Issuu on Google+

Former Jacobs coach Hinkle doing well after health scare

WEDNESDAY, JUNE 5, 2013

WWW.NWHERALD.COM

The only daily newspaper published in McHenry Co.

Sports, C1

75 CENTS

BEVERAGES FOR HOT WEATHER

WESTERN CONFERENCE FINALS

The art of summer cocktails Planit Taste, D1

Hawks fall for Kings’ tricks in 3-1 Game 3 loss Sports, C1

Theater shooter pleads insanity Larimer’s girlfriend says case’s outcome won’t change anything By JOSEPH BUSTOS jbustos@shawmedia.com

James Holmes has pleaded not guilty by reason of insanity

A former Algonquin resident who survived the Aurora, Colo., theater shooting that killed 12 people said that no matter the outcome of the criminal case, it won’t fix what happened.

Julia Vojtsek, who was the girlfriend of Crystal Lake native John Larimer, who was killed during a midnight screening of the “The Dark Knight Rises,” has been closely following James Holmes’ case through the criminal court system. Holmes is accused of open-

ing fire in a packed Denver-area movie theater last summer, killing 12 people and injuring 70 others. He is charged with multiple counts of murder and attempted murder, and prosecutors are seeking the death penalty. On Tuesday, Holmes’ plea of not guilty by reason of insan-

ity was accepted by a Colorado judge. The plea sets the stage for a lengthy mental evaluation. Judge Carlos Samour Jr. also determined that prosecutors can have access to a notebook that Holmes sent to a psychiatrist

See SHOOTING, page A5

Schools feel mental health crunch

Local victim John Larimer, 27, of Crystal Lake, was killed in a mass shooting July 20 at an Aurora, Colo., movie theater. Larimer died protecting his girlfriend Julia Vojtsek, formerly of Algonquin.

Millions spent on IRS training New report details agency’s excesses The ASSOCIATED PRESS

Lathan Goumas – lgoumas@shawmedia.com

Social worker Julie Carnes talks with a student in her office at Crystal Lake South High School. Carnes is one of the two social workers at the school.

State cuts, poor economy increase caseloads for local social workers By EMILY K. COLEMAN ecoleman@shawmedia.com State cuts to mental health funding and a poor economy translate into more families without insurance, and schools are feeling the crunch. “I will have parents call and say, ‘I can’t afford to pay for the sessions. Could you see my students once a week?’ ” said Julie Carnes, a social worker at District 155’s Crystal Lake South High School. “We cannot assume the role of the primary services, but we try and see

those kids through.” In theory, school social workers provide intervention and counseling within the school walls and refer families to outside resources when the student needs it. Between state cuts or money troubles at home, more students are facing longer waiting lists or receiving fewer sessions, said Todd Keesey, a social worker at District 47’s Hannah Beardsley Middle School in Crystal Lake. Transportation and time constraints can make it even tougher to make those appointments.

From the fiscal 2009-10 budget to the one for 2012-13, the state of Illinois has cut $187 million from its mental health spending, a drop of 31.7 percent, according to the National Alliance on Mental Illness. That puts Illinois fourth in terms of cuts by percentage. “Who shores that up?” Hannah Beardsley Middle School Principal Ron Ludwig said. “Right here. We’re it.” Even if they do have insurance, many insurance companies

By the numbers n 145: Social workers in McHenry County area school districts in 2012 (about 9 percent work part time) n 105: Psychologists in McHenry County area school districts in 2012 (about 14 percent work part time) n 70,000-plus: Children in McHenry County area school districts covered by those social workers and psychologists in 2012 Source: Illinois State Board of Education. Some districts included above also enroll students from neighboring counties.

See SCHOOLS, page A5

WASHINGTON – Already heavily criticized for targeting conservative groups, the Internal Revenue Service absorbed another blow Tuesday as new details emerged about senior officials enjoying luxury hotel rooms, free drinks and free food at a $4.1 million training conference. It was one of many expensive gatherings the agency held for employees over a three-year period. One top official stayed five nights in a room that regularly goes for $3,500 a night. Another official, Faris F i n k , s t a y e d At issue four nights in a The IRS held room that regularly goes for 225 employee conferences in $1,499. F i n k w a s 2010 through later promoted 2012, at a toto head the IRS tal cost of $49 division that million, the staged the 2010 report said. conference in Anaheim, Calif., a position he still holds. He also has the distinction of playing Mr. Spock in a cheesy but slickly-produced “Star Trek” video that IRS employees filmed for the conference. A total of 132 IRS officials received room upgrades at the conference, according to a report by J. Russell George, the Treasury Department inspector general for tax administration. The tax agency paid a flat daily fee of $135 per hotel room, the report said, but the upgrades were part of a

See IRS, page A5

LOCALLY SPEAKING Zackery Rhodes and his mother Carmen Rhodes

Kyle Grillot – kgrillot@shawmedia.com

McHENRY COUNTY

CARY

COUNTY AIMING TO KEEP TAX LEVY FLAT

TEAM LOSES POUNDS IN FITNESS CONTEST

McHenry County government will seek again to keep its levy flat and not collect an inflationary increase next fiscal year. The goal was part of the 2014 budget process approved Tuesday by the County Board on a 20-0 vote. The levy applies only to county government, which makes up about 10 percent of property-tax bills. For more, see page B1.

The more than 700 participants in Centegra Health System’s Break Your Boundaries wellness competition lost 4,032 pounds and 3,189 inches. Coilcraft in Cary had the winning team for worksites. Coilcraft’s Jeff Finch was the top male winner and Ashley Goodwin was the second place female winner. For more, see page E1.

CRYSTAL LAKE: Local soldier returns home to CL after six years serving abroad. Local&Region, B1

WEATHER HIGH

LOW

72 57 Complete forecast on A8

Where to find it Advice Business Classified Comics Buzz Local&Region Lottery

D5 E1-2 E3-12 D4 D6 B1-6 A2

Kid Scoop Obituaries Opinion Puzzles Planit Taste Sports TV Grid

Vol. 28, Issue 156

B3 B5 A7 E2, 9 D1-6 C1-6 E9


Page 2

Northwest Herald / NWHerald.com is published daily, Sundays and holidays by Shaw Media, P.O. Box 250, Crystal Lake, IL 60039-0250.

Wednesday, June 5, 2013 • Northwest Herald • NWHerald.com

GENERAL INFORMATION: 815-459-4040

Speak out to dispel mental illness stigma Helpless and powerless, like being on a roller coaster with no one at the controls to make it stop. That’s what it’s like to deal with mental illness – someone else’s mental illness. Our three-part series earlier this week brought back memories for me of the struggles of two of my dear friends who are coping with bipolar disorder. Memories of visits to hospital rooms. Of long conversations at all times of the day and night. Of the terror of not knowing what would happen next. Of tears, both theirs and mine. It’s exhausting and scary. Very, very scary. Yet, today they both are doing well. They are living with and successfully managing their mental illnesses. In the end, mental illness is just a chronic condition that must be dealt with, just as one deals with diabetes,

8LOTTERY

VIEWS Joan Oliver Crohn’s disease or lupus. Just as in those other instances, the failure to get treatment can prove fatal. Yet, unlike with those other conditions, mental illnesses often carry a stigma that causes many people to either refuse to get treatment or to stop the treatment they are receiving. People who are struggling with mental illness aren’t automatically violent. In fact, most are not. Neither of my friends ever posed a threat to anyone but themselves. The stigma, however, can be particularly dangerous for those who refuse to get help. That’s the message that I hope readers got from the very powerful

story told by Trish and Mike Neal, whose son, Ryan, took his own life in January. Ryan Neal stopped taking his medications, his parents say, because he no longer wanted to deal with the “labeling that went with it.” The Neals’ story resonated with me because so many of the things they went through with Ryan were things that I experienced with my friends. “I tried so many times to get him to go to the doctors,” Trish Neal told reporter Chelsea McDougall. That conversation, repeated over and over again, is one of the most frustrating things about trying to help. Sometimes you can get through; sometimes you can’t. No matter how much you want to will your loved ones better, it’s out of your hands. And even when they finally get help, the journey is far from over. There are stops and starts while

doctor and patient find the right drug and the right talk therapy to make it work – a process that can take months or years. For me, researching therapies and treatment options put me in a better position to help my friends. I wanted them to know they were not – and are not – alone. I applaud the Neals for speaking out and telling Ryan’s story. More of us need to make our voices heard. Ryan Neal succumbed to an illness, one that in too many instances goes untreated because of perceptions that also need to change. “Mental health issues are very real,” Mike Neal said. “Society needs to get its head around that.” I couldn’t agree more.

• Joan Oliver is the assistant news editor for the Northwest Herald. She can be reached at 815-526-4552 or by email at joliver@shawmedia.com.

Northwest Herald Web Poll Question

Do you have a news tip or story idea? Please call us at 815-459-4122 or email us at tips@nwherald.com.

8CONNECT WITH US Sarah Nader – snader@shawmedia.com

Veteran John Phalin of McHenry and his granddaughter, Vanessa Prather of Genoa City, Wis., listen to the National Anthem while attending the McHenry Memorial Day ceremony at Veteran’s Park on May 27.

LIKE WHAT YOU SEE? Check out our gallery of images made by Northwest Herald photographers on the Northwest Herald Facebook page at http://shawurl.com/1d6. Photos also can be purchased at http://photos.nwherald.com/photostore. 8TODAY’S TALKER

Hacker who turned Manning in testifies By DAVID DISHNEAU The Associated Press FORT MEADE, Md. – A one-time computer hacker who told authorities Pfc. Bradley Manning was giving information to WikiLeaks testified Tuesday the soldier never said he wanted to help the enemy during their online chats. Manning is on trial for giving hundreds of thousands of documents to the secret-spilling website WikiLeaks. He pleaded guilty to charges that could bring 20 years behind bars, but the military has pressed ahead with a court-martial on more serious charges, including aiding the

Your Home and Your Future Barb Kelly

What’s your favorite summer cocktail?

What do you think about the state’s funding level for mental illness?

...Is My First Priority

enemy. That charge carries a potential life sentence. Adrian Lamo, a convicted hacker, said he started chatting online with Manning on May 20, 2010, and alerted law enforcement the next day about the contents of the soldier’s messages, including his mention of WikiLeaks founder Julian Assange. He said he continued chatting with Manning on and off for six more days. On cross-examination, Lamo said Manning never told him he wanted to help the enemy and did not express disloyalty to America. “At any time, did Pfc. Manning ever say he wanted to

help the enemy?” defense attorney David Coombs said. “Not in those words, no,” Lamo said. Prosecutors have said they will show the 25-yearold Army intelligence analyst effectively put U.S. military secrets into the hands of the enemy, including Osama bin Laden. They said they will present evidence that bin Laden requested and obtained from another al-Qaida member the Afghanistan battlefield reports and State Department cables published by WikiLeaks. The soldier from Crescent, Okla., has said he did not believe the information would

Do you take care of an ill adult family member at home? • losing touch with friends? • anxious or irritable? • feeling like there aren’t enough hours in the day? Caring for someone who is ill can be overwhelming, exhaus>ng and extremely stressful no ma6er how much you love them. The first rule is to take care of you. We can help. Let’s Talk.

815-338-3590

66% 17% 17% Too much

NMLS No. 631482

Accuracy is important to the Northwest Herald, and we want to correct mistakes promptly. Please call errors to our attention by phone, 815-459-4122; email, tips@ nwherald.com; or fax, 815459-5640.

8CRISIS LINE Don’t know where to turn for help? Call the McHenry County Crisis Line at 800892-8900. The phone line is open 24 hours a day. It’s confidential and free. You also can visit the crisis line on the Web at www.mchenry-crisis. org.

“Serving our communities to make them better places to live.”

WHISPERING POINT OPHTHALMOLOGY Maureen Richards MD Joseph Kappil MD

&

Board Certified Ophthalmologists

Comprehensive Eye Exams • Diabetic • Glaucoma • Routine Family Eye Care • Macular Degeneration • No Stitch • No Shot • No Patch Cataract Surgery Full Service Optical Department in our McHenry Office

(815) 788-3330

Apply online at hsbmortgage.com

8CORRECTIONS & CLARIFICATIONS

Medicare & Most PlansExcepted Accepted Medicare & MostMajor Major Plans

Barb Kelly Assistant Vice President bkelly@homestateonline.com 40 Grant Street Crystal Lake, IL 60014

harm the U.S. and he released the information to enlighten the public about the bitter reality of America’s wars. His attorney has also said Manning struggled privately with gender identity early in his tour of duty, when gays couldn’t openly serve in the military. Those struggles led Manning to “feel that he needed to do something to make a difference in this world,” Coombs said. Lamo testified Manning had contacted him because of his notoriety in the hacking community and because of his open support and leadership in the lesbian, gay, bisexual and transgender community.

facebook.com/nwherald @nwherald

Are you...

Inadequate Adequate

VP AUDIENCE DEVELOPMENT Kara Hansen 815-459-8118 khansen@shawmedia.com

8CONTACT US

The Northwest Herald invites you to voice your opinion. Log on to www. NWHerald.com and vote on today’s poll question:

Tuesday’s results:

MARKETING DIRECTOR Katie Sherman ksherman@shawmedia.com

SUBSCRIPTION INFORMATION Daily: $.75 / issue Sunday: $1.75 / issue Basic weekly rate: $6.25 Basic annual rate: $325

Indiana Lottery Daily 3 Midday: 8-7-6 Daily 3 Evening: 2-5-0 Daily 4 Midday: 9-9-5-0 Daily 4 Evening: 5-1-8-0 Cash 5: 15-18-19-24-36 Mix and Match: 21-27-38-47-48 Est. Lotto jackpot: $5.5 million

– Wire report

Display advertising: 815-459-4040 Fax: 815-477-4960

MISSED YOUR PAPER? Please call by 10 a.m. for same-day redelivery

Powerball Est. jackpot: $50 million

BERLIN – A tweak to laws in the German state of Mecklenburg-Western Pomerania to conform with current EU regulations has caused an unexpected casualty: the longest word in the German language. The Rindfleischetikettierungsueberwachungsaufgabenuebertragungsgesetz is no more. The “law delegating beef label monitoring” was introduced as part of measures against mad cow disease. But the DPA news agency reported the law was removed from the books last week because European Union label regulations have changed. German still has Donaudampfschifffahrtsgesellschaftskapitaenswitwe to fall back on – meaning “widow of a Danube steamboat company captain.”

GROUP SALES DIRECTOR Jim Ringness jringness@shawmedia.com

CIRCULATION DEPARTMENT CUSTOMER SERVICE: 7717 S. Route 31 Crystal Lake, IL 60014 Monday-Friday, 6 a.m. to 5 p.m. Saturday & Sunday, 7 to 10 a.m. 815-459-8118 or 800-589-9363

Mega Millions Numbers: 10-11-12-20-55 Mega ball: 19 Megaplier: 3 Est. jackpot: $12 million

Regulation change kills Germany’s longest word

ADVERTISING DIRECTOR Paula Dudley pdudley@shawmedia.com

NEWSROOM Telephone: 815-459-4122 Fax: 815-459-5640

Illinois Lottery Pick 3 Midday: 9-5-4 Pick 3 Evening: 9-1-5 Pick 4 Midday: 2-9-7-7 Pick 4 Evening: 8-3-5-6 Lucky Day Lotto Midday: 4-12-13-37-39 Lucky Day Lotto Evening: 5-11-13-23-25 Lotto jackpot: $4.25 million

8WATER COOLER

EDITOR Jason Schaumburg 815-459-4122 jschaumburg@shawmedia.com

CLASSIFIED To place an ad: 815-455-4800 or 800-589-8237

8NORTHWEST OUTTAKES

Wisconsin Lottery Pick 3: 8-0-1 Pick 4: 2-7-7-2 SuperCash: 11-23-27-32-35-37 Badger 5: 5-8-16-25-27

PRESIDENT AND PUBLISHER John Rung jrung@shawmedia.com 815-459-4040

2 Office Locations 2028 N. Seminary Avenue • Woodstock, Illinois 60098 www.familyallianceinc.org

McHenry

Crystal Lake

4314 W. Crystal Lake Rd

490 Coventry Ln

Call 815-363-8866 To schedule an appointment


NEWS

Northwest Herald / NWHerald.com

Wednesday, June 5, 2013 • Page A3

Quinn may call special session Wants resolution on pension crisis By SOPHIA TAREEN The Associated Press

AP photo

Senate Armed Services Committee member Sen. Kirsten Gillibrand (top right), D-N.Y., questions military leaders Tuesday on Capitol Hill.

Senators: Military fails on sex assault tary’s mostly male leadership understands differences between relatively minor sexual offenses and serious crimes that deserve swift and decisive justice. “Not every single commander necessarily wants women in the force. Not every single commander believes what a sexual assault is. Not every single commander can distinguish between a slap on the [rear] and a rape because they merge all of these crimes together,” said Sen. Kirsten Gillibrand, D-N.Y. Frustration among the senators seemed to boil over as they discussed recent high-profile cases and statistics on sexual assault that underscored the challenges the Defense Department and Congress face. The committee is considering seven legislative proposals, including one introduced by Gillibrand that would deny commanders the authority to decide when criminal charges are filed and remove the ability of senior officers to convene courts-martial.

The ASSOCIATED PRESS WASHINGTON – U.S. senators dressed down senior military leaders Tuesday, led by female lawmakers, combat veterans and former prosecutors who insisted that sexual assault in the ranks has cost the services the trust and respect of the American people as well as the nation’s men and women in uniform. Summoned to Capitol Hill, Army Gen. Martin Dempsey, the chairman of the Joint Chiefs of Staff, and the beribboned four-star chiefs of the service branches conceded in an extraordinary hearing that they had faltered in dealing with sexual assault. One said assaults were “like a cancer” in the military. But they strongly opposed congressional efforts to strip commanders of their authority to decide whether to level charges in their units. Members of the Senate Armed Services Committee, especially the panel’s seven female senators, grilled the chiefs about whether the mili-

CHICAGO – Gov. Pat Quinn dangled the possibility Tuesday that he’ll call lawmakers back for a special session on Illinois’ nearly $100 billion pension crisis, but he pressed Senate President John Cullerton and House Speaker Michael Madigan to first agree on a fix. However, Quinn’s efforts to nudge lawmakers hit an immediate snag when Madigan, who was out of the state, didn’t show up to the first closed-door meeting legislative leaders have held since lawmakers adjourned and didn’t participate by phone either. Quinn said he impressed the urgency of the problem upon Cullerton in the roughly hourlong meeting, which came a day after a major bond house downgraded Illinois’ credit rating. Quinn told reporters he spoke with Madigan last week in Springfield but that the speaker doesn’t have a cellphone – which a spokesman confirmed – and so he left word with Madigan’s wife. “When he is available we will express to him the same thing I told John Cullerton. ... He will come forward, hopefully soon,” Quinn said. “Those two have to put aside any personal differences and work together to put a state public pension reform bill on my desk so I can sign it into law to help the Illinois econ-

term loans for businesses and individuals.

Appeals court gives Gov. time to review gun law CHICAGO – The 7th U.S. Circuit Court of Appeals on Tuesday gave the state of Illinois an extra 30 days to lift its ban on concealed weapons. The court acted on Attorney General Lisa Madigan’s request to allow Gov. Pat Quinn more time to review legislation passed last week. However, on issuing its ruling, the court said it would not issue another extension of its mandate past the new deadline of July 9. Quinn wouldn’t say Tuesday whether he’ll sign the bill.

Bill Daley to decide on governor run in next week CHICAGO – Former White House chief of staff Bill Daley says he’ll decide in the next week whether he’ll run for governor in 2014. The Chicago Democrat called the latest legislative session “a debacle.” He says Gov. Pat Quinn should have done more to resolve some of Illinois’ major issues.

PARIS – France said Tuesday it has confirmed that the nerve gas sarin was used “multiple times and in a localized way” in Syria, including at least once by the regime. It was the most specific claim by any Western power about chemical weapons attacks in the 27-month-old conflict. Britain later said that tests it conducted on samples taken from Syria also were positive for sarin. The back-to-back announcements left many questions unanswered, highlighting the difficulties of

Federal aid available after April Illinois floods SPRINGFIELD – More than $73 million in federal aid has been approved so far to help Illinois communities hurt by April’s floods. Gov. Pat Quinn’s office said in a news release Monday the help includes grants for short-term expenses such as rent on temporary housing and home repairs. About $2 million is also available for short-

– Wire reports

For Cool Comfort Call Biewer Heating & Air Rated one of the top Heating & A/C contractors in Chicagoland, by Chicago Magazine

FREE Air Cleaner With Purchase Of A Rheem System Cannot combine coupons. Prior sales are not valid. Air cleaner model 84-25050-06, 1400 CFM. Valid on the purchase of a Rheem furnace and Air Conditioner. Expires 7/31/13.

Serving Fox Valley for over 35 years

backed by Cullerton that gives workers and retirees a choice in retirement benefits was never called for a House floor vote. Quinn said both leaders would have to move beyond the “personal acrimony” of last week. However, Quinn’s leadership also came under fire, including that he waited several days after session to push forward on a solution. Quinn went to Michigan for a governor’s meeting on the Great Lakes Saturday. Former White House chief of staff Bill Daley, who is considering a Democratic challenge to Quinn in 2014, said he was “really shocked” that lawmakers left without a deal on pensions.

“What a debacle,” Daley said. “I obviously believe the governor is the one who’s got to bring people together, and that didn’t happen. Leaders do that.” Republican gubernatorial candidates, including Illinois Treasurer Dan Rutherford and state Sen. Kirk Dillard, echoed the concerns. “Last summer, when he [Quinn] said we would never leave town without pension reform, I said that if I were him I would make a cameo visit to the mansion for a change and lock all of the stakeholders into a room,” Dillard said. “And no one goes over the wrought iron fence without there being an agreement on pensions.”

confirming from a distance whether combatants in Syria have crossed the “red line” set by President Barack Obama. The regime of Syrian President Bashar Assad has refused to allow U.N. investigators into the country. The French and British findings, based on samples taken from Syria, came hours after a U.N. team said it had “reasonable grounds” to suspect small-scale use of toxic chemicals in at least four attacks in March and April. The U.N. probe was conducted from outside Syria’s borders, based on interviews with doctors and witnesses of

purported attacks and a review of amateur videos from Syria. The team said solid evidence will remain elusive until inspectors can collect samples from victims or from the sites of alleged attacks. Some experts cautioned that the type of evidence currently available to investigators – videos, witness reports and physiological samples of uncertain origin – leaves wide doubts. At the same time, forensic evidence of alleged chemical weapons use is fading away, and the longer U.N. inspectors are kept out of Syria, the harder it will be to collect

conclusive proof, they said. Syria is suspected of having one of the world’s largest chemical weapons arsenals, including mustard and nerve gas, such as sarin. In recent weeks, the regime and those trying to topple Assad have increasingly used accusations of chemical weapons as a propaganda tool, but have offered no solid proof. In the West, meanwhile, the lack of certainty about such allegations is linked to a high stakes political debate over whether the U.S. should get more involved in the Syria conflict, including by arming those fighting Assad.

Second Family, Second Best?

Crundwell transferred to Minnesota prison CHICAGO – A former comptroller sentenced this year for stealing nearly $54 million from the city of Dixon is now in prison in Minnesota. The Telegraph in Dixon reported that Rita Crundwell was transferred Monday to the minimum-security women’s Federal Correctional Institution in Waseca, Minn. A Rockford judge sentenced the 60-yearold to nearly 20 years in prison.

omy.” It was Quinn’s first public comments on legislative matters since lawmakers left Springfield Friday without accomplishing his top priorities, including plans to allow same-sex marriage and deal with Illinois’ worst-in-the-nation pension problem. Although Quinn made pensions his focus for more than a year, both chambers remained sharply divided with Madigan accusing Cullerton of a “lack of leadership.” The Senate rejected a Madigan-sponsored bill that unilaterally cut benefits and a plan for state universities to start picking up their own retirement costs. A bill

France, Britain verify sarin gas used in Syria The ASSOCIATED PRESS

8STATE BRIEFS

AP photo

Gov. Pat Quinn speaks at a news conference Tuesday in Chicago. Quinn says he’s prepared to call a special session of the General Assembly on pension reform. Senate President John Cullerton and House Speaker Michael Madigan have dueling plans to fix the nearly $100 billion pension crisis, and the latest legislative session ended without any progress on the issue.

Michael R. Stetler, has a bachelor’s degree from the University of Illinois in Accountancy and a master’s degree in Taxation. He is also a C.P.A. His law degree is also from the University of Illinois. Mr. Stetler’s focus is on the financial aspects of a divorce and on domestic violence. He is a frequent lecturer to lawyers on divorce/tax matters.

Q: A newspaper story told of a man who after his divorce remarried and has a child by the new marriage. He was found in contempt of court and sentenced to 180 days work release in the McHenry County Jail because he failed to pay his part of the college education costs of a child of the first marriage. Don’t his obligations to his new family count? A: Not much. The Illinois Appellate Courts sometimes give lip service to the concept that the new family of the party obligated to pay support on account of the first marriage should be considered but, in fact, no, or virtually no, consideration is given to the obligation for the second family. Q: Will you give some examples of how Illinois Appellate Courts have ruled on first family versus second family issues? A: • Gregory v. Gregory, 52 Ill.App.2d 262 stated: “Although the effect may be

to deprive a second wife of support, from a legal standpoint, the first come first and the second come second. In other words, the first obligation must be met before the second can or will be considered.” • In Berkheimer v. Berkheimer, 63 Ill.App.3d 19, the appellate court did not allow a reduction in maintenance (alimony) where the husband’s only change of circumstances was increased expenses from a second marriage. Q: I have a child support obligation from my first marriage. I remarried and had a child by the second marriage. I am now again going through a divorce. Will my obligation for child support for the child of my first marriage be considered in determining how much child support I pay for the child of my second marriage? A: Yes. Child support is based on the obligor’s net income. In calculating an obligor’s net income, one of the deductions from gross income to determine net income is, “Prior obligations of support or maintenance actually paid pursuant to a court order.” The result would be the same if the first order for child support was in a paternity case. Q: The newspaper article about the McHenry County case said that a half dozen members of a second wives organization protested the judge’s ruling at a candlelight vigil at the Woodstock Square. Can something be done to overturn the laws favoring the first marriage?

A: Probably not. The legislature will not change the law, if for no other reason than there are many more first family voters than there are second family voters. Q: What advice would you give to a second wife, or one who is about to be second wife? A: Glynnis Walker, a journalist and a second wife, wrote the book Second Wife, Second Best. Her advice is, “To be forewarned is to be forearmed.” Walker’s book contains interesting facts about second wives: • 74% of the second wives surveyed had jobs and the majority said they worked to help their husbands meet support payments to the first family. • 30% of second wives felt they could not afford to have their own children because they were supporting children from their husbands’ previous marriage. • 60% of second wives said they were not prepared for the consequences of marrying men who had been married before. In spite of this, 67% said they would do it again. Q: If I remarry will my new wife’s income have an impact on my obligation for child support? A: Maybe. (1) If you apply for a reduction in support because your wages are lower, but your new wife’s income makes up for your reduced income the court will not reduce your support obligation. (2) Your new wife has no legal obligation for the support of her stepchildren.

GITLIN, BUSCHE & STETLER

(847) 697-2664

biewer.rheemteam.net email: biewerhvac@aol.com

Practice limited to family law H. Joseph Gitlin • Sara L. Busche • Michael R. Stetler

111 Dean Street • Woodstock, IL 60098 • ph. 815-338-0021 • www.gitlin.com These Q&A’s are published as a service to the community. They are not designed to provide specific legal advice for a specific legal problem. For specific advice you should personally consult with a lawyer.


Page A4 • Wednesday, June 5, 2013

Northwest Herald / NWHerald.com

It’s all about the students... Learn about MCC’s Newest Program that Comb nes Mentor ng and Scholarsh p – Educat on to Empowerment At MCC, we’re focused oÿ oÿe thiÿg above all others—helpiÿg our studeÿts succeed. It’s really that simple. As a commuÿity college, MCC’s missioÿ of studeÿt success is embedded iÿ everythiÿg we do. We deiÿe this success as the ÿumber of studeÿts who eÿgage iÿ educatioÿal activities aÿd complete a degree or certiicate, or who meet their educatioÿal goals while at MCC. Through academic aÿd social iÿtegratioÿ, supported by a variety of support services, studeÿts iÿcrease their chaÿces of beiÿg successful iÿ college, aÿd beyoÿd. Support is also fouÿd through our studeÿts’ access to resources. Maÿy studeÿts wouldÿ’t have educatioÿal opportuÿities if ÿot for iÿaÿcial assistaÿce aÿd scholarships. Iÿ fact, betweeÿ MCC’s Ofice of Fiÿaÿcial Aid aÿd the Frieÿds of MCC Fouÿdatioÿ, huÿdreds of scholarships are awarded each year, startiÿg those studeÿts off oÿ a path toward success. Today, groups as varied as gardeÿ clubs, to ire departmeÿts, to musiciaÿs have all decided to pay it forward by makiÿg scholarships available to MCC studeÿts. So, wheÿ a group of rather amaziÿg womeÿ from the commuÿity came together aÿd said they waÿted to support MCC studeÿts with scholarship aÿd meÿtoriÿg, we couldÿ’t have beeÿ happier. The passioÿ these womeÿ feel for educatioÿ led to the birth of Educatioÿ to Empowermeÿt, a program that eÿables womeÿ to reach their fullest poteÿtial aÿd achieve ecoÿomic iÿdepeÿdeÿce through educatioÿ, meÿtoriÿg aÿd iÿaÿcial support. ÿually to raisiÿg scholarship fuÿds aÿd The goal? To briÿg together 100 iÿlueÿtial womeÿ who commit aÿÿually four-year year degree meÿtoriÿg recipieÿts as they complete their iÿal year at MCC aÿd advaÿce to a four aÿd professioÿal career. That’s why 100% of the fuÿds raised stay iÿ the couÿty aÿd go toward the recipieÿts, all of whom must show a demoÿstrated commitmeÿtt to educatioÿ, haviÿg already received a 3.25 GPA while at MCC.

A few thoughts from Er n Sm th, cha r of the Educat on to Empowerment Comm ttee: “Without support from my family, a great educatioÿ, aÿd woÿderful meÿtors aÿd role models, I would ÿot have achieved my goals. As I look back with gratitude oÿ the opportuÿities I received, I waÿt to be able to provide the same support to others iÿ their pursuits. After all, we are all coÿÿected, aÿd we all waÿt to be part of somethiÿg bigger thaÿ ourselves. By helpiÿg others succeed, aÿd by beiÿg part of this iÿspiriÿg group of womeÿ, I’m truly the oÿe who has beÿeitted.” Educatioÿ to Empowermeÿt is more thaÿ just a ÿeeds-based scholarship offered to womeÿ iÿ the couÿty. It closes the gap betweeÿ gettiÿg access to educatioÿ aÿd gettiÿg support aloÿg the way. It coÿÿects studeÿts to successful womeÿ iÿ a variety of ields. It helps develop the successful leaders of tomorrow. As a dedicated member of the Educatioÿ to Empowermeÿt Committee, Eriÿ believes that we are all coÿÿected aÿd must support everyoÿe iÿ our commuÿity toward their path to success. We couldÿ’t agree more. Are you or someoÿe you kÿow poised for a successful future? Fiÿd out more about Educatioÿ to Empowermeÿt aÿd how you caÿ apply at www.mchenry.edu/scholarsh ps. Applicatioÿs are due by July 1, 2013. Learÿ more about Educatioÿ to Empowermeÿt aÿd other scholarship opportuÿities by atteÿdiÿg oÿe of our commuÿity forums this year. A complete schedule is at www.mchenry.edu/forum.

Get to know me. Get to know MCC.

www.mc enry.edu/knowmcc


Northwest Herald / NWHerald.com

FROM PAGE 1

Wednesday, June 5, 2013 • Page A5

Holmes must undergo mental health evaluation before trial • SHOOTING Continued from page A1 before last summer’s rampage. Larimer, a Navy Petty Officer 3rd Class, was part of the U.S. Fleet Cyber Command/U.S. 10th Fleet stationed at Buckley Air Force Base in Colorado. He worked as a cryptologic technician. He was the fourth generation of his family to serve in the Navy. Larimer died protecting Vojtsek, a 23-year-old originally from Algonquin. At the time of the shooting, Vojtsek was visiting Larimer and her father. She has since moved to Centennial, Colo., and regu-

larly attends Holmes’ court appearances. “Whatever happens to [Holmes] is not going to change anything,” Vojtsek said. “People are irreversibly damaged by what has happened. He could be in a mental institution, be in jail, or get the death penalty, it’s not going to change anything.” Vojtsek, who has been dealing with post-traumatic stress, has been going to therapy since Larimer’s death. There’s been “a lot of grieving, a lot of sadness,” Vojtsek said. “Everything has changed since then.” Holmes’ lawyers repeatedly have said he is mentally ill, but they delayed the insanity

plea while arguing that state laws were unconstitutional. They said the laws could hobble the defense if Holmes’ case should ever reach the phase where the jury decides whether he should be executed. The judge rejected that argument last week. On Tuesday, Samour ordered Holmes to undergo a mental evaluation at the state hospital in Pueblo as soon as the hospital is ready to conduct it. Evaluators want to review the 40,000 pages of evidence in the case first, so it’s unclear when it will happen. Samour set a tentative deadline of Aug. 2 for Holmes’ evaluation but indicated he would grant more

time if doctors want it. The hearing came as the court released dozens of pretrial motions filed by defense attorneys challenging the admissibility of ballistics, handwriting and other evidence, and signaling Holmes will seek a change of venue because of pretrial publicity. Lawyers also argued briefly in court about whether prosecutors should have access to a notebook Holmes sent to psychiatrist Lynne Fenton. Media reports have said the notebook contains drawings depicting violence. Defense lawyers argued Fenton never received the notebook so prosecutors shouldn’t have access to it. Prosecutors say police

would like to do unspecified “additional processing” on the notebook. Samour ordered the notebook to be turned over next week. Prosecutors say Holmes spent months buying weapons, ammunition and materials for explosives and scouted the theater in advance of the July 20 shooting. He donned police-style body armor, tossed a gas canister into the seats and opened fire, they say. The insanity plea is widely seen as Holmes’ best chance of avoiding execution, and possibly his only chance, given the weight of the evidence against him. But his lawyers delayed it for weeks, saying Colorado’s laws on the insanity plea and

the death penalty could work in combination to violate his constitutional rights. The laws state that if Holmes does not cooperate with doctors conducting a mandatory mental evaluation, he would lose the right to call expert witnesses to testify about his sanity during the penalty phase of his trial. Defense lawyers argued that is an unconstitutional restriction on his right to build a defense. They also contended the law doesn’t define cooperation. Samour rejected those arguments last week and said the laws are constitutional.

• The Associated Press contributed to this report.

Social workers handle many issues Agency faces multiple investigations • SCHOOLS Continued from page A1 limit the number of sessions patients can receive, Keesey said. “They may meet with them every other week or maybe once a month,” Keesey said. “You can’t always schedule your crises once a month. School social workers and school psychologists are much more accessible.” That compounds with higher stress at home, Ludwig said. That stress trickles down to the kids, Carnes said. They hear their parents discussing financial difficulties or may have to stop their normal activities. “A lot of things are falling on schools,” Riley District 18 Principal Christine Conkling said. “We may get more of it.” The tightening is happening as many districts face budget constraints of their own. While some schools have the funding to invest in mental health professionals, others have had to make cuts,

meaning that one social worker could be the first line of defense for a thousand kids, sometimes across multiple schools. Some small districts don’t have full-time social workers. Riley District 18, for example, has a part-time social worker come on Tuesdays, Thursdays and Fridays. “It becomes triage,” Keesey said. “Do you work with the student who is having difficulty during lunch with someone picking on them? Do you sit and spend time counseling the student who is having a divorce occur in their family? Grief and loss? Kids that are more significantly depressed and self-injuring?” That’s on top of the time social workers have to spend with students who have individualized education plans. The state requires IEPs to set out, in minutes, the services each student must receive each week. “We just keep lessening the opportunity for the [other kids],” Ludwig said. “We probably have 100 IEP kids. That means we have 950 kids

who don’t have a label who you and I both know are probably hurting in some way – not all of them, but even if it’s 50 kids. How do you get to the kids without a label?” Social workers are trying to help kids cope with homelessness, fragmented families, teen pregnancy, poverty, hunger and abuse, said Susan Krause, the Pioneer Center’s director of organizational advancement. “[Social workers] have way too many people,” Krause said. “They’re inundated. They have 750 kids.” There were 145 social workers in 2012 for the 70,000plus kids in McHenry County-area school districts, about 9 percent of them part time, according to data submitted by districts to the Illinois State Board of Education. School districts also employed 105 psychologists, 14 percent of them part time, in 2012. Unless schools address the underlying social and emotional needs of needs of students, the students aren’t going to perform, Keesey said.

Overspending

• IRS Continued from page A1 package deal that added to the overall cost of the conference. The report was made public on the same day leaders of six conservative groups testified at a congressional hearing, where they told lawmakers they had endured abuse from IRS agents as they spent years trying to qualify for tax-exempt status. In often-emotional testimony, the conservatives described IRS demands for details about employees’ and group officials’ political activities and backgrounds, for comments they’d posted on websites, for videos of meetings and information on whether speakers at such sessions voiced political views. Some said it took three years to get their tax-exempt status; others said they were still waiting. “I’m a born-free American woman,” Becky Gerritson, president of the Wetumpka Tea Party of Alabama, tearfully told the lawmak-

New rules imposed by the White House budget office in 2012 cap expenses for a single conference at $500,000. In 2010 alone, the IRS had 13 conferences that cost more than that.

ers. “I’m telling my government, ‘You’ve forgotten your place.’ ” Federal regulations say that tax-exempt social welfare organizations can engage in some political activity but the activity cannot be their primary mission. It is up to the IRS to make that determination of their level of political activity, and some Democrats at Tuesday’s House Ways and Means Committee hearing noted that some liberal groups also have had a hard time winning tax-exempt status from the IRS. However, revelations about IRS agents improperly targeting tea party and other groups have led to investigations by three congressional committees and the Justice Department. One top IRS of-

ficial was forced to resign, another retired and a third was placed on paid administrative leave. Tuesday’s report by the inspector general suggests the agency has struggled with management issues beyond the division that handles tax-exempt applications. According to the report, expensive employee conferences were approved with few restraints or safeguards until new rules were imposed in 2011. In all, the IRS held 225 employee conferences from 2010 through 2012, at a total cost of $49 million, the report said. The Anaheim conference was the most expensive, but others were costly, too. In 2010, the agency held a conference in Philadelphia that cost $2.9 million, one in San Diego that cost $1.2 million and another in Atlanta that also cost $1.2 million. Spending on IRS conferences dropped substantially, from $37.6 million in the 2010 budget year to $6.2 million in 2011 and then to $4.9 million last year, according to the IRS.

IT ALL ADDS UP RECEIVE UP TO UP TO

+

UP TO UP TO

$1,200 $1,300 $500 $350

LENNOX® REBATE* UTILITY REBATE** FEDERAL ENERGY TAX CREDIT 25C CASH DISCOUNT OR FREE HIGH EFFICIENCY AIR FILTER

$3,350 HURRY!

TOTAL SAVINGS ON YOUR LENNOX HEATING AND COOLING SYSTEM.

Limited Time Offer!

815-455-3351 652 W Terra Cotta Ave. • Crystal Lake, IL 60014 *Rebates are Only Valid on Qualifying Lennox Products. **Call Dealer Shop for Details!


Northwest Herald / NWHerald.com

Page A6 • Wednesday, June 5, 2013 ©2013 Media Services S-9709 O 27033R-1

PAID ADVERTISEME T

New a r pur f er n 15 m nutes makes your home a r cr sp, l ghter and fresh smell ng l ke mounta n a r Runs s lent - has no fan Never breathe bad a r aga n By Joh Whitehead, Media Services

The famous Ede PURE® compa y has a ou ced the best air purifier ever, The Mou tai Air™ Ultra Air Purifier. I o ly 15 mi utes, it will make the air i your home like mou tai air. You will otice the air is crisper, lighter a d fresh smelli g like after a thu derstorm. The Mou tai Air ™ purifies air much better tha the top rated air purifiers, yet it ru s totally sile t. It moves large volumes of air without a fa . The Mou tai Air ™ utilizes adva ced Ultra Purificatio tech ology to purify the air. Ultra Purificatio removes polluta ts other air purifiers do ot that cause serious ill ess, allergies, asthma, odors a d more. For more i formatio a d a great educatio o purifyi g air, here is my i terview with Tom Betts, Director of Research a d Developme t for Ede PURE® Q: How can The Mounta n A r ™ move large volumes of a r w thout a fan? A: It does it with a very high tech adva ceme t called Io ically I duced Airflow. I simplified terms, this tech ology creates two pla es of io s, o e positively charged a d o e egatively charged, that draw air from o e pla e to the other i high volumes. The beauty of it is that it moves this air sile tly without a fa . A major seco d be efit to this tech ology is that it moves air i a li ear patter rather tha the turbule t patter produced by mixer-type fa s used i old tech ology. This turbule ce ca create more pollutio tha the old tech ology air purifiers take out of the air. They stir up dirt i carpeti g a d dust off of surfaces. Q: Why does The Mounta n A r ™ pur fy the a r so much better than the top rated a r pur f ers wh ch are HEPA a r pur f ers? A: HEPA is a acro ym for High Efficie cy Particulate Air removal. This old tech ology uses a umber of fiber filters to remove air pollutio . What most people do ’t k ow is that this is 70-year-old World War II tech ology. The filters i this old tech ology ca ot remove the worst pol-

Beat the top rated no sy, expens ve a r pur f er n comparat ve test IQ Health Pro

Mounta n A r™

NOISE LEVEL: 69 Decimeter

NOISE LEVEL: 0 Decimeter

AIR POLLUTION: 0 Particulates

AIR POLLUTION: 1354 Particulates

The Mou tai Air™ Ultra Air Purifier

Removes pollutants that cause llness, allerg es, asthma, odors and more luta ts that cause the most harm. The Mou tai Air ™ uses highly adva ced electro ic tech ology called Ultra Purificatio to capture a d destroy virtually all pollutio i cludi g the worst type of pollutio , which is small particulate pollutio . The small particulate pollutio is what causes the most harm. The HEPA air purifiers do ot remove these small particulate polluta ts, which are microscopic particulates that ca lodge deep i to the lu gs, causi g respiratory problems a d other serious health problems. The Mou tai Air ™ Ultra Purificatio techology uses adva ce pollutio attractio combi ed with adva ced absorptio i to the collector where the pollutio is the destroyed. This is why it destroys small particulate pollutio that HEPA filters do ot remove. Q: What types of pollutants are n ndoor a r that The Mounta n A r™ removes? A: It removes early all orga ic a d i orga ic polluta ts with its proprietary pate ted multifu ctio i g tech ology that has ever existed prior to ow. Orga ic polluta ts removed by The Mou tai Air ™ i clude: fu gus, bacteria, formaldehyde, ammo ia from pet uri e, cooki g odors, sku k odors, ferret odors, fecal a d uri ary odors, perfumes, colog es, tobacco, smoke a d creosote from fireplaces. U like HEPA filters The Mou tai Air™ kills germs a d viruses pulled through our electro ic grid sys-

tem. The Mou tai Air ™ also removes the followi g i orga ic polluta ts: hydroge sulfides, decomposed gases i cludi g rado while absorbi g worst formaldehydes. Our proprietary operati g system ot o ly collects bacteria, germs a d viruses it kills them. We have 28,000 volts a d io s NO germs ca survive. We electrocute the virus a d germs. The Wall Street Jo rnal reported that there is 5 times more air pollutio i a house tha there is i the ope air outside the house. Every day you breathe all these polluta ts i to your lu gs a d ma y are absorbed i to your body. Q. W ll The Mounta n A r ™ take out the pollens, dust m tes, and other pollutants that cause allerg es? A. Yes, it will. It will kill polle s a d dust mites. Yet, at the same time, it will ot harm pets or eve small birds. Users report that they ow feel so much better s i c e t h ey h ave T h e Mou tai Air ™ . Users say that before they were taki g medicatio for allergies, si us problems a d ma y other such ailme ts. They said they do ot have to take the medicatio while they are i the prese ce of The Mou tai Air™. Customers of The Mou tai Air ™ report that they otice a drastic differe ce i the air withi mi utes of tur i g o The Mou tai Air ™. They report that the air is crisper, lighter a d smells fresh like air after a thu derstorm a d mou tai air. I fact, The Mou tai Air ™ has show to pro-

I a comparative test with the top rated air purifier, which is the IQ Health Pro air purifier, The Mou tai Air™ Ultra Air Purifier wo decisively. The particle detector shows the IQ Health Pro with a particle cou t of 1354. The Mou tai Air™ particle cou t is 0. Yet the IQ Health Pro produced 69 decimeters of oise while The Mou tai Air™ ra totally sile t produci g “0” decimeters of oise. The 69 decimeters of oise is early as loud as a leaf blower.

How t works FIRST ION PLANE ACCELERATOR GRID

SECOND ION PLANE AND COLLECTOR GRID

3M FILTER

• Clea sed air is released i to the room

• I duced airflow created by 2 pla es of io s, 1 positive a d 1 egative

• Moves air sile tly i li ear fashio with o fa turbule ce

• Mou tai Air™’s ultraabsorbe t collectors a d special 3M filter remove eve the smallest particulates

Mou tai Air™ has show to produce air that is purer tha the place o earth that has the purest air which is the summit of the Cascade Mou tai s at 3,000 ft. elevatio The Mou tai Air™ tech ology is a pate ted oise free system due to i corporati g adva ced fa -less io drive operatio . This process employes electrostatic attractio of charged air molecules to a acceleratio grid that produces a purified airflow of over o e hu dred cubic feet per mi ute! All this is do e sou dlessly to allow the user to sile tly breathe with co fide ce, ultra pure air without sou d.

duce air that is purer tha the place o Earth that has the purest air, which is the summit of the Cascade Mou tai s at 3,000 feet elevatio . Q: Does The Mounta n A r™ have a f lter? A: Yes. It has a i expe sive filter that lasts for over a year, depe di g o the amou t of pollutio you have. The filter is very i expe sive, o ly $19. I compariso , the cost to replace the filters o the top HEPA air purifiers is over $200.00. Q: How can my readers get the EdenPURE® Mounta n A r™ Ultra A r Pur f er and what s the pr ce? A: A: I am offeri g your readers today The Mou tai Air ™ 30-day free trial. For the ext 10 days you ca try The Mou tai Air ™ shipped to you free, a d if you do ’t like it, retur it i 30 days a d Ede PURE®

will pay the retur shippi g. It costs you absolutely othi g. You will likely see your allergies, breathi g problems, co gestio , headaches, bug bites a d ma y other ill-

esses disappear. If you like it, you ca keep it a d get it at a very low price with my Mou tai Air ™ Big Discou t you will get if you respo d i 10 days.

Try The Mou tai Air™ FREE for 30 days complime ts of Ede PURE® Expires i 10 days 1. Call toll-free:

1-800-830-6991 2. Tell the operator you are claimi g the FREE 30-day trial for The Mou tai Air™ with retur shippi g paid if you do ot like it. Also, you will get The Mou tai Air™ Big Discou t if you decide to keep it. With this discou t you will get The Mou tai Air™ for far less cost tha i ferior bra ds. Give the operator your FREE 30-day trial Authorizatio a d Discou t Code: K1261


Opinion

John Rung President and Publisher

Dan McCaleb Group Editor

Jason Schaumburg Editor

Wednesday, June 5, 2013 • Page A7 • Northwest Herald • NWHerald.com 8OUR VIEW

8SKETCH VIEW

Blame game on pensions The state legislative session that ended Friday was an abject failure, one that demands a new approach to solving Illinois’ public pension crisis. Lawmakers For the record adjourned the spring session The lack of a solution on without coming to pension reform is an embarany agreement on rassment for Illinois and brings a plan to reform further hardships on taxpayers. the state’s pension systems, which are underfunded by almost $100 billion, a debt that grows by a staggering $17 million each day. With pension obligations set to consume a fifth of all state revenues in the next year and the state’s credit rating already the lowest of the 50 states, pension reform was the top item on everyone’s agenda for the session. Still, nothing was accomplished. The blame lies with lawmakers in general and with the state’s legislative leaders, House Speaker Michael Madigan and Senate President John Cullerton, in particular. A pair of Chicago Democrats, Madigan and Cullerton could not reach an agreement among their own party members, even though they have comfortable majorities in both houses. There are others to blame. If the state had a stronger leader in its highest office – governor – then pension reform already might be done. Voters are to blame, too. How much longer will Illinois voters continue to elect and send inept leaders to Springfield? It’s clear the Pat Quinn-Madigan-Cullerton trio can’t govern effectively. Given their failure, it is time for Madigan and Cullerton to step aside and allow others to become involved in crafting a workable compromise. More people need to be involved in this process – Republicans, Democrats, taxpayer advocates, even unions – to come up with a compromise solution that can extricate us from this crisis. The status quo is untenable and benefitting almost no one in Illinois. It is past time for a solution. Because Illinois has the lowest credit rating of the 50 states, state taxpayers spend more on interest payments than any other. The ego-driven approach employed by Madigan and Cullerton this spring has yielded only more embarrassment and financial hardship for our state.

8ANOTHER VIEW

Pay now and later If you are a [recent] school graduate who has been accepted to college, you are probably over-the-moon excited about your future ... as you should be. If, on the other hand, you are a parent preparing to write a check for room, board, tuition and all of the extraneous fees, you are more likely to be hypertensive than excited. The cost of a college education is high, and, unless Congress acts by July 1, the cost for most students will rise. That’s because college loan rates will double from 3.4 percent to 6.8 percent unless Congress moves to keep them low. Failure to act will lead to higher rates and greater uncertainty, and will put a college education beyond the reach of a significant segment of society. Intelligencer Journal/Lancaster (Pa.) New Era

8IT’S YOUR WRITE Deserving ladies

Will I be audited?

To the Editor: Re: Bob Anderson’s letter, “Abolish townships” (May 26). I regard Donna Schaeffer as a top-notch township supervisor, among the best, highly efficient, works well with people, leads by example, the only way to lead. She is at the center of activity, in the trenches with the troops. Our wonderful, recently re-elected mayor of McHenry, the honorable Sue Low, does a stupendous, meritorious job for a mere pittance. They are two deserving ladies of valor. I have served as an election judge for almost 20 years in McHenry, Precinct 26. When I began, we returned election supplies to McHenry County Sheriff’s Office. I got home at 10 p.m. As the area grew, it was necessary to shift processing supplies to the townships offices. I got home from the last election at 8 p.m. Since we start at 5:30 a.m., I appreciate getting home those two hours earlier. The newspapers have shown a lot of public officials moving around, being snatched away by a neighboring community for much more money. If you have a good employee whom you want to keep, pay that employee an appropriately sufficient salary. “The laborer deserves his wages.” (Luke 10:7)

To the Editor: Our government is like a broken record. Government officials are so predictable. As I have written about in the past, President Barack Obama has tried to reinterpret our Constitution. He said, “Our Forefathers didn’t mean that,” and also has said, “It’s outdated.” Current and past administrations have never followed our Constitution. However, this administration has been the worst. They only sue it to strike down something that does not meet their political agenda. Or if they are in trouble and need the Fifth Amendment to save themselves from prosecution, as in the IRS. This is so blatant. Americans should finally wake up and see this, but will not. It will affect the free ride they have been getting. The rest of us just shake our heads in disgust. Just remember that this is not a scandal with the IRS; it is a crime. Now with this letter, I will be waiting to see whether I’m audited.

Dave Boger McHenry

James Korjenek Wonder Lake

Self-destructing To the Editor: I loved your article, “Housing too costly for many,” dated May 26. McHenry County is self-destruct-

How to sound off We welcome original letters on public issues. Letters must include the author’s full name, home address and telephone numbers. We limit letters to 250 words and one published letter every 30 days. All letters are subject to editing

ing before our eyes. Look at all the store vacancies along Route 31 and Route 120. House foreclosures continue to stay high. Your article states that only 30 other counties in the whole country have a higher property tax as a percentage of median income as McHenry County. We are driving people away, but our taxing bodies could not care less. As an example, the fair cash value of my home decreased by 20 percent between 2004 and 2012, which is much less than the national average and another example of being unfair, yet my taxes increased by 17.5 percent for that same period and the tax rate increased a whopping 54 percent over this same period. Our tax rate is now over 10 percent. Don’t the people who head these taxing bodies know they should reduce expenditures, or at least live on the same dollar amount as last year? Why would you want to buy property in McHenry County or

for length and clarity. Submit letters by: • E-mail: letters@nwherald.com • Mail: Northwest Herald “It’s Your Write” Box 250 Crystal Lake, IL 60039-0250

start a business here? Andy Franzen McHenry

No chance To the Editor: I agree with Chuck Stevens of Woodstock (May 29, It’s Your Write). We are held hostage to our real estate tax bills. Our reassessment did nothing but raise taxes again. The answer I received from Treasurer Bill LeFew’s office was call your senator. I am a recently widowed, now self-supporting woman. I want to keep my home in honor of my deceased husband, but it seems to me that no matter what way you look at it, no one cares and I am screwed. I am now sorry I ever moved to the McHenry County area. Seniors and retired citizens do not have a chance. Christine Vesely Trout Valley

Stop the madness in Springfield; adopt pension reform On May 31, the 98th General Assembly adjourned after a week of high-paced legislative action. The state’s financial situation remains dire. There are $7 billion of unpaid bills; the unemployment rate is 9.5 percent; Illinois’ credit has been downgraded and the pension crisis looms. Yet in spite of all this, the Legislature’s reckless spending habits continue to spiral out of control. Most importantly, the Legislature failed to adopt badly needed pension reform. I was sworn in on Jan. 6 and immediately focused on fulfilling my campaign pledges. I declined a legislative pension, voluntarily took a 10 percent pay cut, reduced my office budget by 10 percent, and filed a bill to repeal the 67 percent incometax increase of 2011. I’m proud of those actions, and I believe it set a positive tone for my performance during the entire session. I also plan to continue to lead the fight against the adoption of a graduated income tax in Illinois that would hurt families and kill jobs.

Considering my financial expertise, I was assigned to serve on the House Revenue Committee, a slot not traditionally assigned to freshman members. For weeks, I worked with representatives on both sides of the aisle on my constitutional amendment to abolish the lieutenant governor’s position, which advanced with overwhelming House support. I have been told that it is a rare feat for a freshman legislator to pass a constitutional amendment. There are now 35 Senate sponsors of my constitutional amendment, and it likely will be enacted next spring. If so, it will be on the ballot in 2014. Eliminating the lieutenant governor’s office will save about $2 million per year. I’ve also filed and supported a series of property-tax relief measures. I supported a three-year freeze on all property-tax levies, freezing property-tax levies when housing values decline and a two-year freeze on township property-tax levies. I’m pleased to report that my HB 983 passed both the House and Senate

Editorial Board: John Rung, Dan McCaleb, Jason Schaumburg, Kevin Lyons, Jon Styf, Kate Schott, Stacia Hahn

VIEWS Rep. David McSweeney and is now on the governor’s desk to be signed. HB 983 reforms the process for governmental units to issue alternate revenue bonds and makes it easier for taxpayers to stop bad projects that could result in higher property taxes. Specifically, the bill, which I worked closely on with Rep. Jack Franks and Sen. Pam Althoff, reduces the number of signatures required to force a referendum on the issuance of alternate revenue bonds. Pension reform was my absolute top priority this session. I serve on the Personnel and Pensions Committee and was a leader in the fight for real pension reform. Our state cannot move forward until we address this crisis that is darkening Illinois’ economic future and crowding out other essential government

8THE FIRST AMENDMENT

services. Nothing substantial was accomplished on pension reform this session, but I remain committed to being part of the solution. We need to stop the madness and immediately adopt pension reform in a special legislative session. A major push for job creation in Illinois finally began gaining traction in the last days of session. A measure authorizing fracking passed the Illinois House. Fracking is an energy-drilling process that uses large amounts of fluid under high pressure to force to the surface oil and gas that is trapped underground. Fracking potentially could generate a lot of new revenues for Illinois and create thousands of new jobs in various parts of the state. I strongly supported this important bill. Another positive note is the overwhelming passage of concealedcarry legislation on the last day of session. I supported the bill because I believe in the Second Amendment rights of all Americans. To date, I have hosted three town

hall meetings in which I’ve had the pleasure of meeting with district residents to hear their concerns and ideas on how to address the state’s most pressing issues. My next Town Hall meeting will be from 10 to 11 a.m. Saturday, June 29, at Cary Park District Community Center, 255 Briargate Road, Cary. I encourage all constituents to attend. I came into the General Assembly in earnest, ready to fight for my constituents at the Capitol and tackle our toughest issues. On day one, I began pursuing my commitments while demonstrating the courage to act on politically unpopular issues. As the 52nd District state representative, I thank the residents who have given me the opportunity to serve them and be their voice in Springfield. We will never all agree 100 percent of the time, but I assure you that I will always listen and tell you where I stand.

• Rep. Dave McSweeney, R-Barrington Hills, represents Illinois’ 52nd House District.

Congress shall make no law respecting an establishment of religion, or prohibiting the free exercise thereof; or abridging the freedom of speech, or of the press; or the right of the people peaceably to assemble, and to petition the Government for a redress of grievances.


Wednesday, June 5, 2013 Northwest Herald Page A8

Weather TODAY

THU

FRI

SAT

SUN

MON

TUE

72

68

67

72

73

75

77

Partly sunny and cool

Mostly sunny and warmer

Increasing clouds; late-day t-storms

Partly sunny and pleasant

Partly sunny with a few showers

Partly sunny; a chance of showers early Wind:

Mostly cloudy with a shower in spots

Wind: S 5-15 mph

N/NE 10-15 mph

57

Wind:

Wind:

Wind:

Wind:

Wind:

NE 5-15 mph

E 5-10 mph

S/SW 10-15 mph

W 5-15 mph

S/SW 10-15 mph

52

ALMANAC

53

56

55

58

Shown is today’s weather. Temperatures are today’s highs and tonight’s lows.

at Chicago through 4 p.m. yesterday

Harvard 69/51

Belvidere 70/54

TEMPERATURE HIGH

57

Crystal Lake 72/57

Rockford 70/54

LOW

Hampshire 74/54

90

Waukegan 68/51 Algonquin 74/53

88

Aurora 74/54

Sandwich 74/55

39

Oak Park 74/58

St. Charles 72/57

DeKalb 72/57 Dixon 75/54

McHenry 73/52

An area of low pressure will continue to spread clouds and a few showers across the area. The best chance of rain will come at night. No severe weather is expected. Rainfall amounts should stay under 0.25 of an inch. A few showers will linger into Thursday, but northeasterly winds will keep the air rather cool. High pressure will build in Friday with more of the same. It will be warmer by Saturday.

LAKE FORECAST WATER TEMP: Chicago Winds: SE at 8-16 kts. 74/58 Waves: 1-2 ft.

56

Orland Park 76/57 Normal high

76°

Normal low

54°

Record high

97° in 1977

Record low

35° in 1945

POLLEN COUNT

REGIONAL CITIES

TREES GRASSES

PRECIPITATION 24 hours through 4 p.m. yest.

0.00”

Month to date

0.57”

Normal month to date

0.49”

Year to date

22.80”

Normal year to date

13.57”

SUN AND MOON

WEEDS MOLD

FOX RIVER STAGES as of 7 a.m. yesterday Flood

Current

24hr Chg.

Fox Lake

--

4.28

-0.04

Nippersink Lake

--

4.25

-0.02

10

8.74

-0.19

Sunrise

5:18 a.m.

New Munster, WI

Sunset

8:26 p.m.

McHenry

4

2.25

-0.08

Moonrise

3:25 a.m.

Algonquin

3

1.72

-0.25

Moonset

5:50 p.m.

Today

MOON PHASES New

First

Jun 8

Jun 16

Full

Last

Jun 23

Jun 29

AIR QUALITY Tuesday’s reading

0-50 Good; 51-100 Moderate; 101-150 Unhealthy for sensitive groups; 151-200 Unhealthy; 201-300 Very Unhealthy; 301-500 Hazardous Source: http://www.epa.state.il.us/air/aqi/index.html

UV INDEX TODAY The higher the AccuWeather.com UV Index™ number, the greater the need for eye and skin protection.

9a

10a 11a Noon 1p

2p

3p

NATIONAL CITIES

4p

0-2 Low; 3-5 Moderate; 6-7 High; 8-10 Very high; 11+ Extreme

5p

Today

City

Hi/Lo/W

City

Hi/Lo/W

Albuquerque Anchorage Atlanta Atlantic City Baltimore Billings Boise Boston Charlotte Cincinnati Cleveland Dallas Denver Des Moines Detroit El Paso Fairbanks Fargo Green Bay Honolulu Houston Indianapolis Jacksonville Kansas City Las Vegas Los Angeles Louisville Memphis

90/62/s 60/47/pc 84/67/t 72/58/s 80/59/s 70/51/pc 85/58/s 72/54/s 82/66/t 84/64/pc 76/58/pc 94/71/pc 63/50/c 74/56/c 74/57/pc 99/72/s 65/46/sh 63/45/sh 58/49/sh 88/74/s 95/72/s 80/64/pc 88/70/t 74/58/t 101/81/s 75/61/pc 84/68/pc 88/72/pc

Miami Milwaukee Minneapolis Nashville New Orleans New York Norfolk Oklahoma City Orlando Philadelphia Phoenix Pittsburgh Portland, OR Reno Richmond Sacramento Salt Lake City San Antonio San Diego San Francisco Seattle Sioux Falls St. Louis St. Paul Tampa Tucson Wash., DC Wichita

84/77/t 64/53/t 62/48/sh 88/69/t 88/75/pc 75/58/s 78/63/s 84/65/t 86/72/t 78/58/s 105/80/s 78/62/pc 82/54/pc 92/62/s 82/58/s 92/56/s 80/57/s 93/71/pc 69/62/pc 64/52/pc 76/53/pc 68/47/c 78/66/t 62/48/sh 85/76/t 99/69/s 81/61/s 72/60/t

WORLD CITIES Today

Today

Thursday

Friday

City

Hi/Lo/W

Hi/Lo/W

Hi/Lo/W

City

Hi/Lo/W

City

Arlington Hts Aurora Bloomington Carbondale Champaign Chicago Clinton Evanston Galesburg Joliet Kankakee Mt. Vernon Naperville Peoria Princeton Rockford Rock Island Springfield Waukegan Wheaton

73/56/t 74/54/t 78/60/t 82/65/t 80/61/t 74/58/t 78/60/t 70/56/t 76/56/t 76/56/sh 78/58/sh 80/62/t 74/55/t 76/59/t 77/57/t 70/54/t 74/57/t 78/63/t 68/51/t 72/55/t

67/51/t 72/48/t 77/54/t 80/61/t 76/53/t 69/53/t 77/54/t 65/52/t 74/53/t 71/48/t 74/49/t 80/58/t 70/47/t 75/54/t 73/52/t 70/49/t 73/52/t 77/56/t 63/47/t 69/49/t

68/52/pc 70/49/pc 73/52/pc 77/55/pc 75/52/pc 69/53/pc 73/53/pc 65/53/pc 69/51/pc 70/49/pc 72/50/pc 76/54/pc 70/49/pc 72/53/pc 71/51/pc 69/50/pc 71/50/pc 73/53/pc 64/49/pc 70/51/pc

Acapulco Amsterdam Athens Baghdad Beijing Berlin Brussels Buenos Aires Cairo Cancun Dublin Geneva Hong Kong Islamabad Istanbul Kabul Kingston Lima London Madrid

90/77/pc 68/50/s 81/63/s 104/75/s 90/70/pc 72/48/s 71/51/pc 72/45/s 93/69/s 89/76/t 64/46/s 72/48/pc 88/81/t 107/82/s 77/61/pc 91/60/s 90/79/sh 69/58/s 68/46/pc 84/57/pc

Manila Melbourne Mexico City Montreal Moscow New Delhi Paris Rome Santiago Sao Paulo Seoul Singapore Stockholm Sydney Tel Aviv Tokyo Toronto Vancouver Vienna Warsaw

Source: National Allergy Bureau

Today

Hi/Lo/W

92/80/pc 60/51/c 87/53/s 67/50/s 75/48/sh 102/82/pc 75/57/pc 73/57/s 72/50/s 76/59/s 84/64/pc 91/78/t 70/48/s 68/52/pc 81/64/s 79/66/pc 65/52/c 68/52/pc 66/55/t 70/57/t

NATIONAL FORECAST -10s

-0s

0s

10s

20s

30s

40s

50s

60s

70s

80s

90s

100s 110s

Shown are noon positions of weather systems and precipitation. Temperature bands are highs for the day.

Weather (W): s-sunny, pc-partly cloudy, c-cloudy, sh-showers, t-thunderstorms, r-rain, sf-snow flurries, sn-snow, i-ice

Forecasts and graphics, except WFLD forecasts, provided by AccuWeather, Inc. ©2013

Showers T-storms

Rain

Flurries

Snow

Ice

Cold Front

Warm Front

Stationary Front


FOR THOSE LOOKING FOR A MORE ADVANCED EXPERIENCE !!!

Northwest Herald / NWHerald.com

Wednesday, June 5, 2013 • Page A9

Who Else Wants To Get SWIMSUIT Beautiful?

…for less than 3.50 a day!!!

$

Get Your Body Fit Boot Camp is slowly winning the hearts of all McHenry County and it’s YOUR turn to Burn Fat, Become Stronger and Look Great!

P M A C T O BO TNESS Fit! FI ur Body

TOUGH DECISIONS AHEAD

o Y t e G

Take Your Body To The Next Level!

Do You Want? -

Feel Great Become More Attractive Drop Sizes Tone & Firm Lose Inches Better Mood Definition In Your Arms Feel Great Lose Weight

Be f o re

Dan - Crystal Lake

$99 PER

Be f o reMary Jo Dan & e Crystal Lak

Af te r

MONTH

104 lbs. in 4 Months

Be f o re oodstock Julie - W

Lost 59 lbs. & Fe Af te r els Great!

ASK US ABOUT OU R

2 Jean Size Guarantee Program**

6119 Northwest Hwy Crystal Lake (Parking in the rear of building)

815-575-9195 *See Club for Details **Guarantee program is for 12 months.


Northwest Herald / NWHerald.com

Page A10 • Wednesday, June 5, 2013

STOP Suffering with Back Pain!

,1.&1%.%0 $ #+1!%2.+- )%0/0 $ */%2.%/2 $ *.+!30%0 $ '2/+. *(!-13"+ Start Living Pain Free! Our goal at Superior Health & Wellness is to relieve our patients’ pain. Our doctors perform physical evaluations and review all existing data (such as an MRI or an X-ray) to make sure new patients are candidates for the spinal decompression therapy. If the treatments you’ve tried haven’t helped your chronic neck or back pain, we encourage you to try Spinal Rejuvenation Therapy. This amazing, non-surgical decompression therapy has helped thousands of FORMER pain sufferers. Spinal Rejuvenation Therapy does not mask pain instead it corrects the source of the pain. Our medical practitioners have helped people with many different back conditions, such as bulging discs, protruding discs, degenerative disc disease, arthritis, sciatica, posterior facet syndrome, and failed back surgery.

The Conditions These are just some of the conditions non-surgical spinal decompression is believed to help. Come in for an evaluation to learn if it can help your pain. Herniated Discs When the spine compresses, it can cause disc herniations to expand, putting

pressure on surrounding spinal nerve roots. Experts believe decompression therapy takes the pressure off these damaged discs so the disc bulge will return close to its original size. Superior Health & Wellness has successfully treated many patients with herniated discs.

