Issuu on Google+

$SRWKHUDS\‡&OHDQLQJ6XSSOLHV‡6SLFHV

$OO1DWXUDO

+(1'(56'58*6

DYDLODEOHDW

%$&.72 1$785( &/($1,1* )520$ &203$1<$62/' $6',57

WK6WUHHW(VWHYDQÂ&#x2021;3KRQH DPSP0RQGD\WR)ULGD\DPSP 6DWXUGD\QRRQSP6XQGD\V +ROLGD\V /LNHXVRQ

IRUZHHNO\VSHFLDOV

SOUTHEAST SASKATCHEWANâ&#x20AC;&#x2122;S FREE DISTRIBUTION PAPER

SOUTHEAST TRADER

EXPRESS Cont. Circulation - 9,239

www.estevanmercury.ca

Looking for a job?

See pages 21 - 25

Friday, July 20, 2012

Delicate Strength

Day at the Museum

3

â&#x20AC;&#x153;They can learn a lot about the settlers and how they didnâ&#x20AC;&#x2122;t have a lot.â&#x20AC;?

He She Said She Said

Can women park better than men? *

FLYER CHECK

7

This week's entry into the 2012 front page photo contest was submitted by Hannah Whitman. If you would like to submit a photo email it to editor@estevanmercury.ca. The winner will receive a digital SLR camera. Please ensure that when sending photos they are sent at the highest possible resolution. Contest sponsored by:

â&#x20AC;˘ Sobeys â&#x20AC;˘ Peavey Mart

6HQFKXN

)RUG6DOHV/WG

â&#x20AC;˘ Home Hardware â&#x20AC;˘ Menards â&#x20AC;˘ Co-op â&#x20AC;˘ Canadian Tire

6RXULV$YH1(VWHYDQ 7ROO)UHH VDOHV

 VHUYLFH

(PDLOVDOHV#VHQFKXNFRPÂ&#x2021;ZZZVHQFKXNIRUGFD


Cheers&Jeers Page 2

THE TRADER EXPRESS, FRIDAY, JULY 20, 2012

Cheers to the new hotel on Kensington that has a beautiful, clean, and well lit parking lot. It is nice to see a business take such pride in their property.

Cheers to SMILE Services for making continued independence for our local seniors possible! Cheers to the residents of Estevan who gave the Canada Post letter carriers water on the extremely hot days in the past couple of weeks.

Jeers to the men who spit all over the sidewalks, parking lots and streets in Estevan. Not only is it illegal to do this in this city, but itâ&#x20AC;&#x2122;s also downright filthy thing to do.

Send your Cheer or Jeer to jbaker@estevanmercury.ca or send us a message on the Mercuryâ&#x20AC;&#x2122;s Facebook page

Cheers to the City of Estevan employees who are keeping our green spaces mowed and much neater this summer. They look great! Cheers to the Family Centre for all of its great summer programs.

ARIES (March 21 to April 19) A turn in a relationship upsets the amorous Arian, who is puzzled by Cupidâ&#x20AC;&#x2122;s romantic antics. Be patient and considerate. The confusion soon will sort itself out.

TAURUS (April 20 to May 20) Itâ&#x20AC;&#x2122;s a good time for travel-loving Taureans to take off for fun-filled jaunts to new places. And donâ&#x20AC;&#x2122;t be surprised if Cupid tags along for what could be a very eventful trip.

GEMINI (May 21 to June 20) You appear to be of two minds about continuing a relationship that seems to be riding roughshod over your emotions. A frank talk could help you decide one way or the other. CANCER (June 21 to July 22) Stepping back from a relationship problem provides a new perspective on how to deal with it. Meanwhile, watch your words. Something said in anger now could backfire later.

+L0\QDPHLV%RVWRQ,DPDPDOH6KLK7]XFURVV0\EURWKHU DQG,ZHUHEURXJKWLQIURP.LVEH\'R\RXNQRZPH" 0\ QDPH LV 3KLOO\ , DP %RVWRQ¡V EURWKHU :H DUH DERXW  \HDUV ROG :KHQ ZH DUULYHG DW WKH VKHOWHU ZH ZHUH GLUW\ DQG ORDGHG ZLWKWLFNVEXWDIWHUDEDWK DQG RXU YDFFLQDWLRQV ZH DUHUHDG\WRĂ&#x20AC;QGDIRUHYHU KRPH

5HPHPEHURXU IDUPSURJUDPLV LQIXOOJHDU3KRQH GRZQWRWKHVKHOWHU IRUPRUHLQIRUPDWLRQ

LEO (July 23 to August 22) A changing situation makes the Big Cat uneasy. But hold on until things settle down around the 4th. Meanwhile, continue your good work on that stillunfinished project. VIRGO (August 23 to September 22) A decided improvement in a workplace situation results in an unexpected, but very welcome, added benefit for everyone. Personal relationships also improve. LIBRA (September 23 to October 22) Money matters remain a bit unsettled but soon will ease into the kind of stability you appreciate. Meanwhile, an expand-

ing social life offers a chance to make new friends. SCORPIO (October 23 to November 21) Use an unexpected roadblock in your monetary dealings to reassess your financial plans and make changes, if necessary. It soon will be smooth sailing again. SAGITTARIUS (November 22 to December 21) Aspects of love are strong for both single and paired Sagittarians. Professional dealings also thrive under the Sagâ&#x20AC;&#x2122;s clever handling of difficult situations. CAPRICORN (December 22 to January 19) Set a realistic goal and follow it through to completion.

2USKHXP7KHDWUH 'RZQWRZQ(VWHYDQÂ&#x2021;+U0RYLH,QIRUPDWLRQ/LQHÂ&#x2021;

OPEN ON RELEASE! THE DARK KNIGHT RISES

Remember: Youâ&#x20AC;&#x2122;re more likely to impress the right people with one well-done job than with lots of jobs left undone. AQUARIUS (January 20 to February 18) You like to plan ahead. Thatâ&#x20AC;&#x2122;s fine. But be prepared to make some changes because of an unsettled period that influences your aspects through the 4th. PISCES (February 19 to March 20) A brief phase of instability affects your usual work cycle. Use the time to catch up on chores around the house or office. Things settle down soon after the 4th. BORN THIS WEEK: You love being the center of attention and probably would be a big success in show business. (c) 2012 King Features Synd., Inc.

Book Your Career ad today!

0\ QDPH LV =RH , DP D IHPDOHDURXQG\HDUVROG ,DPDGDFKVKXQGFURVV,ZDV IRXQG RQ WKH 6WHHOPDQ URDG 'RHVDQ\RQHNQRZPH",DP D OLWWOH WLPLG EXW , DP JHWWLQJ EHWWHUHYHU\GD\

:HZLOOKDYHNLWWHQVUHDG\IRU DGRSWLRQLQWKHQH[WZHHNRUWZR 3OHDVHUHPHPEHUWRWDNHH[WUDSUHFDXWLRQVGXULQJWKHKRWVXPPHUZLWK\RXUSHWV%H VXUHWKH\KDYHORWVRIZDWHUDQGVKDGHDQGRQO\H[HUFLVHLQWKHHYHQLQJVRU HDUO\PRUQLQJZKHQWKHWHPSHUDWXUHLVFRROHU1HYHUOHDYH\RXUSHWLQDYHKLFOH 7KH\FDQRYHUKHDWLQDVOLWWOHDVPLQXWHV 7KH(VWHYDQ+XPDQH6RFLHW\UHVHUYHVWKHULJKWWRUHIXVHDQ\DGRSWLRQ

Call

7KDQN\RXIRU\RXUFRQWLQXHGVXSSRUW 7KLVVSDFHLVVSRQVRUHGE\WKLVFRPPXQLW\PLQGHGEXVLQHVV

634-2654 Friday, July 20 - Thursday, July 26

7:30 pm

PG Violence


THE TRADER EXPRESS, FRIDAY, JULY 20, 2012

Page 3

Money Problems?

Marla Adams CA CIRP Trustee in Bankruptcy

Start Fresh. We can help. FREE consultation 1-800-961-DEBT (3328) www. bankruptcy. deloitte. ca 900-2103 11th Ave., Regina

FEATURED HOMES 12:9,(:,1* 23(1

+286( -XO\ DPQRRQ

912 1st Street, Estevan

The Souris Valley Museum hosted Discovery Day Camp Tuesday. The day included a trip out to Roche Perece and some soap carving. The kids got to learn about regional history and how things were in the past.

A plethora of activities at museum The Souris Valley Museum is a popular place to be this summer. The museum is holding a variety of camps for children as well as adults. This summer they have continued with the Pioneer Day Camp and the Hands on History programs, but they have also added a new Discovery Day Camp. The discovery camp will run four times over the summer and the museum has already reached capacity for all days. This camp runs all day, with a variety of activities to keep

the kids entertained. Museum education assistant Jessica Ward said the camp includes trips around the area to learn about regional history and to visit historic sites. Children then have the chance to take part in some activities and games back at the museum. â&#x20AC;&#x153;The focus of the camp is the history of our area,â&#x20AC;? said Ward. The pioneer camp, which the museum runs every year, gives children a chance to see what things were like for the pioneers.

Ward said there is always a pioneer-based activity like relay races or hide and seek. In addition to the games and crafts, there is also a chance for the kids to learn. â&#x20AC;&#x153;They can learn a lot about the settlers and how they didnâ&#x20AC;&#x2122;t have a lot when they first came here,â&#x20AC;? said Ward. The pioneer camps run for three weeks in the summer and like the discovery camps, they are all booked up. Although both the camps are full there is still an opportunity for people to go visit the

museum. Every Friday in July and August from 10 a.m. to 4 p.m. the museum has Hands on History. The program provides an opportunity for families to come down and make crafts, participate in activities and even do some cooking projects. There is a charge for all the programs, but all the money raised goes back into the museum. For more information about the museum and its programs you can visit www.sourisvalleymuseum.com

Welcome to this great starter or investment home. The open dining/kitchen concept has a patio door that leads to the recently poured concrete patio. Great for outdoor entertaining or cooking your favourite meals on the BBQ. www.9121ststreet.bhgress.ca

MLS# 432757

$165,000

160 Railway Avenue, Glen Ewen

Welcome home to this 896 approx. sq. ft., 2 bdrm home. This home is on 8 lots totalling 23000 sq. ft. The main floor features 2 large bdrms. The large living/dining room is great for all entertainment needs. 3 outbuildings. Single 12â&#x20AC;&#x2122;2â&#x20AC;? x 22â&#x20AC;&#x2122; garage, 32â&#x20AC;&#x2122;2â&#x20AC;? x 28â&#x20AC;&#x2122;2â&#x20AC;? shop/shed and a 12â&#x20AC;&#x2122; x 8â&#x20AC;&#x2122; garden shed. www.160railwayavenue.bhgress.ca

MLS# 429230

$99,900

(VWHYDQ6KRSSHUV0DOO

Â&#x2021;Â&#x2021;

ZZZEKJUHVVFD

)(@4,(+6>3(5+05. 7RZQKRXVHVSULFHGIURP (QMR\XSWRIRXUEHGURRPVDQG VTIWRIOLYLQJVSDFHLQWKHVH JRUJHRXVORFDOO\EXLOWWRZQKRXVHV





2QO\ VT

402 Galloway Street, Estevan

Upgrades, upgrades, upgrades. This 1335 sq. ft. home is beautifully done. The many upgrades in the last year including kitchen counter top, sink & faucet and bay window. Beautiful backyard with 7 man waterfall hot tub. Completely renovated basement & detached single car garage.

MLS# 437910

$449,000

&RQWDFW

-DPLH'\HU  www.jamiedyer.bhgress.ca

Hear the Laugh that says, â&#x20AC;&#x153;I Love You! â&#x20AC;? Are you missing the best sounds of summer? Whether itâ&#x20AC;&#x2122;s a story from an old friend or a child telling you about their latest adventure, AleraÂŽ hearing aids help you hear better even in the most challenging summer environments!

DUNLOP HEARING SERVICES & CONSULTING

Call us today to book an appointment at our weekly hearing clinics!

July 21st, 28th and August 4th, 11th, 18th

306-771-9991 The Souris Valley Museum is full of exhibits like this one, that will give you a look at the history of the region.

T

o Y  u to... k n ha

&DWKHGUDO (QHUJ\6HUYLFHV

RI(VWHYDQIRU SXUFKDVLQJP\+VWHHU ´3XGJH\¾DW6ZLIW&XUUHQW )URQWLHU'D\V

(ULFD%DNXV

(UQIROG+%HHI&OXE

Marlo Dunlop, BC-HIS

$EVROXWH3RZHU6NDWLQJ 0DOHDQG)HPDOH&OLQLFV

$WRPDJHJURXS$XJXVWSP 3HH:HHDJHJURXS$XJXVWSP %DQWDPDJHJURXS6HSWHPEHUSP 0LGJHWDJHJURXS6HSWHPEHUSP

NDWHU V  U H S     Q LQIRUPDWLR

RUIRUPRUH 7RUHJLVWHU FRQWDFW 7ULFLD'H%UX\QH

RUWJXHVW#VDVNWHOQHW

4U+PTFQIT)PTQJUBMt/JDIPMTPO3PBEt&TUFWBO4,


SOUTHEAST TRADER

EXPRESS

JULY 20, 2012

Member Canadian Community Newspapers Assoc. Member Saskatchewan Weekly Newspapers Assoc. Audited by Audit Bureau of Circulations.

SOUTHEAST TRADER

EXPRESS General Manager: Brant Kersey Editorial Staff: Norm Park Chad Saxon Jordan Baker Josh Lewis Advertising Sales Manager: Cindy Beaulieu Advertising Sales Representatives: Deanna Tarnes Kristen O'Handley Teresa Hrywkiw Candace Wheeler Production Department: Melanie Tribiger Jodi Gagnon Trinda Jocelyn Manuela Fors Accounting: Kim Schoff Reception: Gayle Worsnop Classifieds: Carol Toth Contributors: Calvin Daniels Tonaya Marr Brian Zinchuk Bruce Penton Susan Sohn

Published weekly by Prairie Newspaper Group Limited Partnership, 68 Souris Avenue N., Estevan, Saskatchewan. Postal address: Box 730 Estevan, Saskatchewan, S4A 2A6 Advertising rates are available upon request and are subject to change without notice. Conditions of editorial and advertising content: The Southeast Trader Express attempts to be accurate in Editorial and Advertising content; however, no guarantee is given or implied. The Southeast Trader Express reserves the right to revise or reject any or all editorial and advertising content as the newspaper's principals see fit. The Southeast Trader Express will not be responsible for more than one incorrect insertion of an advertisement, and is not responsible for errors in advertisements except for the space occupied by such errors. The Southeast Trader Express will not be responsible for manuscripts, photographs, negatives and other related material that may be submitted for possible publication. All of the The Southeast Trader Express' content is protected by Canadian Copyright laws. Reviews and similar mention of material in this newspaper is granted on the provision that The Southeast Trader Express receives credit. Otherwise, any reproduction without the permission of the publisher is prohibited. Advertisers purchase space and circulation only. Rights to any advertisement produced by The Southeast Trader Express, including artwork, typography, photos, etc., remain the property of this newspaper. Advertisements or parts thereof may not be reproduced or assigned without the consent of the publisher. Published weekly in Southeast Saskatchewan by the Prairie Newspaper Group, a subsidiary of Glacier Media Inc. The Glacier group of companies collects personal information from our customers in the normal course of business transactions. We use that information to provide you with our products and services you request. On occasion we may contact you for purposes of research, surveys and other such matters. To provide you with better service we may share your personal information with our sister companies and also outside, selected third parties who perform work for us as suppliers, agents, service providers and information gatherers. Our subscription list may be provided to other organizations who have products and services that may be of interest to you. If you do not wish to participate in such matters, please contact us at the following address: The Southeast Trader Express, Box 730, Estevan, Saskatchewan, S4A 2A6; or phone (306) 634-2654. For a complete statement of our privacy policy, please go to our Website at: www.estevanmercury.ca The Southeast Trader Express is owned and operated by Prairie Newspaper Group, a subsidiary of Glacier Media Inc.

We acknowledge the financial support of the Government of Canada through the Publications Assistance Program toward our mailing costs.

Contact us: Phone: 634-2654 Fax: 634-3934 www.estevanmercury.ca Street Address: 68 Souris Ave. N., Estevan By mail: Box 730, Estevan, Sask. S4A 2A6

Perspective

Page 4

A tale of two CFL team cities The Saskatchewan Roughriders and Winnipeg Blue Bombers have the best rivalry in the CFL, but at the rate this season is going, come Labour Day the Riders will have locked up a playoff spot and the Bombers will be looking ahead to next season. Of course it is early in the Canadian Football League (CFL) season, and as all fans know, everything is still up for grabs. Before I continue, I have to warn everyone that my bias will always lean towards the Bombers, but being born and raised in Winnipeg, I don’t have much choice. As David Puddy from Seinfeld says, “you got to support the team.” I also realize that everyone in this province would rather read War and Peace than a column from a Bomber fan, but don’t count me out yet. One of the reasons I have always wanted to work in Saskatchewan was because of the passion everyone shows for the Roughriders and sports in general. Although I’m sworn to hate the Riders, I do respect the team and the fans. The two prairie provinces currently

Rhys Kelso Rhys’ Pieces find their teams at opposite ends of the spectrum and what I find interesting about that is that both teams went through some major changes this offseason. Saskatchewan lost key players like Andy Fantuz, Gene Makowsky and Jerrell Freeman. They also brought in a new head coach. Winnipeg lost key players such as Doug Brown, Obby Kahn and Odell Willis. I can understand the Roughriders wanting a change in their organization after a tough season last year, but I’m still questioning the moves made by the Bombers’ brass. Why make so many changes to your starting lineups after going to the Grey Cup? The two teams had different startegies on how to fill the holes in the off-season. The Riders went outside

to bring in players to fill the holes, including two former Bombers in Willis and Brendan Labatte, both of whom Winnipeg could really use right now. The Bombers decided to fill their roster from within. Although the Blue and Gold have a young team right now, it’s a big step back for the fans from a Grey Cup appearance. I won’t even touch the new stadium subject. Both teams have lots of new players or a new starting lineup, but one team has come out on fire and the other is slow out of the gates. It’s great news for Saskatchewan, but not as nice for us lowly Bomber fans. If you were to ask me at the beginning of the season, I would’ve said that it was the Riders who might take some time to gel on the field. I’m hoping that just maybe this year’s Bomber team is the one slow to gel. Right now I’m just wishing that by the time Labour Day gets here, Winnipeg will be at least competing for a playoff spot, because we all know the first two games in September are always more exciting when they mean something.

Wet weather affecting crop production As most Prairie producers are all too aware, cropping conditions have been less than ideal this year. Another wet spring on the heels of two wet years meant seeding lagged. Since then, across much of the Prairies, rain has continued to be an issue - lots of rain. Driving around the parkland region over the last several weeks, I have seen too many crops, especially cereals, with yellowish leaves, which always reminds me of an explanation from my grandfather about such crops looking that way because “they have wet feet.” It was a reference to the crops simply sitting in too much water. As we now pass the middle of July, crop conditions are not likely to change greatly, although later seeded fields still have to hope an early frost doesn’t pop up. Again thinking of my grandfather, he would say the dates to worry about would be Aug. 1 and 31, both nights of a

Calvin Daniels Trader Agriculture Columnist full moon. He always said frost was most likely on such nights. On a world level, the wet conditions here are in contrast to droughts in the United States Midwest and the Black Sea region, meaning crops in those two export regions are under pressure. In terms of production, the Canadian situation is not a disaster, but it certainly is one where production will not be such that it can offset problems elsewhere. The wet here, and drought in other locations, have been enough to rally prices, and so farmers might have a fall where harvesting an average crop still produce strong returns. That is good news for farmers here.

There is however, another side to the situation. In times of drought and wet, it is not just the production levels that take a hit. Quality too, can be affected. Canadian farmers are well aware that quality makes a difference. Canadian wheat has a reputation for its quality based on many of the legislated safeguards that have long existed in this country, and those safeguards have allowed this country’s wheat to be accepted into markets where quality is paramount. If weather conditions impact enough cereal export regions, quality production is likely to be squeezed harder than overall production, and that could put a premium on top grades this fall. Certainly the situation has already pushed prices higher, a situation farmers here could take greater advantage of provided the weeks ahead see weather conditions gravitate more towards normal. This would enable farmers to take off the crop that is there in the best possible condition.

Read the Full Edition of the Southeast Trader Express online

www.estevanmercury.ca


THE TRADER EXPRESS, FRIDAY, JULY 20, 2012

Page 5

The day Tonaya saved Kendelleâ&#x20AC;&#x2122;s life When I was eight and Kendelle was seven, our parents took us on the annual family camping trip to a Saskatchewan provincial park. This summerâ&#x20AC;&#x2122;s park of choice was Duck Mountain Provincial Park. It was a great place to camp, or it used to be, back when family camping trips were fun.* One day, my family was down at the beach. It was an unusually blustery day, while being extremely hot, so the beach was packed with vacationers soaking up the rays and children throwing sand into one anotherâ&#x20AC;&#x2122;s eyes. (Ugh). That summer, Dad had purchased my sisters and me two floaty horse toys, which in hindsight seems inconsiderate considering there were three

of us. But I digress. So weâ&#x20AC;&#x2122;re out at the beach and I, being a skilled Level 5 swimmer with the badges to prove I could tread water and had mastered the front crawl, wanted to go swimming. Naturally, Kendelle, who was a decent swimmer in her own right (which she attributed to having two webbed toes) wanted to join me on my adventure. I grabbed an air-filled Pokemon ball (so awesome) and Kendelle took one of the horses and we waded into the water. When our feet couldnâ&#x20AC;&#x2122;t touch the ground, we continued to paddle. After several minutes of swimming, Kendelle noted that we were considerably further away from shore than our parents would approve of.

Tonaya Marr Maybe Itâ&#x20AC;&#x2122;s Just Me But a quick look over my shoulder showed me that Mom and Dad hadnâ&#x20AC;&#x2122;t even noticed we were breaking the rules, which every kid knew meant we were OK to continue. I told Kendelle to stop being a baby. Then disaster struck. Kendelle, for a reason I still donâ&#x20AC;&#x2122;t understand, decided to let go of her horse. And it floated away a lot faster than she was able to swim. So she began to drown. I should point out that

even then, Kendelle had a flair for drama. She bobbed. She choked. She fl ailed her arms. And I hung onto my ball, telling her off for sucking at swimming. Eventually I noticed she was spending more time under the water than above it, so I made an important decision: I passed her my floating ball, assuming that once Kendelle was secured, I could swim over and get her horse for her. This plan failed when Kendelle

missed the ball and it too floated away. Being the heroic big sister I am, I swam after the ball, returned to Kendelle, swam under the water and rescued her from two mermaids and a Grindylow. OK, so maybe I exaggerate. I did grab her and force her onto the ball, and we floated back to the shore. I remember being shocked to see Mom up to her waist in the water, clearly making her way toward us. But I had the situation under control. Kendelle was alive, though blubbering to herself a bit, and we were down one floaty horse, but all in all, I totally saved the day.

* I should point out that I recently visited Duck Mountain and had a great time. So itâ&#x20AC;&#x2122;s not the park that sucks. Tonaya Marr would like everyone to note that Pokemon is awesome, Kendelle owes Tonaya her life and itâ&#x20AC;&#x2122;s important to know your limit when swimming. You might also find interesting that Tonaya dreams about saving Kendelleâ&#x20AC;&#x2122;s life all the time, though never in the same situation. Sometimes there are boat chases and explosions. Itâ&#x20AC;&#x2122;s pretty cool. Send Tonaya an e-mail at tonaya.marr@ gmail.com or tweet her @ TonayaMarr.

%D\0HDGRZ/DQGLQJ 2SHQ+RXVH -XO\

6WRSE\DQGPHHWPHDWDP WRYLHZWKLVEHDXWLIXOSURSHUW\

12973HM00

421-9884 Lori Gonas

*2:,7+*21$6

'RQ¡W&XVV &DOOX6

4-H Saskatchewan Ĺ?Ć?Ä&#x201A;ŜŽŜͲĆ&#x2030;Ć&#x152;ŽĎĆ&#x161; youth development program helping Saskatchewan youth aged 6 to 21 get a head start on success since 1917. Find out more: www.4-H.sk.ca or (306) 933-7727 New members, clubs and volunteer leaders are always welcome!

Learn to Do by Doing!

&RPSOHWH3DLQW6HUYLFH ([SHUW&ROOLVLRQ5HSDLUÂ&#x2021;*XDUDQWHHG:RUN )DVW)ULHQGO\6HUYLFHÂ&#x2021;&RXUWHV\9HKLFOHV

´&86720(5$33529('5(68/76¾

 675((7 $XWRERG\  WK

WK6W (VWHYDQ6N


Page 6

THE TRADER EXPRESS, FRIDAY, JULY 20, 2012

Lessons from a bathroom wall We are living in a day and age where so much of our lives is documented for all to see - whether it’s the Facebook Status update, Instagram picture or perhaps it’s the 140 character thought, rant or quote on Twitter - maybe it’s even a conversation between gamers in the midst of a Transatlantic competition. Whatever the case may be, we seem to be engaged and “on” all the time. I think the only time we are disengaging is when we are sleeping and even then our chosen piece of technology generally lies within arm’s reach. Many of our more seasoned readers often point out the dangers and pitfalls of being so connected to the outside world. They remember (as do I remember while growing up) the days of the “party phone line” whereby

Susan Sohn Welcome to Real Life everyone on your line knew exactly what was going on in your life. As a child, I remember hearing conversations about so-and-so listening in and that we were to be careful of what we shared on the phone because you never knew who was listening and who you were “engaging” with. There were boundaries and seemingly invisible lines that we all knew not to cross. Those days are long gone and have been replaced by hyper communication. It almost feels that those invis-

12073MM01

ible lines that were respected are now buzzing with information and the boundaries have been pushed back. We know where everyone is and what they are doing at almost any given minute. If they haven’t told us via social media, we can google search and find it. We can search addresses and see exactly where people live, what their houses look like and whether or not they garden. We watch children grow up right before our eyes by flicking through years of uploaded pictures

(this I love!). Simply put, life is pretty easy to piece together and piecing together is mostly for the good but sadly, sometimes the not so good. Am I against all of this? No, in fact all of my work is done using social media and the new technology that is available to us. I love it and I use it every day in everything I do. In saying that, however, I am a mother of three children and believe that I not only have to teach them responsible use of technology but I have to display it (monkey-see-monkey-do). I also have to let them know that although “boundaries” seem to be an archaic thought, that in fact, personal boundaries, even through technology, are important. This lesson and teaching is difficult because as a parent, it requires me staying one step ahead or at least trying to stay ahead, and when that doesn’t work (because our children are so techno literate), they need to know I’m engaged in the process. While reading this, you may think that most parents would be engaged in something so pivotal in their children’s lives. Sadly, this isn’t the case. In fact, most parents have no idea what sites their kids visit, who they “chat” to online or what their level of engagement is. To me, that’s a scary place to be. With all of this rattling around in my mind, I found it funny when I saw something,

hanging on a bathroom wall at a restaurant the other day. This wall hanging reminded me of how we should be conducting ourselves not only in our everyday personal interactions with people but online as well. I decided to call these points, “lessons from a bathroom wall.” These lessons are important because we need to remind ourselves (and those in our care) how important personal conduct is and that we all understand that hiding behind a “fake name or handle” doesn’t give any of us liberty to do and say whatever we want. There are boundaries and although they seemingly have been erased, invisible lines still exist and we need to keep them there. I hope you enjoy these few points, as I did. I am sharing these, not only with you but with my family, our friends, our social media followers, fans and as far as my reach will take me. Enjoy and make them your own and remember, “Don’t do anything that wouldn’t make your mom proud.” Lessons from a Bathroom Wall * Marry the right person. This one decision will determine 90 per cent of your happiness or misery. * Work at something you enjoy that’s worthy of your time and talent. * Give people more than they expect and do it cheerfully.

12073SS01

12073PA00

* Become the most positive and enthusiastic person you know. * Be forgiving of yourself and others. * Be generous. * Have a grateful heart. * Persistence, persistence, persistence. * Discipline yourself to save money on even the most modest salary. * Treat everyone you meet like you want to be treated. * Commit yourself to constant improvement. * Commit yourself to quality. * Understand that happiness is not based on possessions, power or prestige, but on relationships you love and respect. * Be loyal. * Be honest. * Be a self-starter. * Be decisive, even if it means you’ll sometimes be wrong. * Stop blaming others and take responsibility in every area of your life. * Be bold and courageous. When you look back on your life you’ll regret the things you didn’t do, more than the things you did. * Take good care of those you love. * Don’t do anything that wouldn’t make your mom proud. Susan J Sohn susan@getreallive.com getreallive.com


THE TRADER EXPRESS, FRIDAY, JULY 20, 2012

Page 7

Should there be gender-specific parking spots?

He She She He

There are an abundance of stereotypes out there about different types of drivers, but the town of Triberg in Germany has taken it a step further by designating gender-specific spots. Although the mayor of Triberg has admitted that this is a publicity stunt, I think it’s in poor taste and there is no reason to reserve parking spots for anyone unless it’s handicapped spots. In today’s age, it is ridiculous to group one gender or group altogether. And if you were to ask me, I would say women were the safer and more cautious drivers. Being a male I don’t like to admit it, but there are lots of us out there who get behind the wheel of a vehicle and think we’re indestructible. There is no way to find these numbers, but I would be interested in seeing the number of males who have left the scene of a hit and run compared to women. And you want to give men tighter spots where they have more of a chance of backing into a parked car or object. Maybe a more experienced driver is able to manoeuvre around obstacles better, but who is more likely to stop if they happen to run into a parked car? To top it all off, the town in question has a listed population of just over 5,000 people. Are parking spots at such a premium you need to designate easy and hard ones. How about you just park wherever you find a spot? If you have to park farther away to get into an easier space, then enjoy the fresh air and exercise as you walk an extra few steps to your destination.

