Page 1

8. Living territories/Abitare il territorio edited by!"#$%&%!'()$*+%&,$-!.$)/$%!0$*$1#$*2-!0%33(2!.1%452&&$*2


Defining areas for intervention is the first step in planners’ and designers’ activities. The regional approach in selecting problematic frames and design surfaces was the key issue proposed in this call for papers in the session entitled Living in Territories. How and why a region is defined are crucial questions in urban and landscape planning. Three criteria are widely known to delimitate a region: biophysical, political and socio-economical. They are deeply connected to the sustainable development of territories. Energy systems, ecological structures, agricultural activities, settlements and communities are the elements identified in querying the regional concept and finally, regional planning incertitude. When we think about the regional scale in the planning and design process we imagine a specific approach which deals with urban and rural issues together, because a region is never a uniform environment. What elements could help planners and designers hypothesize their research field and interpret their operational ground? What are the analysis methods, planning processes and design tools that should be explored in order more effectively implement regional planning? Although people are more and more involved in the planning processes, this point, as well as the procedure to include stewardship practices in planning, is the most relevant uncertainty for planners and designers. In the call for paper two main questions were asked to be explored: on one hand the regional approach in planning and design concerning methods, procedures and operational knowledge; on the other hand the planners’ and designers’ roles in regional transformations. The papers collected in this section explore several meanings of region in urban and landscape planning since different region conceptualizations are proposed by the authors. Furthermore different interpretation keys emerged in reading the actual problems at the regional scale: soil consumption and water management, people’s actions and planned transformation links and landscape transformations. The regional approach is envisioned from territorial (Fanfani), historical (Rosselli, Piras), ecological (Anguillari, Guerra, Romano et al.) and landscape perspectives (Ciabò, Menstriner, Pè). The regional approach is considered useful in understanding complex phenomena and in achieving innovative solutions to problems. The following papers discuss these topics from different perspectives. Some of these deal with new elements in the planning process: analytical, procedural and operational tools are proposed. The future scenario perspective (Anguillari) is a design-based process and it has become a visual instrument to involve politics, planners and people in regional transformations. The GIS - base index and synthetic indicators are suggested in order to bridge the gap between planners’ knowledge and actual territorial features (Romano et al., Ciabo’). The river contract (Guerra) is described as a practice to engage communities in territorial management. A second group analyses different practices that could be used to begin to examine the relationship between the rural and urban, architecture and nature. The agricultural park is proposed and investigated as a territorial governance tool (Fanfani). Roles of traditional agricultural practices in peri-urban areas are explored in order to manage urbanisation (Rosselli). Sustainability is envisioned as a conceptual medium to use ancient practice in environment construction (Mestriner). Final reflections discuss the role of planners and designers in the regional transformation: they are envisioned as mediators having to manage planning and design processes (Pè). Is this role effective in the regional planning process? How could planners and designers, therefore architects, use planning and design knowledge to allow increasing qualities of territorial transformation?

8. Living territories/Abitare il territorio edited by'4C$,#,'-.+$"),#/$2'3$+>$,':$"$%C$"&2':,88.&'3%,1D&##$"&

Veneto 2100: living with water !"#$%&'(")*$++,#$ Urban settlement sensibility assessment. Morphological-based analysis in italian case studies -.#",#/$"&'0&1,"&2'3.#.",'4$,562'!+.",'7.'3,"8$92':,*#&';,5#$<$&2';#,"%.9%&'=*++& The landscape value: interpretive categories, diagnostic techniques and management rules 3.#.",'4$,56 Disputed or shared territory? The Italian experience of river contract: new relationship between river and its region 3$+>$,'?*.##, Local development and “agri-urban” domain: agricultural park as promotion of an “active ruralship” 7,>$/';,"@,"$ Urban landscape development and rural fringes in Delhi 4+,*/$,'0&9.++$ Some reflections on the relationship between people of the fourteenth century, city and territory ("8&".++,'A$#,9 Minimum living A,&+&':.98#$".# Digital technologies landscape design urban curatorship 0,@@,.++,'AB

!"#"$%&!'$()*'+,)&-&!'$()*'+,)&./0&1"#"$% 2',)'%%"&34"5'5" 6/$.,0,$*,&20/*,,("$%) 71/0,$*,8&7,409'0:-;9$,&<=>< !"#$%&'()*+(,-%.$#"(-/ (0.1#$23&4($'(564(7-"'5859:; <<<'="#$%&'$+>(?(@AAB(:65;C9DD; !.-E++F2$G3(=%1"23*+F(2$(HE>-1+.(59:;

?,$,5/&<>==@ !"#"$%&A"5B&C'5,0&& I$.2E-(J$G%2""#.2

0$27+.32>K(@0JL(F2(L+$+M2# +$.2E-'#$G%2""#.2NG&#2"'E-&(

:KDWLVWKHIXWXUHRI WKH9HQHWRUHJLRQJLYHQWKHWKUHDWVSRVHGE\ULVLQJVHDOHYHOVKHDY\UDLQIDOOÁRRGVDQGGURXJKW" :KDWZLOOLWORRNOLNHLQ"$QLQWHUGLVFLSOLQDU\JURXSIRUPHGE\XUEDQSODQQHUVDQWKURSRORJLVWVDQGYLVXDOGHVLC G$+.34(*#3(2&#G2$+F(*-<(>*.++(F2//+.+$>(>+..2>-.2+3(&2G*>(1+(>.#$3/-.&+F(1O(#($%&1+.(-/ (<#>+.(>*.+#>3(#$F(=-33212"2>2+3'( :LGHQLQJ WKH ULYHUEHGV HVWDEOLVKLQJ VSDWLDO FRUULGRUV WR EXIIHU SHDNV RI  ZDWHU ÁRZ UHSOHQLVKLQJ WKH JURXQGZDWHU >*.-%G*(>*+(%3+(-/ ($+<(1#32$34(3>-.2$G(<#>+.(>-(E-%$>+.#E>(=+.2-F3(-/ (F.-%G*>4(.+#E>27#>2$G(>*+($#>%.#"(.+"#>2-$3*2=( 1+><++$(>*+(.27+.3(#$F(>*+(3+#4(#$F(#EE-&&-F#>2$G(>*+(.232$G(3+#(<#>+.("+7+"3(#.+(3>.#>+G2+3(>*#>(3*-%"F(<-.P(*#$F(2$( *#$F(<2>*($+<(=.-E+33+3(-/ (%.1#$2M#>2-$(#$F(F+7+"-=&+$>'(@$(2&="+&+$>2$G(3%E*(3>.#>+G2+34(<#>+.(1+E-&+3(>*+(3>#.C >2$G(=-2$>(/-.(.+>*2$P2$G4(.+3*#=2$G(#$F(.+3>.%E>%.2$G(>*+(>+..2>-.2+3(-/ (>*+(L+$+>-(2$(#$(+//-.>(>-(F+32G$(&-.+(.+32"2+$>( E2>2+3'

!"#$%&'('4(;+$+<-()(**(=(>2?2$8(@2<*(@#<+.A  :KDWLI 7KH0RQWL/HVVLQL&UHHNVZRXOGUHHVWDEOLVKDFORVHUHODWLRQZLWKWKHYDOOH\VIRRWKLOOVDQGSODLQV"7KH B-$<2( >+332$2( 6.++C3( "2+( 2$( #( D#<<+.$( 6-&1"2C+( 1+<@++$( ;+.-$#( #$7( ;26+$E#( <*#<( 23( 6%<( 1F( #( 6-..27-.( -/ ( *+#?F( 2$/.#3<.%6<%.+(#$7(7+$3+(6-$3<.%6<2-$(/-.&+7(1F(<*+(GH(*28*@#FI(<*+(.#2"@#FI(2$7%3<.2#"(#6<2?2<F(#$7(3+<<"+&+$<3'()*+( 7#$8+.("2$C+7(<-(<*+(6.++C3(23(@+""(C$-@$J(<*+(#.+#K3(*+#?F(.#2$/#""(#$7(<*+(3<++D$+33(-/ (2<3(?#""+F3(&#C+(<*+(6.++C3( DFRQVWDQWWKUHDWIRUWKH\RIWHQRYHUÁRZGXHWRXQPDQDJHDEOHDPRXQWVRI UDLQZDWHUDQGWKHHURGHGVHGLPHQW <*23(1.2$83(@2<*(2<'()*+(36+$#.2-(D.-D-3+7(*+.+(3%88+3<3(6.+#<2$8(L=M(1%//+.3(#"-$8(<*+(6.++C3(<*#<(@-%"7(&#C+( .--&(1-<*(/-.(<*+(+N6+33(.#2$@#<+.(#$7(/-.(*-3<2$8(1#32$3I(@+<"#$73(#$7(@--73I(72?+.32/F2$8("-6#"(#8.26%"<%.+(#$7( .+-.2+$<2$8( <*+( %.1#$( 8.-@<*( #"-$8( <*+( ?#""+F3I( #6.-33( <*+( O=P( 6-..27-.( <*+.+1F( 8+$<"F( .+3<.%6<%.2$8( <*23( "#.8+( .+82-$(2$<-(#(.+6.+#<2-$#"(<+..2<-.F'  :KDWLI WKH3RGHOWDZRXOGHQJDJHZLWKWKHHQYLURQPHQWDOWKUHDWV"7KHVKDSHRI WKH3R'HOWDLVWKHUHVXOWRI WKH ;+$+<2#$(Q+D%1"26K3(72?+.32-$(-/ (<*+(!-(.2?+.(2$(ARSH'()-7#FI(<*+(7+"<#(23(#(3-.<(-/ (3%$C+$(3D--$(@2<*(*28*(1-.7+.3( <-@#.7(<*+(3+#(#$7(#("-@(6+$<.#"(#.+#(6#%3+7(1F(<*+(&-.+(/-.&#"(6*#$$+"2$8(-/ (<*+(1.#$6*+3(-/ (<*+(!-(Q2?+.I(D--.( VHGLPHQWDWLRQDQGDORQJSHULRGRI VXEVLGHQFH7KHZHVWHUQERUGHURI WKHGHOWDLVGHÀQHGE\DEXQGOHRI URDGV #$7(3+<<"+&+$<3(<*#<("2+(-$(#(*28*+.(3#$7F(7%$+(3F3<+&(.%$$2$8(L=MI(-//+.2$8(+?27+$6+(-/ (@*#<(<*+(6-#3<"2$+("--C+7( "2C+(1+/-.+(<*+(.2?+.K3(72?+.32-$'(5-$327+.2$8(<*#<(3+#("+?+"(23(+ND+6<+7(<-(.23+(1F(#(&+<.+(1F(<*+(F+#.(9ASSI(@2""(2<(1+( VXVWDLQDEOHWRGHIHQGWKH3R'HOWDDQGNHHSLWGU\ZLWKLQFUHDVLQJO\KLJKHUGLNHVDQGHQRUPRXVHQHUJ\FRVWV"7KH 36+$#.2-(D.-D-3+7(*+.+("+<(<*+(3+#@#<+.(2$?#7+(<*+(7+"<#(%$<2"(<*+(3#$7F(7%$+3I(<%.$2$8(<*+("#<<+.(2$<-(#(1#6C1-$+( <*#<(.%$3(/.-&(<*+(;+$+<2#$("#8--$(7-@$(<-(Q#?+$$#I(#$7(.+#6<2?#<+3(<*+($#<%.#"(.2?+.=3+#(.+"#<2-$3*2D(1F(%32$8(<*+(


!"#$%&'()*+(,-%.$#"(-/ (0.1#$23&(4(5-$/+.+$6+(!.-6++72$83

!"#$"%&'()*+,-.'#+'&&)+/&0 ;*2"+( <*+( 8"-1#"( =.-6+33( -/ ( %.1#$2>#<2-$( 6-$<2$%+3?( 8"-1#"( 6"2&#<+( 6*#$8+( .+3%"<3( 2$( &-.+( /.+@%+$<( #$7( PRUHLQWHQVHÁRRGLQJDQGGURXJKW7KHVHWZRSKHQRPHQDFODVKDVXUEDQL]DWLRQFRQWLQXHVHVSHFLDOO\LQ IRUPHUÁRRGSODLQVQHDUULYHUVDQGFRDVWDODUHDVDQGZDWHUXVHLVLQFUHDVLQJ )*+(A+$+<-(.+82-$(2$(B<#"C(23($-(+D6+=<2-$?(1+6#%3+(-/ (2<3(*28*(7+$32<C(#$7(<*+(*28*(=.-7%6<2E2<C(-/ (2<3(F#<+.G 3+$32<2E+("#$736#=+'(H+.+?(<*+(2&=#6<(-/ (<*+(+$E2.-$&+$<(23(&#$2/+3<2$8(2<3+"/ (F2<*(2$6.+#32$8"C(F-..C2$8( HIIHFWV'XHWRWKHGLVSHUVHGFKDUDFWHURI LWVXUEDQL]DWLRQ²!"##$%&"''()*I(%.1#$(=#<<+.$3(2$<+8.#<+(72E+.3+( SURJUDPVDQGZDWHUXVHVWKDWUHVXOWLQZLGHVSUHDGHSLVRGHVRI ÁRRGLQJGURXJKWDQGSROOXWLRQ ,QWKH9HQHWRKHDY\ÁRRGVFDXVLQJVHULRXVGDPDJHWRRNSODFHLQDQG,QEHWZHHQ2FWREHU 9J3<(#$7(K-E+&1+.(J3<?(2$(#$(#.+#(-/ (JLM(3@%#.+(N2"-&+<+.3?(LMM(&&'(-/ (.#2$(/+""?(&-.+(<*#$(/-%.(<2&+3(<*+( #E+.#8+(3+#3-$#"(3+.2-%3"C(#//+6<2$8(J9M(&%$262=#"2<2+3(#$7(#(=-=%"#<2-$(-/ (#==.-D2&#<+"C(OMM?MMM(=+-="+'( )*+(1#"#$6+(-/ (<*+(7#&#8+(2$6"%7+7(P(7+#<*3?(:?MMM(723="#6+7(=+-="+(#$7(P9M?MMM("2E+3<-6N(7+#7(-.(&2332$8( #3(F+""(#3(<*+(23-"#<2-$(/-.(/-%.(7#C3(-/ (<*+(QL(*28*F#C(#$7(<*+(3%13+@%+$<(1"-6N#8+(-/ (8--73(3*2==+7(/.-&( <*.-%8*-%<(R%.-=+(ST28%.+(PU' 5-$E+.3+"C?(7%.2$8(<*+(3%&&+.(-/ (PMJP?(#3(#(.+3%"<(-/ ("-F(=.+62=2<#<2-$(2$(<*+(#%<%&$(#$7("2<<"+(3$-F(/#""( GXULQJWKHZLQWHUWKH9HQHWRIDFHGDZDWHUGHÀFLWRI QHDUO\EHORZWKHVHDVRQDODYHUDJHRI WKHODVW C+#.3'()*+.+(F#3(#$(#==.-D2&#<+(#13+$6+(-/ (JOM("2<+.3(-/ (F#<+.(=+.(3@%#.+(&+<+.(-/ ("#$7'(V$(<*+(-$+(*#$7( <*+(7.-%8*<(#88.#E#<+7(<*+(6-$72<2-$3(-/ (#$(#8.26%"<%.#"(+6-$-&C(#".+#7C(2$(<.-%1"+?(-$(<*+(-<*+.(*#$7(2<( UHVXOWHGLQDUHGXFWLRQRI HQHUJ\SURGXFWLRQIURPK\GURHOHFWULFVRXUFHVE\FRPSDUHGWRWKHKLVWRULFDO DYHUDJHIRUWKHSHULRGJHQHUDWLQJDZDURI VRUWVRYHUZDWHUEHWZHHQ(QHODQG&ROGLUHWWL7KHGUDPDWLFÁRG -73(-.(<*+(+3<.+&+(7.-%8*<3(<*#<("+7(<*+(.+82-$#"(8-E+.$&+$<(<-(7+6"#.+(<*+(3<#<%3(-/ (F#<+.(6.2323?(#.+(+E+$<3( <*#<(*28*"28*<(<*+(%.8+$6C(-/ (3<%7C2$8(<*+(.+"#<2-$(1+<F++$(%.1#$2>#<2-$(#$7(F#<+.(7C3/%$6<2-$3(2$(-$+(-/ ( <*+(&-3<(=.-7%6<2E+(B<#"2#$(<+..2<-.2+3'(V$(<*+(-$+(*#$7?(*+.+(#3(+"3+F*+.+?(<*+(&+33#8+(-/ (6"2&#<+(6*#$8+( 23(=.+3+$<+7(#3(#(&+33#8+(-/ (/+#.(#$7(%$6+.<#2$<CW(Q"(X-.+Y3(SPMMZU([B$6-$E+$2+$<().%<*Y(=.+3+$<3(<*+(.23N( RI ELJÁRRGVDVDFDOOIRUDFWLRQ2QWKHRWKHUKDQGZKLOHDOOWKHVHLVVXHVDUHEHFRPLQJLQFUHDVLQJO\XUJHQW <*+(6%..+$<(="#$$2$8(3C3<+&3(3++&(<-(1+(2$#7+@%#<+(<-(<#6N"+(<*+3+(E%"$+.#12"2<2+3(S\+66*2?(A28#$]?(PMJJU' 7KHUHIRUHLVWKHUHDUROHIRUGHVLJQHUVLQSUHSDULQJRXUFLWLHVDQGODQGVFDSHVIRULQFUHDVHGULVNV",QWKH ^-<<+.7#&(Q.6*2<+6<%.+(_2+$$#"+?(<*+("+#72$8(<*+&+(F#3([F#<+.Y(#$7(&-7+.#<-.(Q7.2##$(X+%>+(8#E+(2<(<*+( <2<"+([)*+(T"--7Y'()*+("+#72$8(27+#(F#3(<*+(.-"+(-/ (7+328$+.3(2$(F#<+.(6-$<.-"'(;-.N2$8(F2<*(F#<+.(F#3(/.#G PHGDVÀJKWLQJWKHHQHP\DQGWKHUHVXOWDVDYLFWRU\RI HQJLQHHULQJ7KH¶ZDWHUZROI ·RXUHQHP\VKRXOGEH <#&+7'(B$(<*23(E2+F?(/+#.(8+$+.#<+3(<*+($++7(/-.(32&="+(#$7(3#/+(3-"%<2-$3'(B<(23(7.+#&2$8(-/ (6-$<.-"?(-/ (1+2$8( <*+(&#3<+.(-/ ($#<%.+'()*23(#<<2<%7+(*#3(#("-$8(<.#72<2-$(2$(<*+(*23<-.C(-/ (&#$N2$7(#$7(2<(F#3(<*+(7-&2$#$<( #<<2<%7+(-/ (&-7+.$23<(7+328$(#/<+.(<*+(\+6-$7(;-."7(;#.(S)`#""2$822?(PMJPU' ,QWKHODVWWKLUW\\HDUVVLQFHWKHSXEOLFDWLRQRI WKH%UXQGODQGUHSRUW :&(' KRZHYHUPDQ\SHRSOH *#E+(3<#.<+7(<-(6.2<262>+(<*23(1#326(#<<2<%7+'(\+E+.#"(F#E+3(-/ (+$E2.-$&+$<#"(#F#.+$+33(*#E+(&#7+(2<(6"+#.(<*#<( 1+327+3(<*+(3%66+33+3(-/ (#(<+6*$-6.#<26(#==.-#6*(F+(*#E+(#"3-(3++$(&#$C(/#2"%.+3'(_-<*(<*+($#<%.#"(F-."7( DQGRXUVRFLHW\DUHIDUWRRFRPSOH[WRÀWLQWRDVLPSOHFRPPDQGDQGFRQWUROVFKHPH 0RVWDIDYLHWDO PMJMU' 3+72&+$<(<-(6-$3<.%6<(#($+F?(&-.+(.+32"2+$<(7+"<#'  :KDWLI WKH3LDYH5LYHUZRXOGEHFRPHDULYHUDJDLQ"7KHGU\SODLQVRI WKH3LDYH5LYHUDUHXQGHUWKUHDWIURPDQ HYHULQFUHDVLQJULVNRI ÁRRGLQJGXHWRERWKWKHH[WHQGHGGLVSHUVHGXUEDQL]DWLRQRI WKHODVWGHFDGHVDQGWKHULYHU·V GUDPDWLFÁXFWXDWLRQGXULQJWKHUDLQ\VHDVRQV7KHDJULFXOWXUDODFWLYLWLHVRI WKHDUHDDOVRGHSHQGXSRQWKHQXPHURXV 72E+.32-$3(-/ (<*+(!2#E+?(#(.2E+.(<*#<(23(#".+#7C(#<(.23N(1+6#%3+(-/ (<*+(+D="-2<#<2-$(%=3<.+#&'()*+(36+$#.2-(=.-=-3+7( *+.+(6-$327+.3(82E2$8(<*+(.2E+.(&-.+(3=#6+(#$7(.+7%62$8(F#<+.(F2<*7.#F#"3(/.-&(<*+(-<*+.(F#<+.(3C3<+&3'(B$(PJMM?( <*+(!2#E+(^2E+.(=+.2-726#""C(+D=#$7(-E+.(#(F27+.(=-.<2-$(-/ (2<3(#""%E2#"(7.C(="#2$'(\#$71#$N3?(&#.3*"#$73?(&+#7-F3( DQGGLIIHUHQWÁRRGDEOHDUHDVRIIHUDYDULHW\RI FRQGLWLRQVIRUOLYLQJDQGRWKHUODQGXVHVLQUHVSRQVHRI WKHUK\WKP RI WKHULYHU·VÁRZ'U\IRUHVWVFRORQL]HWKHDUHDVRI WKHGU\SODLQWKDWDUHQRWLPSDFWHGE\WKHG\QDPLFVRI WKHULYHU·V ÁRZ3HDNVLQWKHULYHU·VÁRZDQGWKHUXQRII FRPLQJIURPWKHUHJLRQ·VXUEDQVSUDZODUHSUHFLRXVUHVRXUFHVWREH FROOHFWHGDQGWRLUULJDWHWKHIHZUHPDLQLQJDJULFXOWXUDOÀHOGV

!"#$%&'()*+(,-%.$#"(-/ (0.1#$23&(4(5-$/+.+$6+(!.-6++72$83


:KDWPDGHWKHUHFHQWÁRRGVVRGDPDJLQJLVWKHFRPELQHGHIIHFWVRI KXPDQFRQWUROLQGLIIHUHQWSDUWVRI  ;*+( <#""+=3>( 7+/-.+3;#;2-$?( 2$6.+#32$8( @#<+7( 3%./#6+3( #$7( 6*#$$+""2$8( 3;.+#&3'A2""( /%.;*+.( 6-$;.-"( 1+( ;*+( VROXWLRQ"&RQWDLQHGEHWZHHQKLJKHUGLNHVWKHÁRRGVZLOOEHKLJKHUDQGWKHULYHUVZLOOÁXVKPRUHUDSLGO\ 6.+#;2$8(*28*+.(@+#B3(7-C$3;.+#&'(!+-@"+(1+*2$7(D3#/+E(72B+3(C2""(6#.+("+33(#$7(=+;(1+(&-.+(<%"$+.#1"+(2$( 6#3+(-/ (%$@.+726;#1"+(+F;.+&+(+<+$;3'()*+(.23B(-/ (3%6*(+<+$;3(C2""(1+(*28*+.(7%+(;-(;*+(6-&@"+F2;=(-/ (%.1#G $23+7("#$736#@+3(#$7(;*+(%$6+.;#2$;2+3(-/ (6"2&#;+(6*#$8+(HI28%.+(JK'(L;(23(;2&+(;-(6*#$8+(;*+(7+328$(#;;2;%7+( /.-&(6-$;.-"(;-(2$;+.#6;2-$(C2;*(1-;*("#$736#@+(#$7("#$7(%3+.3?(&#2$;#2$#$6+(#$7(%3+(-/ (3*#.+7(;+..2;-.2#"( .+3-%.6+3'(DM+$+;-(NOPP(G(Q2<2$8(A2;*(A#;+.EN( R( @.+3+$;+7(2$( NPON(#;( ;*+(S;*( L$;+.$#;2-$#"( T.6*2;+6;%.+( U2+$$#"+(-/ (V-;;+.7#&(;2;+"7(DW#B2$8(52;=E(R(23(#(/%.;*+.(3;+@(-$(;*23(.+3+#.6*G1=G7+328$(@#;*(;*#;("+#73(;-( .+#"23;26(#$7(.+32"2+$;(@"#$$2$8(#$7(7+328$(@.-@-3#"3'

!"#$%&'((4(I"--7+7(T9(*28*C#=(2$(W-$;+/-.;+(7ET"@-$+?(N$7(-/ (X-<+&1+.(NPOP' !"#$%&')(4(Y-#<+?(W-$;+/-.;+?(Y#$(U-$2/#62-J'

!"#$%&'"'($)* +RZGRZHPDNHDFLW\"$QGKRZGRZHGHSOR\PDNLQJDFLW\LQUHVSRQGLQJWRSUHVVLQJHFRORJLFDODQGVRG FLRHFRQRPLFLVVXHV":LWKWKHVHTXHVWLRQVWKH¶WK,$%5·FDOOHGRQHYHU\RQHLQYROYHGSXEOLFRIÀFLDOVSROLF\ &#B+.3?(@-"2;262#$3?(7+328$+.3(#$7(62;2Z+$3'([%.(/%;%.+(23(;*+(/%;%.+(-/ (-%.(62;2+3?(3-("+;(%3(#6;2<+"=(.+6-$327+.( ;*+(/%;%.+(-/ (62;2+3(1=(\-2$2$8(;-8+;*+.(;-(7+<+"-@($+C(C#=3(-/ (62;=&#B2$8'(DW#B2$8(52;=E(3;#.;+7(/.-&(;*+( SURSRVLWLRQWKDWWKHFXUUHQWFLUFXPVWDQFHVPDGHHYHQPRUHSUHVVLQJE\WKHÀQDQFLDOFULVLVSURYLGHWKH -@@-.;%$2;=(;-(82<+(;*+(@.-6+33(-/ (62;=(&#B2$8(#($+C(2&@+;%3(C2;*(#(&%";272362@"2$#.=(#$7(@.-#6;2<+(#@@.-G N( M+$+;-(NOPP(R(Q2<2$8(C2;*(C#;+.(23(#(.+3+#.6*(1=>(]$.26-(T$8%2""#.2(H%.1#$(7+328$K?(M#"+$;2$#(U-$2/#62-(H#$;.-@-"-8=K?( Q#;2;%7+(!"#;/-.&(H6--.72$#;-.(^(%.1#$(7+328$K?(Y;%72-(LB$-B2(^(0$2;_(72(5.232(H<23%#"(7+328$K' J( )-7#=(;*+(*+#<=(2$/.#3;.%6;%.+(1%$7"+(;*#;(72<27+(Y-#<+(#$7(W-$;+/-.;+(/.-&(Y#$(U-$2/#62-?(6%;;2$8(;*+().#&28$#( DQGWKH$OSRQHFUHHNVLVDSULRULW\IRUSUHYHQWLQJWKHULVNRI ÁRRGLQJ%XWWKLVFDQDOVREHFRPHDFKDQFHWRUHWKLQN ;*+(6.-332$8(#$7(;*+(6-$$+6;2-$(1+;C++$(;*+(X(#$7(Y(327+3(-/ (;*+(7+$3+(6-..27-.'I#62"2;2+3(#$7($+C(1#32$3(/-.(@26B( 3;-.#8+(#$7(2..28#;2-$?(#3(C+""(#3(;*+(-$+3(/-.(;*+(6-&@+$3#;2-$(-/ (;*+(2$7%3;.2#"(#.+#3(#.+(3-&+(-/ (;*+(B+=(#6;2-$3( WKDWFDQEHSXUVXHGWRUHDOL]HÁXLGSDVVDJHVIRUZDWHUDQGSHRSOH$QRWKHUVWUDWHJLFSURMHFWLVWKHGLYHUVLRQRI ERWK ;*+().#&28$#(#$7(;*+(5*2#&@-(6.++B3'()*#$B3(;-(;*#;?(;*+(6.2;26#"(@-2$;(C*+.+(;*+(;*+(5*2#&@-(\-2$3(;*+(T"@-$+( 6"-3+(;-(W-$;+/-.;+(R(C*26*(23(C*+.+(;*+(7=B+(1.-B+(7-C$(2$(NPOP(R(6#$(1+(#""+<2#;+7(1=(.+.-%;2$8(#(6-$327+.#1"+( #&-%$;(-/ (C#;+.(1+"-C(Y#$(U-$2/#62-(#$7(&++;2$8(;*+(T"@-$+(7-C$3;.+#&?(#/;+.(;*+(7+$3+(3+;;"+&+$;3'