Facet Joint Syndrome

Degenerative Disc Disease

Spinal Stenosis

Loss of disc height can be worsened by spinal compression, causing the vertebrae to move closer together. This leads to compressed nerves and other common back pain. Experts believe decompression therapy eliminates the overwhelming pressure on degenerated discs, reducing or eliminating painful symptoms.

Spinal Stenosis happens when the spinal canal narrows. This narrowing may be caused by mechanical problems or by abnormalities in the aging spine. Spinal Stenosis can cause low back pain, limping, or a lack of feeling in the legs. Unfortunately, stenosis is a chronic condition that cannot be cured, but experts believe decompression therapy can improve the condition, and that these improvements can be maintained over time.

Basically, Facet Joint Syndrome is arthritis in the joints which connect the vertebrae in the spine. Experts believe decompression therapy creates more space between the vertebrae, thereby reducing painful symptoms.

The Treatment Spinal Rejuvenation Therapy targets a specific disc or trouble area. It creates a vacuum effect inside the disc, allowing the center of the disc to be reabsorbed into its proper position. When the herniated

material in the disc has receded, the nerves in the disc are able to heal, eliminating the patient’s pain. It may sound painful, but it’s not. Patients

are fitted with a support system, then positioned on a comfortable spinal decompression table. The support system stabilizes the patient’s body so the therapy can focus on the affected

area of the spine. Once on the table, an advanced computer system elongates the spine in a slow, gentle manner. This relieves pressure on compressed discs.

The Science

Symptoms of a herniated disc can vary depending on the location of the herniation and the type of soft tissue involved. In many cases severe and unrelenting pain will radiate into the region served by an affected nerve root that is irritated or impinged by the herniated material.

Healthy Disc. This is the goal of our treatment, to return your disc to it’s healthy state so you can live life free from pain and begin to enjoy life once again!

Spinal decompression gently pulls the It is also believed through this process vertebral joints apart. It is believed this precise the disc is re-hydrated, aiding in its process produces a negative pressure inside restoration. the disc causing any herniated material to slowly recede away from the affected nerve root and back into the disc.

The Goal The decompression doctor’s primary goal is to relieve the patient’s pain. It is extremely important to accurately diagnose the cause of the patient’s condition. The doctor will

perform a physical evaluation, review all previously existing data such as MRI or X-Ray to be certain the patient is a candidate for the decompression procedure. Take advantage

of our New Patient Special on page 4 to start living pain free! Call 815-516-1646 To Schedule Your New Patient Visit!

E N D Y O U R B A C K PA I N !

Better Health Begins Here At Superior Health & Wellness, we are committed to helping you overcome your pain or injury as naturally as possible. We provide high quality services to help restore each and every patient to optimal health and well-being.

When a new patient walks in our door, we design a completely personalized program using the most advanced combination of diagnostics and treatment options available. We want to offer our patients

relief from their pain, while also correcting the underlying condition causing the pain. Our patients who actively participate in their treatment program are the ones who experience the most success.

NEW PATIENT SPECIAL

$

End Your Pain!

47

00

# # # #

9.- 761$.!1 (+6" , %4/6)3 $* 9..0.0 /.8:5 1 :* &$!0$!'3 /.2:"".!061$:!3 *Expires in 14 days. Special offers are for new patients only and Federal Entitlement Programs are excluded.

815-572-0733 6119 Northwest Hwy (Rte 14) Crystal Lake

Chiropractic & Medical Working Together


Local&Region News editor: Kevin Lyons • kelyons@shawmedia.com

8COMMUNITY NEWS

J’BURG WOMAN GETS 9 YEARS IN PRISON WOODSTOCK – A Johnsburg woman, who authorities said used obituaries to target her victims, was sentenced to nine years in prison for residential burglary. Jacquelyn S. Buchholz, 25, was charged with a string of residential burglaries in October 2012. At the time of her arrest, police said she and an accomplice read obituaries in local newspapers to gather personal information and then burglarized the homes while family members were attending funeral services. Jason K. Werner, 26, also was charged with residential burglary. His next court appearance is scheduled for Thursday. Buchholz pleaded guilty Tuesday to two residential burglary charges in front of McHenry County Judge Sharon Prather. As part of her guilty plea, additional residential burglary and theft charges were dropped. She is currently serving a prison sentence for residential burglaries in both Cook and Boone counties, and her McHenry County sentence will be served concurrently.

SECTION B Wednesday, June 5, 2013 Northwest Herald

Breaking news @ www.NWHerald.com

County again seeks flat levy Board chose last year to reject 3 percent increase it could have collected By KEVIN P. CRAVER kcraver@shawmedia.com WOODSTOCK – McHenry County government will aim again to keep its levy flat and not collect an inflationary increase next fiscal year. The goal was part of the 2014 budget process approved Tuesday morning by the County Board on a 20-0 vote. The 21-page document sets down the guidelines by which county government will develop its spending

plan to be approved for fiscal 2014, which starts Dec. 1. “I think it will be another year of a good, reasonable budget,” Finance and Audit Committee Chairwoman Mary McCann, R-Woodstock, said after the meeting. “I think we’ve been really focused on keeping a good fiscal rating and doing the best we can to provide the best services without raising taxes. But it’s becoming more challenging because costs are going up.”

The budget process will allow county staff to capture first-year growth, which is not subject to the tax cap. However, it will not collect the 1.7 percent extension increase that taxing bodies are entitled to on next year’s taxes under the law. The process approved Tuesday applies only to county government, which makes up about 10 percent of property-tax bills. It does not apply to municipalities, school districts, townships or other independent bod-

ies. County Board members chose last year to reject the 3 percent increase the county could have collected under the law on this year’s bills, citing struggling property owners angry that tax bills have been increasing despite the fact that home values have fallen. The tax cap law in place for more than 20 years has had an unforeseen

See TAXES, page B6

SEASONED VETERAN CL soldier home after six years abroad

– Chelsea McDougall

RIGHT TO CARRY TO HOST SAFETY CLASS WOODSTOCK – The McHenry County Right to Carry Association will host a Ladies’ Night program, “Personal Safety Strategies,” at 7 p.m. Thursday at the Woodstock Veterans of Foreign Wars post, 240 N. Throop St. Alexandra Nelson, a 15-year veteran of law enforcement and a firearms trainer for a suburban police department, will be the presenter. Topics covered will include basics of personal security, minimizing weakness typically exploited by criminals, and the combat mindset from the female perspective. The cost is $10 at the door. No reservations are required. This program is for women, men and young adults. For information, visit www. mcr2ca.org.

– Northwest Herald

8ENVIRONMENT TIP

WHERE FOOD COMES FROM MATTERS One way to make positive environmental changes is to ask where your food comes from and to keep asking. What and how you consume has a host of effects on multiple environments. Buying local, organic food reduces your carbon footprint. It burns less carbon to transport food from a local farm/market to your table than it does from overseas. Organic foods also reduce the amount of pollution runoff into the ecosystem. So whether you’re in a restaurant or grocery story, just ask, “Where does this food come from?” Get the conversation started and keep it going.

Source: Environmental Defenders of McHenry County

8LOCAL DEATHS Helen Vestal-Berry 74, Marengo Mary F. Obenauf 98, formerly of Hebron Lloyd N. Pohlman 70, Hebron OBITUARIES on page B5

Photos by Kyle Grillot – kgrillot@shawmedia.com

Zackery Rhodes plays with his dog Ghost on Monday outside his Crystal Lake home. Rhodes joined the military so his mother wouldn’t have to sell their home to pay for his education. He has been gone for the past six years. He was deployed to Iraq twice and Afghanistan once.

By JEFF ENGELHARDT jengelhardt@shawmedia.com

C

RYSTAL LAKE – Zackery Rhodes missed his carpet. It’s what two tours of Iraq and one tour of Afghanistan will do to a soldier. “I remember coming home and just loving the feeling of lying on carpet again ... or taking a real hot shower,” said Rhodes, a 2006 Crystal Lake Central High School graduate. “It’s the little things you take for granted.” Rhodes recently returned home to Crystal Lake and celebrated with community members at Crystal Lake Central High School and Georgio’s

Chicago Pizzeria & Pub. Friends and family had plenty to celebrate about the Army infantryman’s six-plusyear career. At 24 years old, Rhodes was a team leader for three older soldiers during his second tour of Iraq. He also completed Ranger school, which required him to traverse deserts, jungles and mountains in extreme conditions that included as little as two hours of sleep a night and sparse food. His combat leadership included assisting more than 300 partnered combat patrols, an air assault and multiple small kill teams that

See HOME, page B6

Zackery Rhodes and his mother, Carmen Rhodes, pose for a portrait Monday outside their Crystal Lake home.

I remember coming home and just loving the feeling of lying on carpet again ... or taking a real hot shower. It’s the little things you take for granted.” Zackery Rhodes, Army infantryman on his return after three tours in the Middle East

Cary names Fetzer interim police chief By JOSEPH BUSTOS jbustos@shawmedia.com CARY – Deputy Police Chief Ed Fetzer will take over the department on an interim basis. The Village Board on Tuesday appointed Fetzer as acting chief as the village looks for a replacement for Chief Steven Casstevens, who is leaving Friday to become the police chief in Buffalo Grove. Fetzer has previously served as chief on an interim basis. From early 2008 through the end of 2010, Fetzer was the acting chief after former chief Ron Delelio was placed on administrative leave as the result of a back injury. Casstevens was named police chief

in January 2011. The process and timeline to find a permanent replacement for Casstevens will be discussed next week during the village’s police committee meeting, Village Administrator Chris Clark said. Fetzer said on Tuesday it was too soon to say if he would apply for the permanent position. Also Tuesday, the board approved hiring Municipal Code Corporation to codify the village’s ordinances, which was last done in 1981. As part of the codification process, Municipal Code Corporation will make sure there are no ordinances that contradict each other and search

See POLICE, page B6

Huntley road project set to start sometime in June By STEPHEN Di BENEDETTO sdibenedetto@shawmedia.com HUNTLEY – With the design complete and all rights of way acquired, Huntley officials now are simply waiting to know the exact date construction crews will start the $4.17 million Kreutzer Road extension project. The Illinois Department of Transportation has informed village officials that construction will start sometime in June but have yet to meet with Huntley for a pre-construction meeting to discuss the details, Assistant Village Manager Lisa Armour said. The state agency is overseeing the project, since $1.5 million of the construction costs are being covered by federal funds from the McHenry County Council of May-

Construction updates Start the workweek by making sure your commute goes smoothly. Sign up for the Northwest Herald's road construction email newsletter to stay updated on local construction projects. Sign up at NWHerald.com/newsletter. The newsletter will be emailed Sunday evenings throughout road construction season. You also can find construction updates online at NWHerald.com/construction. ors. Huntley will cover the rest of the project, which has long been on the village’s radar. “It’s been quite awhile that it has been planned, designed and worked on,” Armour said.

See ROADS, page B6


LOCAL&REGION

Page B2 • Wednesday, June 5, 2013

Construction continues along Route 31

Northwest Herald / NWHerald.com

McHENRY COUNTY: FEMA

$148,000 in flood aid given to McHenry County residents By JIM DALLKE jdallke@shawmedia.com Gov. Pat Quinn announced a total of $148,000 in federal aid Monday to McHenry County residents affected by the April flooding. So far, 75 people in the county have received aid, which includes grants for temporary home rentals, home repairs and replacement of damaged personal items. More than $76 million in federal aid has been given to 27,000 flood victims statewide, FEMA Public Information Officer Mike McCormick said. Although FEMA is halfway to the July 9 deadline for registering people for disaster aid, McCormick said, the agency probably has not reached half of the affected

Kyle Grillot – kgrillot@shawmedia.com

R.W. Dunteman employee James Wechet directs drivers Tuesday as Stacey Creps (not pictured) operates an asphalt milling machine along Route 31 in Crystal Lake. The Illinois Department of Transportation project will improve the intersection of Route 31 and Route 176. The improvements include reconstruction of the intersection to provide two through lanes, dual left-turn lanes and exclusive right-turn lanes.

8LOCAL BRIEFS Algonquin man violates probation, gets 5 years WOODSTOCK – An Algonquin man will be sent to prison after admitting to violating his probation. Jacob R. Bennett, 21, was sentenced Tuesday to five years in prison by McHenry County Judge Sharon Prather. Assistant State’s Attorney Dave Johnston said Bennett was on probation for 2011 burglary charges, and as part of that sentence, he was not to violate any other laws. While on probation, Bennett was charged with possession of a controlled substance with intent to deliver and driving under the influence out of Kane County, Johnston said. He will serve his prison term concurrently with the Kane County charges.

– Chelsea McDougall

Green Drinks group to meet Wednesday CRYSTAL LAKE – Green Drinks McHenry County will meet from 5 to 7 p.m. Wednesday, at Duke’s Alehouse & Kitchen, 110 N. Main St. Zak Dolezal, chef and general manager of Duke’s Alehouse and Kitchen, will discuss how restaurants can become more sustainable and make money, too. He also will explain how a

restaurant becomes green certified and what consumers can look for to determine which restaurants are greener than others. There will be an information table set up, and attendees are welcome to bring information about their green products and services each month to share. Additional parking is available at the train station. To be added to the group’s email list, send a note to GreenDrinksMC@gmail.com or “like” the group on Facebook.

Master gardeners share secrets at Harvard library HARVARD – Do you want to compost garbage and lawn refuse but not sure how? Master gardeners from McHenry County know the secrets and will share them from 6:30 to 7:30 p.m. Thursday during “Master Gardeners on Composting How-To’s” at Harvard Diggins Library, 900 E. McKinley St. Ask a master gardener about composting and other garden issues at this free event. No registration is required. For information, stop in at the library, call 815-943-4671 or visit www.harvard-diggins.org.

LITH to host park party featuring Steve Beno

in the Hills Parks and Recreation Department invites everyone to join it at 11 a.m. Friday on the Village Hall lawn for a free park party featuring Steve Beno. Beno will get attendees dancing and singing with his innovative show. Attendees are invited to pack a picnic and a blanket to spread out and enjoy the performance. In the event of rain, the show will be held in the multipurpose room at the Village Hall, 600 Harvest Gate. For information, call 847-9607460 or visit www.lith.org.

“There are tons of reasons people don’t reach out for help. They believe if they take assistance from the government, they are taking it from neighbors who need it. Some think it’s a waste of time. Some people think taking money from us will affect retirement or welfare. It doesn’t affect any programs of entitlements they are receiving.” Mike McCormick FEMA public information officer

McHENRY: TREE OF LIFE UNITARIAN UNIVERSALIST CONGREGATION

McHenry church takes new name NORTHWEST HERALD McHENRY – One of the oldest continually operating congregations in McHenry County got a new name when members voted Sunday to adopt the name Tree of Life Unitarian Universalist Congregation. The Tree of Life is an image that occurs in many religious traditions around the world affirming the sustaining gifts of creation. The church has used it for more than 40 years. Now located in McHenry at 5603 Bull Valley Road, the church was founded in Woodstock in 1865 as

McHenry City Jazz Band to start summer concerts McHENRY – The McHenry City Jazz Band will perform its one-hour concerts at Veterans Memorial Park starting at 7:30 p.m. Thursday. The themed concerts by the 18-piece band directed by Michael Bazan and featuring vocalist Maureen Christine continue every Thursday until the last concert Aug. 1. The theme for Thursday is “Swing Into Summer.” Anyone can request a special number by logging onto the band’s website at www.mchenrycityband.com. Attendees should bring lawn chairs or blankets. Food vendors usually are available.

LAKE IN THE HILLS – The Lake

residents in the state. “If you have any uninsured losses, talk to us,” McCormick said. “There are tons of reasons people don’t reach out for help. They believe if they take assistance from the government, they are taking it from neighbors who need it. Some think it’s a waste of time. Some people think taking money from us will affect retirement or welfare. It doesn’t affect any programs of entitlements they are receiving.” McCormick said those who have yet to register for aid can call 800-621-FEMA (3362) or register online at disasterassistance.gov. Residents have until July 9, which is 60 days from the initial disaster declaration. That deadline can be extended at the request of the state, but FEMA has not yet gotten a request for an extension.

the First Congregational Church. Over the next 145 years, the name was changed to the Congregational Universalist Church in 1938 after voting to affiliate with the Universalist Church in America. Then after the Universalists consolidated nationally with the American Unitarian Association to create the Unitarian Universalist Association, the name Congregational Unitarian Church was adopted in 1984. It was changed again to the Unitarian Universalist Congregation of Woodstock just a few years ago after dual affiliation with United

Church of Christ was drop ped. Two years ago, the congregation received the former Haystacks Manor Restaurant building and grounds in McHenry as a donation and moved there from its 100-year-old building in Woodstock. It held its first services in the new building in January 2012. The congregation serves members throughout McHenry County and from nearby areas in Lake County and southern Wisconsin. The new name was launched with a brand-new web page at treeoflifeuu.org.

305 VIRGINIA ST.

WE ER DELIV

(Rt. 14) • Crystal Lake

815-459-4050

Sale dates 6/5 - 6/11 www.cardinalwines.com

SPIRITS SUPER SAVINGS

Southern Comfort

1999

– Northwest Herald

3499

1.75 L

Seagram’s VO

Bill and Marge Schmidt 65th Anniversary June 5, 1948

1899

1.75 L

“We’ve had a good life, a happy life, and we’re blessed.” Marge & Bill Thank you for a lifetime of love and great memories. With much love & gratitude, Your 7 children, 19 grandchildren, 17 great grandchildren and extended family members

Svedka Vodka Bacardi Rum Seagrams 7

Jack Daniels Jagermeister

99

16

1.75 L

1.75 L

Absolut Vodka Dewar’s Scotch Beefeater’s Gin

Early Times Canadian Mist Cluny Scotch

1399

2599

1.75 L

Cutty Sark Sauza Tequila

Skinny Girl Margarita

2199

999

1.75 L

Canadian Reserve Burnett’s Vodka

99

10

750 ml 1.75 L

WINES - 750 ml

© 2013 Vera Bradley Designs, Inc.

• • • • • • • •

Santa Cristina .......................... 5.99 14 Hands - Cabernet ...................... 8.99 Stags Leap - Cabernet ................ 29.99 Simi - Cabernet ........................... 15.99 Franciscan - Cabernet ................. 17.99 Tres Picos - Garnacha ................. 11.99 MacMurray - Pinot Noir ................. 12.99 Acacia A - Pinot Noir ...................... 7.99

Santa Margherita Pinot Grigio (750 ml.

• • • •

15.99

Mer Soleil - Chardonnay ................ 16.99 McManis - Chardonnay ..................... 7.99 Starbourgh - Sauv Blanc ................. 9.99 Pomelo - Sauv Blanc........................ 9.99

1.75 L

VALUE WINES 1.5 L • • • • • •

Woodbridge . ........................ 9.99 Yellow Tail .............................. 8.99 Franzia House Wines 5 L. Box ...... 9.99 Bota Box 3 L. Box ..................16.99 Carlo Rossi 4 L. .................10.99 Sutter Home White Zinfandel .... 7.99

Sparkling • Korbel Brut or X-Dry ........................ 8.99 • Veuve Clicquot Yellow 750 mL ...... 39.99 • Piper Heidsick Brut ..........27.99 • Piper Sonoma ................11.99 • Barefoot Bubbly 750 mL ..... 6.99

BEER SAVINGS

Friend to friend... June 7-9: In honor of National Best Friends Day, purchase the new All in One Crossbody and receive a second one for 50% off! Be one of the first to see the new patterns. Quantities limited, incredible offer! New design and patterns. Shown in new Heather and Lola. See a store associate for complete details. 104 Cass St. • Woodstock, IL 60098 • 815.338.5651 • www.thoughtfulnessshop.com

Miller Lite Bud Light Coors Light

13

99 24 pk cans

Miller High Life Busch

99

12

30 pk. cans

Heineken Dos Equis

Sam Adams Goose Island

12 99 1199 12 pk btls

We reserve the right to correct errors.

12 pk btls


Northwest Herald / NWHerald.com

Wednesday, June 5, 2013 • Page B3

© 2013 by Vicki Whiting, Editor Jefff Schinkel, Graphics Vol. V 29, No. 25

The world just wouldn’t be the same without worm worms. What can we learn from a worm?

As earthworms burrow or dig into the ground, they swallow soil. They eat rotting plants and leaves. As this debris passes through the worm’s body, it is ground up by tiny stones in the worm’s gizzard and leaves the body as waste.

s number e h t p u Add cover each to dis wer. ans

This waste is called worm castings. Castings are dark and fertile and enrich the soil. Each day an earthworm produces its weight in castings.

How long was the longest earthworm ever found?

Worms are master W recyclers!

While we are quiet and shy, we are good to have around. We don’t have eyes, ears or legs, yet we provide an important service.

Garbage is for worms! You might think it is gross, but certain kinds of worms think garbage is yummy. Instead of tossing leftover salad, melon peels and apple cores into the trash or disposal, build a worm bin and start raising worms to eat your garbage.

How strong are earthworms? They can push things up to times their own weight. That would be like you being able to push four refrigerators at one time!

Replace the missing vowels to learn more about earthworms.

_lm_st all _f the _ _rthw_rms in N_rth Am_ric_ are n_t n_tive, but w_re intr_d_ced fr_m the _ld W_rld.

Standards Link: Life Science: Know that all organisms cause changes in their environments and these can be beneficial or detrimental.

This summer, everyone should read “Little House in the Big Woods” by Laura Ingalls Wilder. The main character is Laura Ingalls. Her family lived in the olden times. It is exciting. Emma, Kindergarten “The Lightning Thief” is the book I would nominate. It lets kids learn about Greek mythology, and enjoy reading at the same time. I think more kids should read it, because it keeps them entertained. In the book, Zeus is missing his lightning bolt. He thinks his brother (Poseidon) put his son (Percy) up to do it. Percy has to prove to Zeus he is innocent. But, with every victory comes trouble. Callie, 4th grade

RECYCLERS DISPOSAL GARBAGE SERVICE STRONG DEBRIS STONES BURROW MASTER WORMS GROSS COVER SOIL DARK DIG

Find the words in the puzzle. Then look for each word in this week’s Kid Scoop stories and activities. W K O G N O R T S N D R S I R B E D R D E A E L R G C S E I W D I V A I Y E T S F O U B O D C N S P S E R V I C E O A O L A W M O R R T M S G M W O S G S S R A W O R R U B L D S L Standards Link: Letter sequencing. Recognized identical words. Skim and scan reading. Recall spelling patterns.

Recycle Poster

Standards Link: Number Sense: Solve addition problems.

Students recommend books for others to read during the summer months.

If you put an earthworm on a clean, dry sheet of paper and listen very carefully, you will hear a little scratching noise. This noise is made by the eight small bristles an earthworm has on nearly every segment of its body. These bristles help earthworms move. Standards Link: Science/Investigation: Follow instructions for an investigation.

How many different kinds of earthworms are there?

Best Book for Summer

Do you think you can hear an earthworm move?

A great book that I think you should read this summer is “Eight Keys.” It is about a girl whose mom and dad both died, and she lives with her aunt and uncle. She finds keys that are meant for her, and she unlocks rooms. Within each room holds a secret of life. If you want to know more about this book, check it out at your local library. Lindsey, 5th grade A book I think kids should read during the summer is “Bunnicula,” because I think it is weird, because “Bunnicula” sucked all the juice out of a tomato and it turned white. Katlyn, 2nd grade I prefer the book series Junie B. Jones because it is a good LOL book for everybody. It is a chapter book with pictures. You can check them out at the library or get them at the store. My favorite is “Junie B. Jones is a Graduation Girl.” Grace, 4th grade

Scientists must be observant, watching things very carefully. Try this game to improve your powers of observation. 1. With a partner, pick a newspaper picture. Study it for one minute. 2. Cover the picture and write down everything you remember about it. Who can remember the most details? Standards Link: Science/Investigation: Follow instructions for an investigation.

Look through the newspaper for names and addresses of agencies involved in recycling. Make a poster encouraging students to recycle and list where different items can be recycled. Post this in your school. Standards Link: Research: Students use the newspaper to locate information.

Send Sendyour yourstory story to: (20-120 words) to:

I am brilliant because … Finish this story.

Northwest Herald P.O. Box 250 Crystal Lake, IL 60039

Deadline: June 30 Published: Week of July 28

The book I think you should read over the summer is “Seer of Shadows.” It is a great ghost storybook. This boy finds a rich lady who wants pictures. The boy and the servant try to find how the ghost died and help her get to heaven. This is the book I think you should read this summer. Kacey, 5th grade “The Magic School Bus Kicks up a Storm.” You should read this book because it is about storms. The characters are Ms. Frizzle, Carlos, Ralphie, Wanda and Arnold. The problem is, it is so hot and they need a storm and a weatherman came. So they got on the bus and the first thing they had to do was figure out what exactly was wind, rain and hail. Then they had their storm. You should read this book! Jamari, 2nd grade A good book for summer reading is “No David!” It is about a boy that gets into trouble and it’s funny. Christian, 2nd grade

Please include your school and grade.

I think a good book for summer reading is “Smile” by Raina Telgemeier. It is about a girl named Raina that lost her adult teeth. It is suspenseful and funny! Antonia, 2nd grade In my opinion, the best book for the summer is “Diary of a Wimpy Kid: Rodrick Rules.” This kid named Greg is in middle school. I liked it because it was funny. Miguel, 3rd grade The best book I read is “Ancient Egypt.” It was a big desert and had a lot of giant pyramids. Inside the pyramids were secret Egyptian words. But they were hard to read. When Kid Tut died, he was made into a mummy. His Egyptian soldiers hunted crocodiles and fat hippos. Everyone should read this book this summer. Brayan, 2nd grade

SUPPORT NEWSPAPERS IN EDUCATION. BECOME A SPONSOR TODAY! Kidscoop and other fun, engaging learning activities for students need your support. CALL 815-459-8118 to see how you can enrich a student’s life with a newspaper.


Northwest Herald / NWHerald.com

Page B4 • Wednesday, June 5, 2013

VIKING PA

IO SHOP

LLOYD/ LANDERS ACTORY AUTHORIZED SALE ! *

— S OREWIDE S ALES E VEN —

25% -50% O

**

PATIO

VIKING SKI & PA

URNITURE!

IO SHOP IL 60010

131 W. NORTHWEST HWY BARRINGTON

STORE HOURS Mo /Tues/Wed/Fri 10-6 Thurs 10-8 Sat 10-5 Su 12-4 *LLOYD/FLANDERS FACTORY AUTHORIZED SALE EXPIRES 6/15/2013 **Off MSRP. Excludes Seaside Casual, Berli Garde s, umbrellas, cushio s a d accessories. Photos for example o ly. Store hours subject to cha ge. VIKING SKI & PATIO SHOP IS A DIVISION OF VIKING SKI SHOP, INC.

847-381-1188 chicagopatiofurniturestore.com


LOCAL&REGION

Northwest Herald / NWHerald.com

8PUBLIC ACCESS WEDNESDAY Fox River Grove Parks Commission When: 7 p.m. Wednesday Where: Village Hall, 305 Illinois St. McHenry County Board Liquor and License Committee When: 3:30 p.m. Wednesday Where: Administration Building, 667 Ware Road, Woodstock McHenry County Board Transportation Committee When: 8:15 a.m. Wednesday Where: Division of Transportation, 16111 Nelson Road, Woodstock

McHENRY COUNTY: NEW OPPORTUNITIES McHenry County Housing Commission Education Committee When: 8:30 a.m. Wednesday Where: Administration Building, 667 Ware Road, Woodstock McHenry County Zoning Board of Appeals When: 1:30 p.m. Wednesday Where: Administration Building, 667 Ware Road, Woodstock Rural Woodstock Public Library District Board When: 7 p.m. Wednesday Where: Woodstock Public Library, 414 W. Judd St. Wonder Lake Village Board When: 7 p.m., Wednesday Where: Wonder Lake Village Hall, 4444 Thompson Road

Services Center, 227 W. Judd St., Woodstock Fox River Grove Public Works Committee When: 7 p.m. Thursday Where: Village Hall, 305 Illinois St. Huntley Committee of the Whole When: 7 p.m. Thursday Where: Huntley Village Hall, 10987 Main St. Johnsburg Village Board When: 7:30 p.m. Thursday Where: Village Hall, 515 Channel Beach Ave.

ment, 27901 W. Concrete Drive McHenry Township budget hearings When: Budget hearing for road district starts at 5:15 p.m. Thursday with hearing on town fund to follow at 5:30 p.m. Where: McHenry Township Hall, 3703 N. Richmond Road, Johnsburg McHenry County Conservation District Board of Trustees special meeting When: 6 p.m. Thursday Where: Brookdale Administrative Offices, 18410 Route 14, Woodstock

Lake in the Hills Park and Recreation Board When: 6:30 p.m. Thursday Where: Village Hall, 600 Harvest Gate

Richmond Village Board When: 7 p.m. Thursday Where: Richmond Village Hall, 5600 Hunter Drive

District 200 School Board special meeting When: 6 p.m. Thursday Where: District Administrative

Lakemoor Village Board special meeting When: 7 p.m. Thursday Where: Lakemoor Police Depart-

Woodstock Public Library Board When: 7:30 p.m. Thursday Where: Woodstock Public Library, 414 W. Judd St.

Arrangements are pending at Ehorn-Adams Funeral Home in Richmond. For information, call the funeral home at 815-678-7311.

KEVIN MICHAEL SHANAHAN

MARENGO – Helen Vestal-Berry, 74, of Marengo and formerly of Chicago, died peacefully Monday, June 3, 2013, with her family by her side. Helen was born March 17, 1939, in Chicago, the daughter of Charles and Rose (Miller) Berndl. On Oct. 17, 1959, she married Richard Vestal; he died in 1978. On March 9, 1985, she married John “Jack” Berry. Helen worked for Wright College from 1981 to 1999, retiring as the Assistant Dean of Research in Planning. She was a member of the McHenry County Historical Society, Questers and was a very active member of Shepherd of the Prairie Church. She is survived by her husband, John “Jack” Berry; her daughters, Sheryl (Angelo) Martell, Laura Fiaccato and Christy (Jim) Bury; and her grandchildren, Allison, Samantha, Michael, Anthony, Payton, Matthew and Mikayla. She is also survived by her sister, Diane (John) Button; and many nieces and nephews. Helen was preceded in death by her parents; and by her first husband, Richard. The visitation will be from 3 to 8 p.m. Friday, June 7, at DeFiore Jorgensen Funeral Home, 10763 Dundee Road, Huntley. A funeral service will be at 11 a.m. Saturday, June 8, with visitation one hour prior at Shepherd of the Prairie Lutheran Church, 10805 Main Street, Huntley. Burial will be private in Union Ridge Cemetery in Chicago. In lieu of flowers, memorials may be directed to Grafton Food Pantry, Shepherd of the Prairie Church or Lutheran World Relief. For information, call the funeral home at 847-515-8772. Online condolences may be directed to www.defiorejorgensen.com. Sign the guest book at www. NWHerald.com/obits

a longtime and active member of Nativity Lutheran Church of Wonder Lake. She taught Sunday School until she was 82 years old. She was Mrs. Claus at the Nativity Christmas bazaar for about 20 years, and she was involved in many other Nativity events. Lorraine was involved in many community activities. She was a member of the Memory Maker/ Story Tellers, the Wonder Lake Senior Citizens Club, the McHenry Senior Center and the Young at Heart Travel Club, and she was past president of the Wonder Lake Unit No. 1169 American Legion Auxiliary. Survivors include five children, Shirley (Craig) Maxwell, Edward (Linda) Fejedelem Jr., John (Madge) Fejedelem, Harry (Sue) Fejedelem and Gerald Fejedelem; a daughterin-law, Patricia Fejedelem; a sister, Mary Ann (the late Nunzio) Ganny; two sisters-in-law, Gretal Tolemy and Mae Tolemy; 12 grandchildren; 16 great-grandchildren; three great-great-grandchildren; and many nieces and nephews. She was preceded in death by her parents; her husband, Edward E. Fejedelem Sr.; a son, Andy Fejedelem; a granddaughter, Jennifer Fejedelem; a grandson, Brian Fejedelem; a sister, Evelyn (the late Roy) Schou; and three brothers, James Tolemy, Lawrence (the late Adrian) Tolemy and Peter Tolemy. Friends may visit with her family from 10 to 11:30 a.m. Saturday, June 8, at Nativity Lutheran Church, 3506 E. Wonder Lake Road, Wonder Lake. The memorial service will follow at 11:30 a.m. at the church. In lieu of flowers, a donation in Lorraine’s name to any animal charity of your choice would be appreciated. Private inurnment will be in Abraham Lincoln National Cemetery, Elwood. Arrangements were entrusted to Justen Funeral Home, Wonder Lake. For information, call the funeral home at 815-728-0233 or visit www.justenfh.com. Sign the guest book at www. NWHerald.com/obits

LORRAINE FEJEDELEM

MARY F. OBENAUF

McHenry County Conservation District Citizen Advisory Committee When: 7 p.m. Wednesday Where: Prairieview Education Center, 2112 Behan Road, Crystal Lake

THURSDAY

8OBITUARIES HELEN VESTAL-BERRY Born: March 17, 1939; in Chicago Died: June 3, 2013

Born: Jan. 19, 1922; in Chicago Died: May 15, 2013; in Wonder Lake WONDER LAKE – Lorraine Fejedelem, 91, of Wonder Lake, died Wednesday, May 15, 2013, at her home. She was born Jan. 19, 1922, in Chicago, to John and Alice E. (Ofenloch) Tolemy. On April 7, 1939, Lorraine married Edward E. Fejedelem in Chicago. Formerly of Chicago, Lorraine was a resident of Wonder Lake since 1964. A woman of faith, Lorraine was

Wednesday, June 5, 2013 • Page B5

Died: June 1, 2013; in Palm View, Texas PALM VIEW, Texas – Mary F. Obenauf, 98, of Palm View, Texas and formerly of Hebron, died Saturday, June 1, 2013, at her home. Arrangements are pending at Ehorn-Adams Funeral Home in Richmond. For information, call the funeral home at 815-678-7311.

LLOYD N. POHLMAN

CATHLEEN ANNETTE PONDEL Born: April 12, 1967; in Kankakee Died: May 28, 2013; in Paris, France McHENRY – Cathleen Annette Pondel, 46, of McHenry, passed away Tuesday, May 28, 2013, at the Hotel Du Monte Dore in Paris, France. She was born April 12, 1967, in Kankakee, to William Fredrick and Susan Jolie Ball. She moved to McHenry in 1984 and graduated from Johnsburg High School in 1985. On July 30, 1988, she married Mark Andrew Pondel at Shepherd of the Hills Lutheran Church in McHenry. Above all things, she was a believer in our risen Lord and Savior, Jesus Christ. In living out that faith, she invested her time in being a wonderful mom, wife, daughter, sister and friend. She sought to honor the Lord in all things, be it homeschooling, church at Harvest Bible Chapel in Crystal Lake, Bible Study Fellowship, her Shaklee business, and countless other ministries to family, friends and those in need. We grieve her greatly and yet rejoice in the blessing we shared. We miss her and yet find comfort in her going to her true and final home with The Lord. Survivors include her husband, Mark Andrew Pondel of McHenry; children, Natasha Claire Pondel, Madeline Jolie Pondel and William Isaiah Pondel, all of McHenry; parents, Susan Jolie Ball, William Fredrick Ball and Mary Davis; and sister, Jodi Lynn Clark. She was preceded in death by her paternal grandparents, Lynn M. and Marvel M. Ball; maternal grandfather, Hurland L. Clark; uncle, Russell H. Ball; and uncle, James R. Ball. The visitation will be from 9:30 a.m. until the memorial service at 11 a.m. Saturday, June 8, at the Harvest Bible Chapel, 580 Tracy Trail, Crystal Lake. Memorials may be made to the Bright Start College Savings FBO Pondel. For information, contact Colonial Funeral Home at 815-385-0063 or visit www.colonialmchenry.com. Sign the guest book at www. NWHerald.com/obits

Born: Jan. 25, 1968; in Elgin Died: May 17, 2013 ALGONQUIN – Kevin Michael Shanahan, 45, of Algonquin, passed away Friday, May 17, 2013. The son of Lawrence and Patricia Shanahan, he was born Jan. 25, 1968, in Elgin. He attended college at Northern Illinois University in DeKalb, where he received degrees in athletic training and physical therapy. He was the valedictorian of his physical therapy class. He was the team athletic trainer for the rhythmic gymnastics team at the 1996 Olympics in Atlanta. Kevin had a very rewarding career as a caring and compassionate outpatient orthopedic physical therapist. He was last employed by Centegra Rehab and Sports in Crystal Lake. Kevin was a devoted father and treasured the time he spent with his two sons sword fighting, wrestling and playing football, basketball and baseball. He shared a special bond with his father, Larry, and loved spending time fishing with him in Lake Geneva, Wis. Kevin loved running, the flavor of cinnamon, Diet Coke, Christmas and dogs. He will be missed for his wonderful sense of humor and his love and skill in executing practical jokes. He will also be missed for his blue eyes, love of toothpicks and a style that focused on the colors black, brown and white. Kevin was the loving father of Tyler and Brad Shanahan of Elgin; devoted son of Lawrence Shanahan of Loves Park; grandson of B. Gynelle Rizzo of Crystal Lake; brother of Kimberly (Matt) Stone of Woodstock and Kelly Shanahan of Woodstock; uncle to Zach and Zoe Stone and Kailey Shanahan; nephew to Deborah Rizzo, Karen Shanahan and Jan Collins; and best friend to Lori Stalker (Ryan). He is also survived by numerous cousins and friends. Kevin was preceded in death by his mother, Patricia Shanahan; maternal grandfather, Joseph Rizzo; paternal grandparents, Lawrence and Peggy Shanahan; and paternal uncles, Thomas and Robert Shanahan. There will be a service honoring Kevin’s memory from 7 to 9 p.m. Wednesday, June 12, at Elgin Vineyard Church, 220 Division St., Elgin. Donations may be made in his memory to the Huntington’s Disease Society of America, www. hdsa.org. Sign the guest book at www. NWHerald.com/obits

Died: June 4, 2013; in Hebron HEBRON – Lloyd N. Pohlman, 79, of Hebron, passed away Tuesday, June 4, 2013, at his home.

Cricket Wireless McHenry NOW HIRING 2306 N Richmond Rd (Rt 31) McHenry, IL 60051

815-385-3077

NORTHWEST HERALD CRYSTAL LAKE – McHenry County College is accepting registration for two scholarships that will be awarded to several students, including the Presidential Talent Scholarship and the Founding Faculty Scholarship. The Presidential Scholarship, MCC’s most prestigious scholarship, is awarded each year to qualified high school seniors based on academic achievement, extracurricular activities and community involvement. Recipients will receive a maximum of 60 credit hours of tuition (in district) at MCC, which is typically two years’ worth of tuition. Recipients are required to enroll in at least 12 credit hours each fall and spring semester, maintain at least a 3.0 cumulative GPA and complete 15 service

8LOCAL BRIEFS J’burg library’s used book sale starts Thursday JOHNSBURG – The Friends of the Johnsburg Public Library’s used book sale is Thursday through Saturday in the meeting room of the library, 3000 N. Johnsburg Road. A “Members Only” Sale Night will be held from 6:30 to 8:30 p.m. Thursday. An annual membership to the Friends may be bought at the door for $5. Regular sale hours are from 9 a.m. to 4 p.m. Friday and 9 a.m. to 1 p.m. Saturday. The sale area will be closed from 1 to 1:30 p.m. Saturday to set up for the $2-A-Bag Blowout Sale, which will be from 1:30 to 4:30 p.m.

Repairs • iPhone Unlocking • iPhone Accessories • Rooting

For information, call 815344-0077 or visit www. johnsburglibrary.org.

Bingo event for tornado relief efforts in Oklahoma McHENRY – Wings of an Angel will host an Oklahoma tornado relief bingo event at 7 p.m. Friday at Veterans of Foreign Wars Post 4600, 3002 W. Route 120. Ten percent of the proceeds will be donated to aid children affected by the Oklahoma tornado through Feed the Children. The event will feature a special $1,000 jackpot game. For information, visit www. mchenrybingo.com.

– Northwest Herald

8FUNERAL ARRANGEMENTS Helen Vestal-Berry: The visitation will be from 3 to 8 p.m. Friday, June 7, at DeFiore Jorgensen Funeral Home, 10763 Dundee Road, Huntley. The funeral service will be at 11 a.m. Saturday, June 8, with a visitation one hour prior at Shepherd of the Prairie Lutheran Church, 10805 Main Street, Huntley. Burial will be private in Union Ridge Cemetery in Chicago. For information, call the funeral home at 847-5158772. Lorraine Fejedelem: Friends may visit with her family from 10 to 11:30 a.m. Saturday, June 8, at Nativity Lutheran Church, 3506 E. Wonder Lake Road, Wonder Lake. The memorial service will follow at 11:30 a.m. at the church. For information, call Justen Funeral Home at 815-728-0233. Toby Shussin Levin: A public memorial gathering has been set to celebrate her life and is open to her many friends and loved ones from 2 to 4 p.m. Sunday, July 14, at Wolfe Lake Condominiums Party Room, 4820 Park Commons Drive, Minneapolis. Arline A. McNett: The visitation will be from 5 to 9 p.m. Wednesday, June 5, at Schneider-Leucht-Merwin & Cooney Funeral Home, 1211 N. Seminary Ave., Woodstock. A funeral Mass will be celebrated at 10:30 a.m. Thursday, June 6, at St. Mary Catholic Church, 312 Lincoln Ave., Woodstock.

Interment will follow in Oakland Cemetery in Woodstock. Anna Mae Davidson Michalsen: A memorial service will be at 11 a.m. Wednesday, June 5, at St. Paul’s United Church of Christ, 485 Woodstock St., Crystal Lake. Frances B. Pinson: Family and friends will meet at 10 a.m. Wednesday, June 5, for a funeral service at Village Church of Barrington, 1600 E. Main St., Barrington. Interment will be private in Memory Gardens Cemetery. For information, call the funeral home at 847-3598020. Cathleen Annette Pondel: The visitation will be from 9:30 a.m. until the memorial service at 11 a.m. Saturday, June 8, at the Harvest Bible Chapel, 580 Tracy Trail, Crystal Lake. For information, call Colonial Funeral Home at 815-385-0063. Kevin Michael Shanahan: There will be a service honoring Kevin’s memory from 7 to 9 p.m. Wednesday, June 12, at Elgin Vineyard Church, 220 Division St., Elgin. Donald Lee Simcoe: The memorial service will be at 11 a.m. Wednesday, June 5, at Northwood Presbyterian Church, 2875 State Road 580, Clearwater, Fla. For information, call 727-796-8090. Martin “Butch” Svatick: A memorial service will be at 1 p.m. Sunday, June 9, at Berglund Farms, 10487 Randall Road, Capron.

Non-Surgical spinal disc decompression may reduce or even eliminate your pain.

October 30, 1942 ~ June 5, 2011 Remembering Mark H. Beaubien Jr. Husband, father, grandfather, friend and statesman. You will always be our hero.

If you are suffering with chronic or severe pain despite other treatments that have failed, there is hope with the safe, pain free spinal disc decompression available in McHenry. Spinal disc decompression is a Non-Surgical, Drug-Free procedure for:

✔ Bulging Disc ✔ Degenerative Disc ✔ Herniated Disc ✔ Sciatica

✔ Pinched Nerves ✔ Facet Syndrome ✔ Spinal Stenosis ✔ Pre/Postsurgical Patients

EXAM, X-RAYS & $ FIRST TREATMENT

✔ Numbness and tingling in arms or legs ✔ Radiculopathy ✔ Neck and Lower Back Pain

4995

(X-Rays if needed) Cannot be used combined with any other offer. Expires 6/30/13.

No Contracts • No Roaming • Nationwide

Unlimited Talk, Unlimited Text & Data Starts as low as $35/month $25 Refer a Friend Credit

hours each fall and spring semester. The McHenry County College Founding Faculty scholarship is awarded in recognition of more than 30 years’ worth of contributions from retired founding faculty of McHenry County College. Three scholarships worth 60 tuition credit hours each at MCC will be awarded. Recipients must enroll in at least 12 credit hours each fall and spring semester and maintain at least a 2.5 cumulative GPA at MCC. The deadline to apply for both of these scholarships is June 10. Applications are available at www.mchenry. edu/financialaid/scholarships or in the Financial Aid Office, Room A262 at McHenry County College, 8900 Route 14 in Crystal Lake. For information, call the Financial Aid Office at 815455-8761.

Stop Your Back Pain Now

S M A RT P H O N ES STARTING AT

$19 9.99 9

MCC will offer fall semester scholarships

ELM STREET CHIROPRACTIC

Dee, Mark, Bob, Kelly, Mary, Annie, Bobby, Ella, Marco, Luciana, and Alex

815-344-1025 4921 W. Elm St., Rt. 120, McHenry Dr. Kenneth Reiser, D.C.

Medicare & Medicaid patients may not qualify for this offer.

www.elmstreetchiropractic.com • www.mchenryspinaldecompression.com


LOCAL&REGION

Page B6 • Wednesday, June 5, 2013

Project ends Board member calls for county to cut revenues June 2014 • ROADS

• TAXES

Continued from page B1

Continued from page B1

“Our residents are anxious to get road projects completed and be done with road construction.” An Illinois transportation spokesman said the Kreutzer construction is tentatively scheduled to start in late June or early July. The state selected Plote Construction Inc., based in Hoffman Estates, to do the project in late April. The project is expected to last a year, ending June 2014. Kreutzer Road would be extended a half mile west from Route 47, near the Regency Square strip mall, to Main Street, near the Lion’s Chase subdivision. Officials hope the extension will ease local traffic off Route 47 and provide better access to Huntley’s west side. Once construction begins, crews will upgrade intersections, install lights and extend Kreutzer Road near the area of Route 47. Motorists can expect some traffic delays during that initial phase of construction, which should be completed by late November, Armour said. Crews will then work to extend Kreutzer Road north, near the area of Lion’s Chase and have it connect completely from Main Street to Route 47.

effect with the bursting of the housing bubble. When home values are rising, it limits the increase that taxing bodies can receive over the previous year to either 5 percent or the rate of inflation, whichever is less. But when values fall, a scenario state lawmakers never envisioned, the tax cap ensures that governments receive the inflationary rate if they so choose. Changes made to this year’s budget process include a directive to all departments to review the cost of service delivery and begin considering cost-saving options such as outsourcing, privatization and public/private partnerships. Outside agencies that receive County Board funding also will have to make presentations to the finance committee on top of their required meeting with the county administrator. The process now will include creating a five-year

Northwest Herald / NWHerald.com

Rhodes will attend college on G.I. Bill • HOME Continued from page B1

capital maintenance plan to stay on top of building needs, and allocating $750,000 a year in the Division of Transportation’s annual budget to replace snowplows and other equipment, subject to County Board approval. The County Board last November approved a smaller, $250 million 2013 budget, which was a $6.7 million decrease from the 2012 budget. McHenry County government, one of three Illinois counties with a Aaa bond rating from Moody’s Investors Service, has been trimming its budget in recent years to adjust for the weak economy. But not every County Board member thinks that holding the levy flat is enough. John Hammerand, who almost always votes against spending increases, said the county needs to cut its revenues, not just its expenses. “If we ran for election on the campaign issue that we’re going to reduce taxes, that’s different from just holding the levy flat,” said Hammerand, R-Wonder Lake.

G.I. Bill, Zackery Rhodes plans to attend college at no cost to his mother and pursue a career in the nursing field. Zackery Rhodes said he would make the decision to join the Army again and believes his efforts were for a worthwhile cause in both countries. He said the positive change in Iraq is noticeable, while transformation in Afghanistan is slower and more complicated. “You see a lot of the bad stuff on TV, but there is a lot of good happening there, especially with the police,” said Zackery Rhodes, who also helped train local police officers. “They are more prepared to get control of their country again.”

“You can’t explain in words how proud you are. It’ll be an easy adjustment to have him home again.”

resulted in at least two enemies killed in action, 14 enemies captured and several explosive devices uncovered and destroyed, according to his military documents. “You can’t explain in words how proud you are,” Carmen Rhodes said of her son’s service. “It’ll be an easy adjustment to have him home again. He’s a man now. I don’t have to pay attention or worry about what he does.” The mother-son bond was an important one throughout Zackery Rhodes’ time in the Army. Not only did the two communicate frequently

Carmen Rhodes Zackery’s mother on his return

through Skype, but his mother was a part of the reason he decided to serve. He did not want his single mother to have to make more sacrifices – including the potential sale of their home – to pay for high tuition costs in the college career he wanted to pursue. Now with the help of the

“My friend got them, so I thought I’d check it out. Am I glad I did, the difference is tremendous!” -Kathy, 45

Ordinances to be online

Your Health. Your smile.

• POLICE Continued from page B1 4104 W Crystal Lake Rd • McHenry • 815-344-2840 • ConlonThompsonOrthodontics.com

Winter Hours Mon.-Fri. 8Dates: am- 8 pm; Sat. 8 am to 7 pm; 8 am-6 p Sale February 6 Sun. thru February 12 YOU CAN’T“NEW” AFFORD TO NOT SHOP AT ANGELO’S

WE ARE HERE TO SERVE YOU!

Rd.

Rd . D ra pe r

. Dr

HOURS: Monday-Friday 8am-8pm; Saturday & Sunday 8am-7pm

4000 N. Johnsburg Rd. Johnsburg, IL 815-344-5800

ek re

Bull Valley Rd.

h Dr.

31

d.

rC

120

Shilo

Fax: 815-385-1479 (McHenry Market Place Shopping Center)

Angelo is proud to announce our 2nd Location is Now Open!

t. Elm S

da

4400 Elm - Rte. 120 McHenry, IL 60050 815-385-1430

Ringwood

Sale Dates June 5th thru June 11th Ce

for possible conflicts with state law, among other things. The village in 2001 retained Book Publishing Company to revise and republish the code. “This is a project that has been long overdue,” said Chris Stilling, director of Community and Economic Development. Municipal Code Corporation will perform the project for $14,400. Many communities in the state use Municipal Code, Stilling said. “When we do research on various other communities, ... most of those communities are using Municipal Code ... and I find it very user-friendly,” Stilling said. Codifying the village ordinances could take anywhere from seven to 10 months, according to village documents. As part of the project, the village will be able to put its ordinances online. The first year of having the village’s ordinances online would be free with subsequent years costing $400 to $550 a year, according to village documents. Some of the village’s ordinances are online, such as its sign ordinance and other things that are referenced regularly, Stilling said. Newly adopted ordinances have not been added to the code book, and the staff estimates about 700 ordinances have been approved since 2001. However, there will be a lot of ordinances that will not be applicable to codification, such as the declaration of surplus property. “We’re paying them to make that determination,” Stilling said. The project is expected to produce a 900-page ordinance book. In other action, the Village Board approved keeping Blue Cross/Blue Shield as its insurance provider for $721,000, which is a 12.86 percent increase from a year ago. Employee contributions cover a portion of that cost. Under the plan that goes into effect July 1, employees would pay for 20 percent if they are part of PPO coverage and 13 percent if they are part of the village’s HMO coverage. The total cost to the village is about $707,350. The village budgeted about $716,000 for health insurance costs. The village increased deductibles and out-of-pocket maximums for employees in the PPO plan.

N.

R rg bu ns h Jo

Irene Ct. W. Church St.

HOURS: Monday-Friday 8am-8pm; Saturday & Sunday 8am-7pm

Fax: 815-344-7096

Hours Mon.-Fri. 8am - 8pm; Sat. & Sun 8am - 7pm VISIT OUR WEB SITE FOR OUR WEEKLY SPECIALS • angelosfreshmarket.com

SENIOR CITIZENS DISCOUNT - EVERY TUESDAY AND THURSDAY ARE SENIOR CITIZENS DAYS ALL SENIORS 65 YEARS AND OLDER WILL RECEIVE 5%

ANGELO’S DELI

PRODUCE PEACHES ¢

HAM

99

289

$

LB

PREMIUM SMOKED

3

LB

SARA LEE HOMESTYLE

TURKEY BREAST

89 LB

2

HARD SALAMI

3

$

69 LB

LB

79

49 LB

CORNED BEEF .......................lb $429 SARA LEE MESQUITE

TURKEY BREAST ...................lb $389 SARA LEE BAR-B-Q

CHICKEN BREAST ................lb $349 PROSCIUTTO .........................lb

$

6

99

HEAD LETTUCE ....................head 89¢ CALIFORNIA

NECTARINES..........................lb FRESH EXPRESS

GREEN & CRISP, PREMIUM ROMAINE, LETTUCE TRIO, DOUBLE CARROT 9-12oz bag 2/$3

IMPORTED

GREEN GIANT CAPS OR SLICED PORTABELLA

MORTADELLA ........................lb

3

49

CUCUMBERS.......................... 3/$2 MUSHROOMS ...................6oz 2

RESERS

WASHINGTON EXTRA FANCY RED DELICIOUS

FRESH SWEET BOW TIE

SWEET

MACARONI SALAD .............lb $129 PASTA SALAD .......................lb $249

1

29

CORN ...................................... 3/$1

LARGE SELECT

GENOA SALAMI ....................lb $599

$

FLORIDA SWEET IN-THE-HUSK

VOLPI

$

2

/$

5

APPLES ................................... lb 99¢ VIDALIA ONIONS ...........2lb bag $149

6 39¢ $ 88 2

CENTRELLA

APPLE SAUCE .............. 24oz jar $149 CENTRELLA

TOMATO SAUCE.........8oz can 4/$1 CENTRELLA

3LBS OR MORE

FRESH LEAN CENTER CUT LB

MAYONNAISE ................30oz

199

$

LINDSAY MEDIUM OR LARGE BLACK PITTED OLIVES ........................... 6oz can $129 CENTRELLA

RAISIN BRAN ...........20oz box 2/$4

U.S.D.A. CHOICE

CENTRELLA HEAVY DUTY

U.S.D.A. CHOICE ALL LEAN

C&H GRANULATED CANE

U.S.D.A. CHOICE

T-BONE STEAK ......................lb $849

CENTRELLA SHREDDED

MOZZARELLA OR MILD CHEDDAR . 12oz 2/$4

FRESH LEAN SIRLOIN

PORK CHOPS .......................lb $169

JUICE ............................ 59oz btl 2/$6

FRESH LEAN VARIETY PACK

OPEN PIT ORIGINAL

COOK’S BONE-IN HAMS

CENTRELLA

CUBE STEAK ..........................lb $399

CALIFORNIA

SCOTT PETERSEN

LIMIT 6................ 6oz

WATER .................... 24pack .5L btls

SANDWICH STEAK ..............lb $399

EA

HILLS BROS. ORIGINAL, MED. ROAST OR HIGH YIELD $ 99

HINCKLEY SPRING

LB

PORK CHOPS $ 29

TOMATOES ¢

PROVOLONE CHEESE

CENTRELLA PAPER

PAPER TOWELS .8pack $399

YOGURT

GROUND CHUCK $ 29

2

HENRI’S SELECTED VARIETY

YOPLAIT SELECTED VARIETY

FRESH LEAN

EXTRA LARGE ROMA

SORRENTO SLICING

VOLPI

LB

1LB PKG

289 3

8

JUICE....................................64oz btl $149

COFFEE ..................... 26/33oz can

LB

STEAK $ 99

2 4

$

LB

U.S.D.A. CHOICE PORTERHOUSE

STRAWBERRIES /$

AMERICAN CHEESE

$

4

EA

CALIFORNIA

YELLOW

DRESSING......................... 16oz 99¢

STEAK $ 99

CHERRIES $ 99

PRIMO PRE-SLICED

CHICKEN BREAST $ 99 U.S.D.A. CHOICE BONELESS TOP BUTT

CALIFORNIA

3

$

CENTRELLA APPLE

FAMILY PACK

WATERMELONS $ 99

69

GROCERY

FRESH GOV. INSPECTED BONELESS SKINLESS

1

LB

RED RIPE SEEDLESS

HAM

2

FRESH MEATS

SUGAR SWEET SOUTHERN

SCOTT PETERSEN OLD WORLD BAVARIAN

$

DISCOUNT ON ALL PURCHASES. Cash Transactions Only.

PORK CHOPS .......................lb $179 SHANK PORTION .............................. lb $109 BUTT PORTION ................................. lb $129

FRESH FROZEN FISH COD FILLETS ..................................... lb

189

$

FULLY COOKED THAW & SERVE SHRIMP 26/30 SIZE EXTRA LARGE...2lb bag $1499 SMELTS CLEANED & READY TO COOK ..... 1lb pkg $249

COOKED CRAWFISH ..........................lb $249 SHRIMP RAW HEAD ON 70/80 SIZE.4lb pkg $1499

ALUMINUM FOIL ............ 50ft

199

$

SUGAR ........................... 4lb bag $249 SIMPLY ORANGE

BAR-B-Q SAUCE ..............28oz $189 NAPKINS ....................160 count $109 SCOTT PETERSEN PREMIUM

BACON ......................... 1lb pkg 2/$6

LIQUOR MILLER BEER .........................24-12OZ CANS $1399 COORS BEER .........................24-12OZ CANS $1399 MIL. BEST BEER...................30-12OZ CANS $1099 LEINIE ................................................12PK BTLS $1199 REDD’S APPLE ALE ........................ 6PK BTLS $699


! !! !

Wednesday, June 5, 2013 Northwest Herald

!

!!

!

Sports

SECTION C

Breaking news @ www.NWHerald.com

Sports editor: Jon Styf • jstyf@shawmedia.com

Hinkle doing well after health scare Jim Hinkle had read and heard many stories about old coaches who died shortly after leaving their beloved profession. Six weeks ago, he feared he might be joining that club. Hinkle had difficulty doing the simplest physical tasks. Walking up stairs was exhausting. He figured, at 71 years old, he just needed to get himself in better shape, something for which he soon would have plenty of time. One day, walking to a hospital to visit a friend, he reached the door and, out of breath, turned around, made it to his car and drove home. His next hospital trip would be for his own admission. On April 28, Hinkle’s son, Bryan,

PREP ZONE Joe Stevenson took his father to Provena St. Joseph Hospital in Elgin and he was placed into the intensive care unit. Hinkle learned his problems stemmed from a blood clot in each lung and one in a leg. When medical personnel asked him to swing his legs over the bed, he thought he was going to die. “I can’t tell you how scared I was,” Hinkle said. “It’s scary. It was like, ‘I just retired and now I’m going to die.’ I read

MLB: ESPN REPORT

about coaches all the time that happened to.” Now, Hinkle is taking blood thinners and feels much better. He came back to school to his position as attendance specialist and was in Rockford on Monday night supporting the Jacobs baseball team, which lost to St. Charles East, 7-2, in the Class 4A Rockford Aviators Supersectional. “I feel great,” Hinkle said. “I’m fine now.” When speaking of his impending retirement earlier this year, Hinkle always said Sarah Nader – snader@shawmedia.com he looked forward to the time off, but also Former Jacobs boys basketball coach Jim Hinkle, who retired worried about himself.

See PREP ZONE, page C2

after this past season, was hospitalized recently because of blood clots in both lungs and a leg.

WESTERN CONFERENCE FINALS, GAME 3 – KINGS 3, BLACKHAWKS 1

Suspensions of about 20 players will be sought

Off their game

By JAMES WAGNER The Washington Post Major League Baseball is expected to seek suspensions in the coming weeks for about 20 players, including all-stars Alex Rodriguez and Ryan Braun, connected to the now shuttered South Florida antiaging clinic that is under investigation for reportedly supplying performanceenhancing drugs to players, according to an ESPN report published Tuesday Alex night. MLB officials Rodriguez have been adamant in their desire to investigate clinic founder Anthony Bosch, connected players and the agency ACES, whose players and a former Ryan employee were also Braun linked to the clinic. In March, MLB sued Biogenesis and others connected to the clinic. The Miami New Times decided in March not to hand over Biogenesis documents to MLB officials. According to the new ESPN report, Bosch has decided to cooperate with MLB’s investigation. According to the report, Washington Nationals starter Gio Gonzalez is the only player linked to the Biogenesis clinic who “will be scrutinized but possibly exonerated.” Echoing a report from the same outlet in February, two unnamed sources told ESPN that the substances Gonzalez received from the clinic were legal. Gonzalez was among those linked in January to the clinic, Bosch and several substances, including a testosterone-laden “pink cream,” by a New Times report.

On the list Players who might be suspended by MLB for their connections to Biogenesis, according to ESPN: Player Team Ryan Braun Brewers Everth Cabrera Padres Melky Cabrera Blue Jays Francisco Cervelli Yankees Bartolo Colon Athletics Nelson Cruz Rangers Fautino de los Santos Free agent Gio Gonzalez* Nationals Yasmani Grandal Padres Fernando Martinez Astros Jesus Montero Mariners Jordan Norberto Free agent Jhonny Peralta Tigers Cesar Puello** Mets Alex Rodriguez Yankees * Sources told ESPN that Gonzalez received only legal substances ** minor leaguer, not a member of the MLB Players’ Association

AP photo

Kings center Jeff Carter celebrates Tuesday night after a goal by defenseman Slava Voynov (not pictured) against Blackhawks goalie Corey Crawford during the second period of Game 3 of the Western Conference finals in Los Angeles. The Hawks lost, 3-1.

Too much ugly dooms Hawks LOS ANGELES – In the first period, Patrick Sharp dropped his gloves and clenched his fists. He wanted to fight. In the second period, Duncan Keith swung his stick toward Jeff Carter’s face. He wanted revenge. By the end of the third period, as black-and-silver confetti fell from the top of the Staples Center, the Blackhawks headed off the ice and into a quiet locker room. They wanted to leave. The Hawks lost their composure too many times Tuesday before losing the game, 3-1, to the Los Angeles Kings in Game 3 of the Western

VIEWS Tom Musick Conference finals. And unless the Hawks get their minds right in a hurry, they could be in jeopardy of losing their 2-1 series lead. “We’re not happy with the result,” Hawks captain Jonathan Toews said. “We’ll learn from it.” If it’s a one-game lesson on the road to the Stanley Cup, that’s OK. If it’s the beginning of a trend against the more physical, less tal-

ented Kings, that’s not OK. It would be foolish to press the panic button, but it’s fair to press the concern button. Everyone who watches the Hawks knows that they play a beautiful style of hockey. They have beautiful players (or, uh, so I’m told). They live in beautiful condominiums and houses, and when they head west in the playoffs, they stay in a beautiful hotel in Beverly Hills. So why did they try to be so ugly on such a beautiful night in Southern California?

GLANCE GAME 1 @ Chicago Blackhawks 2, Kings 1 GAME 2 @ Chicago Blackhawks 4, Kings 2 GAME 3 @ Los Angeles Kings 3, Blackhawks 1 GAME 4 @ Los Angeles 8 p.m. Thursday, NBCSN GAME 5 @ Chicago 7 p.m. Saturday, NBC-TV GAME 6 @ Los Angeles* 8 p.m. Monday, NBCSN GAME 7 @ Chicago* TBD June 12, NBCSN

See MUSICK, page C3

* – if necessary

THE DAILY FEED Tweet from last night

What to watch

Really?

3-pointers

“ESPN report, if correct, would likely foretell the largest group punishment by MLB since the “Black Sox” Scandal broke open in Sept. 1920.” – @KeithOlbermann

NHL: Pittsburgh at Boston, 7 p.m., NBCSN The Bruins come home with a 2-0 series lead against the Penguins in the Eastern Conference finals.

Former No. 1 pick JaMarcus Russell reportedly will try out for the Bears on Friday along with three other quarterbacks, ESPN.com reported. Russell, by the way, was mentioned as a Bears option multiple times in The Daily Feed in the past six months.

Ex-White Sox pitcher Bartolo Colon, now 40 years old and with a 6-2 record for the Athletics, is reported to be on a list of players potentially suspended for a connection with PEDs and Biogenesis. Other places Colon might have been seen: 1. In-N-Out Burger 2. Steak ‘n Shake 3. Jabba the Hutt’s lair

Follow our writers on Twitter: Tom Musick – @tcmusick Jeff Arnold – @NWH_JeffArnold Joe Stevenson – @NWH_JoePrepZone

AP file photo


SPORTS

Page C2 • Wednesday, June 5, 2013

Northwest Herald / NWHerald.com

OHIO STATE

President Gee abruptly retires By ANDREW WELSH–HUGGINS The Associated Press

AP file photos

Coach Gregg Popovich (left) is going for his fifth NBA championship with the Spurs, and coach Erik Spoelstra has the Miami Heat in the finals for the third consecutive year, looking for his second title in a row.

NBA FINALS PREVIEW

Spo, Pop make right moves Heat’s Spoelstra, Spurs’ Popovich match wits in finals By TIM REYNOLDS The Associated Press MIAMI – Other than being widely known by just the first syllable of their surnames, the coaches who will match wits in these NBA Finals may seem like polar opposites. Of course, they would probably disagree with that assertion. Miami’s Erik Spoelstra wears sharp suits and is a stats guy; San Antonio’s Gregg Popovich often skips the tie and would immeasurably prefer to answer questions about wine than anything about himself. Both are intensely private, but even during an NBA Finals loaded with star power – the “Big Three” from Miami, the “Big Three” from San Antonio, a fourtime MVP in LeBron James, a four-time champion in Tim Duncan – the coaches will share misery in one way. To their chagrin, Spo and Pop will be in the spotlight. “It’s easier to talk about how they are similar versus how they are dissimilar,” said ESPN analyst Jeff Van Gundy, a former NBA coach who is part of the broadcast team for the series that opens Thursday in Miami. “They are both going to the Hall of Fame. They both have tremendous respect from the coaches they coach against, and they both have a level of humility that I believe shows NBA coaching in the most positive light possible.” Spoelstra is in the finals for the third straight year and is looking for a second consecutive championship. Popovich is going for his fifth title, the last of the ones currently in his collection coming over James and the Cleveland Cavaliers in 2007, and could join Phil Jackson as the only coaches to win championships in three different decades. So far, only Jackson, Red Auerbach,

“They both have a tremendous respect from the coaches they coach against.” Jeff Van Gundy ESPN analyst, on Spurs coach Gregg Popovich and Heat coach Erik Spoelstra John Kundla and Pat Riley – Spoelstra’s mentor and boss in Miami – have five rings as a head coach. “Maybe I don’t show it the way I should, but it’s pretty special,” Popovich said, in a rare moment of near-sheepishness, after his team beat Memphis and won the West title for a fifth time. “I’m just really proud of the group the way they worked all year long to get there, and I’m sure that we’ve been a team that’s probably been written off like they’ve had their day.” Spoelstra took over for Riley five seasons ago, has won nearly twice as many games as he’s lost, and has endured a constant circus of distractions ever since the Heat acquired James and Chris Bosh to play alongside Dwyane Wade in 2010. San Antonio hasn’t had anywhere near that sort of scrutiny; being in a smaller market helps keep the level of attention down. By now, Spoelstra doesn’t even notice what he calls “the noise.” Even in the din of an Eastern Conference championship celebration Monday night – actually during the trophy presentation ceremony – Spoelstra found his mind drifting away from the grind of facing the Indiana Pacers and onto the next challenge, this duel with the Spurs for the NBA title. “It’s one of those few times in competitive team sports you’re not thinking about tomorrow, you’re not thinking about the previous games, you’re not thinking

about what possibly may happen, you’re not thinking about the reward. All you’re thinking about is the desperation of that moment,” Spoelstra said. “That’s a great place to live.” And then ... “It probably hit me right about then, and it was the ‘ohh’ type moment,” Spoelstra said. “We have to get our act together in the next 48 hours. ... They are a great organization. I think the two organizations from afar have always respected each other for similar foundations and culture.” The coaches have items designed to inspire players in their respective locker rooms: a famous quote about a stonecutter for the Spurs; a replica of the championship trophy with the words “All In” emblazoned on it for the Heat. Both believe in loyalty, proven by the fact neither has changed work addresses in nearly two decades. There may be no coach in the league with more open disdain for in-game interviews, the ones taking place at the end of the first and third quarters of nationally televised games, than Popovich. He’d simply rather coach than talk. “He says what he needs to say and he gets out,” Duncan said. “So I guess I’ve learned that much. ... I think it’s hilarious. I think it’s awesome. As I said, he’s direct. He says what he needs to say and he gets out of there.” Popovich has proved that time and again. In these playoffs alone, some of his interview highlights included half-seriously calling Duncan a pain in the butt, talking about wanting to trade Manu Ginobili over poor shot selection, prefacing his response to a question by warning a reporter he was about to receive a trite answer, and offering this gem when asked for his favorite part of the gameday process. “Dinner,” Popovich said.