Said

Clearly this is sexist. By giving women wider, easier parking spots closer to the doors of shopping centres, the mayor of the German town of Triberg is essentially saying that women aren’t good at parking. And that’s not the case. Women are just as good at parking as men. I’ve seen plenty of men, some of whom I’m related to (Dad, Pop) drive a parked vehicle into another parked vehicle. And I’ve seen just as many women, myself included, get into accidents while parking (I suck at reversing sometimes). So on a politically-correct side of things, it’s definitely wrong to make parking spots gender specific. What about people who don’t identify themselves as male or female? And what about men who absolutely cannot park in tricky parking spots? Imagine what it will do to the self-esteem of these men, who society tells aren’t man enough to park like other men! I would like to say that I’m actually OK with this, despite the sexism. If men want to leave easy, close parking spots open for women like me, why would I try to stop them? I don’t want to run into the store through the rain/snow/hail that’s so popular here in Saskatchewan. In fact, men should probably start offering a shuttle service to take me from my easily parked car into the shopping centre, so I don’t cause any traffic problems on the way.

Said

Create your own charging station • “I use the large pails of kitty litter. They have a lid that can be removed completely, but also have a pour spout. I save my empties to collect rainwater. I remove the lid and set them out to catch water when it rains, then put the lid on so that the water does not attract mosquitoes. I use it to water my flowers between storms.” -- A Reader, via email • Create your own

you can fit your electronics connecters (cellphones, iPods, camera, etc.). All the cords will be stored in the box, out of sight.

charging station: Find a wooden box large enough to hold a multistrip power connection and pretty enough to sit on the counter. Drill one hole in the side to fit the plug. In the top of the box, create holes through which

Send your tips to Now Here’s a Tip, c/o King Features Weekly Service, P.O. Box 536475, Orlando, FL 32853-6475 or e-mail JoAnn at heresatip@yahoo. com. (c) 2012 King Features Synd., Inc.

PARK MODELS! The perfect solution for those of you that have a permanent site!

Kingsport K380FRS Pick the one that works for you!!! 40’ of living, 2 slides LOVELY! $29,900!

Country Ridge Fiberglass siding, fireplaces, second air-conditioner LOADED! $42,900!

Cedar Creek R-38 insulation, corion counter tops, leather lay-z-boy recliners! LUXURIOUS! $54,500!

921 Government Road S. • Weyburn, SK • 1-877-842-3288 • www.minardsleisureworld.com


Page 8

THE TRADER EXPRESS, FRIDAY, JULY 20, 2012

Our Past July 19, 2000 Brent Gedak of Estevan attempts a backflip while wakeboarding at Boundary Dam.

Each week the Southeast Trader Express shares recent stories from the community but weâ&#x20AC;&#x2122;ll also give you a look into the past. If you have a photo you think readers of the Southeast Trader Express would find interesting please submit it to Jordan Baker at jbaker@estvanmercury.ca.

)255(17 14,000 Plus Square Feet +HDWHG6KRSRQ$FUHV

&DOO6WHYH

MARITIMES BY MOTORCOACH

Several Tours to Choose From HDUV s Year 34<  FH ice HUYL serv of6 RI

www.nageltours.com

Call Your Travel Agent or 1-800-562-9999

Bridal Guide 2012

0D\UD&*RQ]DOH] $QLEDO%UDYR -XO\ 0DUOHQH7D\ORU 7RGG$GDPV -XO\ -HVVLH(OLDV $QGUHZ6PROLDN -XO\ -DLPH&URVVOH\ 6SHQFHU/DORQGH -XO\ $PDQGD+HQWRQ 'XVWLQ0DFN $XJXVW -DQHOOH'DDH 7ULVWDQ0DFN $XJXVW $VKOH\)RUUHVWHU 'DQLDO%D\OLVV $XJXVW 5DFKHOOH.LFNOH\ &UDLJ&DLVVLH $XJXVW 6DUDK0RQWH\QH .RU\&OHDUZDWHU $XJXVW .DWHO\Q+HUVFKH 0LNH%HQGHU $XJXVW $PDQGD/LQGHQEDFK $GDP/RMHZVNL $XJXVW &KDQQ\+RXVH $DURQ0DFN 6HSWHPEHU -LOO0DF'RQDOG 7\OHU6HON 6HSWHPEHU -HQQD+HLGLQJHU .\OH/XF 6HSWHPEHU $PDQGD/XKU &KDG0XQUR 6HSWHPEHU 7UDFH\'RQDLV -HII:DUG 6HSWHPEHU 7UDF\7\WODQGVYLN 5REHUW%ORZDWW 6HSWHPEHU &KULVWLQD'RUZDUG -HUHP\6WURQJ 6HSWHPEHU /DFH\*LOO 6FRWW6\NHV 6HSWHPEHU -DPLH&DPSEHOO .HYLQ0F&XUG\ 6HSWHPEHU 'DUF\3LHUVRQ (ULF/RUDQJH 6HSWHPEHU $GULHQQH'DZVRQ %UDG'L[RQ 6HSWHPEHU $PEHU)OHFN -DVRQ.XFKLQND 1RYHPEHU 0HLJDQ*HGDN 6KDZQ:LOKHOP1RYHPEHU 6KHODJK%DQJVXQG $DURQ(VNUD 'HFHPEHU

&$7(5,1* )URPODUJHZHGGLQJVWRVPDOOHULQWLPDWHDIIDLUV (%·V'LQLQJ(PSRULXP /HWXVORRNDIWHUWKHFDWHULQJ FDQPDNH\RXU6SHFLDO(YHQWD 'D\WR5HPHPEHU )URPODUJHZHGGLQJVWRVPDOOHU LQWLPDWHDIIDLUV /HWXVORRNDIWHUWKHFDWHULQJ 6RXULV$YH (VWHYDQ



Visit us on the web!! www.estevanmercury.ca <RXUKRPHLV\RXUFDQYDV &RORXULWXQLTXHZLWK\RXUVLJQDWXUHVW\OH

Â&#x2021;'HVLJQHUIXUQLWXUH Â&#x2021;5XJV Â&#x2021;'HFRUDFFHVVRULHV Â&#x2021;6,&2SDLQW VXSSOLHV

Â&#x2021;&XVWRPEHGGLQJ GUDSHULHV Â&#x2021;&XVWRPIUDPLQJ DUWZRUN Â&#x2021;:DOOSDSHU IDX[Ã&#x20AC;QLVKLQJ Â&#x2021;'HVLJQFRQVXOWDWLRQV

)$6+,21 &RWHDX$YH( :H\EXUQ6. 3K

Â&#x2021;%HDXWLIXOJRZQVIRUWKHJUDGXDWH Â&#x2021;)DQF\DWWLUH0RWKHURI%ULGH Â&#x2021;-HZHOOHU\7LDUDV

,QVSLUDWLRQV by Color

$OZD\V7KDW3HUVRQDOL]HG6HUYLFH $SSRLQWPHQWVPD\EHPDGH

&DOOWR$QQRXQFH<RXU8SFRPLQJ:HGGLQJ)RU)UHH

1101 - 5th Street, Estevan â&#x20AC;¢ 634-7008 Open Monday - Friday 9 am - 5 pm


THE TRADER EXPRESS, FRIDAY, JULY 20, 2012

Page 9

Toronto barbecue ends in bloodshed Provincial SASKATOON - Saskatchewanâ&#x20AC;&#x2122;s NDP says the governmentâ&#x20AC;&#x2122;s changes to regulations of public pools may be putting people at risk. MLA Cam Broten says the changes by the Saskatchewan Party means each public pool in the province can decide what training or qualifications a lifeguard requires. Broten says stakeholders have been told that many of the former standards set by The Swimming Pool Regulations have been replaced by the government with an expectation that pool operators will develop their own â&#x20AC;&#x153;swimming pool safety plan.â&#x20AC;? The MLA also says swimmers-to-lifeguard ratios have also been removed from the regulations. National TORONTO - Toronto police are calling for witnesses to come forward following a deadly shooting at an outdoor neighbourhood party that left two people dead and sent 22 others to hospital, including an infant, in what police are calling the worst incident of gun violence in the cityâ&#x20AC;&#x2122;s recent history. More than 200 people were at the party in the cityâ&#x20AC;&#x2122;s east end Monday night when gunmen sprayed the crowd with bullets. Police say 19 people were wounded by gunfire and three more were injured in the stampede that ensued. Police described the shootout, which involved multiple guns, as an â&#x20AC;&#x153;unprecedentedâ&#x20AC;? episode of violence. â&#x20AC;&#x153;Tonightâ&#x20AC;&#x2122;s event, I think, is shocking to every Torontonian. I think it will be shocking to all of Canada,â&#x20AC;? Police Chief Bill Blair said from the scene of the crime. â&#x20AC;&#x153;The level of violence is something we have never experienced.â&#x20AC;? Officials said the two people killed in the shooting were a teenage girl and a young man, but their names were not released.

The street was still strewn with empty water bottles and other remnants of the party on Tuesday, as swaths of police tape surrounded the area. Tears shone in one manâ&#x20AC;&#x2122;s eyes as he recalled walking out of a friendâ&#x20AC;&#x2122;s house and into the crowded celebration just moments before violence erupted. â&#x20AC;&#x153;I saw people running, I heard â&#x20AC;&#x2DC;crack, crackâ&#x20AC;&#x2122; and I hit the ground,â&#x20AC;? said the man, who did not want to be identified out of concern for his safety. â&#x20AC;&#x153;It was like a Quentin Tarantino movie,â&#x20AC;? he said, calling it the most frightening thing he had ever seen in more than four decades in the neighbourhood. The incident took place before 11 p.m. on Danzig St., near Morningside Ave., and Lawrence Ave. East. The area was packed with police cars and emergency response vehicles late Monday night as crews ferried away the injured on stretchers and treated others on buses brought in as mobile clinics. Some people shed tears as they spoke with officers while others watched crews work from behind a police perimeter. â&#x20AC;&#x153;An altercation broke out among some individuals and there was an exchange of gunfire. During that gunfire a number of innocent bystanders were struck,â&#x20AC;? said Blair. â&#x20AC;&#x153;Itâ&#x20AC;&#x2122;s a very shocking event, a lot of people were injured.â&#x20AC;? In a statement issued early Tuesday, Mayor Rob Ford said he is â&#x20AC;&#x153;shocked and disgusted by this senseless act of violence.â&#x20AC;? â&#x20AC;&#x153;While we try to understand this tragic event, I want to assure residents that this horrific, criminal behaviour will not be tolerated in our city,â&#x20AC;? said Ford. *** HALIFAX - The case of a Halifax navy intelligence officer accused of espionage is due back in provincial court today.

Sub-Lt. Jeffrey Paul Delisle faces two charges of passing information to a foreign entity that could harm Canadaâ&#x20AC;&#x2122;s interests. Delisle was denied bail in March and has been in custody at the Central Nova Scotia Correctional Facility in Halifax since his arrest in January. All the offences are alleged to have happened in or near Halifax, Ottawa and Kingston, Ont. Delisle joined the navy as a reservist in 1996, then became a member of the regular forces in 2001, and was promoted to an officer rank in 2008. He was charged under a section of the Security of Information Act that was passed by the House of Commons after the terrorist attacks on the United States on Sept. 11, 2001.

1st inda Cana

International NAYPYITAW, Myanmar - Aung San Suu Kyi is no stranger to tributes for her courageous political opposition in Myanmar, but the latest was perhaps the most bittersweet â&#x20AC;&#x201D; delivered from beyond the grave from an ardent admirer who was another tenacious fighter for democracy. Czech Foreign Minister Karel Schwarzenberg at a dinner Tuesday night presented her with a dried, yellow rose on behalf of his countryâ&#x20AC;&#x2122;s late president, Vaclav Havel, who died in December. He said that in 2005, Havel sent Suu Kyi â&#x20AC;&#x201D; then under house arrest â&#x20AC;&#x201D; birthday greetings in a note in which he said he wanted to meet her and how happy he would be if he could personally give her a rose.

a stretch mark treatment that actually works!

LEGATO Improves The Look Of

â&#x20AC;˘ Keloids â&#x20AC;˘ Mature Scars â&#x20AC;˘ Post Acne Scars â&#x20AC;˘ Stretch Marks

Only treatment available with remarkable results for stretchmarks & scaring

Keloid Scars

It was Havel who nominated Suu Kyi for the 1991 Nobel Peace Prize that she was finally free to accept in person last month in Oslo. She had been detained 15 of the years since 1989, and in the periods when she was free, did not risk going abroad for fear she would not be allowed to return to her struggle in Myanmar. *** TUSCALOOSA, Ala. Alabama police say a gunman fired into a crowded bar then shot people as they ran out, leaving 17 injured, including two critically.

Tuscaloosa Police Chief Steve Anderson said the shooter, who has not been identified, never went inside during the assault early Tuesday. â&#x20AC;&#x153;He fired all of his shots from outside,â&#x20AC;? Anderson said. Hospital spokesman Brad Fisher said 17 people were treated at DCH Regional Medical Center, and two were receiving critical care. Surveillance video released by police shows a man walking down a sidewalk with what appears to be a gun in one hand.

6287+($6775$'(5

(;35(66 Early

DEADLINES $V0RQGD\$XJLV 6DVNDWFKHZDQ'D\ 7KH(VWHYDQ0HUFXU\Ň&#x2039;V%XVLQHVV 2IĂ&#x20AC;FHZLOOEH&ORVHG0RQGD\$XJ WRPDUNWKHVWDWXWRU\KROLGD\ DQGWKLVZLOOUHVXOWLQ

DGYHUWLVLQJGHDGOLQHFKDQJHV

ĹąBefore After Ĺł

IRUWKH

Legato Stretchmarks

:HGQHVGD\$XJXVW (VWHYDQ0HUFXU\

ClassiďŹ ed Advertising )RU7+((67(9$10(5&85<

ĹąBefore After Ĺł

7KH'HDGOLQH:LOO%HÂŤ

7KXUVGD\$XJDWSP

Call for Consultation Ph: 306.634.6789 Fax: 306.634.6793 3-419 Kensington, Estevan, SK S4A 2H8 (Strip Mall by Wal-Mart) cbell@bellmedicalaesthetics.com To see what people are saying about us go to: www.bellmedicalaesthetics.com

 

Display Advertising )RUWKH(VWHYDQ0HUFXU\ 7KH'HDGOLQH:LOO%HÂŤ

7KXUVGD\$XJDWSP

2 - bedrooms Large Deck 1 - bath Septic Tank 1120 Square Cistern Feet Fully Furnished

YEAR ROUND LIVING- MOVE IN READY!

306-848-1000


Page 10

THE TRADER EXPRESS, FRIDAY, JULY 20, 2012

Sinclair wonâ&#x20AC;&#x2122;t be unknown for long Bruce Penton Sports Columnist Christine Sinclair might be the best relatively unknown athlete in Canada. The 30-year-old soccer star, the captain of the Canadian Olympic team thatâ&#x20AC;&#x2122;s competing in the London Games starting July 27, is well known in countries where soccer is a way of life and, in fact, her name is part of the conversation when people talk about the best female players in the world.

In Canada, though, you might get nothing more than blank stares if you asked ordinary Canadians to say what they knew about Sinclair. â&#x20AC;&#x153;You always know something can happen when Christine Sinclair is on the pitch,â&#x20AC;? John Herdman, head coach of Canadaâ&#x20AC;&#x2122;s national womenâ&#x20AC;&#x2122;s soccer team, told Stephen Brunt of Sportsnet Magazine. â&#x20AC;&#x153;Every team that wins a World Cup needs one of those players.â&#x20AC;? Canada has a realistic chance of winning a medal in womenâ&#x20AC;&#x2122;s Olympic soccer. The team is ranked sixth going into the competition, the

second time it has qualified for the Olympics. In 2008, Canada finished eighth. Hopes are higher this year, mainly due to the on-pitch magnificence of Sinclair, the seven-time Canadian womenâ&#x20AC;&#x2122;s Soccer Player of the Year, who was born in Burnaby but made her soccer mark in the U.S. college ranks. A star at the University of Portland, Sinclair, now 29, set an all-time Division I career record with 39 goals. In 2005-06, she was woman athlete of the year in U.S. college athletics. In Canada, though, you

0$&. $8&7,21 )$50(48,30(17

521&$55,(5( 6$785'$<$8*867 (67(9$16$6. ',5(&7,216)520(67(9$1*20,/(61257+21+:<)$5021:(676,'(2) +:<6$/(67$576#$0Â&#x2021;:$7&+)256,*16 75$&7256 -2+1 '((5(  :' 75$&725  +RXUV  6SHHG  +\GUDXOLFV 'XDOV615:6 Â&#x2021;&$6(:'75$&725 $//,('  )(/  +RXUV  +\GUDXOLFV  7LUHV 61 Â&#x2021; -2+1'((5($5:'75$&725372 %HOW3XOOH\7LUHV61$*5Â&#x2021; &$6(/$:'75$&72561$Â&#x2021; )25'621:'75$&72537237+ +$59(67(48,30(17 &$6(,+63&20%,1((QJLQH +RXUV3LFN8S+HDGHU61  Â&#x2021; &$6( ,+  675$,*+7 &87 +($'(5  )7 8,, 3LFNXS 5HHO 61--&2Â&#x2021;9(56$7,/()737 6:$7+(5Â&#x2021;.2(1'(5632/<'580 6:$7+52//(5 6((',1* 7,//$*( %285*$8/7  $,5 6(('(5  %285*$8/7  $,5 7$1.  )7 6LQJOH 6KRRW 3RO\ 3DFNHUV 7RZ %HKLQG $LU 7DQN +\G )DQ  $XJHU Â&#x2021; &$6( ,+  &8/7,9$725  )7 'HJHOPDQ+DUURZVÂ&#x2021;,17(51$7,21$/  ',6&(56 Â&#x2021; )/(;,&2,/ )7 7,1( +$552:6 Â&#x2021; '(*(/0$1 6

*5281''5,9(52&.3,&.(5Â&#x2021;5,7( :$< 52&. 5$.( Â&#x2021; 52&.20$7,& 52&.3,&.(5 *5$,16725$*( % ( + / , 1       % 8 6 + ( /  + 2 3 3 ( 5 %27720 %,1 Â&#x2021; :(67((/   %86+(/ +233(5 %27720 %,16 Â&#x2021; :(67((/526&2 %86+(/ %,1621&(0(17Â&#x2021;6725.,1*721 )(57,/,=(5+233(5%,1Â&#x2021;)/$0$1 +3$5($7,21)$1Â&#x2021;*5$,1*8$5'+3 $5($7,21)$1 *5$,1+$1'/,1* 6$.81',$.  ;  6:,1* $8*(5 Â&#x2021; 6$.81',$.;$8*(5 .2+/(5 +3 (1*,1( :,7+ 029(5  %,1 6:((3 Â&#x2021; %5$1'7  ;  $8*(5  .2+/(5 (1*,1( Â&#x2021; 9(56$7,/(  ;  $8*(5  %5,**6 (1*,1( Â&#x2021; 75$,/(5 02817('*5$,19$&:,7+,+8% *$6(1*,1( 758&.6 '2'*(;3,&.83758&. ([WHQGHG&DE61%+)=<- Â&#x2021;  '2'*(  ; 3,&.83 758&. 5HJXODU &DE  6SHHG )ODW 'HFN 61%.:+6 Â&#x2021;  )25' ) 7$* $;/( *5$,1

758&. 7UDQVPLVVLRQ5ROO7DUS .PV61)&9'*Â&#x2021; '2'*(  6,1*/( $;/( *5$,1 758&. 7UDQVPLVVLRQ5ROO7DUS 61')0- /,9(672&.(48,30(17 %/8(+,//6Ă´;*226(1(&. 672&. 75$,/(5 Â&#x2021; +,*+/,1( %$/( 352  %$/( 352&(6625 Â&#x2021; 1(: +2//$1'  $872 :5$3 5281' %$/(5 Â&#x2021; 1(: +2//$1'   )7 +$<%,1(Â&#x2021;*(+/*5,1'(50,;(5 Â&#x2021; ,17(51$7,21$/ 6,'( '(/,9(5< +$<5$.(Â&#x2021;-2+1'((5(0$185( 635($'(5 Â&#x2021; 75$,/(5 7<3( 3267 3281'(5 Â&#x2021; 0,$0, :(/',1*  %86+(/ 6(/) )(('(5 Â&#x2021; 3257$%/( )73$1(/6 :,1'%5($.3$1(/6 Â&#x2021; 48$17,7< 2) *$7(6  3$1(/6 Â&#x2021; 5281' %$/( )(('(56 Â&#x2021; 523,1*  :(67(516$''/(6Â&#x2021;3$/&2&$77/( &+87( Â&#x2021; 1(: 6,1*/( '5,9,1* +$51(66Â&#x2021;75$,/(502817('*5$,1 52//(5 Â&#x2021;1(: +2//$1' 648$5( %$/(5 6+23722/6 &203/(7(/,1(2)6+23(48,30(17

could show her photo to people in downtown Toronto, Taber or Tisdale and only the most serious of soccer fans would have a clue who she is. With the Canadian teamâ&#x20AC;&#x2122;s profile at the London Olympics, though, that could change. â&#x20AC;&#x153;I think what you will see this summer ... is that her profile will continue to increase,â&#x20AC;? said Peter Montopoli, general secretary of the Canadian Soccer Association, in a CBCsports. com story. â&#x20AC;&#x153;I do believe she is deserving of a Canadian athlete of the year award and it is coming,â&#x20AC;? he said. â&#x20AC;&#x153;Itâ&#x20AC;&#x2122;s always difficult on a team sport that plays internationally and sometimes is not on TV to gain that exposure. â&#x20AC;&#x153; An Olympic gold, silver or bronze medal will certainly bring that exposure and then all of Canada will know about the greatness of Christine Sinclair. â&#x20AC;˘ Greg Cote of the Miami Herald: â&#x20AC;&#x153;Pittsburgh Penguins risked signing

Sidney Crosby to a 12-year, $104 million contract extension. The good news? If his serious concussion problems continue, maybe heâ&#x20AC;&#x2122;ll forget heâ&#x20AC;&#x2122;s owed all that money.â&#x20AC;? â&#x20AC;˘ Bill Scheft, writer for the Late Show with David Letterman: â&#x20AC;&#x153;Katie Holmes is going to take some time for herself, but she needs to be dating A-Rod by Sept. 1 to be eligible for the playoffs.â&#x20AC;? â&#x20AC;˘ Cote again: â&#x20AC;&#x153;Dennis Rodman says he wants to coach a topless womenâ&#x20AC;&#x2122;s basketball team at a New York City gentlemanâ&#x20AC;&#x2122;s club. Players need not be adept at dribbling, but bouncing is a plus.â&#x20AC;? â&#x20AC;˘ Comedy writer Jim Barach: â&#x20AC;&#x153;Phil Mickelson and the former Dodger owning Oâ&#x20AC;&#x2122;Malley family are teaming up to try to buy the San Diego Padres. In a related story, Tiger Woods and John Daly have put in a bid for the San Diego location of the Body Shop strip club.â&#x20AC;? â&#x20AC;˘ R.J. Currie of sportsdeke.com: â&#x20AC;&#x153;CFL referee Andre Proulx suffered a mild

:HGQHVGD\$XJ /HJLRQ+DOOWK6WUHHW (VWHYDQ6.

%R[(VWHYDQ6.6$$ 3K       /LFHQVHG%RQGHG ,QVXUHG3/

ZZZPDFNDXFWLRQFRPSDQ\FRP Floor Lamps

LET THERE BE

LIGHT

heart attack. Three possible causes: 1. Ricky Ray in an Argos uniform; 2. He got a raise; 3. Rod Black pronounced his name correctly.â&#x20AC;? â&#x20AC;˘ Currie again: â&#x20AC;&#x153;I just saw a replay of a home-runsaving grab by Angel sensation Mike Trout. Probably not the last time Trout is the catch of the day.â&#x20AC;? â&#x20AC;˘ Dwight Perry of the Seattle Times: â&#x20AC;&#x153;Greg Reid, Florida Stateâ&#x20AC;&#x2122;s star punt returner, has been charged with possession of marijuana. In other words, his game pants and his rap sheet are both sporting grass stains.â&#x20AC;? â&#x20AC;˘ Steve Simmons of Sunmedia: â&#x20AC;&#x153;The NHL wants the players to take an 11 per cent cut in revenues. So, I presume, ticket prices will be cut 11 per cent across the board. â&#x20AC;&#x153; â&#x20AC;˘ Cote again, on the Tour de France: â&#x20AC;&#x153;Winner used to be first one to pass the finish line. Now itâ&#x20AC;&#x2122;s first one to pass a urine test.â&#x20AC;? â&#x20AC;˘ Dan Le Batard of the Miami Herald, on LeBron James answering his critics: â&#x20AC;&#x153;If Iâ&#x20AC;&#x2122;m in LeBron Jamesâ&#x20AC;&#x2122;s shoes, Iâ&#x20AC;&#x2122;m going to have a hard time not putting that championship ring on my middle finger.â&#x20AC;? â&#x20AC;˘ Another one from Perry: â&#x20AC;&#x153;The Vatican is reportedly $19 million in the red. David Stern immediately offered to make it an honorary NBA franchise.â&#x20AC;? â&#x20AC;˘ David Letterman: â&#x20AC;&#x153;O.J. Simpson celebrated his birthday with some friends in prison, and they had a nice little party for him. Out of habit, after he cut the cake, he hid the knife.â&#x20AC;? â&#x20AC;˘ Brad Dickson of the Omaha World-Herald: â&#x20AC;&#x153;At tryouts for the new Omaha Lingerie Football League team, candidates were judged on their passing, running and catching skills. Yes, and Miss Universe is chosen for her knowledge of algebra.â&#x20AC;? Care to comment? Email brucepenton2003@ yahoo.ca

Traditional

Contemporary

Brighten up your home with lamps from

Desk Lamps

Room by Room

Table Lamps

Furniture

WK6WUHHW(VWHYDQÂ&#x2021;3KRQH 'HVLJQLQJ2QH5RRPDWD7LPH )5(('(/,9(5<Â&#x2021;,17(5(67)5((),1$1&,1*$9$,/$%/(2$& ZZZURRPE\URRPIXUQLWXUHQHW

Come see our wide selection of lighting solutions!


THE TRADER EXPRESS, FRIDAY, JULY 20, 2012

Page 11

Penn State football program in danger National WINNIPEG - Winnipeg quarterback Buck Pierce tore ligaments and a muscle in his left foot. Pierce was knocked out of action early as Winnipeg went down 42-10 to the Edmonton Eskimos on Friday. Blue Bombers general manager Joe Mack released a statement today outlining the injury. He says Pierce is expected to be in a walking boot for at least the next week but will be back as soon as possible. Backup Alex Brink will start Wednesday in Toronto against theArgonauts (1-2) as Winnipeg (0-3) looks for its first win of the season. *** EDMONTON - With five races to go, Will Power says he can still beat Ryan Hunter-Reay and win the IndyCar championship â&#x20AC;&#x201D; but the margin for error is near zero. â&#x20AC;&#x153;I feel Iâ&#x20AC;&#x2122;m a contender, I really do,â&#x20AC;? said Power Tuesday in a conference call. â&#x20AC;&#x153;I feel like if we get everything right in the next five races we have a legitimate chance of winning the championship. The season is turning into a dreaded case of deja vu for Power, from Toowoomba, Australia. He narrowly lost the points championship to Dario Franchitti in 2010 and 2011 only to see Franchitti fall back to eighth this year, but have Hunter-Reay take his place. Power has been dominant in the Alberta capital, winning last yearâ&#x20AC;&#x2122;s event on the new 2.2-mile, 13-turn temporary street course at the City Centre Airport. He also won it in 2009. In 2010, he started on pole and finished second.

