting Cup was likely to face the starter.
“The main thing is how he pulls up. He feltthebestthisweekthewholetimehehas been down here so hopefully it’s onwards and upwards,” Dixon said.
“So I’ll have a talk to Trista (Dixon) and Kevin and Kay (Seymour) and probably do a blood on him on Monday to make sure he’s pulled up good after that run and make the final decision then.”
Kate Gath too was upbeat about the effortofCatchAWavefollowingthepacer’s unplaced performance in last week’s Victoria Cup.
“I thought he was very good tonight,” Gath said.
“Last start he had such a good run and if he goes like he did tonight last week then it’s a very different story and he’s right in it.
“We’ve got to try and sort him out because when he’s behind the leader he doesn’t seem to like it. He was good tonight and he’s clearly going well, so we’ll press on.”
As expected, runners from the country’s dominant freshman stable of Emma
Stewart fought out the finish of the Tatlow Stakes (2YO Fillies).
Ryan Sanderson on the favourite Pre Eminant was allowed to dictate the terms oftheracetosuithimself,whilestablemate
Willows Girl was camped on her back. Pre Eminant reeled off a slick 26.6 last 400 metres, holding on to score by a head from Willows Girl with Delizioso a further 12 metres away third.
“She’s really lovely horse to drive and she’s got a great motor,” Sanderson said.
Sanderson, who is part of Team Stewart, knew Willows Girl would be hard to hold out.
“The one on our back is a really quality horse and she hit the sprint lane in full flight and made it a good race between the stablemates.
“We got home in 26.6 and you can’t get home much quicker.”
Chan is on the rise
By Peter Howe
Friendship ties at primary school helped forge a budding volleyball career that has already seen this month’s Don Deeble Sports Star play for Australia.
Denise Chan only started her volleyball career in 2021 because her school friends enjoyed playing.
“I tried many different sports including gymnastics, dancing, swimming, soccer and table tennis because my dad played it. Only one took my passion,” she said.
Chan started playing competition in 2022 with Western Region Volleyball on a Friday night in a social competition, gaining immediate recognition.
She quickly made her first state team.
“I played for the Victorian state team in 2022 and 2023, in the under-14 and under-15 White team,“ she said.
“In 2022, I trialled late as an emergency due to a few players being unable to play and luckily made the team and ended up as the team most valuable player.
“In 2023 I was the captain and awarded MVP of the white team again.”
It was while playing in that team Chan was exposed to better players and began her journey on the elite pathway in Australian Volleyball.
In 2024, she had a breakout year.
She trialled for the School Sport Victoria volleyball team and made the squad.
Following that national tournament she was selected in the All Schools Australian team.
She was selected in the Volleyball Victoria under-16 blue team and was made vice-captain.
Chan was awarded MVP in her side’s gold medal winning performance.
While success came quickly, Chan kept thingssimpleandisverygratefulforallthe opportunities that come her way.
After competing in the 2023 Australian Youth Volleyball Championships as the team captain and MVP, she attended an Australian volleyball camp in late 2023 for young aspiring volleyball players.
“The next thing I know I getting an email saying I’d made the under-16 Australian team to play in Thailand. I didn’t even know they were scouting for that team,“ she said.
“While I knew most of the girls from playing against them at the under-16 Australian Championships we had never played together in a tournament until we arrived in Thailand. “We all quickly gave ourselves to the team, I had to learn a new role when one of our players took ill.
“While we didn’t reach the ultimate success in that competition it taught us all
so much about the game and what it takes to be the best.”
Chan returned from Thailand with a sore back but then continued to play back-to-back tournaments.
Sadly, that took its toll and she had to withdrawfromplayingin2025tobeableto rehabilitate her injury.
Chan has thrown herself into her rehab.
“One saving grace is that I attend Maribyrnong Sports Academy which allows me to rehab at school with strength and conditioning staff.”
She undertakes five sessions a week which all involve strengthening her back and whole-body movement.
Chan said her strengths are her composure and ability to play any role required
“Also my leadership skills which I
Faulkhead’s new coaching role
Three-time Darley women’s premiership coach Brett Faulkhead is staying at the club, taking on the role of the club’s inaugural under-19 girls coach.