Spurs’ Leonard eyes matchup with LeBron By RAUL DOMINGUEZ The Associated Press SAN ANTONIO – Hours away from drawing the toughest defensive assignment of his two-year career with the San Antonio Spurs, Kawhi Leonard wasn’t feverishly taking mental notes of how to guard LeBron James. The second-year pro was simply reKawhi laxing at home Leonard Monday night, watching Miami rout the Indiana Pacers, 99-76, to set up a showdown with San Antonio in the NBA Finals. Seeing how Paul George and Lance Stephenson defended James wasn’t as important to Leonard as the outcome. “I was just laying [down], seeing who we were going to play,” he said. Leonard means no disrespect. He is just happy to know who the Spurs will play after a week’s wait after their sweep of the Memphis Grizzlies in the Western Conference finals. The 6-foot-7 Leonard will draw the primary defensive assignment against James, the

AP file photo

The Heat’s LeBron James is averaging 26.2 points in the playoffs. reigning NBA Finals MVP and two-time league MVP who is averaging 26.2 points, 7.3 rebounds and 6.4 assists in the playoffs. James is also shooting 51 percent overall and 39 percent on 3-pointers. “It’s just a great challenge for me to try to help my team win by playing good defense on him,” Leonard said. “I just accept the challenge and am ready to play.” Facing a player on a hot streak isn’t new to San Antonio this postseason after showdowns with Golden State’s Stephen Curry and Memphis’

Zach Randolph. After averaging 24 points and 10 assists in an upset of the Denver Nuggets, sweet-shooting Curry was held to 18.2 points and six assists against the Spurs – excluding a 44-point, 11-assist effort in a Game 1 loss by the Warriors. Randolph averaged 18.4 points and 10.8 rebounds while bullying the Oklahoma City Thunder in the paint, but was limited to 11 points and 12 rebounds against the Spurs. His production included a twopoint, seven-rebound effort in a Game 1 loss to San Antonio. In some respect, the Spurs

are facing a hybrid of Curry and Randolph in the 6-foot-8, 250-pound James. “He’s great on offense and defense,” said Leonard, who has a 7-3 wingspan. “He can pass, he can shoot the ball, gets offensive rebounds and defensive rebounds and he can guard the best player on the other team.” While Leonard will be James’ primary defender, the Spurs will attempt to move him toward defensive help in the hope he gives up the ball. It’s a strategy that helped San Antonio limit opponents to 44.2 percent shooting, which was eighth in the league. But James isn’t the only player the Spurs know they will need a group mentality to defend, starting with All-Stars Dwyane Wade and Chris Bosh. “They’ve got more than just the big fella,” San Antonio guard Danny Green said. “They are a great team. There is a reason they won last year, and they also added some pieces this year. On paper they have a really good team. Obviously they haven’t been playing as well as of late, but they have so many shooters surrounding the Big 3 they are a mismatch problem for any team.”

COLUMBUS, Ohio – Ohio State University President Gordon Gee abruptly announced his retirement Tuesday after he came under fire for jokingly referring to “those [darn] Catholics” at Notre Dame and poking fun at the academic quality of other schools. The remarks were first reported last week by The Associated Press, and Ohio State at the time called them unacceptable and said it had placed Gee on a “remediation plan” to change his behavior. Gee, 69, said in a teleconference that the furor was only part of his decision to retire, which he said he had been considering for a while. He said his age and the start of a long-term planning process at the university were also factors. “I live in turbulent times and I’ve had a lot of headwinds, and so almost every occasion, I have just moved on,” he said. Gee explained away the abrupt timing by

saying he was “quirky as [heck]” and hated long transitions. He also said he didn’t regret the way he conducted himself as a higher education leader. “I have regrets when I have said things that I shouldn’t have said, but I have no regrets about having a sense of humor and having a thick skin and enjoying life,” Gee said. According to a recording of a Dec. 5 meeting obtained by the AP under a public records request, Gee, a Mormon, said Notre Dame was never invited to join the Big Ten athletic conference because “you just can’t trust those [darn] Catholics.” Gee also took shots at schools in the Southeastern Conference and the University of Louisville, according to the recording of the meeting of the school’s Athletic Council. Gee apologized when the comments were disclosed, saying they were “a poor attempt at humor and entirely inappropriate.”

8SPORTS SHORTS Wichita St. fires baseball coach after 36 seasons

Sooners sweep Vols to win NCAA softball title

Wichita State baseball coach Gene Stephenson was fired Tuesday after a 36-year career that produced future major leaguers such as Joe Carter and Casey Blake and included the school’s only national championship. Stephenson won more games during his tenure than any other Division I program, and his career record of 1,837-675-3 leaves him with the second-most victories among major college baseball coaches.

OKLAHOMA CITY – National player of the year Keilani Ricketts homered and drove in four runs, Michelle Gascoigne pitched a three-hit shutout, and top-seeded Oklahoma won the NCAA softball championship by beating Tennessee, 4-0, on Tuesday night in Game 2 to sweep the best-of-three Women’s College World Series finals. No. 7 seed Tennessee (52-12) managed three singles against Gascoigne (19-3), who struck out 12 and didn’t walk anyone. – Wire reports

Hinkle attends prom day of hospital release • PREP ZONE Continued from page C1 Those concerns were more about the mental aspect of stepping away from his love, or, his mistress, as he referred to basketball in his blog on coachhink. wordpress.com, a highly recommended read. He worried he might spend too much money betting on horses or other activities with so much idle time. He never envisioned dying before any of that happened. Hinkle says his doctors cannot figure out why his blood was clotting and he will remain on the thinners for at least six months. Once the clots are gone, he has to decide whether to remain on the thinners. The hospital trip was frightening, but uplifting as well with all the outpouring of support. One of Hinkle’s first visitors was Dundee-Crown basketball coach Lance Huber, who matched wits with Hinkle for years. “All the people who came by really pumped me up to get back, to know so many people care about you,” Hinkle said. Hinkle’s six-day stay at St. Joseph ended May 3 in the afternoon, the same day of Jacobs’ prom. As he was about to be released, Hinkle called his annual prom

O 930 Pyott Rd. Unit 103 Crystal Lake, IL Call for appt.

815-385-6600

“date” Jenny Christian, Jacobs’ English Division head, with whom he always chaperones. Kevin Christian, her husband and Jacobs cross country coach, did not attend proms, so Hinkle and Jennifer made it their thing. Naturally, Jennifer was more than reluctant to pick him up this time. “I told him he should rest, and he told me he would just go hang out with young girls I didn’t like,” Jenny said. “He didn’t look great since he’d just come out of the hospital, and I was worried about it a little bit. I made him sit down a lot. The kids all flocked to him, I think he took pictures with everybody there.” Hinkle was able to show everyone he was doing all right, and went home after an hour and a half. Now, Hinkle is invigorated after his scare. “I feel like I’ve always had my priorities in order, but I really appreciate every day now more than ever,” he said. “I really do live every day as though it is my last. It’s a good philosophy, except I’m spending all my money.” • Joe Stevenson is a senior sports writer for the Northwest Herald. He can be reached by email at joestevenson@shawmedia.com. You also can follow him on Twitter @nwh_JoePrepZone.

A Complimentary AC Performance Check with this ad

WWW.OPTIONSAUTOMOTIVE.COM


PRO HOCKEY

Northwest Herald / NWHerald.com

Wednesday, June 5, 2013 • Page C3

BLACKHAWKS NOTES

NHL EASTERN CONFERENCE FINALS

Keith’s penalty draws scrutiny

Bruins return home with chance to sweep

Stick to Carter’s head upsets Sutter By TOM MUSICK tmusick@shawmedia.com EL SEGUNDO, Calif. – Duncan Keith’s violent high-sticking penalty against Los Angeles Kings forward Jeff Carter drew more than blood Sunday. It drew a harsh response from Kings coach Darryl Sutter after his team beat the Hawks, 3-1, to trim their seDuncan ries deficit to Keith 2-1 in the Western Conference finals. “I didn’t think it was a four-minute penalty,” Sutter said. “Thought it was a wrong call.” Hint, hint: Sutter was not campaigning for a shorter penalty for Keith. Sutter explained why he thought the consequences should have been worse. “Retaliation,” Sutter said. “That’s three head injuries now in the playoffs for us. I don’t know how to answer it. It’s retaliation with a stick. It’s not a high stick. Whatever they want to call it, they’ll call it. Don’t even need video.” For his part, Keith said he did not intend to hit Carter in the face. “I wanted to give him a tap, but not where I got him,” Keith said. “I’m glad to see that he came back.” Keith offered a curt response when asked whether he thought the NHL might review the play. “I don’t know,” Keith said. “I have no idea. I just said it was an accident.” We meet again: Rarely do referee assignments make news in the NHL, playoffs or otherwise. Then again, rarely do referees almost cost a team a Game 7 victory. Referee Stephen Walkom worked Game 3 between the Hawks and Kings seven days after waving off Niklas Hjlamarsson’s go-ahead goal late in Game 7 against the Detroit Red Wings. On that sequence, Walkom ruled that play had stopped a moment before Hjalmarsson’s shot hit the back of the net. Walkom worked Game 3 with fellow referee Eric Furlatt, while Shane Heyer and Brad Kovachik served as linesmen. Big absence: The Hawks avoided Kings center Mike Richards for the second time in three games because of an upper-body injury that he suffered in the series opener on a hit by Dave Bolland. Richards (5-10, 200 pounds) is one of the Kings’ smaller forwards, but he notched 32 points (12 G, 20 A) in 48 games during the regular season and 10 points (2 G, 8 A) in 14 playoff games before his injury. “He’s not a big guy, but he plays good,” Hjalmarsson said. “He has a big heart, you can see that. He plays tough every shift. Great passer. Great shooter. “Obviously, for us as defenseman, he’s one less threat out there on the ice. But they’ve got good players.”

Preserving the Independence of McHenry County Seniors

Call 815- 455-3120 or visit scvnmchenrycounty.org

Penguins have scored 1 goal in first 2 games By HOWARD ULMAN The Associated Press AP photo

Kings right wing Justin Williams (left) shoves Blackhawks center Andrew Shaw on Tuesday night in Los Angeles.

Penalty kills take up lots of Hawks’ time • MUSICK Continued from page C1 Sharp has been the Hawks’ best player during the postseason, but he fell for the Kings’ tricks in Game 3. When he lined up across from Kings winger Justin Williams before a faceoff late in the first period, angry chatter led to angry bumps, which led to both players dropping their gloves. “He asked me to fight,” Sharp said. “If he asks me again, I’ll fight him any day he wants.” That was the problem with Game 3 in a nutshell. The Kings acted, and the Hawks reacted. But zero punches thrown by Sharp and Williams meant zero fighting majors, so both players served 2-minute minors for roughing. From his seat in the penalty box, Sharp offered a derisive wink to Williams. Now, there are good winks and bad winks. Marian Hossa confidently winking to his buddies watching from a bar in Slovakia? Good wink. Sharp smugly winking at an opponent after a brief role as “Tough Guy No. 10”? Bad wink. Far worse was Keith drawing blood with a high-sticking penalty on Carter about halfway through the second period. Keith admitted afterward that he wanted to “tap” Carter, but not in the face. “It was just a little scuffle at the end of the play,” said Keith, who drew a four-minute penalty because Carter

was cut. “It was an accident.” Other “accidents” included a slashing penalty by Sharp, an interference penalty by Johnny Oduya and a high-sticking penalty by Marcus Kruger. The Hawks’ penalty kill shined again, going 5 for 5, but the glut of Kings’ power plays kept the Hawks in their defensive zone for nearly 10 minutes. It’s pretty hard to score when you’re almost 200 feet away from the Kings’ net. “We took five penalties tonight,” Hawks coach Joel Quenneville said. “Probably four too many.” At least a few Hawks understood how they would need to play going forward. Bryan Bickell, who scored the Hawks’ only goal on a wrap-around late in the second period, said he and his teammates would have to stay disciplined in Game 4 as the Kings looked to extend their home winning streak of 15 games and their playoff home record of 8-0. “We just need to play between the whistles,” Bickell said, “and stay out of the ruckus kind of stuff.” After Bickell had answered the final question of his marathon postgame interview, he wadded up a piece of hockey tape and took aim at a gray trash can in the middle of the locker room. He missed. It was that kind of night.

BOSTON – Sidney Crosby and the potent Penguins have been punchless. Pittsburgh led the NHL in scoring in the regular season. It averaged 4.27 goals a game in the first two rounds of the playoffs. And it poured in 13 goals in the last two games of the Eastern Conference semifinals. Since then? No addition necessary. The Penguins have one goal in two losses on their home ice to the Boston Bruins. To play there again this season, they must win Wednesday or Friday and avoid what seemed so improbable just a few days ago – being swept in the best-of-seven conference finals. “Right now, we’re not liking the picture, down 0-2. They’re in control,” Penguins coach Dan Bylsma said. “I don’t think we’re frustrated by the fact that we haven’t scored as much as [the fact] they’re getting leads, especially in Game 2.” The Bruins won the opener, 3-0, but led just 1-0 after two periods. The second game was much different. They rolled to a 4-1 lead after one period and remained aggressive in finishing off their 6-1 rout. The Penguins’ effort waned as the game went on. “I didn’t do anything, didn’t change anything. It felt like every time we had a puck that was bouncing, we ended up giving it away,” Crosby said. “We gave them the game. We didn’t really do anything to give ourselves a chance to win.” Combine that with the Bruins’ high level of play – disciplined on defense, organized on offense – and the pre-series chatter about the Penguins being favorites seems like so much nonsense. But any talk that Boston will have an easy path to the Stanley Cup Final is just as premature. “We’re going to have to play even better than we did because they’re going to be desperate,” Boston’s David Krejci said. With a day off to ponder their problems and work at eliminating them, the Penguins’ offense could resurface. “It’s about what we do in the next game,”

• Northwest Herald sports columnist Tom Musick can be reached at tmusick@shawmedia.com and on Twitter @ tcmusick.

Hawks Insider

AP photo

Penguins coach Dan Bylsma stands behind James Neal (left) and Jussi Jokinen on Monday during the third period of Game 2 of the Eastern Conference finals against Boston. The Bruins won, 6-1. Boston defenseman Andrew Ference said, “not about patting ourselves on the back for what’s already happened.” Winning the first two games is a good start but doesn’t always lead to a good finish. Both teams have overcome 2-0 deficits and gone on to win Stanley Cups. In 2009, the Penguins dropped two games at Detroit by a combined score of 6-2 then took four out of five to clinch their first championship since 1992. In 2011, the Bruins lost two games of the opening round at home against Montreal, then won the next two on the road and captured the series on an overtime goal in Game 7. In the finals, they got off to the same poor start, losing two in Vancouver, but then won their first title since 1972 with a 4-0 road win in Game 7. But in the previous season, the Bruins won the first three games of the Eastern semifinals over Philadelphia then lost the next four. “We have a large group of guys that have gone through this and been in that situation on both sides of the coin,” Ference said. “You can really lean on your past experience and not just talk about what could happen, because we’ve done it all. I think with this team, whether it’s coming back or having teams come back on us, we’ve all seen it together and we all know certain lessons that we’ve learned.”

cr

yst

alwoodsgc.c

om

JULY 12 & 13

KINGS 3, BLACKHAWKS 1 Tipping point: A turnover in the Hawks’ defensive zone led to the Kings’ first goal and allowed the Kings to settle into their neutral-zone defense for much of the game. Hawks defenseman Nick Leddy failed to clear the puck along the boards, and the Kings capitalized when Slava Voynov fired a slap-pass to Justin Williams for a goal at the 3:21 mark of the first period. Lamplighters: Hawks forward Bryan Bickell continued his torrid postseason play with his seventh playoff goal in the final minute of the second period, but none of his teammates joined him on the score sheet. Patrick Kane and Patrick Sharp managed only two shots apiece. Between the pipes: Corey Crawford stopped 25 of 27 shots before the Kings added an empty-net goal in the final minute of regulation. Crawford was beat stick-side by Williams, and he was beat glove-side by Voynov for his fifth loss in 15 playoff games. Under the radar: The Kings improved to 8-0 during the playoffs and inched closer to history. The NHL playoff record for consecutive home wins is 11, set by the Edmonton Oilers in 1988.

2013 McHenry County Men’s Amateur Golf Tournament Registration Form Name _____________________________________________________________________ Address ___________________________________________________________________ City__________________________________________________________ Zip __________ Handicap______________ Golf Club (non-resident) __________________________________ ❑ Check (included) / Credit Card ❑ MasterCard ❑ Visa ❑ Discover Expiration Date ____________ Credit Card Number ___________________________________________________________ Total Amount ($110 without cart/$135 with cart) $ ________________ Phone _________________ Email ____________________________

For further information, call the Crystal Woods Pro Shop at 815-338-3111 or Email: playgolf@crystalwoodsgc.com

DEADLINE: Saturday, July 6, 2013

Mail this registration form and verifiable handicap card along with a check, payable to Crystal Woods Golf Club, or credit card number to: Crystal Woods Golf Club, 5915 S. Rt. 47, Woodstock, IL 60098. Absolutely NO REFUNDS will be issued. Tee times will be listed in the Northwest Herald during the week prior to the tournament.

Hey what’s the

B!GDEAL

Starts TOMORROW!

?


PRO GOLF & PRO BASEBALL

Page C4 • Wednesday, June 5, 2013

Northwest Herald / NWHerald.com

Qualifier Sisk embodies U.S. Open Geoffrey Sisk is going back to the U.S. Open, an example of why this major championship truly is open to one and all. In what looked like a marathon and felt like a sprint, the 48-year-old New Englander went from being a long shot to assuring himself of a tee time at the U.S. Open in just 20 days. Sisk was among 18 players – the smallest group in more than a decade – who made it through 18 holes of local qualifying and then 36 holes of sectional qualifying to join Tiger Woods, Rory McIlroy and the rest of the stars at Merion next week for the toughest test in golf. The hard part for Sisk was just getting there. And it gets even more impressive. This was the sixth time he has gone through both stages to qualify for the U.S. Open. “I wish I wouldn’t have, to be honest with you,” Sisk said while waiting to catch a train from New York to Boston. The chuckle made it clear that he was actually glad that he paid the $150 fee to enter America’s national championship. But it was another reminder how maddening this game can be. Sisk has been a pro for 25 years. He made it to the PGA Tour only one time, for the 1999 season. He has been around long enough to have started on the tour’s developmental circuit when it was known as the Hogan Tour. “There’s part of me that says, ‘This is great,’ ” Sisk said. “The flip side is that if I can do this now – I performed well – why can’t I do this on the other levels? I’m my own worst enemy sometimes. But I just try to do the best I can.” There are other stories like Sisk’s, as always. Mackenzie Hughes didn’t make it out of local qualifying – he was the first alternate. But a spot opened for him at Old Warren in St. Louis, where he was among 42 players competing for two spots. Hughes went 72-70 and earned the final spot in a playoff. He was so flustered that, when interviewed by Golf Channel after his round, he forgot which state Merion was located. He was on his way to Vancouver to play before the U.S. Open. Let’s hope he finds his way. Wil Collins and Ryan Nelson made it through both stages for the second time.

ON THE FRINGE Doug Ferguson But six times? “I think after going to Shinnecock (in 2004) and Oakmont (in 2007), I thought these golf courses were too tough for me,” Sisk said. “This year, I don’t have any status on any tour. I’m not playing a lot of tournaments. So I spent the $150 to add a tournament to my very limited schedule. And I added a big one.” Sisk shot a 68 at Pinehills Golf Club in Plymouth, Mass., to grab one of the five spots at his local qualifier. He signed up for the New York sectional because it was the closest one to home, and he had rounds of 68-69 at Old Oaks and Century to share medalist honors, making it with two shots to spare. Most of his U.S. Open memories are from Shinnecock Hills, where he made his U.S. Open debut the year before Woods turned pro. He had played some in South Africa and remembered the tall, athletic kid with an easy swing. So when he saw Ernie Els in the hotel lobby – Els was the defending champion that year – he asked for a practice round. “I’d had a few cocktails, I asked him and he said, ‘Sure, why don’t we play.’ Mark McNulty was going to join us,” Sisk said. “I’m on the putting green, and Ernie says, ‘Sisky, you ready?’ I said, ‘Where’s Mark?’ And he said he wasn’t there, along with a few choice words, and we were ready. Back then, I knew nothing about the U.S. Open. They had a starter on the tee who said, ‘Now teeing off, Geoffrey Sisk and Ernie Els, the 1994 champion. “All of a sudden it goes from two people around us to about 200 on the first tee,” he said. “I’d never played before so many people in my life.” He made it back to Shinnecock in 2004 after both stages of qualifying and was enjoying one of his best Opens, just 5 over going into the final round. That’s the year the course got away from the USGA, particularly the green on the par-3 seventh hole. “I remember hearing a rumor that Kevin Stadler had lipped out a par putt from 2 feet on No. 7 and his ball went into a bunker,” Sisk said. “I hit a perfect shot that landed on a ledge and stayed on a ledge. A foot

AP photo

Geoffrey Sisk, playing a practice round for the 2011 U.S. Open in Bethesda, Md., will compete in his sixth U.S. Open after qualifying again this year. shorter, a foot longer, it would have been dead. I two-putted and never smiled so much over a par. I think I had four or five birdies that day and still shot 82.” His next U.S. Open adventure could be a homecoming of sorts for Sisk, who played college golf at Temple until he graduated in 1987. But he doesn’t see it that way. It was just another tournament to add to his schedule, another chance to test himself in a championship where he plays his best just to get in. How many more times will he try? Perhaps a more significant question is what keeps a guy going when he’s 48 and had made it to the big leagues just once? “I always said I would stop playing competitive golf when I did the best I could and things were going

By TIM BOOTH The Associated Press

ANGELS 4, CUBS 3

Pujols’ HR in 8th knocks off Cubs By JOE RESNICK The Associated Press ANAHEIM, Calif. – Albert Pujols hit a go-ahead homer in the eighth inning and drove in three runs, leading the Los Angeles Angels to a 4-3 victory over the Cubs on Tuesday night. Pujols’ 484th career homer and ninth of the season not only got Jered Weaver off the hook, but also third baseman Alberto Callaspo, whose third-inning fielding error led to a pair of unearned runs. Cubs starter Scott Feldman took a 3-1 lead into the seventh before former Texas Rangers teammate Josh Hamilton led off with a double and scored on Howie Kendrick’s third single of the game, which made him 8 for 18 against the right-hander. James Russell came in and retired the next three batters, including Callaspo on a sacrifice bunt. But Erick Aybar greeted Carlos Villanueva (1-4) with a leadoff single through the box, and Pujols

Next for the Cubs Cubs at L.A. Angels, 6:05 p.m. Wednesday, CSN, AM-720

drove his first-pitch homer over the double-decker bullpen in left field after Mike Trout flied out. Robert Coello (2-1) pitched a scoreless eighth for the win and Ernesto Frieri got three outs for his 13th save in 14 attempts. Weaver struck out five and was charged with an earned run and six hits over six innings in his fourth start this season and second since coming off the disabled list. He is 0-2 with two no-decisions in four starts against Feldman, who spent his eight previous big league seasons with the AL West-rival Texas Rangers. Feldman allowed two runs and six hits in six-plus innings.

GB — 2 4½ 7 7½ GB — 2½ 2½ 4 11½ GB — 1½ 10 10 15

NATIONAL LEAGUE

backward,” he said. The next stop is Merion, though he wasn’t in a huge rush to get there. Keegan Bradley, the former PGA champion and another New Englander, sent him a text of congratulations and invited him to fill out a group Sunday that includes Rickie Fowler. While he made it back to the U.S. Open, Sisk knows it will be even tougher the next time. Only five years ago, more than 30 players made it through local and sectional. But golf is getting younger, deeper. “Without a doubt, local qualifying is not easy nowadays,” he said. Nonetheless, it still has room for anyone with $150 and a dream. • Doug Ferguson covers golf for The Associated Press.

Peavy leaves loss with injury

AP photo

CENTRAL DIVISION W L PCT Detroit 31 25 .554 Cleveland 30 28 .517 Minnesota 26 29 .473 White Sox 24 32 .429 Kansas City 23 32 .418 EAST DIVISION W L PCT Boston 36 23 .610 Baltimore 33 25 .569 New York 33 25 .569 Tampa Bay 31 26 .544 Toronto 24 34 .414 WEST DIVISION W L PCT Texas 35 22 .614 Oakland 35 25 .583 Los Angeles 26 33 .441 Seattle 26 33 .441 Houston 21 38 .356

Tuesday’s Games L.A. Angels 4, Cubs 3 Seattle 7, White Sox 4 N.Y. Yankees 4, Cleveland 3 Detroit 10, Tampa Bay 1 Boston 17, Texas 5 Baltimore 4, Houston 1 Minnesota 3, Kansas City 0 Milwaukee 4, Oakland 3 (10 inn.) San Francisco 2, Toronto 1 Wednesday’s Games White Sox (Axelrod 3-4) at Seattle (Iwakuma 6-1), 2:40 p.m. Cubs (Garza 1-0) at L.A. Angels (Vargas 5-3), 6:05 p.m. Cleveland (Kluber 3-3) at N.Y. Yankees (Sabathia 5-4), 12:05 p.m. Oakland (Colon 6-2) at Milwaukee (Gallardo 4-5), 1:10 p.m. Toronto (Dickey 4-7) at San Francisco (Zito 4-3), 2:45 p.m. Tampa Bay (Cobb 6-2) at Detroit (Fister 5-2), 6:08 p.m. Texas (Ogando 4-2) at Boston (Lackey 3-5), 6:10 p.m. Baltimore (F.Garcia 2-2) at Houston (Keuchel 2-2), 7:10 p.m. Minnesota (Walters 2-0) at Kansas City (Guthrie 5-3), 7:10 p.m. Thursday’s Games Oakland at White Sox, 7:10 p.m. Tampa Bay at Detroit, 12:08 p.m. Baltimore at Houston, 1:10 p.m. Texas at Boston, 6:10 p.m. Minnesota at Kansas City, 7:10 p.m. N.Y. Yankees at Seattle, 9:10 p.m.

MARINERS 7, WHITE SOX 4

The Angels’ Albert Pujols hits a two-run home run in the eighth inning against the Cubs on Tuesday in Anaheim, Calif. The Cubs lost, 4-3.

AMERICAN LEAGUE

SEATTLE – Raul Ibanez hit a two-run homer and a two-run double in his first two at-bats, and Felix Hernandez pitched with a comfortable lead for a change as the Seattle Mariners handed the White Sox their eighth straight loss with a 7-4 victory Tuesday night. Seattle scored three times in the first inning and three times in the third to give Hernandez a rare cushion on a night when he wasn’t at his best early. Thanks to the lead, Hernandez (7-4) was eventually able to find a groove and he ended up pitching into the eighth inning to win his sec-

Next for the Sox Sox at Seattle, 2:40 p.m. Wednesday, WGN, AM-670

ond straight start. Ibanez hit the first pitch he saw out to right field for his 11th homer and added the double his next at-bat. It was his second game this season with at least four RBIs. The anticipated matchup between former Cy Young Award winners Hernandez and Jake Peavy (6-4) never materialized into a pitching showdown. Hernandez gave

up runs in each of the first two innings, while Peavy was knocked around for six earned runs and seven hits in just 21/3 innings before leaving with an injury to his ribs. Hernandez settled down quickly after giving up a run in the first and Adam Dunn’s long homer to center field in the second. After Dunn’s 13th homer of the season and a single by Alexei Ramirez, Hernandez retired 16 of the next 17 batters and faced the minimum over the next five innings. Ramirez led off the eighth with a single, the first Sox hit since the second inning, and Tyler Flowers chased Hernandez with an RBI double.

MLB ROUNDUP

Red Sox rack up 17 runs on Rangers The ASSOCIATED PRESS BOSTON – Jackie Bradley Jr. hit his first career homer and had three RBIs, and the Boston Red Sox set season highs for hits and runs in a 17-5 rout of the Texas Rangers on Tuesday night. Stephen Drew, Mike Carp and Jarrod Saltalamacchia also homered for the Red Sox, who scored at least one run in every inning through the first seven and hit for the cycle as a team in the second. The Red Sox finished with 19 hits, eight of them doubles. Twins 3, Royals 0: At Kansas City, Mo., Ryan Doumit homered and drove in a pair of runs sending Minnesota to a victory and Kansas City to its franchise-record 11th straight home loss. Tigers 10, Rays 1: At Detroit, Prince Fielder homered and drove in four runs, and Detroit handed Matt Moore his first loss of the season with a victory over Tampa Bay.

Yankees 4, Indians 3: At New York, David Phelps allowed only an infield single in six shutout innings and got home run help from Mark Teixeira as New York beat Cleveland. Orioles 4, Astros 1: At Houston, Danny Valencia homered, Chris Tillman threw seven solid innings and Baltimore ended Houston’s sixgame winning streak. NATIONAL LEAGUE Phillies 7, Marlins 3 (11 inn.): At Philadelphia, John Mayberry Jr. hit a grand slam with two outs in the bottom of the 11th inning after his tying homer in the 10th, and Philadelphia beat Miami.

Diamondbacks 7, Cardinals 6 (14 inn.): At St. Louis, Paul Goldschmidt hit a run-scoring single in the 14th inning to lift Arizona over St. Louis. Arizona, which improved to 7-2 in extra innings, has won three of four. Nationals 3, Mets 2: At Washington, Steve Lombar-

dozzi’s sacrifice fly in the ninth gave Washington its first late-inning comeback win of the season, capping a two-run rally for a victory over New York. Rockies 5, Reds 4: At Cincinnati, Troy Tulowitzki hit a two-run homer in the eighth inning – a call changed after the umpires initially ruled fan interference – and Colorado held on for a victory that ended its streak of six consecutive losses to Cincinnati.

Braves 5, Pirates 4 (10 inn.): At Atlanta, Andrelton Simmons hit a game-ending double off Mark Melancon in the 10th inning, lifting Atlanta over Pittsburgh.

INTERLEAGUE Brewers 4, Athletics 3 (10 inn.): At Milwaukee, Carlos Gomez scored from first on Yuniesky Betancourt’s line drive in the gap between center and right in the bottom of the 10th inning, lifting Milwaukee over Oakland.

CENTRAL DIVISION W L PCT St. Louis 38 20 .655 Cincinnati 36 23 .610 Pittsburgh 35 24 .593 Cubs 23 33 .411 Milwaukee 22 35 .386 EAST DIVISION W L PCT Atlanta 36 22 .621 Washington 29 29 .500 Philadelphia 29 30 .492 New York 22 33 .400 Miami 16 43 .271 WEST DIVISION W L PCT Arizona 33 25 .569 San Francisco 31 27 .534 Colorado 31 28 .525 San Diego 26 32 .448 Los Angeles 25 32 .439

GB — 2½ 3½ 14 15½ GB — 7 7½ 12½ 20½ GB — 2 2½ 7 7½

Tuesday’s Games L.A. Angels 4, Cubs 3 Philadelphia 7, Miami 3 (11 inn.) Washington 3, N.Y. Mets 2 Colorado 5, Cincinnati 4 Atlanta 5, Pittsburgh 4 (10 inn.) Milwaukee 4, Oakland 3 (10 inn.) Arizona 7, St. Louis 6, (14 inn.) L.A. Dodgers 9, San Diego 7 San Francisco 2, Toronto 1 Wednesday’s Games Cubs (Garza 1-0) at L.A. Angels (Vargas 5-3), 6:05 p.m. Pittsburgh (W.Rodriguez 6-3) at Atlanta (Teheran 3-2), 11:10 a.m. Miami (Ja.Turner 1-0) at Philadelphia (Hamels 1-9), 12:05 p.m. Oakland (Colon 6-2) at Milwaukee (Gallardo 4-5), 1:10 p.m. Toronto (Dickey 4-7) at San Francisco (Zito 4-3), 2:45 p.m. N.Y. Mets (Gee 3-6) at Washington (Haren 4-6), 6:05 p.m. Colorado (Garland 3-6) at Cincinnati (Cueto 3-0), 6:10 p.m. Arizona (Miley 3-5) at St. Louis (J.Kelly 0-2), 7:15 p.m. San Diego (Marquis 6-2) at L.A. Dodgers (Kershaw 5-3), 9:10 p.m. Thursday’s Games N.Y. Mets at Washington, 6:05 p.m. Arizona at St. Louis, 6:15 p.m. Philadelphia at Milwaukee, 7:10 p.m. San Diego at Colorado, 7:40 p.m. Atlanta at L.A. Dodgers, 9:10 p.m.

MARINERS 7, WHITE SOX 4 Chicago

Seattle

ab De Aza lf 4 Bckhm 2b 4 Gillaspi 3b 3 Rios rf 4 Konerk 1b 4 A.Dunn dh 3 AlRmrz ss 3 JrDnks cf 2 Flowrs c 3 Ryan ss 4 Totals 30

r 1 0 0 0 0 1 1 0 1 0 4

h 2 1 0 0 0 1 2 0 1 0 7

Chicago Seattle

bi 1 0 1 0 0 1 0 0 1 0 4

EnChvz rf Bay lf Seager 3b KMorls 1b Ibanez dh Frnkln 2b MSndrs cf Sucre c Shppch c

ab 4 3 4 4 4 4 3 2 1

r h bi 1 1 0 1 1 0 0 1 0 2 2 1 2 2 4 0 2 1 1 2 0 0 0 0 0 0 1

Totals

33 7 11 7

110 000 020 — 4 303 000 01x — 7

DP–Seattle 3. LOB–Chicago 1, Seattle 5. 2B– Flowers (7), K.Morales (18), Ibanez (6), Franklin (1). HR–A.Dunn (13), Ibanez (11). SB–Al.Ramirez (11), M.Saunders 2 (9). CS–Franklin (1). SF– Shoppach. Chicago Peavy L,6-4 Omogrosso N.Jones H.Santiago Lindstrom Seattle F.Hernandez W,7-4 O.Perez H,3 Wilhelmsen S,14-17

IP

H

R

2⅓ 2⅓ 2⅓ ⅓ ⅔

7 4 0 0 0

6 0 0 1 0

ER BB SO 6 0 0 1 0

0 1 0 1 0

0 3 5 1 1

7⅓ ⅔ 1

6 1 0

4 0 0

4 0 0

1 0 1

8 0 0

Umpires–Home, CB Bucknor; First, D.J. Reyburn; Second, Todd Tichenor; Third, Dale Scott. T–2:57. A–16,294 (47,476).

ANGELS 4, CUBS 3 Chicago ab DeJess cf 5 Valuen 3b 4 Rizzo 1b 3 ASorin dh 4 Schrhlt rf 4 Sweeny lf 4 SCastro ss 4 Castillo c 4 Barney 2b 4 Nlson ph-2b 1 Frieri p 0 Totals 36 Chicago Los Angeles

r 1 1 1 0 0 0 0 0 0 0 0 3

h 0 0 1 2 1 3 0 0 1 0 0 8

bi 0 0 0 1 1 1 0 0 0 0 0 3

Los Angeles ab 4 4 3 4 4 3 2 2 2

r h bi 2 2 0 0 1 0 1 1 3 0 0 0 1 1 0 0 3 1 0 0 0 0 0 0 0 0 0

Aybar ss Trout cf Pujols 1b Trumo dh-lf Hamltn rf Kndrc lf-2b Callasp 3b Iannett c Shuck lf Totals

29 4 8 4

102 000 000 — 3 100 000 12x — 4

E–Callaspo (5). LOB–Chicago 8, Los Angeles 4. 2B–A.Soriano (13), Aybar (12), Hamilton (8). HR–Pujols (9). SB–Trout (13), H.Kendrick (6). S– Callaspo. SF–Pujols. Chicago Feldman Russell H,8 Villanueva L,1-4 BS,1-1 Los Angeles Weaver S.Downs Coello W,2-1 Frieri S,13-14

IP

H

R

6 1 1

6 0 2

2 0 2

ER BB SO 2 0 2

1 0 0

1 1 1

6 1 1 1

6 0 1 1

3 0 0 0

1 0 0 0

1 0 0 0

5 2 1 2

HBP–by Weaver (Valbuena). Umpires–Home, Jim Joyce; First, Cory Blaser; Second, Jeff Nelson; Third, Ed Hickox. T–3:01. A–32,223 (45,483).

TODAY IN BASEBALL 1955 — The Yankees’ Mickey Mantle hit a home run off the White Sox’s Billy Pierce that traveled an estimated 550 feet. The ball cleared the leftfield upper deck at Comiskey Park. 2008 — Atlanta’s Chipper Jones became the third switch-hitter in major league history to hit 400 career home runs. Jones’ homer off Ricky Nolasco was one of his four hits in the 7-5 comeback win over Florida. Mickey Mantle and Eddie Murray were the first two to reach the milestone.


PRO TENNIS & FINE PRINT

Northwest Herald / NWHerald.com

Wednesday, June 5, 2013 • Page C5

FIVE-DAY PLANNER

FRENCH OPEN

Tsonga thrashes Federer; Serena makes semifinals By HOWARD FENDRICH PARIS – A point from losing the first set of his French Open quarterfinal, Roger Federer shanked a routine forehand, sending the ball 10 feet beyond the opposite baseline. The Court Philippe Chatrier crowd roared with approval, then loudly chanted the last name of Federer’s opponent, Frenchman JoWilfried Tsonga. That shot was a clear indication that Federer was hardly Federesque on this day. There were plenty of others: He argued with the chair umpire about a call. He dumped overhead smashes into the net. And in a truly rare ungraceful moment, he failed to put a racket to – or get out of the way of – a backhand flip by a sliding Tsonga, instead getting hit on the back. All in all, Federer looked lost out there Tuesday against the sixthseeded Tsonga, who pounded his way to a 7-5, 6-3, 6-3 victory over the 17-time Grand Slam champion in a 1-hour, 51-minute mismatch remarkable for its lopsidedness and brevity. “I struggled a little bit everywhere. To be honest, personally, I’m pretty sad about the match and the way I played. But that’s how it goes. I tried to figure things out, but it was difficult. And Jo does a good job keeping the pressure on,” Federer said. “He was just ... better in all areas,” continued Federer, whose lone French Open title, in 2009, allowed him to equal Pete Sampras’ then-

PARIS – A look at the French Open on Tuesday: Men’s quarterfinals: No. 6 Jo-Wilfried Tsonga def. No. 2. Roger Federer, 7-5, 6-3, 6-3; No. 4 David Ferrer def. No. 32 Tommy Robredo, 6-2, 6-1, 6-1. Women’s quarterfinals: No. 1 Serena Williams def. Svetlana Kuznetsova, 6-1, 3-6, 6-3; No. 5 Sara Errani def. No. 4 Agnieszka Radwanska, 6-4, 7-6 (6). Wednesday’s quarterfinals: No. 1 Novak Djokovic vs. No. 12 Tommy Haas, No. 3 Rafael Nadal vs. No. 9 Stanislas Wawrinka; No. 2 Maria Sharapova vs. No. 18 Jelena Jankovic, No. 3 Victoria Azarenka vs. No. 12 Maria Kirilenko. AP photo

First, $20,000, SOC $20,000-$10,000, 3 yo’s & up, Six Furlongs 1 Toro Grande Esquivel 116 9-2 2 Bank Account Martinez 121 4-1 3 What Do You Mean Castro 121 8-1 4 Roarin Missile Emigh 121 8-1 5 Go Doug Go Felix 121 5-1 6 Strike the Tiger Desormeaux 124 7-2 7 Razzo Succo Homeister Jr. 124 5-2 Second, $14,000, Claiming $16,000, 3 yo’s & up, One Mile 1 Because I Win Felix 122 10-1 2 Duke of Rutherford Esquivel 117 7-2 3 High Flying Jake Hill 122 5-1 4 Limestone Perez 122 9-2 5 Notoriety Torres 122 6-1 6 Jack’s Tiger Geroux 122 4-1 7 Wild Command Vigil 122 10-1 8 Defiant Flyer Martinez 122 6-1 Third, $11,500, Maiden Claiming $15,000-$10,000, 3 yo’s & up, One Mile 1 T V Five Emigh 120 6-1 2 Via Delorosa Contreras 120 9-2 3 Bushido Thornton 124 12-1 4 Ol Vern Vigil 122 5-1 5 Runaway Cal Geroux 124 6-5 6 King Fest Esquivel 115 4-1 Fourth, $14,000, Claiming $16,000, 3 yo’s & up, Six And A Half Furlongs 1 Strapping Sanchez 118 3-1 2 La Pinata Vigil 122 9-2 3 Lakota Wolf Baird 122 8-1 4 Brother Dr. Bob Perez 118 10-1

GOLF CHAMPIONS TOUR

LPGA CHAMPIONSHIP

REGIONS TRADITION

Site: Pittsford, N.Y. Schedule: Thursday-Sunday. Course: Locust Hill Country Club (6,532 yards, par 72). Purse: $2.25 million. Winner’s share: $337,500. TV: Golf Channel (Thursday, 11:30 a.m.-2 p.m.; Friday, 1:30-3:30 a.m., 11:30 a.m.-2 p.m.; Saturday, 1:30-3:30 a.m., 2-6 p.m.; Sunday, 3:30-5:30 a.m., 2-6 p.m.). Last year: Shanshan Feng became the first Chinese player to win an LPGA Tour title and a major event. She closed with a 5-under 67 for a two-stroke victory. Last week: Karrie Webb won the ShopRite LPGA Classic in New Jersey for her first LPGA Tour title in two years, rallying for a two-stroke victory over Feng. The Australian has 39 tour victories. Notes: The tournament moved to Locust Hill, a longtime regular LPGA Tour stop, in 2010 after five years at Bulle Rock in Havre de Grace, Md.. ... South Korea’s Inbee Park won the first major of the season, the Kraft Nabisco in California in early April, for the second of her three victories this year. ... Asian players have won eight straight majors since Stacy Lewis’ victory in the 2011 Kraft Nabisco. ... Lydia Ko is in the field. The 16-year-old New Zealand amateur won the Canadian Open last August to become the youngest LPGA Tour winner. The South Korea-born Ko has two other pro victories, the New South Wales Open last year and New Zealand Women’s Open this year, and won the U.S. Women’s Amateur last season. ... Yani Tseng won by 10 strokes in 2011, finishing at 19-under 269 to match the lowest score in an LPGA Tour major. She also won the 2008 event at Bulle Rock. ... Cristie Kerr won by 12 strokes in 2010, also finishing at 19 under. ... The tour is off next week. Play will resume June 2123 with the NW Arkansas Championship.

Site: Birmingham, Ala. Schedule: Thursday-Sunday. Course: Shoal Creek (7,145 yards, par 72). Purse: $2.2 million. Winner’s share: $330,000. TV: Golf Channel (Thursday, 5:30-7:30 p.m.; Friday, 11:30 p.m.-1:30 a.m., 5:307:30 p.m.; Saturday, 11:30 p.m.-1:30 a.m., 6:30-8:30 p.m.; Sunday, 1:30-3:30 a.m., 6:30-8:30 p.m.; Monday, 1:30-3:30 a.m.). Last year: Tom Lehman successfully defended his title for the first of his two 2012 victories, beating Bernhard Langer and Chien Soon Lu by two strokes. Last week: Russ Cochran won the Principal Charity Classic in Iowa for his fourth career Champions Tour title, finishing with a 5-under 67 for a one-stroke victory over Jay Don Blake. Notes: The tournament, the second of the Champion Tour’s five major championships is in its third season at Jack Nicklaus-designed Shoal Creek. ... Shoal Creek was the site of the PGA Championship in 1984 and 1990. In 1990, Shoal Creek’s all-white membership and remarks club founder Hall Thompson made that the club wouldn’t be pressured into accepting black members sparked a controversy. The club now has black members, including former Secretary of State Condoleeza Rice. ... In the first major of the season, Japan’s Kohki Idoki won the Senior PGA Championship two weeks ago at Bellerive in St. Louis. Idoki isn’t in the field. ... The tour is off next week. Play will resume June 21-23 with the Encompass Championship in Glenview.

ST. JUDE CLASSIC Site: Memphis, Tenn. Schedule: Thursday-Sunday. Course: TPC Southwind (7,239 yards, par 70). Purse: $5.7 million. Winner’s share: $1,026,000. TV: Golf Channel (Thursday-Friday, 2-5 p.m., 7:30-10:30 p.m.; Saturday-Sunday, noon-1:30 p.m., 8:30 p.m.-1 a.m.) and CBS (Saturday-Sunday, 2-5 p.m.). Last year: Dustin Johnson won in his second event following a back injury that sidelined him nearly three months. John Merrick finished second, a stroke back. Last week: Matt Kuchar won the Memorial in Dublin, Ohio, for his second victory of the year, closing with a 4-under 68 for a two-stroke victory. Tiger Woods finished 20 strokes back at 8-over 296, the second-highest score of his career. Notes: Crystal Lake native Joe Affrunti is playing in his first PGA Tournament since returning from injury. The U.S. Open is next week at Merion in Ardmore, Pa. ... Brandt Snedeker, from Nashville, won at Pebble Beach in February. He missed the event last year because of a rib injury. ... Phil Mickelson is making his third career start in the event and first since 2009. He won the Phoenix Open in February for his 41st PGA Tour title. ... Johnson won the season-opening Tournament of Champions for his seventh tour title. ... Guan Tianlang, the 14-year-old Chinese amateur who made the cut in the Masters, is in the field. He missed the cut last week in the Memorial. ... Paul Goydos is returning from a left wrist injury that sidelined him since February 2012. ... Al Geiberger shot the first 59 in PGA Tour history in his 1977 victory at Colonial Country Club.

EUROPEAN TOUR LYONESS OPEN Site: Atzenbrugg, Austria. Schedule: Wednesday-Sunday. Course: Diamond Country Club (7,410 yards, par 72). Purse: $1.31 million. Winner’s share: $217,670. TV: Golf Channel (Thursday-Sunday, 8-11 a.m.). Last year: Austria’s Bernd Wiesberger won the national championship for the second of his two 2012 European Tour titles, finishing with a 7-under 65 for a three-stroke victory. Last week: Finland’s Mikko Ilonen won the Nordea Masters in Sweden, closing with a 3-under 69 for a three-stroke victory. Sweden’s Jonas Blixt was second. Notes: Wiesberger is coming off a third-place finish in Sweden. He had weekend rounds of 64 and 66. ... In 2006 at Fontana Golf Club, Markus Brier won the tournament for the third time to become the first Austrian champion in European Tour history. The event was part of the second-tier Challenge Tour when Brier won in 2002 and 2004. ... Former tennis star Yevgeny Kafelnikov is in the field. He missed the cut last year with rounds of 75 and 77. ... The Najeti Hotels Open is next week in France, opposite the U.S. Open.

WEB.COM TOUR Next event: Air Capital Classic, June 13-16, Crestview Country Club, Wichita, Kan. Last week: Michael Putnam won the Mid-Atlantic Championship for his second straight title, closing with a 2-under 68 for a two-stroke victory. He won the Mexico Open the previous week.

6 Son of Pearl Castro 120 10-1 7 Chevrons Martinez 120 10-1 8 Thorson Meza 124 30-1 9 Clear the Counter Lantz 118 20-1 10 Lavender Chris Hill 122 9-5 Eighth, $40,000, AOC $40,000, 3 yo’s & up, About One Mile (Turf) 1 Major Gain Graham 121 7-2 1a Stunning Split Thornton 121 7-2 2 Real Power Perez 121 20-1 3 Banner Bill Desormeaux 121 20-1 4 Code of Conduct Geroux 121 6-1 5 Vouch for Victory Roman 121 8-1 6 King Rootin Tootin Meza 121 15-1 7 Southern Parkway Castro 121 5-1 8 Trend Baird 121 9-2 9 Scat About Hill 121 10-1 10 Proceed Bee Emigh 121 4-1 11 Feodor Hernandez 114 30-1 Ninth, $14,000, Claiming $16,000, 3 yo’s & up, About One And One Sixteenth Miles (Turf) 1 Helloagainmyfriend Hernandez 115 4-1 1a Chas the Man Vigil 122 4-1 2 Cosmic Brew Desormeaux 118 30-1 3 El Chuvasco Graham 118 15-1 4 Mephisto Aristo Emigh 120 10-1 5 Sir Bluegrass Geroux 122 10-1 6 Hurricane Elvis Homeister Jr. 122 5-2 7 Blazing Finish Castro 122 10-1 8 Homes the Fact Hill 122 7-2 9 Somewhere in Time Esquivel 117 12-1 10 El Truenos Martinez 122 12-1 11 Gohomebay Perez 122 30-1

BETTING ODDS

HOCKEY

GLANTZ-CULVER LINE

NHL PLAYOFFS

Major League Baseball FAVORITE LINE UNDERDOG National League at Atlanta -140 Pittsburgh at Philadelphia -210 Miami at Washington -145 N.Y. Mets at Cincinnati -190 Colorado at St. Louis -135 Arizona at L.A. Dodgers -200 San Diego American League at Seattle -170 White Sox at N.Y. Yankees -160 Cleveland at Detroit -145 Tampa Bay at Boston -120 Texas at Kansas City -150 Minnesota Baltimore -160 at Houston Interleague at L.A. Angels -165 Cubs at Milwaukee -110 Oakland at San Francisco -110 Toronto

LINE +130 +190 +135 +180 +125 +185 +160 +150 +135 +110 +140 +150 +155 +100 +100

NBA Finals Thursday FAVORITE LINE O/U UNDERDOG at Miami 5½ (188½) San Antonio Odds to Win Series Miami -240 San Antonio +200 NHL Playoffs FAVORITE LINE UNDERDOG at Boston -115 Pittsburgh

LINE -105

CONFERENCE FINALS (Best-of-7; x-if necessary) WESTERN CONFERENCE Blackhawks 2, Los Angeles 1 Saturday: Blackhawks 2, Los Angeles 1 Sunday: Blackhawks 4, Los Angeles 2 Tuesday: Los Angeles 3, Blackhawks 1 Thursday: Blackhawks at Los Angeles, 8 p.m. Saturday: Los Angeles at Blackhawks, 7 p.m. x-Monday: Blackhawks at Los Angeles, 8 p.m. x-Wednesday, June 12: Los Angeles at Blackhawks, TBD EASTERN CONFERENCE Boston 2, Pittsburgh 0 Saturday: Boston 3, Pittsburgh 0 Monday: Boston 6, Pittsburgh 1 Wednesday: Pittsburgh at Boston, 7 p.m. Friday: Pittsburgh at Boston, 7 p.m. x-Sunday: Boston at Pittsburgh, 7 p.m. x-Tuesday: Pittsburgh at Boston, TBD x-Wednesday, June 12: Boston at Pittsburgh, TBD

KINGS 3, BLACKHAWKS 1

BASKETBALL

Chicago Los Angeles

NBA PLAYOFFS NBA FINALS Miami vs. San Antonio Thursday: San Antonio at Miami, 8 p.m. Sunday: San Antonio at Miami, 7 p.m. Tuesday, June 11: Miami at San Antonio 8 p.m. Thursday, June 13: Miami at San Antonio, 8 p.m. x-Sunday, June 16: Miami at San Antonio, 7 p.m. x-Tuesday, June 18: San Antonio at Miami, 8 p.m. x-Thursday, June 20: San Antonio at Miami, 8 p.m. x–if necessary

PLAYOFF LEADERS Durant, OKC Anthony, NYK Harden, HOU James, MIA Curry, GOL Parker, SAN Paul, LAC Lopez, Bro Lawson, DEN Williams, Bro Green, BOS

Scoring G FG 11 112 12 126 6 45 15 137 12 102 14 125 6 49 7 58 6 48 7 45 6 37

SUNDAY

LOS ANGELES* 7 p.m. NBC FM-97.9

at L.A. Angels 6:05 p.m. CSN AM-720 OAKLAND 7:10 p.m. CSN AM-670

at Seattle 2:40 p.m. WGN AM-670

SATURDAY

PITTSBURGH 1:20 p.m. WGN AM-720

PITTSBURGH 7:05 p.m. CSN AM-720

PITTSBURGH 1:20 p.m. WGN AM-720

OAKLAND 7:10 p.m. CSN AM-670

OAKLAND 3:10 p.m. WGN AM-670

OAKLAND 1:10 p.m. CSN AM-670

PORTLAND 7:30 p.m. WPWR at San Antonio 7 p.m. WCUU

SAN ANTONIO 5 p.m. WCUU * Playoff game

ON TAP WEDNESDAY 6 p.m.: Cubs at L.A. Angels, CSN, AM-720 6 p.m.: Texas at Boston, ESPN2

TV/Radio NHL PLAYOFFS 7 p.m.: Conference inals, Game 3, Pittsburgh at Boston, NBCSN

TENNIS 7 a.m.: French Open, quarterinals, at Paris, ESPN2

CYCLING

route to a 6-1, 3-6, 6-3 victory that put Yankees, MLBN 11 p.m.: Criterium du Dauphine, stage 4, Villars-les-Dombres to Parc des Oiseaux, France, NBCSN (same-day tape) 2:30 p.m.: White Sox at Seattle, WGN, AM-670 her back in the semifinals at Paris after a decade’s absence. Williams had lost four consecuTRANSACTIONS FOOTBALL AUTO RACING tive quarterfinals at Roland Garros – in 2004, 2007, 2009 [to Kuznetsova], PROS ARENA FOOTBALL NASCAR SPRINT CUP 2010 – and so when she was serving BASEBALL NATIONAL CONFERENCE while down 2-0 in the final set TuesSCHEDULE American League Central Division CLEVELAND INDIANS–Placed SS AsW L T Pct PF PA day, “I thought, you know, ‘Can’t go June 9 — Party in the Poconos 400 drubal Cabrera on the 15-day DL. Recalled Rush 6 5 0 .545 605 597 presented by Walmart, Long Pond, Pa. out like this again.’ ” INF Juan Diaz from Columbus (IL). San Antonio 5 5 0 .500 434 464 June 16 — Quicken Loans 400, Brooklyn, KANSAS CITY ROYALS–Claimed OF Iowa 4 7 0 .364 526 529 That was a pivotal game, featur- Quintin Mich. Berry off waivers from Detroit and West Division June 23 — Toyota/Save Mart 350, him to Omaha (PCL). Reinstated W L T Pct PF PA ing 16 points and three break chanc- optioned Sonoma, Calif. C Salvador Perez from the restricted list. Arizona 10 1 0 .909 743 525 June 29 — Quaker State 400, Sparta, Ky. es for Kuznetsova, who flubbed the Recalled RHP Kelvin Herrera from Omaha. Spokane 8 3 0 .727 737 593 July 6 — Coke Zero 400 powered by Optioned C Adam Moore and RHP Louis San Jose 7 3 0 .700 520 499 last with a drop shot that floated Coleman to Omaha. Coca-Cola, Daytona Beach, Fla. Utah 4 6 0 .400 510 510 TORONTO BLUE JAYS–Placed RHP AMERICAN CONFERENCE wide. After finally holding in that Ramon Ortiz on the 15-day DL. Activated South Division NASCAR NATIONWIDE game with an inside-out forehand OF Rajai Davis and RHP Josh Johnson from W L T Pct PF PA 15-day DL. Jacksonville 8 3 0 .727 590 494 winner as Kuznetsova stumbled to National League SCHEDULE Tampa Bay 7 4 0 .636 639 590 DIAMONDBACKS–Recalled New Orleans 2 8 0 .200 415 586 the clay, Williams broke right away LHPARIZONA Tyler Skaggs from Reno (PCL). June 8 — DuPont Pioneer 250, Newton, Orlando 2 8 0 .200 499 600 ANGELES DODGERS–Reinstated with a backhand winner that had INFLOS Iowa Eastern Division Hanley Ramirez from the 15-day DL. June 15 — Alliance Truck Parts 250, W L T Pct PF PA Placed LHP Chris Capuano on the 15-day her yelling and shaking her fist. Brooklyn, Mich. Philadelphia 5 5 0 .500 588 525 DL, retroactive to May 30. June 22 — Johnsonville Sausage 200, Pittsburgh 3 7 0 .300 393 531 “Unbelievable competitor,” WASHINGTON NATIONALS–ReinElkhart Lake, Wis. Cleveland 2 8 0 .200 447 603 stated OF Jayson Werth from the 15-day Kuznetsova said. “She turns on [her] DL. June 28 — Feed The Children 300, Recalled INF Anthony Rendon from Sparta, Ky. Monday’s Game Syracuse (IL). Selected the contract of game when she needs it.” July 5 — Subway Firecracker 250 powSan Antonio 42, Utah 41

record of 14 major championships. “He returned better than I did. Served better than I did. I struggled to find my rhythm.” While Federer quickly faced a big deficit Tuesday and never recovered, Serena Williams was able to get out of a much smaller spot of trouble. Like Federer, Williams is 31. Like Federer, she’s won more than a dozen Grand Slam titles, 15. And like Federer, only one of those trophies came at Roland Garros, in 2002. Trailing in the third set against 2009 French Open winner Svetlana Kuznetsova, the No. 1-seeded Williams won five games in a row en

5 Quartermaster Esquivel 117 5-1 6 Cadcam Guing 122 20-1 7 Salty Ruler Castro 118 7-2 8 Runnin On Diesel Martinez 118 8-1 9 Little Kinkaid Homeister Jr. 118 10-1 Fifth, $39,000, Maiden special weight, 3 yo’s & up, About One And One Sixteenth Miles (Turf) 1 Eight Gauge Roman 124 9-2 2 Legal Deed Desormeaux 120 15-1 3 Animal Hour Esquivel 115 30-1 4 I’m Still the King Torres 120 20-1 5 Ballistic Tim Meza 124 30-1 6 Heart Stopper Emigh 120 7-2 7 He’s Dann Good Graham 124 3-1 8 Super Soldier Felix 120 6-1 9 Awol Adam Perez 120 5-2 Sixth, $14,000, Starters allowance $7,500, 3 yo’s & up, F & M (fillies and mares), About One And One Sixteenth Miles (Turf) 1 Direct Breeze Guing 121 30-1 2 Pure Value Torres 121 20-1 3 Run Mama Beare Run Perez 121 20-1 4 Latika Love Graham 121 5-1 5 Katie the Lady Castro 121 1-1 6 Winning Star Esquivel 116 10-1 7 Mistie Royale Thornton 124 9-2 8 Proud Osceola Roman 121 10-1 9 Hello Jake Hill 121 10-1 Seventh, $11,500, Maiden Claiming $15,000-$10,000, 3 yo’s & up, Five And A Half Furlongs 1 Battle Facts Roman 122 6-1 2 French Colonel Felix 120 9-2 3 Borren Identity Contreras 124 15-1 4 M J Winks Hernandez 113 6-1 5 Evil Image Esquivel 115 8-1

FRIDAY

at Los Angeles* 8 p.m. NBCSN AM-720

Noon: Miami at Philadelphia or Cleveland at N.Y.

Jo-Wilfried Tsonga celebrates defeating Roger Federer in three sets Tuesday in their French Open quarterfinal match in Paris.

ARLINGTON PARK ENTRIES Wednesday’s post time: 1 p.m.

THURSDAY

MAJOR LEAGUE BASEBALL

HORSE RACING

PGA TOUR

WEDNESDAY

Tuesday in Paris

The Associated Press

LPGA TOUR

TEAM

FT 93 77 53 90 35 63 33 39 28 37 38

PTS 339 346 158 387 281 322 137 156 128 144 122

AVG 30.8 28.8 26.3 25.8 23.4 23.0 22.8 22.3 21.3 20.6 20.3

0 1

1 1

0 — 1 1 — 3

First Period–1, Los Angeles, Williams 6 (Voynov, Scuderi), 3:21. Penalties–Kopitar, LA (tripping), 6:42; Sharp, Chi (roughing), 14:03; Williams, LA (roughing), 14:03; Sharp, Chi (slashing), 17:32. Second Period–2, Los Angeles, Voynov 5 (Toffoli, Carter), 6:37. 3, Chicago, Bickell 7, 19:26. Penalties–Oduya, Chi (interference), 2:59; Keith, Chi, double minor (high-sticking), 7:58. Third Period–4, Los Angeles, King 1 (Carter, Greene), 19:32 (en). Penalties– Kruger, Chi (high-sticking), 1:52; Brown, LA (interference), 3:43. Shots on Goal–Chicago 7-3-10–20. Los Angeles 8-9-11–28. Power-play opportunities–Chicago 0 of 2; Los Angeles 0 of 5. Goalies–Chicago, Crawford 10-5-0 (27 shots-25 saves). Los Angeles, Quick 9-7-0 (20-19). A–18,477 (18,118). T–2:29. Referees–Stephen Walkom, Eric Furlatt. Linesmen–Brad Kovachik, Shane Heyer.

TENNIS FRENCH OPEN TUESDAY’S RESULTS

WNBA EASTERN CONFERENCE W L Pct Atlanta 3 0 1.000 Sky 3 0 1.000 Indiana 1 1 .500 New York 1 1 .500 Washington 1 1 .500 Connecticut 1 2 .333 WESTERN CONFERENCE W L Pct Minnesota 1 0 1.000 Los Angeles 1 1 .500 San Antonio 1 1 .500 Seattle 1 1 .500 Phoenix 0 2 .000 Tulsa 0 4 .000 Wednesday’s Game Indiana at New York, 10 a.m.

GB — — 1½ 1½ 1½ 2 GB — ½ ½ ½ 1½ 2½

At Stade Roland Garros Paris Purse: $28.4 million (Grand Slam) Surface: Clay-Outdoor Singles Men Quarterfinals David Ferrer (4), Spain, def. Tommy Robredo (32), Spain, 6-2, 6-1, 6-1. Jo-Wilfried Tsonga (6), France, def. Roger Federer (2), Switzerland, 7-5, 6-3, 6-3. Women Quarterfinals Sara Errani (5), Italy, def. Agnieszka Radwanska (4), Poland, 6-4, 7-6 (6). Serena Williams (1), United States, def. Svetlana Kuznetsova, Russia, 6-1, 3-6, 6-3.

LHP Ian Krol from Harrisburg (EL). Placed 2B Danny Espinosa on the 15-day DL, retroactive to June 3. Designated RHP Henry Rodriguez and LHP Zach Duke for assignment. Frontier League FRONTIER GREYS–Signed 1B Balbino Fuenmayor. NORMAL CORNBELTERS–Signed C Chris Wilson. ROCKFORD AVIATORS–Signed C Gabe DeMarco and INF Joseph Taylor. Released RHP Garrett Grantiz. TRAVERSE CITY BEACH BUMS– Signed OF D’Marcus Ingram. WASHINGTON WILD THINGS–Released OF Matt Fleishman. WINDY CITY THUNDERBOLTS– Signed INF C.J. Gillman. Released OF Nathan Tomaszewski. FOOTBALL National Football League BEARS–Announced TE Gabe Miller received a four-game suspension for violating the NFL’s policy on performance enhancing substances. ARIZONA CARDINALS–Signed LB Alex Okafor and G Earl Watford to four-year contracts. DETROIT LIONS–Signed G/C Leroy Harris, G Jake Scott and WR Micheal Spurlock. Released WR Troy Burrell, TE Nathan Overbay and CB Lionel Smith. PITTSBURGH STEELERS–Signed DE Nick Williams to a four-year contract. SAN FRANCISCO 49ERS–Signed WR Kassim Osgood to a one-year contract. Waived WR Joe Hastings. TAMPA BAY BUCCANEERS–Signed K Derek Dimke and WR Carlton Mitchell. Waived TE Evan Landi. HOCKEY National Hockey League DALLAS STARS–Announced the extension of its developmental affiliation agreement with Idaho (ECHL) for the 2013-14 season. SOCCER North American Soccer League SAN ANTONIO SCORPIONS–Announced the retirement of D Chris Williams. MOTORSPORTS NASCAR–Docked Sprint Cup driver Brad Keselowski and car owner Roger Penske six points each and fined crew chief Paul Wolfe $25,000 for failing a postrace inspection at Dover on June 2.

COLLEGE BETHEL (MINN.)–Named Doug Novak men’s basketball coach. DUKE–Named Nunzio Esposto diving coach. GEORGIA SOUTHERN–Announced senior RB Robert Brown was medically disqualified from further participating in football practice or competition. INDIANA STATE–Named Mike Lucas defensive line coach. JACKSONVILLE STATE–Announced resignation of women’s basketball coach Annette Watts. MICHIGAN–Announced the resignation of men’s basketball director of operations Travis Conlan. ST. XAVIER–Announced the transfer of junior softball OF Katie Sears from Evansville. TEXAS TECH–Named Bri Young women’s volunteer assistant soccer coach. UALR–Named Bobby Brasel women’s assistant basketball coach. YALE–Named Patrick Hatch tight ends coach.

SOCCER MLS GA 15 19 14 13 24 9 13 17 19 24 GA 17 15 14 15 12 13 17 23 26

NOTE: Three points for victory, one point for tie. Wednesday’s Game Columbus at Philadelphia, 7:30 p.m. Saturday’s Games Portland at Fire, 8:30 p.m. D.C. United at New England, 7:30 p.m. Los Angeles at Real Salt Lake, 9:30 p.m. Vancouver at Seattle FC, 10:30 p.m.

NWSL W 7 6 3 3 3 1 1 0

L 1 2 2 2 2 4 4 7

T 1 1 2 1 1 3 2 1

Pts 22 19 11 10 10 6 5 1

NFL CALENDAR Aug. 3 — Pro Football Hall of Fame inductions, Canton, Ohio. Aug. 4 — Hall of Fame Game: Dallas vs. Miami. Aug. 8 — First weekend of preseason games. Aug. 27 — Roster cutdown to 75 players. Aug. 31 — Roster cutdown to 53 players. Aug. 29 — Preseason schedule ends. Sept. 5 — 2013 season begins.

GF 17 12 12 7 8 9 6 4

GA 5 6 11 4 7 14 12 16

NOTE: Three points for victory, one point for tie.

ered by Coca-Cola, Daytona Beach, Fla.

INDYCAR SCHEDULE June 8 — Firestone 550, Fort Worth, Texas June 15 — Milwaukee IndyFest, West Allis, Wis. June 23 — Iowa Corn Indy 250, Newton, Iowa July 7 — Pocono IndyCar 400, Long Pond, Pa.