*** TORONTO - Toronto FC is on the lookout for help at forward in the wake of Danny Koevermansâ&#x20AC;&#x2122; season-ending knee injury. Head coach Paul Mariner had been after a veteran defender to help boost his backline. But Koevermansâ&#x20AC;&#x2122;injury has left the 4-11-4 team thin up front. Mariner says realistically he does not expect Koevermans back until next May. The immediate plan is to move rookie Luis Silva up front with Jamaican international Ryan Johnson. International NEWYORK, N.Y. - The president of the NCAA says he isnâ&#x20AC;&#x2122;t ruling out the possibility of shutting down the Penn State football program in the wake of the Jerry Sandusky child sex abuse scandal. In a PBS interview Monday night, NCAA President Mark Emmert said he doesnâ&#x20AC;&#x2122;t want to â&#x20AC;&#x153;take anything off the tableâ&#x20AC;? if the NCAA determines penalties against Penn State are warranted. Emmert said heâ&#x20AC;&#x2122;s â&#x20AC;&#x153;never seen anything as egregious as this in terms of just overall conduct and behaviour inside a university.â&#x20AC;? He added, â&#x20AC;&#x153;What the appropriate penalties are, if there are determinations of violations, weâ&#x20AC;&#x2122;ll have to decide.â&#x20AC;? The last time the NCAA shut down a football program with the so-called â&#x20AC;&#x153;death penaltyâ&#x20AC;? was in the 1980s, when SMU was forced to drop the sport because of extra benefits violations. After the NCAA suspended the SMU program for a year, the school decided not to play in 1988, either, as it tried to regroup. â&#x20AC;&#x153;This is completely dif-

ferent than an impermissible benefits scandal like (what) happened at SMU, or anything else weâ&#x20AC;&#x2122;ve dealt with. This is as systemic a cultural problem as it is a football problem. There have been people that said this wasnâ&#x20AC;&#x2122;t a football scandal,â&#x20AC;? Emmert said. â&#x20AC;&#x153;Well, it was more than a football scandal, much more than a football scandal. It was that but much more. And weâ&#x20AC;&#x2122;ll have to figure out exactly what the right penalties are. I donâ&#x20AC;&#x2122;t know that past precedent makes particularly good sense in this case, because itâ&#x20AC;&#x2122;s really an unprecedented problem.â&#x20AC;? *** NEWARK, N.J. - Scott Stevens, a longtime New Jersey captain and defenceman, was named an assistant coach by the Devils on Tuesday. Stevens, who was inducted into the Hockey Hall of Fame in 2007, was the first player to have his jersey retired by the Devils. His No. 4 hangs from the rafters at the Prudential Center, next to Scott Niedermayer (No. 27) and Ken Daneyko (No. 3), also defencemen who joined Stevens in leading New Jersey to three Stanley Cup titles (1995, 2000, and 2003). New Jersey also named Matt Shaw an assistant. They will replace Adam Oates, who took the head coaching position with the Washington Capitals, and Larry Robinson, who left for an associate coaching job with the San Jose Sharks. New Jersey, a No. 6 seed in the playoffs last year, defeated the Panthers, Flyers and Rangers en route to its

fifth Eastern Conference title. The Devils lost to Los Angeles in the Stanley Cup finals. â&#x20AC;&#x153;Both Peter and I look forward to the additions of

Scott and Matt,â&#x20AC;? Devils general manager Lou Lamoriello said. â&#x20AC;&#x153;They bring experience to our coaching staff with Scottâ&#x20AC;&#x2122;s 22 years as a Hall of

Fame defenceman and five seasons as a special assignment coach, and Mattâ&#x20AC;&#x2122;s 19 seasons of coaching success at every level.â&#x20AC;?

ZZZEKJUHVVHVWHYDQFD &KHFNRXWRXUZHEVLWHIRUJUHDWLQWHULRUDQGH[WHULRU SKRWRVRIWKHSURSHUWLHVWKDWDUHOLVWHGZLWKRXUWHDP



8QLW$.LQJ6W(VWHYDQ

Letters to the Editor Today & in the Past

www.estevanmercury.ca 2-12â&#x20AC;? Family Pizzas :( '(/,9(5

 ZZZWRZHUFDIHFD

6XQGD\$XJXVW 1 12:216$/( 9RWHG(VWHYDQŇ&#x2039;V )DYRXULWH3L]]D 'RZQWRZQ(VWHYDQ

7LFNHWVFDQEHSXUFKDVHGWKURXJK 7LFNHWPDVWHURQOLQHDWKWWSWLFNHWPDVWHUFD RU7LFNHWPDVWHU&KDUJHE\3KRQHDW

(67(9$16.

facebook.com/SpectraPlace

KWWSVSHFWUDSODFHFD twitter.com/SpectraPlace


Page 12

EnergyPage

THE TRADER EXPRESS, FRIDAY, JULY 20, 2012

The

+Z\(DVW(VWHYDQ 3KRQH )D[

:HOOKHDG6\VWHPV '5,//,1*/,&(16(6

7ZHQW\IRXUOLFHQVHVLVVXHGWR)ULGD\-XO\ *6RXWKHUQ:RUNPDQ+]'' *%'2*/LJKWQLQJ+] $$ *&<&0DQRU1RUWK+]&& *%+3%0HOYLOOH  *%+3%0HOLOOH  */HJDF\HWDO9LHZÃ&#x20AC;HOG+]&' *3%(19LHZÃ&#x20AC;HOG+]&& *3%(19LHZÃ&#x20AC;HOG+]&& *3%(19LHZÃ&#x20AC;HOG+]&& *$UUXJD9LHZÃ&#x20AC;HOG+]'' *&9(HWDO:H\EXUQ8QLW,1-+] %% *3DLQWHG3RQ\)ODW/DNH+] %$ *7ULZHVW$ODPHGD+]&& *3%(19LHZÃ&#x20AC;HOG+]'' *%'2*/LJKWQLQJ6:'  *3%(1&ODULODZ:+] %% *3%(19LHZÃ&#x20AC;HOG+]&& *3EHQ9LHZÃ&#x20AC;HOG+] %% *5LR7LQWLR0RQWPDUWUH  *3%(19LHZÃ&#x20AC;HOG+] %% *3EHQ9LHZÃ&#x20AC;HOG+] $$ *+XVN\2XQJUH+]'' *+XVN\2XQJUH+]&' *(QHUSOXV&ROJDWH+]%'

5,*5(3257

%$OOLDQFH 2PDWLXVHWDO6WRUWKRDNV1RUWK+]$' %$OOLDQFH 5HQHJDGH)U\V+] %% *$GYDQFH0LGDOH6LOYHUWRQ% &&UXVDGHU 3%(1+DVWLQJV+]&% )5\GHU&3(&:DXFKRSH6:'5H  '3DUWQHU 92&HWDO0DQRU'' $% %&DQHOVRQ +LJKURFN0DQRU+] %$ ($GYDQFH3KDVHHWDO0DQRU  (%LJ6N\$UF3DUNPDQ9,8+]'' )1DERUV0RVDLF.,(VWHUKD]\6:'  *&DQHOVRQ .LQZHVW$ODPHGD+] %% )(QVLJQ+DUYHVW:KLWHEHDU+]&' /$NLWD %+3%0HOYLOOH  )%HWWV (ONKRUQ1RUWKJDWH+]'$ '9RUWH[7ULZHVW$/DPHGD+] %$ (3UHFLVLRQ5HQHJDGHHWDO&U\VWDO+LOO+]&& )&KDPSLRQ &15/HWDO$ODPHGD:HVW,1-  (&DQHOVRQ (ONKRUQ1RUWKJDWH+]'% '(QVLJQ/HJDF\6WHHOPDQ+] %% &1DERUV %+3%0HOYLOOH  &&KDPSLRQ&15/6WHHOPDQ+]&' (5HG'RJ 6RXWKHUQ:RUGVZRUWK+] $% -7ULQLGDG $UFHWDO%URZQLQJ+]$' %$OOLDQFH 6SHFWUXPHWDO.LVEH\+] $$ )&DQHOVRQ /HJDF\9LHZÃ&#x20AC;HOG+] %% $(QVLJQ /HJDF\3LQWR+]'' &(QVLJQ 3%(1.LVEH\+]&&

7+( (67(9$10(5&85< '5,//,1*5(3257 /(QVLJQ 3%(19LHZÃ&#x20AC;HOG+] %% '(QVLJQ 3%(19LHZÃ&#x20AC;HOG+]'' %(QVLJQ 3%(19LHZÃ&#x20AC;HOG+]&% )1DERUV 375&,1-  &(QVLJQ 3%(19LHZÃ&#x20AC;HOG+]'& ((QVLJQ 3%(19LHZÃ&#x20AC;HOG+]&% )(QVLJQ 3%(19LHZÃ&#x20AC;HOG+]'' (6D[RQ:LOOLVWRQ+XQWHU7DEOHODQG+]&% %&UXVDGHU %D\WH[7DEOHODQFH+] %% (3DQWKHU:LOOLVWRQ+XQWHU7DEOHODQG+] $$ %9RUWH[ 3DLQWHG3RQ\9LHZÃ&#x20AC;HOG+] $$ '+RUL]RQ $SDFKH0LGDOH8QLW+]'$ (3DQWKHU +XVN\2XQJUH+] %% (3UHFLVLRQ +XVN\2XQJUH+]%' '3UHFLVLRQ&9(HWDO:H\EXUQ8QLW,1-+]&% '(QVLJQ (QHUSOXV1HSWXQH+]%' '+RUL]RQ3DLQWHG3RQ\)ODW/DNH  '1DERUV 9DOH3LDSRW&&

:$,7,1*21352*5$0

'%'2*3DUNPDQ '3HPRFR3DUNPDQ % %0RVDLF.(VWHUKD]\:6: (0RVDLF(VWHUKD]\(+ *5HOLDEOH:DZRWD (%'2*0DLU6:' .3RVWHOOHWDO:RUNPDQ %+LJKURFN5\HUVRQ /4XHVWHUUHHWDO5\HUVRQ+] &' .(SSLQJHWDO%HOOHJDUGH6:' %4XHVWHUUHDWDOO)U\V(DVW'' %& &2SHQÃ&#x20AC;HOG0DQRU &%+3%0HOYLOOH -7ULZHVW$ODPHGD(DVW6:' +.LQZHVW$ODPHGD %(ONKRUQ1RUWKJDWH+] '$ .&3(&%URZQLQJ+] && -&3(&9LHZÃ&#x20AC;HOG+] $' &6SHFWUXPHWDO9LHZÃ&#x20AC;HOG+] $& &&3(&9LHZÃ&#x20AC;HOG+]%% .&3(&9LHZÃ&#x20AC;HOG+] && %&3(&9LHZÃ&#x20AC;HOG+] %& $&3(&9LHZÃ&#x20AC;HOG+] && )&3(&9LHZÃ&#x20AC;HOG+]%$ %&3(&9LHZÃ&#x20AC;HOG+] &% .&3(&9LHZÃ&#x20AC;HOG+]$% %&3(&9LHZÃ&#x20AC;HOG+] &% (&3(&+RIIHU+]$$ $&3(&+RIIHU+]%$ %$UF7ULEXQH (&3(&+RIIHU+]$$ $5LR7LQWR6HGOH\ %6SDUWRQ&H\ORQ .3%(13DQJPDQ'' %' '3DVVSRUW0LQWRQ+] &$

Industry Safety Training

www.southeastcollege.org

Skid Control Training (1/2 day theory, 1/2 day practical)

ATCHEWA SK

Y

ITU TE ST

E N E RG

TR

N

SA

Our full-size SUV and a state-of-the-art SKIDCAR system is designed to evaluate your driving skills and practice different skid control maneuvers. The theory portion includes topics such as driving on gravel roads, winter roads, 4x4, fatigue management, texting, DFMMQIPOFT wildlife, collision avoidance, and substance abuse.

AI N I N G I N

SASKATCHEWAN ENERGY TRAINING INSTITUTE

To schedule a course for your employees, please contact Ken, Paula, or Faye toll-free at 1-866-999-7372

A demo of our SKIDCAR simulator can be seen on Visit www.youtube.com/user/SoutheastCollege

CHECK US OUT ON THE WEB www.estevanmercury.ca


THE TRADER EXPRESS, FRIDAY, JULY 20, 2012

Page 13

New Regina stadium a go at Evraz

The

EnergyPage

This has been one fun summer! The highlight of the heat wave came this past Saturday at Mosaic Stadium where, just before the Roughridersâ&#x20AC;&#x2122; first-place showdown with the B.C. Lions, Saskatchewan Premier Brad Wall announced the new stadium in Regina is a â&#x20AC;&#x153;go.â&#x20AC;? The Riders expect to move into their new home at Evraz Place, about 300 yards to the west of the current stadium, in 2017. Then the Riders went out and knocked off the defending Grey Cup champions 23-20 to become the only undefeated team in the CFL at 3-0. The highlight of the game was a 129-yard missed field goal return by Tristan Jackson, a Rider franchise record, which provided the winning points in the fourth quarter. To me, leadership is saying something positive is going to happen, then going out and doing it. Earlier in the week, Rider coach

Rod Pedersen Rider Insider Corey Chamblin mentioned there hadnâ&#x20AC;&#x2122;t been a return touchdown for this team since 2007 and felt it was time that changed. Then it happened. Jackson smiled on our post-game show when he said, â&#x20AC;&#x153;I wasnâ&#x20AC;&#x2122;t even touched!â&#x20AC;? Jackson also admitted that he was very upset earlier in the week when informed by Chamblin that he wonâ&#x20AC;&#x2122;t be allowed to return kicks AND patrol the corner like he did in 2011. Chamblinâ&#x20AC;&#x2122;s reasoning is that he wants to keep â&#x20AC;&#x153;TJackâ&#x20AC;? fresh, and use all 42 guys on the bench. Then, the very next game, Jackson enters the record book and wins the game. Leadership. Vision. Confidence. It reminds me of Bob Poleyâ&#x20AC;&#x2122;s legendary story about their game-winning drive in the 1989 Grey Cup.

In the huddle Kent Austin said, â&#x20AC;&#x153;Guys, weâ&#x20AC;&#x2122;re gonna march it down the field, Ridge is gonna kick a field goal to win this thing and weâ&#x20AC;&#x2122;re gonna get out of here with the Grey Cup.â&#x20AC;? It happened exactly the way Austin said it would. So far the similarities between the young coaching careers of Chamblin and Austin are eerily similar. Theyâ&#x20AC;&#x2122;re so obvious I donâ&#x20AC;&#x2122;t even need to point them out, but as each week goes by, weâ&#x20AC;&#x2122;re starting to see a difference in their methods. Austin, on his way to a Grey Cup win in his rookie season on the Rider sidelines and Coach of the Year honours in 2007, never really relied on gimmicks. His pre-game speeches were legendary and held the team in the palm of his hand each time he spoke. Chamblin goes a little deeper. Heâ&#x20AC;&#x2122;s been showing his team videos of past Grey Cup wins and playoff losses. Last week he printed over-sized game tickets

for each coach and player called â&#x20AC;&#x153;the Big Ticketâ&#x20AC;? against B.C.â&#x20AC;? The next day he trash talked the Lions

by calling them a â&#x20AC;&#x153;mouthy bunch.â&#x20AC;? Then they silenced the cats on game day.

Austin was 2-1 at this point while Chamblin is 3-0. How far does it go?

â&#x20AC;˘ Souris Valley Pipeline Limited operates a High Pressure Carbon Dioxide Pipeline in Southeast Saskatchewan, a component of the gas is Hydrogen SulĂ&#x20AC;de (H2S). â&#x20AC;˘ As a member of Sask 1st Call, Souris Valley Pipeline would like to remind you to call Sask 1st Call at 1-866828-4888. â&#x20AC;˘ Statistics show that a signiĂ&#x20AC;cant cause of pipeline ruptures is due to third party damage.

Midale

For pipeline safety concerns or emergencies call toll free 1-866-PIPELINE (1-866-7473546) Before excavating call Sask 1st Call at 1-866-828-4888 for a free locate. SOURIS VALLEY PIPELINE LTD. 24 HOUR PHONE SERVICE

1-866-747-3546

SOURIS VALLEY PIPELINE LIMITED 26 12th Street, N.E. Weyburn, Sk. Canada S4H 1K2 Phone: 306-848-0206 Fax: 306-848-0293

I \ 6DIHW\ (QYLURQPHQWDO6HUYLFHV

ELECTRICAL CONSTRUCTION, MAINTENANCE & SERVICE PLCâ&#x20AC;&#x2122;S, VFDâ&#x20AC;&#x2122;S BATTERY CONSTRUCTION TRENCHING MOTOR SALES & REPAIRS Enform COR CertiĂ&#x20AC;ed 24 HOUR SERVICE 62 DEVONIAN ST. ESTEVAN, SK.

PH: 637-2180 FAX: 637-2181

)LUHĂ&#x20AC;JKWLQJ7UDLQLQJ :LOOWUDLQDW\RXUORFDWLRQE\DSSRLQWPHQW

367,537UDLQLQJ 3LSHOLQH&RQVWUXFWLRQ $YDLODEOHE\DSSRLQWPHQW

-XO\ 6XQ0RQ7XH:HG7KX)UL6DW 



 +6 /DPSPDQ

 &RQILQHG6SDFH /DPSPDQ

 *OREDO*URXQG 'LVWXUEDQFH /DPSPDQ









 )LUVWDLGFSUDHG /DPSPDQ 

$XJXVW  )LUVWDLGFSUDHG /DPSPDQ&RQWÂś







$XJXVW

-XO\&RQWUDFW

&ORVLQJSULFHDVRI 0RQGD\-XO\



 6SRQVRUHGE\

6XQ0RQ7XH:HG7KX)UL6DW 



-XO\ )LUVWDLGFSUDHG /DPSPDQ

 )LUVWDLGFSUDHG /DPSPDQ&RQWÂś

 &RQILQHG6SDFH /DPSPDQ







 67$7+2/,'$<

 

 )DOO3URWHFWLRQ /DPSPDQ











 +6 /DPSPDQ

 )LUVWDLGFSUDHG /DPSPDQ

  )LUVWDLGFSUDHG /DPSPDQ&RQWÂś  *URXQG'LVWXUEDQFH /DPSPDQ







 5LJJLQJ +RLVWLQJ /DPSPDQ

 &RQILQHG6SDFH /DPSPDQ

 )LUH([WLQJXLVKHU /DPSPDQ









 +6 /DPSPDQ

 )DOO3URWHFWLRQ /DPSPDQ







 86'2//$56

2LOĂ&#x20AC;HOG(OHFWULFDO &RQVWUXFWLRQ 6HUYLFH

3UHUHJLVWUDWLRQ LV UHTXLUHG IRU DOO FRXUVHV &DQFHOODWLRQ QRWLFH LV UHTXLUHG  +UVLQDGYDQFH$OOQRVKRZVZLOOEH ELOOHGIRUWKHIXOOFRVWRIWKHFRXUVH

$YDLODEOHE\DSSRLQWPHQW

LOCALLY OWNED & OPERATED

&58'(2,/

$OO FRXUVHV EHJLQ DW DP XQOHVVRWKHUZLVHQRWHG

12:$9$,/$%/(

,QVWUXPHQWDWLRQ 0RWRU6DOHV5HZLQGV 5HSDLUV .HQVLQJWRQ$YH(VWHYDQ6.

  +2856(59,&(

7R5HJLVWHU&DOO7ULFLD# (PDLOWVWLQVRQ#Ă LQWHQHUJ\FRP


Page 14

THE TRADER EXPRESS, FRIDAY, JULY 20, 2012

9LOODJHRI5RFKH3HUFHH 7(1'(5 6DOYDJHRI0HWDO5RRĂ&#x20AC;QJIURP5HFUHDWLRQ&HQWUH 7(1'(56SURSHUO\PDUNHGDV´5RRĂ&#x20AC;QJ6DOYDJHÂľZLOOEHUHFHLYHGE\ 7KH9LOODJHRI5RFKH3HUFHH /\QGRQ6WDFKRVNL$GPLQLVWUDWRU 32%R[ %LHQIDLW6. 6&0 6XEPLVVLRQVPXVWEHUHFHLYHGQRODWHUWKDQSPRQ-XO\ 6FRSHRI:RUNLQFOXGHVUHPRYDORIDOOPHWDOURRĂ&#x20AC;QJIURPWKH9LOODJHRI 5RFKH3HUFHH5HFUHDWLRQ&HQWUHSULRUWRGHPROLWLRQRIWKHVXEMHFWEXLOGLQJ $OOPHWDOURRĂ&#x20AC;QJPDWHULDOVZLOOEHFRPHWKHSURSHUW\RIWKHVXFFHVVIXOELGGHU 8QOHVVSUHYLRXVO\DUUDQJHGZLWKWKH9LOODJHDOOVXFKPDWHULDOVZLOOEHUH TXLUHGWREHUHPRYHGIURPWKHVLWHGLUHFWO\IROORZLQJUHPRYDO 7KHORZHVWRUDQ\WHQGHUZLOOQRWQHFHVVDULO\EHDFFHSWHG )XUWKHULQIRUPDWLRQLVDYDLODEOHFDOOWKH9LOODJH2IĂ&#x20AC;FHDW3URSRVDO PD\DOVREHVXEPLWWHGE\HPDLOWRYLOODJHRIURFKHSHUFHH#VDVNWHOQHWRUYLD ID[DW

0LGDOH2LOPHQ¡V$VVRFLDWLRQ 2012 Golf Tournament

)ULGD\-XO\ 0DLQSUL]H*ROI&RXUVH

Once again, this yearâ&#x20AC;&#x2122;s tournament is a one day event. The format is two-person scramble, with a horse race involving the top 5 teams, to follow. The tournament is open to all that want to attend (yes, that means you ladies). All we ask is that one person on your team is employed in the Oil Industry. * * * * * * * * *

Registration 8:45 A.M. to 9:45 A.M. 3OHDVHDUULYHHDUO\WRDYRLGOLQHXSV

Shotgun Start at 10:00 A.M. 18 holes of golf at Mainprize Golf Course Free â&#x20AC;&#x153;Beer & Foodâ&#x20AC;? holes BBQ ribs supper after round (extra supper tickets available at $25.00 each) The horse race will be alternate shot with cash prizes for the to teams â&#x20AC;&#x153;Hole-In-Oneâ&#x20AC;? sponsored holes - Major Prizes Entry fee of $100.00/person Putting competion during the round

)25025(,1)2&217$&7 'DUUHQ0ROGHQKDXHU  FHOO  UHV RU &DWULQD0ROGHQKDXHU  FHOO  UHV

Fun At The Beach

Kids participated in a sandcastle building competition as part of the activities for the Woodlawn Regional Parkâ&#x20AC;&#x2122;s 50th anniversary celebration at Boundary Dam beach.

)RU6DOH 7UDLOHUVDOHVFRPSDQ\ZLWKDSSUR[LPDWHO\PLOOLRQ GROODUVSHU\HDULQVDOHV/RFDWHGLQWKHSURVSHURXV RLOULFK6(FRUQHURI6DVNDWFKHZDQ6HOOLQJWKHZHOO PDGHZHOOUHVSHFWHGKHDY\GXW\OLQHRI3-7UDLOHUV LQFOXGLQJXWLOLW\GXPSFDUKDXOHUHTXLSPHQWWLOW GHFNRYHUĂ DWGHFNDQGJRRVHQHFNWUDLOHUV%DFNKRH IRUXQORDGLQJWUDLOHUVLQFOXGHG:HDOVRKDYHWKHKLJK HQGDOODOXPLQXPIUDPH/LJKWQLQJHQFORVHGFDUJR WUDLOHUV0DQ\UHSHDWDQGZHOOHVWDEOLVKHGFXVWRPHUV /RWVRIRSSRUWXQLW\WRH[SDQGDQGJRLQWRRWKHUOLQHV RIVDOHV:LOOVHOOIRU WLPHVQHWLQFRPHSOXV LQYHQWRU\DQGSDUWVDW FRVW6DOHVDQGSURĂ&#x20AC;WV KDYHLQFUHDVHG VXEVWDQWLDOO\HDFK\HDU 5HDVRQIRUVHOOLQJ 5HWLULQJ

&DOO/HRQDUGDW IRU PRUHGHWDLOV

7.7UDLOHU6DOHV

0DQRU6DVN3K ZZZSMWUDLOHUVFRP


THE TRADER EXPRESS, FRIDAY, JULY 20, 2012

Page 15

Little League elbow is overuse injury

DEAR DR. DONOHUE: My 12-year-old son is something of a phenomenon when it comes to baseball, and he loves playing the game. I havenâ&#x20AC;&#x2122;t pushed him into it. Heâ&#x20AC;&#x2122;s a particularly awesome pitcher, and his coaches are amazed at what he can do. I practice with him every day. He now has a sore elbow in his pitching arm. I think it might be Little League elbow. My wife blames me, because, she says, I overwork him. I need some guidelines on how much throwing is too much. Thanks. -- R.C. ANSWER: The elbow is a site thatâ&#x20AC;&#x2122;s a potential calamity for the immature skeleton. Children have vulnerable spots in their bones called growth plates. These bone parts havenâ&#x20AC;&#x2122;t yet become bone. They permit elongation of bones. One of those sites is the elbow. To make sure weâ&#x20AC;&#x2122;re

talking about the same thing, let the boyâ&#x20AC;&#x2122;s throwing arm hang down with his palm facing forward. Feel the area of the elbow next to the body. Thatâ&#x20AC;&#x2122;s where Little League elbow makes itself known. Itâ&#x20AC;&#x2122;s an overuse injury, meaning the boy is throwing too many pitches with too little rest. The incidence of elbow pain in young baseball players is quite high -- 20 percent to 40 percent. It can be avoided with a sensible program that limits the number of throws per day. First, your son should not throw until the pain leaves. Then he can resume throwing, but gradually do so. Eventually he can work up to the Little Leagueâ&#x20AC;&#x2122;s standards for pitching for 12-year-olds. If a boy or girl of this age throws 66 pitches in one game, the child needs four days of rest -- no throwing; if itâ&#x20AC;&#x2122;s 51 to 65 pitches, three days of rest are required; 30 to 50 pitches, two rest days; 21 to 35 pitches, one rest day. In practice, he should be limited to 20 pitches if he throws daily. It he throws more, he should follow the schedule for the number of pitches thrown in a game.

5ISQVO<QUM.TaAW]Z?Ia

If your boyâ&#x20AC;&#x2122;s pain lasts a week, have the family doctor examine him. If he really has Little League elbow, healing can take six to 12 weeks. *** DEAR DR. DONOHUE: Will you kindly tell me what is the appropriate time interval for a repeat colonoscopy? I have different information from doctors. I had my first colonoscopy when I was 51. The doctor who performed it said I didnâ&#x20AC;&#x2122;t need another until I was 61. A different doctor says I need a repeat at 56. Which is it? -- E.P. ANSWER: If no polyps were found on your first exam and if you have no close relatives who have had colon cancer, then the usual time for the next exam is 10 years. Otherwise, it is five years. The booklet on colon cancer explains its detection and treatment. Readers can order a copy by writing: Dr. Donohue -- No. 505W, Box 536475, Orlando, FL 32853-6475. Enclose a check or money order (no cash) for $4.75 U.S./$6 Canada with the recipientâ&#x20AC;&#x2122;s printed name and address. Please allow four weeks for delivery.

*** Dr. Donohue regrets that he is unable to answer individual letters, but he will incorporate them

in his column whenever possible. Readers may write him or request an order form of available health newsletters at P.O.

+ 3,==$ 1 28672

5HDO*RRG)RRG )DPLO\'LQLQJ +3/RXQJH

7+(5(¡6$/271(:$7+2867213,==$ New dine in menu

New seniors menu

 

%OLQGVRIDOONLQGV

2112:7,//$8*867 &HOOXODU6KDGHV :RRG%OLQGV

Sunday: Brunch 10 - 2 Sunday Evening Family Pizza Night Lounge Special: $1.00 off draft Monday:

All you can eat English style fish and chips Lounge Special: Margaritas & Martinis

Tuesday:

Pasta Day (buy 1 get the 2nd half price) Lounge Special: Highball Happy Hour Prices

Wednesday: Seniors Day (10% off Seniors Menu) Lounge Special - Long Island Iced Teas Thursday:

All You Can Eat Mini Ribs (available in 8 flavours) Lounge Special - Buckets of Beer (6 Domestics 2 Kinds)

Fri. & Sat.

Steak Day (AAA Angus Beef) Lounge Special Friday: Double Daz (Double It Up For A Better Deal) Lounge Special Saturday: Paralyzers

Recycle This Paper

Phone: 634-8880

+Z\6RXWK (67(9$16.  %D\+Z\ &$5/</(6. 3K

Visit us on the web! www.estevanmercury.ca

76 Souris Ave. N., Estevan Debit on Delivery Take Out Menu Available Visit our website: www.houstonpizza.ca

Green Thumb? See Us For All Your Gardening Tools & Landscaping Needs

Scotts Fertilizer

Weedpro - landscaping fabric 368-6319

$

3825 $ 00 19.8 kg 50 12.79 kg

1199

3 piece Diamond Back Rain Suit medium - XXXL

5ROOHU6KDGHV 5RPDQ6KDGHV

$1'025(

New wine menu

Daily Specials Restaurant & Lounge

3â&#x20AC;&#x2122; x 100â&#x20AC;&#x2122;

%,*6$/(

New martinis & margaritas

New facebook page! Check it out; click â&#x20AC;&#x2DC;likeâ&#x20AC;&#x2122; and get in on the fun. (www.facebook.com/Houston-Pizza-Estevan)

5($/Â&#x2021;*22'Â&#x2021;)22' ?M 7NNMZ KPIZ\MZ IQZ [MZ^QKM _Q\P [INM\a IVL XI[[MVOMZ KWUNWZ\ I[ W]Z PQOPM[\XZQWZQ\a

Box 536475, Orlando, FL 32853-6475. (c) 2012 North America Synd., Inc. All Rights Reserved

Tomato Cages

$

1999

$ 00

Vulcan Push Fertilizer Spreader 9770587 Regular: $86.99 Now:

$

$

5562

2

7KLQNLQJZLQGRZV" 6KRSDQGFRPSDUH

,QVLVWRQ&:'ZLQGRZVDQGGRRUV 39&:LQGRZV0HWDOFODGZLQGRZV 3DWLRDQGJDUGHQGRRUV,QVXODWHGVWHHOGRRUV

&DOOIRUFRPSDUDWLYHSULFLQJ

:22'&28175< (67(9$10&/($17,6'$/( 3K  Â&#x2021;)D[  Â&#x2021;.HQVLQJWRQ$YHQXH(VWHYDQ +RXUV0RQ)ULDPSP6DWDPSP

VISIT US ON OUR WEBSITE: www.wood-country.com

0HWDO&ODGGLQJ 0DQ\W\SHV SURĂ&#x20AC;OHVDYDLODEOH 1RZVWRFNLQJYDULRXVOHQJWKVRI *DOYDOXPH ZKLWHZKLWHPHWDO )DUPDQGLQGXVWULDOJDOYDQL]HGJDOYDOXPHDQGFRORXUHG  JDXJHPHWDORUGHUHGWRVXLW\RXUVL]HDQGQHHGV 3KRQHIRUSULFLQJZLWK\RXULQGLYLGXDOUHTXLUHPHQWV


Page 16

THE TRADER EXPRESS, FRIDAY, JULY 20, 2012

Hog Wild

Racers in the Estevan Drag Racing Association bike/sled class get ready to go at the municipal airport.