Faulkhead, who guided the Devils to the past three premierships, had announced he was stepping down as women’scoachasitwastimeforanew voice for the group.
With plenty of young talent coming through, Faulkhead will take on the under-19 coaching role. He said he’s ready to introduce under-19 girls to the next stage of their football life.
“It will be an opportunity for them to learn, understand, and play at a different level whilst introducing structuresandgamestyles,improving their way of thinking during game play whilst at the same time, taking their current skills to the next level.”
Success to him is not measured by wins and losses, but about offering players opportunity and pathways within the club and beyond.
“Now that the under-19s has been introduced, it will allow the club to bridge the gap between the juniors and seniors,” Faulkhead said.
“We want our programs to foster skills for sports and life; such as self-belief, trust, team building, leadership, sporting skills, and enjoyment. Our success as a club is measured by the outcomes we can offer for our players on and off the field.”
Faulkheadsaiditwasaboutcreating their own identity in the under-19s.
There is set to be 15 players come up fromtheDevilsunder-16teamintothe new side.
suppose is helped by my composure,” she said.
When asked about her sporting heroes, Chan went quiet, before saying, “my dad, Ivan just ran his first marathon last weekend in Melbourne, he is my hero!”
WhatdoesthefuturelooklikeforChan?”
“My dream is to represent Australia at the Olympics in volleyball,” she said.
“I would like to pursue my career by getting into college in America playing sports and pursuing my academic goals.”
The Don Deeble Sports Star Award is sponsored by the Yarraville Club Cricket Club, Strathmore Community Bank, the Deer Park Club, Ascot Vale Sports and Trophies and StarWeekly
If you would like to nominate a monthly winner or attend a dinner, contact swrsportsclub@gmail.com or 0408 556 631.
“It will be challenging whilst at the same time exciting as we get the opportunity to pave the way for our current list plus our juniors coming through the ranks.”
The Devils are looking for players to join the new side.
Details: Janelle, 0405 495 676.
Brett Faulkhead has taken on a new role at Darley. (Jamie Morey Photography)
Denise Chan. (Ljubica Vrankovic) 412070_06
John Dunne
Leap To Fame. (Stuart McCormick)
Mustang players are keen get back on the green
New Melton coach Matt Blackburn has been itching to get out and get the Bowls Victoria weekend pennant, division 2, section 2 season underway.
Blackburn joined the club in the off season and replaces Todd Trewarne as coach, with the former coach now at Deer Park.
He said it had been a long pre-season.
“It’s probably been about three months, we’re looking forward to it,” he said.
“It’s been understanding what people play like and to get an idea of what is going on around the club.
“It has felt so long.”
Blackburn, who started playing bowls in Ballarat has spent the past five seasons at Fitzroy and has played in the premier competition.
It was a family connection that brought him to the Mustangs.
“Myyoungerbrotherplaysthereandthat makes it easier,” he said.
“My dad as well has come to the club. It’s been really good and an easy move to make.
“It’safamilyclubandmyyoungoneruns amuck. Everyone is so welcome.
“We had two girls playing in the state sides and around gets around them no matter what level they are playing.”
Blackburn said they felt they had put together a good squad for this season and
had a bit of depth to choose from. He said there were two or three players inthesecondsidethatwouldbepushingto playinthetopsideatsometimethroughout the season.
Trang joins Sharks
By Tara Murray
Premiers Hillside aren’t sitting on their handshavingannouncedthesigningofone of the Essendon District Football League women’s competition’s best ever players.
The Sharks, who won their first women’s premiership this season, have added a couple more pieces to the puzzle so far, led by Krissy Trang.
The three-time league best and fairest winner crosses from Burnside Heights, where she has played since the Bears came into the competition.
She is one of just two women’s players to win three league best and fairest awards.
Sharks coach Chris Daley said they were keen to chat to Trang when they heard that she was looking for a fresh start.
“Through some friendship groups it became known that she was looking to play elsewhere and play in premier division,” he said.