!"#$%&'()*+(,-%.$#"(-/ (0.1#$23&(4(5-$/+.+$6+(!.-6++72$83

DFKHVZKLFKOLQNQHZSODQQLQJVWUDWHJLHVWRQHZDOOLDQFHVURRWHGLQVSHFLÀFNQRZOHGJHDQGORFDOFRQGLWLRQV ;<#=2$8(62>?@(23(>*+.+/-.+(A-.=2$8(-$(>*+(A-."7(#/>+.(>*+(6.2323B(#(A-."7(>*#>(A2""("--=(72//+.+$>(/.-&(>*+( A-."7(#3(A+(=$-A(2>(CD.%8&#$3B(!+>+.3+$B(EFGEH' )*+( #$$-%$6+&+$>( -/ ( >*+( D2+$$#"+( A#3( >*+.+/-.+( #2&+7( #>( .+3+#.6*( #$7( 3I#>2#""?JI-"2>26#""?( 2$$-K#>2K+( I.-L+6>3B(A*26*(/-6%3+7(-$(.+"#>2-$3(1+>A++$(&#$#8+&+$>(I-"262+3B(I"#$$2$8(>--"3B(#$7(>*+(7+328$(-/ (62>2+3( #$7(>+..2>-.?'(M2>*2$(>*23(6-$>+N>B(I.-I-32$8(#(.+3+#.6*(I.-L+6>(1#3+7(-$(>*+(A#>+.(3?3>+&3(-/ (>*+(O+$+>-( PDNHV VHQVH DVD UHÁHFWLRQ RQ WKH FRQFHSW RI  WHUULWRULDOFROOHFWLYH LQIUDVWUXFWXUH LQ SDUWLFXODU RQ ZDWHU #3(&#2$(3%II-.>(#$7(>*+&+(>*#>(6#$(*+"I(2$(6-$3>.%6>2$8(#(.+$+A+7(2$>+.I.+>#>2-$(#$7(#(I.-L+6>(/-.(>*+( 6-$>+&I-.#.?(62>?'(P-""-A2$8(A#>+.B(#3(A+""(#3(->*+.(/%$7#&+$>#"(2$/.#3>.%6>%.#"("#?+.3B($->(-$"?(/-.6+3(%3( >-(6-$327+.(>*+(-K+.#""(/%$6>2-$2$8(-/ (>*+(>+..2>-.?(#$7(>*+(7?$#&263(A2>*(A*26*B(1?(.278+3B(2>(2$K+3>3(>*+( YDOOH\VSODLQVDQGODJRRQVQRWRQO\REOLJHVXVWRFURVVSODFHVDQGSDUWVWRRRIWHQH[FOXGHGIURPRXUUHÁHFQ >2-$(C#8.26%">%.#"(#.+#3(#$7(.+6"#2&+$7("#$73B(3?3>+&3(-/ (2..28#>2-$3(#$7(7.#2$#8+B(&#.82$#"(#.+#3B(A+>"#$73B( &#.3*"#$73B(3#$7?(1#$=3B(8.#K+"(I2>3B(72=+3B(&+#7-A3B("#8--$3B(A--73'''HB(1%>(#"3-(1%2"73(%I(#(72//+.+$>(I-2$>( -/ (K2+A(#1-%>(>*+(>.#72>2-$#"(>*+&+3(-/ (%.1#$(I"#$$2$8(#$7(7+328$R(3+>>"+&+$>3B(I.-7%6>2K+(3?3>+&3B(>*+( /-.&3(-/ (A+"/#.+' M-.=2$8(A2>*(>*+(>*+&+(-/ (A#>+.(#"3-(#""-A3(-$+(>-(6#""(>-("28*>(>*+(#&12K#"+$>($#>%.+(-/ (>*+(#.+#(#$7(2>3( /#62"2>2+3'(S>(23(#(;6-&&-$(.+3-%.6+@(1%>(#"3-(#(;6-&&-$(*#T#.7@B(#$7(>*+(>+..2>-.2#"(I.-L+6>(6#$$->(723.+8#.7( >*+(8-K+.$2$8(-/ (>*+(3#&+'(S$(>*23(A#?(#3(&+.+"?(6.-332$8(#(6-&I"+N(#$7(&2$%>+(#&-%$>(-/ (>*+(&#>+.2#"3( #$7(>*+(328$3(>*#>(*#K+(82K+$(7+I>*(>-(>*+(I#"2&I3+3>(-/ (>*+(O+$+>-@3(>-I-8.#I*?(23(2>(I-3321"+>-(*28*"28*>( KRZWKLVWHUULWRU\LVÀUVWRI DOODGHSRVLWRI WKRXVDQGV\HDUVRI SODQQLQJDQGJRYHUQLQJZDWHUWRUHFRJQLVH >*+(2$72K27%#"(#$7(6-""+6>2K+(.+3I-$3212"2>?(>*#>B(7#?(#/>+.(7#?B(6.+#>+3(6-$72>2-$3(-/ (8.+#>+.(.23=' S>(23($+6+33#.?(>-(.+#7(*-A(>*+(3-62#"B(I-"2>26#"(#$7(+6-$-&26(7?$#&263(2$(>*23("#$7(*#K+(1.-%8*>(72//%3+( A+#">*B(1%>(*#K+(#"3-(2$6.+#3+7(>*+(+NI-3%.+(>-(6-""+6>2K+(.23='(D?(6-$6+2K2$8(1->*(>+..2>-.?(#$7(.23=(#3(;6-&Q &-$3@B(72//+.+$>(A#?3(-/ (>.#$3/-.&2$8(>*+(>+..2>-.?(6#$(1+(7+K23+7B(#>(>*+(3#&+(>2&+(6#.+/%""?(I.+3+.K2$8( +N23>2$8(.+3-%.6+3(A*2"+(6-$3>.%6>2$8(#($+A(=2$7(-/ ("#$736#I+(CP28%.+(UV(9H' 7RIRFXVRQWKHQDWXUHRI WKHVHFRQÁLFWVDQGWRLQYHVWLJDWHWKHVRFLDOG\QDPLFVZHZRUNHGWRJHWKHUZLWK #$>*.-I-"-823>3(#$7(6-&&%$26#>2-$(7+328$+.3U,QIDFWWKHWZRGLVFLSOLQHVÀQGDFRPPRQSRLQWLQ¶KRZ >*+(>+..2>-.?(23(I+.6+2K+7(1?(>*-3+(A*-("2K+(2$(2>@(#$7(>*+?(6#$(3%II-.>(-$+(#$->*+.(>*.-%8*(>*+(%3+(-/ (2$Q 3>.%&+$>3(#$7(72.+6>(&+>*-73(>-("23>+$(>-B(>-(%$7+.3>#$7B(#$7(>-(.+I.+3+$>(>*+(A#?3(2$(A*26*(#(6-&&%$2>?( 7+36.21+3(2>3+"/ (#$7(>+""3(2>3(3>-.?'(M*2"+(>*+(#$>*.-I-"-823>(23(2$6"2$+7(>-("23>+$B(>.?2$8($->(>-(2$3+.>(*23(-A$( 2$>+.I.+>2K+(6#>+8-.2+3(1%>(>.?2$8(>-(+3>#1"23*(#(6"-3+(#$7(2$>2&#>+(.+"#>2-$3*2I(A2>*(*23(3%1L+6>B(>*+(6-&&%Q $26#>2-$(7+328$+.(23(2$>+$7+7(#3(#(3I+62#"23>(2$(1.2$82$8(/-.>*(2$/-.&#>2-$(#$7(.+QI.-I-32$8(2>R(>*#>(23B(27+$Q >2/?2$8(>*+(&-3>(#II.-I.2#>+(>--"3(-.(;6-&&%$26#>2K+(#.>+/#6>3@(>-(.+>%.$B(/-.(+N#&I"+B(>-(>*+(8+-8.#I*?(-/ ( >*+(#6>-.3B(>*+(I"->(-/ (I-A+.3B(>-(8+$+.#>+(#(6.2>26#"(7236-%.3+(2$(>*+(3#&+(>+..2>-.?B(>-(7236%33(#$7(+N6*#$8+( LQIRUPDWLRQ %RQLIDFLR%RQLQL/HVVLQJ 7KHGLIIHUHQWUHODWLRQVZLWKZDWHUGLVFORVHVSHFLÀFXUEDQ 3I#>2#"(#$7(3-62#"(233%+3(>*#>(1+6-&+(/%$7#&+$>#"(A*+$(A+(#2&(#>(7+328$2$8B(I"#$$2$8(-.(32&I"?(7+#"2$8(A2>*( >*+(62>?(&#=2$8(I.-6+33'

 7KHPRVWVXEVWDQWLDOSKDVHVRI ÀHOGDQDO\VLVWRRNSODFHGXULQJWZRGLGDFWLFDFWLYLWLHVFRQGXFWHGE\WKHUHVHDUFK JURXSDWWKH,8$9LQ9HQLFH6SHFLÀFDOO\GXULQJWKH(UDVPXV,33URJUDPRQWKH3R'HOWDFRRUGLQDWHGE\ <#.2#(5"#.#()-32B(#$7(7%.2$8(>*+(/#""QA2$>+.(3+&+3>+.(EFGG(#>(W%.-I+#$(!-3>8.#7%#>+(<#3>+.(2$(0.1#$23&B("+7(1?( !#-"#(O28#$X'()*+(.+3%">3(#.+(I%1"23*+7(.+3I+6>2K+"?(2$R(W'(Y$8%2""#.2(+>(#"'(C+73HB(EFGE(#$7(2$R(W'(Z2#$$->>2B(!'(O28#$X( C+73HB(EFGE'

!"#$%&'()*+(,-%.$#"(-/ (0.1#$23&(4(5-$/+.+$6+(!.-6++72$83


!"#$%&'((4(;72-&3(#$7(#6<-.3=(>+.6+2?+7(>.-1"+&3' !"#$%&')'_,QKDELWHG'U\:RRGODQG@

!"#$%&'()*+&,)*-&.*+*-/0 )RUWKH8QHVFR,+(,QVWLWXWHIRU:DWHU(GXFDWLRQVRFLHWLHVDUHYXOQHUDEOHWRÁRRGVGXHWRWKUHHPDLQ /#6<-.3A(+B>-3%.+=(3%36+><212"2<C(#$7(.+32"2+$6+'()*#<(23(<*+(+B<+$<(<-(D*26*(#(3C3<+&=(#(<+..2<-.C=(#(>->%"#<2-$( <*#<(23(+B>-3+7(#3(3%36+><21"+(<-(#$(+?+$<(#$7(2<3(#12"2<C(E-.(2$#12"2<CF(<-(6->+(-.=(&-.+(>.+623+"C=(<-(#7#><(<-( <*#<(+?+$<'(;3(+B>.+33+7(1C(<*+(/-.&%"#A(G%"$+.#12"2<C(H(IB>-3%.+(J(K%36+><212"2<C(L(M+32"2+$6+(EN#"26#(+<(#"'=( OPQOF' 7RGD\PRVWRI WKHYXOQHUDELOLW\VWXGLHVZKLFKLQYHVWLJDWHDUHDVZLWKKLJKÁRRGULVNVIRFXVRQO\RQVRPHRI  <*+(#3>+6<3(<*#<(6*#.#6<+.2R+(?%"$+.#12"2<C(#$7(>.->-3+(#(?+.C(3+6<-.#"(E<+6*$26#"F(#$#"C323(-/ (<*+(<+..2<-.2+3( DQGWKHLUXUEDQLW\)ROORZLQJWKH8QHVFR,+(GHÀQLWLRQZHFDQQRWLFHWKDWPDQ\ÁRRGYXOQHUDELOLW\VWXGLHV WKDWLQYHVWLJDWHVSHFLÀFWHUULWRULHVODFNRI DGHHSXQGHUVWDQGLQJRI VXVFHSWLELOLW\HVSHFLDOO\FRQFHUQLQJWKH .+"#<2-$(1+<D++$(62?2"(3-62+<CS"-6#"(2$3<2<%<2-$3(E<*+2.(>+.6+><2-$(-/ (?%"$+.#12"2<CF(L(<+..2<-.C(E&+#3%.#1"+( ?%"$+.#12"2<CF(L(>-"262+3(E>.+?+$<2-$S2$<+.?+$<2-$F' )*23(23(1+6#%3+(<*+(3%36+><212"2<C(23(#$(2$<.2$326(6-$72<2-$(-/ (<*+(<+..2<-.C(<*#<(7+36.21+3(2<3(#12"2<C(<-(#13-.1( <*+(.23T'(;<(23(#(6-$72<2-$(<*#<(+B23<3(2$7+>+$7+$<"C(-/ (<*+(-66%..+$6+(-.($-$-66%..+$6+(-/ (#$(+?+$<'(;<(<*+U .+/-.+(*#3(#(72.+6<(6-..+3>-$7+$6+(D2<*(<*+(>.->+$32<C(<-(>+.6+2?+(<*+(>.-1"+&(/.-&(<*+(>->%"#<2-$(#$7( "-6#"(2$3<2<%<2-$3' NC(3<%7C2$8(3%36+><212"2<C(<*23(D-.T(#2&3(<-(-//+.(7+328$(36+$#.2-3(<*#<(-1"28+(%3(<-(.+<*2$T(<*+(.+"#<2-$3*2>( EHWZHHQSROLWLFVDQGXUEDQGHVLJQFRQVLGHULQJWKHVSHFLÀFVRFLDOHQYLURQPHQWDOLQVWLWXWLRQDOTXDOLWLHVDVD /%$7#&+$<#"("#C+.(/-.(7+328$(#$7(>.+?+$<2-$' @( (;$(OQPP(<*+(7.C(>"#2$(#<(<*+(/--<*2""3(-/ (V-$<+""-(#>>+#.3(#3(#$(+B<+$7+7(2$*#12<+7(7.C(D--7"#$7(>+./-.#<+7(1C( %.1#$2R+7(>#<<+.$3=(D#<+.(3<-.#8+(1#32$3=(<*+($+D(!+7+&-$<#$#(&-<-.D#C(#$7(#(3+.2+3(-/ (>#.#""+"(3<.2>3(.%$$2$8( 1:6('XHWRWKHUHGXFWLRQLQWKHSUHFLSLWDWLRQSDWWHUQVDQGWKHFORVLQJRI ZDWHULQWDNHVIURPWKH3LDYH5LYHU #8.26%"<%.+(.+<.+#<3(<-("+#?+(3>#6+(<-(7.C(D--73(#$7(7.C(&+#7-D3'(M#2$D#<+.(23(#(>.+62-%3(.+3-%.6+(<-(3<-.+'()*+( +"+&+$<3( -/ ( <*+( /-.&+.( 2..28#<2-$( 3C3<+&( #.+( .+$+D+7( <-( >+./-.&( #3( 7.#2$#8+( 6#$#"3( D*26*( 7+"2?+.( .#2$D#<+.( 2$( 1#32$3(7+328$+7(<-(3<-.+(D#<+.'(W"-$8(<*+3+(7.#2$#8+("2$+3($+D(3+<<"+&+$<3=(/#62"2<2+3(#$7(>#33#8+D#C3(#.+(2$3+.<+7'( )*+(723&233+7(.#2"D#C(6.-332$8(<*+(>"#2$(1+6-&+3(#($+D(X+3<UI#3<(1#6T1-$+(<*#<(3%>>-.<3(<*+(3"-D(/.%2<2-$(-/ (<*+( "#$736#>+'(K-%<*(D#.72$8=(>#<6*+3(-/ (#8.26%"<%.+(1+6-&+(&-.+(+B<+$7+7(32$6+(<*+C(#.+(3%>>"2+7(1C(<*+(D#<+.(3<-.+7( %>3<.+#&'


!"#$%&'()*+(,-%.$#"(-/ (0.1#$23&(4(5-$/+.+$6+(!.-6++72$83

)*+(2$:+3;28#;2-$(#2&3(#;(6-$3;.%6;2$8(#($+<(3+;(-/ (="#$$2$8(;--"3>(%32$8(6#3+(3;%72+3(2$(;*+(?+$+;-(.+82-$'( ,QGRLQJVRLWXQGHUOLQHVWKHLPSRUWDQFHRI ORFDOVWDNHKROGHUVDQGWKHVRFLDODVSHFWVWKDWLQÁXHQFHWKHUH@ 82-$A3(:%"$+.#12"2;B' )*+(;*.++(6#3+(3;%72+3(<+.+(6*-3+$(1+6#%3+(;*+B(=#.#728&#;26#""B(=+.;#2$(;-(;*+(.+"#;2-$3*2=(1+;<++$(*B7.-@ "-826#"(:%"$+.#12"2;B(#$7(=+.6+=;2-$(-/ (;*+(=.-1"+&(1B(;*+("-6#"(=-=%"#;2-$' C;(-$+(+D;.+&+>(;*+("#$7(1+;<++$(;*+(E+332$2(#$7(;*+(="#2$(-/ (;*+(F2:+.(C728+(G1+;<++$(?+.-$#(#$7(?2@ 6+$H#I>(.+=.+3+$;3(;*+("-33(-/ (;*+(*23;-.26(.+"#;2-$3(1+;<++$(;*+(3+;;"+&+$;3(#$7(-/ (+6-$-&2+3(<2;*(.2:+.3'( 0RQWHIRUWHG·$OSRQHZDVRQHRI WKHDUHDVKLWKDUGHVWE\WKHÁRRGRI )RU\HDUVWKHSUREOHPKDV 1++$(%$7+.+3;2&#;+7(1B(;*+(2$3;2;%;2-$3>(8.#7%#""B(<+#J+$2$8(;*+(=+.6+=;2-$(-/ (.23J(1B(;*+("-6#"(=-=%"#;2-$' C;(;*+(-;*+.(+D;.+&+(23(;*+(6#3+(-/ (;*+(;+..2;-.B(-/ (;*+(!-(7+";#(G1+;<++$(F-:28-(#$7(K+..#.#I>(<*+.+2$(;*+( #==#.+$;(/.#82"2;B(-/ (#$(#.+#(;*#;(23(#"&-3;(+$;2.+"B(1+"-<(3+#("+:+"(&+#$3(;*#;(;*+("-6#"(3-62+;B("2:+3(<2;*(;*+( +//-.;3($++7+7(;-(6-%$;+.(;*+(.23J3(;-(<*26*(;*+B(#.+(+D=-3+7' L+;<++$(;*+3+(;<-(+D#&="+3("2+3(;*+(6#3+(-/ (;*+(*28*(="#2$3(-/ (;*+(!2#:+>(#"3-(J$-<$(#3(M7.B(="#2$3N>(<*26*( 3;.+;6*(1+;<++$(;*+(;-<$3(-/ (O-$;+1+""%$#>().+:23-(#$7(5#3;+"/.#$6-'(P+.+(;*+.+(23(3-&+(#<#.+$+33(-/ ( ="%&12$8(=.-1"+&3(#.232$8(/.-&(;*+(.2:+.(!2#:+(#$7(;*+(3+6-$7#.B(*B7.#%"26($+;<-.J>(1%;(#;(;*+(3#&+(;2&+( WKHUH DSSHDUV WR EH YHU\ FOHDU FRQÁLFWV EHWZHHQ GLIIHUHQW VRFLRHFRQRPLF DFWRUV LQ WKH PDQDJHPHQW RI  ;*+3+(=.-1"+&3' Q2:+$(;*+(2$6.+#32$8(/.+R%+$6B(-/ (+D;.+&+(+:+$;3(;-(<*26*(;*+(;+..2;-.B(23(3%1S+6;+7(;-(;*+(1#3+(-/ (;*+( 6-$3;.%6;2-$(-/ (;*+(36+$#.2-3(23(2&="262;"B(;*+(R%+3;2-$T(<*#;(<-%"7(*#==+$(2/ (1B(UVWW(;*+(?+$+;-(1+6#&+( DPRUHUHVLOLHQWWHUULWRU\"7KHSURSRVHGVWXG\VHHNVWRLPDJLQHDQDUHDWKDWLVDEOHWRDEVRUEWKHSUHVVXUH #$7(#7#=;(;-(6*#$8+(GK28%.+(XY(9I' 0$;2"(;-7#B>(&-$%&+$;#"(<#;+.(<-.J3(*#:+(8-$+(#"-$8(<2;*(;*+(-13+332:+(.+2;+.#;2-$(-/ (3&#""(36#"+(6*#$8+3>( DOOMXVWLÀHGE\WKHKXQJHUIRUHFRQRPLFJURZWK8QIRUWXQDWHO\PRVWRI WKHVHRSHUDWLRQVZHUHJURXQGHGRQ ;*+("-826(-/ (.+323;#$6+(.#;*+.(;*#$(-$(;*#;(-/ (.+32"2+$6+'(Z*2"+(6.#:2$8(8.-<;*>(;*+(=.2&#.B(2&=-.;#$6+(-/ ( 8.-<2$8(<2;*2$(;*+(+$:2.-$&+$;>(;-8+;*+.(<2;*(2;3(1#326(&+6*#$23&3>(*#3(1++$(/-.8-;;+$' )*+.+/-.+(;*+(=#;*(;-<#.73(.+32"2+$6+(#3J3(/-.(#(.#726#"(3*2/;(2$(7+328$2$8(;*+(/%;%.+(#$7(2$(;*+(3+;;2$8(%=( #(3B3;+&(-/ (2$/.#3;.%6;%.+($++7+7(;-(&#J+(=-3321"+(;*+(=.#6;26+3(-/ (#(=.+3+$;(#$7(/%;%.+(3-62+;B'([$(;*23( 3+$3+>(;*+(<#B(;-<#.73(#(.+32"2+$;(?+$+;-(6#$$-;(1+(S%3;(#(&#;;+.(/-.(;+6*$262#$3(#$7(=-"2;262#$3'([;(23(&%6*( &-.+(#(6%";%.#"(+:-"%;2-$'()*+(6#.+/%"(%$7+.3;#$72$8(-/ (-%.(=.+3+$;(3B3;+&A3(7B3/%$6;2-$3(23(6.%62#"(#3(23(;*+( #<#.+$+33(#1-%;(=-3321"+(;.+$73(;*#;(<2""(=.+33(;*+(/%;%.+(-/ (;*+(.+82-$(#$7(2;3("-6#"("#$736#=+3'(Z*#;(#.+( WKHJRDOVLQWKHVKRUWDQGORQJUXQ"+RZVKRXOGWKHHFRV\VWHPVSHUIRUP":KDWDUHWKHFKDOOHQJHVWKH\ZLOO KDYHWRIDFH":KDWDUHWKHRSSRUWXQLWLHV" [$(#(.+82-$(<*+.+(=.+3+.:#;2-$(23(;*+(&#2$3;.+#&>(;*+("-826(-/ (.+32"2+$6+(<-%"7(2$+:2;#1"B(6.#3*(-$(;*+(6%"@ ;%.#"(2$+.;2#(-/ (2;3(2$*#12;#$;3'(K-.(;*23(.+#3-$>(1%2"72$8(#(.+32"2+$;(?+$+;-(.+R%2.+3(;*+(72.+6;(=#.;262=#;2-$(-/ ( 2;3(2$*#12;#$;3>(;*+(3-%$7(6-""#1-.#;2-$3(-/ (;*+(#6;2:2;2+3(#$7(=.#6;26+3(6#..2+7(-%;(2$(;*+(;+..2;-.B' )*+(<2""2$8$+33(;-(6*#$8+(-/ (?+$+;-(6#$(1+(.+#"2H+7(1B(2&="+&+$;2$8(;*+(+D23;2$8(6#..B2$8(3;.%6;%.+3(#$7( 2$S+6;2$8(.+32"2+$;(7+:26+3(#&-$8(;*+("#$736#=+(=#;;+.$3'(C(<*-"+(.+32"2+$;(=26;%.+(1%2";(;*.-%8*(;*+(3=.+#@ GLQJRI VWUDWHJLFVSDWLDOHOHPHQWVIRUUHVLOLHQFH5DLQJDUGHQVÁRRGDEOHDUHDVVWRUDJHEDVLQVPHDGRZVÁR@ RGSODLQVHWFFDQDFWXDOO\ÀQGVSDFHLQWKHWHUULWRU\DQGEHLQWHJUDWHGLQWKHVRFLDODQGHFRQRPLFVWUXFWXUH )*+(2&=-.;#$6+(-/ (;*+3+(+D="-.#;2-$3("2+3(&-.+(2$(;*+(/-.6+(-/ (3-&+(=.-S+6;2-$3(#$7(2$(;*+(+//-.;(-/ (.+=.+@ 3+$;2$8(*-<(;*+(/%;%.+(&28*;(1+(2/ (;*+B(<-%"7(#6;%#""B(1+(.+#"2H+7(.#;*+.(;*#$(2$(;*+(%";2&#;+(=.+6232-$(-/ ( ;*+(7#;#'()*+(=.-6+33(-/ (-13+.:2$8>("23;+$2$8>(%$7+.3;#$72$8>(3B$;*+32H2$8(#$7(.+=.+3+$;2$8(;*.-%8*(#$(2$@ ;+.72362="2$#.B(%$7+.3;#$72$8(23(;*+(.+#"(1#6J1-$+(-/ (;*+3+(7+328$(+D=+.2&+$;3'()*+(.+3%";3(#2&(#;(=.-:-J2$8( DUHDFWLRQVWLPXODWLQJDGHEDWHUHÁHFWLQJRQSRVVLEOHVROXWLRQVUHÀQLQJLGHDV,QWKLVVHQVHWKHVFHQDULRLV #(&+72#(#$7($-;(#(=.-7%6;Y(2;3(:#"%+(23(;-(;.#6+(#("2$+>($-;(;-(1%2"7(#(3;.++;' 7KH\HDUUHSUHVHQWVDKRUL]RQVXIÀFLHQWO\ORQJHQRXJKWRVWUHQJWKHQWKHDUJXPHQWHODERUDWLQJSUR@ =-3#"3(<*26*(#.+(#;(;2&+3(7.#3;26(<2;*(.#726#"(2&#8+3'()*23(23(1+6#%3+(;*+(36+$#.2-3>(#3(;*+B(*#:+(1++$(%$@ 7+.3;--7(2$(;*23(<-.J>(7-($-;($+6+33#.2"B(<23*(;-(=.-=-3+(#(7+32.#1"+(/%;%.+(#$7(#.+($-;(;*+(.+3;2;%;2-$(-/ (#(

!"#$%&'()*+(,-%.$#"(-/ (0.1#$23&(4(5-$/+.+$6+(!.-6++72$83



!"#$%&'((4(C$@2.-$&+$;#"(?.+33%.+3'D !"#$%&')'4(E3"#$73'

9( (C""+(+3;(7+332$(7F%$(7+33+2$(23(#(?"#>(-$(G-.73(1#3+7(-$(;*+(3%1;"+($%#$6+(;*#;(723;2$8%23*+3(;*+(&+#$2$8(-/ (H7+332$I( J7+328$:(6-&?-32;2-$K(#$7(;*#;(-/ (H7+33+2$I(J2$;+$;2-$:(?%.?-3+:(7+328$K'().#$3"#;-.F3(L-;+(JL'7';'K(+72;2-$(E;#"2#$(-/ ( M'(N36*+.:(O+3(L-%@+#%<(?.2$62?+3(7+("F%.1#$23&+:(C72;2-$3(7+("FN%1.+:(PQQR'(2;'(+7'(E($%-@2(?.2$62?2(7+""F%.1#$23;26#:( L#?"+3S()%""2-(!2$;-.2(+72;-.+:(PQQT:(PU' D( ( C$@2.-$&+$;#"( ?.+33%.+3( 2$6"%72$8S( G#;+.( ?-""%;2-$:( +%;.-?*23#;2-$:( *>7.#%"26( .23V3:( 2$6.+#3+7( 3#";( G+78+( "+@+"3:( VDOLQL]DWLRQRI VRLOVDQGZDWHUVKRUWDJHV'XHWRDGHFUHDVHLQWKHULYHUVZDWHUÁRZDQGXSVWUHDPVHGLPHQWWUDSSLQJ WKH3RULYHUGHOWDLVXQGHUJRLQJDSURJUHVVLYHHURVLRQRI LWVFRDVWOLQHV'XHWRWKHPHWKDQHJDVH[WUDFWLRQWKH3R GHOWDIDFHVVLJQLÀFDQWODQGVXEVLGHQFHDQGVDOLQL]DWLRQ%HFDXVHRI WKDWDQGWKHH[WLPDWHGVHDOHYHOULVLQJDODUJHSDUW RI WKH3RGHOWDWHUULWRU\UXQVULVNRI ÁRRGLQJ  7KHYLOODJHRI %RFFDVHWWHEHFRPHVDQLVODQGPDLQWDLQLQJSDUWRI WKHRI WKHUHFODPDWLRQODQGVFDSH1HZFRQVWUXFWLRQV #.+(723?-3+7(#"-$8(;*+(7>V+3(-$(#(7.>(.2@+.1+7'(N(*#.1-.(.+3+.@+(;*+(6-$$+6;2-$(G2;*2$(;*+("#8--$3(#$7(#(6-&?"+<( V\VWHPRI ORZLVODQGVHPHUJHGE\WKHÀVKIDUPVVKDOORZZDWHU