FORMULA ONE SCHEDULE June 9 — Canadian Grand Prix, Montreal June 30 — British Grand Prix, Silverstone July 7 — German Grand Prix, Nuerburgring

BASEBALL COLLEGE COLLEGIATE BASEBALL POLL The Collegiate Baseball poll with records through June 3, points and previous rank. Voting is done by coaches, sports writers and sports information directors: Record Pts Pvs 1. Louisiana St. 55-9 497 1 2. Vanderbilt 54-10 496 2 3. North Carolina 55-9 494 3 4. Cal-St. Fullerton 51-8 493 4 5. Oregon St. 48-10 490 5 6. Virginia 50-10 487 6 7. Florida St. 47-15 482 9 8. Louisville 49-12 480 8 9. N.C. State 47-14 475 10 10. UCLA 42-17 474 11 11. South Carolina 42-18 472 13 12. Mississippi St. 46-18 465 14 13. Rice 44-18 462 23 14. Oklahoma 43-19 458 20 15. Kansas St. 44-17 456 15 16. Indiana 46-14 452 22 17. Oregon 48-16 448 7 18. Arkansas 39-22 445 12 19. Arizona St. 37-22-1 442 16 20. Virginia Tech 40-22 439 19 21. Cal Poly 40-19 437 21 22. Oklahoma St. 41-19 436 25 23. Troy 42-20 432 26 24. Florida Atlantic 42-22 427 — 25. Central Arkansas 42-22 426 — 26. Liberty 36-29 422 — 27. Clemson 40-22 420 17 28. William & Mary 39-24 416 — 29. Austin Peay 47-15 413 — 30. San Diego 37-25 411 30

NCAA SUPER REGIONALS Best-of-3 x–if necessary At Boshamer Stadium Chapel Hill, N.C. Friday South Carolina (42-18) at North Carolina (55-9), Noon Saturday South Carolina at North Carolina, 11 a.m. Sunday x-South Carolina at North Carolina, Noon At Doak Field Raleigh, N.C. Friday Rice (44-18) at North Carolina State (47-14), 3 p.m.

EASTERN CONFERENCE W L T Pts GF Montreal 8 2 2 26 22 New York 7 5 4 25 23 Houston 6 4 4 22 19 Kansas City 6 5 4 22 18 Philadelphia 5 5 4 19 19 New England 5 4 4 19 15 Columbus 4 4 5 17 16 Fire 3 7 2 11 9 Toronto FC 1 7 5 8 12 D.C. 1 10 2 5 6 WESTERN CONFERENCE W L T Pts GF FC Dallas 8 2 4 28 23 Real Salt Lake 7 5 3 24 21 Portland 5 1 7 22 22 Los Angeles 6 5 2 20 21 Colorado 5 4 5 20 15 Seattle 5 4 3 18 16 Vancouver 4 4 4 16 16 San Jose 3 6 6 15 13 Chivas USA 3 8 2 11 13

Sky Blue FC Portland Boston FC Kansas City Western New York Washington Red Stars Seattle

Friday’s Game Iowa at Cleveland, 6:30 p.m. Saturday’s Games Utah at Rush, 7 p.m. New Orleans at Philadelphia, 6:05 p.m. Orlando at Tampa Bay, 6:30 p.m. Arizona at San Antonio, 7:30 p.m. Jacksonville at Spokane, 9 p.m. Pittsburgh at San Jose, 9:30 p.m.

Saturday Rice at North Carolina State, 3 p.m. Sunday x-Rice at North Carolina State, 3 p.m. At Alex Box Stadium Baton Rouge, La. Friday Oklahoma (43-19) at LSU (55-9), 6 p.m. Saturday Oklahoma at LSU, 6 p.m. Sunday x-Oklahoma at LSU, 6 p.m. At Goodwin Field Fullerton, Calif. Friday UCLA (42-17) at Cal St.-Fullerton (51-8), 6 p.m. Saturday UCLA at Cal St.-Fullerton, 9 p.m. Sunday x-UCLA at Cal St.-Fullerton, 9 p.m. At Dick Howser Stadium Tallahassee, Fla. Saturday Indiana (46-14) at Florida State (4715), 11 a.m. Sunday Indiana at Florida State, Noon Monday x-Indiana at Florida State, Noon At Hawkins Field Nashville, Tenn. Saturday Louisville (49-12) at Vanderbilt (54-10), 2 p.m. Sunday Louisville at Vanderbilt, 3 p.m. Monday, June 10 x-Louisville at Vanderbilt, 6 p.m. At Davenport Field Charlottesville, Va. Saturday Mississippi State (46-18) at Virginia (47-10), Noon Sunday Mississippi State at Virginia, 6 p.m. Monday, June 10 x-Mississippi State at Virginia, 3 p.m. At Goss Stadium Corvallis, Ore. Saturday Kansas State (44-17) at Oregon State (48-10), 6 p.m. Sunday Kansas State at Oregon State, 9 p.m. Monday x-Kansas State at Oregon State, 6 p.m.

COMMUNITY BASKETBALL

SOCCER

CLBA/FVBA LEAGUE

CARY-GROVE SOCCER CAMPS

Beginning this December through March, CLBA/FVBA will have a basketball league for kindergarten thru high school boys and girls. The season will consist of five practices and 10 games. Each team will consist of only eight players per team, so everybody will receive a lot of playing time. This is a recreational league for all kids to play no matter what skill level. All practices and games will be Fridays, Saturdays, and Sundays. CLBA/FVBA will stress fundamentals of the game, teaching skills, good sportsmanship, team play and fun, fun, fun. Games will be played in local gyms around Crystal Lake, Lake in the Hills and McHenry. Registration will take place June 15 from 11 a.m. to 3 p.m. at Home State Bank, 611 S Main Street, in Crystal Lake. A $10 discount is being applied from May 15 through June 15. Cost with discount is $150 for kindergarten through second grade, $160 for third through eighth grade and $170 for ninth through 12th grade. We are offering a $10 discount for the second child and a $15 discount for the third child. You can also use the three-payment plan to pay. You can register online at www.clhoops.com starting. There is a $4 service charge for registering online. CLBA/FVBA is also in need of board members, coaches, referees and scorekeepers. Referees and scorekeepers are paid positions, and you must be 14 or older to apply. If you are interested in any of the above positions please signup at registration or email. If you have any questions about the league email Bob McIntyre at bigbobbball@ aol.com or call 847-639-8050.

Cary-Grove High School is hosting its annual youth soccer camp June 10-14 at the school. This camp is open to all students entering first through eighth grade in the fall. The camp is designed to improve the skills of all players from beginners to recreation and travel-team levels in a positive, fun and challening environment. The camp is led by the boys and girls coaching staffs at Cary-Grove High School. The cost to register is $45 before June 10 and $50 to register the day of camp. This fee includes a camp T-shirt. Registration forms are available online at d155.org/cg/ under the camps section on the links page under the athletics tab and at the first day of camp. If you have any questions, please contact coach Mark Olson at 847-639-6535 or Bob Slatter at 815-382-0413.

WRESTLING BLANTON AT CYCLONES’ CAMP The Woodstock Cyclones Wrestling Club will host a camp June 26 to 28 at Woodstock North. Camp clinicians will be Jordan Blanton and NIU associate coach Mark Perry. Grades kindergarten to fifth will be from 8 to 9:30 a.m. Grades six to 12 will run from 10 a.m. to noon. The cost is $50 and includes a camp t-shirt if registered before June 14. For information, contact camp director Tim Creighton at 815-482-4223 or coach. creighton@woodstockcyclones.com.


PRO FOOTBALL

Page C6 • Wednesday, June 5, 2013

Northwest Herald / NWHerald.com

BEARS

Marshall back on field after hip surgery WR expects to be 100 percent for camp The ASSOCIATED PRESS LAKE FOREST – Bears wide receiver Brandon Marshall returned to practice Tuesday for the first time since undergoing January hip surgery, saying he expects to be 100 percent for the start of training camp in late July. Marshall had his third hip surgery in four years, an arthroscopic procedure, after a season in which he set franchise records for catches (118) and receiving yards (1,508). “It’s been affecting me for two years,” Marshall said. “It was one of those things where I thought maybe it was just some training or some strength problems or some flexibility problems. But when we went in there they saw a little something and cleaned it up. It was one of those things where after a lot of pounding it tightened up on me, got a little weak. So now I’m just thankful that we caught it in time and

cleaned it out.” Marshall did not go through a full practice but did individual drills and some noncontact scrimmage work in the final week of Bears organized team activities. He will gradually work his way back and will likely not go all out next week when the Bears have a mandatory full-squad minicamp. “He’s got full medical clearance,” general manager Phil Emery said. “Obviously, he was catching the ball well, he looked good with his feet and his routes. And as we build toward veteran minicamp next week it will be exciting to see him get more reps as he goes.” Marshall said his hips will have to be monitored after he leaves the game because of the amount of wear and tear he’s taken. “It’s one of those things where probably when I’m done (playing) it’s going to be one of those things where I’m going to have to stay on it,” Marshall

said of his long-term health. “But it’s a scope. I’m excited that’s all it is. I have to be smart, continue just to rehab throughout the season and throughout the rest of my career. But I’m just thankful that we caught it and it’s in a place where it’s a nonweight-bearing part of the bone. That’s good.” The eight-year veteran admitted he may not have been healthy all last year when he caught 11 touchdown passes and was reunited with quarterback Jay Cutler, who threw to him his first three seasons with Denver. “I’m excited to see what I can do fully healthy and also there are some little things that I’ve been watching on film of myself,” he said. “Every year you get smarter, you get better, and I think being healthy and a little bit smarter this year, it’s going to be a AP photo productive year for me helping Bears wide receiver Brandon Marshall catches a pass during practice Tuesday in Lake Forest. Marshall the offense out.” returned to the field after his rehabilitation from hip surgery.

DAVID ‘DEACON’ JONES: 1938-2013

Leader of ‘Fearsome Foursome’ coined term ‘sack’ By BARRY WILNER The Associated Press His nickname belied his calling. David “Deacon” Jones was the most feared member of the Fearsome Foursome, the original sackmaster. Reggie White, Bruce Smith, Lawrence Taylor – they all followed the lead set by Jones, who died Monday at 74. “Deacon Jones was one of the greatest players in NFL history. Off the field, he was a true giant,” said Redskins AP file photo general manager Bruce Allen, Former Rams defensive end David whose father, George, coached “Deacon” Jones, shown in 2009, Jones with the Los Angeles Rams. “His passion and spirit died Monday. He was 74.

will continue to inspire those who knew him. He was a cherished member of the Allen family and I will always consider him my big brother.” Not only was Jones the main practitioner of the sack in his 14 pro seasons, he coined the term. He once compared bringing down quarterbacks to hog-tying them in a sack. He was smiling when he said it. Yet Jones never got the statistical credit for all those QB knockdowns; sacks didn’t become an official statistic in the NFL until 1982. Jones retired after the 1974 season, having played

11 years with the Rams, two with the Chargers and one with the Redskins. Rams stats show Jones with 159½ sacks for them and 173½ for his career – all unofficial, of course. Jones also was one of the most durable players, missing just five games in his pro career. He entered the Pro Football Hall of Fame in 1980. “He was an icon among the icons,” NFK commissioner Roger Goodell said. “Even with his fellow Hall of Famers, Deacon Jones held a special status. He was a hardcharging football player and the original sack artist who coined the term. He is warmly

regarded by his peers not only as one of the greatest players in NFL history, but also for his tremendous influence and sense of humor.” Jones was held in such high esteem that when he made the league’s 75th anniversary alltime squad, it prompted former teammate and fellow Hall of Famer Jack Youngblood to say: “Deacon Jones has been the most inspirational person in my football career.” That sort of praise was typical for Jones, the anchor of the Fearsome Foursome. Jones made the Pro Bowl every year from 1964-70 and played in eight overall. He combined

with Hall of Famer Merlin Olsen, Rosey Grier and Lamar Lundy on a defensive line that at times was unblockable. Olsen died in 2010 at 69 and Lundy died in 2007 at 71. Grier, 80, is the only surviving member of the Fearsome Foursome. George Allen, who coached the Fearsome Foursome, called Jones the “greatest defensive end of modern football.” The Allen family had Jones present George Allen for his Hall of Fame induction in 2002, yet another example of the regard in which Jones was held.


! ! !

CHEF DEBI

Section D June 5, 2013 Northwest Herald

Page D3

ENTREES • DESSERTS • SOUPS • WINES • BREADS • APPETIZERS • SALADS • GRILLING

!

My recipe for healthy, gluten-free Cashew Chicken makes a great weeknight dinner in no time.

!

!!

!

PlanitNorthwest.com

The Caribbean inspires grilled shrimp salad Rum-spiked marmalade adds flavor to simple summer meal By ALISON LADMAN The Associated Press Caribbean flavors jazz up this simple supper salad. We glaze the shrimp with a zesty rum-spiked marmalade, then toss them on a hot grill with tomatoes and corn before combining everything with a few more veggies. We serve the whole thing with grilled bread seasoned with garlic and orange for a bit of crunch and to aid in scooping up all the delicious bits.

Caribbean Grilled Shrimp Start to finish: 35 minutes Servings: 4

AP photo

in a

glass

Perfecting the careless art of a summer cocktail

By J.M. HIRSCH • The Associated Press

Start to finish: 5 minutes Servings: 1 1 1/2 cups watermelon chunks 1/2 cup ice 1 1/2 ounces vodka 1 ounce lemon juice 1 ounce honey or simple syrup Pinch salt

Heat a grill to medium-high. In a small bowl, stir together the marmalade, brown sugar, 1

Find a recipe for Grilled Greek Chicken Salad and a new take on margaritas. Page D2

teaspoon of salt, the lime zest, rum, coriander and red pepper flakes. Add the shrimp, stirring to thoroughly coat. Arrange the corn and tomatoes on a rimmed baking sheet and drizzle with olive oil. Sprinkle with salt and black pepper. In a small bowl, stir together the garlic, orange zest and 2 tablespoons of olive oil. Brush over both sides of each slice of baguette. Arrange the shrimp, ears of corn, and tomatoes on the grill and cook until the shrimp are cooked through and pink and the corn and tomatoes are beginning to char. Add the baguette slices and grill until lightly charred. Transfer to a platter and allow to cool slightly. Meanwhile, in a large bowl, toss together the jicama, avocado and lime juice. Slice the corn kernels off the cobs. To do this, one at a time stand each ear on its wide end and use a knife to saw down length of the cob. Add the kernels to the jicama-avocado mixture. Add the tomatoes, shrimp and cilantro. Stir gently. Crumble the goat cheese over the top and serve with the toasted bread.

Nutrition information per serving: 700 calories; 220 calories from fat (31 percent of total calories); 25 g fat (7 g saturated; 0 g trans fats); 185 mg cholesterol; 81 g carbohydrate; 15 g fiber; 19 g sugar; 41 g protein; 1,190 mg sodium.

Combine all ingredients in a blender and blend until very smooth and frothy. Pour into a large, heavy glass and serve immediately.

Trashy Red Wine Sangria Start to finish: 5 minutes Servings: 1 1 to 2 slices orange 2 tablespoons lime juice 1 to 2 tablespoons sugar 4 ounces red wine Ice Seltzer water (optional)

The art of the summer cocktail is something I take most seriously. Pisco Sour Because several years ago, I realized Start to finish: 5 minutes what surely is obvious to most people. ... In a large, heavy glass, combine the orange Servings: 1 But I can be a bit slow. Summer is better slices, lime juice and sugar. Gently muddle, with a signature cocktail. Not a fancy then add the wine and enough ice to mostly 2 1/2 ounces pisco dinner cocktail. Not a party cocktail. fill the glass. Stir. If desired, top with a 1 1/2 ounces lime juice And certainly nothing that anyone who splash of seltzer for bubbles. 1 1/2 ounces simple syrup goes by the title “mixologist” ever would 1 1/2 tablespoons egg white deign to make. 1/2 cup ice I’m talking about an everyday cocktail, something that can be thrown toGin And Bitter Combine all ingredients in a blender and gether after work or a day of swimming, Lemon blend until very smooth and frothy. Pour into then casually sipped – or even slurped Start to finish: 5 minutes a large, heavy glass and serve immediately. – while standing at the grill or sitting by Servings: 1 the pool or dock. A good summer cocktail must be simple 1 to 2 slices lemon to assemble, and preferably from memory. It 1 teaspoon sugar must be sweet and refreshing, but not cloying. It should have a crisp1 1/2 ounces gin ness. It should welcome ice and not suffer noticeably as the ice melts. Ice And it must be versatile enough to go with whatever is on the dinner Bitter lemon tonic menu. Fresh mint, to garnish Each summer, I seem to discover a new cocktail, which then becomes my summer cocktail for the remainder of the season. A few In a medium, heavy glass, combine the years back, it was my trashy sangria, which I could slosh together lemon slices and sugar. Gently muddle, then in under a minute. The summer after that it was my vodka wateradd the gin and enough ice to mostly fill the melon chiller. Is there anything more refreshing than watermelon in glass. Top with bitter lemon tonic, then stir August? And last year I discovered the magic that is gin and bitter and garnish with fresh mint. lemon. It’s heaven in the end-of-day sun. This year, it will be the pisco sour. Pisco is a South American brandy that has a clean, mildly sweet flavor. Think frozen margarita, but so much better.

Caribbean Grilled Shrimp AP photo

Where Great Gardens Begin…

Summer

Vodka Watermelon Slushie

2 tablespoons orange marmalade 1 tablespoon packed dark brown sugar Kosher salt Zest of 1 lime 1 tablespoon dark rum 1 teaspoon ground coriander 1/2 teaspoon red pepper flakes 1 pound raw large shrimp, peeled 2 ears corn, husked 10-ounce container cocktail (small) tomatoes Olive oil Ground black pepper 1 clove garlic, minced Zest of 1 orange 8 slices of baguette 1 medium jicama, peeled and diced 1 avocado, pitted, peeled and diced Juice of 2 limes 1 bunch cilantro, leaves and stems, roughly chopped 4 ounces soft goat cheese

Inside

Invincibelle Spirit Hydrangea

MARK YOUR CALENDAR!

FREE SEMINARS! Saturday, June 15 9:30 11:30 1:00 2:30

Miniature Gardening Cooking with Herbs Adding Color with Annuals Best Ornamental and Shade Trees for Northern Illinois

Let us know you are coming to be entered into our prize drawing!

For big, beautiful dark pink blooms fading to a soft, dusty pink - add Inivincibelle Spirit Hydrangeas to your landscape! All Sizes

25% OFF!

Countryside Flower Shop, Nursery & Garden Center 5301 E. Terra Cotta Avenue (Rt. 176) • CRYSTAL LAKE • 815.459.8130

www.countrysideflowershop.com Open Daily 9-8, Saturday & Sunday 9-6


TASTE Page D2 • Wednesday, June 5, 2013

PlanitNorthwest/PlanitNorthwest.com

Have it your way Grilled Greek Chicken Salad is made to be flexible By J.M. HIRSCH The Associated Press Salad recipes that have fussy lists of ingredients generally irritate me. I don’t doubt they are delicious, nor that assembling them just so with just the right blend of flavors and textures makes for a transformative salad experience. It’s simply that my life doesn’t allow for such fuss. To me, the very nature of a salad should be that it brings together whatever is fresh and delicious and marries it all with some oil and acid. Particulars beyond that don’t much matter. So I give you my recipe for grilled Greek salad. I use the term “recipe” loosely, for you should use this merely as inspiration, a guide for making good salad choices. Substitute, modify, amplify. The chicken, for example, is easily replaced with thinly sliced steak. Or turkey tenderloin. Or small cubes of lamb. Or salmon. Don’t have Boston lettuce? Use anything frilly and green. Or even something not so frilly. Heck, use a bed of finely chopped steamed and cooled broccoli if that’s what you have. And substitute at will for the veggies I call for. I like them grilled, but don’t feel compelled. Want something bready? Grill some and add as croutons. My only request? Don’t use bottled dressing. Make it. Homemade vinaigrette tastes better, is better for you, and makes you a better person. And use your hands when dressing the greens with it. You’ll get much better coverage, making for a much better salad.

By MICHELLE LOCKE The Associated Press

Grilled Greek Chicken Salad AP photo

Grilled Greek Chicken Salad Start to finish: 45 minutes Servings: 4 1/4 cup olive oil Juice of 1 lemon 2 cloves garlic, minced 2 tablespoons chopped fresh oregano Kosher salt and ground black pepper 1 1/3 pounds boneless, skinless chicken breasts, cut into thin strips 2 large red bell peppers, cored and cut into 1/2-inch strips 2 ears corn, husked 2 heads Boston lettuce, roughly

chopped 1/2 small red onion, diced 2 tablespoons finely chopped fresh mint 1/2 cup crumbled feta cheese Heat a grill to high. In a large bowl, combine the olive oil, lemon juice, garlic, oregano, 1/2 teaspoon salt and a generous amount of pepper. Whisk well. Transfer 2 tablespoons of the dressing to a medium bowl. Add the chicken to the smaller bowl, toss well to coat, then set aside. Place the bell peppers in the larger bowl and toss to coat with the remaining dressing, then

transfer the peppers to a plate. Roll the ears of corn in the dressing, then set them on the plate with the peppers. Set the peppers and corn on the grill. Lower the heat to medium and cook, turning often, until lightly seared and the peppers just start to turn tender, about 3 to 6 minutes. Return to the plate and set aside. Add the chicken to the grill and cook for 4 minutes per side. Transfer to the plate with the vegetables. Add the lettuce to the large bowl and use your hands to toss it with the dressing, carefully coating each leaf with the vinaigrette. Divide the greens between 4 serving plates,

then top each with some of the peppers and chicken. Divide the red onion and mint between the plates. Stand each ear of corn on its wide end then cut off the kernels by sawing a knife carefully down the sides. Divide the kernels between the salads, then top with feta cheese. Serve immediately.

Nutrition information per serving: 430 calories; 190 calories from fat (44 percent of total calories); 21 g fat (5 g saturated; 0 g trans fats); 105 mg cholesterol; 20 g carbohydrate; 4 g fiber; 8 g sugar; 42 g protein; 560 mg sodium.

Rum plays up – and ignores – its roots By JENNIFER KAY The Associated Press MIAMI – When you’re talking about rum, how much does the Caribbean really matter? For the rum world, it’s a more serious question than it sounds, and the answer exposes a schism in the industry, a divide between massive producers who value uniformity in a global market and smaller players and connoisseurs who prefer nuanced production that reflects the time and place a rum is made. A walk down the rum aisle of a liquor store sees this played out. While major companies like Pernod Ricard might acknowledge its Malibu is a “Carribean rum” and has notes of coconut flavor, you won’t find specifics beyond that. Likewise, Diageo’s Captain Morgan doesn’t indicate which island port its jaunty pirate logo calls home. That’s because the largest liquor companies have realized it’s not critical to promote their rums’ origins in their global branding, said Arun Sharma, professor of marketing at the University of Miami School of Business Administration. That allows them flexibil-

Molecular mixologists raise the bar

Just as we wouldn’t lump together all red wines, we also shouldn’t treat all rums alike. A growing awareness of the differences in regional rums – not to mention variances in how they are produced – opens new opportunities for appreciating each in its own way. And when it comes to cocktails, that opens fun and delicious possibilities for highlighting the nuances of each. To get you started on an exploration of different styles of rum, we created cocktails built around a Cuban-style rum, a blended aged rum, and a vanilla rum.

Rum Revival Start to finish: 10 minutes Servings: 1 1 ounce Cuban-style rum

ity to produce their spirits where they need to meet demand on the mass market. “The brand is more important than where it’s produced,” Sharma said. At Bacardi, which sells more than 18 million cases of rum worldwide each year, consistency and quality are paramount, even as it expands its offerings of

1 ounce orange liqueur 1 ounce lemon juice 1 ounce Lillet Blanc Orange or lemon twist In a cocktail shaker filled with ice, combine the rum, orange liqueur, lemon juice and Lillet Blanc. Shake until well chilled, then strain into a cocktail glass and garnish with an orange or lemon twist.

Rum Sizzle Start to finish: 10 minutes Servings: 1

In a cocktail shaker filled with ice, combine all ingredients and shake well. Strain into an icefilled highball glass, then garnish with fruit.

Golden Mojito Start to finish: 10 minutes Servings: 1 1 teaspoon sugar 1 sprig fresh mint, plus more to garnish 2 ounces vanilla distilled rum 1 ounce freshly squeezed lime juice Club soda or seltzer water

2 ounces blended aged rum (such as Ron Zacapa Solera Gran Reserva) 2 ounces orange juice 2 ounces pineapple juice 1/2 teaspoon orange bitters 1/2 ounce grenadine Dash of hot sauce Fresh pineapple or mango, to garnish

In a cocktail shaker, muddle the sugar and mint sprig. Add the rum and lime juice, then shake until the sugar is dissolved. Strain into a double old fashioned filled with ice, then top off with club soda. Garnish with another sprig of fresh mint.

flavored, spiced and premium rums. “Our marketing approach and advertising hasn’t really focused on the Caribbean. ... It’s a lifestyle. It’s a way of life,” Bacardi brand master David Cid said. Except that rums can vary greatly based on where and how they are produced,

something aficionados have long known and smaller producers have begun promoting as a way to distinguish themselves. Cuba and Puerto Rico have lighter, more delicate rums; Jamaica veers to the full-bodied, darker liquors; and Haiti is known for the cognac-like flavor of its Rhum Barbancourt.

Bartender Tony Conigliaro’s new beverage book is called “The Cocktail Lab,” and he’s not speaking figuratively. Among the equipment at his London-based Drink Factory consulting business are a centrifuge (the better to filter macerated liquids), a cold smoker and smoke gun (for smoking garnishes as well as syrup ingredients), and a refractometer to measure exact alcohol levels. Not quite your standard issue bar gear. And an ordinary day in the lab “can involve thermo-mixing, sous-viding, dehydrating – even stripping bark from trees,” Conigliaro writes in the introduction to the book, due out in July. Conigliaro, a renowned British bartender, is a pioneer in so-called molecular mixology, but he’s got a lot of company these days as more bartenders on both sides of the Atlantic work on elevating the art of the cocktail into a science. “All of the regular tools of molecular cooking are in play: they’re Cryovacing (putting in vacuum-sealed packaging) and slow cooking ingredients, smoke-infusing liquors, carbonating drinks, barrel-aging cocktails, centrifuging juices to get clear liquids, infusing liquors with unexpected ingredients, and using rotary evaporators to get strongly flavored distillates,” said Erica Duecy, cocktail historian and author of the upcoming book “Storied Sips.” “The high-end bar has become as devoted to this equipment and these techniques as the kitchen.” For Conigliaro, molecular mixology started with people asking questions. “And the more questions people asked, you kind of got to points where the only places where you could find the answers were either in the chemistry of food or the science of how it works,” he said. “For years and years, all we’ve ever had is recipes passed down, and you get shown how to make them and shown what they should be like and how they should taste, but it was scratching below the surface of that and seeing what was actually going on that really proved to be of interest for us.” The best of the new breed of drinks look like regular cocktails but “taste like nothing you’ve tried before,” Duecy said. Bartenders like Dave Arnold at Booker & Dax in New York are developing new techniques like nitromuddling (flash-freezing fresh herbs with liquid nitrogen, then crushing them into a powder and incorporating it into the cocktail). What you get – intense herb flavor. What you don’t get – herbs stuck in your teeth. Still, while gadgetry can produce new flavors, it takes a skilled bartender to balance those flavors. Conigliaro may create his cocktails in a lab-like setting,

Mix it up Want to up your home bartending game? Here are some tips. Duecy: Make sure you’re using top quality ingredients, i.e., no shriveled limes. Try infusing liquors or wines with fruit, herbs and even vegetables. Start with vodka until you get familiar with the length of time and results you’ll get from certain ingredients. To a vodka-filled jam jar, just drop in some ingredients, and leave the infusion on the counter. Try spices (cardamom, black pepper, horseradish), fruit (pineapple, lemon peel, berries), and vegetables (beets, celery). Conigliaro: Source your ingredients well. Look at not just what you find on the supermarket shelf, but go that little bit further and find those spirits and cordials. Compare one gin to another. Compare your Beefeater to your Tanqueray and see how the drink works and make choices off the back of that. That’s how you really kind of understand how things work.

but he serves them in an atmosphere that’s anything but clinical. The menu at his Bar 69 in Islington, North London, has just 12 cocktails, three wines and Champagnes, and one beer. The gee-whiz techniques are generally out of sight, though customers who want to know what went into a drink are welcome to ask. Conigliaro rather likes the idea, he writes in “Cocktail Lab,” that “the rest will contentedly sip on a Bloody Mary, blissfully unaware that it took two years to perfect each individual component of their drink.”

Sweet Broiled Lemon Margarita Start to finish: 25 minutes Servings: 1 5 Sicilian lemons Sugar Ice cubes 1 1/2 ounces reposado tequila 2/3 ounce triple sec liqueur Heat the oven to broil. Slice the lemons in half, then arrange cut side up on a rimmed baking sheet. Broil at the center of the oven for about 10 minutes, or until the lemons are golden brown. Set aside until cool enough to handle, then juice the lemons into a bowl or 2-cup liquid measuring container. Using a mesh strainer lined with cheesecloth, strain the lemon juice into a blender. Blend for four 25-second bursts. Set aside. Sprinkle a few tablespoons of sugar on a small plate. Use one of the squeezed lemon rinds to moisten the rim of a coupette or other suitable glass for a margarita. Overturn the glass into the sugar and gently move around to coat the rim. Refrigerate the glass until ready to fill. To prepare the cocktail, in cocktail shaker filled with ice, combine the tequila, 3/4 ounce of the broiled lemon juice and the triple sec. Shake well, then strain into the prepared glass.

Recipe adapted from Tony Conigliaro’s “The Cocktail Lab,” Ten Speed Press, 2013

Sweet Broiled Lemon Margarita

AP photo


TASTE

PLANITNORTHWEST / PlanitNorthwest.com

Wednesday, June 5, 2013 • Page D3

Cashew chicken capitalizes on nut’s health benefits This recipe is healthy, fast and gluten-free. It is a great weeknight dinner, and a creative way to shake up a routine of serving the same chicken dishes. Cashews are considered one of the world’s healthiest foods, an 1-ounce serving of cashews provides 20 percent of your daily recommended value of magnesium, 30 percent of copper, 10 percent of zinc and 10 percent of vitamin E. To learn about the health benefits of cashews, visit www.nutrition-and-you.com/ cashew_nut.

Cashew Chicken 1 1/2 pounds boneless, skinless chicken breasts, cut into 1-inch cubes 1 tablespoon cornstarch 3/4 teaspoon salt 1/4 teaspoon pepper 3/4 cup raw cashews (4 ounces), 2 tablespoons vegetable oil, such as safflower 6 cloves garlic, minced 8 scallions, white and green parts separated, each cut into 1-inch pieces 2 carrots, thinly sliced 1 1/2 cup snow peas, rinsed 1 8-ounce can sliced water chestnuts 2 tablespoons rice vinegar

THE PERSONAL CHEF Debi Stuckwisch

Cashew Chicken

3 tablespoons hoisin sauce 1 cup organic chicken broth Brown rice, for serving (optional) In a medium bowl, toss chicken with cornstarch until it is coated. Season with 3/4 teaspoon salt and 1/4 teaspoon pepper. Pre-heat the oven to 350 degrees F. Place cashews in a single layer in a baking pan for about 5 to 8 minutes. Set aside to cool. In a large nonstick skillet, heat 1 tablespoon of oil over medium-high heat. Cook half the chicken, tossing often, until browned, about 3 minutes. Transfer to a plate. Add remaining oil and chicken to skillet along with the garlic and white parts of scallions, carrots, snow peas and water chestnuts. Cook, tossing often, until chicken is browned, about 3 minutes. Return first batch of chicken to pan. Add vinegar and cook until evaporated, about 30 seconds. Add hoisin sauce and 1 cup of chicken broth. Cook, tossing, until chicken is cooked through, about 1 minute. Remove from heat. Stir in scallion greens and cashews. Serve immediately over brown rice.

Photo provided

Wide rice noodles, broccoli pesto are light combination for spring By JOE YONAN The Washington Post I’ve been trying to break out of a rut, looking for ideas that speak of spring. I found something that fills the bill in the new cookbook “Meatless: More Than 200 of the Very Best Vegetarian Recipes,” by the kitchens of Martha Stewart Living (Clarkson Potter). The broccoli becomes a pesto of sorts –

one without cheese and with less basil than usual. The recipe uses wide rice noodles instead of pasta, a choice that adds even more lightness and also makes the dish gluten-free.

Rice Noodles With Broccoli Pesto 4 servings Salt 1 head broccoli (about 1 pound)

1/3 cup sliced toasted almonds, plus more for garnish 1/4 cup packed fresh basil leaves, plus several small leaves for garnish 1 clove garlic, chopped 2 tablespoons fresh lemon juice 1/3 cup extra-virgin olive oil Freshly ground black pepper 8 ounces medium rice noodles Bring a large pot of salted water to a boil over high heat. Cut the broccoli into florets and

Caring Family,SC

Todd S Giese, MD George B Gancayco, MD

thinly slice the stems (no peeling needed). Add the florets and stems to the water; cook until bright green and barely tender, about 2 minutes. Use a slotted spoon to transfer the broccoli to a bowl, reserving the cooking water for the rice noodles. Season the vegetable with salt and let it cool slightly. Coarsely chop 1 cup of the blanched florets. Add the remaining florets and stems to the bowl of a food processor along with the almonds, basil, garlic, lemon

Discover the

juice and olive oil. Puree to form a smooth pesto. Season with salt and pepper to taste. Return the cooking water to a boil. Add the rice noodles and cook according to the package directions. Reserve 1 cup of the cooking water, then drain the noodles, rinse them in cold water, and return them to the pot (off the heat). Toss with the pesto to coat evenly, adding enough of the reserved water to create a creamy sauce. Divide among individual bowls;

top each portion with the reserved chopped broccoli florets, small basil leaves and sliced almonds. Grind pepper on top and serve. NOTE: Toast the almonds in a small dry skillet over medium-low heat until lightly browned and fragrant. Cool before using.

Nutrition per serving: 450 calories, 7 g protein, 57 g carbohydrates, 23 g fat, 3 g saturated fat, 0 mg cholesterol, 140 mg sodium, 5 g dietary fiber, 2 g sugar.

OPEN to the PUBLIC No Membership Fee

Best Bargains at 6515-352nd Ave, New Munster, WI 262-537-4407

Visit us at: www.bestbargainsinc.com

Hours: Mon- Fri 9-5, Wed 9-6, Sat 8-4, Sun 9-4

Visit Our Cash & Carry Outlet Highway 50 & KD, 8 miles east of Lake Geneva

Check Our Website For Special Restaurant And Tavern League Member Specials

Wholesale Food Service • Bar & Restaurant Distribution • Or Stock Your Pantry

SALE DATES: Wed., June 5th - Tues., June 11th 2013 Supplies Limited No Rain Checks

Deli

Pizza/Pasta

Rosemary Sage/Black Pepper/Italian

Racquel N Ramirez, MD faith based private practice Jamie TM doctors you can trust Gancayco, MD Board Certified Medical Care for the Whole Family since 1988 815-459-2200 by appointment 815-459-220 0 learn more on our web site at www.caringfamilysc.com

Sliced Flavored Turkey ........................... $1.79lb RAY’S BEAT HIS MEAT SPECIALS Sirloin Steaks Select .............................. $3.99lb NY Strip Select ........................................ $5.89lb T-Bone Choice ......................................... $6.49lb Porterhouse Choice ................................ $6.99lb

Appetizers Texas Toothpicks ................................ 2lb $5.00 Spicy Breaded Mushrms.................... 2lb $2.95 Battered Sweet Corn Nuggets........... 2lb $4.25

Chicken Dutch Breaded Chicken Tenders .... 5lb $16.95 Chicken Breast................ 5lb $7.50 Tyson Natural Wings ..... 40oz $4.98

Seafood Shark Steaks ........................................... $4.25lb Battered Scallops ................................... $3.49lb Snapper .................................................... $7.50lb Haddock Fillets ....................................... $3.75lb

Beef/Pork

• Low in Cholesterol WHY • Heart Healthy BUFFALO? • Never Tasted Soooo Good! See Us at GRAYSL the AKE MARK WEDNESET DAY 3-7

Make it a GREAT Father’s Day with bison burgers, brats, hot dogs, pork ribs, and pyrimid cut ribs. COME SEE US AT LESTER’S COUNTRY STORE ON THE RANCH AND VISIT THE BUFFALO STORE HOURS: MONDAY - FRIDAY 9 A.M. - 4 P.M. • SATURDAY - SUNDAY 10 A.M. - 4 P.M.

JUST

(847) 343-8240 OR (262) 537-3779 31807 60TH ST., SALEM, WISCONSIN 53168-9557 EAST OF HWY. W ON HWY K (60TH ST.) NORTH OF HWY. 50 WWW.LESTERSBISONFARM.COM

We also ship directly to your door

Cole Slaw, Potato Salads and Mac Salad 2.5lb tubs

3

$

75

with coupon • limit 6 Retail $5.25

6/5/13-6/11/13

BUFFALO HERD ESTABLISHED 1973

Pulled Pork w/ Sauce.... 5lb $8.95 4 Cheese Meatballs ...... 24oz $3.49 Seasoned St. Louis Spareribs ........... 5lb $9.95 Ball Park Franks...................... 10lb 60ct $11.90

Halftime Hand Made Pizzas.............each Cheese Tortellini ................................. 5lb Veal Ravioli ..................... 3lb Beef Ravioli ................ 25oz

$4.99 $9.50 $7.99 $1.99

Potatoes/Veggies Frozen Veggies ................................. 16oz Potatoes O’Brien ............................. 28oz Potato Skin Shells............................ 32oz Hash Brown Patties .......................... 10ct

$1.25 $1.99 $2.50 $1.49

Desserts Dulce de Leche Cheesecake ........ 36oz $11.00 Wa Wall of Chocolate Cake . 10lb $7.95 Banana Cre’me Pies ............ $3.50 Eli’s Mini Pies ............... 16ct $1.99

Dry/Miscellaneous Cascade Dishwasher Tabs ............60ct $12.99 Sliced Pineapple ........................10oz can $4.95 Peach Slices ...............................10oz can $5.75 Sport Peppers .................................... 1gal $6.50

Squeeeeeky Steve’s Deals!!! Munch Box Breaded Spicy Cheese Nuggets...............................6/2lb $17.95 Breaded Preformed Onion Rings ... 8/2lb $9.95 Clear Coated Waffle Fry .............6/4.5lb $13.95 5/16 Peel on Fry .............................6/6lb $13.50

Kraft American Singles 12oz

2

$

29

with coupon • limit 2 Prepriced $2.99

6/5/13-6/11/13

We have everything you need for your graduation party!

MEAT RAFFLE HEADQUARTERS Specializing in custom cuts. Contact Ray in the meat department at 262-537-2991 or 262-215-1330 Monday Only!!

Tuesday Bargain Bucks

For every $100 purchase we will give you $10 in Mad Money to spend another day.

For every $100 purchase you will receive $10 in Bargain Bucks to spend another day.

Limit 5 per day. Cannot be combined with other offers.

Limit 5 per day. Cannot be combined with other offers.

Checks Accepted • ATM Available We reserve the right to limit or correct printing errors.

Wednesday Senior Discount Day Discount for private parties only, excludes businesses.

www.BestBargainsInc.com

Thursdays Only! Double manufacturer coupons. Pick up your free ticket at the Deli for Friday’s meat raffle drawing. Maximum $1.00 coupon. 10 coupon limit. We Accept the SNAP CARD and Manufacturers Coupons (Excluding internet coupons.)


COMICS

Page D4 • Wednesday, June 5, 2013

Pickles

Brian Crane Pearls Before Swine

For Better or For Worse

Non Sequitur

PlanitNorthwest/PlanitNorthwest.com

Stephan Pastis

Lynn Johnston Crankshaft

Tom Batiuk & Chuck Hayes

Wiley The Duplex

Glenn McCoy

Beetle Bailey

Mort Walker Blondie

Dean Young & Denis LeBrun

Frank & Ernest

Bob Thaves Dilbert

Scott Adams

Monty

Jim Meddick Hi and Lois

Rose is Rose

Pat Brady & Don Wimmer Arlo & Janis

Soup to Nutz

The Family Circus

Rick Stromoski Big Nate

Bill Keane

The Argyle Sweater

Scott Hilburn

Stone Soup

Grizzwells

Brian & Greg Walker

Jimmy Johnson

Lincoln Pierce

Jan Eliot

Bill Schorr


TASTE PlanitNorthwest/PlanitNorthwest.com

Wednesday, June 5, 2013 • Page D5

Son experiencing puberty needs a word to the wise Dear Abby: I’m a single mother of two amazing boys, 16 and 12. While my older son has been private about coming into puberty, my younger son is very open about it, and we have had many conversations about it. Abby, I’ll be honest. The subject makes me uncomfortable. Last night, I walked into my 12-year-old’s room and interrupted him pleasuring himself. I was shocked, and I started to laugh because I was embarrassed. I did tell him he needed to be more private about his curiosity, to close the door and have a blanket over himself. But I was laughing when I was talking to him

for his privacy. So: Apologize to your son for laughing. Explain it was because you were embarrassed. If your children’s father is in the picture (or another male relative), a man-to-man talk about this could be helpful. If there isn’t one, consult your sons’ pediatrician for suggestions on how to discuss sexuality with both of your boys. If you haven’t already done so, the time has arrived. Dear Abby: My brother, three sisters and their husbands and children and I go to our parents’ house for holiday dinners. My youngest sister’s husband refuses to go because he doesn’t get along

DEAR ABBY Jeanne Phillips and literally could not stop. I’m unsure what is the right course of action at this point. Where do I go from here? – Embarrassed Mom Dear Embarrassed: Masturbation is natural. Every healthy, normal person has done it. It is not depraved, a crime or harmful to one’s health. Your son is now at an age when it is appropriate for Mom to knock before entering his room out of respect

with our family. (He also does not get along with his own family.) Before my youngest sister leaves, she insists on taking a plate of food home for her husband who was “unable to be there.” I feel if he doesn’t want to be with our family, he shouldn’t be allowed to have takeout. Our mother is 82, and it upsets her he doesn’t want to be there. What do you think? – Resent-

ful

Dear Resentful: If your brother-in-law can’t get along with the family, he is doing everyone a favor by not attending those family dinners. Because your mother

finds his absence upsetting, it is up to her to put her foot down and tell your sister she doesn’t want food taken to him. Until she does, food deliveries will continue. Dear Abby: I, too, am disgusted with people who answer their cellphones wherever and whenever. I was at a funeral last week where this twit answered her cellphone while viewing the deceased in his casket. She was literally kneeling beside the casket when her phone rang, and she carried on a conversation with the caller for a full three minutes. I timed it. I know some people may

think this is funny or no big deal. I suggest that those who feel that way should learn manners. Unless you’re a doctor or some other emergency caretaker, there is no reason to take a call while in the company of others. – Mi-

chael In Rochester, N.Y. Dear Michael: I agree. When attending a funeral or a memorial, cellphones should be TURNED OFF out of respect not only for the deceased, but for the others around you.

• Write Dear Abby at www.dearabby.com or P.O. Box 69440, Los Angeles, CA 90069.

Fresh take on how to eat Exercises reduce risk of falls too many hard-boiled eggs By J.M. HIRSCH The Associated Press Hard-boiled eggs always seem to go to waste in my house. It’s my own fault. When I think to make them, it somehow strikes me as silly to go to the trouble for just two or three eggs. And since it requires no more time or effort to boil up a dozen, I usually go that route, assuming the extra will make convenient snacks and meals for the next few days. Except I quickly lose interest in them or forget about them, and they get relegated to the back of the refrigerator until they smell. When I recently found myself with an abundance of hard-boiled eggs, I decided to be proactive and come up with a way to use them up right away. The result was a delicious egg salad that I spread on slabs of toasted baguette, then topped with thin slices of smoked salmon. I used it as an appetizer, but it was hearty enough to convert into a main meal. The trick is to make the egg salad a bit in advance, even up to a day ahead. This allows the flavors in the dressing to really develop. And if you’re not a fan of smoked salmon, smoked

Egg Salad Sandwich With Smoked Salmon

AP photo

trout, smoked shrimp or even just plain cooked shrimp would be a delicious substitute.

Egg Salad Sandwich With Smoked Salmon Start to finish: 45 minutes (15 minutes active) Servings: 4 1/2 cup mayonnaise 2 tablespoons Dijon mustard 1/2 teaspoon smoked paprika 1/2 teaspoon hot sauce 1/2 cup finely chopped cornichons 1/2 cup finely chopped celery 8 hard-boiled eggs, cooled and roughly chopped Salt and ground black pepper 4 large slices sourdough bread 4-ounce package thinly sliced smoked salmon

In a medium bowl, whisk together the mayonnaise, mustard, smoked paprika and hot sauce. Stir in the cornichons and celery. Gently stir in the chopped hardboiled eggs, then season with salt and pepper. Cover and refrigerate at least 30 minutes, or up to overnight. When ready to serve, lightly toast the slices of sourdough bread. While the bread is still warm, spread a quarter of the egg salad over each slice, then top with a quarter of the smoked salmon. Serve immediately.

Nutrition information per serving: 590 calories; 190 calories from fat (32 percent of total calories); 21 g fat (4.5 g saturated; 0 g trans fats); 375 mg cholesterol; 67 g carbohydrate; 3 g fiber; 8 g sugar; 30 g protein; 1660 mg sodium.

8FOOD EVENTS CULINARY CLASSES FOR EVERYDAY COOKS, Lakeside Legacy Arts Park, 401 Country Club Road, Crystal Lake. Offered by McHenry County College Continuing Education Department. All classes are 6:30 to 9 p.m. Schedule: June 8, Knife Skills (Course ID: NCUS33006); June 15, Picnic in the Park (Course ID: NCUS82006); June 21, Date Night (Course ID: NCUS36006). Cost: $65 a class. Registration and information: 815-455-8588. SCOTCH TASTING, 6 to 8 p.m. June 13, 26 North, 26 N. Williams St., Crystal Lake. An evening of scotch sampling at 26 North, Raue Center’s new upstairs bar. Move from station to station sipping various brands provided by Cardinal Wine & Spirits. Cost:

$25 in advance. Reservations and information: 815-356-9212 or www.rauecenter.org. TASTE OF SUMMER, 1 to 5 p.m. June 8, on Riverside Drive, Green and Main streets, McHenry. Sixteen restaurants

in downtown McHenry will offer tastes of their specialty items for a minimal fee. Stores also will offer sales on all three streets. Sponsored by the McHenry Downtown Association. Information: 815-385-4300.

Dear Dr. K: In a previous column, you wrote about the importance of balance exercises as we age. But why does our balance get worse as we get older? Dear Reader: A number of changes that come with aging can affect our balance. • Inside our ears is a balance center called the vestibular system that detects where our body is in space. Are we upright or lying flat; are we standing on our feet or performing a handstand? The vestibular system is connected to centers in the brain that also control our balance. When the vestibular system and brain determine we’re about to fall over, the brain directs the body to take corrective action. Maybe we twist back upright so we don’t fall. Maybe we’re too far off center to avoid falling, so our arms and hands stretch out to brace our fall. As we age, cells in the vestibular system die off. This affects how accurately we detect our position in space. That, in turn, affects our ability to correct our position. For example, if we start to tilt to the right

ASK DR. K Dr. Anthony Komaroff

and the vestibular system doesn’t detect this quickly, it becomes harder for the brain to prevent falling to the right. • Our sight, the ability to focus and see things clearly, diminishes with age. So do depth perception, night vision and sensitivity to contrast. Eye problems can impair, blur or distort vision. The loss of these visual cues compromises balance. Corrective lenses or surgery may help. • Blood pressure can dip suddenly when you stand up, causing dizziness, lightheadedness, blurry vision, even fainting. Standing up slowly – sitting first on the side of the bed when you rise, for example – may help. • We lose a lot of muscle mass and strength as we age. We also lose power – a function of strength and speed – which affects balance, too. If you start to trip, power helps you react swiftly. Exercise can help you rebuild strength and power,

“CONGRATULATIONS” Coach JC Brown & The Prairie Ridge HS Girls Soccer Team on a GREAT Season 2nd Place in the STATE FINALS!

Get a Discount on 1 Dozen Donuts

2.00 OFF

$

One Dozen Donuts Mon - Thurs

1.00 OFF

$

One Dozen Donuts Fri - Sun AT THE CLOTHES GALLERY

One coupon for each dozen purchased. Expires June 14th, 2013.

Designer Clothing & Accessories

The Clothes Gallery 51 N. Williams Street, Crystal Lake 815.455.3307 Tues–Fri 10–5:30, Sat 10–5

181 Virginia St. | Crystal Lake | 815-455-2028

or at least slow the pace of decline. • Our reflexes and coordination slow with age. Thus, you may be more likely to stumble – and take more time to react when you do. Many health problems can interfere with balance. They include, but are not limited to, arthritis, stroke, Parkinson’s disease and multiple sclerosis. Medications also may increase your risk of falls. They can cause blurred vision, dizziness, lightheadedness and drowsiness. Some medications may damage the inner ear, spurring balance disorders. Along with regular aerobic exercise and weight training, balance exercises are important as we get older. Such exercises really can help you improve your balance. I’ve posted some of these simple exercises before, but I think it’s worthwhile to highlight them again. You can find them on my website.

• Write to Dr. Komaroff at www.askdoctork.com or Ask Doctor K, 10 Shattuck St., Second Floor, Boston, MA 02115.

OPEN 24-7 DRIVE-THRU OPEN 24 HOURS Print your own coupons at home or show us our coupon on your Smartphone.

EVERYDAY SPECIAL

from Noon - 5pm (until 6/30)

Blendaccinos A delicious blended icy dessert drink, that cost less than the “bigbucks” coffee place.

BUY ONE Blendaccino ND

4 flavors 3.00 16oz $ 3.50 20 oz. $

(same size)

$1.00

(no coupon needed)

181 Virginia St. (Rt. 14) | Crystal Lake | 815-455-2028

VISIT OUR WEBSITE FOR COUPONS! www.countrydonuts.net


SCAN THE QR CODE AT LEFT TO GET YOUR DAILY DOSE OF CELEBRITY NEWS AND GOSSIP ON YOUR SMARTPHONE OR TABLET.

Tatum, wife welcome daughter THINGS

WORTH TALKIN’ ABOUT

Wednesday, June 5, 2013 • Section D • Page 6

Channing Tatum will be juggling acting with diaper duty: He and wife Jenna Dewan-Tatum have a daughter to dote on. Everly Tatum was born last Friday in London, where her father is filming the movie “Jupiter Ascending.” The birth was announced on separate websites for both parents with the message “Welcome to the World!” This is the first child for the Tatums. They met on the set of the film “Step Up” and have been married since 2009. The couple co-starred in last year’s “10 Years.”

BUZZWORTHY

Hewitt expecting first child

Underwood to pay tribute to tornado victims Carrie Underwood will pay tribute to the victims of the recent deadly tornadoes in Oklahoma when she appears at the CMT Music Awards. Underwood will perform her new single “See You Again,” recasting it as a somber memorial with the aid of two dozen choir members from Nashville’s Christ Church. “The choir, I’ve never done that before, and they just kind of take it to a whole ethereal place,” Underwood said Monday night after rehearsal. Viewers will be directed how to donate to the Red Cross during the performance at tonight’s awards show, airing live at 7p.m. from Bridgestone Arena in Nashville. Tornadoes have killed dozens in Oklahoma in the past two weeks, leading to an outpouring of support from country music stars. Blake Shelton hosted a televised telethon and Toby Keith, Ronnie Dunn and others are planning a benefit concert for later this summer. Underwood recently gave a $1 million check to the Red Cross from concert proceeds as well. Underwood grew up in tiny Checotah, about 115 miles east of Oklahoma City, and is familiar with the terror of tornado season. “The people in Oklahoma are really great,” the former “American Idol” winner said. “Tornado season is something that we’re all used to, but you can never fully prepare for it. It takes what it wants and it knocks down what it wants, and there’s nothing you can do about it except just try to be prepared. They’re just wonderful people, and they’re going to rebuild and they’re going to bounce back stronger than ever.”

Jennifer Love Hewitt and Brian Hallisay, who co-star on Lifetime’s “The Client List,” are expecting their first child. In a statement released Tuesday by Hewitt’s publicist, the couple said: “This is a wonderful time and we are looking forward to starting our family Jennifer Love Hewitt together.” The 34-year-old actress was previously engaged to Scottish actor Ross McCall. Hallisay, also 34, was a recurring character on the first season of “The Client List.” He became a regular this season. He also appeared on the CW series “Privileged.” Us Weekly first reported the news.

Russia wants Seagal for campaign Russia is looking at Steven Seagal to be the face of its weapons industry as it guns for first place on the world arms market. Deputy Prime Minister Dmitry Rogozin said the action movie star may head up an international marketing campaign to promote the Degtarev arms plant, Russian news agencies reported. He accompanied Seagal on a visit there Tuesday.

More celeb news at PlanitNorthwest.com/buzz “You’re ready to fight American [manufacturers] with your teeth and your intellect, and if Americans are prepared to promote and support you, that says we’re learning new ways to work on corporate warfare markets,” Rogozin said. Russian officials are big fans of Seagal, who met President Vladimir Putin in March and claimed to have set up a meeting with Rogozin for a Congressional delegation last week.

Former U.K. ‘X Factor’ judge arrested British media say singer and former U.K. “X Factor” judge Tulisa Contostavlos was arrested Tuesday on allegations of supplying hard drugs. The arrest came after the Sun tabloid ran a story claiming the 24-year-old had acted as a go-between in a deal to sell cocaine. The Metropolitan Police force said a 24-year-old woman and a 35-year-old man were arrested “on suspicion of being concerned with the supply of class A drugs.” They were questioned at a London police station and later released on bail pending further inquiries. Police in Britain do not usually name suspects who have not been charged. The BBC and other major media outlets identified the suspect as Contostavlos, who came to fame with London group N-Dubz. She was recently replaced as a judge on TV talent show “X Factor” by Sharon Osbourne. Contostavlos’ spokesman declined to comment Tuesday.

TODAY’S BIRTHDAYS Country singer Don Reid of the Statler Brothers is 68. Guitarist Fred Stone of Sly and the Family Stone is 67. Singer Laurie Anderson is 66. Country singer Gail Davies is 65. Drummer Nicko McBrain of Iron Maiden is 61. Saxophonist Kenny G is 57. Singer Richard Butler of Psychedelic Furs is 57. Actor Ron Livingston is 46. Singer Brian McKnight is 44. Musician Claus

Tuesday, June 11, 2013 7:00 PM Cary Chiropractic Office 395 C Cary Algonquin Rd, Cary www.carychiropracticoffices.com

Norreen (Aqua) is 43. Actor Mark Wahlberg is 42. Actor Chad Allen (“Dr. Quinn, Medicine Woman”) is 39. Bassist P-Nut of 311 is 39. Actress Navi Rawat (“Numb3rs”) is 36. Actress Liza Weil (“Gilmore Girls”) is 36. Bassist Pete Wentz of Fall Out Boy is 34. Guitarist Seb Lefebvre of Simple Plan is 32. Actress Amanda Crew is 27.


Business

SECTION E APPEARS INSIDE TODAY

Business editor: Chris Cashman • ccashman@shawmedia.com

THE MARKETS 76.49 15,177.54

20.11 3,445.26

9.04 1,631.38

Page E3

Wednesday, June 5, 2013 Northwest Herald

Breaking news @ www.NWHerald.com

Hike in home prices most in seven years By CHRISTOPHER S. RUGABER AP Economics Writer

OIL

$93.50 a barrel +$0.05

THE STOCKS Stock

Abbott Labs AbbVie AGL Resources Allstate

Apple AptarGroup AT&T Bank of Montreal Baxter CME Group Coca-Cola Comcast Covidien Dean Foods Dow Chemical Exelon Exxon Facebook Ford General Motors Google Hillshire IBM JPMorganChase Kohl’s Kraft Foods Group Live Nation McDonald’s Microsoft Modine Moto Solutions OfficeMax Pepsi Pulte Homes Safeway Sears Holdings Snap-On Southwest Air. Supervalu Target United Contint. Wal-Mart Walgreen Waste Mgmt. Wintrust Fincl.

Close

Change

36.80 43.63 42.11 46.68 449.31 56.58 35.67 59.27 69.78 69.17 41.42 40.92 63.81 10.49 34.62 31.59 90.79 23.52 15.78 34.96 859.10 34.78 206.19 54.04 51.85 54.40 13.75 98.37 34.99 10.28 57.41 12.78 81.63 20.56 22.97 48.04 91.61 13.92 6.37 71.51 32.20 75.94 48.03 41.77 37.37

-0.36 +0.27 -0.29 -0.79 -1.41 -0.27 +0.60 +0.21 -0.66 +0.40 +0.61 +0.46 unch +0.12 +0.28 -0.02 -0.67 -0.33 -0.11 +0.54 -8.53 -0.07 -2.76 -0.45 +0.42 -0.54 -0.09 +0.41 -0.60 -0.12 -0.42 -0.36 +0.23 -0.76 -0.23 -1.21 -0.13 -0.08 -0.15 +0.46 +0.04 +0.25 -0.47 +0.15 -0.28

COMMODITIES Metal

Close

Gold Silver Copper

1398.50 -13.40 22.50 -0.221 3.368 +0.0375

Grain (cents per bushel) Close

Corn Soybeans Oats Wheat

660.25 1528.75 381.75 709.00

Livestock

Close

Live cattle Feeder cattle Lean hogs

120.10 145.45 94.80

Change

Change

+4.75 -3.75 +2.25 +0.25 Change

+0.625 +1.025 +1.25

Stay connected To sign up for the Northwest Herald Business Update weekly email newsletter, select Business Update at NWHerald.com/newsletter.

Follow us Follow all the latest local and national business news on Twitter @NWHeraldbiz

Business blog The Business Scene blog is your connection to McHenry County’s business information today. Visit NWHerald.com/ blogs/business.

WASHINGTON – U.S. home prices soared 12.1 percent in April from a year earlier, the biggest gain since February 2006, as more buyers competed for fewer homes. Real estate data provider CoreLogic says prices rose in April from the previous April in 48 states. Prices also rose 3.2 percent in April from March, much better than the previous month-to-month gain of 1.9 percent. Prices in Nevada jumped 24.6 percent from a year earlier, the most among the states. California’s gain was next at 19.4 percent, followed by Arizona’s 17.3 percent, Hawaii’s 17 percent and Oregon’s 15.5 percent. More people are looking to purchase homes. But the number of homes for sale is 14 percent lower than it was a year ago. The supply shortage has contributed to the price increases. Rising home prices can help sustain the housing recovery. They encourage more homeowners to sell. And they spur would-be homeowners to buy before prices increase further. Home sales and prices began to recover last year, six years after the housing bust. They have been buoyed by steady job gains and low mortgage rates. Sales of previously occupied homes ticked up to a 3 ½ year high in April, according to the National Association of Realtors. And they are likely to keep growing: A measure of signed contracts to buy homes rose to its highest level in three years in

AP photo

An “Under Contract” sign is posted outside a home in Carmel, Ind. U.S. home prices soared 12.1 percent in April from a year earlier, the biggest gain since February 2006, as more buyers competed for fewer homes. April. There is generally a one- to two-month lag between a signed contract and a completed sale. The limited supply of homes has also made builders more willing to ramp up construction. That’s creating more construction jobs. Applications for building permits rose in April to the highest level in nearly five years. Prices rose in April from the previous year in 94 out of the 100 largest U.S. cities, CoreLogic said. That’s up from 88 in the previous month. Los Angeles and Phoenix reported the biggest price gains among the cit-

ies, CoreLogic said. Prices in both cities leapt 19.2 percent compared with a year earlier. They were followed by Atlanta and Riverside-San Bernardino, which both posted 16.5 percent gains. Dallas rounded out the top five, with a 10.2 percent increase. Despite the large gains, home prices are more than 22 percent below their April 2006 peak, the CoreLogic survey found. In Nevada, they are still 47.3 percent below their peak, and in Florida, prices are 40.5 percent below their peak.

8BUSINESS ROUNDUP Workforce Network hosts info sessions WOODSTOCK – An application information session will be held from 2 to 3 p.m. Thursday at McHenry County Workforce Center, 500 Russel Court, Woodstock. This session is open to job seekers looking for training for any career path. However, if job seekers have questions about the IT industry, a representative from ComNet will be at the Workforce Center at 1 p.m. to answer questions prior to the general information session. The representative will remain after the session for further questions. A session for those interested in truck driving and obtaining a CDL will be from 10 to 11:30 a.m. June 11 at the Workforce Center. Jeff Clark from Eagle Truck Driving School will share the ins and outs of the truck driving industry. Workforce Network may be able to provide training funds to help people get on with their careers. For more information, email DKMickle@co.mchenry.il.us.

College students and money focus of seminar CRYSTAL LAKE – “Teaching Your College Student How to Relate to Money” will be the subject a Friends of the McHenry County College Foundation seminar from 6 to 7 p.m. June 11 at McHenry County College, 8900 Route 14, Crystal Lake. Guest speaker will be Joe Ricciardi, wealth management adviser for Dorion-Gray Retirement Planning Inc. in Crystal Lake. He will explain how college students can budget money, stay out of credit card debt, manage college debt and still save and invest money at the same time. The free seminar will be in room B178 and is open to the general public. Walk-ins are welcome but registration is strongly encouraged. To reserve a seat, visit www. mchenry.edu/seminarseries or call 815-455-8556.

CareerPlace offers ‘boot camp’ for new grads

Provided photo

Coilcraft in Cary was the winning corporate team in Centegra Health System’s Break Your Boundaries wellness competition. Coilcraft participants included (from left): Kathie Capdevielle, Carl Neubaum, Karel Vlasak, Nick Darr, Jeff Finch, Bryan Reynolds, Victoria Berner, Frank Polivka and Ashley Goodwin. Not pictured: Frank Spaethe, Denise Blatzheim, Sean Conway, Dave Torres and Doug Rindfleisch.

Break Your Boundaries Competitors lose 4,032 pounds, 3,189 inches NORTHWEST HERALD Participants in Centegra Health System’s Break Your Boundaries wellness competition lost 4,032 pounds and 3,189 inches. Break Your Boundaries was a healthy lifestyle competition held this spring that encouraged participants to lose weight, eat healthier, exercise regularly and assess their overall lifestyles. More than 700 participants including community members, Centegra Health Bridge Fitness Center members, Centegra associates and employees from 12 corporations that use Centegra’s Worksite Wellness program competed for thousands of dollars in cash prizes. “This eight-week program is a highlight of the year for many people and it uses friendly competition to encourage people to achieve their weight-loss goals,” said Celine Pope, wellness manager with Centegra Health System. “This year’s overall results were outstanding.” Of the 12 companies that competed, 433 participants lost a total of 2,574.5 pounds and 2,017 inches. Two hundred and five Centegra Health System associates lost a total 825.5 pounds

and 573.25 inches. The 132 Centegra Health Bridge Fitness Center and community members lost a total of 633.5 pounds and 599 inches. Coilcraft in Cary was one of the big winners. The company had the winning team for worksites. Coilcraft’s Jeff Finch was the top male winner and Ashley Goodwin was the second place female winner. Top female and male winners took home $1,000 for first place, $500 for second place and $250 for third place. Winning teams took home $200 per person for first place, $150 per person for second place, and $100 per person for third place. Centegra Associate and Worksite Wellness winners will be held to a six-month maintenance requirement in order to earn their full prize money. Donna Candia, first-place female winner for Centegra Health System associates, overcame personal struggles in the past year to achieve her goal. She set up a plan, took advantage of the tools that were available and had support from her husband and family, which she said made the difference. Participants like Char Jensen, captain of the second-place Centegra Health System team, enjoyed the

teamwork and used the program as a chance to have fun and lose weight. Dawn Bauman, first-place female winner from the Worksite Wellness division, stated that she and her husband, who also participated in the program, wanted to feel good and get healthy. The Break Your Boundaries program provided the information and the desire to do something good for themselves. They supported each other with developing a plan, setting goals and gathering the tools needed to continue toward those goals. Hans Mach, first-place male winner from Centegra Health Bridge Fitness Center, said he was motivated by the program. “The independence of the program demonstrated an effective model that fostered a sense of personal self-reliance,” Mach said. “The classes and additional input offered were helpful, especially the first class in which serving sizes were discussed. It’s more helpful to identify the appropriate size of an apple, for instance. The program solidified the need I had to really dig my heels in and try harder to reevaluate not only weight loss, but the factors that impeded it. I now feel on track to get down to a more ideal weight.”

BARRINGTON – To help recent or soon-to-be college graduates both focus and jump start their job-search efforts, CareerPlace in Barrington is offering a three-day “boot camp” on June 17, 19 and 21. The College to Career program will offer 10 handson workshops during three, full-day sessions. “For families who have spent thousands of dollars helping students learn career skills, the $80 fee for this workshop program will be a small but vital investment in helping their students land the first job in their post-college career,” said Keith Owens, CareerPlace program director. College to Career workshop sessions will include: Overview of the job search process, job search research tools, developing a job search marketing plan, managing your online reputation, and how to network to success. CareerPlace is located at 600 Hart Road, Suite 275, Barrington. For more information, visit www.mycareerplace.org, or call 847-304-4157.

Chamber Shop In Thursday at Maurices McHENRY – The McHenry chamber’s Shop In will be from 11 a.m. to 7 p.m. Thursday at Maurices, 3258 Shoppers Drive, McHenry. Enter to win a $25 gift card. Any items purchased when saying “the chamber sent me” receive 20 percent off.


BUSINESS

Page E2 • Wednesday, June 5, 2013

8IN BRIEF

Northwest Herald / NWHerald.com

Changes that will affect estate planning

Chrysler refuses U.S. request for Jeep recall

The American Taxpayer Relief Act of 2012 was enacted on Jan. 2, 2013. The act makes significant changes that will affect many estate plans. Let me summarize the main estate, gift, generation-skipping transfer (GST), and charitable contribution tax laws included in the act and identify opportunities you might consider. • Estate tax exclusion. The act permanently maintains the $5 million estate tax exclusion amount. This amount is adjusted for inflation each year, beginning with 2012. For 2013, the inflation-adjusted estate tax exclusion amount is $5.25 million. This means that a person dying in 2013 can transfer up to $5.25 million ($10.5 million for a married couple, reduced by lifetime taxable gifts) at death without paying estate tax. • Basis adjustment for property acquired from a decedent. The act did not change the law regarding basis adjustment for property acquired from a decedent. Specifically, the basis of property acquired from a person as a result of his death is generally stepped up (or down) to its fair market value on the date of death, thus eliminating all pre-death capital gain or loss on the property. In the case of marital property, both the deceased spouse’s interest in the property and the surviving spouse’s interest in the property qualify for this adjustment. • Gift tax exclusion. The act makes permanent the unification of the gift and estate tax exclusion amounts. This means that in 2013 each person can make lifetime gifts up to $5.25 million without paying gift tax. However,

DETROIT – Chrysler is refusing a request by U.S. safety regulators to recall about 2.7 million vehicles to fix fuel tanks that could leak and cause fires in rear-end collisions. The company says it’s been asked by the government to recall Jeep Grand Cherokees from 1993 through 2004 and Jeep Libertys from 2002 through 2007. But Chrysler says in a statement that the SUVs are safe and not defective. Chrysler says the request from the National Highway Traffic Safety Administration is based on incomplete data analysis. The company says it will work with the agency to resolve the dispute.

U.S. safety agency may expand GM air bag recall DETROIT – U.S. safety regulators are checking to see if up to 400,000 General Motors cars should be added to two recalls for defective air bags. The probe covers Chevrolet Cruze and Sonic small cars, the Chevrolet Camaro muscle car and the Buick Verano small car from the 2012 model year. The National Highway Traffic Safety Administration said in documents posted on its website Tuesday that GM recalled just over 6,800 of the cars in two recalls in October of last year and January. The main front driver’s air bags wouldn’t inflate due to a defect in the electrical connections. In the recalls, GM dealers were to replace the steering wheel air bag coil free of charge to fix the problem. The cars covered by the two recalls were built from Dec. 16, 2011 to Feb. 1, 2012 and from April 2, 2012 to June 29, 2012, according to the documents. The agency says GM may not have fully identified the cause of the problem, so it will see if the recall should be expanded.