Polynesian Drumsticks A quick marinade adds a sweet and tangy glaze to grilled skinless drumsticks -- a favorite with everyone in the family. 1 can (8 ounces) crushed pineapple in unsweetened pineapple juice 1/4 cup (packed) brown sugar 3 tablespoons soy sauce

1 tablespoon (grated) fresh ginger, peeled 1 clove garlic, crushed with press 12 (about 4 pounds) chicken drumsticks, skin removed 1. In blender, puree pineapple with its juice and remaining ingredients except drumsticks. Spoon 1/2 cup pineapple mixture into large self-sealing plastic bag; reserve remaining pineapple

Thank You! )YPZ[V^7YVQLJ[Z :HZRH[JOL^HU3[K IRUSXUFKDVLQJP\VWHHUDWWKH (VWHYDQUHJLRQDOV

&DUWHU*RXG\ 6WRXJKWRQ&URVVURDGV +FOXE

THANK YOU! 7UREHUW/DZ)LUP IRUSXUFKDVLQJP\+VWHHU

-DFNVRQ*RXG\

6WRXJKWRQ&URVVURDGV +&OXE

mixture for grilling. Add drumsticks to bag, turning to coat. Let stand at room temperature 15 minutes. 2. Remove drumsticks from bag; discard bag with marinade. Place drumsticks on grill over medium heat and cook 15 minutes, turning over once. Cook drumsticks 10 to 15 minutes longer, or until drumsticks are golden and juices run clear when thickest part is pierced with tip of knife, brushing twice with reserved pineapple mixture and turning occasionally. Serves 4. Ă&#x2018; Each serving: About 260 calories, 8g total fat (2g saturated), 123mg cholesterol, 385mg sodium, 8g carbohydrate, 0g dietary fiber, 38g protein.

','<285 9(+,&/( *(7+,7%<

+$,/" +$,/5(3$,563(&,$/,67

LVUHWXUQLQJWR0XUUD\*0(VWHYDQ

%HDWWKHUXVK&$//72'$< $//0$.(6 $1'02'(/6

For thousands of tripletested recipes, visit our website at www.goodhousekeeping.com/recipefinder/.

801 13th Ave., ESTEVAN Ph: 634-3661

(c) 2012 Hearst Communications, Inc. All rights reserved

ASK FOR JACKIE

&+(9Â&#x2021;%8,&.Â&#x2021;*0&

$9$,/$%/()259,(:,1* ([FOXVLYHO\/LVWHGE\

)(@4,(+6>3(5+05.

&$//72'$<  ZZZEKJUHVVFD

7RZQKRXVHV SULFHGIURP

 6 8 ( 2 +  1 ( 23

8QLW$.LQJ6W(VWHYDQ

-8/< $030

6WRSE\WRWDNHDORRNDW WKHVHJUHDWQHZSURSHUWLHV (QMR\XSWRIRXUEHGURRPVDQGVTXDUHIHHWRIOLYLQJ VSDFHLQWKHVHJRUJHRXVQHZORFDOO\EXLOWWRZQKRPHV

$VKZRUWK)DUP 5DQFK IRUSXUFKDVLQJP\+6WHHU

%LOO\*RXG\ 6WRXJKWRQ&URVVURDGV +&OXE

ZZZVXQYDOOH\GULYHEKJUHVVFD

2XUDJHQWVDUHUHDG\WRPDNHWKHVHFRQGRV\RXUQHZKRPH

-DPLH '\HU 

0HODQLH 3HWHUV 

/LVD 0RQWH\QH 

0LNH 'H%UX\QH 

-DFNLH )LW]VLPPRQV 

/RUL *RQDV 

.HQ 5RZDQ  SDUWWLPH

0HLJDQ *HGDN  SDUWWLPH

-RVK /H%ODQF  SDUWWLPH


THE TRADER EXPRESS, FRIDAY, JULY 20, 2012 7+(75$'(5)5,'$<$8*867

6287+($6775$'(5

(;35(66



Page 17 3DJH

3OHDVHXVHWKHKDQG\IRUP IRXQGRQWKH&ODVVLILHG SDJHVWRVXEPLW\RXUDG IN MEMORIAM ANTON DEREN June 7, 1925 - July 24, 2011 If I could write a story It would be the greatest ever told Of a kind and loving father Who had a heart of gold I could write a million pages But still be unable to say, just how Much I love and miss him Each and every single day I will remember all he taught me Iâ&#x20AC;&#x2122;m hurt but wonâ&#x20AC;&#x2122;t be sad Because heâ&#x20AC;&#x2122;ll send me down the answers And heâ&#x20AC;&#x2122;ll always be MY DAD AND GRAMPA - Always remembered, forever loved, Carolyn, Susan, Karen and families ANTON DEREN I have only just lost you, the pain is hard to bear Do I have to go through life knowing youâ&#x20AC;&#x2122;re not there Please, some one, explain to me why he had to go Are there any reasons, I really need to know I sit here and remember all the lovely times we shared The talks, the laughter of every one you cared I am told the pain will ease in time And I will think of him without a tear But that will be impossible as I need to have him here He was my very world to me, my ever guiding star Just kiss me softly on the cheek and tell me where you are - Missing you, Love Rosemary

Mike Gonas July 23, 2007 Even though our loved one has gone, In our hearts we will smile and remember. We know that someone who has been loved is never forgotten. - Love Always, your wife Nellie; children, Shirley, Michael, Debbie, Dennis and Families.

In Loving Memory of Syl Knievel 1943 - July 23, 2010 Papa and His Girlies Though your smile is gone forever And your hand we cannot touch Still we have so many memories Of the one we loved so much. Your memory is our keepsake With which weâ&#x20AC;?ll never part God has you in His keeping And we have you in our hearts. - Ever missed and loved, Carol, Anita & Tyson, Chris & Donna, Jeff, Adrian and grandchildren.

Find it all in the Classifieds!

COMING EVENTS

PSYCHICS

MOBILE/ MANUFACTURED

TRUE Advice! TRUE Clarity! TRUE PSYCHICS 1-877-342-3032 or 1-900-528-6256 or Mobile #4486 (18+) 3.19/min. www.truepsychics.ca

At the Southeast Trader Express Pay Full Price for a CLASSIFIED in SOUTHEAST TRADER

EXPRESS

SERVICES FOR HIRE NEED A HOME PHONE? Cable TV or High Speed Internet? We Can Help. Everyone Approved. Call Today. 1-877-852-1122 Protel Reconnect

Repeat the Same Ad in the

Estevan

Mercury

HOUSES FOR SALE

www.estevanmercury.ca

GAT E WAY F E ST I VA L BENGOUGH JULY27-29 BIG WRECK JORDAN COOK GEORGE CANYON HEY ROMEO etc. tickets Bengough Drugs Assiniboia Escape Salon ROCHE PERCEE TRAIL RIDE & WAGON TREK August 10, 11, 12, 2012 634-4380 ~ 634-2432 jacobs@sasktel.net

FOR SALE BY OWNER: Character House, 713 - 3rd Street. 4 Bedrooms, 3 baths, 6 appliances, central air and vac, new windows and water heater, newer fur nace, some furnishings. Living space 1,800 sq. ft. Asking $269,900. Open House - Saturday, July 21, 10 a.m. - 4 p.m. Viewing by appointment, Call Carole: 634-5720.

TOWNHOUSES FOR SALE FOR SALE. WARMAN 55 PLUS AC T I V E A D U LT L I F E ST Y L E Large Ground Level Townhomes 306 241 0123 www.diamondplace.ca

OUT OF TOWN

You are invited to join the family of Betty Eagles to celebrate with us, her 80th Birthday! Come and Go Afternoon will be held on Sunday, July 22nd from 2:00 p.m. to 5:00 p.m. at the Farm of Don Bachorcik and Berry Eagles Please, your Presence, but no Presents!

HEALTH SERVICES Alcohol and drug treatment shows you step-by-step what to do if your drinking and drugging is past the recreational phase. Today is the day to do something about it. Go to www.anguscampbellcentre.ca or call us as 306-693-5977.

LOTS & ACREAGES FOR SALE FOR SALE: 10 Acre parcels of residential land, 1.5 miles west of Estevan. Phone 634-7920 or 4211753.

PROPERTY FOR SALE

FOR SALE In Stoughton: New modular home on own lot. 3 Bedrooms, 2 baths. Vacant. $8,000 down; Payments $800/month. Must have good credit and be able to bank qualify. Phone 1-587-4348525.

FREE BROCHURE Kings County - â&#x20AC;&#x153; Land of Orchards, Vineyards & Tidesâ&#x20AC;? - Nova Scotiaâ&#x20AC;&#x2122;s beautiful Annapolis Valley. Live! Work! Star t Business! - Toll-Free: 1.888.865.4647 www.kingsrda.ca

HOUSE FOR SALE in Kisbey: Approx. 1200 sq. ft. bungalow, 3 bedrooms and 1 bath upstairs, attached insulated 2-car garage, central air, well treed yard. Full sized basement with bathroom, bedroom, kitchen and living area could be used as rental income. Very nice house. $250,000. Phone 306-462-4461, 306-577-8519 or 306-577-1695.

VACATION RENTALS

APARTMENTS/CONDOS FOR RENT FOR RENT: 2 Bedroom main floor of house. Fridge, stove, washer, dr yer. No smoking; No pets. Available August 1. Phone 6347672 or 421-1898. FOR RENT: One bedroom suite. Includes fridge, stove, use of washer and dryer. Heat and water paid. Quiet or mature person. Available August 1. Phone 6349811.

WANTED TO RENT

SLIMDOWN FOR SUMMER! Lose up to 20lbs in just 8 weeks. Call Herbal Magic today! 1-800-8545176.

LOOKING TO RENT: A D o u bl e car garage in Bienfait. Can be heated. Would like to rent for 4 months to a year. Doing SGI hail damage repair on vehicles. Phone 306-565-1995 or 306-536-2650.

LOST

ROOMS

MISSING Black Lab Retriever - Calls by the name of Daisy. Went missing at Boundary Dam on July 14. Anyone with infor mation of whereabouts or where dog was last seen, please phone 634-6584 or 421-5881. Kids miss her very much. Reward Offered.

C U S T O M B U I LT R E A D Y T O MOVE HOMES: R. Barkman Constr uction, Cromer, Manitoba. Quality workmanship and materials. Please Phone Randy at 204662-4561 for Estimates and Design or Stop in to Visit Our Homes.

For

1/2 Price! Our ClassiĂ&#x20AC;ed Sale Never Ends!



Estevan Mercury & Southeast Trader Express CLASSIFIED INDEX

Engagements Wedding Annivers. Anniversaries Birthdays Announcements Prayer Corner In Memoriam Cards of Thanks Coming Events Garage Sales Memorial Services Personals Health/Beauty Lost Found Introduction Services Readings Psychics Travel Health Spas Tickets Childcare Available Childcare Wanted

SERVICES Accounting/

UPTOWN MOTEL Has rooms for rent - Daily or Weekly rates. Phone 634-2624.

FEED & SEED

MOBILE/ MANUFACTURED

HEATED CANOLA WANTED!! - GREEN CANOLA - SPRING THRASHED - DAMAGED CANOLA FEED OATS WANTED!! - BARLEY, OATS, WHT - LIGHT OR TOUGH - SPRING THRASHED HEATED FLAX WANTED!! HEATED PEAS HEATED LENTILS "ON FARM PICKUP" Westcan Feed & Grain 1-877-250-5252

Bookkeeping Appliance Repairs Auctioneers Bricklaying Building/Contracting Building Supplies Drywalling Building/Contracting Electrical Handyperson Hauling Cleaning Janitorial Landscaping Lawn & Garden Moving Painting/Wallpaper Renos/Home Improvement Roofing Snow removal Services for Hire Vacuum Services

LEGAL Notices to Creditors Assessment Rolls Tax Enforcement Tenders Notices/Nominations Legal/Public Notices Judicial Sales Houses for Sale Apts./Condos for Sale Out of Town Cabins/Cottages/ Country Homes Apts./Condos for Rent Duplexes for Rent Houses for Rent Mobiles/Pads Housesitting Wanted to Rent Rooms for Rent Room & Board Shared Accomm. Mobile/Mft. Homes for Sale Recreational Property Revenue Property Garages Real Estate Services Investment Opport. Business Opportunities Hotels/Motels Business Services Financial Services Industrial/Commercial Storage Space for Lease Office/Retail for Rent Warehouses Farms for Sale Farms/Acreages for Rent Land/Pastures for Rent Mineral Rights Farm Implements Livestock Horses & Tack

Farm Services Feed & Seed Hay/Bales for Sale Certified Seed for Sale Pulse Crops/Grain Wanted Steel Buildings/ Granaries Farms/Real Estate Antiques For Sale/Miscellaneous Furniture Musical Instruments Computers/Electronics Firewood Sports Equipment Farm Produce Hunting/Firearms Plants/Shrubs/Trees Pets Wanted to Buy Auctions Adult Personals Domestic Cars Trucks & Vans Parts & Accessories Automotive Wanted RVs/Campers/Trailers Boats Snowmobiles Motorcycles ATVs/Dirt Bikes Utility Trailers Oilfield/Wellsite Equip. Heavy Equipment Career Opportunities Professional Help Office/Clerical Skilled Help Trades Help Sales/Agents General Employment Work Wanted Domestic Help Wanted Career Training Tutors Memorial Donations Obituaries


Page 18

THE TRADER EXPRESS, FRIDAY, JULY 20, 2012

FEED & SEED

FOR SALE - MISC

DOMESTIC CARS

DOMESTIC CARS

ECI STEEL INC. PRINCE ALBERT, SK. HWY # 3 E & 48 ST (306)922-3000

GUARANTEED BEST

PRICE

LARGE QUANTITIES OF SQUARE

&

RECTANGLE

TUBING AVAILABLE FOR IMMEDIATE SALE.

CALL

FOR DETAILS

HAY/BALES FOR SALE

801 13th Ave., ESTEVAN Ph: 634-3661 or 1-888-634-3661

SOUTHEAST SASK USED CAR SUPERSTORE CARS

2011 FORD FUSION SEL AWD leather, pr. roof, V6, only 17,000 kms .......... $24,900 2009 CADILLAC CTS AWD, local trade, black, 82,500km................................ $29,700 2009 PONTIAC VIBE auto, p.w., p.l., air, only 53,700 kms............................ $14,990 2008 CHEV COBALT 4 door, sport red, 56,840 kms ...................................... $11,900 2008 CADILLAC CTS AWD, 3.6L, 66,700 kms .............................................. $29,700 2007 CHEV MAILBU LT Local trade, 77,000 kms ......................................... $10,981 2005 CHEV MALIBU LS local trade, 134,200km ............................................ $8,700 2004 CHEV CORVETTE CONVERTIBLE auto, leather, chrome wheels, 8,600 kms ..................................................................................................... $29,983

TRUCKS, SUVS, VANS 2011 DODGE DAKOTA CREW 4X4 19,200 kms....................................... $25,700 2011 CHEV TRAVERSE AWD, LT, quad, buckets, 43,400 kms, Was $29,900... $28,700 2010 CHEV 1500 CREW LT2 pw roof, leather, 20â&#x20AC;? wheels & more, 77,600 kms ................................................................................................... $31,700 2010 CHEV EQUINOX LTZ 4cyl, leather, pw roof, 8 way pr. seat, 73,700 kms ................................................................................................... $26,900 2010 GMC 1 TON CREW CAB DURAMAX 163,000 kms ......................... $28,700 2010 CHEV CREW 4x4 very nice, black with 20â&#x20AC;&#x2122;s, local trade, 45,000 kms .... $28,814 2010 CHEV 1500 CREW 4X4 6.2L, max pkg, 137,000 kms, local trade ...... $21,980 2010 GMC TERRAIN AWD, rearview camera, 15,000 kms ............................. $24,900 2009 BUICK ENCLAVE AWD CXL2 leather, 7pass, excellent,168,300 kms ... $19,981 2009 FORD ESCAPE XLT tr.tow, remote start, 62,000 kms ........................... $21,900 2009 CHEV AVALANCHE LTZ roof, D.V.D., local trade, 225,000 kms, clean ... $19,900 2009 CADILLAC SRX 4.6 V8 SPORT power roof, 58,7000 kms ................. $32,700 2008 DODGE NITRO SXT white, only 62,000 kms ...................................... $19,900 2008 HUMMER H3 fully loaded, cloth buckets, very clean, 69,000 kms........... $24,987 2008 CHEV TAHOE cloth buckets, 7 pass., power roof, 54,900 kms ............................................................................ Coming Soon $32,900 2008 SATURN VUE AWD A/C, cruise, tilt, pw, pl, 78,000 kms ..................... $17,700 2008 FORD EDGE LIMITED AWD, black, local trade, 101,300 kms ................ $19,900 62/' 2008 FORD F-150 4X4 CREW leather, sunroof, bucket, 65,288 km, local trade, Was $28,900 ............................................................. $27,900 2007 CHEV TRAILBLAZER LTZ leather, local trade, very clean, 89,000 kms .. $16,900 2007 JEEP LIBERTY 4X4 leather, local trade,123,000 kms ........................... $13,900 2005 ACURA MDX leather, power roof, only 102,000 kms ............................ $17,900 2005 HUMMER H2 black, leather, 92,000 kms ............................................ $28,900 2002 CHEV TAHOE LT Leather, local trade, 115,000 kms .............................. $14,900 2001 CHEV SILVERADO E/C 4X4 5.3 L 177,000 kms .............................. $8,900

FOR SALE: Approximately 320 acres of standing alfalfa-mixed hay. Phone 306-634-4809.

LAND WANTED

THE GM OPTIMUM ADVANTAGE STEEL BUILDINGS / GRANARIES FOR SALE: Used steel grain bins, 14 to 19 ft. diameter, aeration fans. Phone 306-421-0205. STEEL BUILDINGS - 33 1/3 to 50% off. Complete for Assembly. Ex. 20x24 Reg. $6,792, Disc. $5,660 (Quantity 1); 50x100 Reg. $42,500 Disc. $29,000 (Quantity 2). Call for Others. Source#18X. 800-964-8335.

DOMESTIC CARS

DISCONNECTED PHONE? ChoiceTel Home Phone Service. No One Refused! Low Monthly Rate! Calling Features and Unlimited Long Distance Available. Call ChoiceTel Today! 1-888-3331405. www.choicetel.ca. FOR SALE: 5000 Watt Powermate Generator - $1,100. Phone 461-9674.

â&#x20AC;˘ Manufacturerâ&#x20AC;&#x2122;s Warranty â&#x20AC;˘ Exchange Privilege â&#x20AC;˘ 150+ Point Inspection â&#x20AC;˘ 24hr Roadside Assistance

HOT TUB (SPA) COVERS Best Price, Best Quality. All Shapes & Colours Available. Call 1-866-652-6837 www.thecoverguy.com/newspaper

&+(9<7$+2(NPV -((33$75,276LOYHUNPV 5$063257%ODFNORDGHGNPV &+(9<6,/9(5$'2NPV 5$0&5(:/21*%2;7DQNPV -((3*5$1'&+(52.((57NPV5HG5RFN -((3&200$1'(563257/HDWKHUNPV )25'(6&$3(;/75HGNPV -((33$75,275HGNPV -((33$75,2763257NPV )25'(6&$3(;/7NPV &+(96,/9(5$'2&5(:&$%/6:KLWHNPV &+(96,/9(5$'2&5(::KLWHNPV62/' )25'('*(/7'NPV &+(9$9$/$1&+(/67DQNPV )25'(6&$3(;/75HGNPV *5$1'&+(52.((',(6(/ '2'*('$.27$NPV )25')/$5,$7%OXHNPV 72<27$781'5$NPV5HG -((3/,%(57</7'5HGNPV62/' '2'*('$.27$&5(:&$%*UH\NPV '2'*(5$048$'&$%'LHVHOEOXHNPV 72<27$781'5$NPV 

+20(2)7+(32:(57($0

,I\RXKDYHQ¡WVKRSSHG32:(5'2'*(\RXPD\KDYHSDLGWRRPXFK

â&#x20AC;˘ CHECK YOUR ADS â&#x20AC;˘ We will only accept responsibility for errors the first time an ad appears â&#x20AC;˘ PLEASE NOTE â&#x20AC;˘ Rewording or Changing an Advertisement After it has been Printed in the Paper Requires Payment for a NEW AD â&#x20AC;&#x201C; No Credits Are Issued for Ads That Are Changed â&#x20AC;&#x201C; â&#x20AC;˘ Cancellation of Advertisements â&#x20AC;˘ Must be received by 3:00 p.m. Wednesday for the Trader and 4:00 p.m. Friday for the Mercury ****************

SOUTHEAST TRADER

EXPRESS Business Office located at 68 Souris Avenue North in Estevan (Across from the Water Tower) Please Phone 634-2654 for further information Office Hours: 8:00 a.m. - 5:00 p.m. Monday through Friday ****************

Use the Handy Form Below to Submit Your Advertisement to: The Southeast Trader Express Box 730, Estevan, SK S4A 2A6 or submit your ad through our website at www.estevanmercury.ca Please Select Your Category from the Classified Index

Name ________________________________________ Address _____________________________________

)DPLO\2ZQHG'HDOHUVKLS6LQFH WK675((7(67(9$1 3+21(  

Telephone No. ________________________________ Number of Weeks ______________________________ Amount Enclosed ______________________________ VISA/MC No. _________________________________

86('&$56 0$='$&;NP  6(%5,1*7285,1*9HU\QLFHFDU  '2'*(&+$5*(5NPV  9:1(:%((7/(&219(57,%/(NPV  &+5<6/(56(%5,1*2QO\NPV 

86('758&.69$16 )25')&5(:&$%NPV  72:1 &28175<  *5$1'&+(52.((  '2'*(&5(:&$%%,*+251NPV  5$063257&5(:&$%  '2'*(-2851(<57$:'/RDGHG  )25';/7683(5&$%  *0&6,(55$&5(:&$%NPV  '2'*(&$/,%(5  5$0'LHVHO6/7  '2'*(-2851(<57/RDGHG  -((33$75,27/7'  *0&(;7&$%  )25'(6&$3(  '2'*(*5$1'&$5$9$16;7  -((3/,%(57<63257  5$0;4& 62/' 72:1$1'&28175<  '2'*(4&6/7NPV  '2'*(5$06/74&;'LHVHO  *0&&5(:&$%  )25');/7  '2'*(4&6/7:' 62/'

75$,/(5602725+20(659V .HQVLQJWRQ$YHQXHa(VWHYDQ6DVN 3KRQH

Prepaid Rates: $7.95 per week for up to 20 words Please add 20¢ for each additional word Remember To Add 5% GST! Cash â&#x20AC;&#x201C; Cheque â&#x20AC;&#x201C; Visa â&#x20AC;&#x201C; MasterCard Note: No refunds are issued for Classified Advertising. If you Cancel your Ad before expiry, Credit will be given which may be applied to future advertising. ***

PLEASE PRINT:

8VHG&DUV &+5<6/(5NPV 8VHG7UXFNV689V 9DQV &$',//$&(6&$/$'(:KLWHNPV

NOTICE

Payment for Classified Advertising Must be Made in Advance

A REMINDER â&#x20AC;Ś EACH ABBREVIATION Counts as One Word (You donâ&#x20AC;&#x2122;t save money by abbreviating, You just make your advertisement more difficult to read)

DOMESTIC CARS

&+(9<&259(77(NPV 3217,$&*5$1'35,;*76XSHUFKDUJHGEURQ]H NPV 0,768%,6+,/$1&(5%ODFNNPV $8',$/%ODFNNPV

CLASSIFIED DEADLINE WEDNESDAY AT 3:00 P.M.

75$9(/$,502725+20()W 

3/86$33/,&$%/(7$;(6

Card Expiry Date: ______________________________

YOUR AD _____________________________________________ _____________________________________________ _____________________________________________ _____________________________________________ _____________________________________________ _____________________________________________ _____________________________________________ _____________________________________________ _____________________________________________ _____________________________________________ _____________________________________________

The Worldâ&#x20AC;&#x2122;s Largest Shopping Centre is the CLASSIFIED SECTION of Your Newspaper


THE TRADER EXPRESS, FRIDAY, JULY 20, 2012 DOMESTIC CARS



DOMESTIC CARS

6HQFKXN¯V6XSHU'HDOV 8VHG&DUV

DOMESTIC CARS

DOMESTIC CARS

,/.'#2%%+-/4/23 !QPK3=HAO 3ANRE?A3EJ?A

0867$1**76+(/%<NPV+3 )25'0867$1*9VSHHGORDGHGRQO\NPV )86,216(/ORDGHGNPV /,1&2/10.6ORDGHGZSRZHUURRIQDYLJDWLRQ NP )2&866(/ORDGHGZLWKOHDWKHURQO\NPV 0867$1*9ORDGHGRQO\NPV62/' %0:=,&219(57,%/(PLOHV 2/'602%,/($/(52/9$XWR62/'

8VHG7UXFNV689V 9DQV

5$3725683(5&5(:[RQO\NPV (6&$3(;/7;ORDGHGZLWKNPV );/7&5(:&$%NPV (6&$3(/,0,7(';ORDGHGOHDWKHUQDYLJDWLRQ NPV (6&$3(;/7[/9ORDGHGZLWKNPV )&5(:&$%',(6(/;NPV *0&6,(55$6/(&5(:&$%;NPV (6&$3(/,0,7(';ORDGHGNPV ('*(/,0,7('DOOZKHHOGULYHORDGHGNPV *0&$&$',$6/(DOOZKHHOGULYHORDGHGNPV 62/' (;3(',7,21/,0,7('0$;[IXOO\ORDGHG ZLWKNPV (;3(',7,21('',(%$8(5[OHDWKHU SRZHUPRRQURRINPV (;3/25(56325775$&;/7;ORDGHG NPV )+$5/(<'$9,'621&5(:&$%;ORDGHGZLWK1DYLJDWLRQ DQGSRZHUURRIRQ\NPV );/7&5(:&$%ONPVORDGHG

ZZZORQJFUHHNPRWRUVFDUSDJHVFD *RYHUQPHQW+LJKZD\)XHO(FRQRP\5DWLQJV

&$56 &KHY,PSDOD/6GUIDFWRU\ZDUUDQW\NP  %XLFN$OOXUH&;/GUOHDWKHUIDFWRU\ZDUUDQW\ &KHY&REDOW/7GUVXQURRIIDFWRU\ZDUUDQW\  3RQWLDF*6(GUIDFWRU\ZDUUDQW\ORDGHG  &KHY0RQWH&DUOR66GU'DOH(DUQKDUGW-U6HULHVZDUUDQW\  &KU\VOHU37&UXLVHUGUZDUUDQW\  +RQGD&LYLF/;GUZDUUDQW\

758&.69$16 689·V 'RGJH*UDQG&DUDYDQ6;76WRZQJRNPIDFWRU\ZW\  0LWVXELVKL5956(GU:'NPIDFWRU\ZDUUDQW\  &KHY6LYHUDGR/7&UHZ&DE[=IDFWRU\ZDUUDQW\  'RGJH'DNRWDFUHZFDE6;7[NPIDFWRU\ZDUUDQW\  'RGJH-RXUQH\6;7$:'SDVVORDGHGZDUUDQW\  )RUG(VFDSH;/7:'GUNPIDFWRU\ZDUUDQW\  &KHY7UDLOEOD]HU[NPVIDFWRU\ZDUUDQW\  +RQGD&59/;$:'ORDGHGZDUUDQW\  *0&6LHUUD6/(([WFDE=[/9IDFWRU\ZDUUDQW\  )RUG);/7([W&DE[ORDGHGZDUUDQW\  'RGJH5DP4XDG&DE/+HPL[ZDUUDQW\  %XLFN5HQGH]YRXV$:'&;/GUSDVVZDUUDQW\  )RUG);/76XSHU&UHZ[ZDUUDQW\  *0&'HQDOL$:'SDVVOHDWKHUVXQURRIZDUUDQW\  &KHY9HQWXUH9DQ(;7SDVVNPZDUUDQW\  'RGJH'DNRWD6/7(&DE[WRSSHUZDUUDQW\  )RUG([SHGLWLRQ;/7[=ZDUUDQW\  &KHY9HQWXUH9DQ(;7GUZDUUDQW\  -HHS&KHURNHH6SRUWGU[ZDUUDQW\  )RUG5DQJHU6WHSVLGH6/7ZDUUDQW\ 

Most of Our Vehicles are Covered by Lubrico Powertrain Warranty

6HQFKXN )RUG6DOHV/WG

@V\YOVTLVMHM[LYZHSLZZLY]PJL 6RXULV$YHQXH1RUWK²(VWHYDQ6DVN

634-3696

3ULFHV5HGXFHGa:H7DNH7UDGHV 5HDVRQDEOH2IIHUV&RQVLGHUHG

FOR SALE: 2009 - 35 ft. Toy Hauler. Loaded, excellent condition. $39,500 - O.B.O. Phone 4619595.

ADULT PERSONAL MESSAGES

CAREER OPPORTUNITIES

CANCEL YOUR TIMESHARE. NO RISK program. STOP Mortgage & Maintenance Payments Today. 100% Money Back Guarantee. Free Consultation. Call us Now. We can Help! 1-888-356-5248 LOCAL HOOKUPS BROWSE4FREE 1-888-628-6790 or #7878 Mobile **************** HOT LOCAL CHAT 1-877-290-0553 Mobile: #5015 **************** Find Your Favourite CALL NOW 1-866-732-0070 1-888-544-0199 18+

DOMESTIC CARS Guaranteed approval drive away today! We lend money to everyone. Fast approvals, best interest rates. Over 500 vehicles sale priced for immediate deliver y OAC. 1-877-796-0514. www.yourapprovedonline.com.