!"#$%&'()*+(,-%.$#"(-/ (0.1#$23&(4(5-$/+.+$6+(!.-6++72$83

!"#"$"%&"' ;$8%2""#.2(<'=(>-$2$2(?+332$8(<'=(@#$A#B-(C'=()-32(C'5'(D+73E=(DFGHFE'(!"#$%&'%()*+%,"&-.//=().+$B-=(I.-/+332-$#"7.+#&+.3' ;36*+.(J'=(DFGGHE'(?+3($-%K+#%L(I.2$62I+3(7+("M%.1#$23&+=(<72B2-$3(7+("M;%1+' >#"26#(N'(J'=(O.28*B(P'(Q'=(K#$(7+.(C+%"+$(J'=(DFGHFE'($ÁRRGYXOQHUDELOLW\LQGH[IRUFRDVWDOFLWLHVDQGLWVXVHLQDVVHVVLQJ +#01%$"&+2%(3"&01,%+$*'(P#B%.#"(R#A#.73=(ST(DHE=(:UVHGW' >-$2/#62-(X'=(>-$2$2(?+332$8(<'(DFGHFE'(3HRSOHDQG,GHQWLW\'(2$(<'(;$8%2""#.2(+B(#"'(D62B'E'(HGVFW' >.%8&#$3(Q'=(!+B+.3+$(,'O'(D+73E=(DFGHFE'( 0DNLQJ&LW\=(5#B#"-8%+(B-(B*+(WB*(Y$B+.$#B2-$#"(;.6*2B+6B%.+(>2+$$#"+(-/ ( @-BB+.7#&=(@-BB+.7#&=(Y;>@' Q+%A+( ;'=( 7+( >##$( 5'=( Z-+[+1#[[+.( \'( D+73E=( DFGGWE'( 7KH )ORRG=( 5#B#"-8%+( B-( B*+( F$7( Y$B+.$#B2-$#"( ;.6*2B+6B%.+( >2+$$#"+(-/ (@-BB+.7#&=(@-BB+.7#&=(Y;>@' Q2#$$-BB2(<'=(X28#$](!'(D+73E=(DFGHFE'(2XU&RPPRQ5LVN6FHQDULRVIRUGLIIXVHFLW\=(C2"#$-=(+B(#"'^<72A2-$2' *RUH$$-U ZULWWHQE\ 'DYLV*XJJHQKHLP GLUHFWHGE\   $Q,QFRQYHQLHQW7UXWK=(!#.#&-%$B(5"#33263' 0RVWDIDYL0'RKHUW\*+DUYDUG8QLYHUVLW\*UDGXDWH6FKRRORI 'HVLJQ HGV   (FRORJLFDO8UEDQLVP=(>#7+$=( ?#.3(C_""+.(!%1"23*+.3' ?#B2B%7+(!"#B/-.&=(DFGHHE'( /LYLQJZLWK:DWHU)ORRG9XOQHUDELOLW\YV8UEDQLVDWLRQLQWKH9HQHWR5HJLRQ$SSOLFDWLRQWR WK,$%5=(C#[2$8(52B2+3(5-%$B+.(N2B+(I.-I-3#"' N+66*2(>'=(X28#$](!'=(DFGHHE':DWHUDQG$VSKDOW=(2$(X'(J+..#.2-=(;'(N#&I2+.2=(!'(X28#$](D+73E'(?#$736#I+(-/ (0.1#$23&=( 5RPD2IÀFLQD )`#""2$822(N'=(DFGHFE'('UHDPVDQG'RRPV'HVLJQZLWKZDWHULQWKH9HQHWRUHJLRQRI ,WDO\=(2$(;$8%2""#.2(<'=(>-$2/#62-(X'=( ?-&1#.7-()'=(C#362#$B-$2-(;'=(@#$A#B-(C'=(X#$2$(J'(D+73E'(X+$+B-(FHGG(V(?2K2$8(O2B*(O#B+.(.+3+#.6*(.+I-.B'(HT'(( :&(' :RUOG &RPPLVVLRQ RQ (QYLURQPHQW DQG 'HYHORSPHQW    2XU &RPPRQ )XWXUH=( \L/-.7=( \L/-.7( 0$2K+.32Ba(!.+33'

!"#$%&'()*+(,-%.$#"(-/ (0.1#$23&(4(5-$/+.+$6+(!.-6++72$83


!"#"$%&!'$()*'+,)&-&!'$()*'+,)&./0&1"#"$% 2',)'%%"&34"5'5" 6/$.,0,$*,&20/*,,("$%) 71/0,$*,8&7,409'0:-;9$,&<=>< !"#$%&'()*+(,-%.$#"(-/ (0.1#$23&4($'(564(7-"'5859:; <<<'="#$%&'$+>(?(@AAB(:65;C9DD; !.-E++F2$G3(=%1"23*+F(2$(HE>-1+.(59:;

?04'$&@,551,A,$5&@,$)"4"1"5:&3)),))A,$5 B/0+C/1/%"*'1-D'),(&3$'1:)")&"$&E5'1"'$&6'),&@59(",)&& I+.$#.F2$-(J-&#$-

',&($$²8QLYHUVLW\RI /·$TXLOD 1+.$#.F2$-'.-&#$-K%$27#L'2> 


OPAQRS(0$27+.32>T(-/ (UVRL%2"# 3+.+$#E2#1-K+E-72+<'2> 


',6,0²8QLYHUVLW\RI /·$TXLOD P"+$#'F+3#$>23K%$27#L'2> 


O-$>+(Y+$X#$#CR">-(Y2X2-(B#>%.#"(J+3+.7+ &#%.-/#1.2X2-K+E-72+<'2> 


',&($$²8QLYHUVLW\RI /·$TXLOD /.#$E+3E-'X%""-K%$27#L'2>  )*+(=.-=-3+F(.+3+#.E*(F+3E.21+3(#$(2$F+[(<*2E*(&+#3%.+3(>*+("#$F(3+$3212"2>T(1T(%.1#$23#>2-$'()*23(2$F+[(*#3(1++$( F+7+"-=+F(/.-&(#(.+>.-3=+E>27+(#$#"T323(-/ (>*+(F+7+"-=&+$>(-/ (3+>>"+&+$>3(<*+.+(G+-G.#=*2E#"(&-.=*-"-GT(7#.2+3(32C JQLÀFDQWO\7KHSUHOLPLQDU\VWXG\DLPVDWJDXJLQJKRZPRUSKRORJLFDOIDFWRUV VORSHDOWLWXGHJUDGLHQWDQGDVSHFW KDYH LQÁXHQFHGFXUUHQWXUEDQLVDWLRQLQWKHVWXG\DUHDVWKH,WDOLDQUHJLRQVRI 8PEULD0DUFKH$EUX]]R/D]LRDQG0ROLVH &DOFXODWLQJWKLVLQGH[KDVLGHQWLÀHGWKHPDLQPRUSKRORJLFDOIDFWRUVOLQNHGWRODQGXSWDNHDQGKLJKOLJKWVDUHDVWKDWDUH &-.+(7%"$+.#1"+(>-(%.1#$23#>2-$4(#33%&2$G(%.1#$23#>2-$(E-$>2$%+3(#EE-.F2$G(>-(>*+(&-F+"(#F-=>+F(-7+.(>*+(=#3>(32[>T( T+#.3'(@>V3(E"+#.(>*#>((%.1#$(3+>>"+&+$>(3+$3212"2>T(F+=+$F3(/.-&(#("->(-/ (=#.#&+>+.3(#3(&-.=*-"-GT4(2$/.#3>.%E>%.+(#$F( HFRQRPLFDQGVRFLDODVSHFWEXWLQDORQJWHUPSHUVSHFWLYHWKHPRUSKRPHWULFFKDUDFWHULVWLFVLQÁXHQFHDOORWKHULQ F+>+.&2$2$G(>*+(3=#>2#"(-.G#$2X#>2-$(-/ (3+>>"+&+$>'

!"#$%&'(#)%" <#$7( %=>#?+( 7%+( >-( @27+3=.+#7( %.1#$23#>2-$( 23( >2+7( >-( +$A2.-$&+$>#"B( 3-62#"( #$7( +6-$-&26( #3=+6>3( #$7( *#3(#"@#C3(-66%..+7(#$7(&#.?+7(1C(6C6"+3(-/ (+36#"#>2-$(-.(7+6"2$+(2$(>+.&3(-/ (2$>+.+3>+7(8+-8.#=*26(#.+#3( DE%&/-.7B(9FG9H' I$( J%.-=+B(>*+( 7+1#>+(*#3( 1++$("2A+"C(@2>*( .+8#.7( >-( =-"2>26#"( 3>#$6+3(#$7( *#3( 2$A-"A+7( &#$C( 3-62#"( #$7( >+..2>-.2#"(8-A+.$#$6+(233%+3B(#3(@+""(#3(233%+3(6-$6+.$2$8(=#.>262=#>2-$(2$(="#$$2$8(=.-6+33+3(DK#."-@B(9FFLM( 5*+3*2.+B(9FFLH'(I$A+3>28#>2-$(-/ (>*+(233%+3(-/ (>*+(62>CN.+82-$(#$7(>*+(3%3>#2$#1"+(7+A+"-=&+$>(-/ (>*23(>C=+( -/ (3+>>"+&+$>(23(2$A#"%#1"+(2$(>*23(7+1#>+(DO.%+8+.(P(Q#A#8+B(:RR;M(S+33+B(:RR;H'()*+.+(#.+(#($%&1+.(-/ ( 2$>+.+3>2$8(3>%72+3(>*#>(6-$327+.(%.1#$( 3=.#@"(#3( #( >+..2>-.2#"( T723+#3+U(/-.( @*26*( 6%.12$8( #$7( &2>28#>2$8( #6>2-$3(#$7(&+#3%.+3($++7(>-(1+(3>%72+7(D,-*$3-$B(:RR9M(O#3#$?-B(K#..+7-B(<#A#""+B(E65-.&26?B(Q#8.23( %UH]JHU'LHW]HO &ODUNH&ODUNH LQFOXGLQJWKHZRUNFDUULHGRXWE\WKH(XURSHDQ 5-&&2332-$(D:RRGH(@*26*(+V#&2$+7(%.1#$(7+A+"-=&+$>(2$(A#.2-%3(J%.-=+#$(6-%$>.2+3(%32$8(#("#$7(%=>#?+( 2$7+V'(W.-&(>*23(.+3+#.6*(2>(6#$(1+(2$/+..+7(>*#>(>*+(#A+.#8+(J%.-=+#$("#$7(%=>#?+(1+>@++$(9FFR(#$7(:RRR( #&-%$>3(>-(#1-%>(-$+(&2""2-$(*+6>#.+3' I$(I>#"CB(>*+(=*+$-&+$-$(-/ ((T%.1#$(3=.#@"U((*#3(1++$(6-$327+.+7(/-.(&#$C(C+#.3(#3(-$+(-/ (>*+(6#%3+3(-/ ( XUEDQIXQFWLRQDOGLVRUJDQLVDWLRQLQWHUPVRI XVHRI VHUYLFHVDQGHIÀFLHQF\RI WUDQVSRUW ,18,QGRN A2$#B(9FFRM(X#&12$-B(9FFGM(I$7-A2$#(P(Q#A2$-B(9FFFM(5#&#8$2B(X21+""2(P(Y28#&-$>2B(:RR:H'(W%.>*+.&-.+B( &2$2&#"(7#>#(#.+(#A#2"#1"+(>-(-%>"2$+($#>2-$#"(%.1#$((8.-@>*(7C$#&263(32$6+(>*+(+$7(-/ (Z-."7(Z#.(IIB(#$7( 2$(=#.>26%"#.(2$(>*+(=#3>(>*2.>C(C+#.3(D!2"+.2B(:R9RM(Y-&#$-(P([%""-B(:R9:HB(@*26*(23(%$7-%1>+7"C(>*+(=+.2-7( ZKHQXUEDQVSUDZOKDVRFFXUUHGZLWKVLJQLÀFDQWO\KLJKHULPSDFWRQODQGHVSHFLDOO\LQWKHÁDWWHUDUHDVRI  >*+(6-%$>.C(D#3(2$(W28%.+(9H' E-.+(.+6+$>"CB(.+3=-$3212"2>C(>-@#.73(>*+(="#$$2$8(#$7(>-@#.73(>*+(=#>*-"-8C(-/ ("#$7(%=>#?+(23(1+6-&2$8( &-.+(#$7(&-.+(2&=-.>#$>(/-.(>*+(=%1"26(-=2$2-$'()*+.+/-.+(@+(>*2$?(>*#>(>*+(/%>%.+(="#$$2$8(>--"3(3*-%"7( 8#>*+.(>*+3+(>+$7+$62+3B(1C(2&=-32$8(.%"+3(>-(6-$>.#3>(-.(&2>28#>+(>*+("#$7(%=>#?+'()*+(6-$>.-"(#6>2-$(3*-%"7( EHHIIHFWLYHPDLQO\ZKHQWKHXUEDQVSUDZOLVUHODWLYHWRZLGHDJULFXOWXUDOÁDWDUHDV ZKLFKUHSUHVHQWOHVVWKDQ RI WKHQDWLRQDOWHUULWRU\ ZLWKORVVRI FURSSURGXFWLRQDQGRI HFRV\VWHPVHUYLFHV0RUHRYHUWKHXUEDQ 3=.#@"(*#3(3+.2-%3(+//+6>3(-$(3-2"(3+#"2$8B(@2>*(7+A#3>#>2$8(27.-8+-"-826#"(2&=#6>(-$((3+>>"+7(*%&#$(6-&&%N $2>2+3(DEJ\B(:RRLM(,#+8+.B(K+.>2""+.B(Q6*@26?B(5#A+$3B(P(O2+$#3>B(:R9RM(Q#$>-"2$2B(:R99H'(( )*23(=#=+.(#2&3(>-(2&="+&+$>(#(T3+>>"+&+$>(.23?(2$7+VU(>2+7(>-(&-.=*-"-826#"(6-&=-$+$>3(3%6*(#3(3"-=+( #">2>%7+B(8.#72+$>(#$7(#3=+6>' )*+(3+>>"+&+$>(.23?(&-7+"(23(2&="+&+$>+7(1C(&+#3%.2$8(3+$3212"2>C(>-(%.1#$23#>2-$(#3(+V=.+33+7(>-7#C(1C( >*+(A#.2-%3(>+..2>-.2#"(/#6>-.3'(032$8(7+6232-$3(#".+#7C(>#?+$(2$(32&2"#.(8+-8.#=*26#"(#.+#3B(#".+#7C(#//+6>+7( 1C(%.1#$23#>2-$B(2>(23(=-3321"+(>-(32&%"#>+(2$(>*+(&27N(#$7("-$8N>+.&(D]RNLR(C+#.3H(>*+(=.-1#12"2>C(-/ (#.+#3( %$7+.8-2$8(32&2"#.(=.-6+33+3B(#33%&2$8($-(6*#$8+(23(&#7+(>-(=.+A2-%3(1+*#A2-%.'( )*+(3+>>"+&+$>(.23?(2$7+V(*#3(1++$(>+3>+7(2$(3-&+(I>#"2#$(.+82-$3(@*+.+(&-.=*-"-8CN.+"#>+7(XIQ("#C+.3(#.+( DYDLODEOHWRDVXIÀFLHQWOHYHORI GHWDLOH[SUHVVHGE\WKHQRPLQDOVFDOHRI  9HQHWR0DUFKH8PEULD <#^2-B(\1.%^^-(#$7(E-"23+H'()*+(2$7+V(*#3(1++$(6#"6%"#>+7(1C(2&="+&+$>2$8(#$(#%>-&#>26(XIQ(&-7+"(>*#>( %3+3(6-&&+.62#"(8+-N=.-6+332$8(/%$6>2-$3'


!"#$%&'()*+(,-%.$#"(-/ (0.1#$23&(4(5-$/+.+$6+(!.-6++72$83

!"'&! !"'%!


!"'$! !"'#! !"'!! !"!&! !"!%! !"!$!










































<*=(3+>>"+&+$>(.23?(@ 7KLVSDSHUUHIHUVWR´VHWWOHPHQWULVNµDVRSSRVHGWRQDWXUDOULVNV HJVHLVPLFK\GURJHRORJLFDOÀUHHWF  ,WPD\DSSHDUWKDWXUEDQFRQWURORYHUIHDWXUHVDQGIXQFWLRQVLVWRWDODVGHVFULEHGE\DVSHFLÀFVWUDWHJ\RU :'&%9(;0+1(0+1-('$%*(:+1#$37($. ("#2+<("1&%7.$12&"#$%("1+%37<("#+3("$(5=2&%(+,$!+"5$'$*-<(+2+1*+(&%3(&1+( +>:1+77+3(?-('$,&'(,$22=%#"#+7<(@5#'+(:'&%7(.$''$@("5+7+("1+%37(1&"5+1("5&%(,$%"1$'("5+2(AB$2&%$<(CDDDE( B$2&%$(F(4&2?=1#%#<(CDDGE(H=%*+""#(F(B$2&%$<(CDDI89(4+11#"$1#&'(,5&%*+7(&1+(31#0+%(?-("5+(J=&'#"&"#0+( &%3( +,$%$2#,( &30&%"&*+7( $. ( :$"+%"#&'( 3+0+'$:2+%"7( &%3( ?-( &0&#'&?#'#"-( $. ( &1+&7( "5&"( &1+( ?+'#+0+3( "$( ?+( ?+""+1(.1$2(&(*+$!2$1:5$'$*#,&'($1(=1?&%(:$#%"($. (0#+@9(K"(#7(%$"(?-(,5&%,+("5&"<(.$1(3+,&3+7<(:'&%%#%*( 5&7(.&0$=1+3(%+@(7+""'+2+%"7(&'$%*(1$&37($1(%+&1(1$&3(L=%,"#$%7<(?="(&'7$(&'$%*($"5+1('#%+&1(+'+2+%"7(&7( 1#0+17(&%3(75$1+'#%+79(M#N+@#7+<('$,&"#$%7("5&"("+%3+3("$(,'$7+(*&:7('+."(?-(:1+0#$=7("1&%7.$12&"#$%7(5&0+( ?++%(:1+.+11+3(A#9+9(:&1"7($. (#%"+17"#"#&'('&%3(+#"5+1(0+1-(%+&1("$($1(#22+17+3(#%(:1+!+>#7"#%*(=1?&%(2&"1#>+789( &RQVLGHULQJJHRPRUSKRORJLFDODVSHFWVVHWWOHPHQWVHLWKHUWHQGWRGHYHORSGRZQVWUHDPLQÁDWDUHDVRUHQ! ,1$&,5(=:$%(5#''-(7+,"$179(6$2+($. ("5+7+(.&,"$17(5&0+(&'1+&3-(?++%(,$%7#3+1+3($%(&"(0&1#$=7(:$#%"7(#%(7:&"#&'( 3+,#7#$%!2&N#%*(3#7,#:'#%+7(AO&11+3$<(P&7&%N$<(Q,R$12#,N(F(M&0&''+<(CDDS89 $OOWKHVHDVSHFWVLPSDFWPDQ\FRXQWULHVZRUOGZLGHZLWKDOWHUQDWLQJSHULRGVRI LQWHQVLÀFDWLRQDQGVORZGRZQ AT&22+1<(6"+@&1"<(U#%@'+1<(B&3+'$.. (F(V$77<(CDDI8(&%3(&1+(3+1#0+3(.1$2("5+(=%3#7:="+3(+,$%$2#,(&%3( TXDOLWDWLYHEHQHÀWVZKLFKFRPPXQLWLHVH[SUHVVWRORFDOJRYHUQPHQWV7UDGLWLRQDOO\WKHUHZDVQRUHDVRQWR RSSRVHWKLVVRFLDOUHTXHVWEXLOGLQJRQÁDWODQGHVSHFLDOO\IRUEXLOGLQJIDFWRULHVDQGFRPPHUFLDOVWUXFWXUHV ,$7"7(.&1('+77(.$1("+,5%#,&'(1+&7$%79(M#N+@#7+<('$,&"#%*(?=#'3#%*7(&%3(=1?&%(7+10#,+7(&'$%*(+>#7"#%*(1$&37(5+':7( "5+('$,&'(+,$%$2-<(3=+("$(&(?+""+1(&,,+77("$("5+("+11#"$1-9(T#''7(&1+(:1+.+11+3(.$1(1+7#3+%"#&'(.=%,"#$%7<(&7("5+( J=&'#"-($. ('#.+(#7(*+%+1&''-(,'#2&"#,&''-(?+""+1(&%3(5#''7(&'7$(:1$0#3+(?+""+1(:1$"+,"#$%(&*&#%7"(5-31$*+$'$*#,&'( ULVNV HJÁRRGVLQXQGDWLRQVHWF HYHQLI VRPHWLPHVLVSUHVHQWODQGVOLGHKD]DUGLQKLOO\WHUUDLQV )7(&(1+7='"<(#"(#7(,'+&1("5&"(&1+&7(%+&1(2&L$1(=1?&%(,+%"1+7(A@5#,5(&,"(&7(7+10#,+(:1$0#3+17(&%3(L$?(,$%,+%"1&! "$178(&%3(.&0$=1&?'+(*+$!2$1:5$'$*#,&'(:$7#"#$%7(A+9*9(7"&?'+("+11&#%(#%(*$$3(,'#2&"#,(W$%+78(&1+(.&1(2$1+( 7=?L+,"("$(7+""'+2+%"(:1+77=1+<("5&%($"5+1(&1+&7(=%3+1(3#..+1+%"(,$%3#"#$%7(&%3(#"(#7("1=+(@$1'3@#3+9 K. ("$@%(:'&%%#%*($%'-(:=17=+7("5+(*$&'($. (*=&1&%"++#%*("5+(?+7"(1+7#3+%"#&'(&%3(:1$3=,"#$%(,$%3#"#$%7("$(

!"#$%&'()*+(,-%.$#"(-/ (0.1#$23&(4(5-$/+.+$6+(!.-6++72$83


*%&#$3<(=2>*("2>>"+(6-$3+.?#>2-$(6-$327+.#>2-$(@A.#$7<(BCC;D<(=+(6#$(+EF+6>(>*#>(F"#$$2$8(>--"3(=2""(&#2$"G( 3%FF-.>(>.#$3/-.&#>2-$3(7+32.+7(1G(F.2?#>+(3>#H+*-"7+.3(@2>(*#3(1++$(>*+(6#3+(/-.(7+6#7+3(2$(I>#"GD'(J3(#(.+K 3%"><(F#.>3(-/ (#(>+..2>-.G(=*26*(3%//+.(+E>.+&+"G(2$>+$32?+("#$7(6-$3%&F>2-$(7%+(>-(%.1#$23#>2-$(=2""(#"=#G3( 1+(7.2?+$(1G(>*+(F.2-.2>2+3(-/ ("-6#"(6-&&%$2>2+3'()*23(=-%"7("#.8+"G(1+(>*+(6#3+(+?+$(2$(>*+(#13+$6+(-/ (#$G( 8-?+.$#$6+'(0$7+.(>*23(36+$#.2-<(F"#$$2$8(&#2$"G(+E+.>3(6-$>.-"(-?+.(32L+(.#>*+.(>*#$("-6#>2-$<(#"28$2$8(2>3+"/ ( >-(>*+(>.+$73(7+6"#.+7(1G(>*+("-6#"(6-&&%$2>G'(M$(>*+(->*+.(*#$7<(#(>+$7+$6G(>-(1GKF#33(F"#$$2$8(.%"+3(23( +?27+$6+7(1G(#("#.8+($%&1+.(-/ (=-.H3(.+"#>2$8(>-(3F#>2#"(32&%"#>2-$3(-/ (%.1#$(8.-=>*(7G$#&263(%32$8(72//+K .+$>(&+>*-73<(#&-$8(=*26*(2$6"%7+(&+>*-73(1#3+7(-$("-823>26(.+8.+332-$(#$7(>*+(6+""%"#.(#%>-&#>#(&-7+"( @5"#.H+<(N-FF+$(O(P#G7-3<(9QQ;R(5-%6"+"23<(9QQ;R(A#>>G<(S2+(O(T%$<(9QQQR(U2<(T#>-(O(V*%<(BCCWR(X.+$H+"( $VKNHQD]L  I>(23(6"+#.(>*#>(>*+(>+$7+$6G(>-=#.7((%.1#$23#>2-$<(#3(7+36.21+7((1+/-.+<(&#G(+2>*+.(1+(3"-=+7(-.(72?+.>+7(/.-&( 2>3(F.+?2-%3(6-%.3+'()*+(2$>.-7%6>2-$(-/ (&+#3%.+3<(3%6*(#3(F.->+6>+7(#.+#3<(&#G(3>-F<(&2>28#>+(-.(6*#$8+( >*+(72.+6>2-$(-/ (*23>-.26#"(>.+$73'()*23(&#G(1+(7+&-$3>.#>+7(1G(6-$327+.2$8(>*+(8"-1#"(=#.&2$8(7+1#>+(#$7( &+#3%.+3(>-(&2>28#>+(>*+(F.-6+33' Y23H(3+>>"+&+$>(&#FF2$8<(2$2>2#""G(6#..2+7(-%>(%32$8(>*+(1#326(7+>+.&2$2$8(/#6>-.3((7+36.21+7(2$(>*23(F#F+.<( &#G("#>+.(%$7+.8-(72//+.+$>(/-.&3(-/ (?#"27#>2-$(#$7(#%72><(1G(6-&F#.2$8(2>(=2>*(>*+(&-3#26(-/ (-$8-2$8( %.1#$(#$7(2$/.#3>.%6>%.#"(F.-8.#&&+3(-.(+$?2.-$&+$>#"(F-"262+3'()*+3+(72//+.+$>(3>+F3(3*-%"7(F.-?27+(6"+#.( 2$726#>2-$3(.+8#.72$8(>*+(#FF.-#6*(>-(+6-"-826#"(3%3>#2$#12"2>G(-/ (%.1#$(8.-=>*'((

!"#$%&'$(&)%*+,$"$+(-"&'(&+'*). *(,-*'(/01*"-2&)%' J$#"G323(*#3(1++$(1#3+7(-$(>*+(6-$>+$>3(-/ (>*+(Z0(5MYI[Z(U#$7(5-?+.<(U+?+"(W'()*+(7#>#(3*-=3(>*#>( %.1#$(#.+#3<(2$6"%72$8(1%2">K%F(#.+#3(/-.(.+327+$>2#"(#$7(F.-7%6>2-$(F%.F-3+3(#3(=+""(#3(3%..-%$72$8(#.+#3( EXWH[FOXGLQJVXEXUEDQURDGV FRYHURQDYHUDJHRI WKHWHUULWRU\DWQDWLRQDOOHYHO 7KHDPRXQWRI XUEDQDUHDYDULHVFRQVLGHUDEO\DFURVVYDULRXVUHJLRQVUDQJLQJIURPDSSUR[LPDWHO\LQ VRXWKHUQUHJLRQVVXFKLQ0ROLVHWRDOPRVWLQPRUHLQGXVWULDOLVHGUHJLRQVVXFKLQ/D]LR 7DEOH  )*+3+(%.1#$23+7(#.+#3(7-($->(2$6"%7+(3%1%.1#$(.-#73(=*+.+($#>2-$#"(7#>#(#.+(?+.G(%$6+.>#2$(#3(*-&-8+K $-%3(PIT(2$/-.&#>2-$(-$(.-#73<(23($->(G+>(#?#2"#1"+(2$(I>#"G'(AG(#$#"G32$8(3-&+(.+82-$3<(=+(6#$(+E>.#F-"#>+( #(F#.#&+>+.(-/ ("#$7(%F>#H+(7%+(>-(>*+(.-#7($+>=-.H\(0&1.2#(*#3(#(.-#7($+>=-.H(=*26*<(1G(2$6"%72$8(.-#73( -/ (#""(>GF+3<(&->-.=#G3(#$7(.#2"=#G3<(#&-%$>3(>-(#1-%>(]^CC(H&<(=2>*(#(.+82-$#"(7+$32>G(-/ (#1-%>(C';(H&_ NPDQGODQGXSWDNHDPRXQWLQJWRRI WKHUHJLRQDOWHUULWRU\7KHSHUFHQWDJHRI ODQGRFFXSLHGE\WKH URDGQHWZRUNLQFUHDVHVWRLQ9HQHWR NPRI URDGVNPNP DQGLQ$EUX]]RWRR NP -/ (.-#73<(9<9(H&_(H&BD'