LOCAL FINANCE Timothy Dooley all gifts that use a portion of this gift tax exclusion will reduce the donor’s estate tax exclusion available at death. For example, if a parent makes a $2 million lifetime taxable gift to a child, the parent’s remaining estate tax exclusion amount is reduced by $2 million at death. The lifetime gift tax exclusion only applies to gifts in excess of the annual gift exclusion (i.e., the annual amount a person may gift to any person taxfree). For 2013, the annual gift exclusion is $14,000 per person (or $28,000 per married couple). • GST tax exclusion. The act makes permanent the unification of the estate tax and generation-skipping transfer tax exclusion amounts. This means that in 2013 each person can make transfers to grandchildren (or multi-generational trusts) of up to $5.25 million without paying a GST tax. • Maximum estate, gift and GST tax rates. The act permanently caps the maximum estate, gift, and GST tax rates at 40 percent. This is a 5 percent increase from the maximum rate in 2012, but 15 percent less than what the maximum rate would have been if the act had not been enacted. • Estate and gift tax exclusion portability. The act makes permanent the concept of estate and gift tax exclusion portability. Portability means that spouses, under certain circumstances, can share their unused $5.25

million estate and gift tax exclusion with each other. This portability allows spouses to effectively use a combined $10.5 million exclusion. Portability allows a surviving spouse to elect to use any exclusion unused by his/her last deceased spouse in addition to his/her own $5.25 million exclusion. For example, if a husband dies in 2013, having made $2 million in lifetime taxable gifts and leaving his entire $8 million estate to his wife, no estate tax is due at husband’s death. If an election is made on the husband’s estate tax return to allow his wife to use his $3.25 million unused estate tax exclusion, the wife’s available exclusion amount (which can be used for lifetime gifts or for estate taxes) is increased to $8.5 million – her $5.25 million plus her husband’s unused $3.25 million. It is important to note that portability is only available if an election is made on the deceased spouse’s estate tax return. Also, portability is not available for the GST tax exemption. Further, in the event of a remarriage and subsequent death of the new spouse, the surviving spouse will no longer have access to the unused estate tax exclusion of the first deceased spouse. • IRA charitable rollover. The act allows taxpayers in 2013 who are age 70½ or older to directly transfer up to $100,000 from their IRAs to charity without incurring taxes. In addition, a distribution from an IRA to a taxpayer in December 2012 can be treated as an IRA charitable rollover in 2012 if the distribution is transferred by

the taxpayer in cash to a charity before Feb. 1, 2013. Also, a direct payment from an IRA to a charity completed by Feb. 1, 2013 can be treated as if made on Dec. 31, 2012.

Estate planning opportunities While the act purports to make permanent changes that will affect many estate plans, taxpayers should not be lulled into complacency. Leaders in both the House and Senate have acknowledged that the act is only the first step toward getting the country’s fiscal house in order. As Congress takes its next steps to address our country’s fiscal challenges, additional legislation designed to raise revenue is anticipated. This legislation may include provisions that severely limit the ability to transfer wealth to children and future generations. Proposals that had been on the table in these discussions and may be renewed again include: a minimum term for grantor retained annuity trusts, term limits for GST trusts, limits on the availability of valuation discounts, and estate taxation of grantor trust assets. Now is an excellent time to consult legal counsel to take advantage of the opportunities currently available. Happy planning!

• Timothy J. Dooley, CFP, is president of Comprehensive Retirement Resources Inc., 201 N. Draper Road, McHenry. Phone 815-578-4217. He specializes in retirement and estate planning, and offers securities through Raymond James Financial Services Inc.

U.S. trade deficit up 8.5 percent to $40.3 billion By MARTIN CRUTSINGER AP Economics Writer WASHINGTON – The U.S. trade deficit widened in April, as demand for foreign cars, cell phones and other imported goods outpaced growth in U.S. exports. The Commerce Department said Tuesday that the trade gap rose 8.5 percent in April from March to $40.3 billion. Exports increased 1.2 percent to $187.4 billion, the second-highest level on record. Companies sold more telecommunications equipment, industrial machinery and airplane parts, while U.S.-made autos and auto parts also rose to an all-time high of $12.8 billion. But imports grew an even faster 2.4 percent to $227.7 billion. Sales of foreign cars increased to $25.5 billion. Americans also bought more consum-

– From wire services

er goods, led by big gain in foreignmade cell phones. A wider trade gap can restrain growth because it means U.S. consumers and businesses are spending more on foreign goods than U.S. companies are taking in from overseas sales. But Joel Naroff, chief economists at Naroff Economic Advisors, said the wider deficit does show growth in the U.S. remains stronger than most others nations. And that growth has helped fuel more spending by consumers on imported goods. “The U.S. economy may not be robust but with growth continuing, the demand for foreign goods is picking up,” Naroff. Most economists said trade will likely be neutral in the April-June quarter after subtracting slightly from growth in the January-March quarter. They expect economic growth has

slowed to an annual rate of around 2 percent, down from a 2.4 percent rate in the first quarter. Still, a weaker global economy is reducing demand for U.S. exports and that could weigh on growth this year. Europe’s recession continues to be a problem for U.S. companies. The deficit with the 27-nation European Union grew 25.6 percent to $12.4 billion. U.S. exports to the region declined 7.9 percent, while imports from the region rose slightly. The politically sensitive deficit with China surged to $24.1 billion, the highest level since January and the largest with any single nation. Imports jumped 21 percent, while exports fell 4.7 percent. The March deficit had been artificially lowered by shipping disruptions caused by the Chinese New Year holiday. The April deficit with South Korea

climbed to a record $2.4 billion. Imports from that country rose to an alltime high of $5.6 billion. Fewer exports have slowed activity at American factories, according to a measure of U.S. manufacturing released Monday. The Institute for Supply Management said Monday that its index of manufacturing activity fell to 49 last month from 50.7 in April. It was the lowest reading since June 2009 and the first time the index had slipped below 50 since November. A reading under 50 indicates contraction in manufacturing. A measure of export orders in the ISM report fell to its lowest level since January. The weakness abroad has coincided with less investment by U.S. businesses, possibly out of concern that government spending cuts could hobble economic growth.

BRIDGE

Crossword Across

Annual May 1 celebration

39 & 41

1 Trek

ending in Mecca 5 Boat with a flat bottom 9 Word heard on 39-/41-Across 14 Et ___ 15 “Well, I don’t think so” 16 Metallic veins 17 Bath, e.g. 18 Jessica of “Hitchcock” 19 Hand game choice 20 Hand sanitizer brand 22 Halves of sawbucks 24 Tends to 27 Made sacred 30 Treater’s declaration 34 Member of the cat family 35 Coat color 37 “Egad!” 38 Gray head?

70

71 43 44 46 48 50 52 54 56 58 62 63 66 67 68 69

“Do Ya” grp. 1998 Sarah McLachlan hit Appear Running, poetically Bikes Pragmatic sorts Behave perfectly Charlotte ___, Virgin Islands Clodhopper Public spat “Star Wars” sister Frat house alternative Debussy’s “___ de Lune” Look like a creep Chekhovian sister of Masha and Irina

ANSWER TO PREVIOUS PUZZLE PP AA W W SS

EE RR II EE

D D E E N N C C H H

EE L L O O P P E E

L L I I C C E E

O O R R A A L L

N N II N N AA N N A A T T U U R R E E W W A A L L K K

SS AA SS SS N N N N W W B B E E D D

BB AA BB YY D D O O C C G G O O Y Y A A S S

SS TT YY LL U U SS

CC H H AA TT SS

S S U U E E

S S O O T T S S

S S O O F F T T

E E U U R R O O

R R EE N N TT EE Q Q U U I I L L A A C C A A R R

AA M M O O SS TT U U N N E E F F L L A A M M E E

M M EE SS AA C C A A D D D D R R O O N N E E S S

SS TT EE N N O O T T A A K K E E O O U U T T

O O N N U U SS

L L E E T T

P P EE JJ O O R R A A T T I I V V E E

TT I I K K I I S S

SS P P E E N N T T

S S L L A A T T

E E O O N N S S

U U S S T T A A

P P E E E E R R

JJ AA B B

EE D D G G EE

72

Performances on 39-/41-Across Long ago Fool (with)

Down

Edited by Will Shortz 11

22

33

55

66

77

88

9 9

10 10

14 14

15 15

16 16

17 17

18 18

19

20 20

21 21

1 Plucked

instrument 2 Baseball family name 3 J’adore fragrance maker 4 King replaced by William and Mary 5 Temporary residence, maybe 6 Feng shui “energy” 7 Only partner? 8 Author Tobias 9 British academic exam 10 “Wouldn’t It Be ___?” (“My Fair Lady” song) 11 River to the Baltic 12 Female fowl 13 Blockhead 21 Tennis great Ivan 23 Turner autobiography 25 Something watched on télévision 26 Hoopla 27 Company with a duck in its logo 28 Poor 29 Kind of acid used in making soap 31 Beer brand owned by Pabst

44

No. 0501

22

24 24 27 27

28 28

25 25

35 35 39 39

44 44

45 45

50 50

42 42

47 47

48 48

52 52

54 54

31 31

32 32

33 33

60 60

61 61

37 37

41 41

51 51

56 56

36 36

40 40 46 46

13 13

23

30 30

38 38

12 12

26 26

29 29

34 34

11 11

43 43 49 49

53 53

55 55

57 57

58 58 64 64

59 59

62 62

63 63

65 65

66 66

67 67

68 68

69 69

70 70

71 71

72 72

PUZZLE BY PAULA GAMACHE

32 33 36 40 42 45 47

Hatch ___ (conspire) Shrieks of pain Pitching professionals Montaigne work Bulldog’s place, in brief Land on the Adriatic Pitching stat

49 51 53 55 56

57 59

The cinema Fishers with pots Shining Nice ___ (prude) Free speech supporter: Abbr. Coarse powder Subversive one

60

56-Down and others: Abbr.

61

Short winter holiday?

62

Institute, e.g.: Abbr.

64

Want ad inits.

65

Suffix with hotel

For answers, call 1-900-285-5656, $1.49 a minute; or, with a credit card, 1-800-814-5554. Annual subscriptions are available for the best of Sunday crosswords from the last 50 years: 1-888-7-ACROSS. AT&T users: Text NYTX to 386 to download puzzles, or visit nytimes.com/mobilexword for more information. Online subscriptions: Today’s puzzle and more than 2,000 past puzzles, nytimes.com/crosswords ($39.95 a year). Share tips: nytimes.com/wordplay. Crosswords for young solvers: nytimes.com/learning/xwords.

To subscribe to the Northwest Herald, call (815) 459-8118.

By PHILLIP ALDER Newspaper Enterprise Association

A.J. Liebling, a journalist and author who died in 1963, said, “Freedom of the press is guaranteed only to those who own one.” That does not seem to be guaranteed. Outside inluences might exert pressure. At the bridge table, some plays are guaranteed; one example is a safety play. Other plays, though, are not sure to work. You just hope that they do. In today’s deal, against four spades, West starts with the heart queen: six, four, two. What should West lead at trick two? After North opened one club and East overcalled one heart, South’s onespade response guaranteed at least a ive-card suit, because with only four spades, he would have made a negative double. West applied maximum pressure with his jump to four hearts -- in a competitive auction, usually bid to the 10-trick level with a 10card it. Then North raised to four spades. This was a slight overbid. If West had passed, North would have rebid three spades. But in competition you may bid one level higher than you would have done in an

noncompetitive sequence. Also, maybe both four hearts and four spades were making. West cannot be sure where four defensive tricks will come from. But unless East has the spade king, the defenders need three minor-suit tricks. Although not underwritten by Lloyd’s of London, West’s best shift is to the diamond queen. Here, South will win with dummy’s king and draw trumps, but when he turns to clubs, East takes a trick and returns a diamond through South’s jack, which is trapped by West’s A-10 tenace.

Contact Phillip Alder at pdabridge@prodigy.net.


CLASSIFIED

Northwest Herald / NWHerald.com

Wednesday, June 5, 2013 • Page E3

Jobs | Real Estate | Legals | Vehicles | Stuff

WAUCONDA 2BR + LOFT, BATH GARDENER NEEDED. PT. Experience & references req'd. Must be dependable. Residence in Woodstock area. 815-337-8842

ALWAYS INVESTIGATE BEFORE INVESTING ANY MONEY Auto

NEW FORD SALES $15/HR PLUS BONUS No Experience Necessary. Must be at least 21 years old with valid driver's license. Call Jose or Mike:

Bull Valley Ford Woodstock 815-338-6680

Contact the Better Business Bureau www.chicago.bbb.org - or Federal Trade Commission www.ftc.gov

Has a great opportunity for an individual wanting to start their won delivery business by becoming an owner/operator of a

DELI SERVER - $9/hr CASHIER – Exp. -$11/hr. STOCKING/ CLEANING-Exp. 1309 North Ave. Crystal Lake 815-477-4141

This GREAT opportunity comes with SUPER SECURITY and UNLIMITED Earning Potential. This is YOUR opportunity to work with the #1 Home Improvement Center. Call: 715-876-4000

DELIVERY TRUCK!

We are seeking experienced:

Driver

Quality Control Technician Maintenance Mechanic Flexo Press Operators & Helpers All positions are 2nd shift Interested applicants can submit their resume, including salary history, to: employment@hscrocker.com or fax to: 847-669-1170, Attn: HR

NEWSPAPER DELIVERY

HVAC INSTALLERS & SERVICE TECHS Experience & Refrigerant license required. Must work weekends if needed. Call Northern Continental Heating at 815-459-9412

HARVARD AREA Huge 3BR, 2BA loft apt. Quiet. Frplc, W/D, C/A. Fish/Swim. Pets ok. $1025/mo. 815-648-2716

LAND SURVEYING Party Chief with Helper Office CAD Designer–Drafter

HARVARD 1 MONTH FREE* Autumn Glen Luxury Apts. Spacious 2 bdrm Apts avail Free extra storage Free heat!! Pets welcome! Rents from: $800 Free 55” flat screen TV CALL TODAY! 815-943-6700 www.gallinacos.com M-F: 10am-6pm Sat: By Appt (*2nd floor units only)

HEBRON ~ 1 BEDROOM Appl, W/D, $635/mo + sec including heat. No pets/smoking. Available 6/1. 815-355-2158

PAINTERS - EXPERIENCED PAINTERS WANTED Must have own tools, reliable transportation. Minimum 2 years experience. Contact Larry for details: 815-814-4627

Apply in person 305 S. Division St. Harvard, IL. 60033

Screen Printing Screen print / pad print set-up position offered. Compensation paid with experience. 8am-4:30 M-F. Barrington Area. Full benefits, vacation, holiday pay.

Send resume to: info@howw.com or call Mike at: 847-382-4380

Quiet building, no pets. $825 + security. 847-526-4435 Marengo Large 1 & 2 BR most utilities included Broker Owner $650 & UP 815-347-1712

MARENGO SMALL 1BR $450/mo + sec. 815-790-7797 Marengo Upper 2 BR w/gar. hrdwd flrs., quiet building, no dogs or smoking $600 815-596-1363 McHenry $199 Move-In Special Large 1BR, from $699. 2BR, 1.5BA from $799. Appl, carpet and laundry. 815-385-2181 McHenry -Large studio/1BR some utilities included, balcony $690 and up Broker Owned 815-347-1712

Cat: small black female, found in Marengo, Deerpass Subdivision, 815-568-8087 Keys: Crystal Lake Rd. & Dartmoor in McHenry on 5/28, Ford card key, Thortons tag 815-344-4427 Leave a message

IRISH PRAIRIE APTS

Social Services

DEVELOPMENTAL TRAINING PROGRAM DIRECTOR Sheltered Village in Woodstock, IL is seeking a Developmental Training Program Director. The program currently consists of 60 clients. Applicants must be: QIDP eligible & have developmental training experience & knowledge of Rule 119. Send resume to: Bob Norris 600 Borden St, Woodstock, IL 60098 or fax to 815-338-6803

Rev Anne 847-431-4014 Weddings, Blessings, Memorials, Christenings I am a Christian man in my forties, looking for a Christian family to stay with in Crystal Lake with access to Pace Bus and Metra lines. I am able to pay rent. If interested, please contact Gabe at Calvary Assembly of God Mon-Thurs. 9a-5p 815-459-4456

MCHENRY QUIET BUILDING

1 bedroom, heat and water incl. $675/mo, security deposit req. NO PETS. 815-382-6418 McHenry/Johnsburg 2BR

Woodstock Studio $585/mo+sec. Efficiency $550/mo + sec.1-BR $650/mo + sec, all 3 furn'd w/all utils incl. No Pets. 815-509-5876

2nd flr, 1BA, 1000 sq ft, W/D, C/A. $800/mo, pet dep. Allodial R. E. 815-477-5300 QUIET FARM SETTING Small private 1-bedroom 1st. floor apt in the country with Private entrys, parking & ALL utilities & appliances included. Available June 15th. 1st. & last month's rent required & no pets please. $740/month. 847-344-4380

Quiet and clean building with storage, laundry and parking. $800/mo. 847-401-3242

available 24/7 at NWHerald.com

East Wonder Lake Nicely furnished room w/house priveleges. Utils/cable. Call for details. $450/mo. 815-349-5291

Marengo - Furnished Room

With cable, utilities included. $115/wk or $460/mo + deposit. 815-482-6347 McHenry: Share a condo, own room, bath TV, garage $115/week 815-344-5975

Crystal Lake – 2/3BR Flat, Garage, Bsmnt, Stove, Refrig., W/D, No pets $900/Month 847-271-8570 or 815-861-3488

Woodstock - Furnished Rooms All utilities incl. $445 - $475. Call Bill 815-260-5259

MARENGO 3BR DUPLEX

1.5BA, 1st floor laundry room. Walk out basement, 2 car garage. $1200 + sec. 815-568-6311

WOODSTOCK 3 BEDROOM 1.5 Bath, A/C, Stove, Refrigerator, Garage, No Pets. Broker Owned. 847-683-7944 HURRY!!

Cary. 3BR, 1BA. 2.5 car garage. C/A. Appls, W/D. Fenced yard, deck. Broker lic. $1250/mo+sec. 815-354-4575 CRYSTAL LAKE - IN TOWN RANCH GREAT in town Brick Ranch in Crystal Lake, walking distance to schools, library and train! Hardwood floors, clean, Patio and large yard. 2 beds up with 3rd in finished basement. $1399/month + security, pets considered, landlord willing to explore options. Call Kim @ 815-276-5796. Broker owned. Beautiful Views! Large wooded grounds, beach, may have boat, 3-4 bedroom, 1.5 bath, porches. NO PETS! $1595/mo. 630-655-2888 Cell 630-899-8899

Lake in the Hills: Female in 40's looking for responsible female to share TH $600/mo+ ½ utils move in 6/1 847-208-2840 lv msg.

VOLO, IL. -FOR RENT

1200 sf. Metal pole barn w/concrete floor and overhead door. $400.00 mo. & sec.dep Bruce Kaplan.

Premier Commercial Realty 847-854-2300 x 20

Crystal Lake CHEAP & CLEAN Office Suite. 400 SF.

Incl. all utils + High Speed DSL. $495/mo. 815-790-0240

Fox Lake. Vacation Village, 1 BR, newly remodeled end unit, water view, pool, sm. dogs ok. 847-651-9906 FOX RIVER GROVE 3BR, 2.5BA, 1 car gar., channel access to Fox River, $1675/mo.+sec., avail. 6/3 847-209-1745 HARVARD 2 BED 1.5 BATH On 6 acres. $1,000/month plus security and utilities. Available July 1st. 847-602-2410 HARVARD 3 BR, 1 BA, Bsmt. Appl. Incl. W/D, 1 car gar. Big yard. Hrdwd Flrs. $925/mo. 815-770-0157 COMPLETE REALTY

Carpentersville Raised Ranch 2400 Sq Ft, 9 Rooms, 4BR, 3BA New appliances, carpeting, large fenced yard, deck, $285,000. 847-381-4843 ~ 708-204-3823

MARENGO PRIVATE FARM

30 acres woods, 1 mile from town. 5BR, 3BA, 3000 sq ft, A/C, bsmt. Garage, heat, A/C, wood floors. $2400/mo. 312-607-6406 McCullom Lake 2BR, 1BA, Broker owned, $775/mo. + sewer, 1st & security deposit Call Shawn 224-577-5521

McHenry Cute 2BR Ranch

CAPRON 1 BR

WOODSTOCK

All appls with DW and Garage. $550.00/mo. Senior discount available. 815-338-2717 Washer/dryer in unit. Recently updated, full size kitchen, parking. $735/mo. 815-404-1354

CRYSTAL LAKE - DOWNTOWN Crystal Lake 1BR $760

Quiet building, hardwood floors, heat and water incl. No pets. 815-455-6964

CRYSTAL LAKE 2BR CRYSTAL LAKE DUPLEX ON SHORE

BREAKING NEWS

CRYSTAL LAKE 1BR, 1BA Newly remodeled, rent to own. $725/mo which incl lot rent and home pymt. Joe@815-356-6045

WOODSTOCK 3BR, 2 STORY

On corner lot, 2 car garage, $985/mo. 815-388-5314

SILVERCREEK 1 & 2 Bedroom ❍ ❍

Affordable Apts. Garage Included

815-334-9380 www.cunat.com WOODSTOCK 1BR $595, 2BR $745. All appliances, D/W, wall to wall carpet. A/C, balcony/ patio, on site lndry. No pets. 847-382-2313 or 708-204-3823 WOODSTOCK Modern Loft Apartment ~ 2BR Historic Rogers Hall, $825/mo. NO DOGS! 815-482-4909

Woodstock Studio

$50 off Deep Cleaning, 15 Yrs Exp 815-814-6343 Caregiver & Nanny looking for job in Crystal Lake or within 20 miles. References available. 773-308-6801 or 815-455-6628

Remodeled 2 full bath, W/D, $995/mo + sec, incl health club. 815-509-7058

McHenry OPPORTUNITY KNOCKS! $175,000 Great investment in McHenry. 3 bedroom, 2 bath all brick ranch home. Views of the Fox River, 1 block from McHenry Country Club. Home needs work. Call for details. 815-575-0940

McHenry 2BR with Den

Algonquin: 1BR, balcony, some utilities included, $690 & up Broker Owned 815-347-1712

No smoking/pets, $795 + sec. 815-893-0059 ~ Lv Msg

Anna's Housecleaning

MCHENRY 2BR CONDO

On acreage, 3BR, 2BA. $1350/mo. Agent Owned. K. D. Schaid Appraisal 815-363-2449

ALGONQUIN - 2 BEDROOM

1 BR, No pets. $750/mo+sec dep. Call: 815-307-2692

CORN DETASSELING: Crew Chief 18+ yrs, Pullers 14+ yrs. Woodstock area. Please apply at hughesseedfarms.com or call Mon.-Fri., 1-4pm 815-338-2480

MCHENRY - End Unit Townhome. 2 BR 2 BA, 2 Car Garage. Patio. Washer/Dryer. $1175. 847-516-7000

McHENRY / BURTONS BRIDGE 2 BR, 1½ BA $950/mo + Security Fishing, 10 mins from Crystal Lake No Pets, 815-353-4952

CARY ~ HUGE 1 BEDROOM ! RN / LPN ! All shifts. Pediatric exp. Wknds. Medical Biller in office also avail. McHenry & Kane Co. 815-356-8400

Short Terms Available W/D and Fitness Center. 815/363-0322

❤Ceremonies of the Heart❤

SERVICE TECH TRAINEE

Clean 2BR, DR, basement. 1 car garage, fenced yard. $985/mo. 815-388-5314

WOODSTOCK FARMHOUSE

All appl, patio, private entrance. $750 - 900, garage available. 815-455-8310

Crystal Lake On Lake MCHENRY - ROUTE 31

1BR Move-In Ready!

needed for a car wash service industry. Mechanical & electrical knowledge helpful. People skills a plus. Dependable transportation & good driving record required. Call 815-477-7441 x223 between 10am & 3pm.

Wonder Lake/West Side

HEBRON 2BR CONDO

Recently renovated 2 bedroom, 1st floor, W/D, garage. Clubhouse pool, no pets. $1000/mo. Sandy 815-338-3300

ISLAND LAKE 2 BEDROOM

Restaurant

FT - COOK PT - PREP COOK

Wonder Lake. 2 BR.- Lrg. lot with gar., No pets. Walk to lake. $850/m + sec + utils. No sec. 8 847-276-5685

Crystal Lake/Four Colonies

1.5 bath, C/A, W/D, attach garage. $1175/mo. Days 815-338-3300 Nights/W/E 815-337-3420

1 year contract.

Box for iPhone 4 with all accessories still inside left at Pauly Toyota in Crystal Lake on 5/25. 815-459-7100

2BR, 1BA, broker owned. $800 + sec. Pets OK with deposit. Call Shawn 224-577-5521

Woodstock – Beautiful Executive Home In Family-Friendly Subdiv., 4 BR, 2 Full BA, Bonus RM Up. Living Rm, Kitchen/Dining, Fam Rm, ½ BA. Part Fin. Bsmnt, ½ BA. $1,650. 219-929-7153

Woodstock 3BR, 1.5BA TH ~ All appl, c/a, gar, no pets. Good credit a must, $1095/mo. Broker Owned Pete, Harding R.E. 815-334-2617

Call 815-526-4434

Luco Const. Inc.

MECHANIC – Small engine equipment repair. Solid diagnostic, repair skills & organized. Call Bob at B&K Power Equipment 815-923-4547

CRYSTAL LAKE CONDO 2b/2b, totally REMODELED! 1st fl, patio, WD in unit, quiet complex, no pets/smoking, water & garage inc $1000 mth + 1 mth sec dep & cred chk req 630-443-0343 or 630-308-0832

TH. 2 car garage. Full basement $1200/mo. 815-482-8080

Crystal Lake Hampshire Harvard Lake in the Hills

Cat: male, 2 years old, about 10 pounds, gray, black, white, & brown, named Dexter, no collar, lost 5/30 morning in Woodstock by Wheeler St. if found, please call 815-701-6052

WONDER LAKE - Nice! 3 BD 2+ BA. Lg. Fam. rm. Lg. yard. AC / WD / appl. No smoking. $1100 + sec + cr. rpt. 815-690-9490

WOODSTOCK - 2 BR, 2½ BA.

Routes now available in:

Cat – Female – Brown & Gray Tabby w/Green Eyes – No Collar – Has Micro Chip - Named Pita - Last Seen In Bright Oaks, Cary 630-677-5151 Reward

Storage area, W/D hook-up, huge yard, Section 8 OK, $1150/mo. 847-810-9115 ~ 224-623-1195

Wonder Lake ~ West Side

CARY: TH 3BR, 2.5BA, FR, FP, 2 car gar., quiet complex, MOVE-IN READY, occ July 1, $1500/month Call 630-416-0659 UPDATED! Randall Village. $895 + deposit. 630-669-5646

Looking for Contractors to deliver newspapers early morning 7 days per week.

Please mail short resume to: 8813 Rte. 31 Cary, IL. 60013

W/D hook-up, 1st floor of a 2 flat. No pets/smkg. $750/mo, 1st & last mo. + security dep. 815-3478347 ~ 815-347-8346

CRYSTAL LAKE 1BR CONDO

JEWELER To work in West Suburb's largest jewelry store. MUST have minimum 10 years bench experience. MUST be very skilled in gold AND platinum repair. MUST be skilled in prong, pave & channel setting. Wax model making preferred. Call 847-426-8881 or visit: D & M Perlman 740 S. Eighth St, West Dundee, IL 60118

WOODSTOCK ~ 2BR, 1BA

Fox River Grove 1 Lrg BR in House, 2nd flr, 6 rooms, quiet, pets OK. $725/mo/obo. 224-595-3148

BE YOUR OWN BOSS!

BOAT BUILDER - EXPERIENCED Sailboat manufacturer looking for perm FT exp composite boat builder. Email resume to: Andy.Lowe@Melges.com

H.S. Crocker Co. Inc. IS HIRING!!!

FOX LAKE ~ GOOD VALUE! Very large 1BR, dining area, balcony, storage and laundry in building, no dogs, $695/mo. Agent Owned 815-814-3348

May have boat, newly remodeled. Large 2BR, 1BA, first floor. Picture windows overlooks large wooded grounds. NO PETS. $1795/mo. 630-655-2888 Cell 630-899-8899

Crystal Lake ~ 1BR, 2nd Floor Small bldg, $800/mo, no pets/ smoking. Heat incl, near metra. Garage available. 815-344-5797

FOX LAKE 1 BR, Laundry on-site, no pets, Sect 8 OK, $670/mo + sec. 847-812-9830

Near Square, 3rd floor, all utilities included, no pets, $650/mo 815-703-8442 ~ 815-568-8742

Great location, all appliances, W/D. 1.5 car gar, pets OK, $1100/mo. Agent Owned 815-382-6753

McHenry Patriot Estates 2BR, 3BA + Loft TH Large master bath, full bsmt, 2 car garage. $1250/mo + sec. Age Restrictions may apply. Free Health Club Membership. Pet Friendly. 815-363-5919 Or 815-363-0322

McHenry: 4BR, 2BA, on Fox River Sch Dist 46 & 155. Boat Dock, 2 car gar, finished bsmnt, frplc, C/A, no pets. $1399. 708-296-4476 McHenry: close to town, 3BR, A/C, fireplace, hrdwd flrs, all appl., 1BA, 1 car gar., no smoking, $1100/mo. 815-385-3770 Rent to Buy. Choose from 400 listed homes. Flexible Credit Rules. Gary Swift. Prudential First Realty. 815-814-6004 Spring Grove Located 4 miles North in Camp Lake/Trevor on 1/2 acre, 3 bed 1 bath ranch on a crawl space, 2.5 det garage, newly remodeled, all appliances, Long Term Lease. $1145 mo. Land Management Properties 815-678-4771 Spring Grove. 3BR, 1.5BA 2 story home with cellar, 2.5 car garage. In old downtown. $1095/mo. Land Management Properties 815-678-4771 Follow Northwest Herald on Twitter @nwherald

MCHENRY - 24 2 Br. Apts.

1.42 Acres. Laundry Room Work area. Reserved parking plus. (6) 4 unit bldgs. 847-438-6922

PUBLIC NOTICE IN THE CIRCUIT COURT OF THE 22ND JUDICIAL CIRCUIT MCHENRY COUNTY WOODSTOCK, ILLINOIS JPMorgan Chase Bank, National Association Plaintiff, Vs. George J. Mendes; et. al. Defendants, 11 CH 2257 NOTICE OF SALE PUBLIC NOTICE is hereby given that pursuant to a Judgment of Foreclosure entered in the above entitled cause on JUNE 11, 2012 LENDER SALES OF ILLINOIS LLC will on JUNE 17, 2013, at the hour of 10:30 A.M., or soon thereafter, at the front doors of the McHenry County Courthouse located at 2200 N. Seminary, Woodstock, IL 60098, sell to the highest bidder for cash, the following described property: The common address of said real estate is: 1560 Shelton Lane, Crystal Lake, IL 60014 PIN:19-18-379-037 Description of premises: RESIDENTIAL Sale Terms: 25% down by certified funds at the close of the auction: The balance, including the Judicial sale fee for Abandoned Residential Property Municipality Relief Fund, which is calculated at the rate of $1 for each $1,000 or fraction thereof of the amount paid by the purchaser not to exceed $300,

pur in certified funds, is due within twenty-four (24) hours. The subject property is subject to general real estate taxes, special assessments or special taxes levied against said real estate and is offered for sale without any representation as to quality or quantity of title and without recourse to Plaintiff and in "as is" condition. The sale is further subject to confirmation by the court. Upon payment in full of the amount bid, the purchaser shall receive a Certificate of Sale, which will entitle the purchaser to a Deed to the real estate after confirmation of the sale. If the sale is set aside for any reason, the Purchaser at the sale shall be entitled only to a return of the deposit paid. The Purchaser shall have no further recourse against the Mortgagor, the Mortgagee or the Mortgagee's attorney." If the property is a condominium, the purchasers other than mortgagees will be required to pay any assessments and legal fees due under The Condominium Property Act, 765 ILCS 605/9(g)(1) and (g)(4). If the property is located in a common interest community, purchasers other than mortgagees will be required to pay any assessment and legal fees due under the Condominium Property Act, 765 ILCS 605/18.5(g-1). No refunds. The property will NOT be open for inspection. For information: Sales Clerk, Codilis and Associates, P.C., Plaintiff' Attorney, 15 W. 030 North Frontage Road, Suite 100, Burr Ridge, Illinois 60527. Attorney Number 0468002, (630) 794 5300, File No: 14-11-31307 I534046 (Published in the Northwest Herald, May 22, 29, June 5, 2013.)

PUBLIC NOTICE IN THE CIRCUIT COURT FOR THE TWENTY- SECOND JUDICIAL CIRCUIT MC HENRY COUNTY, ILLINOIS ILLINOIS STATE BANK, A DIVISION OF NORTH SHORE BANK, F.S.B. Plaintiff, -v.MICHAEL H. WILSON AND PAMELA WILSON, HUSBAND AND WIFE, et al Defendants 12 CH 1267 NOTICE OF SALE PUBLIC NOTICE IS HEREBY GIVEN that pursuant to a Judgment of Foreclosure and Sale entered in the above cause on April 5, 2013, an agent of The Judicial Sales Corporation, will at 1:00 PM on July 8, 2013, at the NLT Title L.L.C, 390 Congress Parkway, Suite D, Crystal Lake, IL, 60014, sell at public auction to the highest bidder, as set forth below, the following described real estate: Commonly known as 8420 CHESTNUT LANE, Cary, IL 60013 Property Index No. 20-17-252009. The real estate is improved with a single family residence. The judgment amount was $221,665.36. Sale terms: 25% down of the highest bid by certified funds at the close of the sale payable to The Judicial Sales Corporation. No third party checks will be accepted. The balance, including the Judicial sale fee for Abandoned Residential Property Municipality Relief Fund, which is calculated on residential real estate at the rate of $1 for each $1,000 or fraction thereof of the amount paid by the purchaser not to exceed $300, in certified funds/or wire transfer, is due within twenty-four (24) hours. No fee shall be paid by the mortgagee acquiring the residential real estate pursuant to its credit bid at the sale or by any mortgagee, judgment creditor, or other lienor acquiring the residential real estate whose rights in and to the residential real estate arose prior to the sale. The subject property is subject to general real estate taxes, special assessments, or special taxes levied against said real estate and is offered for sale without any representation as to quality or quantity of title and without recourse to Plaintiff and in "AS IS" condition. The sale is further subject to confirmation by the court. Upon payment in full of the amount bid, the purchaser will receive a Certificate of Sale that will entitle the purchaser to a deed to the real estate after confirmation of the sale. Where a sale of real estate is made to satisfy a lien prior to that of the United States, the United States shall have one year from the date of sale within which to redeem, except that with respect to a lien arising under the internal revenue laws the period shall be 120 days or the period allowable for redemption under State law, whichever is longer, and in any case in which, under the provisions of section 505 of the Housing Act of 1950, as amended (12 U.S.C. 1701k), and subsection (d) of section 3720 of title 38 of the United States Code, the right to redeem does not arise, there shall be no right of redemption. The property will NOT be open for inspection and plaintiff makes no representation as to the condition of the property. Prospective bidders are admonished to check the court file to verify all information. If this property is a condominium unit, the purchaser of the unit at the foreclosure sale, other than a mortgagee, shall pay the assessments and the legal fees required by The Condominium Property Act, 765 ILCS 605/9(g) (1) and (g)(4). If this property is a condominium unit which is part of a common interest community, the purchaser of the unit at the foreclosure sale other than a mortgagee shall pay the assessments required by The Condominium Property Act, 765 ILCS 605/18.5(g-1). IF YOU ARE THE MORTGAGOR (HOMEOWNER), YOU HAVE THE RIGHT TO REMAIN IN POSSESSION FOR 30 DAYS AFTER ENTRY OF AN ORDER OF POSSESSION, IN ACCORDANCE WITH SECTION 151701(C) OF THE ILLINOIS MORTGAGE FORECLOSURE LAW. For information, contact Plaintiff's attorney: KIMBERLY J. WEISSMAN, 633 SKOKIE BOULEVARD, SUITE 400, NORTHBROOK, IL 60062, (847) 480-0880. THE JUDICIAL SALES CORPORATION One South Wacker Drive, 24th Floor, Chicago, IL 606064650 (312) 236-SALE You can also visit The Judicial Sales Corporation at www.tjsc.com for a 7 day status report of pending sales. KIMBERLY J. WEISSMAN 633 SKOKIE BOULEVARD SUITE 400 NORTHBROOK, IL 60062 (847) 480-0880 Case Number: 12 CH 1267 TJSC#: 33-12773

NOTE: Pursuant to the Fair Debt Collection Practices Act, you are advised that Plaintiff's attorney is deemed to be a debt collector attempting to collect a debt and any information obtained will be used for that purpose. I538354 (Published in the Northwest Herald, June 5, 12, 19, 2013)

PUBLIC NOTICE IN THE CIRCUIT COURT FOR THE TWENTY- SECOND JUDICIAL CIRCUIT MC HENRY COUNTY, ILLINOIS BANK OF AMERICA, N.A., Plaintiff, -v.WESLEY M. HRESKA, et al Defendants 12 CH 1432 NOTICE OF SALE PUBLIC NOTICE IS HEREBY GIVEN that pursuant to a Judgment of Foreclosure and Sale entered in the above cause on March 20, 2013, an agent of The Judicial Sales Corporation, will at 1:00 PM on June 26, 2013, at the NLT Title L.L.C, 390 Congress Parkway, Suite D, Crystal Lake, IL, 60014, sell at public auction to the highest bidder, as set forth below, the following described real estate: Commonly known as 5516 CHANCERY WAY, Lake in the Hills, IL 60156 Property Index No. 18-26-105007. The real estate is improved with a single family residence. The judgment amount was $275,834.83. Sale terms: 25% down of the highest bid by certified funds at the close of the sale payable to The Judicial Sales Corporation. No third party checks will be accepted. The balance, including the Judicial sale fee for Abandoned Residential Property Municipality Relief Fund, which is calculated on residential real estate at the rate of $1 for each $1,000 or fraction thereof of the amount paid by the purchaser not to exceed $300, in certified funds/or wire transfer, is due within twenty-four (24) hours. No fee shall be paid by the mortgagee acquiring the residential real estate pursuant to its credit bid at the sale or by any mortgagee, judgment creditor, or other lienor acquiring the residential real estate whose rights in and to the residential real estate arose prior to the sale. The subject property is subject to general real estate taxes, special assessments, or special taxes levied against said real estate and is offered for sale without any representation as to quality or quantity of title and without recourse to Plaintiff and in "AS IS" condition. The sale is further subject to confirmation by the court. Upon payment in full of the amount bid, the purchaser will receive a Certificate of Sale that will entitle the purchaser to a deed to the real estate after confirmation of the sale. The property will NOT be open for inspection and plaintiff makes no representation as to the condition of the property. Prospective bidders are admonished to check the court file to verify all information. If this property is a condominium unit, the purchaser of the unit at the foreclosure sale, other than a mortgagee, shall pay the assessments and the legal fees required by The Condominium Property Act, 765 ILCS 605/9(g)(1) and (g)(4). If this property is a condominium unit which is part of a common interest community, the purchaser of the unit at the foreclosure sale other than a mortgagee shall pay the assessments required by The Condominium Property Act, 765 ILCS 605/18.5(g-1). IF YOU ARE THE MORTGAGOR (HOMEOWNER), YOU HAVE THE RIGHT TO REMAIN IN POSSESSION FOR 30 DAYS AFTER ENTRY OF AN ORDER OF POSSESSION, IN ACCORDANCE WITH SECTION 15-

CORDANCE WITH SECTION 151701(C) OF THE ILLINOIS MORTGAGE FORECLOSURE LAW. For information, contact Plaintiff's attorney: JOHNSON, BLUMBERG & ASSOCIATES, LLC, 230 W. Monroe Street, Suite #1125, Chicago, IL 60606, (312) 541-9710. Please refer to file number 121811. THE JUDICIAL SALES CORPORATION One South Wacker Drive, 24th Floor, Chicago, IL 606064650 (312) 236-SALE You can also visit The Judicial Sales Corporation at www.tjsc.com for a 7 day status report of pending sales. JOHNSON, BLUMBERG & ASSOCIATES, LLC 230 W. Monroe Street Suite #1125 Chicago, IL 60606 (312) 541-9710 Attorney File No. 12-1811 Case Number: 12 CH 1432 TJSC#: 33-7872 NOTE: Pursuant to the Fair Debt Collection Practices Act, you are advised that Plaintiff's attorney is deemed to be a debt collector attempting to collect a debt and any information obtained will be used for that purpose. I536193 (Published in the Northwest Herald, May 29, June 5, 12, 2013)

PUBLIC NOTICE IN THE CIRCUIT COURT FOR THE TWENTY- SECOND JUDICIAL CIRCUIT MC HENRY COUNTY, ILLINOIS BMO HARRIS BANK N.A. F/K/A HARRIS N.A. Plaintiff, -v.EMELITA S. ACOSTA, et al Defendants 12 CH 1657 NOTICE OF SALE PUBLIC NOTICE IS HEREBY GIVEN that pursuant to a Judgment of Foreclosure and Sale entered in the above cause on March 28, 2013, an agent of The Judicial Sales Corporation, will at 1:00 PM on July 1, 2013, at the NLT Title L.L.C, 390 Congress Parkway, Suite D, Crystal Lake, IL, 60014, sell at public auction to the highest bidder, as set forth below, the following described real estate: Commonly known as 949 GOLF COURSE ROAD, #7, Crystal Lake, IL 60014 Property Index No. 19-07-326022. The real estate is improved with a condominium. The judgment amount was $146,206.43. Sale terms: 25% down of the highest bid by certified funds at the close of the sale payable to The Judicial Sales Corporation. No third party checks will be accepted. The balance, including the Judicial sale fee for Abandoned Residential Property Municipality Relief Fund, which is calculated on residential real estate at the rate of $1 for each $1,000 or fraction thereof of the amount paid by the purchaser not to exceed $300, in certified funds/or wire transfer, is due within twenty-four (24) hours. No fee shall be paid by the mortgagee acquiring the residential real estate pursuant to its credit bid at the sale or by any mortgagee, judgment creditor, or other lienor acquiring the residential real estate whose rights in and to the residential real estate arose prior to the sale. The subject property is subject to general real estate taxes, special assessments, or special taxes levied against said real estate and is offered for sale without any representation as to quality or quantity of title and without recourse to Plaintiff and in "AS IS" condition. The sale is further subject to confirmation by the court. Upon payment in full of the amount bid, the purchaser will receive a Certificate of Sale that will entitle the purchaser to a deed to

PUBLIC NOTICE IN THE CIRCUIT COURT FOR THE TWENTY-SECOND JUDICIAL CIRCUIT MCHENRY COUNTY - WOODSTOCK, ILLINOIS THE BANK OF NEW YORK MELLON TRUSTEE FOR CSMC TRUST 2011-3, Plaintiff, v. JUAN FIGUEROA, ELVIRA M. FIGUEROA, UNKNOWN OWNERS AND NON-RECORD CLAIMANTS, Defendants. No. 11 CH 2650 AMENDED NOTICE OF FORECLOSURE SALE PUBLIC NOTICE is hereby given that pursuant to a Judgment of Foreclosure entered by the Court in the above-entitled cause the property hereinafter described or so much thereof as shall be sufficient to satisfy said judgment, will be sold to the highest bidder. (A) The name, address and telephone number of the person to contact for information regarding the real estate is: Kristi Kurmay, Green Tree Servicing LLC, 33600 6th Ave., S., Suite 220, Federal Way, WA 98003, (480) 333-5205. (B) The real estate is commonly known and numbered as 1325 Mulberry Lane, Crystal Lake, IL 60014. (C) The legal description of the real estate is: LOTS 3 AND 4 IN BLOCK 30 IN R.A. CEPEK'S CRYSTAL VISTA, A SUBDIVISION OF PART OF SECTION 1, TOWNSHIP 43 NORTH, RANGE 7, EAST OF THE THIRD PRINCIPAL MERIDIAN AND A PART OF SECTION 36, TOWNSHIP 44 NORTH, RANGE 7, EAST OF THE THIRD PRINCIPAL MERIDIAN, ACCORDING TO THE PLAT THEREOF RECORDED FEBRUARY 11, 1927 AS DOCUMENT NO. 76823, IN BOOK 6 OF PLATS, PAGES 18 AND 19, IN MCHENRY COUNTY, ILLINOIS. PIN #: 18-01-108-004-0000 AND 18-01-108-005-0000 (D) The time and place of the sale are: Public sale at 10:00 a.m., on June 27, 2013, inside the main hallways of McHenry County Courthouse at 2200 North Seminary Ave., Woodstock, Illinois 60098. The Property will NOT be open for inspection. (E) The terms of the sale are: Cash or certified check or the equivalent thereof. (G) Title will be conveyed without warranties, subject to all general real estate taxes which are a lien upon the real estate, but have not yet become due and payable; special assessments, if any; other exceptions, if any, set forth in the title insurance company and easements, covenants and restrictions of record. (H) IF YOU ARE THE MORTGAGOR (HOMEOWNER), YOU HAVE THE RIGHT TO REMAIN IN POSSESSION FOR 30 DAYS AFTER ENTRY OF AN ORDER OF POSSESSION, IN ACCORDANCE WITH SECTION 151701 (c) OF THE ILLINOIS MORTGAGE FORECLOSURE LAW. (I) Pursuant to 735 ILCS 5/15-1507.1, entitled "Judicial sale fee for Abandoned Residential Property Municipality Relief Fund," upon and at the sale of residential real estate under Section 15-1507, the purchaser shall pay to the person conducting the sale pursuant to Section 151507 a fee for deposit into the Abandoned Residential Property Municipality Relief Fund, a special fund created in the State treasury. The fee shall be calculated at the rate of $1.00 for each $1,000.00 or fraction thereof of the amount paid by the purchaser to the person conducting the sale, as reflected in the receipt of sale issued to the purchaser, provided that in no event shall the fee exceed $300.00. No fee shall be paid by the mortgagee acquiring the residential real estate pursuant to its credit bid at the sale or by any mortgagee, judgment creditor, or other lienor acquiring the residential real estate whose rights in and to the residential real estate arose prior to the sale. Upon confirmation of the sale under Section 15-1508, the person conducting the sale shall remit the fee to the clerk of the court in which the foreclosure case is pending. The clerk shall remit the fee to the State Treasurer as provided in this Section, to be expended for the purposes set forth in Section 7.31 of the Illinois Housing Development Act. THE BANK OF NEW YORK MELLON TRUSTEE FOR CSMC TRUST 2011-3, By: /s/ David G. Wasinger, IlBar #6200269 Michael K. Daming, IlBar #6281714 THE WASINGER LAW GROUP, P.C. Magna Place, Suite 875,1401 S. Brentwood Blvd. St. Louis, Missouri 63144 (314) 961-0400; (314) 961-2726 (Fax) Attorneys for Plaintiff s/s David G. Wasinger (Published in the Northwest Herald June 5, 12, 19, 2013) A1075


CLASSIFIED

Page E4• Wednesday, June 5, 2013 pur the real estate after confirmation of the sale. The property will NOT be open for inspection and plaintiff makes no representation as to the condition of the property. Prospective bidders are admonished to check the court file to verify all information. If this property is a condominium unit, the purchaser of the unit at the foreclosure sale, other than a mortgagee, shall pay the assessments and the legal fees required by The Condominium Property Act, 765 ILCS 605/9(g)(1) and (g)(4). If this property is a condominium unit which is part of a common interest community, the purchaser of the unit at the foreclosure sale other than a mortgagee shall pay the assessments required by The Condominium Property Act, 765 ILCS 605/18.5(g-1). IF YOU ARE THE MORTGAGOR (HOMEOWNER), YOU HAVE THE RIGHT TO REMAIN IN POSSESSION FOR 30 DAYS AFTER ENTRY OF AN ORDER OF POSSESSION, IN ACCORDANCE WITH SECTION 151701(C) OF THE ILLINOIS MORTGAGE FORECLOSURE LAW. For information, contact Plaintiff's attorney: EHRENBERG & EGAN, LLC, 321 NORTH CLARK STREET, SUITE 1430, Chicago, IL 60654, (312) 253-8640. THE JUDICIAL SALES CORPORATION One South Wacker Drive, 24th Floor, Chicago, IL 606064650 (312) 236-SALE You can also visit The Judicial Sales Corporation at www.tjsc.com for a 7 day status report of pending sales. EHRENBERG & EGAN, LLC 321 NORTH CLARK STREET SUITE 1430 Chicago, IL 60654 (312) 253-8640 Case Number: 12 CH 1657 TJSC#: 33-7900 NOTE: Pursuant to the Fair Debt Collection Practices Act, you are advised that Plaintiff's attorney is deemed to be a debt collector attempting to collect a debt and any information obtained will be used for that purpose. I536248 (Published in the Northwest Herald, May 29, June 5, 12, 2013) Find. Buy. Sell. All in one place... HERE! Everyday in Northwest Classified

PUBLIC NOTICE IN THE CIRCUIT COURT FOR THE TWENTY- SECOND JUDICIAL CIRCUIT MC HENRY COUNTY, ILLINOIS GREEN TREE SERVICING, LLC, Plaintiff, -v.ROBERT A. SVIHLIK, et al Defendants 12 CH 2567 NOTICE OF SALE PUBLIC NOTICE IS HEREBY GIVEN that pursuant to a Judgment of Foreclosure and Sale entered in the above cause on March 22, 2013, an agent of The Judicial Sales Corporation, will at 1:00 PM on June 26, 2013, at the NLT Title L.L.C, 390 Congress Parkway, Suite D, Crystal Lake, IL, 60014, sell at public auction to the highest bidder, as set forth below, the following described real estate: Commonly known as 2914 MICHAEL STREET, Wonder Lake, IL 60097 Property Index No. 09-19-127001. The real estate is improved with a single family residence. The judgment amount was $146,374.88. Sale terms: 25% down of the highest bid by certified funds at the close of the sale payable to The Judicial Sales Corporation. No third party checks will be accepted. The balance, including the Judicial sale fee for Abandoned Residential Property Municipality Relief Fund, which is calculated on residential real estate at the rate of $1 for each $1,000 or fraction thereof of the amount paid by the purchaser not to exceed $300, in certified funds/or wire transfer, is due within twenty-four (24) hours. No fee shall be paid by the mortgagee acquiring the residential real estate pursuant to its credit bid at the sale or by any mortgagee, judgment creditor, or other lienor acquiring the residential real estate whose rights in and to the residential real estate arose prior to the sale. The subject property is subject to general real estate taxes, special assessments, or special taxes levied against said real estate and is offered for sale without any representation as to quality or quantity of title and without recourse to Plaintiff and in "AS IS" ondition. Th le is

and in "AS IS" condition. The sale is further subject to confirmation by the court. Upon payment in full of the amount bid, the purchaser will receive a Certificate of Sale that will entitle the purchaser to a deed to the real estate after confirmation of the sale. The property will NOT be open for inspection and plaintiff makes no representation as to the condition of the property. Prospective bidders are admonished to check the court file to verify all information. If this property is a condominium unit, the purchaser of the unit at the foreclosure sale, other than a mortgagee, shall pay the assessments and the legal fees required by The Condominium Property Act, 765 ILCS 605/9(g)(1) and (g)(4). If this property is a condominium unit which is part of a common interest community, the purchaser of the unit at the foreclosure sale other than a mortgagee shall pay the assessments required by The Condominium Property Act, 765 ILCS 605/18.5(g-1). IF YOU ARE THE MORTGAGOR (HOMEOWNER), YOU HAVE THE RIGHT TO REMAIN IN POSSESSION FOR 30 DAYS AFTER ENTRY OF AN ORDER OF POSSESSION, IN ACCORDANCE WITH SECTION 151701(C) OF THE ILLINOIS MORTGAGE FORECLOSURE LAW. For information, contact Plaintiff's attorney: JOHNSON, BLUMBERG & ASSOCIATES, LLC, 230 W. Monroe Street, Suite #1125, Chicago, IL 60606, (312) 541-9710. Please refer to file number 123899. THE JUDICIAL SALES CORPORATION One South Wacker Drive, 24th Floor, Chicago, IL 606064650 (312) 236-SALE You can also visit The Judicial Sales Corporation at www.tjsc.com for a 7 day status report of pending sales. JOHNSON, BLUMBERG & ASSOCIATES, LLC 230 W. Monroe Street Suite #1125 Chicago, IL 60606 (312) 541-9710 Attorney File No. 12-3899 Case Number: 12 CH 2567 TJSC#: 33-9294 NOTE: Pursuant to the Fair Debt Collection Practices Act, you are advised that Plaintiff's attorney is deemed to be a debt collector attin lle debt and

tempting to collect a debt and any information obtained will be used for that purpose. I536235 (Published in the Northwest Herald, May 29, June 5, 12, 2013)

PUBLIC NOTICE Pierce & Associates File Number # 1221862 IN THE CIRCUIT COURT OF THE 22ND JUDICIAL CIRCUIT MC HENRY COUNTY, WOODSTOCK, ILLINOIS JPMORGAN CHASE BANK NATIONAL ASSOCIATION; Plaintiff, vs. MARY HANNIGAN AKA MARY T. HANNIGAN AKA MARY KOUTNY; OAK VALLEY HILLS HOMEOWNERS ASSOCIATION; UNKNOWN OWNERS AND NONRECORD CLAIMANTS; Defendants, 12 CH 2741 NOTICE OF SALE PURSUANT TO JUDGMENT OF FORECLOSURE UNDER ILLINOIS MORTGAGE FORECLOSURE LAW PUBLIC NOTICE is hereby given that pursuant to a Judgment of Foreclosure entered in the above entitled cause on January 31, 2013, Intercounty Judicial Sales Corporation will on Thursday, July 11, 2013, at the hour of 10:30 a.m. in the offices of Botto, Gilbert, Schottland & Andrle, 2030 North Seminary Avenue, Woodstock, Illinois 60098, sell to the highest bidder for cash, the following described property: P.I.N. 04-24-151-034. Commonly known as 8816 GALLERIA COURT, SPRING GROVE, IL 60081. The improvement on the property consists of a single family residence. If the subject mortgaged real estate is a unit of a common interest community, the purchaser of the unit other than a mortgagee shall pay the assessments required by subsection (g-1) of Section 18.5 of the Condominium Property Act. Sale terms: 25% down by certified funds, balance within 24 hours, by certified funds. No refunds. The property will NOT be open for inspection. Upon payment in full of the amount bid, the pur-

pur chaser will receive a Certificate of Sale which will entitle the purchaser to a Deed to the premises after confirmation of the sale. For Information: Visit our website at http://service.atty-pierce.com. Between 3 p.m. and 5 p.m. only. Pierce & Associates, Plaintiff's Attorneys, 1 North Dearborn Street, Chicago, Illinois 60602. Tel.No. (312) 476-5500. Refer to File Number 1221862. INTERCOUNTY JUDICIAL SALES CORPORATION Selling Officer, (312) 444-1122 I536639 (Published in the Northwest Herald, May 29, June 5, 12, 2013)

PUBLIC NOTICE IN THE CIRCUIT COURT OF THE 22ND JUDICIAL CIRCUIT MCHENRY COUNTY WOODSTOCK, ILLINOIS JPMorgan Chase Bank, National Association Plaintiff, Vs. George J. Mendes; et. al. Defendants, 11 CH 2257 NOTICE OF SALE PUBLIC NOTICE is hereby given that pursuant to a Judgment of Foreclosure entered in the above entitled cause on JUNE 11, 2012 LENDER SALES OF ILLINOIS LLC will on JUNE 17, 2013, at the hour of 10:30 A.M., or soon thereafter, at the front doors of the McHenry County Courthouse located at 2200 N. Seminary, Woodstock, IL 60098, sell to the highest bidder for cash, the following described property: LOT 326 IN CRYSTAL IN THE PARK UNIT TWO, BEING A PART OF THE NORTHEAST QUARTER OF THE SOUTHWEST QUARTER AND THE

Northwest Herald / NWHerald.com SOUTHEAST QUARTER OF THE SOUTHEAST QUARTER OF SECTION 18, TOWNSHIP 43 NORTH, RANGE 8 EAST OF THE THIRD PRINCIPAL MERIDIAN, ACCORDING TO THE PLAT THEREOF RECORDED JULY 14, 1988 AS DOCUMENT NO. 88R21344, IN MCHENRY COUNTY, ILLINOIS. The common address of said real estate is: 1560 Shelton Lane, Crystal Lake, IL 60014 PIN:19-18-379-037 Description of premises: RESIDENTIAL Sale Terms: 25% down by certified funds at the close of the auction: The balance, including the Judicial sale fee for Abandoned Residential Property Municipality Relief Fund, which is calculated at the rate of $1 for each $1,000 or fraction thereof of the amount paid by the purchaser not to exceed $300, in certified funds, is due within twenty-four (24) hours. The subject property is subject to general real estate taxes, special assessments or special taxes levied against said real estate and is offered for sale without any representation as to quality or quantity of title and without recourse to Plaintiff and in "as is" condition. The sale is further subject to confirmation by the court. Upon payment in full of the amount bid, the purchaser shall receive a Certificate of Sale, which will entitle the purchaser to a Deed to the real estate after confirmation of the sale. If the sale is set aside for any reason, the Purchaser at the sale shall be entitled only to a return of the deposit paid. The Purchaser shall have no further recourse against the Mortgagor, the Mortgagee or the Mortgagee's attorney." If the property is a condominium, the purchasers other than mortgagees will be required to pay any assessments and legal fees due under The Condominium Property Act, 765 ILCS 605/9(g)(1) and (g)(4). If the property is located in a common interest community, purchasers other than mortgagees will be required to pay any assessment and legal fees due under the Condominium Property Act, 765 ILCS 605/18.5(g-1). No refunds. The property will NOT be open for in ecti

prop ty op inspection. For information: Sales Clerk, Codilis and Associates, P.C., Plaintiff' Attorney, 15 W. 030 North Frontage Road, Suite 100, Burr Ridge, Illinois 60527. Attorney Number 0468002, (630) 794 5300, File No: 14-11-31307 I534046 (Published in the Northwest Herald, May 22, 29, June 5, 2013.)

PUBLIC NOTICE IN THE CIRCUIT COURT FOR THE TWENTY- SECOND JUDICIAL CIRCUIT MC HENRY COUNTY, ILLINOIS ILLINOIS STATE BANK, A DIVISION OF NORTH SHORE BANK, F.S.B. Plaintiff, -v.MICHAEL H. WILSON AND PAMELA WILSON, HUSBAND AND WIFE, et al Defendants 12 CH 1267 NOTICE OF SALE PUBLIC NOTICE IS HEREBY GIVEN that pursuant to a Judgment of Foreclosure and Sale entered in the above cause on April 5, 2013, an agent of The Judicial Sales Corporation, will at 1:00 PM on July 8, 2013, at the NLT Title L.L.C, 390 Congress Parkway, Suite D, Crystal Lake, IL, 60014, sell at public auction to the highest bidder, as set forth below, the following described real estate: LOT 21 IN VIKING HEIGHTS, A SUBDIVISION OF PART OF THE FRACTIONAL SOUTHWEST QUARTER OF THE NORTHEAST QUARTER OF SECTION 17, TOWNSHIP 43 NORTH, RANGE 9 EAST OF THE THIRD PRINCIPAL MERIDIAN, ACCORDING TO THE PLAT THEREOF RECORDED AUGUST 3, 1926, AS DOCUMENT NO. 74328, IN BOOK 5 OF PLATS, PAGE 75, SITUATED IN THE TOWNSHIP OF ALGONQUIN, MCHENRY COUNTY, ILLINOIS. Commonly known as 8420 CHESTNUT LANE, Cary, IL 60013 Property Index No. 20-17-252009. The real estate is improved with a single family residence. The judgment amount was $221,665.36. Sale terms: 25% down of the highest bid by certified funds at the close of the sale payable to The Ju-

AT YOUR SERVICE

pay dicial Sales Corporation. No third party checks will be accepted. The balance, including the Judicial sale fee for Abandoned Residential Property Municipality Relief Fund, which is calculated on residential real estate at the rate of $1 for each $1,000 or fraction thereof of the amount paid by the purchaser not to exceed $300, in certified funds/or wire transfer, is due within twenty-four (24) hours. No fee shall be paid by the mortgagee acquiring the residential real estate pursuant to its credit bid at the sale or by any mortgagee, judgment creditor, or other lienor acquiring the residential real estate whose rights in and to the residential real estate arose prior to the sale. The subject property is subject to general real estate taxes, special assessments, or special taxes levied against said real estate and is offered for sale without any representation as to quality or quantity of title and without recourse to Plaintiff and in "AS IS" condition. The sale is further subject to confirmation by the court. Upon payment in full of the amount bid, the purchaser will receive a Certificate of Sale that will entitle the purchaser to a deed to the real estate after confirmation of the sale. Where a sale of real estate is made to satisfy a lien prior to that of the United States, the United States shall have one year from the date of sale within which to redeem, except that with respect to a lien arising under the internal revenue laws the period shall be 120 days or the period allowable for redemption under State law, whichever is longer, and in any case in which, under the provisions of section 505 of the Housing Act of 1950, as amended (12 U.S.C. 1701k), and subsection (d) of section 3720 of title 38 of the United States Code, the right to redeem does not arise, there shall be no right of redemption. The property will NOT be open for inspection and plaintiff makes no representation as to the condition of the property. Prospective bidders are admonished to check the court file to verify all information. If this property is a condominium unit, the purchaser of the unit at the foreclosure sale, other than a mortgagee, shall pay the assessments and the legal fe quired by Th Cond iniu

In print daily Online 24/7

Visit the Local Business Directory online at NWHerald.com/localbusiness. Call to advertise 815-455-4800 D. K. QUALITY TUCKPOINTING & MASONRY ✦ Tuckpointing ✦ Chimney Repair/Caps

✲ ✲ ✲ ✲

HANDYMAN SERVICES

✦ Brick & Stone

Fully Insured Free Estimates

● Power

Owner Is Always On Job Site!

✲ ✲ ✲ ✲

Washing

Patios, Homes, Fences, Decks, Driveways

● Decks

● Painting ● Carpentry

847-525-9920 www.dkquality.com

● Handyman

Services

Nothing too small

Over 25 yrs experience

AFFORDABLE CLEANING SERVICE

$50 off your first $250 ● Low Rates ● Senior Discounts ● Free

SUMMER SPECIAL! Buy 4 cleaning sessions & receive the 5 th one at ½ off! 15 Years Experience. Owner Operated.

Estimates

♦ ♦ ♦ ♦ ♦

Call Mike & Get It Done RIGHT! 815-823-3161

847-778-1122

Father & Son Heating * Furnace & A/C Insulations * Duck Work & Gas Pipings * Commercial/Residential & Maintenance Service

Fully Insured Free Estimates

FREE ESTIMATES FULLY INSURED

30 + Years Established 847-630-2223

JUNK REMOVAL SERVICES ! Springtime !

Free Pick-Up Appliances, Electronics Any Kind of Metal or Batteries

LUCAS CUSTOM CONCRETE

WOODSTOCK PAVING SERVICE

815-482-8406

Custom Design of Patios

✦ 5% OFF ✦

Driveways, Including Stamped, Color, and Exposed Concrete.

All Paving jobs Residential/Commercial Patching/Seal Coating Overlay Paving Concrete FREE ESTIMATES FULLY INSURED ALL WORK GUARANTEED

We also specialize in Brick & Stone Work Bobcat & Trucking Serv. Provided

815-355-9661

815-337-7279 woodstockpavingservice.com

Imperial Drywall & Remodeling ✦ ✦ ✦ ✦ ✦

Home Repair Hang, Tape & Repair Framing & Insulation Basement Finishing Our Specialty: Electrical & Plumbing Repairs

FREE ESTIMATES Insured, Quality Work Reasonable Rates

Northwest Herald Classified It works.

815-735-0779 Have a photo you'd like to share? Upload it to our online photo album at NWHerald.com/MyPhotos

McHenryCountySports.com is McHenry County Sports Having a Birthday, Anniversary, Graduation or Event Coming Up?

Send your Classified Advertising 24/7 to:

Share It With Everyone by Placing a HAPPY AD!

Find !t here! PlanitNorthwest.com

Northwest Herald Classified 800-589-8237 www.nwherald.com

Buying? Selling? Renting? Hiring? To place an ad, call 800-589-8237 Northwest Herald Classified

Email: classified@ shawsuburban.com Fax: 815-477-8898 or online at: www.nwherald.com

WE'VE GOT IT! Northwest Classified 800-589-8237 www.NWHerald.com

TEXT ALERTS Sign up for TextAlerts to receive up-to-date news, weather, prep sports, coupons and more sent directly to your cell phone! Register for FREE today at

NWHerald.com

Need Help Rebuilding, Repairing or Replanting? Don't See What You're Looking For Today? Check Back Tomorrow! Never The Same Paper Twice! Northwest Classified 800-589-8237 www.nwherald.com

Check out the

DON'T NEED IT? SELL IT FAST! Northwest Classified Call 800-589-8237

At Your Service Directory in the back of Classified and on PlanitNorthwest.com/business for a list of Local Professionals.