TRUCKS & VANS

RVS/CAMPERS/TRAILERS

ZZZORQJFUHHNPRWRUVFDUSDJHVFD HPDLOVDOHVORQJFUHHNPRWRUV#VDVNWHOQHW

FOR SALE: 2001 Winnebago 35 Fo o t Ad ve n t u re r M o to r h o m e. 42,500 miles, 2 Large Slides, G.M. 8.1L Vortec V-8. Excellent condition. $36,000. Phone 306-5774736, Kenosee Lake.

WK6WUHHW²(VWHYDQ6DVN

Instrumentation Instructor Enjoy paid summers off!! Saskatchewan Institute of Applied Science and Technology, Palliser Campus (Moose Jaw, SK) is seeking a full-time, permanent instructor in our Instrumentation program. Why not shift your career and give back to your trade through practical hands-on shop instruction and classroom theory. SIAST provides a wide range of benefits and ongoing employer-provided instructional training. You will be ready to succeed in this role if you have a diploma or degree in Instrumentation Engineering Technology, are eligible for certification as an A.Sc.T. or P. Eng and have two years of related experience. Contact Frank van Breugel, Program Head at 306-691-8336 or vanbreugel@siast.sk.ca

www.goSIAST.com

Springwood Homes

/,)7&+$,56 :$/.(56 (/(&75,&%('6 $1'08&+025(

Daniel Methot Carpentry 7UDLOEOD]HU6FRRWHU Â&#x2021;LQ%ODFN7LUHV Â&#x2021;)XOO6XVSHQVLRQ Â&#x2021;'HOX[H/LJKW3DFNDJH Â&#x2021;+3#03+ Â&#x2021;3RZHU6HDWRU/JH%DWWHULHV

 HVWHYDQEXLOGHU#JPDLOFRP )UDPLQJ0RXOGLQJ:LQGRZ 'RRU,QVWDOOV 6WDLUV)ORRULQJ'HFNV)RXQGDWLRQV6LGLQJ

/RRNLQJIRUD UHOLDEOHFUDIWVPDQ" 7( /$0,1$

WANTED: Johnson 70 HP Outboard motor for parts - 1985 Mod CJ 70TLCOS. Allan Duffus, 4823660 - leave message, Cell: 4838849.

$)7(5+2856&HOO

Health & Mobility Aids

)URP6PDOO 5HQRYDWLRQVWR &XVWRP7XUQ.H\ +RPHV

RVS/CAMPERS/TRAILERS

3+21(&2//(&7)25.(1

Find Your New Vehicle in the Mercury Classifieds!

Carpentry

WANTED

FOR SALE: 2003 Dodge Magnum Ram 2500, Hemi, 5.7 Litre V8, 4X4, Crew Cab. Green. New tires. Very clean, 210,000 km - $14,500. Phone 306-861-4592.



+$5 ': 22'

7,/ 5. (:2 6721

(:

25

.

&DOO$GDP7RGD\

Page 19

23(17+856 6XLWHWK$YH(VWHYDQ VWGRRU6RXWKRI&,%& &$// IRUPHUO\6XQ/LIH%OGJ

72//)5((

ADS DPRQWK

21/<

&DOOWRDGYHUWLVH


Page 20

THE TRADER EXPRESS, FRIDAY, JULY 20, 2012

CAREER OPPORTUNITIES

CAREER OPPORTUNITIES MANAGERS REQUIRED! Sales Manager - must have Case or New Holland ag sales experience. Top salary and bonus program. Great upper management opportunity - yours to grow. Must be able to manage large, new & used inventory, develop & manage sales programs with diversified customer base. Parts Manager must have ag experience. Top salary & bonus. Lots of opportunity - must be able to manage a large staff & be creative. Apply in confidence to Hi Line Farm Equipment, 4723-39 Ave., Wetaskiwin, AB T9A 2J4 or admin@hilinecnh.com.

Progressive Auto Body Shop in Kindersley requires an Auto Body person. Should be minimum 2nd year apprentice or journeyman. We offer a great working environment and a benefits package. Please contact Randy Vold @ 306-463-2110 or email resume to randyvold@hotmail.com

CAREER OPPORTUNITIES SERVICE TECHNICIAN Dr yair 2000 Inc. (www.dryair.ca) located in St.Brieux, SK, requires a motivated individual to work in the area of Product Service. A mechanical/electrical background is a mu s t . E xc e l l e n t c o m mu n i c a tion/telephone skills are necessary. There will be a requirement to travel for customer training and to assist customers. Compensation based on experience. Please fax resume to 306-275-4664 or email dfagnou@dryair.ca Beaver Hotel in North Battleford looking for full time workers: 1 Cook $10-$15 per hr/ 2 kitchen helpers $11per hr/ 1 housekeeper $11per hr send your resume to iskca@yahoo.co.kr

CLASSIFIED ADS WORK!

TRADES HELP

Instrumentation Instructor Enjoy paid summers off!! Saskatchewan Institute of Applied Science and Technology, Palliser Campus (Moose Jaw, SK) is seeking a full-time, permanent instructor in our Instrumentation program. Why not shift your career and give back to your trade through practical hands-on shop instruction and classroom theory. SIAST provides a wide range of benefits and ongoing employer-provided instructional training. You will be ready to succeed in this role if you have a diploma or degree in instrumentation Engineering Technology, are eligible for cer tification as an A.Sc.T. or P.Eng and have two years of related experience. Contact Frank van Breugel, Program Head at 306-691-8336 or vanbreugel@siast.sk.ca.

GENERAL EMPLOYMENT

GENERAL EMPLOYMENT

CRIMINAL RECORD? YOU CAN BE ARRESTED, JAILED OR DEPORTED if you enter the United States with a criminal record. A waiver clears you for entry. Call now, toll free: (1-8-NOW-PARDON) 1-866-972-7366. www.RemoveYourRecord.com In business since 1989.

HELP WANTED!!! Make up to $1000 a week mailing brochures from home! Helping Home-workers since 2001! Genuine Opportunity! No experience required. Start Immediately! www.themailinghub.com

INTERIOR HEAVY EQUIPMENT OPERATOR SCHOOL No Simulators. In-the-seat training. Real world tasks. Weekly start dates. Job board! Funding options. Apply online www.IHESchool.com 1-866-399-3853

CAREER TRAINING M E D I CA L T R A N S C R I P T I O N RATED #2 FOR AT-HOME JOBS. Start training today. Graduates are in demand! Enroll now. Take advantage of low monthly payments. 1- 8 0 0 - 4 6 6 - 1 5 3 5 w w w . c a n scr ibe.com admissions@canscribe.com

The Southeast Trader Express Classifieds Are Bursting With Great Buys!

Contractors

Rentals 20(72:1 5(129$7,216/7'

6$/(6 6(59,&( ,167$//$7,21

Contact us for ALL of your renovation needs

6HUYLQJ6DVNDWFKHZDQ

)UHH(VWLPDWHV /LFHQVHG %RQGHG

Â&#x2021;2IILFH7UDLOHUVÂ&#x2021;6NLG6WHHUVÂ&#x2021; 5RFN7UXFNVÂ&#x2021;'5&UDZOHUV Â&#x2021;0LQL([FDYDWRUV

Insulation & Drywall 635$<32/<85(7+$1( )2$0,168/$7,21

POLARFOAM SOYA Â&#x2021;=HUR2]RQH'HSOHWLRQ  6XEVWDQFH Â&#x2021;(FRORJLFDO,QVXODWLRQ Â&#x2021;+LJK59DOXHSHULQFK Â&#x2021;$GGVVWUHQJWKDQGVXSSRUW

Â&#x2021;'RHVQRWVXSSRUWJURZWKRI  PRXOGV Â&#x2021;$GKHUHVWRZRRGPHWDO  FRQFUHWH

)$&725<',5(&7:,1'2:6 WINDOWS â&#x20AC;˘ Never Paint PVC Windows & Door Frames 6$6.$7&+(:$10$'( â&#x20AC;˘ Sealed Units â&#x20AC;˘ Bay & Bow Windows â&#x20AC;˘ Cladding :,1'2:6 '2256 0$,17(1$1&()5(( SIDING, SOFFIT & FASCIA 6287+(51 */$66 â&#x20AC;˘ Vinyl Siding & Insulation :25.6/7' â&#x20AC;˘ Aluminum SofďŹ t & Fascia Â&#x2021;)LQDQFLQJ$YDLODEOH DOORS â&#x20AC;˘ Steel Entrance Doors â&#x20AC;˘ Aluminum Storm Doors â&#x20AC;˘ Patio Doors â&#x20AC;˘ Garden Doors

 5(12  

0HPEHURI &KDPEHURI &RPPHUFH

5322/(&216758&7,21 5DQG\3RROH 6SHFLDOL]LQJ,Q  Â&#x2021;9LQ\O6LGLQJ  Â&#x2021;6RIILWDQG)DVFLD  Â&#x2021;:LQGRZVDQG'RRUV  Â&#x2021;0HWDO:LQGRZ&ODGGLQJ  DQGPXFKPRUH

:LQGRZ 6SHFLDOLVWV

12:&RQWLQXRXV(DYHVWURXJKLQJ %HDWWKH5XVK DQG%RRN\RXU)5(( (67,0$7(6QRZ

:HDOVRLQVWDOOD&/$66)LUH5DWHGSURGXFW XVHDEOHLQ2LOĂ&#x20AC;HOGDSSOLFDWLRQV

+RPH   &HOO  

&8)&$&HUWLĂ&#x20AC;HG,QVWDOOHUV

<HDUVRIH[SHULHQFHEURXJKWWR\RXUKRPH

67$5'5<:$// ,168/$7256/7' (VWHYDQ6. 3KRQH )D[  

Hot Shot

Ladies Fashions

Warren Seeman



<%:HW 5RRILQJ/WG â&#x20AC;˘ INSURED â&#x20AC;˘ 10% SENIOR DISCOUNT â&#x20AC;˘ FREE ESTIMATES

Specializing in flat roof repairs & full installations

<%:HW5RRILQJ/WG & Home Improvement Contractor â&#x20AC;&#x153;The name that keeps you dryâ&#x20AC;? Quality craftmanship at prices that wonâ&#x20AC;&#x2122;t soak you!

Shawn Wells Cell: (306) 461-8849 â&#x20AC;˘ Fax: (306) 388-2594 Box 35, Bienfait, SK. S0C 0M0

Home & Auto Detailing

<285-($163(&,$/,67

(GCVWTKPI +285'$<6$:((. +276+276(59,&( IRURLOĂ&#x2020;HOGFRPPHUFLDO  DJULFXOWXUDO VHUYLQJ6DVNDWFKHZDQ 0DQLWRED $OEHUWD

â&#x20AC;˘ Windows & Doors â&#x20AC;˘ Fascia â&#x20AC;˘ Soffit â&#x20AC;˘ Decks & Fences â&#x20AC;˘ Seamless Eaves â&#x20AC;˘ Siding â&#x20AC;˘ Metal Cladding

â&#x20AC;˘ New Construction & Renovation â&#x20AC;˘ Commercial & Residential â&#x20AC;˘ All types of roofing â&#x20AC;˘ Metal Buildings & Garage Packages

PYRAMID HOME & AUTO

WHEN ITâ&#x20AC;&#x2122;S GRIMY, Iâ&#x20AC;&#x2122;LL MAKE IT SHINY BONDED & INSURED HOME & AUTO DETAILING

WK6WUHHW(VWHYDQ

Phone/FAX: 306-340-0274 Cell/Text: 306-421-4669 www.pyramidcleaningcrew.ca

1521-3rd Street Estevan, SK S4A 0S5

&DOO7R%RRN<RXU$G7RGD\


THE TRADER EXPRESS, FRIDAY, JULY 20, 2012

Page 21

CAREER OPPORTUNITIES

0DLQWHQDQFH3HUVRQ 7KH9LOODJHRI)URELVKHULVDFFHSWLQJ ZULWWHQDSSOLFDWLRQVIRUWKHSRVLWLRQRI 0DLQWHQDQFH3HUVRQIRUWKH9LOODJH 'XWLHVZRXOGLQFOXGHORRNLQJDIWHUWKH ZDWHUSODQWVHZDJHOLIWVWDWLRQODJRRQ PRZLQJDQGRWKHUPDLQWHQDQFHGXWLHV ,QWHUHVWHGDSSOLFDQWVPD\DSSO\EHIRUH $XJXVWWRWKH 9LOODJHRI)URELVKHU%R[ )URELVKHU6.6&< VWDWLQJZDJHVH[SHFWHG

FOOD SERVICE WORKERS We are accepting resumes for part & full time positions. Duties include: Food preparation, stock and inventory, serving customers, some baking, making sandwiches, operate cash register and be able to give proper change as well as general cleaning and equipment maintenance

5),-<RX4773 7KH)LUVWUXOHRIDGYHUWLVLQJLV FDWFKLQJWKHLUH\H7KH6HFRQGLV VXVWDLQHGUHSHDWHGDGYHUWLVLQJ $GYHUWLVLQJ'RHVQ W&RVWLW3D\V

Starting wage - $11.01/hr. If you are interested in joining our team apply in person with resume or call: Margaret - Subway 517 - 4th Street, Estevan â&#x20AC;¢ 634-6616

®

3XEOLFDWLRQ'DWH)ULGD\$XJXVW 'HDGOLQHWRERRNDGYHUWLVLQJVSDFH 7KXUVGD\$XJXVW

2YHUGLVWULEXWLRQ 'LVWULEXWLRQWDUJHWLQJWKHRLOLQGXVWU\LQ 6DVNDWFKHZDQ0DQLWREDDQG$OEHUWD

6HSWHPEHU,VVXH(GLWRULDO)RFXVLV

"STIMULATION/THERMAL" 'HDGOLQHWRDGYHUWLVH$XJXVW

Creative Marketing Ideas That Get Results

Speak with one of our advertising specialists today to find out how to make the most important impact on your customers

MO MORE ORE WAYS WAYS TO TO STAY UP TO DATE! Visit us on the web!! www.estevanmercury.ca

Cindy Beaulieu

Deanna Tarnes

Candace Wheeler

Teresa Hrywkiw

Kristen Oâ&#x20AC;&#x2122;Handley

3KRQH (PDLODGVDOHV#HVWHYDQPHUFXU\FD


Page 22

THE TRADER EXPRESS, FRIDAY, JULY 20, 2012

:;;& #'(.'(*#.' (+#=9= $#04<9>5><=3?;A9 ,04<9>5><=3?;@; 

   .

       /

     ,QVWUXPHQWDWLRQ7HFKV )(' #!))(&#$(!"(($/  '#2$#'(&)($#2"#(##$*&$)'!(&$#.!). "#!.%#)"(#+&!''*'#'-'("'  #($&#2')%&*'#%%&#('#%&$"$(#  '(-%&$&"  #(&(#+(!(&#'#$"")#($#'  #(##2($  #!#('(#&'

        ,QVWUXPHQWDWLRQ$SSUHQWLFHV )(' #!))(&#$(!"(($/  '''(###'+(!!$#'(&)($##"#(##(' '  &#($  '(-%&$&"  &###*!$%#' !!'#''&-($$"%!(%%&#('% !'&'%$#($"%!$-"#(6#)'(&!!(&1 &&#+!!*#($($'+()&&#(;#&'(2(&##1

EMPLOYMENT OPPORTUNITY PERMANENT FULL-TIME HYDROVAC OPERATORS • Require class 3 or class 1 licence • Safety tickets HYDROVAC SWAMPERS • Require safety tickets Offering competitive wages, benefits available after 3 months. Offering living accomodations.

Email resumes to: extremeexcavating@hotmail.com or fax to: 306•483•2082

$)+!!#$-+$& #$&"!-'$"%#-%&$*#%&")"#('# %&$('&%&$&"'.+(#,!!#('(-&$&#!)# &(($#1

Journeymen Electricians and Apprentices ;<<'!$()/()+$/(!),$>:> %$15=:?6?=>4@<B: -15=:?6?=>4@<A< 

   /       0

         -RXUQH\PDQ(OHFWULFLDQV *)( $"**)'$%)"#))%0  $*()'"3+.%##'"")'"%$()'*)%$$#$)$$  $)%'$3(*&'+($&&'$)($&'%#%)$  ().&'%'#  $)')$,) $()'*#$))%$$%##*$)%$(  $)$$3)%  $"$)()$'(

    /HYHO $SSUHQWLFHV *)( $"**)'$%)"#))%0  ((()$ %*'$.#$,)""%$()'*)%$$#$)$$)(!(  '$)%  ().&'%'#  '$$$+"%&$(!""($(('.)%%#&")&&'$)(&  ((()$#$)%'$ *$%'&&'$)")'$(

PowerTech Industries Ltd. in Estevan is seeking Journeymen Electricians and Apprentices for work in the Estevan and Carnduff areas. Experience: Safety Certificates are needed. 1st Aid/CPR, H2S. Applicants must have a valid driver’s license. Full benefits packages and RSP plan. Duties: Day to day electrical construction and maintenance in the oilfield. Wage/Salary Info: Depending on experience & qualifications. To Apply: Fax: (306) 637-2181, e-mail sschoff.pti@sasktel.net or drop off resume to 62 Devonian Street, Estevan, SK.

CAREERS 6287+($675(*,21$/9,&7,06(59,&(6 (03/2<0(1723325781,7< 2QH\HDUWHUP

9LFWLP6HUYLFHV$VVLVWDQW&RRUGLQDWRU 6RXWKHDVW 5HJLRQDO 9LFWLP 6HUYLFHV LV D QRQSURÀW RUJDQL]DWLRQ ZKLFK ZRUNV LQ FRRSHUDWLRQ ZLWK WKH SROLFH WR SURYLGHDVVLVWDQFHWRSHRSOHZKRKDYHEHHQYLFWLPL]HGE\ FULPHRUWUDXPDWLFHYHQWV8QGHUWKHJXLGDQFHRIWKH9LFWLP 6HUYLFHV &RRUGLQDWRU DQG WKH GLUHFWLYH RI WKH 6RXWKHDVW 5HJLRQDO 9LFWLP 6HUYLFHV %RDUG RI 'LUHFWRUV \RX ZLOO EH UHVSRQVLEOHIRUWKHHIIHFWLYHGHOLYHU\RILQIRUPDWLRQUHIHUUDO VXSSRUWDQGDVVLVWDQFHWRSHRSOH7KHSRVLWLRQLVORFDWHG DWWKH(VWHYDQ3ROLFH6HUYLFHDQGZLOOLQFOXGHWUDYHOZLWKLQ WKH(VWHYDQ5&03'HWDFKPHQWDUHD 4XDOLÀFDWLRQV ‡'HJUHHLQ+XPDQ6HUYLFHVRUFRPELQDWLRQRIHGXFDWLRQ  DQGUHODWHGZRUNH[SHULHQFH3UHYLRXVH[SHULHQFH  ZRUNLQJZLWKYLFWLPVZRXOGEHDQDVVHW ‡$ELOLW\WRUHFUXLWWUDLQDQGFRRUGLQDWHYROXQWHHUV ‡7KHVXFFHVVIXODSSOLFDQWZLOOEHDEOHWRZRUNZHOOLQD  WHDPHQYLURQPHQWDQGZLOOEHDEOHWRSURPRWHDSRVLWLYH  ZRUNLQJH[SHULHQFH ‡3URYHQRUDODQGZULWWHQFRPPXQLFDWLRQRUJDQL]DWLRQDO  VNLOOVDQGFRPSXWHUH[SHULHQFHUHTXLUHG ‡0XVWPHHWWKH5&036HFXULW\&OHDUDQFH ‡0XVWKROGDYDOLGGULYHU·VOLFHQFHDQGSURYLGHRZQYHKLFOH ‡$ELOLW\WRZRUNÁH[LEOHKRXUV )RUZDUGUHVXPHWR 6RXWKHDVW5HJLRQDO9LFWLP6HUYLFHV,QF $WWHQWLQ7DUD%DLOH\&RRUGLQDWRU %R[ :H\EXUQ6DVNDWFKHZDQ 6+.   $SSOLFDWLRQ'HDGOLQH 0RQGD\$XJXVWWK

"('(&%$)%#&"%.#$)7$*()'"")'2 ''$,""+$)%)%(,)*''$)<$'()3)'$$2 %*,""$ %.,%'!$%'#".(%#&$.&'%+$&'#*#$)($ &'%)('&'%'#(/,)$-""$)().'%'$"*$'))%$2

%RXQGDU\'DP0LQH 6KHUULWW &RDO LV &DQDGD·V ODUJHVW WKHUPDO FRDO SURGXFHU ZLWK QLQH VXUIDFH PLQHV LQ WKH SURYLQFHV RI $OEHUWD DQG 6DVNDWFKHZDQ3URGXFLQJPRUHWKDQRIWKHWKHUPDOFRDO SURGXFHGLQWKHFRXQWU\6KHUULWWFXUUHQWO\VXSSOLHVGRPHVWLF XWLOLWLHVDQGLQWHUQDWLRQDOFRPSDQLHVZLWKIXHOIRUHOHFWULFLW\ JHQHUDWLRQ

+DVDQRSHQLQJLQWKHLU

3URGXFWLRQ'HSDUWPHQW 7KH(VWHYDQ0HUFXU\UHTXLUHVDIXOOWLPH DGEXLOGHULQWKHLUSURGXFWLRQGHSDUWPHQW IRURQHPDWHUQLW\OHDYHSRVLWLRQV $SSOLFDQWVPXVWEHDEOHWRPXOWLWDVNLQD IDVWSDFHGGHDGOLQHGULYHQHQYLURQPHQW +HVKHPXVWEHDWHDPSOD\HUZLWKDQH\H IRUGHWDLO.QRZOHGJHRI0DF&RPSXWHUVDQG $GREH&UHDWLYH6XLWHLVDQDVVHWEXWZHDUH ZLOOLQJWRWUDLQWKHULJKWDSSOLFDQW 7KHSRVLWLRQLV0RQGD\WR)ULGD\ DPSP2XUFRPSDQ\RIIHUVD KHDOWKEHQHÀWSDFNDJH 3OHDVHPDLORUHPDLOUHVXPHWR

0HODQLH7ULELJHU3URGXFWLRQ0DQDJHU SUHSUHVV#HVWHYDQPHUFXU\FD 7KH(VWHYDQ0HUFXU\ %R[ (VWHYDQ6.6$$

7ULDOWD2LOÀHOG,QGXVWULHV/WGORFDWHGLQ(VWHYDQ 6DVNDWFKHZDQLVDQHVWDEOLVKHGRLOÀHOGPDQX IDFWXULQJFRPSDQ\VXSSO\LQJURGSXPSSDUWVDQG DFFHVVRULHVWRWKHRLOLQGXVWU\:HDUHORRNLQJWR H[SDQGRXUFXUUHQWRSHUDWLRQVDQGDUHFXUUHQWO\ DFFHSWLQJUHVXPHVIURPTXDOLÀHGDSSOLFDQWVIRU WKHIROORZLQJSRVLWLRQVLQRXUIDFLOLW\ 7UXFN'HOLYHU\'ULYHU7KHLGHDOFDQGLGDWHZLOO KDYHH[SHULHQFHLQKLJKZD\GULYLQJDQGGHOLYHU LQJIUHLJKW'XWLHVZLOOLQFOXGHPRYLQJIUHLJKW EHWZHHQ(GPRQWRQ$%DQG(VWHYDQ6.PDN LQJURXWLQHGHOLYHULHVWRFXVWRPHUORFDWLRQVDQG XQORDGLQJVRUWLQJIUHLJKWLQRXU(VWHYDQZDUH KRXVH7KLVSHUVRQZLOOZRUNZLWKWKHPDQDJHULQ DVKRSVHWWLQJWRHQVXUHRXUFXVWRPHUUHTXLUH PHQWVDUHPHW5HTXLUHPHQWVLQFOXGH&ODVV OLFHQVHZLWK$LU%UDNHVHQGRUVHPHQWDQGFOHDQ GULYLQJUHFRUG7KLVSHUVRQPXVWEHZLOOLQJWR ZRUNZHHNHQGVDQGQLJKWV7UDLQLQJIRU6DIHW\ 7LFNHWVZLOOEHSURYLGHG 7ULDOWDRIIHUVDZLGHDUUD\RIEHQHÀWVLQFOXGLQJ KHDOWKGHQWDODQGOLIHLQVXUDQFHDORQJZLWKYHU\ FRPSHWLWLYHVDODULHV6HL]HWKLVH[FHOOHQWRSSRU WXQLW\WRJURZ\RXUFDUHHUZLWKLQDWKULYLQJVPDOO ÀUPLQWKHKHDUWRI&DQDGD

5HSO\E\ID[RQO\WR $WWQ0DQDJHU

Š‡‘—†ƒ”›ƒ‹‡‹•Ž‘…ƒ–‡†ƒ’’”‘š‹ƒ–‡Ž›ͷͻ ‘ˆ•–‡˜ƒǤ Š‹•‘’‡’‹–‹‡‘’‡”ƒ–‡•ͼ†”ƒ‰Ž‹‡•ƒ†’”‘˜‹†‡• ‡’Ž‘›‡––‘‘˜‡”ͺͶͶ‡’Ž‘›‡‡•Ǥ ‘—†ƒ”›ƒ‹‡Šƒ•‹‡†‹ƒ–‡‘’‡‹‰ˆ‘”ǣ

-RXUQH\PDQ(OHFWULFLDQ ‘•‹–‹‘—ƒ”› Š‹•’‘•‹–‹‘™‘—Ž†„‡”‡•’‘•‹„Ž‡ˆ‘”–Š‡‡Ž‡…–”‹…ƒŽ ƒ‹–‡ƒ…‡‘ˆ–Š‡‹‡™‘”‹‰ƒ•ƒ–‡ƒ‡„‡”‹ –Š‡‡Ž‡…–”‹…ƒŽ†‡’ƒ”–‡–ǤŠ‹•’‘•‹–‹‘‹•”‡“—‹”‡†–‘ ™‘”ͳʹŠ‘—”•Š‹ˆ–”‘–ƒ–‹‘•ǡ†ƒ›•ƒ†‹‰Š–•Ǥ —ƒŽ‹ϐ‹…ƒ–‹‘•ǣ  ‘—”‡›ƒ•–ƒ–—•‹–Š‡‡Ž‡…–”‹…ƒŽ–”ƒ†‡‹•”‡“—‹”‡† ƒ•™‡ŽŽƒ•ƒ –‡”’”‘˜‹…‹ƒŽ”‡†•‡ƒŽǤ”‡˜‹‘—•‹‹‰ ‡š’‡”‹‡…‡™‘—Ž†„‡ƒƒ••‡–„—–‘–”‡“—‹”‡†Ǥ Š‡””‹––‘ƒŽ‘ˆˆ‡”•ƒ…‘’‡–‹–‹˜‡„‡‡ϐ‹–•’ƒ…ƒ‰‡ƒ† ™ƒ‰‡•Ǥ

–‡”‡•–‡†…ƒ†‹†ƒ–‡••Š‘—Ž†‡ƒ‹Ž‘”ˆƒšƒ”‡•—‡ƒ† …‘˜‡”Ž‡––‡”ǤǦƒ‹Žǣ FDUHHUV%'0DQG%)7#VKHUULWWFRDOFRP ƒšǣ͵Ͳ͸Ǧ͸͵ͶǦ͹ͲͷͺǤ ’’Ž‹…ƒ–‹‘•ƒ›ƒŽ•‘„‡•—„‹––‡†‹™”‹–‹‰–‘ǣ —ƒ‡•‘—”…‡•ǡŠ‡””‹––‘ƒŽǡ ‘—†ƒ”›ƒ‹‡ǡ‘š͵ͲͲͲǡ•–‡˜ƒǡͶʹʹ ‡–ŠƒƒŽŽ…ƒ†‹†ƒ–‡•ˆ‘”–Š‡‹”ƒ’’Ž‹…ƒ–‹‘•ǡŠ‘™‡˜‡”ǡ ‘Ž›–Š‘•‡•‡Ž‡…–‡†ˆ‘”ƒ‹–‡”˜‹‡™™‹ŽŽ„‡…‘–ƒ…–‡†Ǥ


THE TRADER EXPRESS, FRIDAY, JULY 20, 2012

Page 23

CAREER OPPORTUNITIES Kelly Panteluk Construction Ltd. has a full time

Administrative Assistant

Recycle This Paper

position available in the office in Estevan, SK. KPCL is looking for a self-motivated, organized, and conscientious person who will pay attention to detail and is willing to follow directions accurately. The successful applicant will assist with accounts payable and receptionist procedures as well as general office duties including, but not limited to, answering phones, filing, running errands, etc. A valid driverâ&#x20AC;&#x2122;s license is required. Data Entry, Microsoft Excel and Word experience is an asset. Experience with web based applications is an asset. KPCL offers competitive wages, with overtime paid after forty hours per week.

Forward your resume, complete with references to: elly@kpcl.sk.ca Attention: Elly Panteluk No phone calls please.