7DEOH4()+..2>-.2#"(6*#.#6>+.23>263(-/ (>*+(3>%7G(.+82-$3(@&-.F*-K "-826#"(6*#.#6>+.23>263(7+.2?+7(/.-&(>*+(IT)J)(7#>#1#3+(@[#>2-$#"( 5+$>.#"(I$3>2>%>+(-/ (T>#>23>263D'

1DWLRQZLGHGDWDRQXUEDQJURZWKRYHUWKHSDVW\HDUVDUHODFNLQJ'DWDEDVHVRI UHJLRQVDUHLQFUHDVLQJ 1->*(2$(>+.&3(-/ (`%#$>2>G(#$7(`%#"2>G(#>(#(/#3>(F#6+(#$7<(2$(#(/+=(G+#.3(>2&+<(2&F-.>#$>(2$/-.&#>2-$(=2""(1+( #?#2"#1"+'(T-&+(.+6+$>(3>%72+3<(1#3+7(-$(PIT(F.-6+332$8(-/ (%.1#$(8.-=2$8(/.-&(9Q]^<(*#?+(F.-7%6+7(3-&+(


!"#$%&'()*+(,-%.$#"(-/ (0.1#$23&(4(5-$/+.+$6+(!.-6++72$83

2$<+.+3<2$8(.+3%"<3'(=-.(+>#&?"+@(<*+(A-"23+(.+82-$@(-$+(-/ (<*+(3&#""+3<(2$(B<#"C(D2<*(#(3%./#6+(#1-%<(EEF@GGG( NPKDVVHHQLWVXUEDQDUHDVJURZLQJIURPKDLQWRDOPRVWKDLQDULVHLQÀIW\ C+#.3'(5-$327+.2$8(<*#<(<*23(.+82-$@(32<%#<+7(2$(<*+(6+$<.#"H3-%<*+.$(?#.<(-/ ((B<#"C@(*#3(.#<*+.(&-7+3<(3-62#"( #$7(+6-$-&26(7C$#&263@(2<(23(?"#%321"+(<*#<(2$(-<*+.(.+82-$3@(D*+.+(+6-$-&26(+$+.8C(23(/#.(8.+#<+.@(<*+(.23+( 2$(%.1#$(3%./#6+(-I+.(<*+(3#&+(?+.2-7(*#3(#"3-(2$6.+#3+7(1C(#(8.+#<+.(7+8.++(JK-&#$-@(L%""-@(5#.82$2@(=+1-@( B+MM2@(A#MM-"#(N(K-""-@(OG99P' )*+(7#<#(-1<#2$+7@(#"1+2<("2&2<+7@(3*-D(<*#<@(7%+(<-($#<2-$#"(+6-$-&26(<.+$73@(<*+(#I+.#8+("#$7(%?<#Q+(2$( ,WDO\ZLOOEHDSSURDFKLQJVRRQ,QSDUWLFXODUWKHSKHQRPHQDZKLFKOHDGWRLQFUHDVHGEXLOGLQJDUHWLHG WRWKHQHHGRI PXQLFLSDOLWLHVWRFROOHFWPRUHWD[HVRQEXLOGLQJVLQRUGHUWRÀQDQFHSXEOLFVHUYLFHVEXWWKHUH 23(#"3-(#(<+$7+$6C(/-.(?+-?"+(<-(2$I+3<(2$(.+#"(+3<#<+(D*+$(2$<+.+3<(.#<+3(*#3(1++$("-D(2$(B<#"C(%$<2"(C+#.(OG9G'( XUEDQLVDWLRQPD\VHHPKDUGO\DODUPLQJEXWWKHPRVWFRQFHQWUDWHGDUHDVRI EXLOGLQJVDQGWKHLUVXUH .-%$73(J3%6*(#3@(?#.Q2$8("-<3@(3+.I26+3@(&#$-+%I.2$8(#$7(#$62""#.C(#.+#3P(#.+(I+.C("2&2<+7'(B$(#(6-%$<.C("2Q+( ,WDO\ZKHUHPRXQWDLQDUHDVRFFXS\DSSUR[LPDWHO\DQGKLOO\DUHDVRYHUXUEDQVHWWOHPHQWGHQVLÀH FDWLRQLVTXLFNO\VDWXUDWLQJWKHÁDWDUHDVZKLFKRFFXS\RQO\RI QDWLRQDOWHUULWRU\ 7KH QHJDWLYH HIIHFWV RI  PDNLQJ ODQG LPSHUPHDEOH DUH DOUHDG\ YHU\ VLJQLÀFDQW DQG WKHUH LV FRQFHUQ WKDW 6"2&#<+(6*#$8+@(<*+(7+3<.%6<2-$(#$7((/.#8&+$<#<2-$(-/ (<*+(*#12<#<3(-/ (2$<+.$#<2-$#""C(2&?-.<#$<(3?+62+3(2$( 6+$<.#"(B<#"C(J3%6*(#3(<*+(1+#.@(<*+(D-"/ (#$7(<*+("C$>P@(<*+(#"<+.#<2-$(-/ (3%./#6+(#$7(8.-%$7(D#<+.@(<*+(.+7%H 6+7(6#?#12"2<C(<-(#13-.1(7-&+3<26(#$7(2$7%3<.2#"(+&2332-$3@(<*+(2..+I+.3212"2<C(-/ ("#$7(<-(#8.26%"<%.+(-$6+(2<( *#3(1++$(<.#$3/-.&+7(1C(%.1#$23#<2-$(#$7@(2$(3*-.<@(-I+.#""(.+7%6+7(.+32"2+$6+(<-(<*+(723<%.1#$6+3(#//+6<2$8( +6-3C3<+&3(JR-""2$8@(9S;TP'(U77+7(<-(<*23@(<*+.+(#.+(?.-1"+&3(<2+7(<-(%.1#$(3?.#D"@(3%6*(#3(72332?#<2-$(-/ ( HQHUJ\SROOXWLRQPRELOLW\UHODWHGGLIÀFXOWLHVLGHQWLW\ORVVDQGKLJKHUHFRQRPLFDQGVRFLDOFRVWV

!"#$%&# )*+(3+<<"+&+$<(.23Q(2$7+>(&+#3%.+3(*-D(3+$32<2I+(#(<+..2<-.C(23(<-(%.1#$("#$7(6-$3%&?<2-$'(B<(23(#$(+I#"%#H <2-$(1#3+7(-$(?.+I2-%3"C(#$#"C3+7(?*+$-&+$#(<#Q2$8(2$<-(#66-%$<(&-.?*-"-826#"(/+#<%.+3(3%6*(#3(3"-?+( #"<2<%7+@(8.#72+$<(#$7(#3?+6<'()*+(2$7+>(23($-<(V3?.+#7W(-I+.(?.+H+3<#1"23*+7(&2$2&%&(<+..2<-.2#"(%$2<3@(3%6*( #3(+$I2.-$&+$<#"(%$2<3(-.(#7&2$23<.#<2I+("2&2<3@(1%<(2$3<+#7(-I+.(3+"/H7+.2I+7(%$2<3' K+#""C(<*+(2$7+>(23(#"3-(#7&2$23<.#<2I+H1#3+7(1+6#%3+(23(2&?"+&+$<+7(-$(32$8"+(.+82-$3'((()*23(23(7%+(<-(<*+( /#6<(<*#<(%.1#$(3+<<"+&+$<(23(7.2I+$(1C(*%&#$(1+2$83(#$7($-<(1C(X#<%.+(#$7(3-("2$Q+7(2$(#(&+#3%.+(<-("#$7( <.#$3/-.&#<2-$(.+82-$#"(?-"262+3'( )*+(YBZ(&-7+"(%3+7(8+$+.#<+3(<+..2<-.2#"(%$2<3@((1C(&+#$3(-/ (#(3+[%+$6+(-/ (3?#<2#"(2$<+.3+6<2-$3(#&-$8(<*+( I#.2-%3(<*+&#<26("#C+.3@(D*26*(.+?.+3+$<(<*+(3+"+6<+7(&-.?*-"-826#"(I#.2#1"+3(J0$2[%+(5-$72<2-$(0$2<P(J5#"H FDWHUUD'L0DUWLUH3DOPD 3DULVH $VLPLODUPHWKRGRORJ\KDVEHHQXVHGLQGLIIHUHQWIUDPHZRUNV HJIRUHVWLPDWLQJWKHODQGVOLGHKD]DUGDQGULVN %UDEE $Q\ZD\WKHEDVHFRQFHSWLVYHU\GLIIHH .+$<(/-.(3+<<"+&+$<(.23Q@(1+6#%3+(<*+(%.1#$(8.-D2$8(23(#$(+I-"%<2I+(?*+$-&+$-$@(D2<*(<2&+(6-$3<#$<(-/ (<*+( -.7+.(-/ (7+6#7+3@(D2<*(7.2I+.3(D*26*(#.+(1-<*($#<%.#"(#$7(+6-$-&26H3-62#"@(#$7(&-.+-I+.(23(#(?*+$-&+$-$( /-.(D*26*(2<(23(?-3321"+(<-(6-$3<.%6<(#(3<#<23<26@(#<("-6#"(<+..2<-.2#"(36#"+' 0.1#$(Z+<<"+&+$<(K23Q(*#3(1++$(#33+33+7(1C(6-$327+.2$8(&-.?*-&+<.26(?#.#&+<+.3'(B<(23(<.%+(<*#<(#&-$8(<*+( &-3<(2&?-.<#$<(7.2I+.3(-/ (%.1#$(3+<<"+&+$<(#$7(8.-D2$8@(3-62#"(#$7(+6-$-&26(/+#<%.+3(?"#C(#(Q+CH.-"+@(1%<( *23<-.26#""C(<*+3+(/+#<%.+3(7+?+$7(2$(<%.$(-$(&-.?*-"-826#"(/#6<-.3'(A-.?*-"-826#"(/+#<%.+3(J-.(6#<+8-.2+3P( 23(.#$Q+7(7-D$(2$<-(V6"#33+3W' 7KHDOWLWXGHFODVVHVKDYHWKHWKUHVKROGVGHULYHGE\VWDWLVWLFDOPRUSKRORJLFDOFODVVLÀFDWLRQ ,67$7 ZKLFKLQ B<#"C(23(<*+(/-""-D2$8\ *(](TGG(&(#'3'"'( J6-#3<#"(1+"<3(#$7("-D(*2""3P TGG(^(FGG(&(#'3'"'( J*2""3P ²PDVO KLJKKLOOVDQGORZPRXQWDLQV


_(9GGG(&(#'3'"'( J&-%$<#2$3P

!"#$%&'()*+(,-%.$#"(-/ (0.1#$23&(4(5-$/+.+$6+(!.-6++72$83


)*+(8.#72+$<(6"#33+3(7+.2=+7(1>(?#$7(5#@#12"2<>(A+<*-73(BC8.26%"<%.+(5#$#7#(DE@+.<(5-&&2<<++(-$(F-2"( 6XUYH\&RVWDQWLQL ZKHUHODQGFDSDELOLW\LVHYDOXDWHGIRUDJULFXOWXUDODQGVHWWOHPHQWXVHVEDVHG -$(72//+.+$<(6*#.#6<+.23<263G(3%6*(#3(<*+(3"-@+(8.#72+$<'()*+(<*.+3*-"73(#.+(<*+(/-""-H2$8I S  S S S S! 






)*+(#3@+6<(6"#33+3(#.+(.#$J+7(%32$8(<*+(K%#7.#$<3(LDMLNG(LNMFNG(FNMFDG(FDMLD' )*+(3+<<"+&+$<(723<.21%<2-$(.#<+(23(&+#3%.+7(/-.(+#6*(6"#33(+E#&2$+7'()*23(23(+E@.+33+7(#3(#(@+.6+$<#8+(-/ ( %.1#$(6-=+.(H2<*2$(<*+(+#6*(6"#33'( )*23(@+.6+$<#8+(23(6#""+7(2OMF+<<"+&+$<(F+$32<2=2<>(P$7+E(BF3E2OQG(H*+.+(2R9GSGT(#$7(.+@.+3+$<3(<*+(6#<+8-.2+3G( OR9GSGU62(#$7(7+$-<+3(<*+(6"#33'(62(23(<*+($%&1+.(-/ (6"#33+3(2$(6#<+8-.>(2'(F3E2O(.+@.+3+$<3(<*+(+E<+$<(<-( H*26*(<*+((6"#33(O((2$(6#<+8-.>(2(23(3+$32<2=+(<-(<*+(@*+$-&+$-$(-/ (%.1#$23#<2-$(-=+.(<2&+'( *LYHQDVWXG\WHUULWRU\ZLWKDUHDHTXDOWR66V[LMLVIRUPDOO\GHÀQHGDVIROORZV

H*+.+I(( F%2O(R(3%&(-/ (<*+(%.1#$(#.+#3(/#""2$8(H2<*2$(<*+(6"#33(O(-/ ((6#<+8-.>(2V ( F2O(R(3%&(-/ (<*+(#.+#3(1+"-$82$8(<-(<*+(6"#33(O(-/ (6#<+8-.>(2'(

6LQFHRXUJRDOLVWKDWRI GHÀQLQJDVHWWOHPHQWULVNLQGH[ 6L[ ZKLFKWDNHVLQWRDFFRXQWWKHVHQVLWLYLW\LQGLFHV /-.(#""(<*+(6#<+8-.2+3G(2<(23(.+#3-$#1"+(<-(#33-62#<+(<-((#$(#.+#(6*#.#6<+.2W+7(1>(<*.++(6"#33(#<<.21%<+3G(-$+(/-.( +#6*(6#<+8-.>G(#(3+<<"+&+$<(.23J(2$7+E(H*26*(23(<*+(H+28*<+7(3%&(H2<*(.+3@+6<(<-(2(-/ (<*+(6-..+3@-$72$8(F3E2O( 2'+'


6L[  !!


7KHFRHIÀFLHQW_#LVDPHDVXUHRI WKHLQÁXHQFHRI FDWHJRU\#(-=+.(<*+(3+<<"+&+$<(723<.21%<2-$(#$7(23(/%$6<2-$( -/ (<+6*$26#"(#3@+6<3(B+'8'(H+(+E@+6<(<*#<(<*+(3+<<"+&+$<(@+.6+$<#8+(23(W+.-(H*+$(<*+(3"-@+(23(-=+.(#(82=+$(<*M .+3*-"7QG(-/ (6"2&#<26G(*23<-.26(#$7(3-62-M+6-$-&26(/#6<-.3'(Z%.(27+#(23(<*#<(-/ (6-$327+.2$8(<*+(=#.2#$6+Y#!-/ ( 2$726+3(F3E2OG(M F#,QIDFWWKHKLJKHULVWKHYDULDQFHWKHKLJKHULVWKHLQÁXHQFHRI FDWHJRU\#'(N*+$(=#.2#$6+( 23($WKHQWKHULVQRLQÁXHQFH7KHFRHIÀFLHQW_#LVGHÀQHGDV _2(RYL YYY

H*+.+(H+(#33%&+(<*#<(Y%Y&Y'X$(#$7(3-(<*+(=#"%+(-/ (F2E(23(1+<H++$($(#$7(%'

)*+(<*.+3*-"73(1+<H++$(6#<+8-.2+3(#$7(6"#33+3(23(3*-H$(2$()#1"+(S' A-.@*-"-826#"(6#<+8-.2+3(B52Q 59


( ( C"<2<%7+(B&(#1-=+(3+#("+=+"Q( ( (

5"#33+3(B52OQ [(T\\(((((((( 1+<H++$(T\\(#$7(:\\ EHWZHHQDQG EHWZHHQDQG X9\\\

!"#$%&'()*+(,-%.$#"(-/ (0.1#$23&(4(5-$/+.+$6+(!.-6++72$83


( <66"2=2>?(@3"-A+B( (


( <3A+6>( (



I-.+(2$(7+>#2"3J(/-.(#(6+.>#2$(6#>+8-.?J(>*+(3>%7?(>+..2>-.?(23(3%172=27+7(2$>-(K-$+3J(+#6*(-/ (#(6+.>#2$(6"#33'( L?(A%>>2$8(#""(6#>+8-.2+3(>-8+>*+.J(M+(-1>#2$(#(7+>#2"+7(A26>%.+(-/ (3%1FK-$+3J(+#6*(M2>*(#(6"#33(=#"%+(/-.(+#6*( 6#>+8-.?'(N$(+#6*(-/ (>*+3+(3%1FK-$+3J(>*+(=#"%+(-/ (>*+(2$7+O(H2O(-/ (-=+.#""(3+$3212"2>?(>-(%.1#$23#>2-$(6#$(1+( FRPSXWHG2I FRXUVHWKHSUHFLVLRQRI WKHUHVXOWGHSHQGVRQWKHOHYHORI GHWDLORI WKHDYDLODEOH'70PRGHO 'LJLWDO7HUUDLQ0RGHO' $VIRUWKHPHDQLQJRI WKHLQGH[XQGHUWKHK\SRWKHVLVWKDWVRFLDOEHKDYLRXU 3-(/#.(&+#3%.+7(.+&#2$3(%$6*#$8+7(2$(>*+(/%>%.+J(H2O(7+36.21+3(#(36+$#.2-J(#$7(M+(6-%"7(#33%&+(>*#>(2>3( YDOXHDVVRFLDWHGWRDQDUHDUHSUHVHQWVWKHSRVVLEOHXUEDQL]DWLRQUDWHIRUWKDWDUHDZLWKLQDVXIÃ&#x20AC;FLHQWORQJ >2&+(*-.2K-$(@#>("+#3>(CP(?+#.3B'(5-$327+.2$8(>*+(.+#"(=#"%+3(-1>#2$+7(#AA"?2$8(>*+(&+>*-7-"-8?(>-(>*+(3>%7?( UHJLRQVWKHÃ&#x20AC;QDOLQGH[KDYHEHHQUDQNHGDVIROORZ H2O(Q(PJPR(( ( PJPR(Q(H2O(Q(PJ9P((( PJ9P(Q(H2O(Q(PJ;R((( H2O(T(PJ;R( (

@"-M(.23SB @&+72%&(.23SB @*28*(.23SB @=+.?(*28*(.23SB

7KLVUDQNLQJLVDOVRUHIHUUHGWRWKHQDWLRQDODYHUDJHRI XUEDQUDWHLQ,WDO\WKDWLVHVWLPDWHDERXW$VDOUHF #7?(.+&#.S+7(2$(->*+.(3+6>2-$3(-/ (>*23(A#A+.J(%.1#$23#>2-$(A*+$-&+$#(#.+(#"3-(7+>+.&2$+7(1?(->*+.(/#6>-.3J( #3(2$/.#3>.%6>%.+3(#$7(A.-O2&2>?(>-(->*+.(%.1#$(#.+#3'(H2$6+(>*+3+(/#6>-.3(6#$(1+(7+328$+7(1?(>*+(A"#$$2$8( WRROVWKHNQRZOHGJHRI 6L[JLYHVDQLPSRUWDQWWRROWRLQFUHDVHRUGHFUHDVHWKHXUEDQLVDWLRQSUHVVXUHGHÃ&#x20AC;F $+7(-$(>*+(1#323(-/ (&-.A*-"-826#"(/#6>-.3' !"#$%%&










5.(//-/ 789::818(;/;.; 9::AB::818(;/;.; B::A=::818(;/;.; =::A>:::818(;/;.; E8>:::818(;/;.; F.(4 HIAHJ HJAKJ KJAKI KIAHI :A@L @A>:L >:AD:L D:A@:L E@:L




























































































7DEOH(4(0.1#$(3+$3212"2>?(-/ (&-.A*-"-826#"(6"#33+3

!"#$%&'()*+(,-%.$#"(-/ (0.1#$23&(4(5-$/+.+$6+(!.-6++72$83











5(4-6&#)-/ !"#$#%&'






































































7DEOH(4(0.1#$(3+$3212"29:(-/ (&-.;*-"-826#"(6#9+8-.2+3

!"#$%&'((4(0.1#$23#92-$(3+$3212"29:(#"-$8(9<-(&-.;*-"-826#"(9.#$3+693(-/ (5+$9.#"(=9#":(+>;.+33+7(1:(?2>(=$7+>


!"#$%&'()*+(,-%.$#"(-/ (0.1#$23&(4(5-$/+.+$6+(!.-6++72$83


787: 789;


787: 78:;


!()'*# ("+)'

<(*28*(3+=="+&+$=(.23>(?@2ABCD9CE(.+/+.3(=-(=*-3+(#.+#3(F*26*(#.+(+A=.+&+"G(H%"$+.#1"+(=-(%.1#$23#=2-$(#$7( $-=(-$"G(=-(1%2"72$8'(0.1#$(#.+#3(2$6"%7+(=*+(I-.=2-$(-/ ("#$7(-66%I2+7(1G(1%2"72$83(1%=(#"3-(1G(3%./#6+3( #.-%$7(1%2"72$83(F2=*(#$62""#.G(/%$6=2-$3D(3%6*(#3(6#.I#.>3(#$7(=+6*$-"-826#"(+J%2I&+$=3D(F*26*(=#>+(%I(3-2"( #$7(6#%3+(3-2"(3+#"2$8D(#3(1%2"72$83(7-' )#1"+3(K(#$7(L(#$7(M28%.+(N(3*-F(=*#=(72//+.+$=(=+..2=-.2+3D(3%6*(#3(=*+(3=%7G(O=#"2#$(.+82-$3D(*#H+(H#.G2$8( 3%36+I=212"2=G(=-(%.1#$23#=2-$'(O$(=*+(6#3+(-/ ((P#Q2-D(R#.6*+(#$7(0&1.2#D(#"=2&+=.G(I"#G3(#(&-.+(2&I-.=#$=( UROHLQWKHORFDWLRQDQGGHQVLÀFDWLRQRI VHWWOHPHQWVWKDQLQ$EUX]]RDQG0ROLVH*HQHUDOO\VORSHDVSHFWV KDVOLPLWHGLQÁXHQFHRYHUVHWWOHPHQWVLQDOOVWXG\FDVHVVKRZLQJWREHDWHUULWRULDODVSHFWWKDWGRHVQRWKDYH DVLJQLÀFDQWLPSDFWRQWKHGLVWULEXWLRQRI XUEDQVWUXFWXUHV )*+(#&-%$=(-/ (2$/-.&#=2-$(-1=#2$+7(2$(6#"6%"#=2$8(=*+(3+=="+&+$=(.23>(2$7+A(/-.(#""(=*-3+(I#.=3(-/ (=*+(=+.S .2=-.G(F*26*(*#H+(=*+(3#&+(/+#=%.+3(#$7(I.-H+$(=-(1+(1+==+.(3%2=+7(=-(%.1#$(3+=="+&+$=D(3*-F3(=*#=(F+(6#$( DVFULEHVHWWOHPHQWULVNWRWKHVHIHDWXUHVDVH[SUHVVHGLQ)LJXUH,QWKLVÀJXUHZKLFKVKRZVDGMDFHQWVWXG\ .+82-$3(2$(6+$=.#"(O=#"G(-$"GD(=*+(&#A2&%&("+H+"3(-/ (=*+(.23>(-/ ("#$7(6-$3%&I=2-$(7%+(=-(%.1#$23#=2-$(#.+( FRQFHQWUDWHGLQWKHÁDWDUHDVDQGDORQJWKHFRDVWDOOLQHVRUDORQJULYHUYDOOH\ÁRRUVEXWDOVRLQWKHEURDGHU H#""+G3(-/ (2$"#$7(#.+#3'(O=(23(-$"G(=--(6"+#.(=*#=D(F*+.+(3+=="+&+$=(.23>(23(*28*D(2=("+#73(=-(1%2"72$8(#$7(%.1#$( VDWXUDWLRQIRUWKHÁDWPRUSKRORJLHV7KLVLQWXUQOHDGVWRVHYHUHLVRODWLRQRI PRXQWDLQDUHDVZKHUHWKHPRVW 2&I-.=#$=($#=%.#"(+6-3G3=+&3(#.+(6-$6+$=.#=+7D(F*26*("-3+(=*+2.(2$=+.#6=2-$(-II-.=%$2=2+3D(=*%3(7#&#82$8( =*+(/#%$#(-/ (2$=+.$#=2-$#"(6-$3+.H#=2-$(2$=+.+3=(2$(=*+(<I+$$2$+3' $IXUWKHUFRQVLGHUDWLRQLVWKHORVVRI ÁDWODQGWKDWFRXOGEHXVHGIRUIDUPLQJ0XFKKDVDOUHDG\EHHQORVW F*2"+(=*+(6%..+$=(=.+$7(23(&#.>+7(1G(%.1#$(+AI#$32-$(2$(*2""G(#.+#3(=--D(I#.=26%"#."G(2$(=*+(6-#3=#"(*2$=+."#$7'(( )*+3+(#.+#3(3%II-.=(2&I-.=#$=(3I+62#"23+7(6.-I3D(3%6*(#3(-"2H+(8.-H+3D(H2$+G#.73(#$7("#.8+(#.+#3(-/ (8.#Q2$8( "#$7(F*26*(/-.&(#("#$736#I+(-/ (*28*(#+3=*+=26(H#"%+'

!"#$%&'('4(T+-8.#I*26#"(.+3%"=(-/ (3+=="+&+$=(3+$3212"2=G(#33+33&+$=(-$(=*+(3=%7G(#.+#3( 2$(5+$=.#"(O=#"G(+AI.+33+7(1G(H#"%+3(-/ (@2A(O$7+A'