CLASSIFIED

Northwest Herald / NWHerald.com pay lega fees required by The Condominium Property Act, 765 ILCS 605/9(g) (1) and (g)(4). If this property is a condominium unit which is part of a common interest community, the purchaser of the unit at the foreclosure sale other than a mortgagee shall pay the assessments required by The Condominium Property Act, 765 ILCS 605/18.5(g-1). IF YOU ARE THE MORTGAGOR (HOMEOWNER), YOU HAVE THE RIGHT TO REMAIN IN POSSESSION FOR 30 DAYS AFTER ENTRY OF AN ORDER OF POSSESSION, IN ACCORDANCE WITH SECTION 151701(C) OF THE ILLINOIS MORTGAGE FORECLOSURE LAW. For information, contact Plaintiff's attorney: KIMBERLY J. WEISSMAN, 633 SKOKIE BOULEVARD, SUITE 400, NORTHBROOK, IL 60062, (847) 480-0880. THE JUDICIAL SALES CORPORATION One South Wacker Drive, 24th Floor, Chicago, IL 606064650 (312) 236-SALE You can also visit The Judicial Sales Corporation at www.tjsc.com for a 7 day status report of pending sales. KIMBERLY J. WEISSMAN 633 SKOKIE BOULEVARD SUITE 400 NORTHBROOK, IL 60062 (847) 480-0880 Case Number: 12 CH 1267 TJSC#: 33-12773 NOTE: Pursuant to the Fair Debt Collection Practices Act, you are advised that Plaintiff's attorney is deemed to be a debt collector attempting to collect a debt and any information obtained will be used for that purpose. I538354 (Published in the Northwest Herald, June 5, 12, 19, 2013)

PUBLIC NOTICE IN THE CIRCUIT COURT FOR THE TWENTY- SECOND JUDICIAL CIRCUIT MC HENRY COUNTY, ILLINOIS BANK OF AMERICA, N.A., Plaintiff, -v.WESLEY M. HRESKA, et al Defendants 12 CH 1432 NOTICE OF SALE PUBLIC NOTICE IS HEREBY GIVEN that pursuant to a Judgment of Foreclosure and Sale entered in the

above cause on March 20, 2013, an agent of The Judicial Sales Corporation, will at 1:00 PM on June 26, 2013, at the NLT Title L.L.C, 390 Congress Parkway, Suite D, Crystal Lake, IL, 60014, sell at public auction to the highest bidder, as set forth below, the following described real estate: LOT 41 IN SPRING LAKE FARM SOUTH UNIT 1, BEING A SUBDIVISION IN THE WEST 1/2 OF THE NORTHWEST 1/4 OF SECTION 26, TOWNSHIP 43 NORTH, RANGE 7, EAST OF THE THIRD PRINCIPAL MERIDIAN, ACCORDING TO THE PLAT THEREOF RECORDED SEPTEMBER 30, 1993 AS DOCUMENT 93R58543, IN MCHENRY COUNTY, ILLINOIS. Commonly known as 5516 CHANCERY WAY, Lake in the Hills, IL 60156 Property Index No. 18-26-105007. The real estate is improved with a single family residence. The judgment amount was $275,834.83. Sale terms: 25% down of the highest bid by certified funds at the close of the sale payable to The Judicial Sales Corporation. No third party checks will be accepted. The balance, including the Judicial sale fee for Abandoned Residential Property Municipality Relief Fund, which is calculated on residential real estate at the rate of $1 for each $1,000 or fraction thereof of the amount paid by the purchaser not to exceed $300, in certified funds/or wire transfer, is due within twenty-four (24) hours. No fee shall be paid by the mortgagee acquiring the residential real estate pursuant to its credit bid at the sale or by any mortgagee, judgment creditor, or other lienor acquiring the residential real estate whose rights in and to the residential real estate arose prior to the sale. The subject property is subject to general real estate taxes, special assessments, or special taxes levied against said real estate and is offered for sale without any representation as to quality or quantity of title and without recourse to Plaintiff and in "AS IS" condition. The sale is further subject to confirmation by the court. Upon payment in full of the amount bid, the purchaser will receive a Certificate of Sale that will title th ch a deed

entitle the purchaser to a deed to the real estate after confirmation of the sale. The property will NOT be open for inspection and plaintiff makes no representation as to the condition of the property. Prospective bidders are admonished to check the court file to verify all information. If this property is a condominium unit, the purchaser of the unit at the foreclosure sale, other than a mortgagee, shall pay the assessments and the legal fees required by The Condominium Property Act, 765 ILCS 605/9(g)(1) and (g)(4). If this property is a condominium unit which is part of a common interest community, the purchaser of the unit at the foreclosure sale other than a mortgagee shall pay the assessments required by The Condominium Property Act, 765 ILCS 605/18.5(g-1). IF YOU ARE THE MORTGAGOR (HOMEOWNER), YOU HAVE THE RIGHT TO REMAIN IN POSSESSION FOR 30 DAYS AFTER ENTRY OF AN ORDER OF POSSESSION, IN ACCORDANCE WITH SECTION 151701(C) OF THE ILLINOIS MORTGAGE FORECLOSURE LAW. For information, contact Plaintiff's attorney: JOHNSON, BLUMBERG & ASSOCIATES, LLC, 230 W. Monroe Street, Suite #1125, Chicago, IL 60606, (312) 541-9710. Please refer to file number 121811. THE JUDICIAL SALES CORPORATION One South Wacker Drive, 24th Floor, Chicago, IL 606064650 (312) 236-SALE You can also visit The Judicial Sales Corporation at www.tjsc.com for a 7 day status report of pending sales. JOHNSON, BLUMBERG & ASSOCIATES, LLC 230 W. Monroe Street Suite #1125 Chicago, IL 60606 (312) 541-9710 Attorney File No. 12-1811 Case Number: 12 CH 1432 TJSC#: 33-7872 NOTE: Pursuant to the Fair Debt Collection Practices Act, you are advised that Plaintiff's attorney is deemed to be a debt collector at-

tempting to collect a debt and any information obtained will be used for that purpose. I536193 (Published in the Northwest Herald, May 29, June 5, 12, 2013)

PUBLIC NOTICE IN THE CIRCUIT COURT FOR THE TWENTY- SECOND JUDICIAL CIRCUIT MC HENRY COUNTY, ILLINOIS BMO HARRIS BANK N.A. F/K/A HARRIS N.A. Plaintiff, -v.EMELITA S. ACOSTA, et al Defendants 12 CH 1657 NOTICE OF SALE PUBLIC NOTICE IS HEREBY GIVEN that pursuant to a Judgment of Foreclosure and Sale entered in the above cause on March 28, 2013, an agent of The Judicial Sales Corporation, will at 1:00 PM on July 1, 2013, at the NLT Title L.L.C, 390 Congress Parkway, Suite D, Crystal Lake, IL, 60014, sell at public auction to the highest bidder, as set forth below, the following described real estate: UNIT 949-7, TOGETHER WITH ITS UNDIVIDED INTEREST IN THE COMMON ELEMENTS IN CAMELOT CONDOMINIUMS OF CRYSTAL LAKE, ACCORDING TO THE CONDOMINIUM DECLARATION RECORDED AS DOCUMENT NUMBER 2007R0052621 ON AUGUST 1, 2007, AND AS AMENDED FROM TIME TO TIME IN THE OFFICE OF MCHENRY COUNTY RECORDER OF DEEDS, BEING A PART OF LOT 1 IN COLONY SQUARE UNIT 2, BEING A SUBDIVISION IN SECTION 7, TOWNSHIP 43 NORTH, RANGE 8, EAST OF THE THIRD PRINCIPAL MERIDIAN, ACCORDING TO THE PLAT THEREOF RECORDED JULY 22, 1985 AS DOCUMENT 912725, IN MCHENRY COUNTY, ILLINOIS. Commonly known as 949 GOLF COURSE ROAD, #7, Crystal Lake, IL 60014 Property Index No. 19-07-326022. The real estate is improved with a condominium. The judgment amount was $146,206.43. Sale terms: 25% down of the highest bid by certified funds at the

highe by close of the sale payable to The Judicial Sales Corporation. No third party checks will be accepted. The balance, including the Judicial sale fee for Abandoned Residential Property Municipality Relief Fund, which is calculated on residential real estate at the rate of $1 for each $1,000 or fraction thereof of the amount paid by the purchaser not to exceed $300, in certified funds/or wire transfer, is due within twenty-four (24) hours. No fee shall be paid by the mortgagee acquiring the residential real estate pursuant to its credit bid at the sale or by any mortgagee, judgment creditor, or other lienor acquiring the residential real estate whose rights in and to the residential real estate arose prior to the sale. The subject property is subject to general real estate taxes, special assessments, or special taxes levied against said real estate and is offered for sale without any representation as to quality or quantity of title and without recourse to Plaintiff and in "AS IS" condition. The sale is further subject to confirmation by the court. Upon payment in full of the amount bid, the purchaser will receive a Certificate of Sale that will entitle the purchaser to a deed to the real estate after confirmation of the sale. The property will NOT be open for inspection and plaintiff makes no representation as to the condition of the property. Prospective bidders are admonished to check the court file to verify all information. If this property is a condominium unit, the purchaser of the unit at the foreclosure sale, other than a mortgagee, shall pay the assessments and the legal fees required by The Condominium Property Act, 765 ILCS 605/9(g)(1) and (g)(4). If this property is a condominium unit which is part of a common interest community, the purchaser of the unit at the foreclosure sale other than a mortgagee shall pay the assessments required by The Condominium Property Act, 765 ILCS 605/18.5(g-1). IF YOU ARE THE MORTGAGOR (HOMEOWNER), YOU HAVE THE RIGHT TO REMAIN IN POSSESSION FOR 30 DAYS AFTER ENTRY OF AN ORDER OF POSSESSION, IN ACCORDANCE WITH SECTION 151701(C) OF THE ILLINOIS MORTGAGE FORECLOSURE LAW.

Wednesday, June 5, 2013 • Page E5 (C) GAGE FORECLOSURE LAW. For information, contact Plaintiff's attorney: EHRENBERG & EGAN, LLC, 321 NORTH CLARK STREET, SUITE 1430, Chicago, IL 60654, (312) 253-8640. THE JUDICIAL SALES CORPORATION One South Wacker Drive, 24th Floor, Chicago, IL 606064650 (312) 236-SALE You can also visit The Judicial Sales Corporation at www.tjsc.com for a 7 day status report of pending sales. EHRENBERG & EGAN, LLC 321 NORTH CLARK STREET SUITE 1430 Chicago, IL 60654 (312) 253-8640 Case Number: 12 CH 1657 TJSC#: 33-7900 NOTE: Pursuant to the Fair Debt Collection Practices Act, you are advised that Plaintiff's attorney is deemed to be a debt collector attempting to collect a debt and any information obtained will be used for that purpose. I536248 (Published in the Northwest Herald, May 29, June 5, 12, 2013)

PUBLIC NOTICE IN THE CIRCUIT COURT FOR THE 22nd JUDICIAL CIRCUIT, MCHENRY COUNTYWOODSTOCK, ILLINOIS. Citimortgage, Inc., Plaintiff, vs. James A. Simpson, et al. 12 CH 1835 Notice to Heirs and Legatees. Notice is hereby given to you, the Unknown Heirs and Unknown Legatees of the decedent(s), James A. Simpson, that on March 4, 2013, an order was entered by the Court, naming William P. Butcher, 2044 Ridge Road, Homewood, Illinois 60430, Tel. No. (708) 799-0600, as the Special Representative of the above named decedent(s) under 735 ILCS 13-1209 (Death of a Party). The cause of action for the Foreclosure of a certain Mortgage upon the premises commonly known as: 4515 Ashley Dr. McHenry, Il 60050. I536096 (Published in the Northwest Herald, May 29, June 5, 12, 2013)

AT YOUR SERVICE

PUBLIC NOTICE IN THE CIRCUIT COURT FOR THE TWENTY- SECOND JUDICIAL CIRCUIT MC HENRY COUNTY, ILLINOIS GREEN TREE SERVICING, LLC, Plaintiff, -v.ROBERT A. SVIHLIK, et al Defendants 12 CH 2567 NOTICE OF SALE PUBLIC NOTICE IS HEREBY GIVEN that pursuant to a Judgment of Foreclosure and Sale entered in the above cause on March 22, 2013, an agent of The Judicial Sales Corporation, will at 1:00 PM on June 26, 2013, at the NLT Title L.L.C, 390 Congress Parkway, Suite D, Crystal Lake, IL, 60014, sell at public auction to the highest bidder, as set forth below, the following described real estate: LOT 10, BLOCK 22 IN WONDERVIEW UNIT 1, A SUBDIVISION OF THE NORTH 66 FEET OF LOT 2 OF THE SOUTHWEST 1/4 OF SECTION 19 AND LOT 2 OF THE NORTHWEST 1/4 OF SECTION 19, TOWNSHIP 45 NORTH, RANGE 8, EAST OF THE THIRD PRINCIPAL MERIDIAN, AND THE EAST 1/2 OF THE NORTHEAST 1/4 OF SECTION 24, (EXCEPT THE SOUTH 885 FEET) IN TOWNSHIP 45 NORTH, RANGE 7, EAST OF THE THIRD PRINCIPAL MERIDIAN, ACCORDING TO THE PLAT THEREOF RECORDED MARCH 11, 1952 AS DOCUMENT 251543, IN BOOK 11 OF PLATS, PAGE 44, AND AS AMENDED BY INSTRUMENTS RECORDED AS DOCUMENT 254535 AND 268736, IN MCHENRY COUNTY, ILLINOIS. Commonly known as 2914 MICHAEL STREET, Wonder Lake, IL 60097 Property Index No. 09-19-127001. The real estate is improved with a single family residence. The judgment amount was $146,374.88. Sale terms: 25% down of the highest bid by certified funds at the close of the sale payable to The Judicial Sales Corporation. No third party checks will be accepted. The balance, including the Judicial sale fee for Abandoned Residential Property Municipality Relief Fund, which is lculated sidential

op ty pality which is calculated on residential real estate at the rate of $1 for each $1,000 or fraction thereof of the amount paid by the purchaser not to exceed $300, in certified funds/or wire transfer, is due within twenty-four (24) hours. No fee shall be paid by the mortgagee acquiring the residential real estate pursuant to its credit bid at the sale or by any mortgagee, judgment creditor, or other lienor acquiring the residential real estate whose rights in and to the residential real estate arose prior to the sale. The subject property is subject to general real estate taxes, special assessments, or special taxes levied against said real estate and is offered for sale without any representation as to quality or quantity of title and without recourse to Plaintiff and in "AS IS" condition. The sale is further subject to confirmation by the court. Upon payment in full of the amount bid, the purchaser will receive a Certificate of Sale that will entitle the purchaser to a deed to the real estate after confirmation of the sale. The property will NOT be open for inspection and plaintiff makes no representation as to the condition of the property. Prospective bidders are admonished to check the court file to verify all information. If this property is a condominium unit, the purchaser of the unit at the foreclosure sale, other than a mortgagee, shall pay the assessments and the legal fees required by The Condominium Property Act, 765 ILCS 605/9(g)(1) and (g)(4). If this property is a condominium unit which is part of a common interest community, the purchaser of the unit at the foreclosure sale other than a mortgagee shall pay the assessments required by The Condominium Property Act, 765 ILCS 605/18.5(g-1). IF YOU ARE THE MORTGAGOR (HOMEOWNER), YOU HAVE THE RIGHT TO REMAIN IN POSSESSION FOR 30 DAYS AFTER ENTRY OF AN ORDER OF POSSESSION, IN ACCORDANCE WITH SECTION 151701(C) OF THE ILLINOIS MORTGAGE FORECLOSURE LAW. For information, contact Plaintiff's attorney: JOHNSON, BLUMBERG & ASSOCIATES, LLC, 230 W. Monroe Street, Suite #1125, Chicago, IL 60606, (312) 541-9710. Pl fe file be 12

In print daily Online 24/7

Visit the Local Business Directory online at NWHerald.com/localbusiness. Call to advertise 815-455-4800

A-Yard

EVERCHANGING LANDSCAPING ResidentIal!Commercial ✤ ✤ ✤ ✤ ✤ ✤ ✤ ✤

Mulch Planting Lawn Maintenance Patios Walkways Retaining Walls Driveways Brick & Flagstone

.com

Nippersink

Since 1995 Mulch

Landscape Supply

-Fine Ground Hardwood: Red, Brown, and Black -Premium Bark -Clean Play Chips -Regular Wood Chips

SUMMER

FREE ESTIMATES! 815-560-1943 lisamgplus5@yahoo.com

✦Tuckpointing ✦Chimney Rebuilding

Mulch Specials double ground triple ground ruby red top soil compost gravel

Soil & Rock -Garden Mix -Compost -Driveway Gravel -Large & Sml River Rock -Pea Gravel -Play Sand -Decorative Color Gravel -Pond Rock -Flagstone -Boulders -Large Accent Stones & More! Come Check Our Selection!

A. M. R. CONTRACTING, INC.

✦All

$30.00 $32.00 $45.00 $30.00 $30.00 $30.00

Free Estimate. Fully Insured

All work is Guaranteed.

847-857-8783 In business since 1998 with an unrivaled commitment to detail and quality workmanship.

www.AnchorMasonry.com

“INSTALLATION AVAILABLE” Free Delivery to Richmond, Spring Grove & Johnsburg

NOTICE

For More Info, or to schedule delivery; 8713 NORTH SOLON ROAD

PUBLICATION POLICIES This publication reserves the right to edit or reject any ads without comment. This publication is careful to review all advertising but the burden of truthful content belongs to the advertiser. We use standard abbreviations and we reserve the right to properly classify your ad. All ads are subject to credit approval. We reserve the right to require prepayment. We accept cash, check, Visa, Mastercard and Discover. CHECK YOUR AD Please check your ad the first day it is published. If you see an error, call us immediately and it will be corrected for the next available publication date. Our liability is for only one publication date and shall not exceed the total cost of the first day of publication.

www.mulchmania.com

815-675-0900 847-514-9671 847-833-2598

SPECIAL: Cypress Bags $1.50/ea Installation available! Professional Landscaping and tree service

Pick up or Delivery

815-385-4560

CASA AFFORDABLE PAINTING 40 Years Exp. ● ● ● ● ● ●

Dark Brown Mulch

$25 Cubic Yard Installed JOBS ANNOUNCEMENTS STUFF VEHICLES REAL ESTATE SERVICES Northwest Herald Classified and online at: NWHerald.com

815-482-6990 Delivery Available! Having a Birthday, Anniversary, Graduation or Event Coming Up? Share It With Everyone by Placing a HAPPY AD!

CAN'T GET ENOUGH BEARS NEWS? Get Bears news on Twitter by following @bears_insider

Northwest Herald Classified 800-589-8237 www.nwherald.com

and Repairs types of masonry work

EXTERIOR/INTERIOR CEDAR STAINING TRIM PAINTING DECKS/FENCES POWER WASHING ALUM. PAINTING PROFESSIONAL KITCHEN & BATH DESIGN/REMODEL

We are At Your Service!

A. JAYNE ROOFING

INSTANT SMART PHONE

FREE ESTIMATES M. Casamento 815-823-2722 800-BIG-CASA

Free Estimates

ALL TYPES OF ROOFING

casadecorating.com Follow Northwest Herald on Twitter @nwherald

Send your Classified Advertising 24/7 to: Email: classified@ shawsuburban.com Fax: 815-477-8898 or online at: www.nwherald.com

Northwest Classified 800-589-8237 www.NWHerald.com

TEXT ALERTS

36 Years Exp.

5% OFF With This Ad

Sign up for TextAlerts to receive up-to-date news, weather, prep sports, coupons and more sent directly to your cell phone!

815-334-8616 847-931-2433

Register for FREE today at

O.C.F. Preferred Contractor

NWHerald.com

The Northwest Herald reaches 137,000 adult readers in print every week, and 259,000 unique visitors on NWHerald.com every month.

BBB - Excellent Angie's List Member

Call to advertise in the At Your Service directory. Need Help Rebuilding, Repairing or Replanting? Check out the

At Your Service Directory in the back of Classified and on PlanitNorthwest.com/business for a list of Local Professionals.

In the Northwest Herald classified everyday and on PlanitNorthwest Local Business Directory 24 hours a day, 7 days a week.

planitnorthwest.com/business

800-589-8237

classified@shawsuburban.com


CLASSIFIED

Page E6• Wednesday, June 5, 2013 OFFICIAL PUBLICATION OF REAL ESTATE ASSESSMENTS FOR 2013 NOTICE TO RICHMOND TOWNSHIP TAXPAYERS: ASSESSED VALUES FOR 2013 Valuation date (35 ILCS 200/9-95): January 1, 2013 Required level of assessment (35 ILCS 200/9-145): 33.33% Valuation based on sales from (35 ILCS 200/1-155): 2010-2012 Publication is hereby made for equalized assessed valuations for real property in this township in accordance with 35 ILCS 200/12-10. As required by 35 ILCS 200/9-210 and 35 ILCS 200/10-115, the following equalization factors have been applied to bring the assessments to the statutorily required three-year median level of 33.33%: Farm Land: 1.0000 Farm Improvements: 1.0000 Non-Farm Land: 0.9589 Non-Farm Improvements: 0.9589 Questions about these valuations should be directed to: PATRICIA O’NEILL 7812 S RT 31, RICHMOND IL 60071 (815) 678-2014 N/A Office hours are: BY APPT Property in this Township, other than farmland and coal, is to be assessed at a 33.33% median level of assessment, based on the fair cash value of the property. You may check the accuracy of your assessment by dividing your assessment by the median level of assessment. The resulting value should equal the estimated fair cash value of your property. If the resulting value is greater than the estimated fair cash value of your property, you may be over-assessed. If the resulting value is less than the fair cash value of your property, you may be under-assessed. You may appeal your assessment to the Board of Review. If you believe your property’s fair cash value is incorrect or that the equalized assessed valuation is not uniform with other comparable properties in the same neighborhood, the following steps should be taken: • Contact your township assessor’s ofice to review the assessment. • If not satisied with the assessor review, taxpayers may file a complaint with the McHenry County Board of Review. For complaint forms, instructions, and the Rules and Procedures of the Board of Review, call (815) 334-4290 or visit www.co.mchenry.il.us/ departments/assessments/Pages/ FormsRules.aspx. • The inal iling deadline for your township is generally 30 days from this publication date. After this date, the Board of Review is prohibited by law from accepting assessment complaints for properties in this township. For more information on complaint deadlines, call (815) 334-4290 or visit: www. co.mchenry.il.us/departments/assessments/ PDFDocs/BORReport.pdf. Your property may be eligible for homestead exemptions, which can reduce your property’s taxable assessment. For more information on homestead exemptions, call (815) 334-4290. Your property tax bill will be calculated as follows: Final Equalized Assessed Value – Exemptions = Taxable Assessment; Taxable Assessment x Current Tax Rate = Total Tax Bill. All equalized assessed valuations are subject to further equalization and revision by the McHenry County Board of Review as well as equalization by the Illinois Department of Revenue. Robert H. Ross, ASA, Chief County Assessment Officer, McHenry County, Illinois A list of assessment changes for this township for the current assessment year, except those assessments that were decreased only as a result of the township equalization factor noted above, is as follows: 04-01-300-001 04-01-300-003 04-01-300-004 04-01-400-001 04-01-400-003 04-01-400-004 04-01-400-005 04-01-400-006 04-01-400-008 04-01-400-009 04-01-400-010 04-01-400-011 04-01-400-012 04-01-400-014 04-01-400-015 04-01-400-016 04-01-400-017 04-02-301-011 04-02-331-005 04-02-331-006 04-02-351-005 04-02-376-002 04-02-400-001 04-02-400-002 04-02-400-008 04-02-476-009 04-03-100-001 04-03-200-001 04-03-300-001 04-03-300-004 04-03-400-001 04-04-100-006 04-04-300-012 04-04-300-027 04-04-300-032 04-04-300-034 04-04-300-035 04-04-326-006

CHGO TITLE TR CO TR 1093626 ST BANK OF THE LAKES 98 101 CHGO CENTRAL NATL BK TR 22846 CHGO CENTRAL NATL BK TR 22846 KOSINSKI, EDWARD A KOSINSKI, EDWARD A KOSINSKI, EDWARD A KOSINSKI, EDWARD HELEN BERG, WALTER A/MARLENE K LUDTKE, ELLEN REV TR VOIGHT, MARY E LIV TR BAGBY, MAVIS H CHGO CENTRAL NATL BK TR 22846 BOLSINGER, JAMES A PATRICIA R KASOVIC, JAMES M JANET ZARNSTORFF, F F TR 1 & V TR 1 ZARNSTORFF , VIRGENE TR 1 ET PETERKA, DONALD YVONNE ULVEN, KAREN A BLES, ROBERT F CATHERINE B VARGA, EDITH M NEALS, PATRICIA PETERKA, DONALD YVONNE CHGO TITLE TR CO TR 1093626 ST BANK OF LAKES 98 101 MUCEK, MARK W CAROLYN J NORTHWEST NATL BK TR 6748 NORTHWEST NATL BK TR 6748 NORTHWEST NATL BK TR 6748 WILSON , NANCY DECL OF TR ET NORTHWEST NATL BK TR 6748 LAURINE, DAVID J BUCKLES, COLETTE G DECL OF TR FOUNTAINHEAD COMMERCE UNIT I FOUNTAINHEAD COMMERCE UNIT II FOUNTAINHEAD COMMERCE UNIT II FOUNTAINHEAD COMMERCE UNIT I FOUNTAINHEAD COMMERCE UNIT II

5,416 191 1,472 119 50,442 480 118 62,989 62,482 74,879 70,796 42,090 2,895 49,496 31,445 48,687 61,474 36 52,770 351 29,394 55,676 68,027 1,360 45 102,606 243 132 72,168 372 579 1,808 5,512 4 104 2,255 3,829 3

04-04-376-013 04-04-376-016 04-04-376-017 04-04-377-001 04-04-377-004 04-04-400-003 04-04-400-010 04-04-400-021 04-04-400-022 04-04-400-023 04-04-400-028 04-04-400-030 04-05-100-004 04-05-300-005 04-05-300-006 04-05-400-005 04-05-400-006 04-06-100-001 04-06-100-002 04-06-200-002 04-06-200-003 04-06-300-004 04-06-300-006 04-06-300-007 04-06-400-002 04-06-400-005 04-06-400-007 04-06-400-008 04-06-400-009 04-07-100-001 04-07-100-002 04-07-100-004 04-07-100-005 04-07-200-001 04-07-200-002 04-07-200-003 04-07-300-002 04-07-300-004 04-07-300-005 04-07-300-006 04-07-300-007 04-07-400-001 04-07-400-004 04-07-400-005 04-08-100-004 04-08-100-011 04-08-100-012 04-08-200-013 04-08-300-002 04-08-300-006 04-08-300-007 04-08-300-008 04-08-400-008 04-08-400-016 04-08-400-017 04-09-126-015 04-09-151-007 04-09-182-005 04-09-201-002 04-09-202-006 04-09-252-014 04-09-252-052 04-09-276-007 04-09-276-008 04-09-277-001 04-09-277-007 04-09-278-023 04-09-334-016 04-09-352-004 04-09-452-038 04-10-100-002 04-10-100-003 04-10-100-004 04-10-100-009 04-10-153-001 04-10-200-006 04-10-200-013 04-10-200-014 04-10-200-015 04-10-200-016 04-10-200-017 04-10-300-001 04-10-300-002 04-10-300-003 04-10-400-003 04-10-400-004 04-10-400-005 04-10-400-006 04-10-400-007 04-10-400-008 04-10-400-009 04-11-100-013 04-11-100-015 04-11-100-016 04-11-100-019 04-11-100-020 04-11-100-021 04-11-100-022 04-11-100-023 04-11-100-027 04-11-200-008 04-11-200-010 04-11-200-011 04-11-276-007 04-11-277-008 04-11-300-002 04-11-377-002 04-11-400-006 04-11-400-010 04-11-400-017 04-11-400-019 04-11-400-020 04-11-400-022 04-11-400-023 04-11-400-024 04-11-401-008 04-11-451-013 04-12-100-003 04-12-100-004 04-12-100-005 04-12-100-006 04-12-200-003 04-12-200-004 04-12-200-005 04-12-200-006 04-12-300-013 04-12-300-014 04-12-300-015 04-12-300-016 04-12-300-018 04-12-300-020 04-12-300-021 04-12-300-022 04-12-301-001 04-12-400-022 04-13-100-001 04-13-100-002 04-13-100-004 04-13-126-001 04-13-126-002 04-13-126-003 04-13-200-011 04-13-200-012 04-13-200-013 04-13-254-009 04-13-254-011

FOUNTAINHEAD COMMERCE UNIT II FOUNTAINHEAD COMMERCE UNIT II FOUNTAINHEAD COMMERCE UNIT II FOUNTAINHEAD COMMERCE UNIT II FOUNTAINHEAD COMMERCE UNIT II NORTHWEST NATL BK TR 6748 SIX WONDERS LLC EX TECH PLASTICS INC NORTHWEST NATL BK TR 6748 NORTHWEST NATL BK TR 6748 SIX WONDERS LLC SIX WONDERS LLC ROBINSON PROP INC ROBINSON PROP INC ROBINSON PROP INC FOUNTAINHEAD COMMERCE UNIT I 815 PALLETS INC HAMMERSTROM, GABE HANSEN FARMS LP HANSEN FARMS LP ROBINSON, MICHAEL H DIANA J JACOBSON, RICHARD L ARLENE LASALLE BK NA TR 51958 HANSEN FARMS LP LASALLE BK NATL ASSOC TR 5195 HANSEN FARMS LP MICHELS, CAROL E HEANEY, ROBERT C ROBINSON PROP INC JACOBSON, RICHARD L ARLENE JACOBSON, RICHARD L ARLENE HANSEN FARMS LP HANSEN FARMS LP HANSEN FARMS LP FOSZCZ, RUSSELL REV TR WEXLER, SAMUEL S ET AL POPENHAGEN, BARBARA J DAVID L POPENHAGEN, BARBARA J DAVID L LASALLE NATL BK TR 51958 BEESE, EVELYN A REV TR BEESE, EVELYN A REV TR LASALLE NATL BK TR 51958 KOLTON, WILLIAM ANTHONY ET AL WEXLER, SAMUEL S ET AL KUEBKER, PATRICK SBA2012TC ASSETS LLC SBA2012TC ASSETS LLC GS THIRD GEN LLC BARBER, AUDREY C WALTER E TR GS THIRD GEN LLC GS THIRD GEN LLC SUBURBAN BK TR CO TR 74 3011 TAMARACK FARMS LLC TAMARACK FARMS LLC TAMARACK FARMS LLC HOME STATE BANK NA 4387 CHGO TITLE TR CO TR 1079609 MCDONALDS CORP 012 1240 RICHMOND STATE BANK KRAUS, EDMUND W JENNIFER S PALATINE NATL BANK 4108 FRACE BW, MICHEHL JL TR ANDERSON, RAY J/NANCY J TR ANDERSON, M J/CRAIG G E * PEILER, WENDY B HENDEE, LIV FAM TR BAPPERT, JOSEPH F ELIZABETH E GILARDI, PHILIP NIPPERSINK SCHL DIST 2 HASSELBURG K B, NICHOLSON S J WILSON, NANCY DECL OF TR ET A RICHMOND HUNTING CLUB INC RICHMOND HUNTING CLUB INC RICHMOND HUNTING CLUB INC TUCSEK, RALPH DIANE C RICHMOND HUNTING CLUB INC VARGA, ERNEST J KAREN S J WOODSTOCK HARRIS BANK 5434 WOODSTOCK HARRIS BANK 5216 WDSTK HARRIS BK TR 5435 WOODSTOCK HARRIS BANK 5216 RICHMOND HUNTING CLUB INC GRAF, RICHARD R ELAINE C RICHMOND HUNTING CLUB INC RICHMOND HUNTING CLUB INC ELLISH, RICHARD J CHERYL R T SKALA, MICHAEL SKALA, C A LIV TR M J SKALA, C A LIV TR M J RICHMOND HUNTING CLUB INC HERNANDEZ, EMMA WDSTK HARRIS BK TR 3897 WOODSTOCK HARRIS BANK 3897 WOODSTOCK HARRIS BANK 5216 WOODSTOCK HARRIS BANK 5433 WDSTK HARRIS BK 5216 WOODSTOCK HARRIS BANK 5432 WOODSTOCK HARRIS BANK 5216 VARGA, ERNEST ELEONORE R ROBERT ALLEN INVSTMNTS LLC ROBERT ALLEN INVSTMNTS LLC GAUGER, GARY A GAUGER, GARY A HUFFMAN, ROBERT M JANET R DUEX, THOMAS JANET E ROBERT ALLEN INVSTMNTS LLC PLOTSKY, FRED D BARBARA K MATICH, M/P/M TR* KRANZ, JAMES M CHRISTINA M SCHNEIDER, M M C FAM TR RAFFAUF, DALE KIMBERLY RAYBLACK DEVELOP LLC DURNIAT, CYNTHIA A DURNIAT, WALTER ROBERT ALLEN INVSTMNTS LLC MERLO, FRANK D III PAULA RAE COMM PROP TR CHGO CENTRAL NATL BK TR 22846 CHGO CENTRAL NATL BK TR 22846 GAUGER, GINGER A GAUGER, GINGER A CHGO CENTRAL NATL BK TR 22846 LASALLE NATL BANK 10-22846-0 LASALLE NATL BANK 10-22846-0 LASALLE NATL BANK 10-22846-0 CAMPBELL, CHERI ELLIS TR 2003 CAMPBELL, CHERI ELLIS TR 2003 ELLIS, ROBERT F JR ELLIS, ROBERT F JR HARVARD ST BK LAND TR 723 HARVARD ST BK LAND TR 723 HARVARD ST BK LAND TR 723 PALOMBI, P J ADAMS T A JAROCKI, JAROSLAW MARZENA CHGO TITLE TR CO TR 1074050 MATICH, M/P/M TR* MATICH, M/P/M TR* ELLIS, ROBERT F JR CV2 LLC CV2 LLC CV2 LLC BARR HARRIS BK TR 114119 BUSCHMAN HOMES LLC BUSCHMAN HOMES LLC MCHUGH, DONALD V BRIAN P MCHUGH, DONALD V PATSY A

Northwest Herald / NWHerald.com 4 221 4 3 1,630 1,768 1,444 639 969 38,771 240 490 1,076 1,996 224 1,091 455,792 549 4,574 2,486 117,390 18,134 79,264 289 5,765 7,748 42,314 94,994 54,236 72,204 41,725 8,185 58,443 15,672 146,625 13,482 50,297 732 1,546 66,316 325 99,574 17,176 9,940 87,215 7,742 50,822 100 85,126 3,388 275 58,925 14,831 122,025 3,661 82 32,213 335,165 181,422 76,150 7,872 90,973 59,349 47,124 72,421 83,681 72,900 99,005 2,642 27,749 353 504 4,012 115,204 79,901 8,839 39,158 198 47 47,981 18 6,154 29,522 10,378 5,041 583 78,596 543 358 8,242 63,904 255 39,350 19 383 57 594 90 69 6,856 2,279 566 15,228 87,265 108,478 805 129,170 19 92,027 479 128,287 1,149 641 536 414 113,647 4,795 4,359 21,688 25,948 646 1,013 557 1,465 10,272 1,582 95,452 1,319 1,239 4,185 2,761 906 104,730 352 1,436 29,794 1,070 56,840 4,795 4,795 4,795 127,038 45 3,544 4,795 132,468

04-13-300-008 04-13-300-020 04-13-300-021 04-13-300-022 04-13-301-009 04-13-351-007 04-13-400-005 04-13-400-006 04-13-401-011 04-13-402-013 04-13-402-015 04-13-402-018 04-13-426-003 04-14-100-006 04-14-200-010 04-14-200-012 04-14-200-019 04-14-200-020 04-14-200-021 04-14-200-024 04-14-200-025 04-14-200-026 04-14-200-027 04-14-300-004 04-14-300-010 04-14-400-003 04-14-400-018 04-14-400-019 04-14-400-022 04-14-400-023 04-14-400-032 04-14-400-033 04-15-101-001 04-15-101-002 04-15-102-010 04-15-203-001 04-15-204-008 04-15-226-003 04-15-226-004 04-15-226-005 04-15-226-006 04-15-276-001 04-15-300-009 04-15-300-011 04-15-400-003 04-15-400-004 04-15-400-008 04-16-101-005 04-16-151-001 04-16-151-003 04-16-151-004 04-16-176-003 04-16-203-033 04-16-230-014 04-16-252-014 04-16-252-015 04-16-252-021 04-16-301-002 04-16-301-003 04-16-326-001 04-16-351-001 04-16-352-001 04-16-376-002 04-16-400-005 04-16-400-008 04-16-400-009 04-17-100-002 04-17-100-004 04-17-200-003 04-17-300-001 04-17-300-005 04-17-300-006 04-17-300-007 04-17-300-008 04-17-400-002 04-17-400-005 04-17-400-006 04-18-100-002 04-18-100-003 04-18-100-004 04-18-100-005 04-18-100-008 04-18-200-001 04-18-200-003 04-18-200-005 04-18-300-001 04-18-400-002 04-18-400-003 04-18-400-004 04-19-100-001 04-19-100-002 04-19-100-003 04-19-200-001 04-19-200-002 04-19-200-003 04-19-200-004 04-19-200-005 04-19-200-006 04-19-300-001 04-19-300-002 04-19-400-007 04-19-400-008 04-19-400-013 04-19-400-014 04-20-100-001 04-20-100-005 04-20-200-003 04-20-200-005 04-20-200-007 04-20-300-015 04-20-300-024 04-20-300-025 04-20-300-026 04-20-300-028 04-20-400-003 04-20-400-004 04-20-400-005 04-21-100-015 04-21-100-017 04-21-226-002 04-21-251-003 04-21-251-012 04-21-251-017 04-21-251-018 04-21-251-020 04-21-251-021 04-21-276-001 04-21-300-021 04-21-300-023 04-21-300-024 04-21-400-013 04-21-400-029 04-21-400-030 04-21-400-031 04-21-400-035 04-22-100-001 04-22-100-005 04-22-100-007 04-22-100-008 04-22-200-001 04-22-200-005 04-22-200-006 04-22-200-008 04-22-200-009

WINN, EDWARD T ERMA M REV TR HEIL, DONALD J/CHARLENE J HEIL, DONALD J/CHARLENE J HEIL, DONALD J/CHARLENE J HAGEN, SCOTT ERDMANN, FAM TR KINSCH, G R C L KINSCH, G R C L TIEMAN, ROGER J LINDA L KEOING, WILLIAM B SUSAN R GEHRIG, ROBERT W WILEEN A ROTH, CORINNE REV LIV TR SMITH, RAYMOND A SUSAN L SOLON RD FARM LLC COOK, DAVID/LORI LANZER, WILLIAM A/LINDA C RUCKDESCHEL, JEROME CRUZ, FRANCISCO/JUANA FOX, KEVIN E WANDA SOWINSKI, DANIEL 1ST MIDWEST TR CO TR 6723 CABALLERO, MIGUEL SYLVIA MILLER, TIMOTHY P TRUDY K SOLON RD FARM LLC SOLON RD FARM LLC H O E FARMS LLC CANALLE, JOHN F LINDSEY J CANALLE, JOHN F LINDSEY J NELSON, WILLIAM R NELSON, WILLIAM R SOLON RD FARM LLC LASALLE BK NA TR 133572 MAY DEVELOP CO AMER COMM BK TR MAY, SANDRA F ALEXANDER, DONALD J KATHLEEN BATT, THAYER R TAUNYA L TR CONT IL NATL BK 56596 BLASCHAK CONSTR CO BLASCHAK CONSTR CO BLASCHAK CONSTR CO SCHMITT, KEVIN MARCAMP INVSTMNTS LLC MARCAMP INVSTMNTS LLC DOMENELLA, FAM LP 1 DOMENELLA, FAM LP 1 MARCAMP INVSTMNTS LLC TAMARACK FARMS LLC TAMARACK FARMS LLC TAMARACK FARMS LLC TAMARACK FARMS LLC TAMARACK FARMS LLC DUNCAN, GREGORY MAY DEVELOP CO MAY DEVELOP CO MAY DEVELOP CO AMER COMM BK TR TAMARACK FARMS LLC TAMARACK FARMS LLC TAMARACK FARMS LLC TAMARACK FARMS LLC TAMARACK FARMS LLC TAMARACK FARMS LLC PIONEER TR SVGS BK TR 15520 HOFFMAN, EUGENE V JR PIONEER TR SVGS BK TR 15520 SUBURBAN BK TR CO TR 74 3011 BARBER, AUDREY C WALTER E TR TAMARACK FARMS LLC SUBURBAN BK TR CO TR 74 3011 OLSEN, CHARLES TR 78 OLSEN, ALAN S ET AL * OLSEN, ALAN S ET AL* OLSEN, ALAN S ET AL* TAMARACK FARMS LLC TAMARACK FARMS LLC TAMARACK FARMS LLC POPENHAGEN, BARBARA J DAVID L POPENHAGEN, BARBARA J DAVID L LASALLE NATL BK TR 51958 LASALLE NATL BK TR 51958 POPENHAGEN, BARBARA J DAVID L LASALLE NATL BK TR 51958 RUCK, A W JR 1998 QTIP TR * WOIT, PAUL H GWEN JCC REALTY LLC JCC REALTY LLC OLSEN, ALAN S ET AL* JCC REALTY LLC JCC REALTY LLC STILLING , R A P A TR 80 1ST MIDWEST BANK 13390 1ST MIDWEST BANK 13390 WAYNE HUMMER TR CO NA TR 2276 1ST MIDWEST BANK 13390 SCHWIND REV LIV TR SCHWIND REV LIV TR WOODSTOCK HARRIS BANK 5672 STILLING, R A P A TR 80 STANFEL, S J SR/D A TR * WAYNE HUMMER TR CO NA TR 2276 SALVI, ALBERT J KATHLEEN R HOLIAN, C J SR REV TR HOLIAN, C J L SR REV TR SCHWIND REV LIV TR WOODSTOCK HARRIS BANK 5672 TAMARACK FARMS LLC TAMARACK FARMS LLC TAMARACK FARMS LLC EASTABROOKS, A A/A TAMARACK FARMS LLC TAMARACK FARMS LLC 1ST MIDWEST BK TR 1175 MICHMERSHUIZEN, GERALD T HOLIAN, 2009 FAM TR ET AL TAMARACK FARMS LLC TAMARACK FARMS LLC TAMARACK FARMS LLC TAMARACK FARMS LLC LASALLE NATL TR NA TR 119504 CEMAIL, ADNAN THERESA A WILCOSKI, ROBERT G A BERGSMA, RONALD L BARBARA A BERGSMA, RONALD L BARBARA A LUNA, ALFREDO LUNA, ALFREDO CHGO TITLE TR CO TR 34025 TAMARACK FARMS LLC TAMARACK FARMS LLC HOLIAN, DENNIS P CHRISTINE SURGIPATH MEDICAL IND INC CHGO TITLE TR CO TR 34025 ORSOLINI, ALEXANDER L DOROTHY STANDARD BK TR TRS TR 20456 MCHENRY CO CONSERV DIST LASALLE NATL TR 119504 ET AL MARCAMP INVSTMNTS LLC LASALLE NATL TR 119504 ET AL SALTOUROS, NICHOLAS STAVROULA MARCAMP INVSTMNTS LLC KAMINSCKY, M E C B ORTIZ, JOSE M JUAN C KICK, ROSALIE TR 30811 KRIEGER, L D/STRIMPLE S D

Continue on next page

85,731 112 112 82,703 52,021 78,053 53,261 247 4,795 4,795 153,908 138,300 4,795 16,840 124,198 102,850 167,573 144,054 96,036 120,903 1,301 74,746 3,142 5,301 3,404 129,780 257 61,353 3,172 63,127 687 88,572 105 1,501 100,050 81,268 136,774 208,409 613 106 282 2,465 2,237 174 2,235 49,207 1,284 3,530 2,784 476 19 697 12,620 603 997 11 6,656 792 70 40 312 3,923 41,707 1,705 62,723 55,090 12,592 15,071 83,995 278 53,593 72,540 1,555 5,010 1,744 1,192 5,822 3,952 5,925 5,076 8,263 96,411 17,890 149,652 7,353 52,242 14,406 6,175 51,389 8,859 13,257 21,628 15,181 3,954 4,239 6,688 2,981 6,763 19,572 99,418 168,060 227 23 49,255 53,643 6,048 6,941 7,376 2,081 26,302 3,287 1,686 34,517 52,947 3,600 4,112 2,370 50 16,202 1,160 136,065 62,101 18,956 52,433 72,522 757 754 2,249 1,018 59,975 1,614,849 1,375 14,598 2,837 555 4,203 5,306 667 574 19,759 71,012 64,403 46,829 64,221


CLASSIFIED

Northwest Herald / NWHerald.com Continued from previous page 04-22-200-011 04-22-200-012 04-22-200-014 04-22-200-015 04-22-200-018 04-22-200-019 04-22-200-020 04-22-200-021 04-22-300-022 04-22-300-040 04-22-300-041 04-22-301-115 04-22-377-009 04-22-400-010 04-22-400-012 04-22-400-016 04-22-400-017 04-22-400-026 04-22-400-033 04-23-101-005 04-23-126-002 04-23-177-014 04-23-200-001 04-23-200-002 04-23-200-009 04-23-301-001 04-23-351-011 04-23-376-004 04-23-400-004 04-23-400-010 04-23-400-011 04-23-400-012 04-23-427-005 04-24-100-005 04-24-151-017 04-24-176-004 04-24-276-011 04-24-300-008 04-24-300-009 04-24-300-015 04-24-300-016 04-24-300-017 04-24-300-019 04-24-401-005 04-24-401-008 04-24-401-009 04-24-451-002 04-24-476-020 04-24-476-023 04-25-101-005 04-25-151-011 04-25-151-016 04-25-152-028 04-25-152-033 04-25-154-001 04-25-154-002 04-25-154-005 04-25-154-006 04-25-251-002 04-25-278-004 04-25-279-012 04-25-279-022 04-25-300-011 04-25-300-026 04-25-352-003 04-25-377-006 04-25-400-004 04-25-400-009 04-25-400-014 04-25-400-041 04-25-402-002 04-26-128-004 04-26-128-005 04-26-152-004 04-26-176-006 04-26-176-007 04-26-200-005 04-26-200-009 04-26-200-012

BARTSCH, MARYANN M JOHN W EASTERBERG, JOHN C/JUDITH B RISCHE, KURT G PATRICIA L HODNIK, ANTHONY PATRICIA SOLON RD LLC SOLON RD LLC EASTERBERG, JOHN C/JUDITH B EASTERBERG, JOHN C/JUDITH B CHGO TITLE TR CO TR 34025 THOMAS FAM LIV TR, THOMAS, BRENT WALTER ZAUGH, SHERRY ANTHONY RABELHOFER, M J B S GARDNER, ROBERT W FAM TR GARDNER, ROBERT W FAM TR BLAKE, EUGENE C SHEA, RYAN G KELLY J GARDNER, DAVID B CYNTHIA M ANDERSON, CLYDE R REBECCA P SMITH, LARRY E CECILY R MAZUR, JOHN M JULIA L GEEVER, JOHN E DEBRAH ANN SOLON RD FARM LLC GRCIC, MILOS JANA MAZUR, JOHN M JULIA L THURLWELL, JEFFREY B GARDNER, WILLIAM B GARDNER, E/M/RIGGINS V EVEN, NORMAN A ROSEMARY K MILLER, CONRAD J VIRGINIA L SPRING RIDGE PRTNS LP REID, RICHARD L ET AL * MILLER, RODNEY MELANIE WINN, EDWARD T/ERMA M REV TR GIANNONI, JEFFREY M AMANDA M PINKA, REIN/ROBERTA A KUJAWA, DONALD L DONNA E BLAKE, EUGENE C BOI, JAMES P MICHAEL W ERIK D SCOT FORGE CO BLAKE, EUGENE C COMM OF FAITH LUTH CHURCH LTD BLAKE, EUGENE C BRADEN, RAYMOND G LAKES ST BK TR 2002 131 BRADEN, RAYMOND G THELEN SAND GRAVEL INC ST PETERS CHURCH LORENZ, GERRY H TR KRIEGER, FAM LIV TR CHGO AMER NATL BK 12425708 1 7705 INDUSTRIAL DR LLC MB LLC WEIDNER SCHILLER LLC IND DR SPRING GROVE LLC IND DR SPRING GROVE LLC IND DR SPRING GROVE LLC IND DR SPRING GROVE LLC DRL LLC BOELKOW, RUSSELL W SANDRA A FALLON, DAVID M SPRING GROVE MALL INC ST BK OF THE LAKES TR 2004127 LASALLE BANK NA 11736810 WALCK, EDWARD A KATHRYN A NELSON, MICHAEL S/LESLIE J KOEPKE WALTER C DECL OF TR PT LLC BAPA LLC 2222 PIERCE DR LLC HOME ST BK NA TR 4162 MCDONALDS USA LLC ALLES, JAMES REV TR GARDNER, E/M/RIGGINS V JANDA, RUDOLPH W III CHGO AMER NATL BK 12425708 GARDNER, WILLIAM B CHGO AMER NATL BK 12425708 CHGO AMER NATL BK 12425708 CHGO AMER NATL BK 12425708

(3 ) Please refer to file number 123899. THE JUDICIAL SALES CORPORATION One South Wacker Drive, 24th Floor, Chicago, IL 606064650 (312) 236-SALE You can also visit The Judicial Sales Corporation at www.tjsc.com for a 7 day status report of pending sales. JOHNSON, BLUMBERG & ASSOCIATES, LLC 230 W. Monroe Street Suite #1125 Chicago, IL 60606 (312) 541-9710 Attorney File No. 12-3899 Case Number: 12 CH 2567 TJSC#: 33-9294 NOTE: Pursuant to the Fair Debt Collection Practices Act, you are advised that Plaintiff's attorney is deemed to be a debt collector attempting to collect a debt and any information obtained will be used for that purpose. I536235 (Published in the Northwest Herald, May 29, June 5, 12, 2013)

PUBLIC NOTICE Pierce & Associates File Number # 1221862 IN THE CIRCUIT COURT OF THE 22ND JUDICIAL CIRCUIT MC HENRY COUNTY, WOODSTOCK, ILLINOIS JPMORGAN CHASE BANK NATIONAL ASSOCIATION; Plaintiff, vs. MARY HANNIGAN AKA MARY T. HANNIGAN AKA MARY KOUTNY; OAK VALLEY HILLS HOMEOWNERS ASSOCIATION; UNKNOWN OWNERS AND NONRECORD CLAIMANTS; Defendants, 12 CH 2741 NOTICE OF SALE PURSUANT TO JUDGMENT OF FORECLOSURE UNDER ILLINOIS MORTGAGE FORECLOSURE LAW PUBLIC NOTICE is hereby given that pursuant to a Judgment of Foreclosure entered in the above entitled cause on January 31, 2013, Intercounty Judicial Sales Corporation will on Thursday, July 11, 2013, at the hour of 10:30 a.m. in the offices of Botto, Gilbert, Schottland & Andrle, 2030 North Seminary Avenue, Woodstock, Illinois 60098, sell to the highest bidder for cash, the following described property: LOT 11 IN OAK VALLEY ESTATES UNIT NO. 1, A SUBDIVISION OF PART OF THE NORTHWEST QUARTER OF SECTION 24, TOWNSHIP 46 NORTH, RANGE 8 EAST OF THE THIRD PRINCIPAL MERIDIAN, ACCORDING TO THE PLAT THEREOF RECORDED JUNE 28, 1990 AS DOCUMENT NO. 90R023555, IN MCHENRY COUNTY, ILLINOIS. P.I.N. 04-24-151-034. Commonly known as 8816 GALLERIA COURT, SPRING GROVE, IL 60081. The improvement on the property consists of a single family residence. If the subject mortgaged real estate is a unit of a common interest community, the purchaser of the unit other than a mortgagee shall pay the assessments required by subsection (g-1) of Section 18.5 of the Condominium Property Act. Sale terms: 25% down by certified funds, balance within 24 hours, by certified funds. No refunds. The property will NOT be

open for inspection. Upon payment in full of the amount bid, the purchaser will receive a Certificate of Sale which will entitle the purchaser to a Deed to the premises after confirmation of the sale. For Information: Visit our website at http://service.atty-pierce.com. Between 3 p.m. and 5 p.m. only. Pierce & Associates, Plaintiff's Attorneys, 1 North Dearborn Street, Chicago, Illinois 60602. Tel.No. (312) 476-5500. Refer to File Number 1221862. INTERCOUNTY JUDICIAL SALES CORPORATION Selling Officer, (312) 444-1122 I536639 (Published in the Northwest Herald, May 29, June 5, 12, 2013)

PUBLIC NOTICE UNITED STATES OF AMERICA STATE OF ILLINOIS COUNTY OF McHENRY IN THE CIRCUIT COURT OF THE TWENTY-SECOND JUDICIAL CIRCUIT MCHENRY COUNTYWOODSTOCK, ILLINOIS BMO Harris Bank N.A. f/k/a Harris N.A.,Plaintiff vs. Ludwig Gilgien; Mary A. Gilgien; The Americana Homes Homeowners Assocation; Unknown Owners and Non-Record Claimants, Defendants. Case Number 12 CH 3092 The requisite affidavit for publication having been filed, notice is hereby given to you, Mary A. Gilgien, Unknown Owners and Non-Record Claimants, Defendant (s) in the above entitled suit, that the said suit has been commenced in the 22nd Judicial Circuit Court of McHenry County, Illinois, by the Plaintiff(s) against you and other defendants, praying for the foreclosure of a certain Mortgage conveying the premises described as follows, to wit: LOT 332 IN SPRING LAKE FARMS CLUSTER HOMES – PHASE 2, BEING A SUBDIVISION OF PART OF THE SOUTHWEST QUARTER OF SECTION 23, TOWNSHIP 43 NORTH, RANGE 7 EAST OF THE THIRD PRINCIPAL MERIDIAN, EXCEPT THAT PART OF 332 LYING WESTERLY OF THE FOLLOWING DESCIRBED LINE: BEGINNING AT A POINT ON THE NORTHERLY LINE OF SAID LOT 332, BEING 37.08 FOOT EASTERLY OF THE NORTHEAST CORNER THEREOF; THENCE SOUTH 17 DEGREES 07 MINUTES 33 SECONDS EAST 57.49 FEET TO A POINT ON THE SOUTHERLY LINE OF SAID LOT 332, BEING 37.19 FEET EASTERLY OF THE SOUTHWEST CORNER THEREOF, AS MEASURED ALONG SAID SOUTHERLY LINE; ALSO EXCEPT THAT PART OF LOT 332 LYING EASTERLY OF THE FOLLOWING DESCRIBED LINE: BEGINNING AT A POINT ON THE NORTHERLY LINE OF SAID LOT 332, BEING 37.14 FEET WESTERLY OF THE NORTHEAST CORNER THEREOF, THENCE SOUTH 17 DE-

46,191 923 49,645 76,772 56,773 2,071 882 52,794 259 46,051 167 13,664 59,257 3,935 514 4,522 125,116 3,443 86,064 76,248 7,606 65,071 6,126 5,970 977 35,601 994 7,990 41,302 13,252 6,338 1,174 85,111 64,477 80,651 62,681 68,671 1,494 115,613 70,089 3,068 378 17 637 35,012 1,707 296 214 231,638 5 562 285,674 269,139 21,966 39,973 27,567 99,804 32,472 398,862 49,878 49,483 193,122 64,988 120 111,218 96,454 49,739 212,117 549,248 60,224 246,589 48,720 517 347 294 377 358 1,341 40,719

04-26-200-014 04-26-200-016 04-26-200-017 04-26-302-002 04-26-327-008 04-26-426-012 04-26-477-011 04-27-100-005 04-27-100-006 04-27-201-002 04-27-226-020 04-27-226-021 04-27-276-001 04-27-276-002 04-27-300-002 04-27-300-005 04-27-300-007 04-27-400-001 04-27-400-006 04-27-451-004 04-28-100-017 04-28-100-018 04-28-200-006 04-28-200-007 04-28-200-017 04-28-200-026 04-28-200-029 04-28-300-004 04-28-400-004 04-28-400-006 04-29-100-002 04-29-100-006 04-29-100-008 04-29-100-009 04-29-200-001 04-29-200-002 04-30-100-001 04-30-100-003 04-30-100-010 04-30-100-011 04-30-100-012 04-30-100-013 04-30-100-014 04-30-100-015 04-30-100-016 04-30-200-006 04-30-200-010 04-30-200-012 04-30-200-013 04-30-200-017 04-30-200-018 04-30-200-019 04-30-200-022 04-30-200-023 04-30-200-026 04-30-200-027 04-30-300-001 04-30-300-003 04-30-300-004 04-30-300-005 04-30-300-006 04-30-300-007 04-30-300-008 04-30-400-006 04-30-400-010 04-30-400-011 04-30-400-012 04-30-400-013 04-31-100-008 04-31-100-009 04-31-100-010 04-31-100-016 04-31-100-017 04-31-100-019 04-31-100-020 04-31-100-021 04-31-200-009 04-31-200-018 04-31-200-019 04-31-301-025

GREES 07 MINUTES EAST 70.03 FEET TO A POINT ON THE SOUTHERLY LINE OF SAID LOT 332, BEING 37.52 FEET WESTERLY OF THE SOUTHEAST CORNER THEREOF, AS MEASURED ALONG SAID SOUTHERLY LINE, ACCORDING TO THE PLAT THEREOF RECORDED DECEMBER 11, 1991 AS DOCUMENT 91R47865, IN MCHENRY COUNTY, ILLINOIS. COMMONLY KNOWN AS: 13 Redbug Court Lake In The Hills, IL 60156 P.I.N.: 18-24-302-080 and which said Mortgage was made by Ludwig Gilgien and Mary A. Gilgien Mortgagor(s), to BMO Harris Bank, N.A. f/k/a Harris N.A. as Mortgagee, and recorded in the Office of the Recorder of Deeds of McHenry County, Illinois as Document No. 2005R0081627. And for such other relief prayed; that summons was duly issued out of the said 22nd Judicial Circuit Court against you as provided by law, and that the said suit is now pending. NOW, THEREFORE, UNLESS YOU, the said above defendant(s), file your answer to the complaint in the said suit, or otherwise make your appearance therein, in the Office of the Clerk of the 22nd Judicial Circuit Court, at the McHenry County Circuit Clerk, 2200 North Seminary Avenue, Woodstock, Illinois 60098 on or before the 10th day of July, 2013 default may be entered against you at any time after that day and a decree entered in accordance with the prayer of said complaint. Dated: May 20, 2013 at Woodstock, Illinois /s/ Katherine M. Keefe Clerk of the 22nd Judicial Circuit Court, McHenry County, Illinois EHRENBERG & EGAN, LLC Attorney for Plaintiff BMO Harris Bank, N.A. f/k/a Harris N.A. 321 North Clark Street Suite 1430 Chicago, IL 60654 312-253-8640 (Published in the Northwest Herald June 5, 12, 19, 2013. #A1062)

PUBLIC NOTICE ADOPTION NOTICE ) STATE OF ILLINOIS ) ss COUNTY OF MCHENRY ) IN THE CIRCUIT COURT FOR THE 22nd JUDICIAL CIRCUIT McHENRY COUNTY, ILLINOIS IN THE MATTER OF THE ADOPTION OF TYRESE PARISE, a Male Child. Adoption NO: 13 AD 7 ADOPTION NOTICE To: ANNETTE PARISE and ALL TO WHOM IT MAY CONCERN Take notice that a petition was filed in the Circuit Court of McHenry

CHGO AMER NATL BK 12425708 CHGO AMER NATL BK 12425708 CHGO AMER NATL BK 12425708 MAY, EDWARD M LUELLA K DERUBEIS, DOUGLAS GERALD EBJB PROP LLC KILLIAN, CHRISTINE GARDNER, ROBERT W TR C&S DAIRY FARM GARDNER, ROBERT W FAM TR GARDNER, ROBERT W FAM TR GARDNER, ROBERT W MARITAL TR GARDNER, ROBERT W TR GARDNER, ROBERT W TR MCHENRY CO CONSERV DIST KARSTENSON, CAROLE A TR ET AL MCHENRY CO CONSERV DIST MAY, E M/L K MCHENRY CO CONSERV DIST DITTMER, SCOTT V CATHY A HOLIAN, TRAVIS DAWN MCHENRY CO CONSERV DIST WIDEN, TIMOTHY J CITIZENS 1ST NATL BK TR 54348 BEHM, RICHARD A LINDA KAY TR EMERY, HOWARD E NANCY ANN WEIDNER, BERNARD L COX, CAROLYN R TR MCHENRY CO CONSERV DIST KARSTENSON, CAROLE A TR ET AL TAMARACK FARMS LLC CARVER, MARIAN GRACE ANDREW BALLAGH, L RENNIE TR JACOBS, BEN H JR SUSAN TAMARACK FARMS LLC HOLIAN, 2009 FAM TR ET AL HOLIAN, D J T M STANFEL, S J SR/D A TR * KNOX, MARK R GAIL M CLIFFWOOD FARM LLC EMMONS , BETTY LOU TR ET AL HOLIAN, SUSAN REV TR WDSTK 1ST NATL BK 1809 STILLING, R A P A TR 80 HOLIAN, TIMOTHY AMANDA C RWK FARM LLC WAYNE HUMMER TR CO NA TR 2276 MAHONEY, ROBERT SANDRA BAUMAN, GERALD F DIANE M RWK FARM LLC ZAMASTIL, DALE A DONNA M VELDHUIZEN, VERNON L ALICE M HARRIS, DONALD L VERA M HARRIS, DONALD STANFEL, STEPHEN JR SANDRA HARRIS, DONALD WDSTK 1ST NATL BK 1809 WDSTK ST BK TR 1962 WDSTK ST BK TR 1962 SHERWIN, GORDON MARGARET CURTIS, B/MATHIA G* SHERWIN, GORDON/MARGARET SHERWIN, GORDON MARGARET WDSTK ST BK TR 1962 PREJNA, ROBERT L NICOLE J SHEETS, MICHAEL DENISE PREJNA, L J A C REV TR PREJNA, L J A C REV TR DEMS, KENNETH F CHRISTINE A VALENTINE, WALTER D JANE B VALENTINE, WALTER D ET AL GARRELTS, STEPHEN STADE, VERNON MADDEN, DAVID J EVP TR MADDEN, DAVE FREUND, SCOTT DEANNA MEYER, KARL THATCHER JEAN 1ST MIDWEST BANK 3950 BONITZ, FRANK FAM TR

County, Illinois, for the adoption of a child named TYRESE PARISE. Now, therefore, unless you, ANNETTE PARISE and ALL TO WHOM IT MAY CONCERN, file your answer to the Petition in the action or otherwise file your appearance therein, in the office of the Circuit Clerk of McHenry County, 2200 North Seminary Avenue, Woodstock, Illinois, on or before the 5th day of July, 2013 a default may be entered against you at any time that day and a judgment entered in accordance with the prayer of said Petition. Dated 5-16-2013, At Woodstock, Illinois. Katherine M. Keefe Circuit Clerk of Court Carl W. Gilmore ARDC#6225019 Woodstock Legal Consultants Attorneys for Petitioners 127 E. Calhoun St. Woodstock, Illinois 60098 (815) 338-5297 (Published in the Northwest Herald May 22, 29, June 5, 2013. #A970)

PUBLIC NOTICE IN THE CIRCUIT COURT OF THE 22nd JUDICIAL CIRCUIT MC HENRY COUNTY WOODSTOCK, ILLINOIS Ameritrust Mortgage Corporation Plaintiff, vs. Elizabeth Seegers a/k/a Elizabeth E. Hardt; City of Harvard; Capital One Bank (USA), N.A.; Unknown Heirs and Legatees of David C. Seegers; Unknown Owners and Nonrecord Claimants; Richard Kuhn, as Special Representative Defendants. Case No. 13 CH 00015 NOTICE TO HEIRS AND LEGATEES Notice is hereby given to you, the Unknown Heirs and Unknown Legatees of the decedent, David C. Seegers, that on April 30, 2013, an order was entered by the Court, naming Richard W. Kuhn, 552 S. Washington Street, Suite 100, Naperville, Illinois 60540, Tel. No. (630) 420-8228, as the Special Representative of the above named decedent under 735 ILCS 13-1209 (Death of a Party). The cause of action for the Foreclosure of a certain Mortgage upon the premises commonly known as: 506 W. Roosevelt Road, Harvard, IL 60033. (Published in the Northwest Herald May 29, 2013, June 5, 12, 2013 A1035)

PUBLIC NOTICE IN THE CIRCUIT COURT FOR THE 22nd JUDICIAL CIRCUIT, MCHENRY COUNTYWOODSTOCK, ILLINOIS. Citimortgage, Plaintiff, vs. Teresa Bajon, et al.

13 CH 171 Notice to Heirs and Legatees. Notice is hereby given to you, the Unknown Heirs and Unknown Legatees of the decedent(s), Teresa Bajon, that on April 25, 2013, an order was entered by the Court, naming William P. Butcher, 2044 Ridge Road, Homewood, Illinois 60430, Tel. No. (708) 799-0600, as the Special Representative of the above named decedent(s) under 735 ILCS 13-1209 (Death of a Party). The cause of action for the Foreclosure of a certain Mortgage upon the premises commonly known as: 11015 Preservation Way Richmond, IL 60071. I536098 (Published in the Northwest Herald, May 29, June 5, 12, 2013)

PUBLIC NOTICE IN THE CIRCUIT COURT OF THE 22nd JUDICIAL CIRCUIT MC HENRY COUNTY WOODSTOCK, ILLINOIS Wells Fargo Bank, N.A., Plaintiff, vs. Dawn Miller; Discover Bank; Capital One Bank (USA), N.A.; Unknown Heirs and Legatees of James Joseph Miller; Josephine Miller, possible minor, Unknown Owners and Nonrecord Claimants; Richard Kuhn, as Special Representative for James Joseph Miller (deceased), Defendants. Case No. 13 CH 00182 NOTICE TO HEIRS AND LEGATEES Notice is hereby given to you, the Unknown Heirs and Unknown Legatees of the decedent, James Joseph Miller, that on April 23, 2013, an order was entered by the Court, naming Richard W. Kuhn, 552 S. Washington Street, Suite 100, Naperville, Illinois 60540, Tel. No. (630) 420-8228, as the Special Representative of the above named decedent under 735 ILCS 13-1209 (Death of a Party). The cause of action for the Foreclosure of a certain Mortgage upon the premises commonly known as: 251 Hickory Drive, Crystal Lake, IL 60014. (Published in the Northwest Herald May 22, 29, 2013, June 5, 2013 A976)

PUBLIC NOTICE IN THE CIRCUIT COURT FOR THE 22nd JUDICIAL CIRCUIT, MCHENRY COUNTYWOODSTOCK, ILLINOIS. Genworth Financial Home Equity Access, Plaintiff, vs. Elynor J. Dencker, et al. 13 CH 199 Notice to Heirs and Legatees. Notice is hereby given to you, the Unknown Heirs and Unknown Legatees of the decedent(s), Elynor J. Dencker, that on May 2, 2013, an order was entered by the Court, naming William P. Butcher, 2044

Wednesday, June 5, 2013 • Page E7 1,917 3,558 1,412 56,564 59,803 712 86,020 33,900 4,597 7,945 1,439 573 105,363 2,655 9 30,114 15,952 9,223 7,980 164,865 66,502 3,704 48,288 38,111 3,361 94,029 3,622 36 26 3,187 5,938 3,804 75,107 49,000 6,403 4,440 557 17 31,868 426,747 58,411 141,281 4,187 41,107 179 86,799 46 68,338 222 365 62,485 73,198 218 66 47 82,953 1,507 734 38,952 2,125 117,277 61,838 2,474 1,073 108,334 82,413 81,649 376 36,010 572 458 3,022 2,568 43,296 7,709 11,721 144,616 2,149 63,152 1,472

04-31-301-026 04-31-326-004 04-31-326-005 04-31-328-003 04-31-351-001 04-31-376-001 04-31-401-001 04-31-426-009 04-31-452-003 04-31-476-004 04-32-300-015 04-33-200-014 04-33-300-001 04-33-400-007 04-34-100-002 04-34-100-003 04-34-100-004 04-34-100-007 04-34-100-008 04-34-100-011 04-34-200-001 04-34-200-003 04-34-200-011 04-34-200-012 04-34-200-014 04-34-200-016 04-34-200-017 04-34-200-018 04-34-200-019 04-34-200-020 04-34-200-021 04-34-200-022 04-34-300-004 04-34-300-006 04-34-300-007 04-34-300-010 04-34-300-011 04-34-300-012 04-34-300-013 04-34-300-014 04-34-400-005 04-34-400-007 04-34-400-009 04-34-400-011 04-34-400-012 04-34-400-013 04-34-400-014 04-34-400-015 04-35-100-002 04-35-100-005 04-35-200-001 04-35-200-002 04-35-200-003 04-35-200-004 04-35-300-001 04-35-300-006 04-35-300-008 04-35-300-010 04-35-400-001 04-35-400-003 04-35-400-004 04-36-100-003 04-36-100-006 04-36-100-008 04-36-200-001 04-36-200-007 04-36-200-008 04-36-300-002 04-36-300-003 04-36-300-004 04-36-300-005 04-36-300-006 04-36-300-007 04-36-300-008 04-36-400-004 04-36-400-005 04-36-400-006 04-36-400-007 04-36-400-008

Ridge Road, Homewood, Illinois 60430, Tel. No. (708) 799-0600, as the Special Representative of the above named decedent(s) under 735 ILCS 13-1209 (Death of a Party). The cause of action for the Foreclosure of a certain Mortgage upon the premises commonly known as: 4101 Whitehall Lane Algonquin, IL 60102. I536097 (Published in the Northwest Herald, May 29, June 5, 12, 2013) More people read the Northwest Herald each day than all other papers combined in McHenry County!