2XUFOLHQW0LOOHQQLXP6WLPXODWLRQ6HUYLFHVLVDVDIHW\DQGVHUYLFH TXDOLW\IRFXVHGSULYDWHFRUSRUDWLRQRIIHULQJIXOOFRPSOHWLRQDQGHQJLQHHULQJ VHUYLFHVLQFOXGLQJ&RPSOHWHZHOOVWLPXODWLRQLQFOXGLQJK\GUDXOLFIUDFWXULQJ FRPSXWHUDLGHGIUDFGHVLJQUHVHUYRLUHQJLQHHULQJVWLPXODWLRQDVZHOODV SRVWIUDFSURGXFWLRQPRQLWRULQJ %DVHGLQ(VWHYDQ6.0LOOHQQLXPLVJURZLQJDQGQHHGVWKHIROORZLQJ VWDII +5+6($GYLVRU <RXZLOOEHWKHPDLQSRLQWRIFRQWDFWIURPDKXPDQUHVRXUFHVDQGVDIHW\ SHUVSHFWLYH7KLVLQFOXGHVLQLWLDWLQJWKHSODQQLQJRIVDIHW\SURJUDPV DQGWKHPRQLWRULQJRIGDLO\ZRUNDFWLYLWLHVWRLQVXUHWKH'LVWULFWDQGDOO SHUVRQQHODUHLQFRPSOLDQFHZLWKVDIHW\VWDQGDUGVDQGRWKHUDSSOLFDEOH UXOHVDQGUHJXODWLRQV 0DLQWHQDQFH0DQDJHU <RXZLOORYHUVHHWKHPDLQWHQDQFHRIDOOHTXLSPHQWXVHGRXWRIWKH(VWHYDQ 2I¿FH

:25/':,'(/($'(5

7$/(17('7($0

6HUYLFH0DQDJHU <RXHQVXUHWKHSURSHUVHUYLFLQJRIFOLHQW¶VMREVRXWRIWKH(VWHYDQ2I¿FH ,I\RXDUHORRNLQJIRUDJURXQGÃ&#x20AC;RRURSSRUWXQLW\WRMRLQDQHZRUJDQL]DWLRQ DQGFRQWULEXWHWRLWVVXFFHVVWKHQZHZRXOGOLNHWRKHDUIURP\RX 3OHDVH(PDLO<RXU5HVXPH7RWKRPSVRQ#MUSVLFDRUFDOO%UHWW 7KRPSVRQDW  

6WDUWZRUNLQJZLWKDQLQGXVWU\OHDGHULQDSRVLWLRQZLWKURRPWR JURZH[FHOOHQWWUDLQLQJSURJUDPDQGFRPSUHKHQVLYHEHQHILWVDQG ERQXVHV6WDUWWKLQNLQJ1DWLRQDO2LOZHOO9DUFR2XU3RUWDEOH 3RZHUWHDPLVFXUUHQWO\UHFUXLWLQJIRU

$UHD0DQDJHU !.2!+1. !3. +1.  !01.*0++1.            %-(*''#)!.( #$!($#)'$!##$*)$$*'()+# '#(%$()$#('(%$#(!$')()/*%('+#$%')$#$ $*'($!($#)'$!&*%"#)          

 .'('' -%'#$'-%'#,)#)'*(($!($#)'$! (.()"(#()'%%#"* )'$##)'%'($#!( !!( #!%))*#)!).)$)'$*!($$),'#$&*%"#) +!'+'0(!#(,)!#'+'0(()')

.$*'#)'()#)($%%$')*#).%!((#.$*''(*")$ ' %-$!$'-   .*# 

               

 

â&#x20AC;¢ \HDUVRIPDQDJHPHQWH[SHULHQFHLQRLODQGJDVRU SRUWDEOHSRZHURSHUDWLRQV â&#x20AC;¢ ([FHOOHQWFRPPXQLFDWLRQVNLOOV â&#x20AC;¢ $ELOLW\WRPHQWRUDQGWUDLQHPSOR\HHV â&#x20AC;¢ $ELOLW\WRPDQDJHEXGJHWV

6DOHV5HSUHVHQWDWLYH â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢ â&#x20AC;¢

([SHULHQFHZLWKSRUWDEOHSRZHUJHQHUDWLRQRUUHQWDOV ([FHOOHQWFRPPXQLFDWLRQDQGFRPSXWHUVNLOOV :LOOLQJWRWUDYHO 5RRPIRUJURZWK

129RIIHUVDFRPSHWLWLYHEHQHILWVSDFNDJHLQFOXGLQJ LQGXVWU\FRPSHWLWLYHVDODU\FRPSDQ\SDLGEHQHILWVYHKLFOH DOORZDQFHDQGHPSOR\HHGLVFRXQWV 7RDSSO\SOHDVHFDOOID[RU HPDLO&DQDGDUHFUXLWLQJ#QRYFRP :HWKDQNDOODSSOLFDQWVRQO\WKRVHXQGHUFRQVLGHUDWLRQZLOOEH FRQWDFWHG

 $'"$'#$'")$#$*)%-+()$*',()) 



!  "

3257$%/( 32:(5


Page 24

THE TRADER EXPRESS, FRIDAY, JULY 20, 2012

CAREERS Kitchen Helpers/ Short Order Cooks Tower Cafe is looking for 2 cooks for permanent full-time employment Prepare & cook pizzas, salads, sandwiches as ordered. Set up & stock line to maintain proper levels of ingredients required. Train new staff. Use proper weights & measurements to make/prepare consistent product. Clean equipment & clean line & work area as required. Must be available to work until midnight. $13.00 per hour permanent full time available. Apply in person with resume to

1124 4th Street Estevan

/LQH/RFDWRU$VVLVWDQW Wanted for outdoor work in the oilfield, combination of walking, standing and bending. Attention to detail, hand-eye coordination and willingness to learn are definite assets. H2S and First Aid/CPR required, employer willing to train. No experience necessary.

CONSTRUCTION LTD. SEWER & WATER INSTALLATIONS â&#x20AC;¢ CUSTOM CRUSHING & WASHING AVAILABLE

*OHQ3HWHUVRQ&RQVWUXFWLRQ6. OHDGHU LQ DJJUHJDWH WUXFNLQJ FRQFUHWH FRQVWUXFWLRQ DQGVHZHUDQGZDWHULQVWDOODWLRQVLVJURZLQJ ,PPHGLDWHRSHQLQJVIRU 6DIHW\&RRUGLQDWRU 0XVWKDYH&25VDIHW\SURJUDPDQGDOOVDIHW\TXDOLÃ&#x20AC;FDWLRQV IRU6HZHUDQG:DWHU&RQFUHWHFRQVWUXFWLRQDQGDJJUHJDWH RSHUDWLRQV)XOOWLPHSRVLWLRQ7RSZDJHVIRUULJKWSHUVRQ 7HFKQLFDO(QJLQHHU \HDUVH[SHULHQFH0XVWEHDEOHWRUXQOLHFDVXUYH\HTXLSPHQW )XOOWLPH:DJHVGHSHQGRQH[SHULHQFH 6HZHU :DWHU/DERXUHUV2SHQLQJV KRXUGHSHQGLQJRQH[SHULHQFH (TXLSPHQW2SHUDWRU ([SHULHQFHLQRSHUDWLQJORDGHUVKRHVGR]HUVDQGFUXVKHUD GHÃ&#x20AC;QLWHSOXV0XVWEHGHSHQGDEOH)XOOWLPHSRVLWLRQ:DJH GHSHQGLQJRQH[SHULHQFH 'LHVHO0HFKDQLF 0XVWKDYHWRROV([SHULHQFHLQGLHVHOK\GUDXOLFVHOHFWULFDO V\VWHPV:HOGLQJDELOLW\SUHIHUUHG7RSZDJHIRUULJKWSHUVRQ

,QWHUHVWHGDSSOLFDQWVFDQFDOO 7\OHUDWRU ID[UHVXPHWR &RQFUHWH)RUHPDQ2SHQLQJV \HDUVH[SHULHQFHLQDOOSKDVHVRIFRQFUHWHZRUN:DJH GHSHQGLQJRQH[SHULHQFH &RQFUHWH/DERXUHUV2SHQLQJV 0XVW KDYH UHOLDEOH WUDQVSRUWDWLRQ :DJH   KRXU GHSHQGLQJRQH[SHULHQFH 'ULYHUSRVLWLRQV ([SHULHQFH ZLWK WDQGHPV EHOO\ GXPSV ORDGHUV $7UDLQ DQG%7UDLQOLFHQFHUHTXLUHG/RRNLQJIRUDORQJWHUP RSSRUWXQLW\"

,I\RXZRXOGOLNHWRDSSO\IRU DQ\RIWKHVHSRVLWLRQVSKRQH 6DPDWRUID[UHVXPHWR

Apply in person to:

Quest Line Locators Ltd. 104C Perkins Street or email questlocators@sasktel.net

*OHQ3HWHUVRQ&RQVWUXFWLRQ/WGLVDQHTXDORSSRUWXQLW\ HPSOR\HUGHGLFDWHGWRDVDIHGUXJIUHHZRUNSODFH:H RIIHUH[FHOOHQWZDJHVDQGEHQHÃ&#x20AC;WVSOXVRYHUWLPH LQFHQWLYHVDQGERQXVHV 

3URXGWRVHUYH (VWHYDQDQG$UHDIRURYHU

\HDUV

LVVHHNLQJD

+($/7+$1'6$)(7< &225',1$725 $GYDQFH'ULOOLQJDOHDGLQJGULOOLQJFRPSDQ\LVORRNLQJIRU D+($/7+$1'6$)(7<&225',1$725WREHSDUWRIRXU LQGXVWU\OHDGLQJRUJDQL]DWLRQ

Glen Peterson Construction Ltd. 314 - 6th Street, Estevan, SK S4A-2V7 Ph: 306â&#x20AC;¢634â&#x20AC;¢2741 Fax: 306â&#x20AC;¢634â&#x20AC;¢4643 or E-mail construction@glenpeterson.ca

Visit us on the web! www.estevanmercury.ca

7KHH[SHULHQFHGLQGLYLGXDOZLOOEHUHVSRQVLEOHIRU LPSOHPHQWLQJFRPSDQ\KHDOWKVDIHW\DQGHQYLURQPHQWDO  SROLFLHVDQGSURFHGXUHV LGHQWLI\KHDOWKDQGVDIHW\KD]DUGVHYDOXDWHULVNV  FRPSOHWHVLWHLQVSHFWLRQVLQFLGHQWLQYHVWLJDWLRQV PDLQWDLQFRPSOLDQFHZLWKVDIHW\GDWDEDVHVLQFOXGLQJ  ,61HWZRUOGDQG&RPSO\ZRUNV HQIRUFHFRPSOLDQFHZLWKJRYHUQPHQWUHJXODWLRQVSROLFLHV  DQGVWDQGDUGV 7KH+6(FRRUGLQDWRUZLOOKDYHWKHSURYHQDELOLW\WRSURYLGHVWURQJ OHDGHUVKLSFRPPLWPHQWZKLOHZRUNLQJZLWKLQDGLYHUVHJURXSRI SHRSOHWRPDLQWDLQDVWURQJVDIHW\DWWLWXGH7KH\ZLOOKDYHDÃ&#x20AC;UP XQGHUVWDQGLQJLQLQFLGHQWLQYHVWLJDWLRQSURFHGXUHVDQGUHODWHG OHJLVODWLRQVDQGUHJXODWLRQVDWWKHIHGHUDOSURYLQFLDODQGORFDO ORFDOOHYHOV7KH\ZLOOKDYHH[FHOOHQWFRPPXQLFDWLRQVNLOOVDQG FRPSXWHUVNLOOVZLWKSURÃ&#x20AC;FLHQF\LQ06:RUGDQG([FHO7KH\ZLOO DOVRKDYHDVWURQJNQRZOHGJHDQGXQGHUVWDQGLQJRIWKHRLODQG JDVLQGXVWU\7KHVXFFHVVIXODSSOLFDQWZLOOEHFRQVWDQWO\VHHNLQJ ZD\VWRLPSURYHLPSURYHDOODVSHFWVRIWKH+6(SURJUDPVRIWKH FRPSDQ\DQGPRWLYDWLQJDSRVLWLYHFKDQJHWRDFKLHYHSURIRXQG VDIHW\JRDOV ,I\RXDUHGHGLFDWHGWRSURYLGLQJDVDIHDQGKHDOWK\ZRUNLQJ HQYLURQPHQWSOHDVHVHQG\RXUUHVXPHDQGFXUUHQW+6 &RQÃ&#x20AC;QHG6SDFH)LUVW$LGDQG:+0,6FHUWLÃ&#x20AC;FDWHVWR 'HYRQLDQ6WUHHW 32%R[ (VWHYDQ6DVNDWFKHZDQ 6$+ (PDLONDXEHUW#PHFRP 3KRQH  

)D[  

LVVHHNLQJD

EXCAVATING, SAND AND GRAVEL â&#x20AC;¢ REDI-MIX CONCRETE

+DLUVW\OLVW:DQWHG IRURXUEXV\VDORQ )OH[LEOHKRXUV

&DOO.DUDDW RU

3/$7,180

+$,5'(6,*1

+($9<'87< 0(&+$1,& $GYDQFH'ULOOLQJDOHDGLQJGULOOLQJFRPSDQ\LVORRNLQJIRUD +HDY\'XW\0HFKDQLFORFDWHGLQ(VWHYDQ6DVNDWFKHZDQ 7KHVXFFHVVIXOFDQGLGDWHZLOOEHDOLFHQVHGPHFKDQLFZLWK H[SHULHQFHSURYLGLQJSUHYHQWDWLYHPDLQWHQDQFHDQGUHSDLUV WRGLHVHOPRWRUVWUDLOHUVDQGSHUIRUPLQJLQVSHFWLRQVDQG VDIHWLHV ,QGHSWKNQRZOHGJHRIK\GUDXOLFV\VWHPVGLHVHOHQJLQHV $ELOLW\WRGLDJQRVHDQGWURXEOHVKRRW $EOHWRSHUIRUPFRPSOHWHUHSDLUDQGRYHUKDXOIXQFWLRQV :LOOLQJQHVVWRZRUNRYHUWLPHZKHQUHTXLUHG 0DLQWDLQDFOHDQGULYLQJUHFRUG &OHDQ'ULYHU·VDEVWUDFWDQGYDOLG'ULYHU·V/LFHQVH $EOHWROLIWOEV &DQGLGDWHVPXVWEHDEOHWRZRUNLQGHSHQGHQWO\PDLQWDLQ DVDIHDQGFOHDQZRUNDUHD$GYDQFH'ULOOLQJRIIHUVDQ H[FHOOHQWEHQHÃ&#x20AC;WDQGZDJHSDFNDJHWKRXJKWKHVXFFHVVIXO DSSOLFDQWVKRXOGEHSUHSDUHGWRVXSSO\WRROVIRUWKHSRVLWLRQ

,QWHUHVWHGFDQGLGDWHVGURSUHVXPHRIIDW 'HYRQLDQ6WUHHW 32%R[ (VWHYDQ6DVNDWFKHZDQ 6$+ (PDLONDXEHUW#PHFRP 3KRQH   )D[   3OHDVHQRWH7KDQN\RXLQDGYDQFHIRUDOOWKDWKDYH VXEPLWWHGUHVXPHVEXWRQO\WKRVHZKRKDYHEHHQ FKRVHQIRUDQLQWHUYLHZZLOOEHFRQWDFWHGGLUHFWO\

12073AT00


THE TRADER EXPRESS, FRIDAY, JULY 20, 2012

Page 25

CAREER OPPORTUNITIES '(/,9(5<'5,9(5   IRU

&DQDGD3RVW0DLO6HUYLFH

Local SE Gravel operation is looking for experienced

Class 1A Drivers Pay will be according to experience, Medical & Dental benefits available. Fax resume with references and Drivers Abstract to: (306) 634-4167 or email: chamneycrushing@hotmail.com

/HDVH RSHUDWRU UHTXLUHG ZLWK ODWH PRGHO PLQLYDQLQJRRGFRQGLWLRQIRU&$1$'$ 3267PDLOGHOLYHULHVLQWKH&LW\RI(VWHYDQ 3DUWWLPHSRVLWLRQDSSUR[LPDWHO\KRXUV SHU GD\ 0RQGD\ WR )ULGD\$EOH WR ZRUN LQGHSHQGHQWO\DQGDVSDUWRIDWHDP

)8//7,0()5217&2817(5 0$,17(1$1&(3(5621 DQG

3$577,0(:$6+$77(1'$176 'URSUHVXPHRIIDW

3OHDVHID[UHVXPHWR $WW´0DQDJHUµ

WK6W (VWHYDQ

LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!









!  

 !   160%+.*#42#44'&5*'  6&)'58*+%*+0%.6&'&#10'/+..+0%3'#4'#0&%105+06'451 /''55*'.10)5'3/(+0#0%+#.)1#.45*#58'3''45#$.+4*'&+0       '&6%''92'0&+563'4#0&+0%3'#4'3'7'06'4(31/15*'34163%'45*#02312'35: 5#9#5+10   #"  '7'06'(31/5*'3163%'4<+0%3'#4'&51 +0  (31/ +0   2'3#5+0)92'0&+563'4<#3)'0%3'#4'+0$15*3'7'06'#0&'92'0&+563'4(31/ 2'%53#.#%'45"'#312'3#5+0)#48'..#4'0*#0%'&4'37+%'4+01654+&' 12'3#5+10446%*#4)3#44%655+0)512317+&'4'37+%'+0'25'/$'3#0&%51$'31( '#%*:'#3&645%10531.215*1.'2#5%*+0)'5%*'3'#3'0'8'/2.1:''214+5+104 (#%513'&+051/''5)3185*&'/#0&4#0&#0'8*6/#03'4163%'4*#3+0)2.#05*#5 5#-'4#&7#05#)'1(4'#410#.813-&'/#0&4$'58''0#3-46$.+%!13-4      317+&'#0#22319+/#5' (31/5*''0'3#.60&(13#2+5#.31,'%54   #"  317+&+0)+0'9%'441( (31/5*''0'3#.60&(13#2+5#.31,'%54      317+&'#0#22319+/#5' (31/5*' 5+.+5:60&(13#2+5#.31,'%54   #"  317+&+0)+0'9%'441((31/5*' 5+.+5:60&(13#2+5#.31,'%54      &&3'445*'*+)*%1//'3%+#.2312'35:5#9#5+103#5'   #"  !+../#+05#+03'4+&'05+#.#0&%1//'3%+#.2312'35:5#9'4#441/'1(5*'.18'45+0 #4-#5%*'8#0+5+'4  *'+5:+47'3:2.'#4'&51#00160%'5*#55*'%633'05.'7'.1(4'37+%'2317+&'&8+..$' /#+05#+0'&13'0*#0%'&#0&#06/$'31(0'8+0+5+#5+7'4231)3#/4#0&231,'%54#3'$'+0) 60&'35#-'0   0/5*/6"5*0/0'453"5&(*$&26*1.&/53&1-"$&.&/546$)"4536$,4"/%.08&34 503&%6$&3&1"*3"/%."*/5&/"/$&$0454  0/5*/6&%*/$3&"4&%&.1)"4*40/"11&"3"/$&0'5)&*5:

 &/4*/(50/3&&/4"3,*()5*/(  &/4*/(50/3&&/4"3,-"/5*/(

 30+"/"3,8"-&*()5*/(  30+"/"3,)"4&   03(&40/"3,  &/4*/(50/3&&/4"3,3"*/"(&0/%3&"  03&3&$5"/(-&1"5)8":4 &*463&&/53&"3,*/(054 *-/&3&4$&/5065)&(  3"''*$*()54&/4*/(50/"/%&70/*"/  0"%3&$0/4536$5*0/503.&8&30/-&9"/%3"*/(507"  0"%3&$0/4536$5*0/&/4*/(50/7&/6&  0"%3&$0/4536$5*0/5"350'*/(53&&5&)"#*-*5"5*0/  0"%&$0/4536$5*0/!"5&3."*/4503.&8&3;6/$"/0"% 0"% 1(3"%&56%:;*45&30%%:0"% 41)"-57&3-":&3&((&-"-"$& 3%5 5)7&00/&:% 0/5*/6&%46110350'1"1&3"/%$"3%#0"3%3&$:$-*/( "9/$&/5*7&30(3". 00'&1"*3;45&7"/35"--&3:"/%64&6. 1&$53"-"$&;0/$&354"/%7&/5426*1.&/5 &.&5&3:"/%"3,4"/%4$"1*/(30+&$54 !"5&3&4&370*3 !"45&8"5&33&"5.&/5-"/5 1(3"%&4 

 006#.60+%+2#.312'35:5#9'410#2312'35:8+5*#5#9#$.'7#.6'1( 816.& 2#:  5*7=*&7 -&9.8 5*72439-(135*'#..5*'4'37+%'45*'+5:2317+&'4 #0&+4%1/2#3#$.'13.'445*#0:163'.'%53+%#.$+..105*#54#/'4+;'&*164'13:163 %1/$+0'&2*10'%#$.'#0&+05'30'5$+..  1/'1(5*'4'37+%'45*#5:1635#9&1..#32317+&'4#3'  .7*749*(9.43 &7081&=,74:3)8&3)&))1.3,4418 7**&.39*3&3(* 41.(*749*(9.43 486:.94439741 3.2&1439741&3)3.2&1-*19*7 #**)439741 74,7&28+47=4:9- 4:7.82 (4342.(*;*1452*39 7&38.9+479-*.8&'1*) 4:7.8"&11*=*.8:7**397* 4(&1*,.43&1.'7&7.*8 7*3&8 4((*75.9(-*8 .75479 97**9.,-98 &5.9&174/*(98 89*;&37984:3(.1 89*;&379&11*7=:8*:2 #44)1&<3*,.43&1&70 34<7*24;&1&3)897**98<**5.3, &11.&243)8 =1&<3+47(*2*39 :'8.).>*)-4:8.3,.35&793*78-.5<.9- *33.84:798 9-*74;.3(.&1*)*7&14;*732*398 0&9*5&70 97**9&3)&(011*=&.39*3&3(* 97**9&(011*=34<*24;&1 :'8.).>*)*.8:7**7;.(*8+47%4:9- :89439741   "1635#9&1..#3+4#..1%#5'&#4(1..184  "   $ 4:3(.1  3,.3**7.3,*7;.(*8   &3)*;*1452*39*7;.(*8  (4342.(*;*1452*39 4:7.82   *,.81&9.;**7;.(*8   47547&9**7;.(*8  :19:7&1*7;.(*8   .3&3(.&1*7;.(*8   .7**7;.(*8   :'1.(#4708*7;.(*8  41.(**7;.(*8  *.8:7**7;.(*8  *'9*5&=2*39   &5.9&174/*(98  

    48'..5*'3'+4#4'2#3#5'5#9.'7:(135*''#.5*'7:5*#5#7'3#)'42'3:'#3 #0&3'%:%.+0)5*#5#7'3#)'4 2'3:'#3   !  *'+5:#.41*#4#!#5'3'8'3 5+.+5:60&#0&#1.+&!#45' 5+.+5:60&*'4' #3'+0'44'0%'4'2#3#5'$#0-#%%160548*'3'3'7'06')'0'3#5'&#0&'92'04'42#+&#3' #%%1605'&(13  *'3'8#4#+0%3'#4'+05*'!#5'3'8'3 5+.+5:60&#0&01+0%3'#4'+05*'1.+& !#45' 5+.+5:60&  05*'!#5'3'8'3 5+.+5:60& 1('7'3:&1..#3$+..'&)1'451518#3&42#:+0) .10)5'3/&'$5#4%1/2#3'&51 +05*'312'35:#960&*'&'/#0&41(5*' 5+.+5:60&#3'10)1+0)#0&231,'%54$'+0)2#+&(13+0%.6&'   !#5'33'#5/'05.#05 2)3#&'4  '4'371+3  !#5'3#+0'2.#%'/'054 

(IÃ&#x20AC;FLHQF\(IIHFWLYHQHVV ([FHOOHQFH

LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!

LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!

LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!

LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!



  % $!

LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!

LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!

(67(9$17+((1(5*<&,7< LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!

LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!

&,7<3$*(

LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!


Page 26

THE TRADER EXPRESS, FRIDAY, JULY 20, 2012

(67(9$16. 7LFNHWVFDQEHSXUFKDVHGWKURXJK WLFNHWPDVWHUÂ&#x160;RQOLQHDWKWWSWLFNHWPDVWHUFD RUWLFNHWPDVWHUÂ&#x160;&KDUJHE\3KRQHDW

6XQGD\$XJXVW 12:216$/(

At The Library..... Saturday, 21 July @ 2:30 pm â&#x20AC;&#x201C; Armchair Travel: South of the Border/Northern States â&#x20AC;&#x201C; Join Janet McPherson, who will discuss her travels to Williston (ND), Yellowstone National Park (WY), Cody (WC), Medora (ND) and Bismarck (ND). She will talk about activities to do along the way. Come learn to plan an eventful, affordable road trip this summer! Monday, 23 July â&#x20AC;&#x201C; Celebrate: National Vanilla Ice Cream Day! â&#x20AC;&#x201C; Come to the Estevan Public Library & receive one free vanilla ice cream when you check out 2 or more items! For children and adults! Tuesday, 24 July @ 5:30 pm â&#x20AC;&#x201C; Crafterâ&#x20AC;&#x2122;s Circle: Knitting/Crocheting â&#x20AC;&#x201C; Enjoy the company of others with the same interest. Beginners, advanced and master knitters are all welcome. Share your knowledge or benefit from the advice of other crafters. Bring your own materials and come join the circle. No pre-registration required. Adults only. Thursday, 26 July @ 6:00 pm â&#x20AC;&#x201C; Simple Sushi â&#x20AC;&#x201C; Curious about sushi? Come learn to make California rolls and tasty sweet potato tempera rolls. Simply bring an appetite and a container for leftovers! Please indicate any allergies when registering. Friday, 27 July @ 1:00 pm â&#x20AC;&#x201C; Down by the Docks With Daryl Robb & Leroy the Lobster â&#x20AC;&#x201C; Families & all ages welcome! Youâ&#x20AC;&#x2122;ll have claws of fun with childrenâ&#x20AC;&#x2122;s entertainer Daryl Robb & Down by the Docks crew! Join us for a lobstertastic time of singing and high energy performance! No registration necessary. There will be no Baby Time, Toddler Time or Story Time Programs for July & August. Regular sessions will start in September. Effective 17 June, we will be closed Sundays during the summer months. Please pre-register for all programs unless otherwise indicated. Call 636-1621.

3/($6(&$//,1

:DWHU0HWHU5HSODFHPHQWLQWKH3OHDVDQWGDOH$UHD 7KH&LW\RI(VWHYDQZLOOEHFKDQJLQJWKHZDWHUPHWHUVIRUDOOWKRVHUHVLGHQWVWKDW GRQRWFXUUHQWO\KDYHUDGLRUHDGPHWHUV7KHUHLVQRIHHIRUWKLVVHUYLFHKRZHYHU ZHUHTXHVWWKDW\RXFDOO&LW\+DOOWRPDNHDQDSSRLQWPHQWWRDUUDQJHDWLPHWKDWLV FRQYHQLHQWIRU\RX 3OHDVHFDOO$SULODWWRVHWXSDQDSSRLQWPHQWWRGD\

KWWSVSHFWUDSODFHFD KWWSIDFHERRNFRP6SHFWUD3ODFH KWWSWZLWWHUFRP6SHFWUD3ODFH

32/,&(&2167$%/( 7KH(VWHYDQ3ROLFH6HUYLFHZDVHVWDEOLVKHGLQDQGKDVEHHQEXLOWRQDWUDGLWLRQRIH[FHOOHQFH 7KH&LW\RI(VWHYDQKDVH[SHULHQFHGDJUHDWGHDORIJURZWKLQWKHSDVWWKUHH\HDUVHVSHFLDOO\LQWKH HQHUJ\VHFWRULQFOXGLQJRLOFRDOPLQLQJDQGSRZHUJHQHUDWLRQ7KLVJURZWKDQGHFRQRPLFERRPKDV FUHDWHGVHYHUDOFKDOOHQJHVZLWKLQWKH&LW\RI(VWHYDQLQFOXGLQJWKH3ROLFH6HUYLFH 7KH (VWHYDQ 3ROLFH 6HUYLFH LV LQFUHDVLQJ WKH VL]H RI WKH 3ROLFH 6HUYLFH DQG FXUUHQWO\ KDV WZR YDFDQFLHV IRU WKH SRVLWLRQ RI &RQVWDEOH 7KH (VWHYDQ 3ROLFH 6HUYLFH KDV D ULJRURXV DSSOLFDWLRQ SURFHVVKRZHYHUWKLVSURFHVVLVWRHQVXUHWKDWWKHSHRSOHZHKLUHWRZHDUWKH(VWHYDQ3ROLFH6HUYLFHXQLIRUP DUHWKHULJKWSHRSOHIRUWKHMRE ,I\RXDUHKLUHGDVDQHZUHFUXLW\RXZLOOHQWHUDULJRURXVWUDLQLQJSHULRGRIZHHNV7KHĂ&#x20AC;UVWZHHNVZLOO EHDWWKH6DVNDWFKHZDQ3ROLFH&ROOHJHLQ5HJLQD6DVNDWFKHZDQZKHUH\RXZLOOUHFHLYHLQVWUXFWLRQLQFULPLQDO ODZ RIĂ&#x20AC;FHU VDIHW\ VHOI GHIHQFH Ă&#x20AC;UHDUPV UHSRUW ZULWLQJ DQG FURVV FXOWXUDO WUDLQLQJ $IWHU JUDGXDWLQJ IURP WKH 3ROLFH&ROOHJH\RXZLOOUHFHLYHDIXUWKHUZHHNVRIĂ&#x20AC;HOGWUDLQLQJXQGHUWKHJXLGDQFHRID)LHOG7UDLQLQJ2IĂ&#x20AC;FHU ([SHULHQFHGPHPEHUVDUHHQFRXUDJHGWRDSSO\7KH(VWHYDQ3ROLFH6HUYLFHRIIHUVDQH[FLWLQJFDUHHULQODZ HQIRUFHPHQWZLWKH[FHOOHQWEHQHĂ&#x20AC;WVDQGDFRPSHWLWLYHVDODU\

COMMUNICATIONS OFFICER (Dispatcher)

Duties and Responsibilities: The successful candidate will demonstrate excellent interpersonal communication skills. This person will handle incoming telephone calls, general public inquiries and complaints, and will communicate via radio transmissions with members on patrol. Must be able to work independently under stress as well as produce a high degree of accuracy.