!"#$%&'()*+(,-%.$#"(-/ (0.1#$23&(4(5-$/+.+$6+(!.-6++72$83


!"#$%&'("#' )*+(8+-8.#<*26#"(2$/-.&#=2-$(7+.2>+7(/.-&(=*+(6#"6%"#=2-$(-/ (=*+(3+=="+&+$=(.23?(&#@(1+(%3+/%"(=-(<"#$$+.3( 2$(-.7+.(=-(27+$=2/@(=.+$73'(()*+3+(6#$(2$/-.&(=*+(%3+(-/ (=-A$(<"#$$2$8(6#<#12"2=2+3(2$(-.7+.(=-(+B+.=(8.+#C =+.(6-$=.-"(#$7(2&<"+&+$=(6-$=#2$&+$=(<-"262+3(DE#33&+.F(9::GH(I-@"+(J(K-*#&+7F(9::;L(=*.-%8*(&-.+( 2$6232>+("#A3(=*#$(2$(=*+(<#3=(D5-"72$8F(9::;L'()*+(7+1#=+(-$(*-A(=-(M6-&<#6=N(%.1#$(#.+#3(.+&#2$3(-<+$F( 6-$327+.2$8(=*#=(=*23(3-"%=2-$(=--($++73(=-(1+(<%=(2$(<.#6=26+(%32$8(.+#3-$#1"+(6.2=+.2#(A*26*(>#.@(1+=A++$( 8+-8.#<*26#"(#.+#3'(O=(7-+3($-=("+$7(2=3+"/ (=-(32&<"23=26(8+$+.#"2P#=2-$3(D,+$?3F(I%.=-$(J(E2""2#&3F(QRRGL(7%+( WRPDQ\LQWHUUHODWLRQVEHWZHHQFRQXUEDWLRQVDQGWKHLUDGMDFHQF\PDWUL[ )RUPDQ  K-.+->+.F(#3(&+$=2-$+7(+#."2+.F(A+(3*-%"7($-=(/-.8+=(=*#=(=*+(6#=+8-.2+3(A*26*(3*-%"7(1+(%3+7(=-(6#"6%"#=+( =*+(3+=="+&+$=(.23?(2$7+B(&#@(1+(/#.(&-.+($%&+.-%3(=*#$(=*+(&-.<*-"-826#"(-$+3(7236%33+7(2$(=*23(<#<+.'( 0$/-.=%$#=+"@F( *-&-8+$-%3( #$7( +B=+$7+7( "#@+.3( -/ ( 2$/-.&#=2-$( A+.+( %$#>#2"#1"+( /-.( =*+( 3=%7@( .+82-$3( 6-$327+.+7'(S%=%.+(%.1#$(723=.21%=2-$(23(7+<+$7+$=(-$(8+-C"2=*-"-826(6*#.#6=+.23=263F(=*+(.-#7($+=A-.?(#$7( +B23=2$8(6-$%.1#=2-$3'(T+-"-826#"(<#.#&+=+.3(#.+(2&<-.=#$=($-A#7#@3(#$7(2=(23(#6=%#""@(6-$327+.+7(1@(%.1#$( SODQQHUVDQGPDQDJHUVLQGHÃ&#x20AC;QLQJWKHWUHQGRI XUEDQJURZLQJ%XWLWZDVQRWWKHVDPHLQWKHSDVWDORWRI  &%$262<#"2=2+3(A+.+(/-%$7+7(-$(A+#?(.-6?3(#$7(%$3=#1"+(=+..#2$3(#$7F(7%.2$8(=*+(=2&+3F(=*+@(+$"#.8+7(=*+2.( 1-%$7#.2+3(->+.(+>+$(A-.3+(=+..#2$F(2/ (<-3321"+' O$(=*+(6#3+(-/ (8+-C"2=*-"-8@F(A+(6#$(6-$327+.(>#.2-%3"@(8.-%<+7(6"#33+3'((U$+(<-33212"2=@(23(=-(.+3=.26=(-%.3+"C >+3(=-(=*+(&#2$(/+#=%.+3(3*-A$(2$(3=.%6=%.#"(36*+&+3'((V"=+.$#=2>+"@(A+(6-%"7(%3+(=*+(%$2=3(7+.2>+7(/.-&( 3=.#=28.#<*26(#$7(=+6=-$26(7236-$=2$%2=@(#$7(=*+(/-.&#=2-$3(2$=-(A*26*(=*+("#==+.(#.+(1.-?+$(7-A$(/-.(#(&-.+( 7+=#2"+7(36#"+(DS2-.2$2(J(W-&#$-F(9::;L'()*+(6*-26+("#.8+"@(7+<+$73(-$(=*+(32P+(-/ (=*+(=+..2=-.@(A*+.+(=*+( 2$7+B(23(%3+7(#$7(-$(=*+(8+-"-826#"(6-&<"+B2=@(-/ (=*+(3+==2$8(6-$327+.+7' )*+(6*-26+(-/ (6"#33+3(23(+#32+.(2$(=*+(6#3+(-/ (<.-B2&2=@(=-(.-#73F(A*+.+(2=(23(<-3321"+(=-(27+$=2/@(.-#7C327+( 3=.2<3(-/ (#(6-$3=#$=(A27=*(D+'8'(X:F(Q::F(QX:F(9::(&L' V33%&2$8(=*#=(2$(=*+(O=#"2#$(+B<+.2+$6+(=*+(&-.<*-"-826#"(/#6=-.3(*#>+(1++$(=*+(&#2$(7.2>+.3(-/ (%.1#$(<"#C 6+&+$=F(2$(<#.=26%"#.(2$(=*+("#3=(/-.=@(@+#.3F(#(&-.+(3-<*23=26#=+7(&+=*-7-"-8@(23(=*+(-$+(%3+7(=-(&+#3%.+( =*+(M%.1#$(#.-%$7(=*+(%.1#$NF(=*#=(23(=-(3#@(=*+(<-32=2>+(/++71#6?(+//+6=(=*#=(%.1#$(#.+#3(<.-7%6+(2$(#7Y#C FHQWWHUULWRULHVE\DWWUDFWLQJQHZXUEDQLVDWLRQ 0XUJDQWH/DV&DVDV 'DQHVH0XUJDQWH%RUUXVR J(Z#<%662F(9:QQL'(O$(=*23(6#3+F(2=(A-%"7(1+($+6+33#.@(=-(*#>+(#3(7#=#(#1-%=(3+=="+&+$=(7+>+"-<&+$=(3<.+#7( ->+.(#3(&#$@(<-2$=3(2$(=2&+(#3(<-3321"+'(([-A+>+.F(=*+3+(#.+(7#=#1#3+3(A*26*(#.+($-=(@+=(>+.@(A27+3<.+#7( 2$(O=#"@(#$7(=*+@(#.+(*#.7"@(*-&-8+$+-%3(/.-&(#(6*.-$-"-826#"(>2+A<-2$='()*23(#$#"@323(6-%"7F(*-A+>+.F(1+( YHU\VLJQLÃ&#x20AC;FDQWLI LPSOHPHQWHGLQDUHDVVXUURXQGLQJFRQXUEDWLRQVZKLFKZHFDQFODVVLI\DV´XUEDQFRQFHQC =.#=-.3NF(=*#=(23(=-(3#@(&-.+(#==.#6=2>+(/-.($+A(3+=="+&+$=3F(1+2$8(6"-3+(=-(3+.>26+3(#$7(.26*(2$(+&<"-@&+$=( <-33212"2=2+3'( )*+(&-7+"(7+36.21+7(2$(=*23(.+3+#.6*(6-%"7(1+(%3+/%"(2$((=+..2=-.2+3(#.-%$7(=*+(A-."7F(2$(<#.=26%"#.(A*+.+(=*+( %.1#$(<.+33%.+(23(*28*(#$7(=*+(&-.<*-"-8@(*#3(#(3=.-$8(2&<#6='



!"#$%&'()*+(,-%.$#"(-/ (0.1#$23&(4(5-$/+.+$6+(!.-6++72$83


!"#$%&'()*+(,-%.$#"(-/ (0.1#$23&(4(5-$/+.+$6+(!.-6++72$83




!"#$%&'()*+(,-%.$#"(-/ (0.1#$23&(4(5-$/+.+$6+(!.-6++72$83

!"#"$%&!'$()*'+,)&-&!'$()*'+,)&./0&1"#"$% 2',)'%%"&34"5'5" 6/$.,0,$*,&20/*,,("$%) 71/0,$*,8&7,409'0:-;9$,&<=>< !"#$%&'()*+(,-%.$#"(-/ (0.1#$23&4($'(564(7-"'5859:; <<<'="#$%&'$+>(?(@AAB(:65;C9DD; !.-E++F2$G3(=%1"23*+F(2$(HE>-1+.(59:;

?@,&!'$()*'+,&A'19,B& C$5,0+0,5"#,&6'5,%/0",)8&D"'%$/)5"*&?,*@$"E9,)& '$(&F'$'%,G,$5&H91,) A+.+$#(I2#1J

0$27+.32>K(F+G"2(A>%F2(F+""LMN%2"# 3+.+$#E2#1-OG&#2"'E-&  &

7KLVUHVHDUFKFRPHVIURPWKHREVHUYDWLRQWKDWRYHUWKHSDVWÃ&#x20AC;IW\\HDUVWKH,WDOLDQODQGVFDSHKDVEHHQUDGLFDOO\DOWHUHG 1P(%.1#$(F+7+"-=&+$>4(-/>+$(E#..2+F(-%>(<2>*-%>(/-.&#"(#$F(/%$E>2-$#"(N%#"2>2+3'()*+.+(23(#(/%$F#&+$>#"(F23E.+=#$EP( 1+><++$("+G23"#>2-$(-$("#$F3E#=+(E-$3+.7#>2-$(#$F(2>3(2&="+&+$>#>2-$4(+3=+E2#""P(2$(E#3+3(-/ (&+#3%.+3(<2>*-%>(#(3=+C FLÃ&#x20AC;FREMHFWPHDVXUHVWKDWWDNHLQWRDFFRXQWWKH´HYHU\ZKHUHµWKH´UHDOZRUOGµ )DULQD DQGQRWRQO\LQGLYLGXDO +"+&+$>3( -/ ( %$N%+3>2-$#1"+( 7#"%+4( #3( 2$F++F( .+N%2.+F( 1P( >*+( &-3>( .+E+$>( I-&&%$2>P( G%2F+"2$+3'( @$( 72+<( -/ ( >*+3+( =.+&23+34(#/>+.(#(3%.7+P(-/ (>*+(F2//+.+$>(E%">%.#"(#==.-#E*+3(>*#>(*#7+(G%2F+F(#$F(3>2""(G%2F+(3>#$F#.F34(3>%F2+3(#$F(=.#EC WLFHVUHODWHGWRWKHODQGVFDSHWKHXUEDQL]DWLRQRI VRLOVKDVEHHQLGHQWLÃ&#x20AC;HGDVDSDUDPHWHUWKDWFDQEHXVHGWRHYDOXDWH >*+(3>#>+(-/ (@>#"2#$("#$F3E#=+34(#3(2>(#//+E>(2$F23E.2&2$#>+"P(+7+.P(+Q=.+332-$3(-/ ("#$F3E#=+(7#"%+3'()*23(=#=+.(=.-=-3+3( DOVRRQWKHEDVLVRI TXDOLWDWLYHDQGTXDQWLWDWLYHWUHQGVRI XUEDQL]DWLRQWKHLGHQWLÃ&#x20AC;FDWLRQRI ´WUHQGLQJODQGVFDSHVµ F+.27+F(#"3-(/.-&(R-E#"(A>.#>+G2E(!"#$3(=.-7232-$3'(

!"#$%&'(#)%" )*+(<-"=3+&=(-/ (>*+(6-$6+<>(-/ ("#$736#<+?(.+6-8$2@+7(#"3-(1=("+823"#>2A+(8%27+"2$+3?(>*+(72//+.+$>(72362<"2$B #.=(#<<.-#6*+3(>*#>(8%27+(+C<+.>3(>*#>?(/-.(>*+(.+#3-$(#1-A+?(7+#"?(D2>*(+E%#"(.28*>3?(D2>*(>*+("#$736#<+?(#$7?( Ã&#x20AC;QDOO\WKHODFNRI JXLGHOLQHVIURP,WDOLDQDXWKRULWLHV ZKLFKDUHLQVWHDGSUHVHQWLQRWKHU(XURSHDQFRXQWULHV 3%6*(#3(F.2>#2$(#$7(G.#$6+H?(*#A+("+7(>-(#$(+C>.+&+"=(72A+.3+(&+>*-7-"-826#"(/.#&+D-.I(-/ (>+6*$2E%+3(#$7( SDUDPHWHUVXVHGWRGHÃ&#x20AC;QHDQGDVVHVVODQGVFDSHVHYHQLQWKRVHSURFHGXUHVZKHUHLW·VH[SUHVVO\UHTXLUHGVHFB >-.(<"#$3?(+$A2.-$&+$>#"(#33+33&+$>3(JKLM?(NKM?(KKMH(#$7("#$736#<+3(.+<-.>3' )*+.+/-.+?( D*+$( >+6*$262#$3( #.+( .+E%2.+7( >-( +A#"%#>+( >*+( >+..2>-.=( /.-&( #( "#$736#<+( <-2$>( -/ ( A2+D?( >*+=( 8+$+.#""=(6*--3+(O%78&+$>(6.2>+.2#(6#3+(1=(6#3+?(#66-.72$8(>-(>*+2.(<+.3-$#"(2$6"2$#>2-$3(1%>(#"3-(1#32$8(>*+2.( 7+6232-$(-$(>*+(6*#.#6>+.23>263(-/ (>*+("-6#"(6-$>+C>(?(-$(>*+(>=<+(-/ (2$3>.%&+$>(>-(1+(2&<"+&+$>+7(#$7(-$( >2&+(#$7(7#>#(#A#2"#1"+'(P*2"+(-$(-$+(327+(>*23(&-7%3(-<+.#$72(#""-D3(>-(6#"21.#>+(>*+(#$#"=323(-$(>*+(3<+62B Ã&#x20AC;FLW\RI WKHWHUULWRU\RQWKHRWKHULWPDNHVH[WUHPHO\GLIÃ&#x20AC;FXOWWRFRPSDUHDQDO\]HVEHWZHHQGLIIHUHQWFDVH 3>%72+3(#$7(6-$3+E%+$>"=(>-(#6E%2.+(#$(-A+.A2+D(-$(>*+(3>#>+(-/ (>*+(L>#"2#$("#$736#<+(1#3+7(-$(-1O+6>2A+(#$7( 6-&&-$(<#.#&+>+.3'(L>(#"3-(<.+A+$>3(>-(%$7+.3>#$7(>*+(>.+$7(-/ ("#$7(>.#$3/-.&#>2-$(#$7(>*%3(>-(<.-A27+( 8+$+.#"(8%27+"2$+3(/-.(>*+(+$>2.+(6-%$>.=' Q$(3+A+.#"(-66#32-$3(7%.2$8(>*+(.+6+$>(=+#.3?(+3<+62#""=(#/>+.(>*+(K%.-<+#$(R#$736#<+(5-$A+$>2-$(JKR5H?( >+6*$262#$3(#$7(36*-"#.3(+C<.+33+7(>*+($++7(>-(&-$2>-.(>*+("#$7(2$(2>3(D*-"+$+33SZLWKFRGLÃ&#x20AC;HGSDUDPHWHUV /-.(#$=(#6>2A2>=(>*#>(.+"#>+3(>-(>*+("#$736#<+(6-&+3(/.-&(#(7++<(I$-D"+78+(>*#>(6#$(<.-&->+(#6>2-$3(#$7( #33+33&+$>(&+>*-73(>*#>(8%27+(<"#$$2$8?(&#$#82$8(#$7(&#2$>+$#$6+(#6>2A2>2+3(JT#$28"2-(5'?(9UUVH'

*+,-,./0'/#)%"-#,(+")1',2 M(3%.A+=(-/ (>*+(+A#"%#>2-$(>+6*$2E%+3(6-&&-$"=(%3+7(2$("#$736#<+(#$#"=323(3*-D3(>*.++(/%$7#&+$>#"(#<B SURDFKHVHDFKRQHZLWKDVSHFLÃ&#x20AC;FFXOWXUDODQGPHWKRGRORJLFDOSRLQWRI YLHZWKHDHVWKHWLFDQGSHUFHSWLYH DSSURDFKWKHFXOWXUDORQHDQGÃ&#x20AC;QDOO\WKHHFRORJLFDOIXQFWLRQDORQH M&-$8(>*+(>*.++?(>*+(<+.6+<>2A+(#<<.-#6*(23(6+.>#2$"=(>*+(-$+(>*#>(1+3>(8-+3(1+=-$7(2>3(72362<"2$#.=(1-%$7B #.2+3(#3(2>(23(#(<-2$>(-/ (A2+D(#"3-(>#I+$(2$>-(#66-%$>(2$(.+3+#.6*(#$7(#$#"=323(/-6%3+7(-$(>*+(->*+.(<#.#&+>+.3' (YHQWKHHFRORJLFDOYDOXHVR  I WKHODQGVFDSHDOWKRXJKPHQWLRQHGLQGHÃ&#x20AC;QLWLRQVDQGJXLGHOLQHVHVSHFLDOO\DW 9 2$>+.$#>2-$#"("+A+" ?(#"&-3>($+A+.(#6E%2.+(#(/%$6>2-$#"(&+#$2$8?(<+.323>2$8(D2>*(>*+(27+#?($-D(-13-"+>+?(-/ ( W$#>%.#"(1+#%>=X' 7KLVVKRZVKRZWKHFXOWXUDOFRQFHSWVRI QDWXUHDUHVWLOOYHU\GLIIHUHQWIURPWKHVFLHQWLÃ&#x20AC;FFRQFHSWRI HFRB "-826#"(/%$6>2-$(JY#33#%+.?(SZZ[H' &RPPXQLWLHVVWLOOKDYHGLIÃ&#x20AC;FXOWLHVWRSHUFHLYHQDWXUHDVDZKROHDQGWRLGHQWLI\LWHPRWLRQDOO\ZLWKWKHHYB +.=7#=("#$736#<+?(D*2"+(2>(23(6-&&-$(<.#6>26+(>-(.+&#2$(2$(#D+(-/ (3<+6>#6%"#.(36+$+.2+3(#D#=(/.-&(*-&+( JY#A+*?(SZZ:H'()*23(D+#I$+33(*#3(#//+6>+7(>*+(+A#"%#>2-$(<.-6+33(#$7?(6-$3+E%+$>"=?("#$736#<+(A#"-.2@#>2-$( #$7(&#$#8+&+$>(#$7(%">2&#>+"=(>*+(>.#$3/-.&#>2A+(<*+$-&+$#(-/ (>*+(#.+#' L$(L>#"=?(D*+.+(>*+(#+3>*+>26(6-&<-$+$>("+7(8%27+"2$+3(#$7(<.#6>26#"(#<<"26#>2-$3(32$6+(>*+(1+82$$2$8(-/ (>*+( W"#$736#<+X(233%+?(>*23(32>%#>2-$(23(<#.>26%"#."=(+A27+$>' )*+(*28*+.(2$3>2>%>2-$#"(3+$32>2A2>=(>-(#+3>*+>26(#$7(6%">%.#"(A#"%+3(((-/ (>*+("#$736#<+(7-+3$\>("+#7(>-(&#O-.( 7+/+6>2-$3(-/ (6-$3+.A#>2-$(2$(3-B6#""+7(.+&->+(#.+#3?("-6#>+7(-A+.(#(6+.>#2$(723>#$6+(/.-&(>*+($+#.+3>(%.1#$( #.+#( J]-&#$-( #$7( ^%""-?( 9USUH?( D*+.+( >*+( 1+#%>=( -/ ( >*+( "#$736#<+( #6>3( "2I+( #$( W%&1.+""#( 6-$6+<>X( /-.( >*+(6-$3+.A#>2-$(-/ (+6-B/%$6>2-$#"(A#"%+3(('(L>(<-3+3?(>*-%8*?(3+.2-%3("2&2>#>2-$3(2$(>*+(W.+#"(D-."7(WJG#.2$#?( S( G-.(+C#&<"+?(>*+(7+6#"-8%+(7.#D$(%<(1=(>*+(L>#"2#$(_+-8.#<*26#"(N-62+>=(´)RUJRRGSROLFLHVLQGHIHQVHRI RXUKHULWDJHµ 2$6"%7+7(2$(>*+(9UUZ(`LL(M$$%#"(]+<-.>(+$>2>"+7(WL>#"2#$("#$736#<+3'(F+>D++$($-3>#"82#(#$7(>.#$3/-.&#>2-$X(3>#>+3( >*#>a(´7KHUHLVQRSURWHFWLRQDQGWKHUHIRUHQRYDORUL]DWLRQDQGGHYHORSPHQWZLWKRXWWKHDQDO\WLFDONQRZOHGJHRI WKHVWUDWLÃ&#x20AC;HGPRVDLFRI  ,WDOLDQODQGVFDSHVUHJLRQE\UHJLRQDUHDE\DUHDVLWHE\VLWHDQGZLWKRXWWKHDELOLW\WRPRQLWRUFRQWLQXRXVO\WKHODQGVFDSHDVPRGHUQ WHFKQRORJLHVZRXOGDOORZXVWRGRLI WKHUHZHUHDWDOOOHYHOVWKHZLOOLQJQHVVWRPRYHWRZDUGVWKLVGLUHFWLRQµ 9( N%6*(#3(2$(>*+(5-$A+$>2-$(-$(>*+(!.->+6>2-$(-/ (>*+(P-."7(5%">%.#"(#$7(Y#>%.#"(b+.2>#8+(1=(0YKN5Q(JSZ;9H(D*26*( .+6-8$2@+3(>*+(W$#>%.#"(*+.2>#8+X(#$7(2$(>*+(&-.+(.+6+$>(K%.-<+#$(R#$736#<+(5-$A+$>2-$(J9UUUH'


!"#$%&'()*+(,-%.$#"(-/ (0.1#$23&(4(5-$/+.+$6+(!.-6++72$83

 ZKHUHVRPHWLPHVWKHHOHPHQWVRI QDWXUDOEHDXW\DUHQRWFRQVLGHUHGDVVLJQLÃ&#x20AC;FDQWE\WKHSHRSOH <+=(=*+(>.+#"(?-."7@(23(?*+.+(=*+(8#&+(-$(=*+(6-$3+.A#=2-$(-/ ("#$736#B+(C%#"2=D(23(1+2$8(B"#D+7E(?*+.+("#$7( =.#$3/-.&#=2-$3(-66%.(&-.+(C%26F"D(#$7(&-.+(2$6232A+"DE(#$7(?*+.+(+6-$-&26(2$=+.+3=3(#.+(*#.7"D(+A+.(.+"#G =+7(=-(=*+(A#"%+3(-/ ($#=%.#"(6#B2=#"(#$7(-/ (+6-"-826#"(/%$6=2-$3H' I3( 5#"7?+""( JKLLMN( 3=#=+3O( >"#$736#B+( +6-"-823=3( #$7( B"#$$+.3( $++7( #( 6.2=26#"( %$7+.3=#$72$8( -/ ( 1-=*( =*+( 3-62#"(+6-"-8D(#$7(=*+($#=%.#"(+6-"-8D(-/ (=*+(+$A2.-$&+$=3(?2=*2$(?*26*(=*+D(?-.F'()*+D($++7(=*23(2$328*=( $-=(-$"D(=-(3%66+33/%""D(B%.3%+(=*+2.(B.-/+332-$#"(=#3F3E(1%=(#"3-(=-(*+"B(+"+A#=+(B%1"26(6-&B.+*+$32-$(-/ ( WKHVLJQLÃ&#x20AC;FDQFHRI ODQGVFDSHIRUWKHTXDOLW\RI OLIHµ )*23(23(#(A2=#"(&+33#8+E(82A+$(=*+(.#B27(#$7(8"-1#"("#$736#B+3(7+8.#7#=2-$(#$7(=*+("-33(-/ (=*+2.(12-"-826#"E( 6%"=%.#"(#$7(36+$26(#6=2A2=2+3'

!"#$%&'(#)*+&'$&, $-)./'$*&+0*$/*$1##2+'3$4&+'2 P2$72$8(#(6-&&-$(8.-%$7E(6-&&-$(=*.+#=3(#$7(2$=+.B.+=#=2-$3(A#"27(/-.(+#6*(-/ (=*+(=*.++(6%"=%.#"(#BB.-G #6*+3(23(6%..+$="D(=*+(&-3=(+//+6=2A+(?#D(=-(1+(#1"+(=-(&#F+(+6-G/%$6=2-$#"(A#"%+3(((&-.+(%$7+.3=#$7#1"+(#$7( =-(6-$$+6=(=*+&(=-(=*+(6-8$2=2A+(#$7(6%"=%.#"(7-&#2$3' I(B#.#&+=+.(=*#=(23(B#.=26%"#."D(3%2=+7(=-(B.-A27+(#(3D$=*+=26(Q%78&+$=(23(=*+(%.1#$2R#=2-$(-/ (3-2"3(?*26*( #//+6=3(2$(=*+(3#&+(?#D(=*+(+SB.+332-$3(-/ (=*+(=*.++("#$736#B+(A#"%+3' )*+($+8#=2A+(+//+6=3(-/ (=*+(2$6.+#3+(2$(%.1#$(3B.#?"(2$A-"A+(=*+("#$736#B+($-=(-$"D(/.-&(#$(+6-"-826#"(B-2$=( -/ (A2+?E(1%=(#"3-(2$(2=3(#+3=*+=26(B+.6+B=2-$(#$7(2$(2=3(27+$=2=D(#$7(*23=-.D(&+#$2$83E(1D(/#2"2$8(1#326(+6-3DG 3=+&(3+.A26+3(J)#1"+(TN'()*23(23(+A+$(&-.+(=.%+(2$(T=#"DE(?*+.+("#$736#B+(A#"%+3(-/=+$(-A+."#B(-$(=*+(3#&+( =+..2=-.D((O(*+.+(=*+(3B.#?"(+$73(%B(1D(#//+6=2$8(*23=-.26(#$7(6%"=%.#"(=+..2=-.2+3E(?*26*(?2""(1+(7+3=.-D+7(#$7( #$$2*2"#=+7(2/ (=*+.+(23($-(#?#F+(3-62#"(6-$362-%3$+33(=-(3#/+8%#.7(=*+3+(A#"%+3(J)%..2E(9MMMN' 5%&*6*2#1$*#)(+%#


V-2"(23(#$(+33+$=2#"(+"+&+$=(2$(=*+(.+8%"#=2-$(-/ (=*+($#=%.#"(6D6"+3(-/ (?#=+.E(#2.E(&2$+.#"3 DQGRUJDQLFPDWWHULWÃ&#x20AC;OWHUVSXULÃ&#x20AC;HVGHJUDGHVDQGDFFXPXODWHV V-2"(.+B.+3+$=(=*+("2A2$8(*#12=#=(-/ (#(?27+(.#$8+(-/ (-.8#$23&3(J&26.--.8#$23&3E(/%$82E( W2-"-826(/%$6=2-$ #$2&#"3E(B"#$=3(#$7(*%&#$3N' V-2"(23(=*+(1#323(/-.(#8.26%"=%.#"(#$7(/-.+3=.D(B.-7%6=2-$(#$7(=*+(3-%.6+(-/ (.#?(&#=+.2#"3( U6-$-&26(/%$6=2-$ 3%6*(#3(6"#DE(3#$7E(8.#A+"E(&2$+.#"3' V-2"(+&1-72+3(=*+("#$736#B+(#$7(=*+(&#.F3(-/ (*23=-.26(#$7(6%"=%.#"(&+&-.D(-/ (*%&#$( 5%"=%.#"(/%$6=2-$ #$7($#=%.#"(#6=2A2=2+3' 7DEOH4(V-2"(+6-3D3=+&(3+.A26+3 U#6*(#$7(+A+.D(A#"%+(((-/ (=*+("#$736#B+(23(=*+.+/-.+(+C%#""D(3+$32=2A+(=-(=*+(6-$A+.32-$(-/ ("#$7(2$=-(%.1#$(%3+E(=*%3(=*+( PRQLWRULQJRI WKLVSKHQRPHQRQFRXOGEHDÃ&#x20AC;UVWVWHSWRZDUGVODQGVFDSHFRQVHUYDWLRQDQGPDQDJHPHQW DVFDOOHGIRU 1D(UX5NE(1#3+7(-$(#(*-"23=26(#$7(6-&B"+S(A2+?(-/ (=*+("#$736#B+(#3(#(6-&&-$(8--7' U6-"-826(/%$6=2-$

!"#$-)./'+8/2+&'$+'$9.)-88& I(6#3+(3=%7D(-/ (%.1#$2R#=2-$(#3(#(B#.#&+=+.(=-(#33+33("#$736#B+(C%#"2=D(2$(#""(-/ (2=3(#3B+6=3(?#3(6-$7%6=+7( 2$(=*+(I1.%RR-(.+82-$'()*+(3=%7D(#.+#3(?+.+(6*-3+$(#&-$8(=*+("#$736#B+(%$2=3E(7+=+.&2$+7(1D(=*+2.(B*D32-G 8.#B*26(+"+&+$=3(JIYVVI(I1.%RR-NE(?*+.+(=*23(=.+$7(-/ ("#$7(%3+(6*#$8+(*#3(1++$(-13+.A+7'()*23(.+3+#.6*( XVHGDGLDFKURQLFDSSURDFKFRPSDULQJWKUHHWLPHSHULRGVWKHPLGVWKHHDUO\VDQGWKHSHULRG #/=+.(9MMM'()*+(#==+$=2-$(?#3(=*+$(/-6%3+7(-$(Z;(&%$262B#"2=2+3(-/ (=*+(B.-A2$6+(-/ ()+.#&-E(I1.%RR-E(/-.( ZKLFKWKHPRVDLFRI WKH/RFDO6WUDWHJLF3ODQ 35* SURYLVLRQVDVLQIRUFHXQWLOKDVEHHQH[DPLQHG H( P-.(=*+3+(.+#3-$3(?+.+(7+A+"-B+7(3-&+(+A#"%#=2-$(B#.#&+=+.3E(3%6*(#3(=*+(+6-3D3=+&(3+.A26+3(J5-3=#$R#(+=(#"'(KLL;[( 'DLO\6FRWWHWDO+DLQHV<RXQJ/XFNHWDO$QWURS ZKLFKJLYHDYDOXHWRWKH´QDWXUDO FDSLWDOµPRUHHDVLO\TXDQWLÃ&#x20AC;DEOHLQHFRQRPLFWHUPV(FRV\VWHPVHUYLFHVDUHFXUUHQWO\RQHRI WKHEHVWZD\VWRUHODWH =*+(+6-"-826#"(A#"%+(=-("#$736#B+(#33+33&+$='