“Wewerekeentohaveachatandwewere able to convince her to come across. She spoke to a few clubs.
“She’s still improving her footy.”
Daley said when they heard Trang was availabletheywerekeentohaveherintheir team rather than playing against her with herdominatinginthemidfieldforanumber of years.
He said Trang was still keen to further her Victorian Football League women’s career as well as playing with the Sharks.
ShemadeherdebutforWilliamstownthis year, playing four games.
“We want to help her and push her within that program,” he said. “She is good enough [to play VFLW]. She’s played at premier division before and when you drop down a division below it can be hard.
“She held a high standard this year, finishing runner up in the league best and fairest.
“She’s really fit and fits in well.”
Daley, who has stepped up from assistant coach this season, said he knows you’re never going to win a second premiership with the same team.
As well as announcing the signing of Trang, the Sharks have Nikita Wright returning to the side after missing this year with a knee injury.
The Mustangs will play in division 2 this season after finishing seventh last season in division 1 and being relegated.
Blackburn said they felt they could find their way back up to division 1 and be a consistent side.
“We didn’t think we were that far off,” he said. “We lost a few games under 10 shots and we were in games.
“We win those games we find ourselves playing finals not relegated. We have to make sure we get the results right but we’re not looking to far ahead.”
Melton started its season on Saturday against Altona 2 at Altona.
ItwasawinningstartfortheMustangsas they won, 87 (14)-76 (4).
Bradley Thomas’ rink was the standout for the Mustangs with a 33-10 win.
Blackburn’s rink had a one shot win, while Oscar Jones’ rink lost by three shots and Todd Blackburn’s rink lost by 10 shots.
Meanwhile, in division 1, section 1, Bacchus Marsh lost its season opener to Brunswick, 89 (16)-73 (2).
Simon Cornock was the winning skip for Bacchus Marsh.
Tara Murray
Lions on a roll
Melton has already equalled its win tally from last year’s Victorian Sub-District Cricket Association season in the first two rounds.
After a tough season last season, the Lions have started the season strongly and sit undefeated after two rounds.
On Saturday, the Lions got the job done with the bowl against Taylors Lakes.
Taylors Lakes resumed at 0-31 in reply to Melton’s 155.
Kavin Ravi was quickly out for Taylors Lakes but at 1-91 it was well and truly on top with plenty of wickets in hand.
Taylors Lakes lost three quick wickets to slip to 4-102 but still had plenty of batting in the shed.
While Taylors Lakes put on 18 for thefifthwicket,itwasallMeltonafter that.
Melton took 6-24 to bowl Taylors Lakes out for just 144 in the 61st over.
Debutant Arjun Upadhyay top scored with 38, with Shijit Chandran Poovathingal (29) the only other bowler to pass 20.
Lachlan Peterson took 6-27 for Melton off nearly 20 overs to be the chief destroyer with the ball.
“She has VFLW experience as well and is a strong player for us,” Daley said. “I’ve spoken to her about where she might want to play.
“She’s played mainly as a defender in the last few years. [Former coach] Blaise [Ferraro] played her forward in one of the finals last year after she had already done her knee.
“She is open to playing different roles. We won’t rush her, but she’s like a new recruit for us.”
Daley said they had re-signed 98 per cent of their side from this year in a good signing going forward.
He said they were still unsure what Ash Thorneycroft’s plans were as she pursues VFLW coaching opportunities.
“We’ll see where that lands,” he said. “Hopefully she’s in our program as a player.
“We’ll let her sort that out in her own time.”
Daley said they were still talking to a couple of other possible recruits.
He said the competition would only get stronger.
“We’re not sitting still,” he said.
Peterson took five of the last seven wickets including the important one of Taylors Lakes captain Steffan Roberts.
Melton is one of five clubs undefeated after two rounds.
This round it faces Croydon, which is without a win so far.
Meanwhile, Melton’s women’s side had to sit on the sidelines on Sunday in the Cricket Victoria Womens Community Cricket Competition shield (1).
The Lions opponent La Trobe University Flamewings had forfeited the game, but wet weather meant all the games were abandoned anyway.