7RDSSO\RUUHFHLYHIXUWKHULQIRUPDWLRQSOHDVHVHHFRQWDFWLQIRUPDWLRQEHORZ $SSOLFDWLRQSDFNDJHVFDQEHSLFNHGXSDWWKH(VWHYDQ3ROLFH6HUYLFHRUPDLOHGRXWXSRQUHTXHVW 3OHDVHUHWXUQWKHFRPSOHWHGSDFNDJHZLWKDQXSGDWHGUHVXPHLQDVHDOHGHQYHORSHWR

(VWHYDQ3ROLFH6HUYLFH WK$YH(VWHYDQ6DVNDWFKHZDQ6$&RUFDOO <RXFDQDOVRHPDLOVFKDUWUDQG#HVWHYDQSROLFHFDRU MSLHUVRQ#HVWHYDQSROLFHFD 'HO%ORFN²&KLHIRI3ROLFH(VWHYDQ3ROLFH6HUYLFH

7D[1RWLFHV

7D[1RWLFHVZHUHPDLOHGRXWRQ7KXUVGD\-XQH ,I\RXKDYHQRWUHFHLYHG\RXUQRWLFHSOHDVHFRQWDFW7ULQDDW 7D[HVDUHGXHRQ-XO\ 3HQDOWLHVDUHDFFXPXODWLYHDQGVWDUW$XJXVWVWLQWKHDPRXQWRI6HSWHPEHU 2FWREHU1RYHPEHU'HFHPEHU $UUHDUV3HQDOW\RIZLOOEHDGGHGWRDOORXWVWDQGLQJDPRXQWVRQ-DQXDU\ 

Outdoor Fire Pit Safety

With summer just around the corner, itâ&#x20AC;&#x2122;s time for families to enjoy an evening around their backyard fire pits. To ensure your summer fun is not dampened, keep in mind a few fire safety tips while using your outdoor fire pit. -Many people are allergic to smoke, so be courteous to your neighbours and donâ&#x20AC;&#x2122;t allow smoke from your fire to interfere with their enjoyment of the outdoors. -Keep your fire manageable. Large fires can give off excessive amounts of heat, which could easily ignite surrounding combustible materials (fences, decks, sheds). -Never start a fire in your pit with flammable liquids. Remember your boy scout days, and start it with small kindling. -Small children should always be kept a safe distance from the fire pit. -Keep a garden hose nearby, just in case hot embers do escape. -Never leave your fire unattended. Before you retire for the evening, soak your fire down with water to ensure all hot embers are completely extinguished. -A permit is required for all outdoor fire pits. Theyâ&#x20AC;&#x2122;re free. Just drop by the Fire Hall for a permit application. -If requested to extinguish your fire by a City Official (Police or Fire), please do so immediately. Failure to comply will result in a revoked permit, and a fee for service should the Fire Department be called to extinguish it on your behalf. Be fire safe and enjoy your fire pit this summer.

Journeyman Electrician The City of Estevan is searching for a reliable self-starter who is independent, has initiative and takes pride in their trade. What weâ&#x20AC;&#x2122;re looking for; â&#x20AC;˘ Licenced Interprovincial Journeyman Electrician â&#x20AC;˘ Proficiency in Computer Software â&#x20AC;˘ Monday to Friday availability - occassional weekends for special events â&#x20AC;˘ Driverâ&#x20AC;&#x2122;s Licence - Class 5 Kelvin Pillipow, Human Resources Co-ordinator We offer; 1102-4th Street â&#x20AC;˘ Great schedule with varied Estevan, SK S4A 0W7 duties P: (306) 634-1842 â&#x20AC;˘ Strong work life balance F: (306) 634-9790 â&#x20AC;˘ Competitive wage hr@estevan.ca â&#x20AC;˘ Great people to work with

Only successful candidates will be contacted.

/,)(*8$5'6 0RUHWKDQDJUHDWSD\FKHTXHDFDUHHUZLWKDGLIIHUHQFH 3HUPDQHQW)XOO7LPH3RVLWLRQV 5HTXLUHPHQWV Â&#x2021;&XUUHQW&HUWLĂ&#x20AC;FDWLRQLQ Â&#x2021;1DWLRQDO/LIHJXDUGLQJ6HUYLFHV  %URQ]H&URVV0HGDOOLRQ

Â&#x2021;$VVLVWDQW:DWHU6DIHW\,QVWUXFWRU:6, Â&#x2021;)LUVW$LG&35 Â&#x2021;(QVXUHWKHVDIHW\RI$TXDWLF&HQWUH*XHVWV

(QMR\ Â&#x2021;*UHDWZRUNHQYLURQPHQW Â&#x2021;&RQWLQXRXVOHDUQLQJRSSRUWXQLWLHV Â&#x2021;2XWVWDQGLQJEHQHĂ&#x20AC;WSDFNDJH Â&#x2021;:RUNLQJZLWKJUHDWSHRSOH

Â&#x2021;,QVWUXFWOHVVRQVIRUFKLOGUHQDQGDGXOWV DOLNH Â&#x2021;$GPLQLVWHU)LUVW$LGLQWKHHYHQWRIDQ HPHUJHQF\ Â&#x2021;.HHSHQYLURQPHQWFOHDQDQGIUHHRI KD]DUGV

$SSO\WR .HOYLQ3LOOLSRZ+XPDQ5HVRXUFHV )RXUWK6WUHHW(VWHYDQ6.6$: 3KRQHÂ&#x2021;)D[ (PDLOKU#HVWHYDQFD

&,7<2)(67(9$1127,&( People are reminded that boulevards cannot be used for parking of any private property such as but not limited to the following:

Ă&#x2DC;  Boats Ă&#x2DC;  Campers Ă&#x2DC;  Trailers

Ă&#x2DC;  Fishing Shacks Ă&#x2DC;  Vehicles

Ă&#x2DC;  Skidoos Ă&#x2DC;  Quads

As well, people are reminded that City property cannot be used for any purpose such as storing construction materials, dirt or materials while working on your own property without permission from the City and that permits are required from Engineering Division for any work being done on City Property .  For further information contact 306-634-1800 and your co-operation is appreciated.

6XPPHU&DPSDWWKH($*0 $UH\RX"$UH\RXH[FLWHGDERXWPDNLQJDZHVRPHDUW" 7KHQ WKH (VWHYDQ $UW *DOOHU\ DQG 0XVHXP KDV H[FLWLQJ QHZV IRU \RX  :HŇ&#x2039;UH UXQQLQJ WKUHH DPD]LQJ VXPPHU DUW FDPSVDQGZHZDQW<28WRFRPHMRLQXV ,QFUHGLEOH,QVWDOODWLRQV -XO\DPQRRQ25SPSP ZLOOOHW\RXZRUNZLWK\RXUSHHUVWROHDUQ DERXWLQVWDOODWLRQDUWDQGFUHDWH\RXUYHU\RZQH[KLELWHQYLVLRQLQJWKHIXWXUHRI(VWHYDQ:HŇ&#x2039;OOKDYH DQRSHQLQJMXVWIRU\RXUZRUNRQ+HULWDJH'D\-XO\DWSPDQG\RXUZRUNZLOOKDQJLQWKHJDOOHU\ IRUDOORI$XJXVW 5HJLVWHU12:2QO\SHUZHHNSHUFKLOG&DOOXVDWHPDLO.DUO\DWJDOOHU\HG# VDVNWHOQHWRUFRPHWRWKH($*0DWWK6W5HJLVWHUHDUO\VSDFHLVOLPLWHG

LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!

LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!

LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!

LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!

(67(9$17+((1(5*<&,7<

LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!

LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!

&,7<3$*(

LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!

LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!

LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!

LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!


THE TRADER EXPRESS, FRIDAY, JULY 20, 2012

$FFRUGLQJWR6HFWLRQ  RIWKH7UDIÃ&#x20AC;F6DIHW\$FW1RSHUVRQVKDOORSHUDWHDPRWRUYHKLFOHWUDLOHU RUVHPLWUDLOHURQDKLJKZD\XQOHVVDFHUWLÃ&#x20AC;FDWHRIUHJLVWUDWLRQRUUHJLVWUDWLRQSHUPLWLVREWDLQHG SXUVXDQWWRWKLV$FWZLWKUHVSHFWWRWKHYHKLFOH WKLVDOVRDSSOLHVLI\RXUYHKLFOHWUDLOHURUVHPL WUDLOHULVSDUNHGRQWKHVWUHHWRUKLJKZD\ )LQHVIRUWKLVRIIHQFHFDQEHXSWR IRUYHKLFOHV  DQG IRUXQUHJLVWHUHGWUDLOHUV DQG\RXUYHKLFOHPD\EHVHL]HGXQGHU6HFWLRQRIWKH 7UDIÃ&#x20AC;F6DIHW\$FW  $FFRUGLQJWR%\ODZ6HFWLRQ$1RSHUVRQVKDOOULGHDVNDWHERDUGRQWKHIROORZLQJ VWUHHWV )URPWKDYHQXHWRWKDYHQXH )URPUGVWUHHWWRWKVWUHHW 1RSHUVRQVKDOOULGHDVNDWHERDUGRQDQ\SULYDWHRUSXEOLFSURSHUW\RQZKLFKVLJQV DUHORFDWHGSURKLELWLQJVNDWHERDUGLQJ $Q\3ROLFH2IÃ&#x20AC;FHUPD\LPSRXQGDQ\VNDWHERDUGWKDWLVXVHGLQFRQWUDYHQWLRQWRWKLV6HFWLRQ$Q\ VNDWHERDUGLPSRXQGHGVKDOOEHVWRUHGDWDQ\SODFHDXWKRUL]HGE\WKH3ROLFH&KLHIIRUDQ\SHULRG QRWH[FHHGLQJGD\VIURPWKHGDWHRILPSRXQGPHQW

7(1'(5

7KH&LW\RI(VWHYDQLQYLWHVWHQGHUVWRFRPSOHWHWKHIROORZLQJZRUNV  7HQGHU(66L[WK6WUHHW:DWHUPDLQ5HSODFHPHQW  WK$YHQXHWK$YHQXH

   7HQGHUSDFNDJHVDUHDYDLODEOHDWWKH/HJLVODWLYH6HUYLFHV%XVLQHVV'LYLVLRQ²/RZHU/HYHO ²&LW\+DOO)RUIXUWKHULQIRUPDWLRQUHJDUGLQJWKLVWHQGHUSOHDVHFRQWDFW-DQNLW3DWHODW )D[RUHPDLOHQJWHFK#HVWHYDQFD  ,QWHUHVWHG&RQWUDFWRUVDUHLQYLWHGWRVXEPLWVHDOHGHQYHORSHVPDUNHGZLWKWKH UHVSHFWLYH7HQGHU1XPEHUWRWKHIROORZLQJE\30ORFDOWLPH7KXUVGD\$XJXVW  /HJLVODWLYH6HUYLFHV%XVLQHVV'LYLVLRQ 0DLQ)ORRU²)RXUWK6WUHHW &LW\RI(VWHYDQ (VWHYDQ6.6$:  3XEOLFRSHQLQJRIWHQGHUVVKDOOWDNHSODFHDW30ORFDOWLPH7KXUVGD\$XJXVW LQWKH&RXQFLO&KDPEHUV&LW\+DOO(VWHYDQ6DVNDWFKHZDQ 7KH&LW\RI(VWHYDQUHVHUYHVWKDWULJKWWRUHMHFWDQ\RUDOOWHQGHUVDQGWKHORZHVWWHQGHU PD\QRWQHFHVVDULO\EHDFFHSWHG

&LW\RI(VWHYDQ 38%/,&127,&( 7KH&RXQFLORIWKH&LW\RI(VWHYDQSXUVXDQWWR6HFWLRQRIWKH3ODQQLQJDQG'HYHORSPHQW$FWJLYHVQRWLFHRI LWVLQWHQWLRQWRDPHQG=RQLQJ%\ODZ WKHFRUUHVSRQGLQJ=RQLQJ0DSDVKHUHLQDIWHUSURYLGHG  7RUHSHDO%\ODZ  7RUH]RQHWKHIROORZLQJSURSHUW\DVGHVFULEHGEHORZ D    

6XUIDFH3DUFHO1XPEHUORFDWHGLQWKH1RUWKZHVW4XDUWHU6HFWLRQ7RZQVKLS 5DQJH:HVWRIWKH6HFRQG0HULGLDQ(VWHYDQ6DVNDWFKHZDQWREHUH]RQHGWRWKHIROORZLQJ ]RQHGHVLJQDWLRQVLQDFFRUGDQFHZLWKD3ODQRI3URSRVHG6XEGLYLVLRQSUHSDUHGE\7KRPDV 6DPVRQ6/60LGZHVW6XUYH\V,QFDQGGDWHG-XQH

L 

Residential Low Density-Single Detached Zone (R1) Â&#x2021; %ORFNV05

LL Residential Medium Density Zone (R3)  Â&#x2021; %ORFNV

LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!

LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!

7LSRIWKH:HHN

(67(9$17+((1(5*<&,7<

LLL Residential Manufactured Home Neighborhood Zone (R6)  Â&#x2021; %ORFNV05050505 LY Residential High Density Mixed-Use Zone (R4)  Â&#x2021; %ORFNV0505 Reason7KH%\ODZLVLQWHQGHGWRVXSSRUWSURSRVHGFKDQJHVIRUDSODQQHG¶PL[HGXVH·5HVLGHQWLDOVXEGLYLVLRQ QHLJKERUKRRGGHYHORSPHQWNQRZQDV´WKH0HDGRZVµ7KH%RXQGDULHVRIWKHYDULRXVSURSRVHG]RQLQJGHVLJQDWLRQVDUH VKRZQRQWKHDFFRPSDQ\LQJSODQ 7KHDPHQGLQJ%\ODZ  PD\EHLQVSHFWHGE\DQ\SHUVRQDWWKH/HJLVODWLYH6HUYLFHV%XVLQHVV'LYLVLRQ&LW\ +DOOWK6WUHHW(VWHYDQ6DVNDWFKHZDQEHWZHHQWKHKRXUVRIDPSP0RQGD\WR)ULGD\ &LW\&RXQFLODWLW·VPHHWLQJWREHKHOGRQ0RQGD\-XO\DWSPLQWKH&RXQFLO&KDPEHUV&LW\+DOO )RXUWK6WUHHW(VWHYDQ6DVNDWFKHZDQZLOOKHDUDQ\SHUVRQ V ZLVKLQJWREHKHDUGZLWKUHVSHFWWRWKHSURSRVHG UH]RQLQJE\ODZDQGZLOOIXUWKHUFRQVLGHUDQ\ZULWWHQVXEPLVVLRQVUHVSHFWLQJWKHSURSRVHG]RQLQJDPHQGPHQWSURYLGHG VXFKLQWHQWLRQVDQGRUVXEPLVVLRQVDUHUHFHLYHGE\WKH&LW\&OHUN·V2IÃ&#x20AC;FH/HJLVODWLYH6HUYLFHV&LW\+DOO)RXUWK 6WUHHW(VWHYDQ6DVNDWFKHZDQ6$:QRODWHUWKDQSPRQ:HGQHVGD\-XO\ 'DWHGDWWKH&LW\RI(VWHYDQWKLVWK'D\RI-XQH

&LW\RI(VWHYDQ 38%/,&127,&( 7KH&RXQFLORIWKH&LW\RI(VWHYDQSXUVXDQWWR6HFWLRQRIWKH3ODQQLQJDQG'HYHORSPHQW$FWJLYHVQRWLFHRI LWVLQWHQWLRQWRDPHQG=RQLQJ%\ODZ WKHFRUUHVSRQGLQJ=RQLQJ0DSDVKHUHLQDIWHUSURYLGHG &RQVLGHUDWLRQLVEHLQJJLYHQWRDPHQGWKH=RQLQJ%\ODZ0DSE\UH]RQLQJWKHIROORZLQJSURSHUW\DV GHVFULEHGEHORZ ´$OOWKDWSRUWLRQRIWKH1RUWKHDVW4XDUWHU6HFWLRQ7RZQVKLS5DQJH:HVWRIWKH6HFRQG0HULGLDQ (VWHYDQ6DVNDWFKHZDQHQFRPSDVVLQJDSSUR[LPDWHO\KHFWDUHVDVVKRZQRQD3ODQRI3URSRVHG 6XEGLYLVLRQSUHSDUHGE\60'UHZ6/6DQGGDWHGWKHWK'D\RI-XQHµWREHUH]RQHGDVIROORZV D 3URSRVHG/RWV Â&#x2039; WKURXJK%ORFN Â&#x2039; WKURXJK%ORFN Â&#x2039; WKURXJK%ORFN )URPWKHH[LVWLQJ85%$1+2/',1*=21( 8+ WR5(6,'(17,$//2:'(16,7<6,1*/('(7$&+('=21( 5  E 3URSRVHG/RWV Â&#x2039; DQG%ORFN Â&#x2039; WKURXJK%ORFN )URPWKHH[LVWLQJ85%$1+2/',1*=21( 8+ WR5(6,'(17,$//2:'(16,7<0,;=21( 5  F 3URSRVHG/RWV Â&#x2039; %ORFN Â&#x2039; %ORFN Â&#x2039;  %ORFN )URPWKHH[LVWLQJ85%$1+2/',1*=21( 8+ WR5(6,'(17,$/0(',80'(16,7<=21( 5  F 3URSRVHG/RWV Â&#x2039; %ORFN )URPWKHH[LVWLQJ85%$1+2/',1*=21( 8+ WR&200(5&,$/$57(5,$/+,*+:$<=21( &  F 3URSRVHG/RWV Â&#x2039; %ORFN )URPWKHH[LVWLQJ85%$1+2/',1*=21( 8+ WR,167,787,21$/=21( ,1  5HDVRQ5H]RQLQJLVEHLQJXQGHUWDNHQWRVXSSRUWWKHSURSRVHGGHYHORSPHQWRIWKH'RPLQLRQ+HLJKWV3KDVH 6XEGLYLVLRQ %RXQGDULHVRI5H]RQLQJDUHVKRZQRQWKHDFFRPSDQ\LQJ3ODQ

7KHDPHQGLQJ%\ODZ  PD\EHLQVSHFWHGE\DQ\SHUVRQDWWKH/HJLVODWLYH6HUYLFHV%XVLQHVV'LYLVLRQ&LW\ +DOOWK6WUHHW(VWHYDQ6DVNDWFKHZDQEHWZHHQWKHKRXUVRIDPSP0RQGD\WR)ULGD\ &LW\&RXQFLODWLW·VPHHWLQJWREHKHOGRQ0RQGD\-XO\DWSPLQWKH&RXQFLO&KDPEHUV&LW\+DOO )RXUWK6WUHHW(VWHYDQ6DVNDWFKHZDQZLOOKHDUDQ\SHUVRQ V ZLVKLQJWREHKHDUGZLWKUHVSHFWWRWKHSURSRVHG UH]RQLQJE\ODZDQGZLOOIXUWKHUFRQVLGHUDQ\ZULWWHQVXEPLVVLRQVUHVSHFWLQJWKHSURSRVHG]RQLQJDPHQGPHQWSURYLGHG VXFKLQWHQWLRQVDQGRUVXEPLVVLRQVDUHUHFHLYHGE\WKH&LW\&OHUN·V2IÃ&#x20AC;FH/HJLVODWLYH6HUYLFHV&LW\+DOO)RXUWK 6WUHHW(VWHYDQ6DVNDWFKHZDQ6$:QRODWHUWKDQSPRQ:HGQHVGD\-XO\ 'DWHGDWWKH&LW\RI(VWHYDQWKLVWK'D\RI-XQH LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!

LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!

LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!

&,7<3$*(

Page 27

LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!

LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!

LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!

LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!

LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!


Page 28

THE TRADER EXPRESS, FRIDAY, JULY 20, 2012

0(',&$/&(175( .LQJ6WUHHW(VWHYDQ6$7 3KRQH  )$;    Â&#x2021;'U.RÃ&#x20AC;$PX'DUNR Â&#x2021;'U$OOLVRQ&KULVWLH Â&#x2021;'U+DNDQ3HKOLYDQ Â&#x2021;'U(GZDUG7VRL Â&#x2021;1XUVH3UDFWLWLRQHU²/RLV&RIIH\

(67(9$10(',&$/*5283 ²1LFKROVRQ5RDG(VWHYDQ6$ 6 3KRQH  )$;    Â&#x2021;'U-LPL$NLQVHWH Â&#x2021;'U$QGUp*UREOHU Â&#x2021;'U0HKGL+RUUL

0(',&$/&/,1,&6$767-26(3+Ò&#x2039;6+263,7$/35,0$5<+($/7+&$5(&(175( 1LFKROVRQ5RDG(VWHYDQ6$9 Â&#x2021;'U<XVXI.DVLP²6XLWH 3KRQH  )$;   Â&#x2021;'U6XQGD\2ORZX²6XLWH 3KRQH   )$;  

Â&#x2021;'U&KDUOHV22PRVLJKR²6XLWH 6KDORP0HGLFDO&OLQLF 3KRQH   )$;   Â&#x2021;'U.KDOLG06KHLNK²6XLWH 3KRQH   )$;  

4PE]4EVOW -XO\ZLOOEH2O\PSLFV:HHNDWWKH3OD\3DUNV 5XVW\'XFH0RQGD\²0DUEOH6ZLP 7XHVGD\²/LPER&RQWHVW:HGQHVGD\²0RUQLQJ6ZLP7KXUVGD\²6LGHZDON&KDON'UDZLQJ&RQWHVW +LOOFUHVW0RQGD\²-HUVH\'D\7XHVGD\²1LJKW6ZLP SP :HGQHVGD\²%DNH6DOH7KXUVGD\² )LWQHVV'D\ +LOOVLGH0RQGD\²-HUVH\'D\7XHVGD\²2EVWDFOH&RXUVH:HGQHVGD\²6LGHZDON&KDON'UDZLQJ &RQWHVW7KXUVGD\²1LJKW6ZLP SP

&KXUFKLOO0RQGD\²0RUQLQJ6ZLP7XHVGD\²:DWHU%DOORRQ)LJKW:HGQHVGD\²/LPER&RQWHVW 7KXUVGD\²7DOHQW6KRZ 7URMDQ3DUN0RQGD\²6DQG&DVWOH&RPSHWLWLRQ7XHVGD\²)LWQHVV'D\:HGQHVGD\²:DWHU%DOORRQ'D\ 7KXUVGD\²-HUVH\'D\)ULGD\²%DNH6DOH 8SFRPLQJ6DWXUGD\6ZLPV SP  -XO\²&KXUFKLOO -XO\²5XVW\'XFH

3/$<3$5.6029,(1,*+7 'U6HXVVÒ&#x2039;7KH/RUD[ $XJXVWDW+LOOVLGH3DUN

)RUDOOWKHODWHVW3OD\3DUNXSGDWHVVHQG\RXUHPDLODGGUHVVWRSOD\SDUNV#HVWHYDQ FDDQGFKHFNRXWWKHIXOOVFKHGXOHVRQZZZHVWHYDQFD

Ever wonder what happens at a major event? Do you want to make extra money? No plans for the weekend? We are searching for Events staff to assist with the set-up/tear down, seating and parking for events held at Spectra Place.

We offer: â&#x20AC;¢ Opportunity to meet great people â&#x20AC;¢ Flex scheduling â&#x20AC;¢ Chance to be part of the show experience

Do you: â&#x20AC;¢ Have an attention to detail â&#x20AC;¢ Thrive in a fast paced environment â&#x20AC;¢ Work well under pressure â&#x20AC;¢ Enjoy tight deadlines

Be part of a great team, apply to: Kelvin Pillipow, Human Resources Manager 1102 4th Street, Estevan, SK S4A 0W7 E-mail: hr@estevan.ca Phone (306)461-5905

:+$7Ò&#x2039;6+$33(1,1* $77+((67(9$1$576&281&,/ :HDUHEDFNRQWUDFN &XOWXUHRQWKH*R9LVXDO$UWV6WXGLR ´6HOI*XLGHGµ7RXU /HWXVLQWURGXFH\RXWRORFDOWDOHQWHGDUWLVWV *DOOHULHV6WXGLRVDQG´DUWRULHQWHGµEXVLQHVVHV &KRRVHWKHGD\DQGWLPHWKDWVXLWV\RX -8/<²²6LWHVRSHQIURP²SPHDFKGD\ 3LFNXS\RXUEURFKXUHJXLGHDW7RXULVPDQGEHJLQWKHWRXUIURPHLWKHUWKH (VWHYDQ7RXULVP%RRWKRUIURPWKH1RUWK3RUWDO7RXULVP%RRWK &ODVVHV :RUNVKRSV6WDUWXSLQ$XJXVW Â&#x2021;6FUHHQ3ULQWLQJZLWK$VWULG3KLOOLSV²$XJXVW Â&#x2021;5RVHPDOLQJ 6FDQGLQDYLDQDUWVW\OHRISDLQWLQJRQZRRG

ZLWK&KHU\O$QGULVW²2FWREHU  Â&#x2021;:RRGFDUYLQJZLWK'RULV6KHOGRQ ZZZFRWWDJHBFRXQWU\FDUYLQJFRP ²1RY  Â&#x2021;3RWWHU\ZLWK'DUOHQH0DUWLQ&KLOGUHQFODVVHV²1RY 'HF    $GXOW6HVVLRQV²1RY 'HF $QQXDO$GMXGLFDWHG$UW6KRZ1RYHPEHU  )RUGHWDLOVSOHDVHFDOORXURIÃ&#x20AC;FHDW $QGRUYLVLWRXUZHEVLWHZZZHVWHYDQDUWVFRXQFLOFRP (QWU\)RUP21/,1( 9LVLWRXUZHEVLWHIRUIXUWKHULQIRUPDWLRQRQWKLVDQGRWKHUFODVVHV )RUGHWDLOVSOHDVHFDOORXURIÃ&#x20AC;FHDW $QGRUYLVLWRXUZHEVLWHZZZHVWHYDQDUWVFRXQFLOFRP

/,.(8621

6SRUWV&DPSV &$//,1*$//$7+/(7(6,I\RXDUHEHWZHHQWKHDJHVRIDQGIHHOLQJDOLWWOHERUHGWKLV VXPPHU«6SRUWV&DPSVDUHIRU\RX &KHFNRXWWKHVHXSFRPLQJVSRUWVFDPSV 'URSLQ6SRUWV²-XO\$XJXVW 'LYLQJ²-XO\ %0;²$XJXVW /LIH6DYHUV²$XJXVW /DFURVVH²$XJXVW 7KHUHLVVWLOOOLPLWHGURRPDYDLODEOH5HJLVWHUTXLFNO\3LFNXSDIXOOVFKHGXOHDQGUHJLVWHUDWWKH/HLVXUH &HQWUH,QIRUPDWLRQ'HVNWRGD\ ,I\RXKDYHDQ\TXHVWLRQVFRQWDFW/LLVD.OHHPRODDW

&RQVWUXFWLRQ%XOOHWLQ 7KH&LW\RI(VWHYDQLVXQGHUWDNLQJFRQFUHWHZRUNDQGURDGZRUNVDW 'XQFDQ5RDG²3HUU\&UHVFHQWWR0F'RQDOG5RDG7KHSXUSRVHRIWKLVZRUNLVWRSURYLGHWLPHO\DQGFRVWHIIHFWLYH UHSODFHPHQWRIH[LVWLQJFDVWLURQZDWHUPDLQZLWK39&SLSHUHSODFHPHQWRIH[LVWLQJZDWHUDQGVDQLWDU\VHZHU VHUYLFHVIURPZDWHU VHZHUPDLQXSWRWKHSURSHUW\OLQHDQGVXUIDFHUHVWRUDWLRQ7KLVZRUNZRXOGUHTXLUHFORVXUH RI LPPHGLDWH DUHDV RI H[FDYDWLRQ DQG PD\ QHFHVVLWDWH SDUNLQJ UHVWULFWLRQ LQ DGMDFHQW DUHDV 7KLV ZRUN ZLOO FRPPHQFHGXULQJWKHZHHNRI-XQHDQGZLOOWDNHDSSUR[LPDWHO\(LJKW  WR7HQ  :HHNVWRFRPSOHWH VXEMHFWWRZHDWKHU *OHQ3HWHUVRQ&RQVWUXFWLRQ/WGZLOOSHUIRUPWKLVZRUNZLWKLQWKHFXUUHQW%\ODZUHJXODWLRQV :RRGODZQ5HVHUYRLU 7KH&LW\RI(VWHYDQLVXQGHUWDNLQJFRQVWUXFWLRQRID7UHDWHG'ULQNLQJ:DWHU5HVHUYRLU 7KHDIIHFWHGDUHDLQFOXGHV7KH:RRGODZQ$YHQXH5LJKWRI:D\1RUWKRIWKH6W-RVHSK·V+RVSLWDO 7KLV5LJKWRI:D\LVQRWDWKRXJKURDGDQGQRWUDIÃ&#x20AC;FZLOOEHDOORZHGLQWKHDUHDWKDWLVQRWLQYROYHGZLWKWKHUHVHUYRLU FRQVWUXFWLRQ 7KLVZRUNZLOOFRPPHQFH0DUFKDQGZLOOWDNHDSSUR[LPDWHO\WHQ  PRQWKVWRFRPSOHWH /HGFRU&RQVWUXFWLRQ/WGDQG-9 0&RQVWUXFWRUV,QFZLOOSHUIRUPWKLVZRUNZLWKLQWKHFXUUHQW%\ODZUHJXODWLRQVDQG VSHFLÃ&#x20AC;FDWLRQV &RQVWUXFWLRQRQ$OH[DQGUD$YHQXH .LQJ6WUHHWWR+HQU\6WUHHW

7KLVZRUNZRXOGUHTXLUHFORVXUHRILPPHGLDWHDUHDVRIH[FDYDWLRQDQGPD\QHFHVVLWDWHSDUNLQJUHVWULFWLRQLQ DGMDFHQWDUHDV7KLVZRUNZLOOFRPPHQFHGXULQJWKHZHHNRI-XO\DQGZLOOWDNHDSSUR[LPDWHO\WKUHH  WR ZHHNVWRFRPSOHWH VXEMHFWWRZHDWKHU 

6DIHW\ &RQVWUXFWLRQVLWHFRXOGEHGDQJHURXV,I\RXKDYHFKLOGUHQSOHDVHDVNWKHPWRNHHSDVDIHGLVWDQFHIURPWKH VLWH:HZLOOWDNHHYHU\SUHFDXWLRQWRHQVXUHSXEOLFVDIHW\EXWZHQHHG\RXUDVVLVWDQFHWRFRQVWUDLQWKHQDWXUDO FXULRVLW\RI\RXQJHUFKLOGUHQ3OHDVH'2127DWWHPSWWRJRFORVHWRDUHDVDIIHFWHG 7KHIWRU9DQGDOLVP ,I\RXVHHDQ\DFWRIYDQGDOLVPWKHIWRUDQ\RQHVXVSLFLRXVO\WDPSHULQJZLWKHTXLSPHQWVLJQDJHRUEDUULFDGHV SOHDVHFRQWDFWFDOO3ROLFH 4XHVWLRQVDQG&RQFHUQV 7KH&LW\RI(VWHYDQ(QJLQHHULQJ6HUYLFHVDSRORJL]HIRUDQ\LQFRQYHQLHQFHVWKDWWKLVZRUNPD\FDXVHDQGWKDQN \RXLQDGYDQFHIRU\RXUFRRSHUDWLRQDQGSDWLHQFH,I\RXKDYHDQ\TXHVWLRQRUFRQFHUQVSOHDVHFDOODW RUDSSURDFKWKHVXSHUYLVRURUIRUHPDQRQVLWH ´'XULQJDVSKDOWDQGSDYLQJRIURDGVFRXOGDOOFLWL]HQVSOHDVHEHUHVSHFWIXORIFRQVWUXFWLRQVLWHVDQG REVHUYHEDUULFDGHVDQGVLJQDJHIRUWKHLURZQVDIHW\)LQHVZLOOEHLVVXHGWRDOOSHRSOHQRWREH\LQJWKH UXOHVµ LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!

LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!

LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!

LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!

0(',&$/67$)),1(67(9$1

(67(9$17+((1(5*<&,7<

LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!

LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!

&,7<3$*(

LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!

LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!

LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!

LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY! LETâ&#x20AC;&#x2122;S CLEAN UP OUR COMMUNITY!


Issue No. 152

July 20, 2012

A Supplement to the Southeast Trader Express

Thereâ&#x20AC;&#x2122;s The Beef

The grand champion steer at the District 1 4-H Show and Sale staged on the Estevan Exhibition Grounds belonged to Jonathon Geisel of the Benson 4-H Club who then saw it sold for $4.25 a pound during the auction sale that concluded the two-day event that included achievement days for the four participating 4-H beef clubs.

6HQFKXN

)RUG6DOHV/WG

6RXULV$YH1(VWHYDQ 7ROO)UHH VDOHV

 VHUYLFH

(PDLOVDOHV#VHQFKXNFRPÂ&#x2021;ZZZVHQFKXNIRUGFD


Page 2

SOUTHEAST AGRI NEWS, FRIDAY, JULY 20, 2012

Southeast Regional 4-H Show results posted The Alameda 4-H Club held its annual Achievement Day on June 8 at the Alameda Auction Mart with all 41 members participating in the day-long event. The day began with a questionnaire at 9 a.m. The members then gathered their results and knowledge and participated in the Southeast Regional 4-H Show which was held the very next day, once again at the Auction Mart. The results are as follows with the three top placements plus the home town of the winning competitors included in brackets:

Clover Bud Steers: Kamryn Gilliland (Carievale); Grace Christensen (Alameda) and Madeline Christensen (Alameda). Steer Judging: Senior â&#x20AC;&#x201C; Megan Moore (Alida); Renee Boutin (Alida) and Meghan Brown (Alameda). Intermediate - Haley Brownell (Alida); Emma Boutin (Alida) and Kaley McMillen (Carievale) and Sydney Dalrymple (Alida) â&#x20AC;&#x201C; tied for third. Junior â&#x20AC;&#x201C; Tristen Miller (Alida); Thomas Buchanan (Carnduff) and Kaileigh Lawless (Alida). Steer Classes:

Class 1, 865 to 1,085 lb. - Carey Levesque (Carnduff); Ethan Newell (Alameda) and Tori Chapman (Alameda). Class 2, 1,090 to 1,150 lb. - Meghan Brown (Alameda), Joe Glennie (Carnduff) and Dalton Biesenthal (Alida). Class 3, 1,155 to 1,215 lb. - MacKenzie Henderson (Carievale); Emma Boutin (Alida) and James Jones (Carnduff). Class 4, 1,225 to 1,255 lb. - Teighan Dalrymple (Alida); Alyce Ricard (Alameda) and Kaley McMillen (Carievale).

Class 5, 1,260 to 1,325 lb. - Renne Boutin (Alida); Kianna Brooks and Haley Brooks (Alameda). Class 6, 1,330 to 1,465 lb. - Tristen Miller (Alida); Megan Moore (Alida) and Sydney Dalrymple (Alida). Grand Champion Steer â&#x20AC;&#x201C; Renee Boutin (Alida). Reserve Grand Champion Steer â&#x20AC;&#x201C; Kianna Brooks (Alameda). Champion Homegrown Steer â&#x20AC;&#x201C; MacKenzie Henderson (Carievale). Reserve Champion Homegrown Steer â&#x20AC;&#x201C; McKenzie Henderson (Carievale). Steer Breed Specials:

;¡SRVWIUDPHFDWWOHVKHG FZERWWRPURZV;SZIVSODVK SODQN WRSURZV;VSUVSODVK SODQN 

;¡SRVWIUDPHEXLOGLQJ FZ;5RYHUKHDGGRRU  7,0(72

0HWDO&ODGGLQJ

022229(

0DQ\W\SHV SURĂ&#x20AC;OHVDYDLODEOH 1RZVWRFNLQJYDULRXVOHQJWKVRI *DOYDOXPH ZKLWHZKLWHPHWDO )DUPDQGLQGXVWULDOJDOYDQL]HGJDOYDOXPHDQGFRORXUHG  JDXJHPHWDORUGHUHGWRVXLW\RXUVL]HDQGQHHGV 3KRQHIRUSULFLQJZLWK\RXULQGLYLGXDOUHTXLUHPHQWV

,172$/$5*(5 %8,/',1*"

7KLQNLQJZLQGRZV" 6KRSDQGFRPSDUH

,QVLVWRQ&:'ZLQGRZVDQGGRRUV 39&:LQGRZV0HWDOFODGZLQGRZV 3DWLRDQGJDUGHQGRRUV,QVXODWHGVWHHOGRRUV

&DOOIRUFRPSDUDWLYHSULFLQJ

:22'&28175< (67(9$10&/($17,6'$/( 3K  Â&#x2021;)D[  Â&#x2021;.HQVLQJWRQ$YHQXH(VWHYDQ +RXUV0RQ)ULDPSP6DWDPSP

VISIT US ON OUR WEBSITE: www.wood-country.com

Charolais â&#x20AC;&#x201C; Kamryn Gilliland (Carievale). Hereford â&#x20AC;&#x201C; Haley Brooks (Alameda). Simmental â&#x20AC;&#x201C; Tristan Miller (Alida). Angus â&#x20AC;&#x201C; Renee Boutin (Alida). Group of Five Steers: Alida, Alameda and Carievale. Class 1 â&#x20AC;&#x201C; Angus â&#x20AC;&#x201C; Kianna Brooks (Alameda); Alyce Ricard (Alameda) and Carey Levesque (Carnduff). Class 2 â&#x20AC;&#x201C; Angus â&#x20AC;&#x201C; Cody Levesque (Carnduff); Barrett Dumaine (Carievale) and Bailey Kozman (Carievale). Class 3 â&#x20AC;&#x201C; Simmental â&#x20AC;&#x201C; Shandi McMillen (Carievale), Kaley McMillen (Carievale) and Liam Rutten (Alameda). Class 4 â&#x20AC;&#x201C; Mixed â&#x20AC;&#x201C; Haley Brooks (Alameda); Zachary Hill (Alida) and Blake Brooks (Alameda). Junior Champion Heifer â&#x20AC;&#x201C; Shandi McMillen (Carievale). Junior Reserve Champion Heifer â&#x20AC;&#x201C; Kaley McMillen (Carievale). Heifer Breed Specials: Angus â&#x20AC;&#x201C; Kianna Brooks (Alameda). Simmental â&#x20AC;&#x201C; Shandi McMillen (Carievale). Hereford â&#x20AC;&#x201C; Haley Brooks (Alameda). Continuation Heifer Class â&#x20AC;&#x201C; Shandi McMillen (Carievale); MacKenzie Henderson (Carievale) and Lane Newell (Alameda). Senior Grand Champion Heifer â&#x20AC;&#x201C; Shandi McMillen (Carievale). Supreme Champion Heifer â&#x20AC;&#x201C; Shandi McMillen (Carievale). Reserve Supreme Champion Heifer â&#x20AC;&#x201C; MacKenzie Henderson (Carievale). Champion Homegrown Heifer â&#x20AC;&#x201C; Shandi McMillen

(Carievale). Group of Five Heifers â&#x20AC;&#x201C; Alameda. Pairs of Calves â&#x20AC;&#x201C; Kianna Brooks (Alameda); Haley Brooks (Alameda) and Shandi McMillen (Carievale). Showmanship: Senior â&#x20AC;&#x201C; Haley Brooks (Alameda); Renee Boutin (Alida) and Shandi McMillen (Carievale). Intermediate â&#x20AC;&#x201C; Kianna Brooks (Alameda); Kaley McMillen (Carievale) and Sydney Dalrymple (Alida). Junior â&#x20AC;&#x201C; Janai Ricard (Alameda); Cody Levesque (Carnduff) and Bailey Kozma (Carievale). Team Grooming â&#x20AC;&#x201C; Shandi McMillen (Carievale); Kianna Brooks (Alamea); Tristen Miller (Alida) and Shaylee Baglole (Carnduff). Second went to Megan Moore (Alida); Kacey North (Carnduff); Bailey Kozma (Carievale) and Brody Dorrance (Alameda). Third was awarded to Blake Brooks (Alameda); Sydney Dalrymple (Alida); Thomas Buchanan (Carnduff) and Turner McMillen (Carievale). Record Books: Senior â&#x20AC;&#x201C; Rhandi Turton (Carnduff); Shandi McMillen (Carievale) and Meghan Brown (Alameda). Intermediate â&#x20AC;&#x201C; Ryanne North (Carnduff); Barrett Dumaine (Carievale) and MacKenzie Henderson (Carievale). Junior â&#x20AC;&#x201C; Payton Baglole (Carnduff); Joe Glennie (Carnduff) and Kade McMillen (Carievale). Clover Buds â&#x20AC;&#x201C; Shaylee Baglole (Carnduff); Grace Christensen (Alameda) and Cheyenne Klatt (Alameda). Best Kept Stall â&#x20AC;&#x201C; Carievale, Alida, Alameda.

:(<%851,1/$1'7(50,1$//7' &DQDGLDQ:KHDW%RDUG'HOLYHU\&RQWUDFW6XPPDU\ 3(5&(17$*(6

6(5,(6´$¾

&$//(' &$//('$&&(37(' &URS<HDU ² ²  5HG6SULQJ  KLJKHU     5HG6SULQJ  ORZHU     5HG6SULQJ  KLJKHU     5HG6SULQJ  ORZHU     5HG6SULQJ  KLJKHU     5HG6SULQJ  ORZHU     5HG6SULQJ    &2: ² ²  &365HG     &36:KLWH ² ²  5HG:LQWHU     ([WUD6WURQJ  ² ²  'XUXP  KLJKHU     'XUXP  ORZHU     'XUXP  KLJKHU     'XUXP  ORZHU     'XUXP    'XUXP    'XUXP ² ²

6(5,(6´%¾

6(5,(6´&¾

&$//('$&&(37(' ² ²    

&$//('$&&(37('

      ²  ² ² ² ² ² ² ² ² ²

      ²  ² ² ² ² ² ² ² ² ²

                

²        ²   ²  ² ² ² ² ² ²

²        ²   ²  ² ² ² ² ² ²

:,7672&.4827$7,216 :HHN(QGLQJ -XQH

ZNORZ  

ZNKLJK &ORVH  

9ROXPH 

<LHOG 

%DVHGRQWUDGLQJSULFHRIDPLQLPXPRIRQHERDUGORWZKLFKLVHTXDOWRVKDUHV %DVHGRQWKHVHPLDQQXDOGLYLGHQGVSDLGLQWKHSUHYLRXVPRQWKVDQGWKHFXUUHQWPDUNHWSULFH

&RQWDFW8QLRQ6HFXULWLHV 6XLWH&RUQZDOO6W5HJLQD6DVN63.  Â&#x2021;7ROO)UHH

:,7:HEVLWHZZZZLWFD :,7:H\EXUQ 

Â&#x2021;&URS,QSXW'LYLVLRQ+RXUV DPSP0RQGD\WKUX6DWXUGD\DPSP6XQGD\ :($7+(53(50,77,1* &DOOH[W Â&#x2021;5HJXODU'HOLYHU\+RXUVDPSP0RQGD\WR6DWXUGD\ Â&#x2021;3HOOHW0LOO+RXUVDPSP0RQGD\WR)ULGD\ Â&#x2021;2IĂ&#x20AC;FH+RXUVDPSP0RQGD\WR)ULGD\

*Contract terminations* please contact the office for further information.

Published monthly in Southeast Saskatchewan by the Prairie Newspaper Group., a subsidiary of Glacier Media. The Glacier group of companies collects personal information from our customers in the normal course of business transactions. We use that information to provide you with our products and services you request. On occasion we may contact you for purposes of research, surveys and other such matters. To provide you with better service we may share your personal information with our sister companies and also outside, selected third parties who perform work for us as suppliers, agents, service providers and information gatherers. Our subscription list may be provided to other organizations who have products and services that may be of interest to you. If you do not wish to participate in such matters, please contact us at the following address: The Southeast AgriNews, Box 730, Estevan, Saskatchewan, S4A 2A6; or phone (306) 634-2654. For a complete statement of our privacy policy, please go to our Website at: www.estevanmercury.ca The Southeast AgriNews is owned and operated by Boundary Publishers Ltd., a subsidiary of Glacier Ventures International Corp. We acknowledge the financial support of the Government of Canada through the Publications Assistance Program toward our mailing costs.

Editor: Norm Park Publisher: Peter Ng Advertising Manager: Jan Boyle email: normpark@estevanmercury.ca 68 Souris Avenue, Estevan Phone: 634-2654 Fax: 634- 3934


SOUTHEAST AGRI NEWS, FRIDAY, JULY 20, 2012

Page 3

Quick progress made on hay crops Haying operations across Saskatchewan are entering the downside with over half of the hay stocks now gathered and put away for future use. Warm and dry conditions allowed for significant progress on the haymaking front between July 3 and 9 with 44 per cent of the 2012 hay crop reported as being

cut and 20 per cent having been baled or put into silage. Since then the process has accelerated with only a few interruptions, providing an assumption that well over half of the hay crop has now been cut and nearly 50 per cent baled. As far as the rest of the crops are concerned, the field reporters are indicat-

ing that 80 per cent of the fall cereals, 62 per cent of the spring cereals, 57 per cent of the oilseeds plus 70 per cent of the pulses were at a normal stage of development entering into the third week of July. Most of these crops were listed as being in fair to excellent condition. High daytime tem-

$10 million bump in wheat research funding welcomed Just recently it was announced that $10 million in new funding for wheatrelated research will be forwarded to the farming industry by the provincial government. The announcement, made by Premier Brad Wall, noted that the money will go toward research projects that accelerate the development of wheat varieties and improve yield, quality and tolerance to disease and extreme weather conditions. â&#x20AC;&#x153;Itâ&#x20AC;&#x2122;s time to put wheat back on top again,â&#x20AC;? Wall said while making the announcement. â&#x20AC;&#x153;Early varieties like Marquis made farming worthwhile in all but the most inhospitable parts of the Prairies. It allowed the prairies to become the Bread basket of the British Empire for the next 100 years. Itâ&#x20AC;&#x2122;s time to recapture that leadership, so Saskatchewan can help feed a hungry planet.â&#x20AC;? In recent years wheat has become less profitable for producers relative to other options such as canola and pulses, two crops that werenâ&#x20AC;&#x2122;t even grown in any significant amount in Western Canada 40 years ago. Yet increasing global demand for food makes it crucial that new investments be made in wheat research. The announcement regarding the funding was made during the February Wheat Summit in Saskatoon which brought together industry stakeholders who discussed research, variety development, production and marketing. â&#x20AC;&#x153;Wheat has always been an important crop for Saskatchewan farmers and research is critical to our future,â&#x20AC;? said Gerrid

Gust of the Western Canadian Wheat Growers, who served as chairman for the summit. â&#x20AC;&#x153;We are very pleased with this new funding which will give farmers the opportunity to increase profits and help our industry remain competitive in the world marketplace.â&#x20AC;? The new research funding will be used in partnerships with public and private research organizations. The funding was added to the Ministry of Agricultureâ&#x20AC;&#x2122;s Agriculture Development Fund in the past budget. Since 2008 the Ministry of Agriculture has



invested about $62 million to support agriculture research in Saskatchewan.

peratures throughout the province resulted in some thunderstorms in a few areas and some of those

provided strong winds and hail, thus damaging a few selective crops. The typical crop diseases along with

occasional flash flooding and wind have caused most of the reported damages to crops this summer.

:25.621 ,QFUHDVHLQRFWDQHE\SRLQWV %27+*$6  ,QFUHDVHLQFHWDQHE\SRLQWV ',(6(/ 2UJDLQLFIXHOHQKDQFHUWKDWSDFNVDSXQFK '($/(56:$17(' 0F.HQ]LH/DQH0RRVH-DZ

$87263$Â&#x2021;Â&#x2021;

)RUDOO\RXU%DOHU7ZLQHUHTXLUHPHQWVFRQWDFW RQHRIRXUILYHORFDWLRQVWRGD\

*LUDUG%XON6HUYLFH/WG (67(9$1

3523$1(

2;%2:

$/,'$

&$5/</(

5('9(56









WK6WUHHW



6HQFKXNÂŻV6XSHU'HDOV 8VHG&DUV

Quality Post Frame Buildings

0867$1**76+(/%<NPV+3 )25'0867$1*9VSHHGORDGHGRQO\NPV )86,216(/ORDGHGNPV /,1&2/10.6ORDGHGZSRZHUURRIQDYLJDWLRQ NP )2&866(/ORDGHGZLWKOHDWKHURQO\NPV 0867$1*9ORDGHGRQO\NPV62/' %0:=,&219(57,%/(PLOHV 2/'602%,/($/(52/9$XWR62/'

8VHG7UXFNV689V 9DQV

5$3725683(5&5(:[RQO\NPV (6&$3(;/7;ORDGHGZLWKNPV );/7&5(:&$%NPV (6&$3(/,0,7(';ORDGHGOHDWKHUQDYLJDWLRQ NPV (6&$3(;/7[/9ORDGHGZLWKNPV )&5(:&$%',(6(/;NPV *0&6,(55$6/(&5(:&$%;NPV (6&$3(/,0,7(';ORDGHGNPV ('*(/,0,7('DOOZKHHOGULYHORDGHGNPV *0&$&$',$6/(DOOZKHHOGULYHORDGHGNPV 62/' (;3(',7,21/,0,7('0$;[IXOO\ORDGHG ZLWKNPV (;3(',7,21('',(%$8(5[OHDWKHU SRZHUPRRQURRINPV (;3/25(56325775$&;/7;ORDGHG NPV )+$5/(<'$9,'621&5(:&$%;ORDGHGZLWK1DYLJDWLRQ DQGSRZHUURRIRQ\NPV );/7&5(:&$%ONPVORDGHG

Grain Storage

Call for your FREE estimate

Machine Storage

6HQFKXN )RUG6DOHV/WG

Industrial Shops

@V\YOVTLVMHM[LYZHSLZZLY]PJL 6RXULV$YHQXH1RUWK²(VWHYDQ6DVN

www.goodon.com

634-3696

Please Recycle This Newspaper

Commercial Buildings

...And Much More!

1-800-665-0470

For all of your Farm, Commercial & Industrial Needs


Page 4

SOUTHEAST AGRI NEWS, FRIDAY, JULY 20, 2012

Peruvian market now opens wider for Canadian beef The Canadian Cattlemen’s Association (CCA) said in mid-June they were pleased to see the re-opening of Peru as a market for Canadian beef.

Peru, it was announced by the Canadian government, has approved the importation from Canada of all beef and offals from cattle under 30 months and

over 30 months of age. Since the closure of nearly all of Canada’s beef export markets in 2003, the CCA has worked with the federal government to re-

open them. The efforts made by both government and the CCA has resulted in about 70 countries either fully or partially re-establishing access for Canadian beef.

Beef welfare symposium a big hit in Saskatoon Canadian organizers hosted the third International Symposium on Beef Cattle Welfare from June 5 to 7 in Saskatoon. The event drew more than 450 participants including 130 who attended the symposium in person while more than 300 delegates registered for the live webcasts and recorded podcasts that came from the Saskatoon venue. This was the first time Canada served as host for the educational event that sheds an international spotlight on

2012 FOCUS SE

MSRP $25,259 EMPLOYEE PRICE

$21,835

2012 ESCAPE XLT 4X4

2012 FUSION SE

MSRP $27,599 EMPLOYEE PRICE

$21,563

2012 ESCAPE XLT 4X4

MSRP $34,099 EMPLOYEE PRICE

MSRP $33,199 EMPLOYEE PRICE

2012 EXPEDITION LIMITED MAX 4X4

2012 EXPEDITION LIMITED MAX 4X4

$27,379

MSRP $67,749 EMPLOYEE PRICE

$58,597

2012 F-150 SUPERCREW FX4 4X4 MSRP $55,499 EMPLOYEE PRICE

$42,532

2012 F-150 SUPERCAB XLT 4X4

Canada as well as from the United Kingdom, New Zealand, Brazil, Finland and Mexico ... most of the out-ofCanada registrants checked in through the webcasts and podcasts. Temple Grandin of Colorado State University, David Fraser of the University of British Columbia and Hans Doetzee of Iowa State University were among the symposium’s 18 speakers who offered global insights on a variety of topics including pain management, animal

beef cattle welfare and the future of the beef industry. “Based on the event’s registration numbers and the overwhelmingly positive feedback from our speakers and participants, we’ve accomplished our goal of informing a wide range of people about the current and emerging welfare issues that face the beef cattle industry around the world,” said Joseph Stookey, chairman of this year’s event. The symposium attracted registrants from across

$26,617

MSRP $64,949 EMPLOYEE PRICE

$56,190

2012 F-150 SUPERCREW FX4 4X4

MSRP $52,619 EMPLOYEE PRICE

$39,555

2012 F-150 SUPERCAB XLT 4X4

2012 FUSION SE MSRP $27,599

EMPLOYEE PRICE

$21,563

2012 ESCAPE XLT 4X4

MSRP $33,199 EMPLOYEE PRICE

$26,617

2012 F-150 SUPERCREW FX4 4X4 MSRP $52,019 EMPLOYEE PRICE

$39,039

2012 F-150 SUPERCREW FX4 4X4 MSRP $48,199 EMPLOYEE PRICE

$35,754

2012 F-150 SUPERCAB XLT 4X4

MSRP $44,339 EMPLOYEE PRICE

MSRP $39,999 EMPLOYEE PRICE

MSRP $45,239 EMPLOYEE PRICE

2012 F-350 CREWCAB LARIAT 4X4

2012 F-350 CREWCAB LARIAT 4X4

2012 F-350 CREWCAB LARIAT 4X4

$32,434

MSRP $78,379 EMPLOYEE PRICE

$63,823

2013 EDGE LIMITED AWD

MSRP $45,299 EMPLOYEE PRICE

$41,425

$29,202

MSRP $73,659

EMPLOYEE PRICE

$59,764

2013 EDGE LIMITED AWD

$33,208

MSRP $75,639 EMPLOYEE PRICE

$61,466

2013 EDGE LIMITED AWD MSRP $41,599

MSRP $45,799

EMPLOYEE PRICE

$41,854

EMPLOYEE PRICE

$38,138

welfare, animal behaviour and bovine health management. The next symposium is scheduled for 2014 at a location yet to be determined. Since the first international symposium was held in 2008 at Kansas State University, the event’s popularity has grown to worldwide levels. More information regarding the symposium and the work of the committee may be obtained by visiting www.beefwelfare2012.ca

2013 MUSTANG G.T. CONVERTIBLE MSRP $48,739

EMPLOYEE PRICE

$42,060

2012 ESCAPE XLT MSRP $29,199

EMPLOYEE PRICE

$23,557

2012 F-150 SUPERCREW XLT 4X4 MSRP $46,819

EMPLOYEE PRICE

$34,567

2012 F-150 SUPERCREW LARIAT 4X4 MSRP $59,359 EMPLOYEE PRICE

$45,851

2012 F-150 SUPERCAB XLT 4X4 MSRP $44,199

EMPLOYEE PRICE

$32,314

2012 F-350 CREWCAB XLT 4X4

$52,845

2013 EDGE LIMITED AWD MSRP $45,299

EMPLOYEE PRICE

$41,424

LANE REALTY CORP. Jason Beutler: (306) 735-7811 To view full colour feature sheets for all of our CURRENT LISTINGS Visit our web site at www.lanerealtycorp.com

LANE REALTY CORP. Saskatchewan's Farm & Ranch Specialists™ PH: 306-569-3380 EMAIL: lanrerealtycorp@sasktel.net

www.lanerealtycorp.com

MSRP $47,739

$41,100

2012 ESCAPE XLT MSRP $29,699

EMPLOYEE PRICE

$23,987

2012 F-150 SUPERCREW XLT 4X4 MSRP $45,799

EMPLOYEE PRICE

$33,689

2012 F-150 SUPERCREW LARIAT PLATINUM 4X4 MSRP $63,229

EMPLOYEE PRICE

$48,679

2012 F-250 CREWCAB XLT 4X4

MSRP $52,684 EMPLOYEE PRICE

$42,726

2012 F-350 CREWCAB XLT 4X4 MSRP $67,653

EMPLOYEE PRICE

$54,598

2013 EDGE LIMITED

2013 TAURUS LIMITED AWD

MSRP $48,449 EMPLOYEE PRICE

$40,668

2012 ESCAPE XLT 4X4

MSRP $34,299 EMPLOYEE PRICE

$27,563

2012 F-150 SUPERCREW HARLEY 4X4

MSRP $66,599 EMPLOYEE PRICE

$52,078

2012 F-150 SUPERCREW LARIAT 4X4 MSRP $59,339 EMPLOYEE PRICE

$45,833

2012 F-250 CREWCAB XLT 4X4

MSRP $61,599 EMPLOYEE PRICE

$49,393

2013 EDGE SEL AWD

MSRP $40,399 EMPLOYEE PRICE

$37,106

2012 FOCUS TITANIUM

MSRP $44,399

EMPLOYEE PRICE

said Martin Unra, CCA president. The OIE recommends that controlled risk countries be able to export all beef from cattle of all ages. To date Peru has only accepted live cattle born after August 2007 from Canada. Their decision to allow beef products and offal brings the Canadian beef sector one step closer to restoring full access around the world.

For the most EXPOSURE that you deserve in the marketing of your farm or ranch property - Contact you local agent:

2013 MUSTANG G.T. GLASS TOP EMPLOYEE PRICE

MSRP $65,614

EMPLOYEE PRICE

“While Peru may hold modest potential, it is important to Canadian beef producers that all countries adhere to the international standards established by the World Animal Health Organization (OIE). They have recognized Canada’s strong BSE control measures and designated us as a controlled risk country with respect to BSE (bovine spongiform encephalitis),”

$39,590

MSRP $29,449

EMPLOYEE PRICE

$25,621

2012 ESCAPE XLT

MSRP $28,699 EMPLOYEE PRICE

$23,127

2013 ESCAPE SEL 4X4

MSRP $39,449 EMPLOYEE PRICE

$35,618

2012 F-150 SUPERCREW LARIAT 4X4 MSRP $59,359 EMPLOYEE PRICE

$45,851

2012 F-150 SUPERCREW XLT 4X4 MSRP $43,889 EMPLOYEE PRICE

$32,074

2012 F-250 CREWCAB XLT 4X4

MSRP $52,759 EMPLOYEE PRICE

$42,790

2013 EDGE LIMITED AWD MSRP $43,949

EMPLOYEE PRICE

$40,263

2012 FUSION SEL MSRP $33,649

EMPLOYEE PRICE

$26,946


Trader July 20