!"#$%&'()*+(,-%.$#"(-/ (0.1#$23&(4(5-$/+.+$6+(!.-6++72$83


<!26=%.+(>?'()*23(&#7+(2=(@-3321"+(=-(3*-A(*-A(8+$+.#"(%.1#$(@"#$$2$8(8%27+3(=*+(=.#$3/-.&#=2-$(-/ (=*+( =+..2=-.B(#$7(A*26*(#.+(=*+(/#6=-.3(=*#=(7+=+.&2$+(=*+(6*#$8+3(+$C23#8+7(1B(=*+(@"#$3'(!"#$$2$8(2$3=.%&+$=3D( +3@+62#""B(=*+(!EFD(#.+(=*+(-$+3(=*#=(*#C+(&-3=(@-A+.(=-(&#$#8+(#$7(3#/+8%#.7(=*+("#$736#@+(1B(2&@"+&+$G =2$8(#@@.-@.2#=+(@-"262+3D(#3(2=(23(#=(=*+("-6#"("+C+"(=*#=(=*+(3=.-$8+3=(6*#$8+3(-66%.'(H=(23(=*+.+/-.+(+33+$=2#"(=-( %$7+.3=#$7(=*23(&+6*#$23&3(2$(-.7+.(=-(1+3=(#6=(#8#2$3=(=*+(6%..+$=(=.+$7(-/ ("#$736#@+(#"=+.#=2-$'




!"#$%&'()*+(,-%.$#"(-/ (0.1#$23&(4(5-$/+.+$6+(!.-6++72$83


!"#$%&'()*+(,-%.$#"(-/ (0.1#$23&(4(5-$/+.+$6+(!.-6++72$83


HOHPHQWDERXWKDRI XUEDQL]HGWHUULWRU\RI WKHWRWDOLWLVQRWHYHQWRXFKHGE\WKHSHULPHWHURI  #$9(-:*+.(#.+#(7+.2;+7(/.-&(:*+(<-$2$8(&-3#26'(=:(&+#$3(:*#:(#(>-.:2-$(-/ (:*+(3+::"+&+$:3(8-+3(1+9-$7(:*+( SODQQLQJFRQWURO7KLVLVDSURRI RI KRZGLIÃ&#x20AC;FXOWLWLVWRFRQWUROWKHXUEDQVSUDZOWKURXJKSODQQLQJSROLFLHV "2?+(:*+9(#.+(6%..+$:"9(6-$6+2;+7(#$7(2:(>-3+3(:*+(233%+(-/ (*-@(:-(.+/-.&(>"#$$2$8(&+:*-7-"-82+3A(:--(-/:+$( WUHDWHGDVDPHUHPDQXDOVIDUIURPVSHFLÃ&#x20AC;FSUREOHPVRI WKHWHUULWRULHVDQGRIWHQFDOLEUDWHGWRRQO\PHHW :*+($++73(-/ (6+.:#2$(&%$262>#"(#.+#3' )*+(#$#"9323(3*-@3(:*#:(:*+(<-$2$8(>"#$3(3++&(:-(.+3>-$7(:-(#("-826(6-&>"+:+"9(2$7+>+$7+$:(/.-&(2$>%:3( #..2;2$8A(-.(+B>+6:+7(:-(#..2;+A(/.-&(*28*+.("+;+"3(-.(2$>%:3(:*#:(3*-%"7(6-&+(/.-&(#$#"9323(6-$7%6:+7(-$(:*+( "-6#"(32:%#:2-$'()*+9(#.+A(2$(/#6:A(2$(6-$:.#3:(@2:*(7+&-8.#>*26(:.+$73(C-/:+$(2$(7+6"2$+D(#$7(@2:*(:*+(7+8.++( -/ (2&>"+&+$:#:2-$(-/ (>.+;2-%3(>"#$$2$8(2$3:.%&+$:3A($-:(3#:23/92$8(:*+(79$#&263(:*#:(#.+(#6:%#""9(:#?2$8( >"#6+A(#$7(3+"/E.+/+.+$:2#"(6-&>#.+7(:-(:*+(3%88+3:2-$3(6-&2$8(/.-&(*28*+.E"+;+"(#%:*-.2:2+3(#$7(:-(@*#:( *#>>+$3(2$($+#.19(#.+#3A(+3>+62#""9(.+8#.72$8(32<+(#$7(>"#6+&+$:(-/ (#6:2;2:2+3A(3%6*(#3(2$7%3:.2#"A(1%32$+33( #$7(6.#/:(#.+#3A(@2:*(:*+(*28*+3:(F%#"2:#:2;+(#$7(F%#$:2:#:2;+(2&>#6:(-$(("#$736#>+'

!"#$%&'((4(!.-;2$6+(-/ ()+.#&-G(.#:+(-/ (%$.+#"2<+7(>.-7%6:2;+(#.+#3

$FODVVLÃ&#x20AC;FDWLRQRI ODQGVFDSHVE\XUEDQG\QDPLFV )*+(3:%79(-$(32<+(#$7(F%#"2:9(-/ (%.1#$2<#:2-$(:.+$73(&28*:(1+(%3+7(:-(>.-;27+(#(79$#&26(>26:%.+(-/ ("#$E 736#>+3A(#(;2+@(-$(:+$7+$62+3(:*#:(@-%"7(1+(&%6*(&-.+(%3+/%"A(:*#$(#(3:#:26(#>>.-#6*A(:-(:*-3+(@*-(#.+( JRLQJWRGHÃ&#x20AC;QHWKHIXWXUHWUDQVIRUPDWLRQVRI WKHWHUULWRU\WKURXJKWKHPRVWGLVSDUDWHSODQQLQJSURFHVVHV )HUUDULR 7KLVSDSHUWKHUHIRUHSURSRVHVDÃ&#x20AC;UVWGHÃ&#x20AC;QLWLRQRI ´WUHQGLQJODQGVFDSHVµEDVHGRQWKHLU 6%..+$:(7+8.++(-/ (%.1#$2<#:2-$(#$7(-$(:*+(:.+$7(:*#:("#$7(%3+(>.-6+33+3(#.+(/-""-@2$8' ,QWKHVSHFLÃ&#x20AC;FFDVHRI $EUX]]RWKLVVWXG\GLYLGHGODQGVFDSHXQLWVLQWRIRXUWUHQGV SLFWXUH  Â&#x2021; H#$736#>+3(:*#:(:+$7(:-(1+(3#:%.#:+7G(#.+#3(2$(@*26*(:*+(+B>"-2:#:2-$(-/ ("#$736#>+3(#$7(+$;2.-$&+$:#"( .+3-%.6+3(23($-@(.+#6*2$8(:*+(6#..92$8(6#>#62:9'()*+9(6-$323:(-/ ("#$736#>+(%$2:3(2$(@*26*(:*+(%.1#$2<#E :2-$(23(#(6-$3:#$:"9(8.-@2$8(>*+$-&+$-$A(1%:(:*+(>+.6+$:#8+(-/ (:-:#"(%.1#$2<+7(3-2"((2$(:*+3+(%$2:3(23(2$( 7+6"2$+I(:*+(#&-%$:(-/ (%.1#$2<+7(3-2"(2$(-:*+.("#$736#>+(%$2:3(23A(2$(-:*+.(@-.73A(2$6.+#32$8(#:(8.+#:+.( .#:+3(6-&>#.+7(:-(:*23(3+6:-.'()*23(23(7%+(:-(:*+("2&2:+7(#;#2"#12"2:9(-/ (3>#6+(:*#:(6#%3+3(#(3"-@7-@$(


!"#$%&'()*+(,-%.$#"(-/ (0.1#$23&(4(5-$/+.+$6+(!.-6++72$83

-/ (<*+(1%2"72$8(=.-6+33+3'(>$6"%7+7(2$(<*23(6#<+8-.?(#.+(<*+(6-#3<"2$+(#$7(<*+(.2@+.(@#""+?3(-/ (A1.%BB-' Â&#x2021; C#$736#=+3(#<(.23D(-/ (3=.#E"F(-<*+.(6-$6+=<%#"(<?=+3(.+"#<+7(<-(<*+(3-G6#""+7(H3+<<"+&+$<(.23DI(JK-&#$-( L(!#-"2$+""2M(9NN;O'(A""(<*+(*2""?("#$7/-.&3(6*#.#6<+.2B+7(1?(<*+(2$6.+#3+(-/ (.+327+$<2#"(#$7(7236-$<2G $%-%3(3+<<"+&+$<3'()*+(.%.#"("#$736#=+M(/%""(-/ (&+#$2$83(2$(<+.&3(-/ (6%"<%.+M(27+$<2<?M(1+#%<?(#$7(+6-G "-8?M(23(<*+(-$+(#<(8.+#<+.(.23D(2$(<*+3+(32<%#<2-$3'()*+(<.#$3/-.&#<2-$(2$(<*+(.%.#"(6-$<+P<(23(&#2$"?(7%+( <-(=.2@#<+(2$2<2#<2@+M(#66+=<+7(#$7(<-"+.#<+7(1?("-6#"(8-@+.$&+$<3'(!.2@#<+(=.-Q+6<3(#.+(-/<+$(#6<2@+(2$( <*-3+(HE*2<+(#.+#3I(2$327+(B-$2$8(="#$3M(<*+(&-3<(8+$+.#"(#.+#3(7+328$#<+7(#3(HRIM(.+8%"#<+7(1?(*28*+.G "+@+"("#E3(#$7(.+82-$#"(-.(=.-@2$62#"(2$3<.%&+$<3'(>$6"%7+7(2$(<*23(6#<+8-.?(#.+(!"2-G!"+23<-6+$+(#$7( 0HVRDGULDWLFODQGIRUPVVRLOVZLWKDOWHUQDWLRQVRI VDQGVWRQHDQGÃ&#x20AC;QHJUDLQHGOD\HUVXSWRPDERYH <*+(3+#("+@+"(#$7(2$<+.&-%$<#2$(1#32$3(E2<*(@-"6#$26(7+=-32<3(#$7(*?7.-"-826(3+72&+$<#<2-$3' Â&#x2021; C#$736#=+3(#<(.23D(-/ (#1#$7-$&+$<F()*23(6#<+8-.?(2$6"%7+3(#""(<*-3+("#$736#=+3(3%36+=<21"+(<-(#(3*#.=( 7+6"2$+(2$(=-=%"#<2-$M(E*26*(6-..+3=-$73(<-(#(.+"#<2@+"?("-E(.#<+(-/ (%.1#$2B#<2-$'()*+(.23D(/-.(<*23(6#G <+8-.?(-/ ("#$736#=+3M("-6#<+7(2$(<*+(&-%$<#2$3(-/ (<*+(2$<+.2-.M(23(<*#<(<*+.+(23(#(<+$7+$6?(-/ (=-=%"#<2-$( <-(&-@+(#E#?(/.-&(<-E$3(#$7(@2""#8+3(#$7(<*#<(<*+(8.-E<*(-/ (3+<<"+&+$<3(6#%3+3(#(7+<+.2-.#<2-$(-/ (<*+( &-.=*-"-826#"(#3=+6<3(<*#<(6*#.#6<+.2B+(<*+&M(1+6#%3+(<*+3+(3+<<"+&+$<3(#.+($-<(#"E#?3(#66-&=#$2+7( 1?(S%#"2<?(#$7(6-$323<+$6?(6.2<+.2#' Â&#x2021; C#$736#=+3(2$(1#"#$6+F(<*+3+("#$736#=+(%$2<3(#.+(<*-3+(E*26*(2$(T:UV(*-3<+7(<*+(*28*+3<(=+.6+$<#8+( -/ (%.1#$2B+7(3-2"M(1+2$8(#//+6<+7(1?(<*+(=.+3+$6+(-/ (<*+("#.8+3<(*23<-.26#"(6+$<+.3(-/ (<*+(2$<+.2-.'(>$( <*+3+(#.+#3(<*+.+(23(3<2""(#(6+.<#2$(7+8.++(-/ (6-..+"#<2-$(1+<E++$(+@-"%<2-$(-/ (%.1#$(#.+#3(#$7(=-=%"#G <2-$(7?$#&263'(0.1#$(+P=#$32-$(3*-E3(2<3+"/ ((=.2&#.2"?(#3(#$(+P<+$32-$(-/ (<*+(=+.2G%.1#$(#.+#(#.-%$7( #$62+$<(<-E$3'()*+(6-$6+=<(-/ (1#"#$6+(2$(<*23(6#3+(23(+P6"%32@+"?("2$D+7(<-(S%#$<2<#<2@+(/#6<-.3(#$7(<*23( 7-+3($-<(8%#.#$<++(<*#<(<*+("#$736#=+(E2""(.+&#2$(%$#//+6<+7(1?(<.#$3/-.&#<2-$(=*+$-&+$#(6#%3+7(1?( <*+(1%2"72$8(+P=#$32-$M(*-E+@+.M(<*+(.23D(23("-E(E*+$(6-&=#.+7(E2<*(-<*+.(.+82-$3'(52<2+3(6#$(+P=#$7( #66-.72$8(<-(@#.2-%3(&-7+"3M(E*26*(&#?($-<(1+(3%1Q+6<+7(<-(.+S%2.+&+$<3(-/ (%.1#$(#$7("#$736#=+(S%#G "2<?'()*+(2$<+.&-%$<#2$(1#32$3(E*+.+(%.1#$(3+<<"+&+$<3(#.+("-6#<+7(#.+(<*+(=*?32-8.#=*26(%$2<(H3?&1-"I( -/ (<*23(6#<+8-.?'


!"#$%&'()*+(,-%.$#"(-/ (0.1#$23&(4(5-$/+.+$6+(!.-6++72$83


7KLVFODVVLÃ&#x20AC;FDWLRQSURSHUO\GHWDLOHGDQGHQULFKHGZLWKDGGLWLRQDOFDVHVWXGLHVFRXOGEHXVHGLQODQGVFDSH <"#$3(-/ (.+82-$#"(-.(<.-=2$62#"("+=+"(>-(<.-=27+(8+$+.#"(&#$#8+&+$>(8%27+"2$+3(>*#>(6-%"7(1+(2&<"+&+$>+7( #$7(+?<#$7+7(7%.2$8(>*+(<.+<#.#>2-$(-/ (@-6#"(A>.#>+826(!"#$3B(%32$8(3%.=+C3(-$(>*+(3-62#"(6-&<-$+$>(>*.-%D 8*(<#.>262<#>-.C(<.-6+33+3(2$=-"=2$8(#(3&#""(6-&&%$2>C


(&)%*+","-." S(>*#$](Y+.$#.72$-(T-&#$-B(E#%.-(L#1.2K2-(#$7(E#.8*+.2>#(523#$2(/-.(>*+2.(6--<+.#>2-$'


!"#$%&'()*+(,-%.$#"(-/ (0.1#$23&(4(5-$/+.+$6+(!.-6++72$83

!"#"$%&!'$()*'+,)&-&!'$()*'+,)&./0&1"#"$% 2',)'%%"&34"5'5" 6/$.,0,$*,&20/*,,("$%) 71/0,$*,8&7,409'0:-;9$,&<=>< !"#$%&'()*+(,-%.$#"(-/ (0.1#$23&4($'(564(7-"'5859:; <<<'="#$%&'$+>(?(@AAB(:65;C9DD; !.-E++F2$G3(=%1"23*+F(2$(HE>-1+.(59:;

?")+95,(&/0&@A'0,(&B,00"5/0:C BA,&D5'1"'$&EF+,0",$*,&/. &G"#,0&6/$50'*5H& I,J&G,1'5"/$)A"+&4,5J,,$&G"#,0&'$(&"5)&G,%"/$&& A2"72#(I%+..#


)*23(=#=+.(=.+3+$>3(>*+(L27+.(M-$>.#E>4(#(>--"(/-.(=#.>2E2=#>+F(="#$$2$G(#$F(/-.(>*+(+"#1-.#>2-$(#$F(2&="+&+$>#>2-$( -/ (<#>+.(.+3-%.E+3(&#$#G+&+$>'()*+(.27+.(1#32$(23(>*+(>+..2>-.2#"(#.+#(-/ (.+/+.+$E+4(#(.+G2-$(<*2E*(-%>3>.2=3(#F&2$2C VWUDWLYHERXQGDULHV7KLVWHUULWRULDOJRYHUQDQFHPRGHUHTXLUHVGLDORJXHDWWZROHYHOVÀUVWO\DWDQLQVWLWXWLRQDOOHYHO #&-$G(N%$2E2=#"2>2+34(!.-72$E+3(#$F(L+G2-$3O(3+E-$F"P4(#>(#(3+E>-.("+7+"4(1+E#%3+(>*+(2$>+.+3>3(#>(3>#Q+(#.+(7#.2-%3(#$F( VRPHWLPHVFRQÁLFWLQJ ,WDOLDQH[SHULHQFHVVWUXJJOHWRÀQGWKHLULGHQWLW\DQGVKRZPDQ\OLPLWDWLRQVDERYHDOODVXEVWDQWLDOGLIÀFXOW\IRUSDUWLC E2=#$>3(>*2$Q2$G(#>(#(1#32$(3E#"+(#$F(>.P2$G(>-(-7+.E-&+(#F&2$23>.#>27+(#$F(3+E>-.(F27232-$3'(R(E%">%.#"(E*#$G+(23($++F+F( 2$(-.F+.(>-(1--3>(#($+<(>+..2>-.2#"(7232-$'

!"#$%&'(#)%"*+,)-.$+(%"#$/(# 7KH:DWHU)UDPHZRUN'LUHFWLYHVDQFWLRQHGE\WKH(XURSHDQ3DUOLDPHQWDQGRI WKH&RXQFLOVHWVDIUD< &+=-.>(/-.(?*+(2&@"+&+$?#?2-$(-/ (2$?+8.#?+7(@-"262+3(/-.(=#?+.(.+3-%.6+3(&#$#8+&+$?A,WLGHQWLÀHVWKH .2B+.(1#32$(#3(#(?+..2?-.2#"(#.+#(-/ (.+/+.+$6+(#$7(2&@-3+3(2$/-.&2$8(#6?2-$3(#1-%?(?*+(6*-26+3(&#7+(1C("-6#"( 8-B+.$&+$?'(D?(#"3-(=23*+3(/-.(?*+(3?#.?(-/ (@.-6+33+3(/-.(62?2E+$3F(6-$3%"?#?2-$(#$7(#6?2B+(@#.?262@#?2-$' )*+(G2B+.(5-$?.#6?(HG5I(23(#$(#8.++&+$?(?*#?(#""-=3(?-(#7-@?(#(3+?(-/ (.+8%"#?2-$3(2$(=*26*(6.2?+.2#(-/ (@%1"26( %?2"2?CJ(+6-$-&26(.+?%.$J(3-62#"(B#"%+(#$7(+$B2.-$&+$?#"(3%3?#2$#12"2?C(+K%#""C(?#>+(@#.?(2$(?*+(3+#.6*(/-.(+/< /+6?2B+(3-"%?2-$3(/-.(?*+(.2B+.(1#32$F3(.+6-B+.C(HL-."7(L#?+.(M-.%&J(=*26*(?-->(@"#6+(2$(NO#(2$(:PPPI'(Q-.$( LQ)UDQFHLQWKHHDUO\(LJKWLHV WKHÀUVW5&E\/D7KXUZDVVLJQHGLQ: LWLVDWRROVSHFLÀFIRUÁXYLDO DUHDV·UHFRYHU\,WGHYHORSVDSDWKWKDWOHDGVWRWKHGHÀQLWLRQRI DFRQWUDFWDQGZKRVHIXQGDPHQWDOHOHPHQWV #.+(H&LUFXODLUHGX0LQLVWUHGHO·(QYLURQQHPHQWHWGX&DGUHGH9LHIpYULHUIR 3*#.2$8(#(6"+#.(-1O+6?2B+S 328$2$8(#$(#8.++&+$?(#&-$8(62?2E+$3J(&%$262@#"2?2+3(#$7(2$7%3?.2#"23?3J(1#3+7(-$(3%6*(#(3*#.+7(-1O+6?2B+S ÀQGLQJVSRQVRUVZKRDUHDYDLODEOHWRSURYLGHWKHQHFHVVDU\UHVRXUFHVWRUHDFKWKHVHWREMHFWLYH ,Q  WKH /DZ DERXW ZDWHU HVWDEOLVKHV 6'$*( 6FKpPD 'LUHFWHXU G·$PpQDJHPHQW HW GH *HVWLRQ GHV (DX[J( M.+$6*(/-.R(D$3@2.2$8(T6*+&+(/-.(L#?+.(!"#$$2$8(#$7(U#$#8+&+$?I(#$7(TNVW(H6FKpPDVG·$PpQDJHPHQWHW GH*HVWLRQGHV(DX[J(M.+$6*(/-.R(T6*+&+(/-.(L#?+.(!"#$$2$8(#$7(U#$#8+&+$?I'()*+(/-.&+.(23(#(7-6%&+$?( RI WHFKQLFDODQGÀQDQFLDOSODQQLQJWKDWVHWVXSJHQHUDOJRDOVIRUWKHZDWHUJRYHUQDQFHRI HDFKEDVLQ7KH ODWWHULVDORFDOYHUVLRQRI 6'$*(DQGGHÀQHVJRDOVDQGFULWHULDIRUWKHXVHRI WKLVUHVRXUFHDWVXEEDVLQ "+B+"'(D?(@.-B27+3(72.+6?2-$3(/-.(#(1#"#$6+7(&#$#8+&+$?(-/ (=#?+.(2$(-.7+.(?-(@.+3+.B+(?*+(#K%#?26(+6-3C3?+&( #$7(=+?(#.+#3J(.+#6*2$8(K%#"2?C(#$7(K%#$?2?C(@#.#&+?+.3(-/ (?*+(=#?+.(.+3-%.6+'(D?(#"3-(82B+3(2$726#?2-$3(/-.( ?*+(2&@.-B+&+$?(-/ (=#?+.(#3(#$(+6-$-&26(.+3-%.6+(?--J(=2?*(?*+(#2&(-/ (6-$62"2#?2$8(2?3(72//+.+$?(%3+3(#$7( DFWLYLWLHV7KH5LYHU&RQWUDFWEHFDPHDPHDQWRDSSO\6$*( 'RUDWL*XHUUDSS 

01.+$)-.$+2/3)"+/3+#.$$)#%$)/4+/$./+%5 +$.5.$."(.+5%$+6%4)().3+%5 +7/#.$+$.3%'$(.3+8/"/9 :.8."#*+)"+5/-%'$+/"&+/:/)"3# )*+(6-$6+@?(-/ (*C7.-8.#@*26(1#32$(*#3(+B-"B+7(7%.2$8(?*+(6-%.3+(-/ (*23?-.C(#$7(2?(*#3(1++$(#33-62#?+7( ?-(72//+.+$?("2$+3(-/ (?*-%8*?(#$7(6-<-@?+7(1C(@-=+.(8.-%@3(2$(-.7+.(?-(3?.+$8?*+$(?*+("+82?2&#6C(-/ (?*+2.( DFWLRQVDQGFODLPV1RZDGD\VLQWKHÀHOGRI LQWHJUDWHGPDQDJHPHQWRI ZDWHUUHVRXUFHVWKHULYHUEDVLQ 23(6-$327+.+7(#3(#(@"#6+(/-.(2$?+.#6?2-$(1+?=++$(&#$(#$7(+$B2.-$&+$?J(/.-&(#$(+6-3C3?+&26(@+.3@+6?2B+( ?*#?(@%?3(*%&#$(1+2$83(=2?*2$(#(=27+(#$7(6-&@"+X(+$B2.-$&+$?#"(3C3?+&'()*+.+/-.+J(?*+($-?2-$(-/ (*C7.-< 8.#@*26(1#32$(#6K%2.+3(#(@-"2?26#"J(27+-"-826#"(#$7(-@+.#?2-$#"(B#"%+(HU-""+J(:PPYI'(L#?+.J(=*26*(2$(?*+(@#3?( XVHGWREHPHDQWDVDSK\VLFDOERG\WRFDSWXUHGLYHUWVWRUHDQGGHOLYHUDWVSHFLÀFORFDWLRQVDQGWLPHVQRZ 1+6-&+3(#"3-(#(*#12?#?'( N66-.72$8( ?-( Z2+2""#.7<5-//.+( H:PPAIJ( ?+..2?-.C( &#$#8+&+$?( #?( #( .2B+.( 1#32$( 36#"+( 3++&3( ?-( 1+( ?*+( &-3?( UDWLRQDORSWLRQIURPDQHFRORJLFDOSRLQWRI YLHZ7KLVLVERWKEHFDXVHLW·VDQHDVLO\LGHQWLÀDEOHDUHDWKDQNV ?-(?*+(7+"2&2?#?2-$(-/ (?*+(.2B+.(#$7(2?3(?.21%?#.2+3J(#$7(1+6#%3+(2?(/-""-=3(?*+($#?%.#"(-.7+.J(2'+'(?*#?(-/ (=#?+.( 7.#2$2$8J(=*+$(2?(6-&+3(?-(/#62$8(@.-1"+&3(6-$$+6?+7(?-(3-2"(@.-?+6?2-$(#$7(*C7.-"-8C'(D$7++7J(N//+"?.#$< 8+.(#$7([#33+..+(H:PP9I(3#CJ(.+8#.72$8(.2B+.(1#32$J(?*+(6-$3+K%+$6+3(-/ (%@3?.+#&(2$?+.B+$?2-$3(-$(3%./#6+( DQGXQGHUJURXQGÁRZVLQHYLWDEO\DIIHFWGRZQVWUHDP7KLVLVWUXHERWKIRUHQYLURQPHQWDOO\KDUPIXODFWLRQV H3%6*(#3(+X6+332B+(=2?*7.#=#"3J(@-""%?2$8(7.#2$3J(1#$>(-.(7#&(1%2"72$8I(#$7(/-.(#6?2-$3(@.-?+6?2$8(?*+(=#?+.( .+3-%.6+(H/-.(+X#&@"+(?*+(6.+#?2-$(-/ (=#3?+=#?+.(?.+#?&+$?(@"#$?3(-.(?*+(7+&#.6#?2-$(-/ (@.-?+6?+7(#.+#3I' +RZHYHUGHÀQLQJWKHK\GURJUDSKLFEDVLQDVWKHLGHDOVSDWLDOVFDOHRI PDQDJHPHQWPHDQVLPSRVLQJDPRGHO ZKLFKGRHVQ·WQHFHVVDULO\ÀWDOOWKHVLWXDWLRQVSUHVHQWRQWKHWHUULWRU\DQGZKLFKDERYHDOOFDQ·WEHDFFHSWHG 1C(#""(?*+(@-"2?26#"(#$7(+6-$-&26#"(@-=+.3(-/ (?*+(1#32$'(N$C(7+6232-$(.+8#.72$8(=#?+.(.+@.+3+$?3(#(3@#?2#"(  'LUHFWLYH(&*??@R\\+6'+%.-@#'+%\+$B2.-$&+$?\=#?+.\=#?+.</.#&+=-.>\2$7+X]+$'*?&"' :( M-.(&-.+(2$/-.&#?2-$3(R(*??@R\\8+3?+#%'+#%/.#$6+'/.\'