PUBLIC NOTICE IN THE CIRCUIT COURT OF THE 22ND JUDICIAL CIRCUIT McHENRY COUNTY WOODSTOCK, ILLINOIS U.S. BANK NATIONAL ASSOCIATION PLAINTIFF VS WILLIAM J. HATFIELD; DEBORAH K. HATFIELD; LAKELAND PROPERTY OWNERS ASSOCIATION, INC.; UNKNOWN OWNERS AND NON RECORD CLAIMANTS ; DEFENDANTS 4506 CLEARVIEW DRIVE MCHENRY, IL 60050 13 CH 540 NOTICE BY PUBLICATION NOTICE IS GIVEN YOU, LAKELAND PROPERTY OWNERS ASSOCIATION, INC.; UNKNOWN OWNERS AND NON RECORD CLAIMANTS ; defendants, that this case has been commenced in this Court against you and other defendants, asking for the foreclosure of a certain Mortgage conveying the premises described as follows, to wit: LOT 22 IN BLOCKS 5 IN LAKELAND PARK UNIT NO. 4, A SUBDIVISION OF PART OF THE NORTH HALF OF THE NORTHEAST QUARTER OF SECTION 27, TOWNSHIP 45 NORTH, RANGE 8 EAST OF THE THIRD PRINCIPAL MERIDIAN, ACCORDING TO THE PLAT THEREOF RECORDED MARCH 9, 1954 AS DOCUMENT NUMBER 276054, IN BOOK 11 OF PLATS, PAGE 102, IN MCHENRY COUNTY, ILLINOIS. Commonly known as: 4506 CLEARVIEW DRIVE MCHENRY, IL 60050 and which said Mortgage was made by, WILLIAM J. HATFIELD; DEBORAH K. HATFIELD; Mortgagor (s), to AMERITRUST MORTGAGE CORPORATION Mortgagee, and recorded in the Office of the Recorder of Deeds of McHENRY County, Illinois, as Document No. 00R0054218; and for other relief. UNLESS YOU file your answer or otherwise file your appearance in this case in the Office of the Clerk of this County, Katherine M. Keefe Clerk of the Court 2200 North Seminary Woodstock, Illinois 60098 on or before June 28, 2013 A JUDGMENT OR DECREE BY DEFAULT MAY BE TAKEN AGAINST YOU FOR THE RELIEF ASKED IN THE COMPLAINT. PIERCE & ASSOCIATES Attorneys for Plaintiff Thirteenth Floor 1 North Dearborn Chicago, Illinois 60602

BONITZ, FRANK FAM TR MARCONI, JAMES J MARCONI, JAMES J MCHENRY CO CONSERV DIST SCIMECA, ANTHONY CLAUDIA JONES, HARVEY F /DARLENE A TR MCHENRY CO CONSERV DIST MCHENRY CO CONSERV DIST JONES, HARVEY F JR DARLENE A SMITH, WILLIAM C DONNA V MCHENRY CO CONSERV DIST MCHENRY CO CONSERV DIST MCHENRY CO CONSERV DIST MCHENRY CO CONSERV DIST FABBRI CIOTA LLC KESSEL, HERBERT/WALSH ROSE M GREENBERG, D M/G M LIV TR * BOWLING, JOHN TR PENNINO, FAM TR HARTNETT, TIMOTHY J TRS FABBRI CIOTA LLC MCHENRY ST BK TR 2336 OBENAUF, R H/M F LIV TR* OBENAUF, RICHARD MARTINA TR OBENAUF, RICHARD MARTINA TR KEENAN 101 OBENAUF, R H M F TR MAY, ARNOLD M FAM TR ET AL MAY, ARNOLD M FAM TR ET AL MAY, ARNOLD M FAM TR ET AL MAY, ARNOLD M FAM TR ET AL MAY, ARNOLD M FAM TR ET AL KING, TOM MCHENRY ST BK TR 12356 1ST MIDWEST BK TR 12356 CALHOUN, KENNETH A ET AL KING, TOM PALMER, MARGARET MAE HUNTER T STRESKE, BERNICE A DECL OF TR STRESKE, BERNICE A KAUTZ, ERNEST W/PATRICIA L BRUHN, WALTER J JR BERNICE M DAY, KEVIN SAMANTHA WOLDEN, ROGER L MARY H BRUHN, WALTER J JR BERNICE M B B TR 1, MILLER FAM REV TR, KING, TOM MAY, A M FAM TR/I M TR* GAYLOR PARTNERSHIP 1ST MIDWEST BK TR 2854 STADE, VERNON 1ST MIDWEST BK TR 2854 1ST MIDWEST BK TR 2854 GAYLOR PARTNERSHIP STADE, VERNON G MCHENRY ST BK TR 1076 ZANK, CAROLYN DAVID 1ST MIDWEST BK TR 2854 1ST MIDWEST BK TR 2854 ROY, FAM REV TR SCHMITT, LOREN O COLLEEN A TR STADE, VERNON BEHM, RICHARD A LINDA KAY TR HOME ST BK NA TR 4162 HOME ST BK NA TR 4162 SCHMITT, JOHN H BEVERELY A TR ROY, FAM REV TR LBJP PRTNSHP SCHMITT, LOREN O COLLEEN A TR YUNG, WILLIAM H BARBARA A LBJP PRTNSHP LBJP PRTNSHP BLASIUS, ROBERT F ET AL FREUND, VINCENT J SUSAN L TRS SCHMITT, JOHN H BEVERLY A TR BD OF ED NIPPERSINK DIST 2 FREUND, ALVIN J ALMA C TRS SCHMITT, JOHN J BEVERLY A TR Tel. (312) 346-9088 Fax (312) 346-1557 PA 1220588 I528528 (Published in the Northwest Herald, May 29, June 5, 12, 2013)

PUBLIC NOTICE IN THE CIRCUIT COURT OF THE 22ND JUDICIAL CIRCUIT MCHENRY COUNTY WOODSTOCK, ILLINOIS BANK OF AMERICA, N.A., PLAINTIFF vs. MARK A. GASKILL A/K/A MARK GASKILL; LASALLE BANK, N.A.; ATLANTIC CREDIT AND FINANCE INC.; LAKELAND PARK PROPERTY OWNERS ASSOCIATION; UNKNOWN OWNERS AND NON-RECORD CLAIMANTS, DEFENDANTS 13 CH 0574 PUBLICATION NOTICE The requisite affidavit for publication having been filed, notice is hereby given to you, LAKELAND PARK PROPERTY OWNERS ASSOCIATION; UNKNOWN OWNERS AND NONRECORD CLAIMANTS, Defendants in the above entitled suit, that the said suit has been commenced in the Circuit Court of the 22nd Judicial Circuit, McHenry County, Illinois by the plaintiff against you and other defendants, praying for the foreclosure of a certain mortgage conveying the premises described as follows to wit: LOT 8 IN BLOCK 5 IN LAKELAND PARK UNIT NUMBER 4, A SUBDIVISION OF PART OF THE NORTH HALF OF THE NORTHEAST QUARTER OF SECTION 27, TOWNSHIP 45 NORTH, RANGE 8, EAST OF THE THIRD PRINCIPAL MERIDIAN, ACCORDING TO THE PLAT THEREOF RECORDED MARCH 9, 1954, AS DOCUMENT NUMBER 276054, IN BOOK 11 OF PLATS, PAGE 102, MCHENRY COUNTY, ILLINOIS. COMMON ADDRESS: 4421 Parkway Ave. McHenry, Illinois 60050 P.I.N.: 09-27-205-008 and which said mortgage was signed by MARK A. GASKILL A/K/A MARK GASKILL, mortgagors, to Mortgage Electronic Registration Systems, Inc., as nominee for Aegis Wholesale Corporation , as Mortgagee, and recorded in the Office of the Recorder of Deeds of McHenry County as Document No. 2005R0057604 and modified by a Modification Agreement recorded as Document Number 2011R0044484; and for such other relief prayed; that summons was duly issued out of the Circuit Court of McHenry County against you as provided by law, and that the said suit is now pending. NOW THEREFORE, UNLESS YOU, the said above defendants, file your answer to the Complaint in said suit or otherwise make your appearance therein, in the Office of the Clerk of this Court in McHenry County at 2200 N. Seminary Ave., Woodstock, IL 60098 on or before the July 5, 2013, default may be entered against you at any time after that day and a judgment entered in accordance with the prayer of said complaint. Circuit Clerk Johnson, Blumberg, & Associates, LLC 230 W. Monroe Street

72,689 48,383 634 35 3,164 570 7,023 3,028 182 107,138 1,590 5,186 8,815 14,153 2,730 46,316 1,025 1,553 1,454 101,377 1,072 75,180 338 2,313 4,058 282 931 31,151 420 964 941 984 5,840 151,300 2,708 8,898 5,829 79,970 32,482 55 78,103 87,781 141,121 124,842 1,081 9,284 9,905 5,851 6,788 8,354 9,492 8,121 8,858 8,206 8,989 61,407 8,251 103,921 204,921 16,246 33,941 7,837 39,872 51,937 7,782 64,538 1,847 32 5,079 7,084 4,060 4,446 4,345 9,634 59,397 78,539 3,343 12,691 5,805

Suite 1125 Chicago, Illinois 60606 Ph. 312-541-9710 Fax 312-541-9711 JB&A # IL 13 6787 I531996 (Published in the Northwest Herald, June 5, 12, 19, 2013)

PUBLIC NOTICE IN THE CIRCUIT COURT OF THE 22ND JUDICIAL CIRCUIT MC HENRY COUNTY WOODSTOCK, ILLINOIS JPMorgan Chase Bank, N.A. successor by merger to Bank One, N.A. PLAINTIFF Vs. Dean C. Taylor; April L. Taylor; Harvard Savings Bank; Unknown Owners and Nonrecord Claimants DEFENDANTS 13 CH 00630 NOTICE BY PUBLICATION NOTICE IS GIVEN TO YOU: Dean C. Taylor, Unknown Owners and Nonrecord Claimants, That this case has been commenced in this Court against you and other defendants, praying for the foreclosure of a certain Mortgage conveying the premises described as follows, towit: LOT 46 IN JOHN K LUCAS SUBDIVISION UNIT II, BEING A SUBDIVISION OF PART OF THE SOUTHWEST QUARTER OF SECTION 26, TOWNSHIP 46 NORTH, RANGE 5 EAST OF THE THIRD PRINCIPAL MERIDIAN, ACCORDING TO THE PLAT THEREOF RECORDED DECEMBER 9, 1996 AS DOCUMENT 96R62322, IN MCHENRY COUNTY, ILLINOIS. COMMONLY KNOWN AS: 1504 9th Street Harvard, IL 60033 and which said Mortgage was made by: Dean C. Taylor, April L. Taylor, the Mortgagors, to Bank One, NA, as Mortgagee, and recorded in the Office of the Recorder of Deeds of McHenry County, Illinois, as Document No. 2003R0127011; and for other relief; that summons was duly issued out of said Court against you as provided by law and that the said suit is now pending. NOW, THEREFORE, UNLESS YOU file your answer or otherwise file your appearance in this case in the Office of the Clerk of this Court, Katherine M. Keefe Clerk of the Circuit Court 2200 N. Seminary Woodstock, IL 60098 on or before June 28, 2013, A DEFAULT MAY BE ENTERED AGAINST YOU AT ANY TIME AFTER THAT DAY AND A JUDGMENT MAY BE ENTERED IN ACCORDANCE WITH THE PRAYER OF SAID COMPLAINT. CODILIS & ASSOCIATES, P.C. Attorneys for Plaintiff 15W030 North Frontage Road, Suite 100 Burr Ridge, IL 60527 (630) 794-5300 DuPage # 15170 Winnebago # 531 Our File No. 14-13-07557 NOTE: This law firm is deemed to be a debt collector. I534070 (Published in the Northwest Herald, May 29, June 5, 12, 2013) Have a photo you'd like to share? Upload it to our online photo album at NWHerald.com/MyPhotos


CLASSIFIED

Page E8• Wednesday, June 5, 2013 PUBLIC NOTICE IN THE CIRCUIT COURT OF THE 22ND JUDICIAL CIRCUIT McHENRY COUNTY WOODSTOCK, ILLINOIS WELLS FARGO BANK, N.A. PLAINTIFF VS MILDRED CAMBENSY; STATE OF ILLINOIS; UNKNOWN HEIRS AND LEGATEES OF EVELYN SCHAEFER A/K/A EVELYN P SCHAEFER; UNKNOWN OWNERS AND NON RECORD CLAIMANTS ; WILLIAM BUTCHER, SPECIAL REPRESENTATIVE OF THE ESTATE OF EVELYN SCHAEFER A/K/A EVELYN P. SCHAEFER, DECEASED; DEFENDANTS 214 RIDGE STREET ALGONQUIN, IL 60102 13 CH 697 NOTICE BY PUBLICATION NOTICE IS GIVEN YOU, MILDRED CAMBENSY; UNKNOWN HEIRS AND LEGATEES OF EVELYN SCHAEFER A/K/A EVELYN P SCHAEFER; UNKNOWN OWNERS AND NON RECORD CLAIMANTS ; defendants, that this case has been commenced in this Court against you and other defendants, asking for the foreclosure of a certain Mortgage conveying the premises described as follows, to wit: LOT FOUR (4) IN BLOCK SEVEN (7) IN JANAK'S SECOND ADDITION TO ALGONQUIN, A SUBDIVISION OF PART OF SECTION THIRTY-FOUR (34), TOWNSHIP FORTY-THREE (43) NORTH, RANGE EIGHT (8) EAST OF THE THIRD PRINCIPAL MERIDIAN, ACCORDING TO THE PLAT THEREOF RECORDED JULY 11, 1955, AS DOCUMENT NO. 294995, IN BOOK 12 OF PLATS, PAGE 39, IN MCHENRY COUNTY, ILLINOIS. Commonly known as: 214 RIDGE STREET ALGONQUIN, IL 60102 and which said Mortgage was made by, EVELYN SCHAEFER A/K/A EVELYN P SCHAEFER DECEASED; Mortgagor, to WELLS FARGO BANK, N.A. Mortgagee, and recorded in the Office of the Recorder of Deeds of McHENRY County, Illinois, as Document No. 08R0057887; and for other relief. UNLESS YOU file your answer or otherwise file your appearance in this case in the Office of the Clerk of this County, Katherine M. Keefe Clerk of the Court 2200 North Seminary Woodstock, Illinois 60098 on or before June 28, 2013, A JUDGMENT OR DECREE BY DEFAULT MAY BE TAKEN AGAINST YOU FOR THE RELIEF ASKED IN THE COMPLAINT. PIERCE & ASSOCIATES Attorneys for Plaintiff Thirteenth Floor 1 North Dearborn Chicago, Illinois 60602 Tel. (312) 346-9088 Fax (312) 346-1557 PA 1304225 I533714 (Published in the Northwest Herald, May 29, June 5, 12, 2013)

PUBLIC NOTICE IN THE CIRCUIT COURT OF THE 22ND JUDICIAL CIRCUIT McHENRY COUNTY WOODSTOCK, ILLINOIS CITIMORTGAGE, INC. PLAINTIFF VS NOE SALGADO; GRISELA J. SALGADO; UPLAND ACRES SUBDIVISION HOMEOWNERS' ASSOCIATION; UNKNOWN OWNERS AND NON RECORD CLAIMANTS ; DEFENDANTS 6717 MEADOW DRIVE CRYSTAL LAKE, IL 60012 13 CH 729 NOTICE BY PUBLICATION NOTICE IS GIVEN YOU, NOE SALGADO; GRISELA J. SALGADO; UPLAND ACRES SUBDIVISION HOMEOWNERS' ASSOCIATION; UNKNOWN OWNERS AND NON RECORD CLAIMANTS ; defendants, that this case has been commenced in this Court against you and other defendants, asking for the foreclosure of a certain Mortgage conveying the premises described as follows, to wit: LOT 3 IN BLOCK 16 IN UPLAND ACRES SUBDIVISION, A SUBDIVISION OF LOTS 1, 2 AND PART OF LOT 3 OF TESSENDORF FARM PLAT AND BEING ALSO A PART OF THE SOUTHWEST QUARTER OF SEC

SOUTHWEST QUARTER OF SECTION 29, TOWNSHIP 44 NORTH, RANGE 8 EAST OF THE THIRD PRINCIPAL MERIDIAN, ACCORDING TO THE PLAT THEREOF RECORDED FEBRUARY 14, 1956 AS DOCUMENT NO. 303798, IN BOOK 12 OF PLATS, PAGE 62, IN MCHENRY COUNTY, ILLINOIS. Commonly known as: 6717 MEADOW DRIVE CRYSTAL LAKE, IL 60012 and which said Mortgage was made by, NOE SALGADO; GRISELA J. SALGADO; Mortgagors, to M.E.R.S., INC., AS NOMINEE FOR LOANCITY Mortgagee, and recorded in the Office of the Recorder of Deeds of McHENRY County, Illinois, as Document No. 06R0067527; and for other relief. UNLESS YOU file your answer or otherwise file your appearance in this case in the Office of the Clerk of this County, Katherine M. Keefe Clerk of the Court 2200 North Seminary Woodstock, Illinois 60098 on or before June 28, 2013, A JUDGMENT OR DECREE BY DEFAULT MAY BE TAKEN AGAINST YOU FOR THE RELIEF ASKED IN THE COMPLAINT. PIERCE & ASSOCIATES Attorneys for Plaintiff Thirteenth Floor 1 North Dearborn Chicago, Illinois 60602 Tel. (312) 346-9088 Fax (312) 346-1557 PA 1226455 I534452 (Published in the Northwest Herald, May 29, June 5, 12, 2013)

PUBLIC NOTICE IN THE CIRCUIT COURT OF THE 22ND JUDICIAL CIRCUIT McHENRY COUNTY WOODSTOCK, ILLINOIS CITIMORTGAGE, INC., SUCCESSOR BY MERGER WITH ABN AMRO MORTGAGE GROUP, INC. PLAINTIFF VS DENNIS C LEY A/K/A DENNIS CLARENCE LEY; LINDA J LEY A/K/A LINDA JEAN LEY; FOUR COLONIES PROPERTY OWNERS ASSOCIATION; FOUR COLONIES CONDOMINIUM ASSOCIATION I DENNIS CLARENCE LEY, AS TRUSTEE OF THE DENNIS CLARENCE LEY TRUST DATED 4/3/09; LINDA JEAN LEY, AS TRUSTEE OF THE LINDA JEAN LEY TRUST DATED 4/3/09; UNKNOWN BENEFICIARIES OF THE DENNIS CLARENCE LEY TRUST DATED 4/3/09; UNKNOWN BENEFICIARIES OF THE LINDA JEAN LEY TRUST DATED 4/3/09; UNKNOWN OWNERS AND NON RECORD CLAIMANTS ; DEFENDANTS 740 SAINT ANDREWS LANE APT 28 CRYSTAL LAKE, IL 60014 13 CH 813 NOTICE BY PUBLICATION NOTICE IS GIVEN YOU, UNKNOWN BENEFICIARIES OF THE DENNIS CLARENCE LEY TRUST DATED 4/3/09; UNKNOWN BENEFICIARIES OF THE LINDA JEAN LEY TRUST DATED 4/3/09; UNKNOWN OWNERS AND NON RECORD CLAIMANTS defendants, that this case has been commenced in this Court against you and other defendants, asking for the foreclosure of a certain Mortgage conveying the premises described as follows, to wit: PARCEL 1: UNIT 740-28 AS DELINEATED ON SURVEY OF THE FOLLOWING DESCRIBED PARCEL OF REAL ESTATE (HEREAFTER REFERRED TO AS "PARCEL"). PART OF LOT 112 IN UNIT ONE OF FOUR COLONIES, BEING A SUBDIVISION OF PART OF THE NORTH HALF OF SECTION 7, TOWNSHIP 43 NORTH, RANGE 8 EAST OF THE THIRD PRINCIPAL MERIDIAN, ACCORDING TO THE PLAT THEREOF RECORDED AUGUST 28, 1972 AS DOCUMENT NO. 574773, IN MCHENRY COUNTY, ILLINOIS, WHICH SURVEY IS ATTACHED AS EXHIBIT "A" TO DECLARATION OF CONDOMINIUM OWNERSHIP RECORDED IN THE OFFICE OF THE RECORDER OF DEEDS OF MCHENRY COUNTY, ILLINOIS AS DOCUMENT NO. 601783, FIRST AMENDMENT RECORDED NOVEMBER 1, 1973 AS DOCUMENT NO. 606037, SECOND AMENDMENT RECORDED APRIL 3, 1974 AS DOCUMENT NO. 613729, THIRD AMENDMENT RECORDED DECEM-

AMENDMENT RECORDED DECEMBER 2, 1992 AS DOCUMENT NO. 92R066219, TOGETHER WITH A PERCENTAGE OF THE COMMON ELEMENTS APPURTENANT TO SAID UNIT AS SET FORTH IN SAID DECLARATION, AS AMENDED FROM TIME TO TIME, WHICH PERCENTAGE SHALL AUTOMATICALLY CHANGE IN ACCORDANCE WITH AMENDED DECLARATIONS AS SAME ARE FILED OF RECORD PURSUANT TO SAID DECLARATION, AND TOGETHER WITH ADDITIONAL COMMON ELEMENTS AS SUCH AMENDED DECLARATIONS ARE FILED OF RECORD, IN THE PERCENTAGES SET FORTH IN SUCH AMENDED DECLARATIONS WHICH PERCENTAGES SHALL AUTOMATICALLY BE DEEMED TO BE CONVEYED EFFECTIVE ON THE RECORDING OF EACH SUCH AMENDED DECLARATION AS THOUGH CONVEYED HEREBY. PARCEL 2: EASEMENT APPURTENANT TO PARCEL 1, A PERPETUAL EXCLUSIVE EASEMENT FOR PARKING PURPOSES IN AND TO PARKING SPACE NO. G740-28 AS DEFINED AND SET FORTH IN SAID DECLARATION AND SURVEY. Commonly known as: 740 SAINT ANDREWS LANE APT 28 CRYSTAL LAKE, IL 60014 and which said Mortgage was made by, DENNIS C LEY A/K/A DENNIS CLARENCE LEY; LINDA J LEY A/K/A LINDA JEAN LEY; Mortgagors, to ABN AMRO MORTGAGE GROUP, INC. Mortgagee, and recorded in the Office of the Recorder of Deeds of McHENRY County, Illinois, as Document No. 2007R00654; and for other relief. UNLESS YOU file your answer or otherwise file your appearance in this case in the Office of the Clerk of this County, Katherine M. Keefe Clerk of the Court 2200 North Seminary Woodstock, Illinois 60098 on or before June 28, 2013, A JUDGMENT OR DECREE BY DEFAULT MAY BE TAKEN AGAINST YOU FOR THE RELIEF ASKED IN THE COMPLAINT. PIERCE & ASSOCIATES Attorneys for Plaintiff Thirteenth Floor 1 North Dearborn Chicago, Illinois 60602 Tel. (312) 346-9088 Fax (312) 346-1557 PA 1307264 I534451 (Published in the Northwest Herald, May 29, June 5, 12, 2013)

PUBLIC NOTICE IN THE CIRCUIT COURT OF THE 22ND JUDICIAL CIRCUIT MCHENRY COUNTY, ILLINOIS FIRST NATIONAL BANK OF OMAHA Plaintiff, vs. MICHAEL J. NIEMIEC and JENNIFER M. NIEMIEC; HOMEOWNERS ASSOCATION, if any; UNKNOWN OWNERS and NON-RECORD LIEN CLAIMANTS, Defendants No. 13 CH 976 PUBLICATION NOTICE The requisite Affidavit having been duly filed herein, NOTICE IS HEREBY GIVEN YOU, MICHAEL J. NIEMIEC and JENNIFER M. NIEMIEC; HOMEOWNERS ASSOCIATION, if any; UNKNOWN OWNERS and NON-RECORD LIEN CLAIMANTS, Defendants in the above-entitled action, that an action is now pending in this Court as shown above, wherein the Plaintiff seeks to foreclose a mortgage made to MICHAEL J. NIEMIEC and JENNIFER M. NIEMIEC; HOMEOWNERS ASSOCATION, if any; UN-

any KNOWN OWNERS and NONRECORD LIEN CLAIMANTS, with respect to the following described real estate: THAT PART OF THE NORTHEAST QUARTER OF THE SOUTHWEST QUARTER OF SECTION 12, IN TOWNSHIP 45 NORTH, RANGE 5 EAST OF THE THIRD PRINCIPAL MERIDIAN, DESCRIBED AS FOLLOWS: BEGINNING AT A POINT IN THE CENTER OF THE HIGHWAY FORMERLY KNOWN AS ILLINOIS STATE HIGHWAY 19 AND NOW KNOWN AS U.S. 14, THAT IS 255.25 FEET WEST OF THE EAST LINE AND 734.5 FEET SOUTH OF THE NORTH LINE, OF SAID QUARTER SECTION; THENCE NORTH 440 FEET TO A POINT; THENCE WEST 271 FEET TO A POINT; THENCE SOUTH 215 FEET TO THE CENTER LINE OF SAID HIGHWAY; THENCE SOUTHEASTERLY, ALONG SAID CENTER LINE, TO THE PLACE OF BEGINNING; IN MCHENRY COUNTY, ILLINOIS. PIN NO. 06-12-300-004 Commonly known as 20702 E. Route 14, Harvard, IL 60033 NOW, THEREFORE, you are further notified to file your appearance in the Office of the Clerk of the Court above stated on or before July 10, 2013, and if you fail to do so or do not otherwise make your appearance on or before said date, this cause may be heard and judgment entered as prayed for in said Complaint without further notice. IN TESTIMONY WHEREOF, I have hereunto set my hand and affixed the seal of said Court at my office in Woodstock, Illinois, this 29 day of May, 2013. /s/ Katherine M. Keefe Clerk of the Circuit Court McHenry County, Illinois FRANKS, GERKIN & MCKENNA Our file No. 15020.334 Attorney for Plaintiffs 19333 E. Grant Hwy. PO Box 5 Marengo, IL 60152 (815) 923-2107 (Published in the Northwest Herald June 5, 12, 19, 2013. #A1051)

IN THE CIRCUIT COURT OF THE 22nd JUDICIAL CIRCUIT McHENRY COUNTY, ILLINOIS

NOTICE NOTICE IS GIVEN TO YOU, Sabino Javier Alonso, Leticia Munoz, defendants, and unknown owners of the single family home at 1703 North Avenue, McHenry, Illinois 60050, PIN 09-27-177-021 (”Subject Property”) a lawsuit has been commenced in this Court against you and other defendants, and that a hearing on preliminary injunction to secure and close the house on the Subject Property based on building and fire code violations, has been scheduled for June 7, 2013, at 10:00 a.m., Room 202, in the McHenry County Courthouse, 2200 N. Seminary Avenue, Woodstock, Illinois 60098. Your failure to appear in court on

STATE OF ILLINOIS IN THE CIRCUIT COURT OF THE 22nd JUDICIAL CIRCUIT McHENRY COUNTY Case Number 13ED10 Illinois Department of Transportation, Plaintiff vs. McHenry Savings Bank, et al., Defendant

PUBLIC NOTICE

PUBLICATION NOTICE

IN THE CIRCUIT COURT FOR THE TWENTY-SECOND JUDICIAL CIRCUIT MCHENRY COUNTY - WOODSTOCK, ILLINOIS

NOTICE IS GIVEN YOU, Unknown Owners and Non-Record Claimants defendants, that this case has been commenced in this Court against you and other defendants, asking for judgment as to determination of just compensation for certain and real property legally described as set forth in Exhibit A. LEGAL DESCRIPTION: A part of the South half of Section 26, Township 45 North, Range 8 East of the Third Principal Meridian with bearings referenced to the Illinois State Plane Coordinate System, East Zone (NAD 83) described as follows:

THE BANK OF NEW YORK MELLON TRUSTEE FOR CSMC TRUST 2011-3, Plaintiff, v. JUAN FIGUEROA, ELVIRA M. FIGUEROA, UNKNOWN OWNERS AND NON-RECORD CLAIMANTS, Defendants. No. 11 CH 2650 AMENDED NOTICE OF FORECLOSURE SALE PUBLIC NOTICE is hereby given that pursuant to a Judgment of Foreclosure entered by the Court in the above-entitled cause the property hereinafter described or so much thereof as shall be sufficient to satisfy said judgment, will be sold to the highest bidder. (A) The name, address and telephone number of the person to contact for information regarding the real estate is: Kristi Kurmay, Green Tree Servicing LLC, 33600 6th Ave., S., Suite 220, Federal Way, WA 98003, (480) 333-5205. (B) The real estate is commonly known and numbered as 1325 Mulberry Lane, Crystal Lake, IL 60014. (C) The legal description of the real estate is: LOTS 3 AND 4 IN BLOCK 30 IN R.A. CEPEK'S CRYSTAL VISTA, A SUBDIVISION OF PART OF SECTION 1, TOWNSHIP 43 NORTH, RANGE 7, EAST OF THE THIRD PRINCIPAL MERIDIAN AND A PART OF SECTION 36, TOWNSHIP 44 NORTH, RANGE 7, EAST OF THE THIRD PRINCIPAL MERIDIAN, ACCORDING TO THE PLAT THEREOF RECORDED FEBRUARY 11, 1927 AS DOCUMENT NO. 76823, IN BOOK 6 OF PLATS, PAGES 18 AND 19, IN MCHENRY COUNTY, ILLINOIS. PIN #: 18-01-108-004-0000 AND 18-01-108-005-0000 (D) The time and place of the sale are: Public sale at 10:00 a.m., on June 27, 2013, inside the main hallways of McHenry County Courthouse at 2200 North Seminary Ave., Woodstock, Illinois 60098. The Property will NOT be open for inspection. (E) The terms of the sale are: Cash or certified check or the equivalent thereof. (G) Title will be conveyed without warranties, subject to all general real estate taxes which are a lien upon the real estate, but have not yet become due and payable; special assessments, if any; other exceptions, if any, set forth in the title insurance company and easements, covenants and restrictions of record. (H) IF YOU ARE THE MORTGAGOR (HOMEOWNER), YOU HAVE THE RIGHT TO REMAIN IN POSSESSION FOR 30 DAYS AFTER ENTRY OF AN ORDER OF POSSESSION, IN ACCORDANCE WITH SECTION 151701 (c) OF THE ILLINOIS MORTGAGE FORECLOSURE LAW. (I) Pursuant to 735 ILCS 5/15-1507.1, entitled "Judicial sale fee for Abandoned Residential Property Municipality Relief Fund," upon and at the sale of residential real estate under Section 15-1507, the purchaser shall pay to the person conducting the sale pursuant to Section 151507 a fee for deposit into the Abandoned Residential Property Municipality Relief Fund, a special fund created in the State treasury. The fee shall be calculated at the rate of $1.00 for each $1,000.00 or fraction thereof of the amount paid by the purchaser to the person conducting the sale, as reflected in the receipt of sale issued to the purchaser, provided that in no event shall the fee exceed $300.00. No fee shall be paid by the mortgagee acquiring the residential real estate pursuant to its credit bid at the sale or by any mortgagee, judgment creditor, or other lienor acquiring the residential real estate whose rights in and to the residential real estate arose prior to the sale. Upon confirmation of the sale under Section 15-1508, the person conducting the sale shall remit the fee to the clerk of the court in which the foreclosure case is pending. The clerk shall remit the fee to the State Treasurer as provided in this Section, to be expended for the purposes set forth in Section 7.31 of the Illinois Housing Development Act. THE BANK OF NEW YORK MELLON TRUSTEE FOR CSMC TRUST 2011-3, By: /s/ David G. Wasinger, IlBar #6200269 Michael K. Daming, IlBar #6281714 THE WASINGER LAW GROUP, P.C. Magna Place, Suite 875,1401 S. Brentwood Blvd. St. Louis, Missouri 63144 (314) 961-0400; (314) 961-2726 (Fax) Attorneys for Plaintiff s/s David G. Wasinger (Published in the Northwest Herald June 5, 12, 19, 2013) A1075

) ) ) ) ) ) )

Case No. 13CH992

PUBLIC NOTICE

Commencing at the southwest corner of Lot 4 of the County Clerk's Plat of the South Half of Section 26, being a subdivision of part of the Southwest Quarter of Section 26, Township 45 North, Range 8 East of the Third Principal Meridian, according to the plat thereof recorded May 6, 1902 as Document No. 14006 in Book 2 of Plats, Page 38 in McHenry County, Illinois; thence along the west line of said Lot 4, North 00 degrees 23 minutes 21 seconds West, 40.01 feet to the point of beginning; thence continuing along said west line, North 00 degrees 23 minutes 21 seconds West, 8.83 feet to a point on the southeasterly line of Illinois State Route 120; thence along said southeasterly line, North 71 degrees 51 minutes 33 seconds East, 102.91 feet to a bend point in said southeasterly line; thence along the southwesterly line of said Illinois State Route 120 per said Document No. 14006, said line being the northerly line of Lot 2 in Block 23 in the Original Plat of the Village (Now City) of McHenry, on the west side of Fox River, a subdivision of part of the Southeast Quarter of Section 26, Township 45 North, Range 8 east of the Third Principal Meridian, according to the plat thereof recorded July 6, 1840 in Book B of Deeds, Page 160, South 67 degrees 13 minutes 17 seconds East, 108.13 feet to a point of curvature; thence westerly 82.20 feet along a curve to the left having a radius of 342.92 feet, the chord of said curve bears North 79 degrees 58 minutes 15 seconds West, a chord distance of 82.00 feet; thence South 03 degrees 09 minutes 45 seconds West, 6.00 feet; thence westerly 52.41 feet along a curve to the left having a radius of 336.92 feet, the chord of said curve bears South 88 degrees 42 minutes 22 seconds West, a chord distance of 52.36 feet; thence South 85 degrees 15 minutes 36 seconds West, 65.86 feet to the point of beginning, in McHenry County, Illinois. Said parcel containing (0.076 acres) more or less. Owner: McHenry Savings Bank Route: F.A.P. 336 - Illinois State Route 31/120 Section: 05-00067-00-CH County: McHenry Job No: R-91-011-06 Parcel: JF0007 Station: 21+31.24 to 23+47.77 PIN: 09-26-378-005 09-26-454-001 and for other relief. UNLESS YOU file your answer or otherwise file your appearance in this case in the office of the McHenry County Clerk of Court, McHenry County Government Center, 2200 N. Seminary Avenue, Room C380, Woodstock, Illinois 60098, on or before June 30, 2013, A JUDGMENT OR DECREE BY DEFAULT MAY BE TAKEN AGAINST YOU FOR THE RELIEF ASKED IN THE COMPLAINT. Witness: May 22, 2013 Katherine M. Keefe Clerk of the Circuit Court Michele S. Gonzales Attorney for Plaintiff 7653 Monroe St. Ste. 100 Forest Park, IL 60130 Telephone: 708-536-7070 (Published in the Northwest Herald May 29, June 5, 12, 2013 #A1025)

appe that date and time may render you in default and subject the Subject Property to being secured, with access only by the City of McHenry Code Enforcement officials. David W. McArdle Zukowski, Rogers, Flood & McArdle Attorney for City of McHenry 50 Virginia Street Crystal Lake, Illinois 60014 815/459-2050 (Published in the Northwest Herald June 5, 2013 A1081)

PUBLIC NOTICE

CITY OF MCHENRY, an Illinois Municipal Corporation, Plaintiff, vs. SABINO JAVIER ALONSO, LETICIA MUNOZ, and TCF NATIONAL BANK, Defendants.

) ) ) ) ) ) )

Case No. 13CH992 NOTICE AVISO se da a usted, Sabino Javier Alonso, Leticia Munoz, acusados y los propietarios desconocidos de la vivienda unifamiliar en 1703 North Avenue, McHenry, Illinois 60050, PIN 09-27-177-021 ("propiedad en cuestión") una demanda ha sido comenzado en este Tribunal contra usted y otros acusados, y que una audiencia sobre la orden judicial preliminar para sujetar y cerrar la casa en la propiedad en cuestión se basa en violaciones del código de edificio y fuego, se ha programado para el 07 de junio de 2013, a las 10:00, sala 202, en McHenry County Courthouse, 2200 N. Seminary Avenue, Woodstock, Illinois 60098. Su falta de comparecencia ante el tribunal en la fecha y hora en que pueda dictar en defecto y someter la propiedad en cuestión de ser protegido, con acceso sólo por los funcionarios encargados de la Ciudad de McHenry de hacer cumplir códigos.

(Published in the Northwest HeraldJune 5, 2013 A1081)

PUBLIC NOTICE STATE OF ILLINOIS IN THE CIRCUIT COURT OF THE TWENTY-SECOND JUDICIAL CIRCUIT

McHENRY COUNTY IN PROBATE In the Matter of the Estate of JILL GUNDERSEN, Deceased Case No. 13 PR 115 CLAIM NOTICE Notice is given of the death of JILL GUNDERSEN of LAGRANGE, IL Letters of office were issued on 5/10/2013 to Representative: WILLIAM ELMAN, 100 S AYER ST, STE E, HARVARD, IL 60033-3317 whose attorney is ELMAN & EHARDT LTD, 100 S AYER ST, SUITE E, HARVARD, IL 60033.

IN THE CIRCUIT COURT OF THE 22nd JUDICIAL CIRCUIT McHENRY COUNTY, ILLINOIS

David W. McArdle Zukowski, Rogers, Flood & McArdle Attorney for City of McHenry 50 Virginia Street Crystal Lake, Illinois 60014 815/459-2050

PUBLIC NOTICE

CITY OF MCHENRY, an Illinois Municipal Corporation, Plaintiff, vs. SABINO JAVIER ALONSO, LETICIA MUNOZ, and TCF NATIONAL BANK, Defendants.

Northwest Herald / NWHerald.com

Claims against the estate may be filed within six months from the date of first publication. Any claim not filed within six months from the date of first publication or claims not filed within three months from the date of mailing or delivery of Notice to Creditor, whichever is later, shall be barred. Claims may be filed in the office of the Clerk of Circuit Court at the McHenry County Government Center, 2200 North Seminary Avenue, Woodstock, Illinois 60098, or with the representative, or both. Copies of claims filed with the Clerk must be mailed or delivered to the representative and to his attorney within ten days after it has been filed. /s/ Katherine M. Keefe Clerk of the Circuit Court (Published in the Northwest Herald May 22, 29, 2013 June 5, 2013 A975)

PUBLIC NOTICE IN THE CIRCUIT COURT OF THE 22ND JUDICIAL CIRCUIT MCHENRY COUNTY STATE OF ILLINOIS ESTATE OF BEVERLY J. GUADAGNUOLO, DECEASED. 13 PR 137 Notice is given to creditors of the death of the above named decedent. Letters of office were issued to MICHELLE BELCASTRO, 91 RAVEN DRIVE, AURORA, ILLINOIS 60506, as Independent EXECUTOR, whose attorney of record is JON A. MICHAL, 5576 N. ELSTON AVENUE, CHICAGO, ILLINOIS 60630. The estate will be administered without court supervision, unless under section 5/28-4 of the Probate Act Ill. Compiled Stat. 1992, Ch. 755, par. 5/28-4) any interested person terminates independent administration at any time by mailing or delivering a petition to terminate to the clerk. Claims against the estate may be filed in the office of the clerk Katherine M. Keefe Clerk of the Court 2200 North Seminary Woodstock, Illinois 60098

or with the representative, or both, on or before DECEMBER 5, 2013, or, if mailing or delivery of a notice from the representative is required by section 5/18-3 of the Probate Act, the date stated in that notice. Any claim not filed on or before that date is barred. Copies of a claim filed with the clerk must be mailed or delivered by the claimant to the representative and to the attorney within 10 days after it has been filed. JON A. MICHAL 5576 N. ELSTON AVENUE CHICAGO, ILLINOIS 60630 I538422 (Published in the Northwest Herald, June 5, 12, 19, 2013)

(5 ) ope y Dale L. Vierck. Unit 703 (10 x 20) Property of Susan Courtney. Unit 123 (5 x 10) Property of Kenneth Bellino. Unit 410 (10 x 20) Property of Mary Trainor. Unit 641 (10 x 10) Property of Annette Osborn. Unit 334 (10 x 10) Property of Richard Cumming Ho. Unit 334 (10 x 10) Property of Elvis Skrijeli. Unit 310 (10 x 25) Property Jason Mapes (Published in the Northwest Herald June 5, 12, 2013. #A1069)

PUBLIC NOTICE PUBLIC NOTICE

LOOKING FOR DBE'S! Curran Contracting Company is seeking IDOT approved DBE subcontractors, suppliers, & trucking companies for the 06/14/2013 IDOT letting! Plans & Specs are available at www.dot.state.il.us or email (Published in the Daily Chronicle & the Northwest Herald June 3, 4, 5, 6, 7, 2013 and in the Lake County Journal May 30, June 6, 2013)letting

ASSUMED NAME PUBLICATION NOTICE Public Notice is hereby given that on June 3, 2013, a certificate was filed in the Office of the County Clerk of McHenry County, Illinois, setting forth the names and postoffice address of all of the persons owning, conducting and transacting the business known as MULTI MINION located at 9 WESTEND DRIVE, ALGONQUIN, IL 60102

PUBLIC NOTICE Notice of intent to dispose of abandoned and unclaimed property. PYOTT ROAD SELF STORAGE, 1401 Industrial Drive, Lake in the Hills, IL 60156, will sell on June 28, 2013 at 11:00 a.m. the following property: Unit 655 (10 x 15) Property of Bernadine Hernandez. Unit 351 (10 x 20) Property of Michelle Farinella. Unit 144 (10 x 20) Property of Vincent Bartuch. Unit 115 (10 x 10) Property of Richard Karbowski. (Published in the Northwest Herald June 5, 12, 2013. #A1068)

PUBLIC NOTICE Notice of intent to dispose of abandoned and unclaimed property. HIGHWAY 20 SELF STORAGE, 1030 E. Grant Highway, Marengo, IL 60152 will sell on June 27, 2013, at 11:00 a.m. the following property:

Dated June 3, 2013 /s/ Katherine C. Schultz County Clerk (Published in the Northwest Herald June 5, 12, 19, 2013. #A1077)

ADOPTION Young, happy married couple wishing for newborn. Love, affection, security and opportunities await your baby. Expenses paid. Please call Jullian/David anytime 800-571-3763 GORDON TRUCKING CDL-A Drivers Needed! Up to $4,000 SIGN ON BONUS! Starting Pay Up to . 46cpm. Full Benefits, Excellent Hometime, No East Coast. Call 7 days/wk! TeamGTI.com 888-653-3304 Need Legal Help? FREE REFERRAL Call 877-270-3855 Courtesy of the Illinois State Bar Association at www.IllinoisLawyerFinder.com SERVE TO LEARN. Earn money for college, train for a career, receive excellent pay and benefits. Serve in the National Guard. Call 1-800-GO-GUARD or visit nationalguard.com

Unit 842 (10 x 20) Property of Jeffrey Phen. Unit 240 (10 x 10) Property of Leonard Green. Unit 325 (5 x 10) Property of

Call to advertise 815-455-4800 Follow Northwest Herald on Twitter @nwherald

PUBLIC NOTICE ORDINANCE 13-01 ANNUAL APPROPRIATION ORDINANCE NORTHERN MORAINE WASTEWATER RECLAMATION DISTRICT AN ORDINANCE APPROPRIATING SUCH SUMS OF MONEY DEEMED NECESSARY TO DEFRAY ALL NECESSARY EXPENSES AND LIABILITIES OF THE NORTHERN MORAINE WASTEWATER RECLAMATION DISTRICT, LAKE AND McHENRY COUNTIES, STATE OF ILLINOIS, FOR THE FISCAL YEAR OF SAID DISTRICT COMMENCING MAY 1, 2013 AND ENDING APRIL 30, 2014. BE IT ORDAINED BY THE BOARD OF TRUSTEES OF THE NORTHERN MORAINE WASTEWATER RECLAMATION DISTRICT, LAKE AND McHENRY COUNTIES, ILLINOIS, as follows: SECTION 1: That the sums hereinafter specified, or so much thereof as may be authorized by law, be and the same are hereby appropriated for the corporate purposes of the Northern Moraine Wastewater Reclamation District, Counties of Lake and McHenry and State of Illinois, for the fiscal year commencing May 1, 2013 and ending April 30, 2014. SECTION 2: That such appropriations shall be regarded as the maximum amounts to be expended under the respective appropriations amount and shall not be construed as a determination or approval by the Board of Trustees for the expenditure of the sums so specified, or of the payment of any obligation or liability of such District, whether fixed, contingent or otherwise, but shall be deemed only as provision for funds as required by law for the payment of the legal obligations of the District when and as the bills, contracts or other evidence of such obligations have been duly vouchered, audited and approved by the Board of Trustees. SECTION 3: That the amount appropriated for each object and purpose shall be as follows:

Amount Appropriated GeneralFund 5000 Salaries 5040 Training/Seminars 5130 Maintenance- Equipment 5330 Telephone 5380 Rental 5390 Travel Expenses 5410 Software Support 5450 Legal Services 5510 Office Supplies 5530 Web Site Expenses 5540 Printing/Publishing 5560 Membership Dues 5630 Bank Service Charges 5710 Miscellaneous Expenses Other Expense 6010 Office Equipment over $500 Total General Fund Expenses Audit Fund 5420 Accounting Services Total Audit Expenses Sewer O&M Fund 5000 Salaries 5010 Payroll Tax Expense 5020 Payroll Expense other 5030 Employee Insurance 5040 Training/Seminars 5050 Clothing Allowance 5110 Maintenance - Buildings 5120 Maintenance - Vehicles 5130 Maintenance-Equipment 5140 Maintenance - Utility Systems 5150 Maintenance Supplies 5160 Sludge Hauling 5210 Operating Supplies 5220 Motor Fuel & Lube 5230 Vehicle Supplies 5240 Lab Supplies 5245 Miscellaneous Equipment 5250 Small Tools 5255 Chemical Expenses 5260 Safety Equipment 5330 Telephone 5360 Utilities 5361 Security System 5380 Rental 5390 Travel Expenses 5430 Professional Lab Testing 5435 JULIE Locate Expenses 5440 Engineering Services 5450 Legal Services 5460 Permit Fees (Publshed in the Northwest Herald May 31, 2013)

$14,760.00 $2,050.00 $1,230.00 $20,500.00 $153.75 $256.25 $8,712.50 $15,375.00 $9,225.00 $1,537.50 $3,075.00 $3,075.00 $76.88 $102.50 $80,129.38 $3,946.25 $84,075.63 $6,457.50 $6,457.50

5480 Other Professional Services 5510 Office Supplies 5520 Postage 5540 Printing and Publishing 5550 Publications & Subscriptions 5560 Membership Dues 5630 Bank Service Charges 5710 Miscellaneous Expenses 5810 Refunds Other Expense 6030 Capitalized Treatment Upgrade 6070 Building Improvements Total Sewer O&M Expenses Tort Immunity Fund 5320 General Insurance Construction Fund 6030 Capitalized Treatment Upgrade Total Construction Expense Alternate Revenue Bond Fund Expenses 5640 Interest Expense 5710Miscellaneous Expenses 6040 Bond Principal

$23,698.00 $1,025.00 $25,568.91 $1,537.50 $512.50 $2,050.00 $8,200.00 $717.50 $1,537.50 $1,252,039.70

$840,317.55 $30,750.00 $2,123,107.25 $97,846.50

$1,557,750.00 $1,557,750.00 $90,666.25 $15.00 $395,666.25 $486,347.50

Appropriations Summary for the Fiscal Year Ending April 30, 2014 General Fund Expenses $84,075.63 Audit Fund Expenses $6,457.50 Total SO&M $2,123,107.25 Tort Immunity Fund $97,846.50 Construction Fund $1,557,750.00 Alternate Revenue Bond Fund $486,347.50 $4,355,584.38 SECTION 4: Any sums of money heretofore appropriated and not heretofore expended or drawn against, now in the Treasury of the Northern Moraine Wastewater Reclamation District, are hereby specifically reappropriated for the same general and special purposes for which the same were originally made and may be expended in making up any insufficiency in any other item or items provided in this Ordinance. SECTION 5: That any unexpected balance of any items of any appropriationsmadebythisOrdinancemaybeexpendedinmakingany insufficiencyinanyotheritemofappropriationmadebythisOrdinance. SECTION 6: That should any clause, sentence, paragraph or part of this Ordinance be declared by a court of competent jurisdiction to be invalid, such decision shall not affect the validity of the Ordinance as a whole or any part thereof other than the part so declared to be invalid. SECTION 7: That the Clerk is hereby authorized and directed by the Board of Trustees to publish this Ordinance in accordance with the Statute in such case made and provided. SECTION 8: That a certified copy of this ordinance shall be filed with the County Clerks of the County of McHenry and County of Lake within thirty (30) days of adoption. SECTION 9:That this Ordinance shall be in full force and effect from and after its passage, approval and publication as provided by law.

$467,581.16 $34,556.37 $309.55 $68,505.46 $18,347.50 $871.25 $13,530.00 $6,662.50 $40,231.25 $53,812.50 $12,300.00 $20,500.00 ADOPTED this 14th day of May 2013, pursuant to a roll call vote by the Board of Trustees of the Northern Moraine Wastewater $21,525.00 Reclamation District $13,325.00 $717.50 Ayes: 5 $7,687.50 Nays: 0 $41,000.00 Abstain: 0 $768.75 $46,125.00 $10,250.00 APPROVED this 14th day of May 2013 $2,911.00 $145,898.50 $6,334.50 Kenneth A. Michaels, Jr., President $768.75 Northern Moraine Wastewater Reclamation District $1,025.00 ATTEST: $6,150.00 $3,280.00 $61,500.00 Maria Carrera, Clerk $61,500.00 Northern Moraine Wastewater Reclamation District $19,218.75


CLASSIFIED

Northwest Herald / NWHerald.com

▲ ▲

▲ ▲

▲ ▲

SUDOKU

Wednesday, June 5, 2013 • Page E9

CROSSWORD

HOROSCOPE

▲ ▲

TODAY - Success in several partnership arrangements is a strong possibility in the year ahead. Although these alliances will take time to develop, be patient, because they will pay off in the long run. GEMINI (May 21-June 20) -- You might find it necessary to make a small but significant sacrifice for a loved one. Don’t make a big deal out of it. CANCER (June 21-July 22) -- You should concentrate on your latest interest, because that’s where you’re likely to make your greatest strides. It won’t hurt to put your other hobbies on the back burner. LEO (July 23-Aug. 22) -- If you’re properly motivated, you can make some outstanding achievements. If you just coast along, however, you’ll actually lose ground. VIRGO (Aug. 23-Sept. 22) -- Try to find time to spend with friends who share your philosophical beliefs. You can help one another to think bigger and better. LIBRA (Sept. 23-Oct. 23) -- Your ability to uncover things that others are trying to keep hidden is unusually keen. Now is the time to investigate a work matter that hasn’t seemed right to you. SCORPIO (Oct. 24-Nov. 22) -- One-on-one relationships will require grace and tact. To appease a certain individual, you might have to make a few concessions that you normally would balk at. SAGITTARIUS (Nov. 23-Dec. 21) -- Don’t think your self-esteem won’t suffer if you fritter your time away. Many of your friends might get away with being unproductive, but you won’t. CAPRICORN (Dec. 22-Jan. 19) -- A group project will fare better if you take a leadership role. The current commander might not be as talented as you. AQUARIUS (Jan. 20-Feb. 19) -- You are presently in an excellent cycle, so don’t waste this day. Visualize the results you want and work for them with all your might. PISCES (Feb. 20-March 20) -- If you find yourself a bit restless, either mentally or physically, check out new project that has aroused your curiosity. It might be just what you’re looking for. ARIES (March 21-April 19) -- Don’t be surprised if you are unusually focused on your material interests. Even when you’re just having some fun, it’s likely to have something to do with money. TAURUS (April 20- May 20) -- You’ll have no trouble asserting yourself in any kind of situation that calls for it, but you won’t go so far as to push others around to get your way.

JUMBLE

WEDNESDAY EVENING JUNE 5, 2013 5:00

5:30

6:00

6:30

7:00

7:30

8:00

8:30

9:00

9:30

10:00

10:30

11:00

11:30

12:00

12:30

Comics UnCriminal Minds Kevin thinks Garcia CSI: Crime Scene Investigation CBS 2 News at (:35) Late Show With David Letter- (:37) The Late Late Show With 10PM (N) (CC) man (N) ’ (CC) leashed Craig Ferguson (N) ’ (CC) has a love interest. ’ “Strip Maul” ’ (CC) (DVS) NBC 5 Chicago (:34) The Tonight Show With Jay (:36) Late Night With Jimmy Fallon Last Call With Law & Order: Special Victims Unit Chicago Fire A failed rescue News at 10:00 Leno (N) ’ (CC) Carson Daly ’ ’ (CC) “Undercover Blue” ’ (CC) impacts firehouse 51. ’ (CC) (:37) Nightline (12:07) Windy City Live Hosts Val The Middle ’ Family Tools (N) Modern Family Live WithYour ABC’s The Lookout (N) ’ (CC) ABC7 News (N) (:35) Jimmy Kimmel Live Seth Parents Warner and Ryan Chiaverini. (CC) (DVS) (CC) (DVS) ’ (CC) Rogen; Chris Messina. (N) ’ (CC) (N) (CC) ’ (CC) Arrow “Honor Thy Father” Oliver Supernatural Kevin’s mom is sur- WGN News at Nine (N) ’ (CC) 30 Rock “I Do Friends ’ (CC) Friends ’ (CC) Family Guy 30 Rock ’ (CC) According to ) WGN “Family Goy” Jim ’ (CC) runs into Laurel. ’ (CC) rounded with demons. ’ (CC) Do” ’ (CC) BBC World Nightly Busi(:15) Ed Slott’s Retirement Rescue for 2013! Step-by-step plan for Chicago Tonight Matthew Morrison:Where It All Il Volo We are Love Three Italian tenors perform in Wild Kratts ’ + WTTW (EI) (CC) Began -- Live From the Bushnell Miami. ’ (CC) News ’ (CC) ness Report (N) retirement. ’ (CC) ’ Out of Ireland Globe Trekker The U.S. Mint in Journal (CC) Tavis Smiley ’ Charlie Rose (N) ’ (CC) Journal (CC) Masterpiece Newsline ’ (CC) Nightly Busi- Michael Wood’s Story of England Rick Steves’ Journeys in 4 WYCC ness Report (N) Lost history of Kibworth, England. Europe (CC) (CC) Mystery! ’ India “Kerala” ’ Denver; Mesa Trail. ’ Family Guy American Dad The Simpsons Family Guy NUMB3RS “Primacy” The world of NUMB3RS “Burn Rate” A serial That ’70s Show That ’70s Show The Simpsons American Dad Baggage (CC) Excused ’ (CC) Everybody Frasier “IQ” ’ 8 WCGV “Family Goy” Loves Raymond (CC) “MoneyBART” “Peter’s Two Dads” alternate-reality gaming. (CC) “Con Heir” ’ letter-bomber. ’ (CC) ’ (CC) ’ (CC) ’ (CC) ’ (CC) Rules of EnRules of EnThe King of That ’70s Show Seinfeld “The Seinfeld “The The King of The Doctors Learning from celebri- omg! Insider (N) Are We There Are We There Meet the Browns Tyler Perry’s Tyler Perry’s Family Guy : WCIU Queens (CC) ’ (CC) Yet? Yet? House of Payne House of Payne “Peter’s Two Dads” gagement ’ gagement ’ Queens (CC) Cadillac” (CC) Shoes” (CC) ties’ deaths. ’ (CC) ’ (CC) Dish Nation (N) The Simpsons The Simpsons MasterChef Preparing a meal for 300 children. (N) ’ (CC) (DVS) Fox Chicago News at Nine (N) ’ TMZ ’ (CC) Dish Nation ’ The Office The Office ’ King of the Hill King of the Hill @ WFLD TMZ (N) (CC) Black Nouveau BBC World BBC World Nightly Busi- Magic Moments:The Best of 50s Pop Musicians perform. ’ (CC) PBS NewsHour (N) ’ (CC) Charlie Rose (N) ’ (CC) Tavis Smiley ’ Journal (CC) PBS NewsHour (N) ’ (CC) D WMVT (CC) News America ness Report (N) News ’ (CC) Flashpoint “Severed Ties” (CC) Flashpoint “Follow the Leader” Flashpoint “Whatever It Takes” WWE Main Event (N) ’ Flashpoint ’ (CC) Flashpoint “The Other Lane” ’ F WCPX (4:30) Movie: ›› “The Quick and the Dead” (1995) Sharon Stone. Two/Half Men Big Bang FOX 39 News at Nine (N) MasterChef Preparing a meal for 300 children. (N) ’ (CC) (DVS) Family Guy ’ American Dad 30 Rock (CC) 30 Rock (CC) G WQRF American Dad Family Guy ’ Two/Half Men Big Bang How I MetYour How I MetYour Everybody Everybody Law & Order: Criminal Intent A It’s Always Cops “JacksonFamily Feud ’ Family Feud ’ The Big Bang The Big Bang NUMB3RS “Primacy” The world of NUMB3RS “Burn Rate” A serial R WPWR (CC) Theory (CC) Theory (CC) Mother (CC) Mother (CC) Loves Raymond Loves Raymond serial killer resurfaces. ’ (CC) Sunny in Phila. ville” ’ (CC) alternate-reality gaming. (CC) (CC) letter-bomber. ’ (CC) CABLE 5:00 5:30 6:00 6:30 7:00 7:30 8:00 8:30 9:00 9:30 10:00 10:30 11:00 11:30 12:00 12:30 Duck Dynasty Duck Dynasty Duck Dynasty Duck Dynasty Duck Dynasty Duck Dynasty Duck Dynasty Duck Dynasty Duck Dynasty Duck Dynasty Duck Dynasty Duck Dynasty Duck Dynasty Duck Dynasty (A&E) The First 48 (CC) CSI: Miami “Rest in Pieces” The Movie ››› “National Lampoon’s Christmas Vacation” (1989, Com- (:15) Movie › “Vegas Vacation” (1997, Comedy) Chevy Chase. The (:15) Movie ›› “National Lampoon’s Vacation” (1983) Chevy Chase. A (12:15) Movie ›› “National (AMC) Miami Taunter kills again. (CC) edy) Chevy Chase, Beverly D’Angelo, Randy Quaid.‘PG-13’ (CC) Griswolds descend upon the gambling mecca.‘PG’ (CC) vacationing family detours into screwball side trips.‘R’ (CC) Lampoon’s European Vacation” Tanked “Jurassic Campground” Tanked “Jurassic Campground” (ANPL) To Be Announced Tanked ’ (CC) Tanked “Fermenting Donuts” ’ Treehouse Masters ’ Tanked “Fermenting Donuts” ’ Treehouse Masters ’ Erin Burnett OutFront Piers Morgan Live Erin Burnett OutFront (N) Anderson Cooper 360 (N) (CC) Piers Morgan Live (N) (Live) Anderson Cooper 360 (CC) Anderson Cooper 360 (CC) (CNN) (4:00) The Situation Room (N) (:27) Tosh.0 Colbert Report Daily Show (6:58) Futurama (:29) Futurama South Park South Park Daily Show Colbert Report (:01) South Park (:31) South Park Daily Show Colbert Report Futurama (CC) South Park (COM) South Park Cubs Postgame SportsNet Cent SportsNet Cent SportsNet Cent Fight Sports SportsNet Cent SportsTalk Live SportsTalk Live (N) (Live) MLB Baseball: Chicago Cubs at Los Angeles Angels of Anaheim. (N) (Live) (CSN) The Big Brain Theory MythBusters “Duct Tape Hour 2” MythBusters ’ (CC) MythBusters “Duct Tape Hour 2” Outrageous Acts of Science ’ (DISC) Deadliest Catch ’ (CC) Outrageous Acts of Science ’ MythBusters (N) ’ (CC) Cory in the (:35) Gravity Shake It Up! Good Luck Dog With a Blog Austin & Ally ’ Shake It Up! ’ Cory in the A.N.T. Farm ’ Jessie ’ (CC) Jessie ’ (CC) Shake It Up! ’ Austin & Ally ’ Movie ›› “G-Force” (2009, Action) Bill Nighy, Zach (DISN) Charlie (CC) (CC) (CC) (CC) House ’ (CC) House ’ (CC) “Start It Up” ’ (CC) Falls ’ (CC) “Wingstan” ’ (CC) Galifianakis. ’ ‘PG’ (CC) (4:50) Movie: ››› “Presumed Innocent” (1990) Harrison Ford. A mar- Movie: ›› “Conspiracy Theory” (1997, Suspense) Mel Gibson, Julia Roberts, Patrick (:20) Movie: ›› “Absolute Power” (1997, Suspense) Clint Eastwood. A Movie: ››› “Blue Steel” (1990, Suspense) Jamie (ENC) ried prosecutor goes on trial for his lover’s murder. ’ (CC) Stewart. A paranoid cabbie’s rantings make him a CIA target. ’ (CC) master thief stumbles into a presidential conspiracy. ’ (CC) Lee Curtis, Ron Silver, Clancy Brown. ’ (CC) NFL History NFL History College Softball: NCAA World Series Championship, Game 3: Teams TBA. (N) (CC) SportsCenter (N) (Live) (CC) SportsCenter (N) (Live) (CC) SportsCenter (N) (Live) (CC) (ESPN) SportsCenter (N) (Live) (CC) Interruption MLB Baseball: Texas Rangers at Boston Red Sox. From Fenway Park in Boston. (N Subject to Blackout) Baseball Tonight (N) (Live) (CC) Nation at Night (N) (Live) Baseball Tonight (N) (Live) (CC) NASCAR Now NFL Live (N) (ESPN2) Around/Horn Fresh Prince Fresh Prince Paid Program Paid Program (FAM) Baby Daddy ’ Baby Daddy ’ Melissa & Joey Melissa & Joey Melissa & Joey Baby Daddy (N) Dancing Fools Melissa & Joey The Fosters “Pilot” ’ (CC) The 700 Club ’ (CC) Special Report With Bret Baier FOX Report With Shepard Smith The O’Reilly Factor (N) (CC) On Record, Greta Van Susteren The O’Reilly Factor (CC) Hannity On Record, Greta Van Susteren Hannity (N) (FNC) Diners, Drive Restaurant: Impossible Restaurant: Impossible Restaurant: Impossible Mystery Diners Mystery Diners Restaurant: Impossible Restaurant Stakeout Restaurant Stakeout (N) (FOOD) Diners, Drive (3:30) Machete Anger Two/Half Men Two/Half Men Movie: ››› “Salt” (2010, Action) Angelina Jolie, Liev Schreiber. (FX) Movie: ››› “Salt” (2010, Action) Angelina Jolie, Liev Schreiber. Movie: › “Deep Rising” (1998) Treat Williams, Famke Janssen. The Brady The Brady The Brady The Brady The Golden The Golden The Golden Frasier Patients Frasier “Murder Frasier “Guns ’N Frasier “Seabee Frasier “Frasier- Frasier ’ (CC) Frasier “Freudian Frasier “Caught The Golden (HALL) Bunch (CC) Bunch (CC) Bunch (CC) Bunch (CC) frazzle Frasier. Most Maris” ’ Neuroses” Jeebies” (CC) Lite” ’ (CC) Girls ’ (CC) Girls ’ (CC) Girls ’ (CC) Girls ’ (CC) Sleep” ’ in the Act” ’ House Hunters Hunters Int’l House Hunters Hunters Int’l Property Brothers (CC) Property Brothers (CC) Property Brothers (CC) (HGTV) Income Property “Karen & Kevin” Income Property “Jason & Peky” Elbow Room (N) Elbow Room Larry the Cable Guy Larry the Cable Guy American Pickers (CC) American Pickers (CC) Top Shot All-Stars (N) (CC) (:02) Top Shot All-Stars (CC) (:01) American Pickers (CC) (HIST) Swamp People (CC) Unsolved Mysteries (CC) Unsolved Mysteries (CC) Unsolved Mysteries (CC) Unsolved Mysteries (CC) Unsolved Mysteries (CC) (:01) Unsolved Mysteries (CC) (:02) Unsolved Mysteries (CC) (12:02) Unsolved Mysteries (CC)

CBS 2 News at ^ WBBM 5:00PM (N) ’ NBC 5 Chicago % WMAQ News at 5:00 ABC7 News (N) _ WLS ’ (CC) MLB Baseball

CBS Evening News/Pelley NBC Nightly News (N) (CC) ABC World News WGN News at Five (N) (CC) The Electric Company Journal (CC)

CBS 2 News at Entertainment 6PM (N) (CC) Tonight (N) ’ NBC 5 Chicago Access HollyNews at 6:00 wood (N) (CC) ABC7 News ’ Wheel of Fortune (N) (CC) (CC) Two and a Half Two and a Half Men ’ (CC) Men ’ (CC) PBS NewsHour (N) ’ (CC)

The American Baking Competition (N) ’ (CC) Dateline NBC (N) ’ (CC)

(LIFE)

Hardball With Chris Matthews The Last Word All In With Chris Hayes The Rachel Maddow Show All In With Chris Hayes (N) The Rachel Maddow Show (N) The Alectrix ’ Awkward. ’ Girl Code ’ Girl Code ’ The Real World ’ (CC) The Real World (N) ’ (CC) The Real World (N) ’ (CC) Girl Code ’ Girl Code ’ Victorious ’ Drake & Josh Full House ’ Full House ’ Full House ’ Full House ’ The Nanny ’ The Nanny ’ Friends (CC) (:33) Friends ’ (:06) Friends (:39) Friends (3:30) Movie: ›› “The Wolfman” Movie: ›› “Snakes on a Plane” (2006, Horror) Samuel L. Jackson, Kenan Thompson. Movie: ›› “Piranha” (2010) Elisabeth Shue, Adam Scott. Hundreds of Never Ever Do Never Ever Do Never Ever Do This at Home This at Home This at Home (2010) Benicio Del Toro. ’ Premiere. An FBI agent contends with a swarm of deadly serpents. ’ man-eating fish converge on a popular waterside resort. ’ Paranormal Witness Wine box is Haunted Collector The team Haunted Collector The team Haunted Collector “House of Pain; Paranormal Witness “The Long Haunted Collector “House of Pain; Paranormal Witness “The Long said to house evil spirits. investigates a home. investigates Madison Seminary. Antique Spirits” (N) Island Terror” Antique Spirits” Island Terror” Movie: ››› “Westward the Women” (1951) Robert Taylor, Denise Movie: ››› “The Far Country” (1955, Western) (:45) Movie: ››› “Winchester ’73” (1950) James Stewart, Shelley Movie: ››› “Devil’s Doorway” (1950, Western) Darcel. Women travel to California to meet their new husbands. James Stewart, Ruth Roman, Walter Brennan. (CC) Winters. A cowboy is determined to retrieve his stolen rifle. (CC) Robert Taylor, Louis Calhern, Paula Raymond. (CC) Breaking Amish: Brave New The Good Buy The Good Buy Toddlers & Tiaras ’ (CC) The Good Buy The Good Buy Toddlers & Tiaras ’ (CC) Toddlers & Tiaras ’ (CC) Toddlers & Tiaras ’ (CC) Castle “Setup” (CC) (DVS) Castle “Countdown” CSI: NY “Sanguine Love” (CC) Major Crimes (CC) Castle “Last Call” ’ (CC) Castle “Nikki Heat” ’ (CC) Castle “The Final Nail” ’ M*A*S*H (CC) M*A*S*H (CC) Home Improve. Home Improve. Hot, Cleveland The Exes (CC) Love-Raymond Love-Raymond Hot, Cleveland The Soul Man King of Queens King of Queens (:12) The King of Queens (CC) NCIS “Toxic” A government scientist NCIS “Truth or Consequences” The NCIS “Reunion” The death of a NCIS “The Inside Man” A blogger NCIS “Good Cop, Bad Cop” A NCIS “Code of Conduct” Joke-loving NCIS “Road Kill” Death of a petty goes missing. ’ (CC) team tries to replace Ziva. ’ Marine. ’ (CC) turns up dead. ’ (CC) Marine’s body surfaces. ’ (CC) Marine is found dead. ’ officer. ’ (CC) 100 Greatest Songs of the ’00s 100 Greatest Songs of the ’00s 100 Greatest Songs of the ’00s 100 Greatest Songs of the ’00s Bringing Up Baby: Royal Edition Model Employee (N) ’ Hit the Floor “Game On” ’ King of Queens Seinfeld (CC) Seinfeld (CC) Seinfeld (CC) Family Guy ’ Family Guy ’ Big Bang Big Bang Big Bang Big Bang Conan (N) (CC) The Office ’ Conan (CC)

(MSNBC) PoliticsNation (N) Mind Right (MTV) Mind Right SpongeBob (NICK) SpongeBob (SPIKE) (SYFY) (TCM) (TLC) (TNT) (TVL) (USA) (VH1) (WTBS)

PREMIUM (HBO) (MAX) (SHOW) (TMC)

5:00

5:30

6:00

6:30

7:00

7:30

8:00

8:30

9:00

9:30

10:00

10:30

(4:45) Movie “Reagan” (2011) The life and legacy of Movie ›› “Trouble With the Curve” (2012) Clint Eastwood. An aged Veep “Shutdown” Game of Thrones Robb presents Real Time With Bill Maher Health(CC) care expert Neera Tanden. (CC) baseball scout takes his daughter on a road trip.‘PG-13’ (CC) himself to Walder Frey. ’ (CC) President Ronald Reagan. ’ ‘NR’ (CC) Movie ›› “The Revenant” (2009, Comedy) David Anders. A conscious Banshee “Pilot” Thief assumes the Movie ››› “Heat” (1995, Crime Drama) Al Pacino, Robert De Niro, Val Kilmer. A homicide detective matches identity of a sheriff. ’ (CC) wits with a cunning adversary. ’ ‘R’ (CC) corpse needs blood to prevent his decay. ’ ‘R’ (CC) The Borgias “Tears of Blood” (4:45) Movie ›› “Shade” (2003) Stuart Townsend. Movie ›› “All In:The Poker Movie” (2009) The 60 Minutes Sports (N) ’ (CC) 60 Minutes Sports ’ (CC) Con artists try to swindle a poker player.‘R’ renaissance of one of our nation’s oldest games. Pilgrims travel to Rome. ’ (CC) (3:30) Movie (:20) Movie “Pros & Ex-Cons” (2005, Action) Sam Movie ›› “Valkyrie” (2008, Historical Drama) Tom Cruise. Col. Claus Movie ›› “W.” (2008, Docudrama) Josh Brolin. Premiere. The life and “Last Dance” Worthington, Steve Bastoni, Brett Stiller. ’ ‘R’ (CC) von Stauffenberg attempts to assassinate Hitler. ’ ‘PG-13’ controversial presidency of George W. Bush. ’ ‘PG-13’ (CC)

11:00

11:30

The Last Word Guy Code ’ Guy Code ’ George Lopez George Lopez Never Ever Do 1,000 Ways to This at Home Die ’ Movie:“Scream of the Banshee” (2011, Horror) Lauren Holly. Movie: ›› “Cimarron” (1960) Glenn Ford, Maria Schell. (CC) Breaking Amish: Brave New Cold Case “The Letter” ’ (CC) King of Queens Golden Girls House “Transplant” House helps the team with a patient. ’ (CC) Movie: ›››› “Pulp Fiction” The Office

12:00

12:30

Family Tree ’ (:45) Movie ›› “A Very Harold & Kumar 3D Christ(CC) mas” (2011, Comedy) John Cho. ’ ‘R’ (CC) (10:50) Zane’s (:20) Movie “Pleasure Spa” (2013, (:35) ›› “The Running Man” the Jump Off ’ Adult) ’ ‘NR’ (CC) Jim Rome on Showtime Gigolos ’ (CC) The 2013 AVN Awards (CC) (:10) Movie ››› “Fahrenheit 9/11” (2004, Documentary) Filmmaker Michael Moore examines the Bush adminstration. ’ ‘R’ (CC)


Page E10• Wednesday, June 5, 2013

CLASSIFIED

Northwest Herald / NWHerald.com

The Illinois Classified Advertising Network (ICAN) provides advertising of a national appeal. To advertise in this section, please call ICAN directly at 217-241-1700. We recommend discretion when responding. Please refer questions & comments directly to ICAN.