!"#$%&'()*+(,-%.$#"(-/ (0.1#$23&(4(5-$/+.+$6+(!.-6++72$83

72&+$32-$;(2<=3(+6-"-826#"(>*+$(2<(6-$6+.$3(.+3?+6<(/-.(<*+(+6-3@3<+&3A(<+..2<-.2#"(/-.(2$/.#3<.%6<%.+(1%2"72$8( #$7(3-62-B?-"2<26#"(>2<*(.+8#.73(<-($#<%.+(#$7(<*+("-6#<2-$(-/ (72//+.+$<(6#<+8-.2+3(-/ (%3+.3'()*+.+/-.+A(>#<+.( .+3-%.6+3(&#$#8+&+$<(#<(1#32$("+C+"(2&?"2+3(#(?.+623+(6*-26+(2$(<+.&3(-/ (<+..2<-.2#"(&#$#8+&+$<(DE//+"<.#$B 8+.A(F#33+..+A(GHH9I' %ORPTXLVW  LVDPRQJWKHDXWKRUVZKRPRVWRSSRVHWKHDOOHJHGHFRORJLFDODQGWHUULWRULDOXQLW\RI WKH .2C+.(1#32$A(1+6#%3+(2$(#(1#32$(<*+.+(#.+; Â&#x2021; GLIIHUHQWNLQGVRI ZDWHUUHVRXUFHVWKHUHLVWKHULYHUZKLFKGHÃ&#x20AC;QHVWKHEDVLQDQGLWVWULEXWDULHVWKHB .+(#.+(8.-%$7>#<+.(#J%2/+.3A(>+<"#$73A(3?.2$83A("#K+3A(C+.$#"(?--"3(#$7(8"#62+.3'(L*#<+C+.(&-7+3(#.+( +3<#1"23*+7(/-.(#(3%3<#2$#1"+(&#$#8+&+$<(-/ (<*+(1#32$=3(>#<+.(.+3-%.6+3A(2<=3($+6+33#.@(<-(6-$327+.(<*+( ?*@326#"(6-&?"+M2<@(-/ (3%6*(.+3-%.6+3N Â&#x2021; #7&2$23<.#<2C+(1-.7+.3(>*26*(7-$=<(6-..+3?-$7(<-(<*+(>#<+.(.+3-%.6+3=($#<%.#"(1-.7+.3N Â&#x2021; C+.@( 72//+.+$<( 6-&&%$2<2+3A( >2<*( 72//+.+$<( 1+*#C2-%.3A( .%"+3( #$7( 7+&#$73( <*#<( #.+( 726<#<+7( 1@( <*+2.( 3-62-B+6-$-&26(#$7(6%"<%.#"(/+#<%.+3(#$7(1@(<*+2.(8+-8.#?*26#"("-6#<2-$(D3-&+(6-&&%$2<2+3(#.+(%?3<.+B #&A(-<*+.3(#.+(7->$3<.+#&N(3-&+(7.#>(>#<+.(/.-&(8.-%$7(7+?-32<3A(-<*+.3(#.+(#7O#6+$<(<-(>+<"#$73N( 3-&+(-<*+.3(#.+(?*@326#""@(#$7(+6-$-&26#""@("2$K+7(<-(6-#3<#"(#.+#3' )*+(6-$6+?<(-/ (*@7.-8.#?*26(1#32$(#3(#(<+..2<-.@(%$2<(7%+(<-(<*+(+M23<2$8($#<%.#"(>#<+.($+<>-.K(23(6.2<262P+7( #"3-(1@(Q#33#.%<<-(DRSSSI(#$7(Q-33(DGHH9I'()*+@(+&?*#32P+(*->A(+C+.(32$6+(#$62+$<(<2&+3(D"+<=3(<*2$K(-/ ( DTXHGXFWVDQGDUWLÃ&#x20AC;FLDOFDQDOVEXLOWE\WKHDQFLHQW5RPDQV PDQLQWHUYHQWLRQKDVFKDQJHGWKHK\GURORJLFDO 3*#?+(1@(&-C2$8(8.+#<(&#33+3(-/ (>#<+.(<*-%3#$73(-/ (K2"-&+<.+3(#>#@(/.-&(2<3(3?.2$8(#$7(1@(6-$$+6<2$8( .+#"2<2+3(>*26*((%3%#""@(*#C+$=<(8-<(#$@(+"+&+$<(2$(6-&&-$(D-<*+.(<*#$(/.-&(<*+(?-2$<(-/ (C2+>(-/ (<+..2<-.@( 8-C+.$#$6+I' T%.<*+.&-.+A(>#<+.(.+3-%.6+(2$<+8.#<+7(&#$#8+&+$<(#<(#(1#32$(36#"+(2&?"2+3(C#.2-%3(?.-1"+&3A(#3(2<(#??+#.3( <-(1+(J%2<+(6-&?"+M'(E3(#(&#<<+.(-/ (/#6<A(<*+.+(#.+($-(#6<-.3(-.(+"+&+$<3(<*#<(6#$(1+(+M6+?<+7(#(?.2-.2'(U$( <*+(6-$<.#.@A(<*23(K2$7(-/ (&#$#8+&+$<(3%??-.<3(#(*-"23<26(#??.-#6*(<-(<*+(.2C+.(<+..2<-.@(8-C+.$#$6+A(>*26*( Q-33(DGHH9I(2""%3<.#<+3(#3;(>#<+.(.+3-%.6+3(&#$#8+&+$<(D>#<+.(J%#"2<@A(>#<+.(.+8%"#<2-$IA(<+..2<-.@(&#$#8+B &+$<(D6-$<.-"(-/ (3-2"=3(7+8.#7#<2-$(#$7(%3+IA(+6-"-826#"(&#$#8+&+$<(D12-72C+.32<@(?.+3+.C#<2-$I(#$7(*%&#$( #6<2C2<@(&#$#8+&+$<(D3-62-B+6-$-&26(#7C#$<#8+3I' E3(<*+@(#2&(#<($%&+.-%3(8-#"3A(2$<+8.#<+7(?-"262+3(/-.(>#<+.(.+3-%.6+3(&#$#8+&+$<(2$+C2<#1"@(-?+.#<+(2$( VHYHUDOÃ&#x20AC;HOGV´WRXFKLQJµPDQ\LQWHUHVWV 0DVDUXWWR  )*+.+/-.+A(2<(3++&3(&-.+(#??.-?.2#<+(<-(27+$<2/@(<*+(<+..2<-.2+3(D2'+'(<*-3+(?-.<2-$3(-/ (-$+(1#32$A(-.(-/ (<>-(-.( &-.+(1#32$3(<-8+<*+.I(<*#<(#.+(&-3<(2$<+.+3<+7(1@(<*+(?.-1"+&(#<(233%+(+#6*(<2&+A(>*26*(&+#$3(6.+#<2$8(-.8#B QL]DWLRQVRUDGKRFDJUHHPHQWVIRUHDFKREMHFWLYHUDWKHUWKDQRQO\RQHSDFWDWEDVLQVFDOH %ORPTXLVW 

!"#$%&'()*%+,*-&")&.*+/0 V$(GHH9(<*+(W+$+.#"(Q#$#8+&+$<(/-.(L#<+.(X+3-%.6+3(#$7(!%1"26(0<2"2<@(Y+.C26+3(-/ (F-&1#.7@(X+82-$( 7+627+7(<-(3<#.<(#(?.-6+33(/-.(<*+(328$2$8(-/ (<*+(ZX2C+.(5-$<.#6<(/-.(<*+(.+6"#&#<2-$(#$7(<*+(2&?.-C+&+$<( -/ (X2C+.(U"-$#=3(1#32$['(V<(23(#(*28*"@(%.1#$2P+7(#$7(2$7%3<.2#"2P+7(#.+#(>*+.+(#$<*.-?26(?.+33%.+(*#3(?.-7%B 6+7(3+C+.+(6*#$8+3(2$(<*+(+6-"-826#"(6-$72<2-$(-/ (<*+(.2C+.A(1-<*(/.-&(#(&-.?*-"-826#"(?-2$<(-/ (C2+>(D>2<*( .+"+C#$<(.+?+.6%332-$3(-$(*@7.-8+-"-826#"(+C+$<3I(#$7(/-.(<*+(J%#"2<@(-/ (>#<+.'(Y%13+J%+$<"@(-<*+.(X2C+.( 5-$<.#6<3(>+.+(3<#.<+7(/-.(<*+(/-""->2$8(.2C+.3;(Y+C+3-A(F#&1.-A(Q2$62-A(E77#A(Q+""#(#$7(U8"2-9'()*+(X2C+.( 5-$<.#6<(23(#2&+7(#<;(D2I(6--.72$#<2$8(?%1"26(2$<+.C+$<2-$(1@(<*+(3+C+.#"(2$3<2<%<2-$#"("+C+"3N(D22I(.#<2-$#"2P2$8( #$7(2$<+8.#<2$8(?%1"26(.+3-%.6+3N(D222I(3<2&%"#<2$8(#$7(1--3<2$8(?.2C#<+(2$C+3<&+$<3'(V<(23(#(?#6<(#&-$8(X+B JLRQ3URYLQFHVDQGORFDOFRPPXQLWLHVZKLFKDLPVDWÃ&#x20AC;QGLQJGHYHORSPHQWREMHFWLYHVVHFWRUVDQGÃ&#x20AC;HOGVRI  2$<+.C+$<2-$A(2&?"+&+$<#<2-$(<2&2$8A(#C#2"#1"+(.+3-%.6+3(#$7(#7*+.+$6+(&-7+3(/-.(?-3321"+(?.2C#<+(3%1O+6<3'(  5HJLRQDO/DZQRI WKH\HDUHVWDEOLVKHVWKH2XWOLQH$JUHHPHQWIRU7HUULWRULDO'HYHORSPHQW $467$FFRUGR 4XDGURGL6YLOXSSR7HUULWRULDOHI(#3(-$+(-/ (<*+(<--"3(/-.($+8-<2#<+7(?"#$$2$8'()*+(.2C+.(6-$<.#6<(23(*+.+(3*#?+7(#3(#$( $467DWDVFDOHRI K\GURJUDSKLFEDVLQRUVXEEDVLQ6HH/RPEDUG\5HJLRQ·VZHEVLWHRQ5LYHU&RQWUDFWV*<<?;\\ ZZZFRQWUDWWLGLÃ&#x20AC;XPHLW

!"#$%&'()*+(,-%.$#"(-/ (0.1#$23&(4(5-$/+.+$6+(!.-6++72$83


)*+(8-#"(23(<*+(.+6"#&#<2-$(-/ (<*+(.2=+.(1#32$' )*+(3+6-$7(><#"2#$(.+82-$(<-(#7-?<(@2=+.(5-$<.#6<3(A#3(!2+7&-$<(@+82-$B(A*26*(2$(CDD;(3<#.<+7(<#E2$8( <*+&(2$<-(6-$327+.#<2-$(#3(#(?-3321"+(A#F(<-(2&?"+&+$<(<*+(G#<+.(!.-<+6<2-$(!"#$(H!)IB(3LDQRGL7XWHODGHOOH $FTXHJ'()*+F(#.+(<*%3(3++$(#3(<--"3(/-.($+8-<2#<+7(?"#$$2$8B(A*26*(?.-&-<+(K2$<+8.#<+7(&#$#8+&+$<(&-7+3( #<(*F7.-8.#?*26(1#32$(#$7(3%1L1#32$("+=+"B(?%.3%+((?.-<+6<2-$(#$7(2&?.-=+&+$<(-/ (A#<+.(.+3-%.6+3(#$7(.+L ODWHGHQYLURQPHQWVDORQJZLWKVDIHJXDUGIURPÁRRGULVNµ 37$DUWLFOH 2QDQH[SHULPHQWDOEDVLVWKH ?%1"26(M-7F(2$2<2#""F(3%??-.<+7(/-%.(@2=+.(5-$<.#6<3N(O#$8-$+B(P.1#B(I8-8$#(#$7(M+"1-'(I3(2$(<*+(6#3+(-/ ( Q-&1#.7FR3(@2=+.(5-$<.#6<3B(!2+7&-$<(@+82-$(E+?<(<*+(.-"+(-/ (?.2&+(&-=+.(-/ (<*+(@53(1%<B(2$(#66-.7#$6+( A2<*(<*+(?.2$62?"+(-/ (=+.<26#"(3%13272#.2<FB(2<(#3328$+7(<*+(?.-6+33(&#$#8+&+$<(<-(<*+(!.-=2$62#"(I%<*-.2<2+3( -/ (.+/+.+$6+B(#3(<*+F(#.+(<*+(&-3<(3%2<#1"+(3%1S+6<(/-.(<*+(2$=-"=+&+$<(-/ (<*+("-6#"(.+#"2<2+3(+T23<2$8(-$(<*+( <+..2<-.F:' 7KH5HJLRQ·VDLPLVWRSURJUHVVLYHO\H[WHQGWKHFRQWUDFWWRROWRDOOK\GURJUDSKLFDUHDVLGHQWLÀHGLQWKH 37$LQGHSHQGHQWO\RI VSHFLÀFSUREOHPV 37$5XGHOODW*RYHUQD  'XULQJWKHODVW\HDUVDERXW5&VKDYHGHYHORSHGDOORYHUWKHQDWLRQDOWHUULWRU\EXWWKH\DOOKDYHWKHLURZQ VSHFLÀFLWLHVFRQFHUQLQJUHODWHGUHJXODWLRQVU'()*+(-$"F(3*#.+7(7-6%&+$<B(HA*26*(#$FA#F(*#3($-("+8#"(=#"%+JB( 23(<*+(V#<2-$#"(5*#.<(-/ (@2=+.(5-$<.#6<3B(A*26*(?.+3+$<3(#(?#.<262?#<+7(6-%.3+(-/ (#6<2-$(A2<*(3+=+$(3<+?3(2$( -.7+.(<-(.+#6*(<*+(328$2$8(-/ (<*+(.2=+.(6-$<.#6<B(1%<(2<(/#2"3(<-(3<#<+(<*+(#.6*2<+6<%.+(-/ (<*+(?.-6+33B(2<3(<2&2$8B( 2<3(&-7+3(-/ (#6<2-$(#$7(2<3(/%$72$8'()*23(23(#""(7+=-"=+7(<-(<*+(6-&?+<+$6+3(#$7(3E2""3(-/ (<*+(2$=-"=+7(#7L &2$23<.#<2-$3'(P$"F(<*.++(+"+&+$<3(#.+(6-$327+.+7(<-(1+(+33+$<2#"(/-.(<*+(2&?"+&+$<#<2-$(-/ (@53N(/+#3212"2<FB( SURFHVVXDOLW\DQGÁH[LELOLW\W' >$(8+$+.#"B(@2=+.(5-$<.#6<(23(#$(><#"2#$(#7=#$6+7(+T?+.2&+$<#<2-$(-/ (#$(2$<+8.#<+7(#??.-#6*(.+8#.72$8(A#<+.( .+3-%.6+(&#$#8+&+$<(#$7(2<(6#$(2$6"%7+(*F7.#%"26B($#<%.#"B(+6-"-826#"B(3-62#"(#$7(+6-$-&26(#3?+6<3'(><3(?-2$<( RI UHIHUHQFHLVWKHULYHUEDVLQDVDWHUULWRULDOHFRORJLFDODQGK\GURORJLFDOXQLW &DORUL 

!"#$%&'#%$()*&+$&+$,-).&)+$/&'#%$01+-%)2-* >$(X.#$6+(FRQWUDWVGHULYLqUH(H.2=+.(6-$<.#6<3J(6"#2&(#(<*2.<FLF+#.(<.#72<2-$B(A*26*(23(<-7#F(6-$=+.<+7(2$<-(#(62.L FXODURI WKH\HDUWKDWGHÀQHVWHUPVDQGREMHFWLYHVRI WKHSDUWLFLSDWHGSURFHVV3URFHGXUHVDUHFOHDUO\ GHÀQHG7KH,WDOLDQUHDOLW\HYHQWKRXJKLQVSLUHGE\WKH)UHQFKRQHLVYHU\GLIIHUHQWDFWXDOO\$OWKRXJKLQ <*+2.(2$<+$<2-$3(2<("--E3("2E+(<*+(?.-&-<2$8(#%<*-.2<2+3(#8.++(2$(6-$6+2=2$8(<*+(@5(#3(#(8-=+.$#$6+(<--"(/-.( ZDWHUPDQDJHPHQWDWDEDVLQVFDOHWKH\GLIIHULQWKHLPSOHPHQWDWLRQPRGHV %REELR6DURJOLD  7KHÀUVW,WDOLDQH[SHULHQFHVVHHPWRFRQÀUP%ORPTXLVW·VWKHRULHV  DVHDFKULYHUFRQWUDFWLVDVHSDL .#<+(-66%..+$6+B(7+<+.&2$+7(1F(<*+(2$=-"=+7(3%1S+6<3(#$7(<+..2<-.FB(A*26*(*#.7"F(+=+.(<#""2+3(A2<*(<*+(A*-"+( 1#32$'(@53(<*#<(#.+(#$(+T6+?<2-$(<-(<*23(#.+(<*-3+(A*26*(+"#1-.#<+(#$7(2&?"+&+$<(3*#.+7(<+..2<-.2#"(?-"262+3B( -/<+$(<*#$E3(<-(<*+(.+7%6+7(32Y+(-/ (<*+(1#32$B(3%6*(#3(2$(<*+(6#3+(-/ (<*+(6-&&%$2<2+3(6.-33+7(1F(<*+(X#.=#( 3<.+#&'()*23(E2$7(-/ (@53(&#F(1+(7%+(<-(2$3<2<%<2-$#"(.+#3-$3(H/-.(+T#&?"+(#""(<*+(Z%$262?#"2<2+3(A2<*2$(#( ?.-<+6<+7(#.+#B(3%6*(#3(/-.(<*+(I"6#$<#.#(3<.+#&J(-.(<-(K*23<-.26#"[(.+#3-$3(H#3(2$(<*+(6#3+(-/ (<*+(O#$8-$+( VWUHDPZKRVH5&·V0XQLFLSDOLWLHVKDYHVWDUWHGVHYHUDOSURMHFWVIRUWKHUHFRYHU\RI ÁXYLDODUHDVVLQFH  $5LYHU&RQWUDFWSURMHFWXVXDOO\GHYHORSVIURPDVSHFLÀFSUREOHPDQGLWLQYROYHVWKHWHUULWRU\WKDWLVGLUHFWO\ #//+6<+7(1F(2<'(O-&+(+T#&?"+3(#.+(<*+(.2=+.(!#$#.-R3(@5(HA*26*(#2&3(#<(<*+(.+6"#&#<2-$(-/ (#$(#.+#(A*+.+(<*+L .+(%3+7(<-(1+(#$(#&&%$2<2-$(/#6<-.FJ(#$7(<*+(@5(-/ (<*+(P.1#B(#(!2+7&-$<(3<.+#&(A*-3+(+6-"-826#"(6-..27-.( *#3("-$8(1++$(2$<+$7+7(<-(1+(.+3<-.+7(A*+.+(2<("#6E3B(#$7(?.-<+6<+7(A*+.+(2<(#".+#7F(+T23<3'(>$(<*+3+(6#3+3(<*+( 1#32$(23($-<(<#E+$(2$<-(6-$327+.#<2-$(#3(#(A*-"+B(1%<(-$"F(#(?#.<(-/ (2<(23B(<*+(&-3<(?-""%<+7(-$+B(-.(32&?"F(<*+( :( O++(!2+7&-$<(@+82-$R3(A+132<+(-$(@63N(*<<?N\\AAA'.+82-$+'?2+&-$<+'2<\#6]%#\6-$<.#<<2'*<&^6#.72$+ U( _T6+?<( /-.( CDDD\WD\5_B( A*26*( 2$( ><#"F( A#3( #13-.1+7( 1F( Q#A( $'`UC( 2$( CDDWB( +=+$( <*-%8*( <*+.+( 23( $-( +T?"262<( .+/+.+$6+(<-(@2=+.(5-$<.#6<3'  )HDVLELOLW\KDVWREHERWKÀQDQFLDO LWPXVWEHNQRZQKRZPXFKWKHIRUHVHHQLQWHUYHQWLRQVZLOOFRVWDQGZKRDQG A2<*(A*#<(<2&2$8(A2""(/%$7(<*+&J(#$7(+6-$-&26(H2'+'(2<(*#3(<-(2$6"%7+(<*+(6-3<3(/-.(<*+(2&?"+&+$<#<2-$(-/ (+=+.F(32$8"+( DFWLRQDQGDFWLYLW\HVWLPDWLQJLWV\HDUO\DPRXQWDQGWKHFROOHFWLYHDQGVRFLDOEHQHÀWV 


!"#$%&'()*+(,-%.$#"(-/ (0.1#$23&(4(5-$/+.+$6+(!.-6++72$83

<#.=(=*#=(23(2$6"%7+7(2$(3-&+(<.->+6=(?*26*("-6#"(2$3=2=%=2-$3(#"-$+(6#$$-=(7+@+"-<'( )*+.+/-.+A(=*+(*B7.-8.#<*26(1#32$(2$(C=#"B(23($-=(#(.+/+.+$6+(%$2=(/-.(=+..2=-.2#"(<-"262+3'(C$(D5(+"#1-.#=2-$A( VXEMHFWVDUHFDOOHGWREXLOGZKDWZHFDQGHÀQHDV´DULYHUFRPPXQLW\µZLWKLQWKHEDVLQ+RZHYHUWKHK\GURE 8.#<*26(1#32$(*#3($-(1-%$7#.B(#6F$-?"+78+7(1B(=*+(<-<%"#=2-$A(2=G3(-/=+$(#("#.8+"B(%$F$-?$(=+..2=-.B(H-.A(#=( "+#3=A(2=G3($-=(=*+(=+..2=-.B(=*+B(#.+(%3+7(=-(=*2$F(-/IA(2=G3(/.#8&+$=+7(2$(=*+(6-""+6=2@+(2&#82$#=2-$'(J-.(+K#&E SOHLQKDELWDQWVUHFRJQL]HWKHWRZQRUWKHGLVWULFWDVDORFDOXQLWZKLOHÀUPVORRNDWQHWZRUNVDQGPDUNHWV RI GLIIHUHQWVHFWRUVDFFRUGLQJWRWKHLUDWWUDFWLYHQHVVIRUSURGXFWLRQDQGH[FKDQJHÀQDOO\ORFDOSROLWLFLDQV 7-($-=(=#F+(=*+(.2@+.(1#32$(2$=-(6-$327+.#=2-$(1+6#%3+(2=(*#3($-(+"+6=2@+("+82=2&#6B(HL-@+.$#A()-"7-A(MNOOI'( )*+(-$"B("+82=2&#6B(-/ (3%6*(#(=+..2=-.B(.+3=3(-$(=*+(+K23=+$6+(-/ (=*+(.2@+.'(C$(3-62-E+6-$-&26(#$7(3<#=2#"( <"#$$2$8A(+6-$-&26(.+#3-$3(*#@+(<.+@#2"+7A(.+"+8#=2$8(=*+(7+3=2$B(-/ (.2@+.3(#$7(*B7.-8.#<*26(1#32$3(=-(#( 3%&(-/ (3+6=-.(#6=2-$3(?*26*(#.+(+6-$-&26A(<.-7%6=2@+A(#8.26%"=%.#"A(%.1#$A(+=6' C=(23(&-.+(-/ (#(6%"=%.#"(&#==+.(=*#$(#(<.+36.2<=2@+(-$+'()*+(.2@+.(1#32$(23($-=(6-$327+.+7(1B(.+<.+3+$=#=2@+3( DQGE\WKHRIÀFHVLQFKDUJHRI WKHHODERUDWLRQRI SODQVDQGSURMHFWV DVWKHWHUULWRULDOXQLWRI UHIHUHQFH$ 6*#$8+(-/ (6-%.3+(23(<-3321"+(-$"B(2/ (#(6*#$8+(-/ (<-"262+3(-66%.3' J.-&(=*23(<-2$=(-/ (@2+?A(=?-(2$=+.+3=2$8(+K#&<"+3(#.+(=*+(P/#$=-G3(#$7(=*+(Q-.&27#G3(D2@+.(5-$=.#6=3' 7KH%RUPLGDLVDULYHUWKDWÁRZVPDLQO\DFURVV3LHGPRQWEXWLWULVHVLQ/LJXULD$VIDUDVHQYLURQPHQWDO 233%+3(#.+(6-$6+.$+7A(2=3(@#""+B(3*-?3(&#>-.(7+8.#7#=2-$(-/ (=*+(+$@2.-$&+$=A(&#2$"B(6#%3+7(1B(7.#2$2$83( /.-&(R5SRA(#(6*+&26#"(<"#$=("-6#=+7(2$(5+$82-(HT#@-$#(!.-@2$6+A(U28%.2#I(#$7(6"-3+7(2$(OVVV'(!2+7&-$=( D+82-$(H?*26*(#""-6#=+7(W(M:NANNNI(*#3(<.-&-=+7(=*+(Q-.&27#(D2@+.(5-$=.#6=(?2=*(=*+(#2&(-/ (2$@-"@2$8( #"3-(=*+(U28%.2#$(2$3=2=%=2-$3(#=("-6#"A(<.-@2$62#"(#$7(.+82-$#"("+@+";'()*+(<.-6+33(3=#.=+7(2$(MNON(#$7(=*+( 5-$=.#6=(23(+K<+6=+7(=-(1+(328$+7(1B(=*+(+$7(-/ (MNOM'(U28%.2#(D+82-$(727$G=(<#.=262<#=+(=-(=*+(<.-6+33A(1%=( T#@-$#(!.-@2$6+(727A(=*-%8*(=*+B(*#@+$G=(7+6"#.+7(?*+=*+.(=*+B(?2""(328$(=*+(6-$=.#6=(-.($-='( )*+(P/#$=-A(-$(=*+(-=*+.(*#$7A(23(#(.2@+.(=*#=(6.-33+3(=*.++(.+82-$3(2$(T-%=*+.$(C=#"BX(2=(.23+3(2$(=*+(C.<2$2#( SODWHDXLQ&DPSDQLD5HJLRQFURVVHV%DVLOLFDWD5HJLRQDQGÀQDOO\ÁRZVLQWRWKH$GULDWLF6HDLQ%DUOHWWD3URE YLQFH$SXOLD5HJLRQ 'HOOLVDQWL 7KHSURMHFWRI D5LYHU3DFW(?#3(6-$6+2@+7(2$(MNN;A(?2=*(=*+(+3=#E 1"23*&+$=(-/ (=*+(YD2@+.(P/#$=-ZV(<.-=+6=+7(#.+#A(?*-3+(1-.7+.3(/#""(?2=*2$(=*+(R<%"2#$(<#.=(-/ (=*+(1#32$'( )*23(#.+#(8+$+.#=+3(&#$B(=+$32-$3(1+=?++$(/#.&+.3(#$7(#%=*-.2=2+3(1+6#%3+(-/ (=*+(.+3=.26=2-$3(2$=.-7%6+7( ZLWKWKHSDUN·VIRXQGLQJ'XULQJWKHIROORZLQJ\HDUWKHUHZHUHPHHWLQJVDQGQHJRWLDWLRQVIURPZKLFKWZR QHHGVHPHUJHGWKHÀUVWRQHLVWRUHGXFHWKHDUHDRI WKHSDUNE\ONA(?*2"+(=*+(3+6-$7(-$+(23(=-(2$6"%7+(2$( 2=(=*+(?*-"+(.2@+.'()*23(23(1+6#%3+(=*+(P/#$=-G3(<-""%=2-$(23(7%+(1-=*(=-(2=3(=.21%=#.2+3G(?#=+.(#$7(=-(=*+(3+@+.#"( FDWFKPHQWVLQWKHVWUHWFKRI WKHULYHUWKDWÁRZVDFURVV&DPSDQLDDQG%DVLOLFDWDUHJLRQVOO'(C$(R<.2"(MNNV(=*+( !#6=(?#3(<.+3+$=+7!"A(?2=*(=*+(#2&(-/ (+K<+.2&+$=2$8(#(=+..2=-.2#"(7+@+"-<&+$=(&-7+"(#66-.72$8(=-(=*+(12-E .+82-$#"(#<<.-#6*A(?*26*(23(1#3+7(-$(#(3%<+.-.72$#=+(+$@2.-$&+$=#"(3B3=+&(6-$3=2=%=+7(1B(=*+(2$=+..+82-$#"( K\GURJUDSKLFEDVLQ,WLVWKHÀUVW DQGVRIDUWKHRQO\ LQWHUUHJLRQDO5LYHU&RQWUDFWLQ,WDO\