READER NOTICE: As a service to you -- our valued readers -- we offer the following information. This newspaper will never knowingly accept any advertisement that is illegal or considered fraudulent. If you have questions or doubts about any ads on these pages, we advise that before responding or sending money ahead of time, you check with the local Attorney General's Consumer Fraud Line and/or the Better Business Bureau. They may have records or documented complaints that will serve to caution you about doing business with these advertisers. Also be advised that some phone numbers published in these ads may require an extra charge. In all cases of questionable value, such as promises or guaranteed income from work-at-home programs, money to loan, etc., if it sounds too good to be true -- it may in fact be exactly that. Again, contact the local and/or national agency that may be able to provide you with some background on these companies. This newspaper cannot be held responsible for any negative consequences that occur as a result of you doing business with these advertisers.

1994 Mercedes Benz C280, AC excellent rubber, runs great, vry clean, well maintained. $3150 815-568-8646 lv msg if no ans.

1998 Saturn SL2 180K, good condition, second owner, $1000 Tim 815-759-1780

2000 Oldsmobile Alero

54,700 miles, new tires, battery, brakes. $3000. 224-627-8029 2000 Pontiac LS. 4 door. Black. 86K mi. New tires, front brakes, new rotors. Runs great. Wife's car. $4250. 847-669-5530 2001 Chrysler PT Cruiser Ltd $3500 Must See. Orig owner, 105K EXCELLENT New Wheels, Brakes, Battery, Alt/Belts. 847-987-2008

2002 Ford Expedition $3000. 847-219-2454

2004 Mazda 6 gunmetal grey, 4 door, 165K miles, good body, new tires, needs new engine, $1000 224-829-4834

Start finding better today. Visit www.NWHerald.com/jobs or call 1-800-589-8237 2005 Ford Ranger XLT. V6. 3L. A/C, Tilt Wheel, AM/FM/CD, Running Boards, Shell. 44K mi. $11000. 847-802-4270

www.HuskieWire.com All NIU Sports... All The Time

FREE Money!

FREE Classified Ad! Sell any household item priced under $400.

Visit nwherald.com/PlaceAnAd or use this handy form.

âœ

Headline:___________________________________________

Description:_________________________________________ __________________________________________________ __________________________________________________ Asking Price (required):________________________________ Best Time To Call:____________________________________ Phone:_____________________________________________ NAME:_____________________________________________ ADDRESS:__________________________________________ CITY__________________________STATE_____ZIP________ DAYTIME PHONE:____________________________________ E-Mail:_____________________________________________

Upgrade Your Ad ! Add Bold $5 ! Add A Photo $5 ! Add an Attention Getter $5 ! ! !

Mail to: Free Ads P.O. Box 250 Crystal Lake, IL 60039-0250 ! Sell an item priced Email: over $400 - $26 classified@shawsuburban.com

Ad will run one week in the Northwest Herald and on nwherald.com. One item per ad. Offer excludes real estate, businesses & pets, other restrictions may apply. We reserve the right to decline or edit the ad.


CLASSIFIED

Northwest Herald / NWHerald.com BATH VANITY TOP - New 36" stone, w/ sink. Still in carton. 815-385-1285 Birch doors, 2-30” painted, stained w/jams $5/each 815-385-0020

1999 Chevrolet Astro. Handicap driver & wheel chair accessible. 99K mi. Fair condition. AWD. $4995 OBO. 815-382-6665 2000 Chrysler Town and Country $2000/OBO 815-909-7771

1957 Chevy Pickup. Barn Find Restoration project. 87K miles. $2300. obo. 847-875-6739 1988 Chevy Corvette. Black. One owner. Excellent condition. $11,000 OBO. 847-533-7321

Car Rims (4) -18- Brand- MB- pattern 120, $220. 815-900-1807 Front Bumper: 73 to 80 Chevy Truck $40 815-219-3882 TIRE - Single Goodyear Eagle RS-A Tire (Used). Size: P215/50R17, Driven about 15000 mi. Asking $20, Call 847-658-2338, pick up in Algonquin Tire Rims ~ Konig Silver, 17x7 5 on 100 in good condition! $300/for 4 815-900-6009

A-1 AUTO

BRICKS - OVER 300 "KING SIZE", 9 1/2 BY 2 3/4". LIGHT RED, HAVE BEEN STORED INDOORS. $100 TAKES ALL. 815-382-7080 FREE - Upright Piano, Keyboard in great condition. You Haul. 847-462-0302 HORSE MANURE - FREE. clean no rocks or twine. U haul we will load. take a lot or a little. 815-566-1155 Magazines – Cooking – 6”x8” Good Condition – Lots of Good Recipes FREE 815-338-9137

SATCHEL PURSE - Lg Vinyl Brown / Khaki W Cargo Pant Pockets. 18" W x 14" H. Black lining w/ pockets of same material. $35. McHenry 815-236-1747 SPECIAL OCCASION DRESS - Stunning, fancy full with intricate detailing, gorgeous bead work, very beautiful. White, Girls Size 12, Communion, Junior Bride, Flower Girl, Quinceanera. $75. 815-477-9023 Suit: Men's black suit size 42, like new, $45 815-356-1870 Sweater, Womans - Harley Davidson, Black Turtleneck, Size XL. $15 224-387-6480 9am - 12pm Wedding Kimonos – Japanese Ceremonial – Adult Size – Silk - New $140ea. 815-675-6516

WAHL APPLIANCE

Will BUY UR USED CAR, TRUCK, SUV,

MOST CASH WILL BEAT ANY QUOTE GIVEN!! $400 - $2000 “don't wait.... call 2day”!! * 815-575-5153 * !!!!!!!!!!!

I BUY CARS, TRUCKS, VANS & SUVs 1990 & Newer Will beat anyone's price by $300. Will pay extra for Honda, Toyota & Nissan

815-814-1964 or

815-814-1224 !!!!!!!!!!!

WANTED: OLD CARS & TRUCKS FOR

$CASH$ We pay and can Tow it away!

Call us today: 815-338-2800 ROUTE 14 AUTO PARTS

Butterfly Sailboat Good condition, $700. 815-338-4734

OMC Sringer Drive Complete

175HP includes throttle, steering, etc, 302 Ford. Local delivery available. $350/obo. 815-404-9510 ~ Cell

2002 Trail Lite Camper For SALE. Model - B21B Bantam, comes fully equipped to start camping today. Must see! Asking $5,500. Please call 847-343-6869 for details. Fleetwood Flair Class A motorhome. Low miles. All amenities. $7995. 815-943-3134

1995 Honda GL 1500 Goldwing, Interstate, 40,000 Miles, Red, Some Extras, Great Shape, $5500. 630-746-9944 2000 HD ELECTRA GLIDE 18k mi., Exc. Cond., 2 covers, 4 spkr stereo, much more. $9500. 815-307-9714 2003 Road King Classic, black anniversary model, 46,000 miles, 1 owner, lots of extras, $11,500/OBO 847-774-7751

Reconditioned Appliances Lakemoor 815-385-1872 FREEZER - Sears Kenmore Coldspot upright freezer. Older model that works great! Asking $150/obo. Can email picture of freezer interior. Call Mike 815-260-8297 before 9 pm Range – Frigidaire – Gas – 4 Burner – White – Self Cleaning Oven Needs Igniter - $40 Harvard 847-854-1494 After 6pm Toaster Oven /MW Operation – Sharp Oven capacity 0.5cu.ft.Works – Manual - Harvard $20 847-854-1494 After 6pm

McHenry County Fairgrounds $7 Admission & $40 Booth

630-985-2097

WE'VE GOT IT! Northwest Classified 800-589-8237 www.NWHerald.com

LIGHTING TRIMS - 4 Halo 993W Recessed Lighting Trims. New in box, $40 for all 4. 815-344-3073 VANITY - 32" bathroom vanity w/stone top & sink, moen faucet & mirror. All $45. 815-385-1285

ASPHALT ROLLER 1-1/4 Ton and Trailer, both redone, parts and paint, $2000. 815-382-4009 Liquidating ~ Tan metal desks cubicles, office supplies, resume folders and stationary, $400. 815-385-9383

Bar Sign: Neon lite beer sign, works fine no damage, can email pics. $60 815-690-1073 BULLETIN BOARD WITH CUBBIES Corkboard measures 23 H x 15 W with 3 cubbies 5 W x 3.5 D, 4 antiqued hooks to hold keys, leashes, caps, etc., quality made, framed in satin black, like new condition. $35. 815-477-9023 DOLL - Ashton Drake Winter Bride Porcelain Doll. in original box. $25. email: trichalin@aol.com

BUTTER CHURN - Antique Wooden Butter Churn 18" high, the barrel is constructed with oak wood slats & 4 brass bands & 10" diameter at the bottom tapered to 8-1/2" at the top. The dasher stick is 42" long. It is in excellent used condition and is very clean. This is a fun piece for country decoration and can be used for storage. $165. Bring cash. 815-236-1747 CHAIR - Antique Child's Red Wooden Chair - 24-1/2" high at back. $28. McHenry. 815-236-1747

Light - BUDWEISER BEER LIGHT WORKS GOOD, CAN SEND PICS. $25. 815-690-1073

Good Condition—works great Charging Cable included, but no headphones. $150 Crystal Lake 815-690-0527 Text or lv msg

Sansui Receiver, 1970's, great sound, powerful. Z9000. $150. 815-578-0212 TELEVISION - 61” HD TV. Excellent Shape. Only 8 yrs old. $125. Call anytime, 815-861-9864. TV TOSHIBA 20” DVD/VCR combo, excellent working condition! $125 847-829-4546 TV. Toshiba. 50” $200 815-943-3134

Exercise Machine Weider Master Trainer Exercise Machine In good shape.

Steamer Trunk – 100 Yrs Old Medium Size – Original Condition $45obo 815-943-4146 after 5pm TABLE - Vintage 1950's chrome table w leaf and 4 chairs. good condition. Will email pictures. $250. call 815-455-6936.

$100

847-302-7009

Hay Wagon 16 ft. John Deere. $750 815-943-3134

6 piece wicker set: loveseat, 2 chairs, 2 end tables & coffee table $200 847-271-4478 ANTIQUE DRY SINK - Charming shabby chic painted wood antique dry sink with attached adjustable mirror and white enamel metal bowl. 25-3/4" wide, 21-1/2" deep & 29" high. 2 attached wood towel racks on each side for a total width of 33". White enamel bowl 15" diameter, 6" deep. Bottom shelf 6" from floor. Top section with mirror is 20-1/2" high & 25-3/4" wide & has 2 drawers, each 6" wide & 2-3/4" high. $380 Bring Cash. 815-236-1747 ANTIQUE OAK CHAIR - 36" high at back & seat 16-1/2" wide. 2 curved accent braces as shown. Chair is in excellent condition and is very sturdy. $52. 815-236-1747 Armoire – Light Cherry Finish – 24x41x76 - Like New $95 847-658-4608

Time-Life Planet Earth Complete set of 18 Books $25. 708-680-7022

Bar stools w/tan seats: Rattan

$15.

4/$200

815-363-5716

Bedroom Set. Triple Dresser, Mirror, Chest, 2 Night Stands, King Bed Frame. $175. 815-568-1175 CARTS - 2 Wooden Serving/Bar Carts $50. Call 708-680-7022

Chair - Upholstered

Big and comfy, pale green, good condition! Bought at Bloomingdale's, $90. 815-477-5301 CHEST OF DRAWERS - Neiman Marcus Royalty Chest of Drawers. Asking $325. 708-680-7022 Chest of Drawers. Niemann Marcus Royalty. Gorgeous. $325. 708-680-7022 Child's Twin Bed: Little Tykes Car Corvette Bed $125 847-220-0496 Cocktail Table and Matching End Table, Glass, Chrome and light wood. $50 email: trichalin@aol.com

COFFEE & SIDE TABLES

Couch ~ Chocolate Brown

Microfiber, oversize, 2 years old, like new, $125 815-529-4605 Couch/Love Seat / Ottoman Piece 3 Group – Tan Leather Over Sized! Great For Family Room $150 815-322-6192 Crib mattress: Sealy Golden Dream Ultra,150 gage inter spring, non allergenic, fits toddler bed, purchased for grandma's house, slight use, never soiled, $40 847-421-7770 CURIO CABINET- WOODEN- GREAT SHAPE- TWO SECTIONS WITH LIGHTS 3 GLASS SHELVES - 23" WIDE, 14" DEEP, 6' TALL....$100. CALL TERI 847-658-3264

Designer Arm Chairs (2) B-Vent Pipe. 6”. (4) 5 ft sections, (2) 6”- 45º fittings. $50/all. 815-260-5361 BANISTER PIECES - NEW SOLID OAK, 2 4 FOOT SECTIONS SOLID AND 2 4 FOOT CUT OUT FOR SPINDLE SECTIONS. 17 NEW WHITE SPINDLES ALSO. $25 TAKES ALL. CALL 815-382-7080 McHenryCountySports.com is McHenry County Sports

High Boy Cherry $150 847-271-4478 HIGH CHAIR - Antique Pine Child's. 39" high 17" wide with removable metal tray. Tray arm lifts. McHenry $125. 815-236-1747 Jewelry cabinet Cherry $50 847-271-4478

Kitchen table & chairs: solid oak, 6 chairs, $375/OBO 847-533-7321 KITCHEN TABLE - Black, solid wood 30” high, 59” long and 36” wide. Very strong and in nice shape. $25. Call 262-945-5207 before 9pm.

Loveseat & Couch - Beige & Blue good condition, $80/both. Light brown leather recliner, $30. 815-385-6598

Matching Dressers and armoire, great condition! $100 224-321-9680 Metal Cabinet - Brown with sliding glass doors, 55”Hx36”Wx15”D, $25. 815-363-5716

Microwave Custom Cabinet White with natural wood on coasters, has a very nice easy glide drawer, $60. 815-527-2796 Patio Table & 4 chairs $40 815-728-7466

5' L x 3'W wrought iron. All From Pier 1, seats up to 8, $350. 815-370-4165

PICTURE - 40" x 60". $175. email: trichalin@aol.com Recliner – Lazy-Boy - Med. Brown Rock/Swivel $100 firm 815-338-9397 9am-12pm Solid wood, $70 815-385-4353

Roll Top Desk and barrel chair, $100

815-385-4353

815-385-4353 SOFA - Large blue sectional sofa. Seats 6-8 with four recliners. Like new, hardly used excellent condition. $400.00 firm. McHenry area. Call 843-701-2688 Sofa Sleeper – Queen Size – 82” Long – Tan Cloth – Good Condition – None Smoker - $50.obo 815-356-7749 after 7pm Sofa Table: Cherry $60 847-271-4478 TABLE - wood & 4 chairs. Beautiful hand carved, rectangular, 72” x 40”. Coffee color $275. Call 815-900-1807

Table: round oak 50” $80 815-385-4353

TV STAND/PLANT STAND Oak, 37”Hx15”Wx12”D. Excellent cond $85. 847-829-4546

Vanity Dresser & Mirror -Waterfall $160. 815-455-2877

Wall Unit. 3 sections. White oak laminated. Shelves & doors. $250 815-895-6427

Plus 2 ottomans, $185/all. 847-833-8948 Follow Northwest Herald on Twitter @nwherald

VACUUM Hoover Wind Tunnel Self Propelled Bagless Upright w/HEPA filter. $100/cash. 847-639-8572 Wood Storage Chest - Decorative chest that is great for storage and decoration 26 L x 17.5 H x 15 W. Mitered corners, well built, excellent condition. $55. 815 477-9023

Bagger - Craftsman 42 inch Bagging Attachment (2 bin), with wall mounted storage bracket. $150 Call 847-209-8981, before 5:00pm. Ask for Dave.

Blue Spruce 2-3' $23

American Arborvitae 4-5' $25 Black Dirt $40 To Pick-Up 815-569-2117 Dethatcher - Craftsman 40 inch Dethatcher (tow behind) manually operated. $50. Call 847-209-8981, before 5:00pm. Ask for Dave. Farmall Cub 1953, restored, 5ft mower, Wegner loader, weights, 12 volt system, runs great, $3000 815-363-2454

FIELD MOWING No Job Too Large or Too Small 815-363-9636 GLIDER - WOODEN ROCKER Handcrafted double seat glider bench. Great for the patio, porch or among flowering plants in your garden. Smooth gliding motion for relaxation. Hand painted a chippy grey for that cottage setting. Built and designed to last. $225. 815-477-9023 Horse Manure - Take a lot or a little. U haul. will load. FREE Harvard 815-566-1155 John Deere GX345 Riding mower, 48" deck, comes with small wagon, 300 hours $3500 obo. 815-455-1233

LAWN MOWER ~ TORO

With 22” self-propelled with mulching bag. Still under warranty until 10/14-10/15. Used twice, orig price $359, sell for $200. 847-669-9297 - Aft 6pm

LAWN TRACTOR

Craftsman, 17HP, 44” deck. At the end of its life, but still cutting grass, $100. 815-385-4559 LIQUID SPRAYER, 25 GAL, PULL BEHIND LAWN MOWER TO FERTILIZE LAWN. $100. 815-382-7080 MOWER - Craftsman 21" push mower with mulching attachment. NEW. $145. 847-669-1806

COACH BAG

Black, #0784-1110, $10. 815-675-2216

Coach Purses & Wallets

$50 AUTHENTIC-PRICED TO SELL! 847-736-3127 andyjill@sbcglobal.net Drive Shaft – PTO, Brand New, Fits John Deere and Others. $125 Call 815-569-2277 ENGINE HOIST ON ROLLERS $50. 815-382-7080 FISHER BOY CONCRETE STATUE with hat. $165. 847-515-8012 Gas Grill / Char – Broil – 2 Burner w/Side Burner – Must be Ignited Manually - $25 815-338-6957 Grill – Weber Charcoal – 22½ New – Never Used – Paid $99+tax Asking $55 815-338-2888 JUKE BOX – ROWE. 200 45 SONGS AND 6 CD's. GREAT FOR REC ROOM OR BAR. $400. 815-382-7080 LUGGAGE – 3 Piece Samsonite Luggage Set w/ Wheels. Never Used. $50 OBO. Call anytime, 815-861-9864. Luggage Set Top Brand and cond. American Tourister. Not canvas sides, 2 pieces 7x24”, 7x20”, $40. 815-455-3555 Metal Detector. Brand new, in box. $55. 815-344-4843 PATIO CHAIRS (6) that rock with rectangular table and a cover. Tan color. $200 Call 312-972-5923 PET PORTER - Deluxe. Airline approved. 24 tall, 18 wide, 27 long. Good cond. 815-455-6936 Play Center – Wood – 4 Swings – 2 Forts – 1 Slide – Monkey Bars You Disassemble & Carry $275. 847-220-0496 RABBITS (2) with custom built cages. One Dutch Dwarf and one Jersey Wooly. Custom cages come with them. Both need new loving family. 224-628-0800

SALT LAMP

1 pyramid, $60. 815-370-4165

Sewing Machine

Kenmore ,4 stitch, 30 different spools, $40. 815-404-6083 Sump pump battery back up system, fully automatic auxiliary power source, retails for $2100 asking $1700 847-208-0452

SWINGSET -- FREE

Raspberry Bushes

Free wood swing set. Two swings, slide and rings. Good shape. Call 815-713-6386

Riding Tractor Lawn Mower Craftsman 15/43. Runs really good; deck getting rusted. $299. 815-482-9429 Roller Conveyers – 2 Sections Very Nice Shape - $25 815-569-2277

TABLE - CERAMIC TILE FRUIT SIDE TABLE - Makes an artistic statement with vibrant, detailed hand painted tile to bring that splash of color to your backyard or sunroom. Measures 13.5 square by 18 inches high. Attractive Verdi green patina finish. Excellent strong original condition. $45. 815-477-9023

Red, big, sweet berries. $5/ea, 5 for $20. 815-477-7916

RotoTiller Replacement Bolo Tines For Troy-Bilt – Pony ( Complete Custom Tine Kit) (New $299.99) $150 815-477-4113 aft. 6pm Rototiller – Troybilt – Pro Line 7hp Intek Pro 206 OHV Briggs Engine Used Only 2 Hours -$700 Value For $300 815-334-1878

Sansavera Plant

or (Mother's In Law Plant or Snake Plant). Veragated, big, 3-4'T, in pot. $35/obo. 815-527-2796 Snow Blade - Craftsman 42 inch Snow Blade, manually operated (Up/Down & Left/Center/Right). $125 Call 847-209-8981, before 5:00pm. Ask for Dave Spreader - Craftsman Spiker Aerator/Spreader, manually operated. $125. Call 847-209-8981, before 5:00pm. Ask for Dave. SPREADER - LAWNCRAFTER BRAND fertilizer /seed drop spreader $20, very good condition. Email: bpk31257@yahoo.com

SWING SET - WOODEN $250/obo in McHenry. 815-307-2893 TRIMMER - Yardstick Grass Trimmer/Edger, 12V with charger, spare batteries, extra spools and string. $50. Call 847-209-8981, before 5pm. Ask for Dave. V & V Lawn Care 815-814-8542 Lawn Maint, Gravel Clean-up from Plows, Mowing, Garden Tilling, Reasonable Rates. Free Estimates. Weed Cutter - Jari, 36”, Briggs 5hp. $300 815-569-2277 Wheel Weights - Craftsman 30 pound Wheel Weights with Chains, when using Lawn Tractor Snow Blade. $25 Call 847-209-8981, before 5:00pm. Ask for Dave.

4 Piece Tool Shop

18 volt, $60. 224-523-1569

Aluminum Step Ladder

10 ft, $25,

815-385-4353

Glass and brass, rectangle, oval, $75, $125/both. SOFA TABLE, Smoked Glass, $50 815-385-4353

Bike Rack for car. Brand new! Fits 2 bikes. $25 815-344-4843 GT1 – 20” Boys Bike $70 OBO. 815-382-4213 Men's Roadmaster Mountain Sport Bike, 18 speed, 20” wheels, nice, $75 815-459-7485

HEADBOARDS - 2 twin size solid wood, not the same style. $40 each. Cash only. No returns. Call Dolores @ 815-219-0204

Room dividers (2): rattan $50

ARMY FOLDING COT Old, iron, 65”x27', no mattress,

High Chair – Fisher Price – Easy Fold – Aquarium Design – Like New – 7 Settings $20. 815-459-3671

HEADBOARD - GORGEOUS RUSTIC FULL SIZE. These are so cool looking! We have many to choose from. Can be sawed down and made into a footboard so you can have a matching set. You will need to drill holes in order to attach a bedframe. Text or call Katy 815-409-9261

ROCKING CHAIR

Table – Folding – Ethan Allen – Wood w/Turned Legs $40obo 815-943-4146 after 5pm

TOOL BOX - Antique Refinished Pine 28-1/2" x 13" x 8-3/4" w/ 7 sectioned drawer & brass latch dowel carrying handle. $145. McHenry. 815-236-1747 VANITY - Beautiful pine vanity with attached mirror & center drawer. This beautiful antique piece was brought from England by the dealer. 37-1/4" wide, 20" deep & 29-1/2" to top of vanity. Mirror 22-3/8" wide by 35-3/8" high. Center drawer has metal pull & 14" wide. Legs & side mirror supports have charming decorative sculptured detail. $450. 815-236-1747 WHEATIES BOX COLLECTION 122 boxes. $341 for entire collection. Not selling individuals boxes. 847-515-8012 Wooden Ice Box. Needs refinishing. $100 815-344-4843

Metal, silver, $10. 815-675-2216

Patio/Sunroom Table & Chairs

IRONING BOARDS - 2 Antique Wooden Ironing Boards-Illinois Specialty Company - Asking $100. 708-680-7022 JAR - Glass w/ metal Lid. Outside red w/ ridges in glass. Top opening 5" diameter, Jar is 7 1/2" diameter & 7" high. $25. McHenry. 815-236-1747 Lanterns (2): vintage Coleman, red, 200A, dated 12/56 & 10/63, very good condition, $40/each 815-479-1961 Rick

Snuff Box: J.M. Carlstedt, Rockford Pewter, 3” x 1.5”, c.1900 $25 815-459-3477 or 815-404-1587

Headboard - Full Size

KITCHEN or DINING SET 5 Pc Table & 4 chairs with rollers. 71” long w/ leaf x 42” wide. $60. 815-560-1680 815-568-6285

BOW FLEX – Like new! $200 Call after 6pm 815-385-6839

Outboard motor – Antique 1957 5-1/2 Johnson with fuel tank, excellent shape $400. Call 815-5692277 Painting – Oil - Old North American Indian – 18x24 – Wood Frame - $30obo 815-943-4146 after 5pm

Futon: like new $150 (value $700) 847-961-6005

ELECTRIC GUITAR - Superman Electric Guitar. Fender Stratocaster knock off that retails for $300. It is new and has the whammy bar! Selling for $150 or best offer. Call Mike 815-260-8297 before 9 PM

Foot Locker – U.S. Army – Wood $30obo 815-943-4146 after 5pm

MIXING BOWLS - 3 matching: "Hall's Superior Quality Kitchenware - Eureka Homewood Pattern". Lg 8 5/8", Med 7 3/8", Sm 6 1/8". $49. McHenry. 815-236-1747

ETERGERE - Good Condition. $40. email: trichalin@aol.com

Kids bedroom set: bunk beds, dresser, desk, drawer, side tables, distressed wood, $500/OBO for the set, will separate, 847-951-0184

IPOD TOUCH: 8GB-- 4 GEN Antique Vanity. Attached mirror, 7 drawers, harp chair. Restored mahogany. $200. Photo available. 815-568-1175

Entertainment Center

Solid oak, quality, like new. Lots of storage, fits TV up to 39”. $200/obo. 815-338-4058

DOLLS - Marie Osmond Tiny Tot Dolls. 6 dolls - 4 have original boxes & tags. Pictures if requested. $100. email: trichalin@aol.com

th

Motorcycle Swap Meet

WOODSTOCK SUNDAY, JUNE 23 8AM - 3PM

Electrical Box – 16 Circuit Breaker Transfer Switch – Automatic - Generac EZ - $700 Value – For $399 815-385-4828 after 9am

DINING ROOM SET

Henredon, table & 6 chairs, cane back, 3 leaves, $175/all. 815-703-9650 Dining Room Set. 1930s-40s walnut. 3 leaves, 6 chairs. $350. 815-338-0070 Dinnette Set. Table plus Leaf & 6 Chairs. $150. Photo available. 815-568-1175 Entertainment Center and matcing Etegere Lots of storage space. Light Oak $250 email: trichalin@aol.com

Wednesday, June 5, 2013 • Page E11

815-508-1114

Hot Tub/Jacuzzi. Great Lakes. Beige marble, seats 6 w/6 jets. Heating system needs work. $199 815-459-7217 POOL LADDER - A-frame Confer Eliminator 7000 for 48-54" pools. Swings up and locks. Used one season. Exc cond. $100 OBO. Cash only. In McHenry. 262-424-9927

2 Big Jon & 2 Cannon Down Riggers - Plus two weights. $225 / obo. Call: Chris. 847-910-4849 Canoe, Rogue River, 15.7 ft. Used Little. 3 Seats and Storage Compartments. $350 815-455-0120 Golf Bag – Taylor Made – Stand Up – Black & Brown – Very Good Condition $35 815-943-4146 after 5pm Golf Clubs: Wilson, stainless/graphite, w/bag, practicing net, $65 847-961-6005 Ping Pong Table – 2 Piece w/Folding Legs – Access. $30obo 815-943-4146 after 5pm

SKIS ~ (2) SETS

With bag, 1pair of poles & boats. $40. 815-404-6083

AMP - CRATE GX-15 Amp. Used, but in excellent condition. Asking $60/obo. Call Mike 815-260-8297 Harmonicas (3). Hohner From 1940's. $125/all 3 815-344-4843 KEYBOARD - Casio. Keys light up to teach you how to play. Pre-recorded songs. Can download more. $80. email: trichalin@aol.com

Pianos Quality Pre-Owned Pianos - Delivered & Guaranteed. 815-334-8611

Barn Cats. All spayed & neutered. 815-943-3134 BIRD CAGE ~ VISION “Less Mess” cage, 29Wx22Hx12D. $75/cash. 847-639-8572

Dog House/Igloo Large McHenry $65 Call or text 815-307-2893 FREE: 3 KITTENS, 1 male tiger orange, 1 Female black, 1 female black and white. Gurnee area. Born April 19th. Cell: 910-333-4000 German Shepherd Puppies. Beautiful, black & red. Top West German show lines. Health warranty. $1600. 815-385-3350 Guinea Pigs (2) Male. 6 mos old. Incl rabbit hut cage & accessories. $25/both. 815-814-1895 Kittens - Two 8 wk old kittens. 1 male orange tabby, 1 female solid black. Super friendly & litterbox trained. If interested, call 815-575-3948.

Bed: new, full size, mattress, box springs, frame and wood, headboard, manufactured by Verlo $200 815-823-5513

RC Helicopters (2)

Fly indoors or out, includes radio and chargers, $125/obo. 815-382-3952 Spring Bouncy Horse, Great condition, $45 McHenry Call or text 815-307-2893

SWING SET - WOODEN $250/obo in McHenry. 815-307-2893

Antique and Modern Guns Old Lever Actions, Winchesters, Marlins, Savages, etc. Old Pistols and Revolvers. Cash for Collection. FFL License 815-338-4731

Lionel & American Flyer Trains 815-353-7668

WANTED TO BUY: Vintage or New, working or not. Bicycles, Outboard motors, fishing gear, motorcycles or mopeds, chainsaws, tools etc. Cash on the spot. Cell: 815-322-6383

Grey Thorough Bred Gelding

8 years old, 16 hands, wonderful horse and wonderful personality. $400 847-540-0083

Quarter Horse Palomino Mare 9 years old $500 815-648-2973

ALGONQUIN

AREA RUG 5'3" x 7'7" Encore EN-03 Shades of smoke/beige. Never used. $295, cash only. 815-459-3477 Basement well window - New basement double pane well window from Innerweld 37x31. $75 815-482-9429 Brother PE-180D, Disney Embroidery only machine. Like new, hardly used, with hoop. $200. Call: Chris 847-910-4849 BUTCHER BLOCK TOP - Portable folding kitchen island Butcher block top Folds for storage $65. 815-385-1285 DINNERWARE SET – Royal Seasons Snowman Dinnerware Set. 71 piece. $50. Call anytime, 815861-9864. Dinnerware: Noritake, 60 pcs, pattern/platinum rim, service 8 $320 (value $800) 847-961-6005 Drink ware: Crystal Platinum rim, glasses, 8 each, water, wine, champagne, cocktail, $180 (value $480) 847-961-6005 FIREPLACE TOOL SET - Brass & Black, includes: Match holder, log holder, rack with shovel, poker & brush. $40 for all. Cash only. No returns. Dolores 815-219-0204. ICE CRUSHER Portable Electric Use on counter for drinks or fancy food. Works good, $20. 815-455-3555 QUILT - J.C.Penney Toile Garden quilt, full-queen size, 2 shams, drapery panels, valence in blue multi. Barely used-like new. $150. Call 815 455-6936

NELLIE 3 month old female Terrier mix I don't take things so seriously and I try to laugh often, even at myself. I think it's the simplest things that give me the most joy. www.helpingpaws.net 815-338-4400

With dust collector, 3'x4', 110V. $300. 815-455-2470

Wire Spool Racks

Electrical, 2 wheel, 4 wheel, $85/ea 847-302-7009

Wood Lathe ~ Craftsman

12x36, with or without motor on custom wood bench. $225/obo. 708-363-2004

NOAH 8 year old male Lhasa Apso mix. I want to improve with age--to know more, to get less agitated and to be kinder too. I want the courage to always follow my dreams. www.helpingpaws.net 815-338-4400

Bessie Pease Prints

Books History of Civilization Will & Ariel Durant, Volumes 1-11 $20 815-455-5903 leave a message

8AM - 6PM

SAT, JUNE 8 ! CASH ONLY ! 405 WILMINGTON COURT (Bull Valley & Valley Hill Rd) All household items; lots of garden items, wrought iron & wooden lawn furniture, hand & electric tools, kitchen misc, bed & table linens, blankets, comforters glassware, crystal, carpets, space heater, dehumidifier, standing fan, gas grill, office, shelving, TV cabinet with bookcases, hand cart, Lladros, headboard, vases, 33-RPM records, Thomasville DR set with 8 chairs, Thomasville BR set with 2 armoires, more furniture & tables, 2 recliners, framed pictures, office supplies, Cassio keyboard, metal shelving, bookcases, 50 gallon water tank, collectible plates, Mikasa dinnerware & Sango china, fertilizer/insecticides, seasonal & Xmas décor, men's outdoor work shirts & MUCH MORE!!

Bull Valley

7907 Cambridge Ct Fri & Sat 9a-5p

DESIGNER ESTATE SALE

Furniture, books, toys, clothes, linens, workout equip, kitchen, household, tools, builder materials, plants, decor, dishes, & much, much more!

428 N. Harrison

FRI/SAT - 06/07-08 9:00-4:00 DESIGNER MOVING TO FL. Beautiful furniture. See estatesales.net for pix.

CARY

GENOA CITY 610 Main St

1265 Sagebrush Trl

Fri & Sat, June 7 & 8 9am - 3pm

Thursday, June 6 through Saturday, June 8 8am to 4pm

Big Man's Clothes, new/used, Knickknacks & collections

GARAGE SALE! Toys, Furniture, Household Items, Misc Items and More!

th

th

CARY ECKEL'S MCHENRY FLEA MARKET

3705 W. ELM Starting Mar 28 NEW HOURS THURS & FRI 11-5 SAT & SUN 8-5 815-363-3532 WOODSTOCK

FUN IN THE SON Craft Fair & Bake Sale Redeemer Lutheran Church 1320 Dean St. Sat, JUNE 8th 8:00 am – 2:00 pm Free admission. 815-338-9370

354 Sterling Circle Off Silver Lake Rd. June 6th, 7th, 8th. 9am – 2pm Freezer, tables, couch, love seat, lamps, tools, sewing mach, toys, elderly care, like new dryer, chairs, kitchen appliances, pictures, many more.

Cary

G Gage Train Sale New & Used

ALGONQUIN

THURS, FRI, & SAT JUNE 6, 7, 8 9AM - 4PM Algonquin Rd, West of Randall to Square Barn to Entrance

Algonquin Lakes Neighborhood Garage Sale ~ 25+ homes! Toys, kids clothes, furniture etc. Subdivision is off Algonquin Rd Between Rt. 25 & Sandbloom Rd Thursday-Saturday June 6,7 & 8th 9am-3pm

5 Echo Hill Oakwood Hills

810 Oceola Dr. Rt 62, South on Hubbard St Tools, Coins, Knives, Housewares, Longaberger, Dolls SMOKEY 12-1/2 year old female Torti DSH. Unfortunately my life has never followed a script. Maybe because I'm not shy about speaking my mind! Now more than ever, it's my time to shine. www.helpingpaws.net 815-338-4400

Snowblower, 19” wide, 3hp, Electric Start. Rarely Used. $100 847-669-6820

CARY GARAGE/ESTATE SALE

306 Sherwood Drive Thurs. June 6 to Sat. June 8 9 am to 4 pm Collectibles, glassware, plates, jewelry, small furniture, bicycles, household items, decorations, lamps.

Cary Multi Family Garage Sale

Thurs 6/6 & Fri 6/7 9a-3p 490 Tanglewood Dr Furniture, Pottery Barn, kids items, clothing, toys, camping supplies, and more!

CARY

Algonquin – East Side

Thursday & Friday 10am - 4pm

Wheelchair: Heavy Duty wheelchair, w/foot braces, capacity 250LB, Tracer 4 $60/OBO 815-308-5934

In frames, 16x20, $10. 815-675-2216

FRI, JUNE 7

Thurs-Sat 9a-5p

ALGONQUIN

Knee Roller- Roscoe w/Hand Brakes and Basket, Like New-Used Once $150 815-459-0096 AM

BEAR - 5 FOOT TALL, CARVED WITH A CHAIN SAW AS SEEN IN WISCONSIN DELLS, HAS WELCOME SIGN IN PAWS. $300. 815-382-7080

ESTATE & MOVING SALE

7816 Bennington Ct

Sponsored by Arlene Friedli Coldwell Banker Residential

SAND BLASTER

Skill Saw & Jig Saw. Black & Decker. Work good. $35/both. 815-459-7485 Tool Chest. Craftsman Mechanic. 7 drawers with keys. 27X12x18” $50. 815-575-4858

BULL VALLEY

405 Wilmington Ct

11th Annual Manchester Lakes Sub. Sale

MECHANIC VICE

ROOFING Pro 450 gun, new Senco. $75. Chris 847-910-4849

Housewares, sporting stuff, lamps, kitchenware, and more!

Friday - Saturday, June 7 & 8 9am-5pm

Campbell Hausfeld, $125/both. 815-578-0212 Extra Heavy Duty Hand Truck $15 815-363-5716 Snap On Tool, 5.5” jaw, never used. Model # WV1755, $350. 815-236-9377 PLATFORM TRUCK - Composite plastic platform truck, 48" X 25", 2000 pd. capacity. Made by AkroMils. Excellent condition. $75. Call 262-945-5207 before 9pm

710 Mulberry Ct.

MOVING/ESTATE SALES

Brad Nailer's (2)

Gun Safe – Steel -12”x12”x4ft Long – 2 Handles – 3/8 Seah On Top – Humidity Indicator- Desicant6 Locking Latches $125 815-569-2277

Thurs 6/6-Sat 6/8 9a-4p

8AM - 4PM

WINDMILL

Rustic wood with 2 planter boxes, never used. 4'H, $35. 815-578-0212 Workbench – 60” by 30” by 32” Solid $20 815-347-4945

Algonquin

HUGE SALE QUALITY ITEMS

TEXT ALERTS Sign up for TextAlerts to receive up-to-date news, weather, prep sports, coupons and more sent directly to your cell phone! Register for FREE today at

NWHerald.com

ONE DAY ONLY SAT. JUNE 8TH 8AM TO 4PM

6718 WANDER WAY Near Lions Park 20 Years Of Accumulation

Household, Furniture, Vintage & Collectible, Holiday, Crafts, Games, Bicycle, Doll House, Dolls Don't See What You're Looking For Today? Check Back Tomorrow! Never The Same Paper Twice! Northwest Classified 800-589-8237 www.nwherald.com


CLASSIFIED

Page E12• Wednesday, June 5, 2013

Northwest Herald / NWHerald.com Wednesday, June 5, 2013 “Girls on the Run 2013 - Glacier Ridge Elementary” Photo by: Renee

Upload your photos on My Photos – McHenry County’s community photo post! Photos on My Photos are eligible to appear in print in Northwest Herald Classified. Go to NWHerald.com/myphotos

CRYSTAL LAKE

CRYSTAL LAKE

Crystal Lake Sat 6/8 8a-5p 1723 Village Ct

1420 Blue Heron Dr Thur 6/6 & Fri 6/7: 8am to 4pm Sat 6/8: 8am to Noon Beds, Books, Chairs, China cabinet, Decor, Dishes, Dressers, Games, Garden Pond, Kitchen ware, Movies Music, Sofa, Sports, Tables, More

CRYSTAL LAKE

1636 DOGWOOD DR (Near Village Rd)

Thurs June 6 - Fri June 7 8am - 3pm Sat June 8 8am – 12pm Housewares, books, clothes, exercise equipment , bed frame & headboard, and much more!

CRYSTAL LAKE

Community Garage Sale Thursday, Friday, Saturday June 6, 7, 8 9 am to 5 pm Village Road Off Of Randall Road in The Villages Subdivision, from Penny Lane through Brompton Road. Many Households Participating Too Many Items To List!

CRYSTAL LAKE

Skis, bikes, bike racks, baby girl's clothes & crib, women's clothes, household items, police equipment & clothes, Jeep Wrangler light bar, coolers, and weighter's, assorted misc. household items.

Crystal Lake

STAMPIN' UP! RUBBER STAMP SALE Sat, June 8th 9am-12noon

Country Inn & Suites 600 Tracy Trail

340 GREENVIEW DRIVE

4313 New Hampshire Trail

FRI/SAT JUNE 7th & 8th- 9am-3pm

Thursday, June 6, 9 - 3 pm Friday, June 7, 9 - 3 pm and Saturday, June 8, 9 - 1 pm The Estate Sale is over so let the sale begin! All items are 75% - 90% off! Furniture, Bed Set, China, Art Work, Books, Antiques and Much More!

PRICED LOW TO GO GREAT FINDS Daybed w/Trundle and Mattresses, Snowblower, Air Hockey Table, 51" Sony Projection TV, Entertainment Centers, Electronics, Speakers, High Back Living Room Chair, Sporting Equip, Pack N Play Porta Crib, Tools, Household Misc, Books, Clothing, Puppy Crate, 7.5 foot Christmas Tree and Much More.

Crystal Lake

423 Eugene Street Rt 14 to Keith, near Fanny May

Thurs. & Friday, 9am-4pm Saturday, 9am-2pm Furniture, Longaberger baskets, needle point canvases, cross stitch items, books, wood products, much more. Cash only.

CRYSTAL LAKE

Crystal Lake

Fri 6/7 8a-4p 75 Indian Hill Trail Beautiful home décor & household items, dishes, linens, small furniture, weight bench, teen & adult clothes, accessories, toy cars & trucks, books, holiday decorations, office supplies & much more! Many items are new or barely used! Great for college or to spruce up your home or wardrobe.

CRYSTAL LAKE FUNDRAISER

Off Ringwood Rd, Between Spring Grove Rd & Pioneer Rd.

FARM WAGON FULL OF PERENNIALS Baby & toddler, lots of great books, household & decor, furn, armoire, dining set, china, collectible pottery, Creative Circle kits, clothes for junior, mens, and womens, lots more!!

1835 & 1828 Deerhaven White Wicker Daybed w/Trundle, Night Stand, Armoire, Wooden Dresser w/Mirror, Unfinished Queen Headboard SAR. Many books, toys, videos, clothing, bikes, holiday & household items!

18817 & 19009 Oxbow Dr (Oxbow is off Harmony Hill Rd by Marengo Ridge Golf Course)

Fri 6/7, Sat 6/8 9am-3pm Antique, Vintage, Shab Chic, Arts & Crafts & Other Furniture, Calif Q Oak Water Bed, Glassware, Dish Set, Women's S/M & Men's M/Lg Clothing, Books, Pictures, Linens, Electronics, Tools, Garden Items, Etc.

HARVARD

Friday & Saturday 8:30am – 4pm

109 & 110 Quail Run

4716 Wild Cherry Rd. Friday & Saturday, 9-4

All items in very good condition, too many to list. Come & see for yourself !

Crystal Lake

Thurs/Fri June 6&7 8am-4pm Saturday, June 8 8am – NOON HELP us get to Zambia, Africa to HELP abused women and children. HUGE assortment of furniture, small appliances, children-adult clothing, toys, exercise equipment and MUCH MORE!

CRYSTAL LAKE 521 Peach Tree Ct In The Villages off Randall June 6-7 9am-5pm, June 8 9am-1pm School “stuff”, pet items, LPs, Christmas & sewing stuff, tins, collectibles and misc. All welcome!

CRYSTAL LAKE

550 Stony Hill Ln. Multi-Family Garage Sale FRIDAY ONLY 6/7/13 8:00a.m.-3:00p.m. Wake Board, Water Skis, Foosball Table, Curio Cabinet, Collectibles, Plates, Aquarium, Electronics, Boys Clothes size 8, Men's XL

CRYSTAL LAKE

794 Oak Hollow Road (off Pingree Road)

Garage/Estate Sale

The Biggest Big One Thurs., Fri. & Sat. 8 AM – 4 PM 1398 Gardina Lane

(near West Beach) Q-Aero Bed, Router, Bits & Table, Cordless Drills, Sockets, Wrenches, Many More Tools, New Telescope, Battery Chargers, Air Hockey Table, Full Canopy Bed, Girl's Clothes 6 – 6x, Trex Pull Behind Bike, Trevis Glasses, Girl's Bikes, 35ml Scanner, Maternity, Krups Coffee Maker, Toys, Kitchen Misc., & Much, Much More

CRYSTAL LAKE

HUGE COMMUNITY GARAGE SALE! 1395 Skyridge Drive

Tools, Furniture & Houshold Items.

531 Putnam St.

450 Riverside Drive Gate 2

993 Camelot Dr.

PINK, Hollister, AE, AERO Sizes XS-LG, American Girl Dolls w/Clothing & Furniture, Men's XXL Tall, Women's M-XL, Grill, Books & Lots Of Household Items.

SATURDAY ONLY JUNE 8 10 AM-3 PM

CRYSTAL LAKE

Send your Classified Advertising 24/7 to: Email: classified@ shawsuburban.com Fax: 815-477-8898 or online at: www.nwherald.com

Antique furniture, wicker set, mirrors, mid-century furniture, baby items, toys, Barbie bike, mini fridge, area rugs, vintage bikes, dishes, clothes, mini tramp, weights, bench, equipment, camping, computers, surround sound, pony saddle, DVD's, books, piano, home décor & MORE! ! Portion of the Proceeds go to The Benefit for Luke Moore Hebron

St. John's Lutheran Church Rummage Sale

Community Garage Sales Jackson Road / Marjorie Drive, just south of Route 20, west of Marengo. Look for signs! Thursday, 6/6 - Saturday, 6/8 8AM-3PM, 5 houses 1944 H-Series Farmall, Motorcycle, Snowmobile, 1999 Harley Sportster, Go Cart, Kids Items, tools, treadmill and much more!

Thurs., Fri. & Sat. June 6, 7 & 8 8am-6pm 21303 Harmony Rd. ¼ mile East of Rt 23

LAKE IN THE HILLS

MARENGO

The Villas Of Boulder Ridge Community Corner of Frank & Algonquin Rd. Friday 6/7 & Saturday 6/8 8AM-4PM Cocktail Tables, Brighton Luggage, Home Decor, Bedding Sets, Golf Clubs, Treadmill, TVs, Coach Purses, Women's Clothing, Wall Art & More.

LAKE IN THE HILLS

THURS, FRI, SAT JUNE 6, 7, 8 9AM - 3PM 1119 HEAVENS GATE Marble patio set - seats 8, Thule cargo box, bike rack, kitchen table, Bombay Queen Cherry 4 poster bed, Stihl gas lawn trimmer, leather cream couch & loveseat, clothes (Justice & Aero), strollers, toys, tools, home décor Tuscon style, desks, armoire & MUCH MORE!

LAKEWOOD

10113 Main St.

Turnberry, Village of Lakewood.

Next to Subway

7702 Dairy Lane

Thursday June 6th & Friday June 7th only. 8 am to 4 pm. Moving in 2 weeks! Must sell! Fisher-Price toys, child's musical rocking chair, 2 twin head boards, (not the same) dresser, bar stools, much, much more. Cash only. No returns.

LAKEWOOD THURS & FRI JUNE 6th & 7th 7AM - DARK Lake Dawnwood Sub. 1721 Sandalwood Ln New patio furniture, antique furniture, wood horse, men's Schwinn stick shift bike 26”, much more... SOME HIGH END ITEMS 847-417-9770

HUGE GARAGE SALE!! THURS 6/6 - SAT 6/8 8AM-4PM

8950 BARDWELL LN LARGE FURNITURE, HOUSEHOLD ITEMS / DECOR, AREA RUGS, LIGHTING FIXTURES / LAMPS, AIR HUMIDIFIERS / PURIFIERS, SPORTING GOOD ITEMS AND EVEN SOME UNIQUE TAXIDERMY!

Lakewood

Thurs & Fri 9a-4p

1747 Goldsboro June 6-8. 9am-3pm

840 Broadway Ave

Toys, household items, clothes and more!

Household, seasonal, rugs

Target your recruitment message close to home or reach our entire area. For more information, call 800-589-8237 or email: helpwanted@ shawsuburban.com

MCHENRY

Search businesses on Planit Northwest Local Business Directory PlanitNorthwest.com/business Find company information Read and write reviews Link to Web sites and emails

Send your Classified Advertising 24/7 to: Email: classified@shawsuburban.com Fax: 815-477-8898 or online at: www.nwherald.com

SAT, JUNE 8 8AM - 2PM 400 7TH AVE. High back Deacons Bench smaller Deacons Bench, Rocker, Telescope, Upholstered Chair, Electronics & MUCH MORE!!

Marengo THURS, FRI, SAT 6/6-6/8 8am-5pm

710 EAST PRAIRIE Collectibles, Great Stuff! New Wedding Dress, Used Books, Old Magazines, Lamps, Buggy & Stroller, Pet Supplies, Hand Crafted Candles, Reasonable Prices! Something for Everyone! Rain or Shine! McHenry / Village of Holiday Hills

2407 DRIFTWOOD DR

MCHENRY

2706 ARBOR DR. Thurs & Fri: 9-4 Sat: 8:30-2 INCREDIBLE SELECTION of BARELY USED, LIKE-NEW KIDS CLOTHES: swim suits, dresses, jackets, & shoes: GYMBOREE, OLD NAVY, CHILDREN'S PLACE, JUMPING BEANS, ETC. ASHLEY SOFA SECTIONAL w/Sleeper, Recliner, & Chaise Lounge, Coffee & End Table, (2) Papasan Chairs w/ Foot Stool, Bar Stools, 27" Tv, Large DVD/CD Storage Unit, (2)SUPER YARD XT Play Areas, Maternity Glider, HORIZON ELITE ELIPTICAL, AND MORE! EVERYTHING IN EXCELLENT, CLEAN CONDITION! NO JUNK HERE!

TEXT ALERTS Sign up for TextAlerts to receive up-to-date news, weather, prep sports, coupons and more sent directly to your cell phone! Register for FREE today at

NWHerald.com

3414 Thunderbird Lane

COMMUNITY GARAGE SALE EASTWOOD MANOR BY OUTDOOR THEATER JUNE 6 - JUNE 8 (8-4PM)

Huge Baby Sale, Part of Oak Grove Neighborhood Sale, gently used Old Navy, Gap, Carter's boys and girls clothes (NB-3T), quality baby equipment, everything you need for baby!

Mchenry

PRAIRIE GROVE

Fox Pointe Retirement Community is conducting an Estate Sale on

Fri, 6/7 9a-4p Sat 6/8 9a-12noon 3300 Charles Miller Rd.

Twin Headboard, Desk, Iron Bakers Rack, Dorm Refrigerator, Small Patio Set w/2 Chairs, Ceiling Fans, Light Fixtures, Tools, and Many Misc. Household Items. Woodstock

1400 Oakwood Ct Elliptical, pool solar rings, Burley bike cart, Pfaff sewing machine cabinet model: older model, works better than the ones, and more! No baby stuff!

THURS & FRI 9-5 SAT 8-? 3505 W. Shepherd Hill Ln. (Off of Green St.)

NEIGHBORHOOD GARAGE SALE Oak Grove Subdivision Friday, June 7th, 9 - 3 and Saturday, June 8th 8 - 12. Route 31 and Ames Rd, 2 miles N of Route 176.

RINGWOOD

FRI & SAT, JUNE 7 & 8

1828 WICKER ST. Old watches, clocks, tools, neon Bear sign, air hockey, table, furniture, collectibles & MUCH, MUCH MISC!!

4418 RT. 31 Antiques, furniture, household items & MUCH MORE!

Woodstock

FRI & SAT JUNE 7 & 8 8AM - 3PM

SPRING GROVE

Free admission. 815-338-9370

Huge Perennial Plant Sale! Over 25 Years! Thurs & Fri, 8am-3pm Sat, 8am-10am

10612 Breezy Lawn Road

& MUCH MISC ITEMS!!

UNION

MCHENRY

8718 Thompson Rt 120 to Thompson Rd. Most plants $3-$4 Shade and Sun Plants, Hostas, Iris, Day Lillies. Compost Tumbler for Sale: $50

WOODSTOCK ! MULTI FAMILY !

MULTI-FAMILY GARAGE SALE

MCHENRY

Crate and Barrel table and wine cabinet, kids toys, baby items, all age clothes, Kangaroo Climber, furniture, Healthrider, 30 gal. fish tank, weight machine, water skis, keyboard, more!

WOODSTOCK

Thursday, Friday, Saturday 8:00 to 5:00 Couch, end tables, stroller, pictures, toys, games, lamps, clothes, misc household items and much more.

Many Kitchen items, Furniture and much much more!

Thurs, 6/6 - Sat., 6/8 8-3

FUN IN THE SON Craft Fair & Bake Sale Redeemer Lutheran Church 1320 Dean St. Sat, JUNE 8th 8:00 am – 2:00 pm

Teapot collection, Capodimonte collection, antique desk, Mother of the Groom/Bride size Fall dresses also + size clothing + children, computer items, furniture, exercise equip, tools, collector sports items

THURS., FRI. & SAT. 8am-4pm 5202 W. Sarasota

Apple Creek Estates neighborhood garage sales with 10+ homes. 3021 Braeburn Way

WOODSTOCK

Mchenry Fri 6/7 9a-3p Sat 6/8 9a-12noon

Thurs, Fri, Sat 8am-5pm Let our very well kept items become your treasures!! Household decor, holiday decorations, bread machine, computer, paper shredders, sleeping bags, puzzles, toys, 1st Act acoustic guitar, microscopes, golf clubs, STREET LEGAL GOLF CART, "Man Table" w/ misc tools & hardware. Too much more to list!

PRAIRIE GROVE

Woodstock

Friday 6/7: 9-3, Saturday 6/8: 8-12

An abundance of furniture, household items, clothing, and linens are available.

4 Car Garage Packed Full. Something for Everyone! Too Much To List!

Friday, 8am-6pm Saturday, 8am-12pm

MULTI-FAMILY SALE

RECRUIT LOCAL!

"We Have Too Much Stuff" Sale! Come and see: household items, full room decorations, toys, clothes, books, tools, bike, American Girl dolls, and much, much more!

MARENGO

Furniture, Outdoor Items, Books, Electronics, Tools, Clothes, Household Items & More!

8914 JOHNSON RD.

JOHNSBURG

Fri. & Sat. 9am – 3pm

SMALL KIDS CLOTHING, BOARD GAMES, PUZZLES, BOOKS FOR ALL, SMALL APPLIANCES, PICTURES, TOYS, MORE

JUNE 6, 7, 8, 9 9AM - 5PM

Crystal Lake

Sat. June 8th 9-1

CRYSTAL LAKE

HEBRON MULTI FAMILY SALE

Clothes, Toys, Household Items & Much More!

Multi Family

Women's clothing and shoes galore, outside bar set, home goods and more...

Everything must go: dresser, beds, tables, chairs, kitchen ware, tools, garden/landscape supplies and much household miscellaneous.

Spring cleaning has been done on house, garage and pole barn. Lots of household items, ladies clothing, tools, craft supplies, furniture. Don't miss this one!

Friday, 8am-5pm Saturday, 8am-12noon

701 W. BURBANK STREET Friday 6/7 and Saturday 6/8 8-3pm

13 Tables, Antiques, Collectibles, Lots of Household, Kitchen Appliances, Boys Clothing, Lots of Furniture, Bar Related items.

Thoroughbred Estates Friday June 7th 9-3 and Saturday June 8th 9-1

301 S. Carriage Trail

Thurs. June 6 and Fri. June 7 (8:30 - 3:00) and Sat. June 8 (8:30 – 12:00).

MCHENRY MULTI FAMILY

Saturday, June 8th, 2013 7am-4pm Free Bounce House & Refreshments! Open to all, rain or shine! Any Questions: 815-455-9100

Thurs. & Fri. June 6th & 7th 9-3

MCHENRY

Off of Chapel Hill Rd. & Lincoln, Watch for signs

2 FAMILY SALE

375 Nash Road (SW of Hillside & Walkup)

Sofa, End Tables, American Girl Doll Stuff, Adult and Kid Bikes, Tool Bench, Elliptical Exercise Machine, and much much more. Don't Miss This One!!

4704 Oregon Trail

FOX LAKE

SUBDIVISION SALE June 6, 7, 8 8th annual FOX RIDGE subdivision sale, multi family, too many items to list, stop by all three days. Off of Route 12, North of Route 59 split, frontage road to entrance

10207 Arabian Trail

Huge Garage Sale w/ something for everyone.

in the Trails of Winding Creek.

Marengo Multi- Family MULTI-FAMILY SHOP BOTH SIDES OF THE STREET

Thurs 6/6-Sat 6/8 9am-3pm 2307 W. Fairview Ln

Friday 6/7 and Saturday 6/8 7am – 1pm

Thurs, Fri & Sat. 9am - 3pm

Thurs 6/6 and Fri 6/7 from 9am-2pm

Lake in the Hills

WOODSTOCK

MARENGO

TONS of name brand girls (Gymboree, P.S. Aeropostale, Justice, etc.) clothes (NB-10). 50's style kitchen table, boat seats, household items, and much much more miscellaneous items!!!

Enter at main gate off Frank Road a map of the addresses will be given. 1167 Ridgewood Circle, 10 Shoal Creek Court, 1189 Ridgewood Circle, 706 Granite Court, 1 Point O'Woods

McHenry

McHenry

THURSDAY 6/6; 3 PM-6 PM FRIDAY 6/7; 9 AM-5PM and SATURDAY 6/8; 9 AM-noon

BOULDER RIDGE GARAGE SALES Multi family Boulder Ridge Greens & Estates garage sales Lake in the Hills

MCHENRY 3218 ALMOND LN.

2 MANY ITEMS 2 LIST!

742 Hickory Ln.

815-355-1719

Thurs & Fri 8am – 4pm Saturday 8am – 12 noon

Marengo

LAKE IN THE HILLS

Hundreds of Rubber Stamps, Card Stock, Accessories & More. Get the new SU Catalog, and make a card!

Crystal Lake COVERED BRIDGE TRAILS

JOHNSUBRG Windy Prairie Acres 2 GARAGES MULTIPLE FAMILIES THURS 6/6 & FRI 6/7 8AM - 6PM SAT 6/8 8AM -12PM 3707 BERKSHIRE DR. 5207 HAMPSHIRE LN.

THURS - SUN JUNE 6, 7, 8, 9 8AM - 4PM 9513 KNOLL TOP RD. Parents downsized a lot of everything, vintage, antiques, odds and ends, depression, milk glass, Starcraft Camper, tools, newborn to 4T clothes. You name it, its probably here!

FRI & SAT JUNE 7 & 8 8AM - 4PM

535 & 541 PLEASANT ST.

Park Ridge Estates Sub Sales 25+ HOMES!

WEST DUNDEE

Woodstock MULTI FAMILY SALE

Community Garage Sales

FRI 6/7 ONLY 7A-2P

Crystal Lake Rd. to Dartmoor

Thursday thru Saturday June 6th - 8th 9a-3p daily Multi-Family

THURS, FRI, SAT JUNE 6, 7, 8 9AM - 4PM

Sponsored by Carrie Prodhan 847-337-1674 carrie.prodhan@bairdwarner.com

Something for everyone. Clothes, furniture, baby items, toys, books, kitchen items, tools & MUCH, MUCH MORE!

The Fairhills of Canterfield Carrington Reserve Grand Pointe Meadows & Aspen Hills

Off of Route 134

Clothes, furniture, antiques, kids items & MANY MISC ITEMS!!

Send your Help Wanted Advertising 24/7 to: Email: helpwanted@ shawsuburban.com Fax: 815-477-8898

PRICED TO SELL

WOODSTOCK

Indoor Garage Sale

WOODSTOCK

1000 Golden Ave

2916 N. BAYVIEW LN.

Kayak, clothes, & miscellaneous

St. Johns Annual

MCHENRY

THURS & FRI 9AM - 3PM

Dacy Street

Saturday, June 8th, 8-2 TV, microwave, computer equipment, laptop, household items, books, new costume jewelry, toys, clothes, shoes and more.

Northwest Classified 800-589-8237 www.NWHerald.com

RECRUIT LOCAL! Target your recruitment message to McHenry County or reach our entire area. For more information, call 800-589-8237 or email: helpwanted@ shawsuburban.com

Friday, June 7th 8am - 3pm Saturday, June 8th 8am - Noon Sat is $3 Per Bag Day

Corner of Rt. 47 & St. Johns Rd. Small appliances, pictures, furniture, kitchen items, toys, kids clothing, tools, jewelry, craft supplies and much more!

! Also take part in our Bake Sale 815-338-5159 Get the job you want at NWHerald.com/jobs


FREE WORKSHOP DIGESTIVE “Preventing Digestive Problems with Natual Alternative Methods”

Tuesday, June 11th at 6:30pm Crystal Lake Park District at Park Place

406 W. Woodstock Street

Do You Suffer From: ✓ Gas ✓ Bloating ✓ Upset Stomach Often

✓ ✓ ✓ ✓

Hiatal Hernia Toxicity Diarrhea Constipation

FIND OUT What may be causing your digestive problems along with a non-drug Dr. Victoria Rake, D.C. Presented by solution that can help The Foundation for you start feeling normal. Wellness Professionals www.crystallakeparks.org to Register or Call 815-435-5695 For More Information

Seating is Limited Register Today!

T O O B P M C A SS… E N T FIt Your Body Fit! Ge

See inside for details


19

$

99

PER MONTH*

GYM ONLY $ 59 enrollment

' )*-*** 9%:6#/ +//< 1$ +;<2/!! +:2( ' .6#0;1 8=/6<#/ ' ,/#!1267 8#6;2;2" ' 4;3#6<;12 8=/#6&5

NOW FEATURING! LES MILLS™ group fitness classes harness the energy of many for a motivating, challenging and totally addictive workout experience. BODYPUMP, BODYSTEP CLASSES! and BODYCOMBAT classes are scientifically backed, and proven all around the world. You’ll unleash yourself, fall in love with fitness, and change your life. You’ll sweat, you’ll shout - you may even curse us - but you’ll leave feeling exhilarated. And tomorrow you’ll come back and do it all again.

40

GROUP FITNESS SCHEDULE MONDAY 9am–10am 10am–11am 11am–11:30am 11:30am–11:50am 12pm–12:30pm 5pm– 6pm 6pm–7pm 7:15pm–7:45 TUESDAY 7:15am–8:15am 8:15am–8:45am 9am–10am 10:15am–10:45am 11am–11:30am 6:20pm–6:50pm 7pm– 7:45pm WEDNESDAY 9am–10am 10am–11am 11am–11:30am 11:30am–11:50am 12pm–12:30pm 5pm–6pm 7:15pm–8:15pm 7:30pm–8pm

THURSDAY 7:15am–8:15am BODYSTEP 8:15am–8:45am BODYPUMP Mat Pilates Express 9am–10am Meditate & Stretch 10:15am–10:45am 11am–11:30am Ab Attack 6pm–6:30pm BODYCOMBAT 6:20pm–6:50pm ZUMBA 6:30pm– 7:30pm Yoga FRIDAY Yoga 9am–9:30am Mat Pilates Express 9am–10am BODYPUMP 10am–10:30am Ab Attack 10:30am–11am 11am–11:20am Tough Tush SATURDAY Power Cycle Step & Strength 9am–9:30am

Yoga Mat Pilates Express BODYPUMP Ab Attack Tough Tush Ab Attack/Tough Tush Power Cycle ZUMBA Yoga BODYPUMP Ab Attack Mat Pilates Express Meditate & Stretch

Cardio Strength Circuit 9:35am–10:20am Power Cycle BODYSTEP 10am–11am ZUMBA BODYPUMP Mat Pilates Express SUNDAY ZUMBA Meditate & Stretch 9am–10am Ab Attack UNLIMITED GROUP FITNESS BODYCOMBAT Yoga Cardio Strength No Gym Membership Required Circuit

$

19

99 per month

%++! 13/-'*,.- #*( & )/(.-0" 20$, (Parking in the rear of building)

815-575-9195

*See club for details.


NWH-6-5-2013