!"#$%&'()*+(,-%.$#"(-/ (0.1#$23&(4(5-$/+.+$6+(!.-6++72$83


!"#$%&'("#')*+",-./'*-*0-'(#1'$-%2*-33."-$4 <$(-.7+.(=-(->+.6-&+(=*23(6.%?(#$7(=-(#6*2+>+(#(=+..2=-.2#"(@.-A+6=(=*#=(6#$(2$=+8.#=+(+$>2.-$&+$=#"(#$7( #$=*.-@26(>#"%+3B(C#8$#8*2(3%88+3=3(=-(#7-@=(#D ´ELRUHJLRQDOYLVLRQWKDWZRXOGKHOSSODQQLQJLPDJLQDWLRQWRUHGHÀQHWKHLVVXHRI JURZWKDVDPDWWHURI H[E @"-.#=2-$(#$7(&+#3%.+(-/ (=*+(.+"#=2-$3*2@(1+=F++$(*%&#$(3+=="+&+$=3(#$7(+$>2.-$&+$=(F2=*2$(=*+(.+82-$B( 2$(-.7+.(=-(3+=(%@(@.2$62@"+3(-/ (12-(+6-$-&GB(-.2+$=2$8(3+=="+&+$=(@.2$62@"+3(=-F#.73(=*+(=+..2=-.2#"(+6-3GE 3=+&H(3+"/E.+@.-7%6212"2=GI(JKLMM#B(@'9;N'( C#8$#8*2(JKLMM1B(@'(KO:N(7.#F3(-$(P+11H3(6-$6+@=(-/ (12-.+82-$#"23&B(2$=+$7+7(#3(=*+(/-.&(-/ (7+6+$=.#"2Q+7( *%&#$(-.8#$2Q#=2-$(E(=*#=(3++R2$8(=-(&#2$=#2$(=*+(2$=+8.2=G(-/ (12-"-826#"(@.-6+33+3B(=*+(/-.&#=2-$3(-/ ("2/+( DQGWKHVSHFLÀFJHRJUDSKLFDOIRUPDWLRQVRI ELRUHJLRQKHOSVWKHPDWHULDODQGVSLULWXDOGHYHORSPHQWRI  *%&#$(6-&&%$2=2+3("2>+(=*+.+' 7KHULYHUDQGLWVWHUULWRU\VKRZIRUWKHLURZQQDWXUHDSK\VLFDOHQYLURQPHQWDOW\SHRI FRKHUHQFH VSHFLÀE 6#""GB(#(*G7.-8.#@*26(-$+N(F*26*(#""-F3(=-(->+.6-&+(#(&+.+"G(@-"2=26#"E#7&2$23=.#=2>+(27+#'(<$(/#6=B(F#=+.(23( #(/%$7#&+$=#"(+"+&+$=(1-=*(/-.(=*+(7+>+"-@&+$=(-/ (+6-3G3=+&3(#$7(/-.(=*+(8.-F=*(-/ (#$=*.-@26(3-62+=2+3'( )*+.+/-.+B(=*+(6.%62#"(233%+("2+3(2$(=*+(#12"2=G(=-(.+6-8$2Q+B(#$7(=-(&#R+(-=*+.3(R$-FB(=*+(12-.+82-$(F*-3+( 7+>+"-@&+$=(23(=-(1+(@"#$$+7' 7KHULYHUFRQWUDFWDLPVDWÁXYLDOUHFODPDWLRQDWDEDVLQVFDOHE\PHDQVRI LQWHJUDWHGSROLFLHVZKLFKDUH 7+>23+7( =*.-%8*( @#.=262@#=+7( @.-6+33+3( =*#=( #""-F( /-.( =*+( +?6*#$8+( -/ ( R$-F"+78+'( S-( 2=( 6#$( 1--3=( =*+( 7+>+"-@&+$=(-/ (#(3-62#"(#$7(6%"=%.#"(#F#.+$+33(=*#=(23(72//+.+$=(/.-&(=*+(6-$6+@=(-/ (12-.+82-$(2$(2=3(+$>2E .-$&+$=#"B(=+..2=-.2#"(#$7("#$736#@+(#3@+6=3(JC#8$#8*2B(KLMM1N'(T-F+>+.D U+?@+.2+$6+3(3=#.=+7(=-(=*23(7#G(3*-F(=*+($++7(/-.(#(@.-/-%$7(#6=2-$(-/ (6%"=%.#"(.+-.2+$=#=2-$(#=(=*+("+>+"( -/ (=+6*$26#"(+?@+.=3(#$7(@-"2=26#"(7+6232-$E&#R+.3B(1+/-.+(#7-@=2$8(#$7(32&@"G(3@.+#72$8(=*+(U/.#&+I(-/ ( #(F-.R2$8(&-7+"(3%6*(#3(=*#=(-/ (P2>+.(5-$=.#6=3B(+>+$(2$(=*+2.(U-.282$#"I(#$7(&-3=(@+6%"2#.(/-.&%"#=2-$'( S2&@"G(=*+(@.-@-32=2-$(-/ (#(&+6*#$23&(V(+>+$(#(6-$=.#6=%#"(-$+(V(23($-=(+$-%8*(-$(2=3(-F$(=-(&-72/G(#$7( .+-.2+$=#=+(6-$3-"27#=+7(72362@"2$#.G(@.#6=26+3(F*26*(#.+($-=(#1"+(=-(1+#.(-$(=*+(6#%3+3(/-.(7+8.#7#=2-$(#$7( ZKLFKFRQWULEXWHWRFUHDWLQJLWLQPDQ\ZD\Vµ &DORULS,  ,Q DOO OLNHOLKRRG PRUH FODULW\ DERXW ZRUNLQJ PHWKRG WLPLQJ ÀQDQFLQJ DQG HVSHFLDOO\ SUHVFULSWLYH #6R$-F"+78+&+$=(-/ (=*+(P5( 6-%"7(/#62"2=#=+($-=( -$"G( 2=3( 62.6%"#=2-$B( 1%=( #"3-( =*+( 6%"=%.#"( 6*#$8+( =*#=( 23( $+6+33#.G(/-.(@-"2=262#$3B(.+@.+3+$=#=2>+3(#$7(62=2Q+$3(=-(6-$327+.(2=(#(=+..2=-.2#"(36#"+(-/ (.+/+.+$6+(J72//+.+$=( /.-&(=*+(#7&2$23=.#=2>+(-$+N(/-.(=+..2=-.2#"(@-"262+3'(


!"#$%&'()*+(,-%.$#"(-/ (0.1#$23&(4(5-$/+.+$6+(!.-6++72$83


!"#$%&'()*+(,-%.$#"(-/ (0.1#$23&(4(5-$/+.+$6+(!.-6++72$83


!"#"$%&!'$()*'+,)&-&!'$()*'+,)&./0&1"#"$% 2',)'%%"&34"5'5" 6/$.,0,$*,&20/*,,("$%) 71/0,$*,8&7,409'0:-;9$,&<=>< !"#$%&'()*+(,-%.$#"(-/ (0.1#$23&4($'(564(7-"'5859:; <<<'="#$%&'$+>(?(@AAB(:65;C9DD; !.-E++F2$G3(=%1"23*+F(2$(HE>-1+.(59:;

!/*'1&?,#,1/+@,$5&'$(&A3%0"&-&B04'$C&?/@'"$D& 3%0"*91590'1&2'0E&')&20/@/5"/$& /. &'$&A3*5"#,&F90'1)G"+C 'DYLG)DQIDQL


0.1#$(F+7+"-=&+$>(=.-E+33+34(1+O-$F(>*+(2&#G+(-/ (&+>.-=-"2>#$(=-"#.2K#>2-$4(>+$F(>-(E.+#>+(#$(2$>+.&+F2#>+(%.1#$C .%.#"(F-&#2$(>*#>4(1+E#%3+(2>3((3=#>2#"(#$F(3-E2-(+E-$-&2E(E-&="+P2>O4((E#""3(/-.($+<(2$E"%327+(#$F(&%">2(3+E>2-$#"((=*O32C FDOSODQQLQJDQGGHVLJQDSSURDFK7KHWRRORI WKHDJULFXOWXUDOSDUNDSSOLHGLQPDQ\(XURSHDQFRQWH[WVVHHPVWRÃ&#x20AC;W <2>*(>*23(7232-$'()*+(=#=+.4(F+3E.212$G(>*+(E#3+3(-/ (>*+(#G.2E%">%.#"(=#.Q(E.+#>2-$(2$(>*+(&+>.-=-"2>#$(#.+#(-/ (J"-.+$E+( #$F(2$(>*+(-7+."#==+F((&%$2E2=#"2>O(-/ (!.#>-(R)%3E#$OS4(#FF.+33+3(3%E*(#(&#>>+.(=-2$>2$G(-%>(+3=+E2#""O(>-(>*+($+E+332>O( -/ (2$7-"7+&+$>(-/ (/#.&+.3(#3(Q+O(#E>-.3(2$(&#2$>+$#$E+(#$F(3>+<#.F3*2=(-/ (=+.2C%.1#$(#.+#3'()*+(=#=+.(/-3>+.3(>*+( 2F+#(>*#>4(<2>*-%>(#$(2$E"%327+(#$F(=#.>2E2=#>27+(T1->>-&(%=U(F+32G$(#==.-#E*4(#2&+F(>-(F+"27+.(="#E+(#<#.+$+33(2$( /#.&+.3(#3(<+""(#3(2$(E2>2K+$34(#$F(<2>*-%>(#(.+#"(/#.&+.3(+&=-<+.&+$>(#E>272>O4((/++F2$G(#$(T#E>27+(.%.#"3*2=U4>*+(=#.Q( =.-V+E>(.23Q3(>-(=.-F%E+(#(/%.>*+.4(#$F($->(+//+E>27+4(T>-=(F-<$U(12$F2$G(="#$'

!"#$%&'()*+&,(%# )*+( .+6+$<( 3+<<"2$8( 7=$#&263( 3*->+7( #( .+"+$<"+33( %.1#$2?#<2-$( @.-6+33( <*#<( @.-7%6+7( <*+( 3<.+$8<*+$2$8( -/ (<*+(%.1#$(7-&#2$(#3(<*+(7#2"=("2/+(+$A2.-$&+$<(/-.(<*+(&#B-.2<=(-/ (<*+(>+3<+.$(#$7(>-."7(@-@%"#<2-$( 2(&'(6321  C6<%#""=(.+6+$<(#$7(7++@+$+7(3<%72+3(@-2$<(-%<(-$(<*+(/#6<(<*#<((>+($-<(-$"=(#3323<(<-(#(.+323<#$6+(<-(<*+( %.1#$(-$(1+*#"/ (-/ (.%.#"(#.+#3(2$(D++@2$8(<*+2.(->$(3-62#"(#$7(@.-7%6<2A+(/+#<%.+3(EF#.1+.23G(H::IJ(1%<(K#3( >+""K(<-(<*+(.#232$8(-/ (#$(2$<+.&+72#<+(%.1#$K.%.#"(7-&#2$(>*+.+("2A+(#($-<($+8"2821"+(#&-%$<(-/ (@+-@"+( (85267$7 SUHYLRXVO\LPSURSHUO\FODVVLÀHGDVXUEDQ 2(&' $GRPDLQWKDWLVFKDUDFWHULK ?+7(1=(<*+(3<.-$8(2$<+8.#<2-$(-/ (%.1#$(#$7(.%.#"(/%$6<2-$3(#$7("2/+(@.#6<26+3(#$7(/.-&(>*26*(3<+&3(.+&#.K NDEOHLQQRYDWLRQSRWHQWLDOLWLHV ('25$  )*23(<#D+3(@"#6+(2$(#(L"->(7+$32<=M(3+<<"+&+$<(#$7(-/ (%.1#$(3@.#>"((1%2"<(+$A2.-$&+$<(ENNC(H::OJG(>*+.+( >+(>2<$+33(<-(*+#A=(6-$3+P%+$6+3(#$7(2&@#6<3(2$(<+.&3(-/ (/+.<2"+("#$7(6-$3%&@<2-$G(+6-3=3<+&3(+.-32-$G( .%.#"(7+A+"-@&+$<(@-<+$<2#"2<=(.+7%6<2-$(#$7G(8+$+.#""=G(-/ (<*+("-6#"(7+A+"-@&+$<(2<3+"/'( )*23(L2$(1+<>++$M(<+..2<-.2#"(7-&#2$(3*->3(.+"#<2A+"=($+>3(/+#<%.+3(#$7G(<*+.+/-.+G($-<(+#3=(<-(7+#"(>2<*'( )*#<(1-<*(/-.(<*+(@*=326#"(@"#$$2$8(#$7(%.1#$(7+328$(72362@"2$+3(Q&#2$"=(/-6%3+7(-$(%.1#$(/-.&(#$7(3+<K <"+&+$<(@.-6+33+3(3<%7=K(#$7(/-.(<*+(+$A2.-$&+$<(#$7(#8.-K+$A2.-$&+$<(+R@+.<23+G(<*#<(6%..+$<"=((#.+(6#""+7( <-(6-@+(>2<*(L*=1.27M(&#<<+.3(#$7(<+..2<-.2#"(/-.&3(3<.-$8"=(6-$6+.$+7(1=(<*+(#$<*.-@-8+$26(@.+3+$6+(#$7( @.+33%.+'( 7KLV ´WKLUG VSDFHµ 9DQLHU  )DQIDQL   FRXOG EH GHÀQHG DV D ´QHZ VRFLRSK\VLFDO IRUPDWLRQµ >*+.+(32$8"+(-%<(#$7(3%@@-.<($+>(3=$+.82+3(1+<>++$(%.1#$(#$7(.%.#"(@.-6+33+3(#$7(/+#<%.+3G(/-.(#$(-A+.#""( ´IRXQGLQJUHIUDPLQJµRI WKHVHWWOHPHQWVWUXFWXUHDVDZKROH7KDWGHÀQLQJLQPXOWLGLVFLSOLQDU\WHUPVWKH $+>(L<--"D2<M(/-.(<*+(.+82-$#"(#$7(%.1#$(7+328$'( )*+(6*#.#6<+.(#$7(-.282$(-/ (<*23(3@#6+("+#7(<-(-A+.6-&+(#$(L%.1#$6+$<.26M(#@@.-#6*(<*#<(6-$6+2A+(2<(#3(.+K 327%#"(@.-7%6<(-/ (<*+(<->$(7+A+"-@&+$<G(#$7(<-(#@@.+62#<+(2<3(/-%$72$8(A#"%+(2$(@.-7%62$8(%.1#$("#$736#@+( #$7(+$A2.-$&+$<G(+3@+62#""=(#3(.+3-%.6+(/-.(<*+(@.-7%6<2-$(-/ (L$-$K&#.D+<(-.2+$<+7M(6-&&-$3(#$7(@%1"26( %<2"2<2+3(E+'8'(+6-3=3<+&(3+.A26+3J(&#2$"=(7+"2A+.+7(#$7(&#$#8+7(1=(/#.&+.3' 5-$3+P%+$6+3(-/ (3%6*(#$(#@@.-#6*(6#""(/-.S( ‡ LQWHJUDWLRQRI WKHDJULHFRV\VWHPVWUXFWXUHRI WKHSHULXUEDQDUHDVLQGHÀQLQJVHWWOHPHQWDVVHWVDQG 7+A+"-@&+$<(6*-26+3T ‡ VLQJOHRXWDQGGHYHORSPHQWRI GHVLJQDQGPDQDJHPHQWWRROVÀWWLQJZLWKWKHQHFHVVLW\WRLQWHJUDWHVHWK <"+&+$<(&#<<+.3(#$7(@.#6<26#"($++73("2$D+7(<-(/#.&2$8(#6<2A2<2+3(#$7(+$A2.-$&+$<#"(@.-<+6<2-$T( ‡ A232-$2$8(#$7(@#.<262@#<2A+(@.-6+33+3(#6<2A#<2-$G(3%2<#1"+($-<(-$"=(/-.(<*+(62<2?+$3(2$6"%32-$(2$(7+6232-$#"( /-.%&3(1%<(+A+$(/-.(<*+(/#.&+.3(6"#2&3(+$*#$6+&+$<(#$7(3%@@-.<(2$(<*+(6-$<+R<(-/ (7+6232-$#"(@.-6+3K 3+3(6-$6+.$2$8(3+<<"+&+$<3(#$7("-6#"(7+A+"-@&+$<T )*+(/-""->2$8(@#.<(-/ (<*+(#.<26"+(/-6%3+3(+3@+62#""=(-$(<*+("#3<(<>-(@-2$<3G(3*->2$8(#3G(2$(<>-(.+#"(6-$<+R<3(( K(.+/+..2$8(<-(<*+(.+82-$#"(@.-@-3#"(/-.(<*+(C8.26%"<%.#"(!#.D(2$(<*+(&+<.-@-"2<#$(#.+#(U2.+$?+K!.#<-(#$7(<-( <*+(-$8-2$8(L1-<<-&(%@M(@.-6+33(/-.(<*+(@+.2K%.1#$(#8.26%"<%.#"(@#.D(-/ (!.#<-K(2<(23(6%..+$<"=(%$7+.(+R@+K .2&+$<#<2-$G(+A+$(2/ (>2<*(72//+.+$<(&+<*-73(#$7(.+3%"<3G(#$(+&@->+.&+$<(#$7(2$A-"A+&+$<(@.-6+33G(<%.$+7( -$("-6#"(#6<-.3(#$7(/#.&+.3G(#2&+7(<-(3%@@-.<(#$(2$$-A#<2A+(<--"(/-.(<*+(@+.2K%.1#$(L@.2&+M(/#.&"#$7(#.+#3( .+8+$+.#<2-$S(<*+(#8.26%"<%.#"(@#.D'

-"#./0#12',+*3&*'13#41'5#16#)06,2%#,%&02'1&0)#1%)#41'&0+,41&,70#&((38#&/0#+160#(9 #&/0# :1'+(#)0331#:,1%1#;,'0%<0=:'1&(" -"!"#./0#4'(>0+&#,%6&,&*&,(%13#9'1?0@('5#1%)#2(70'%1%+0# 7KH´YLVLRQµIRUDZLGHSDUNLQWKHÁRUHQWLQHPHWURSROLWDQRXWVNLUWVDUHDRULJLQVPRUHWKDQ\HDUVDJRLQ <*+(6-$<+R<(-/ (<*+(2$<+.&%$262@#"(@*=326#"(@"#$$2$8(#<<+&@<3(-/ (<*+(@"#2$(#.+#(3<#.<2$8(#<($-.<*K>+3<(1-.7+.( -/ (U"-.+$6+'(C.-%$7(<*+(VI:<*(<*+(@.-6+33(.+#6*+3(#(/-.&#"(#$7(-@+.#<2-$#"(3<#<+&+$<(>2<*(<*+(.+82-$#"(#6<( ´)ORUHQWLQH0HWURSROLWDQDUHDVWUXFWXUHVFKHPHµ ,18 'HVSLWHWKLVDFWWKHVFKHPHLV


!"#$%&'()*+(,-%.$#"(-/ (0.1#$23&(4(5-$/+.+$6+(!.-6++72$83

$-<(2&="+&+$<+7(#$7(<*+(=.->+6<(27+#?(2$6"%72$8(#(@27+(6+$<.#"(+$A2.-$&+$<#"(=#.B(#.+#?(%$7+.=2$$+7(-$(#( GLDORJLFLQVWLWXWLRQDOSODQQLQJDSSURDFKGRHVQ·WÀQGUHDOL]DWLRQ C$( <*+( DEE;( <*+( =.-6+33( .+3<#.<3?( #$7( )%36#$F( G+82-$( =.-&-<+( #$( 2$3<2<%<2-$#"( #8.++&+$<( =.-<-6-"( @2<*( 3-&+(H%$262=#"2<2+3(-/ (<*+(&+<.-=-"2<#$(#.+#(IJ+3<-(K2-.+$<2$-?(5#&=2(L23+$M2-?(K"-.+$6+N(#$7(!.-A2$6+( RI )ORUHQFHDLPHGWRGHÀQHDSODQQLQJGRFXPHQWIRUWKHFUHDWLRQRI DQDJULHQYLURQPHQWDOSDUNLQWKH SHULXUEDQDUHDEHWZHHQ)ORUHQFHDQG3UDWR$IWHUZDUGVEHWZHHQDQGRWKHUPXQLFLSDOLWLHVMRLQW <-(<*+(="#$$2$8(#8.++&+$<(I!.#<-?(J28$#?(5#"+$M#$-?(5#.&28$#$-?(!-882-(#(5#2#$-N(@2<*(<*+(!.-A2$6+(-/ ( !.#<-(#$7(<*+(=#.B(=.->+6<(.+#6*(-%<((#(.+&#.B#1"+(72&+$32-$(%=(<-(#.-%$7(OEEE(*+6<#.+3(-/ (+$A2.-$&+$<#"( #$7(/#.&"#$7(#.+#3?(<*#<(6-$3<2<%<+(<*+("2/+(1#32$(-/ (1+F-$7(OEE'EEE(2$*#12<#$<3'( J2$6+(DE:E(%=(<-(DE:D?(1+327+3?(<*+(=.-6+33(/-.(<*+(=#.B(=.->+6<(*#3(1++$(/%.<*+.(/+7(<*#$B3(<-(#$(#6<2A2<F(-/ ( 3<%7F?(7++=+$2$8(#$7(+P6*#$8+(@2<*(-<*+.(Q%.-=+#$(=+.2%.1#$(=#.B3?(6#..2+7(-$(2$(<*+(6-$<+P<(-/ (C$<+..+8( CR(5(=.->+6<(S!+.2%.1#$(!#.B3T:' J%&&2$8(%=(<*+(7+328$(3<.#<+826(A232-$(/-.(<*+(!#.B(3%==-.<+7(1F()%36#$F(G+82-$(6-%"7(1+(3#27(<*#<(<*+( =.->+6<(3++B3(<-(&#2$<#2$(<*+(6*#.#6<+.23<263(-/ (+P23<2$8(I-.(.#<*+.?(S.+323<2$8TN(#8.26%"<%.#"(#$7(+$A2.-$&+$U WDODUHDVLQWKHKHFWDUHVRI DJULFXOWXUDOSODQDQGFORVHVWKLOO\VORSHVHHLQJWKHVHDUHDVDVDODUJHJUHHQ "%$8(@*26*(*+"=3(3%..-%$72$8(%.1#$(#.+#3(<-(1.+#<*+'()*+F($++7(2$$-A#<2-$(2$(#8.26%"<%.#"?(+$A2.-$&+$<#"( #$7(6-&=#<21"+(3+.A26+(#6<2A2<2+3?(2$(-.7+.(<-(<.#$3/-.&(<*+&3+"A+3(/.-&(#.+#3(#@#2<2$8(/%<%.+(%.1#$2M#<2-$( 2$<-(#$(+P#&="+(-/ (S%.1#$(6-%$<.F327+T(2$("2$+(@2<*(<*+(&-3<(.+6+$<(Q%.-=+#$(&+<.-=-"2<#$(+P=+.2+$6+3'( )*23(@2""($-<(-$"F(+$*#$6+(<*+(.26*($+<@-.B(-/ (6%"<%.#"(#$7(#.6*+-"-826#"(*+.2<#8+?(1%<(#"3-(<*+(=-<+$<2#"(/-.( #"<+.$#<2A+(&-12"2<F(#$7(2$<+.U&-7#"2<F(@2<*(=%1"26(<.#$3=-.<'(K-.(<*+(.#$8+(-/ (%.1#$2M+7(#.+#3(<*#<(@2""(/#6+( -$<-(<*+(=#.B?(<*23(.+=.+3+$<3(#$(+P<.#-.72$#.F(=-33212"2<F(/-.($+@(.+8+$+.#<2-$(#$7(+$*#$6+&+$<?(<*.-%8*( #($+@(7+328$(#==.-#6*(<*#<(6-%"7(<%.$3(6%..+$<(1#6BF#.73("2B+((8.++$(3=#6+3(2$<-(#($+@(6+$<.#"?(&%"<2/%$U 6<2-$#"(#8.-(+$A2.-$&+$<#"(7-&#2$'( )*+(!#.B(23($-<(-$"F(=.-&-<+7(#3(#(3<.%6<%.#"V3<.#<+826(<--"(#$7(8%27+(/-.(<*+(=*F326#"(="#$$2$8(-/ (<*+(=+U ULXUEDQÁRUHQWLQHDUHDEXWLVDOVRFRQFHLYHGDNH\LQVWUXPHQWIRUORFDOGHYHORSPHQW7KH3DUNLVFRQFHLYHG DVDPXOWLVHFWRUDQGLQWHJUDWHGWRROZKLFKGHÀQHVDOOSRWHQWLDOXVHVRI WKHFXOWXUDOHQYLURQPHQWDODQG "#$736#=+(.+"#<+7(/+#<%.+3(-/ (<*+(=#.B(2<3+"/ (#$7(-/ (<*+(3%..-%$72$8(#.+#'()%36#$F(G+82-$(23(7+A+"-=2$8(<*+( =#.B(@2<*2$(<*+(/.#&+@-.B(-/ (<*+(G+82-$#"(!*F326#"(!"#$$2$8(<--"(I!2#$-(G+82-$#"+(72(C$72.2MM-()+..2<-.2#"+N' )RUWKDWUHDVRQLQWKHÀHOGRI ORFDOGHYHORSPHQWWKH5HJLRQDO0LQLVWU\IRU7RZQ3ODQQLQJSURPRWHVDQ #6<2A+(=-"26F(-/ (2$<+8.#<2-$(#$7(6--.72$#<2-$(@2<*(<*+(=-"262+3?(=.->+6<3(#$7(.+3-%.6+3(-/ (-<*+.(&2$23<.2+3'( 6XFKDQLQWHJUDWLRQLVSXUVXHGLQWKHFRQWH[WRI WKH5HJLRQDO'HYHORSPHQW3ODQ )*+(=#.B(6.+#<2-$(@2""(1+(<*+$(/-3<+.+7(1F(#(3+.2+3(-/ (=2"-<(#6<2-$3(@2<*(#(&%"<2="2+.(+//+6<(-$(<*+(3-62-U +6-$-&26( #$7( +$<.+=.+$+%.2#"( #33+<3( -/ ( <*+( .+82-$( 3%==-.<2$8( -$8-2$8( +P23<2$8( "-6#"( =.->+6<3( =.-=-3+7( -$( 1+*#"/ ( -/ ( "-6#"( &%$262=#"2<2+3( 2$( 3<.-$8( 6-*+.+$6+( @2<*( <*+( =#.B( 8-#"3'( C$( 3%6*( #( =.-3=+6<?( @2<*-%<( &-72/F2$8(<*+(72//+.+$<(1%78+<("2$+3(-/ (<*+(A#.2-%3("-6#"(#%<*-.2<2+3(2$A-"A+7?(<*+(G+82-$(6-U/%$7+7(3-&+( SURMHFWVVHOHFWHGDFFRUGLQJO\ZLWKWKHLUFRKHUHQFHDQGLQWHJUDWLRQZLWKWKHVSHFLÀFREMHFWLYHVDQGDFWLRQV -/ (<*+(-A+.#""(3<.#<+826(=#.B(=.->+6<D'( )*+(6.+#<2-$(#$7(8.-@<*(-/ (<*+(!#.6-(W8.26-"-(7+""#(!2#$#(23(#(.+82-$#"(=.2-.2<F?(1%<(-$+(<*#<(.+X%2.+3(6-&U &2<&+$<?(.+3-%.6+3(#$7(+3=+62#""F(3*#.+7(3-62#"(#@#.+$+33(#1-%<(<*+(3<.#<+826(A#"%+(-/ (<*+(=#.B(=.->+6<(#3( #(<--"(<-(=.-&-<+(#$(+$7-8+$-%3(#$7(3%3<#2$#1"+(2$$-A#<2A+(7+A+"-=&+$<(=.-6+33(/-.(<*+(#.+#?(W(=.-6+33( #2&+7(<-(7+"2A+.(2$<+8.#<+7(8-#"3(-/ ("-6#"+(7+A+"-=&+$<?(*+.2<#8+(=.-<+6<2-$(#$7((@+""(1+2$8(/-.(<*+(62<2M+$3'( :( !.->+6<(2$(@*26*()%36#$F(.+82-$(@#3("+#72$8(=#.<$+.(#$7(<*#<(=.-7%6+7(.+&#.B#1"+(+//+6<3(2$(<+.&3(-/ (#@#.+$+33( 1%2"72$8(2$(<*+(2$A-"A+7(&%$262=#"2<2+3(<+6*$262#$3(#$7?(&-.+-A+.?(#(=2"-<(=.->+6<(/-.(<*+(!.#<-(=+.2%.1#$(/#.&"#$7( #.+#3( <--'( J++( @+132<+( IEDV:YN'( 5-""#1-.#<2-$?( +P6*#$8+( #$7( 6#=#62<F( 1%2"72$8( @2<*2$( <*+( !QGC0GLWZ( !WG[J( =.->+6<(3%==-.<3(#$7(1%2"73(-$(<*+(.+82-$#"(-1>+6<2A+3?(#$7(<*+()%36#$F(G+82-$((23("--B2$8(/-.@#.7(<-(6-$<2$%+7( #6<2A2<2+3(-A+.(<*+($+P<(<@-(F+#.3'  $FFRUGLQJO\ZLWKWKHVHDLPV7XVFDQ\UHJLRQFRIXQGHGIRUDUDWLRRI WKHWRWDOIRUHVHHQEXGJHWSURMHFW =.-=-3#"3(/-.(#((<-<#"(#&-%$<(-/ ((\(H"V]'((

!"#$%&'()*+(,-%.$#"(-/ (0.1#$23&(4(5-$/+.+$6+(!.-6++72$83


<$(-.7+.(=-(#6*2+>+(3%6*(#$(#?#.+$+33()%36#$@(A+82-$(/-3=+.+7B(32$6+(=*+(-%=3+=(-/ (=*+(C#.D(6.+#=2-$(C.-E 6+33B(#(.+&#.D#1"+(C.-6+33(-/ (2$/-.&#=2-$(#$7(C%1"26(C#.=262C#=2-$(#7-C=2$8(>#.2-%3(=--"3B(2$2=2#=2>+3(#$7( +FC+.=23+3'(

!"!"#$%&#'()*+,+'(*+-&.,/0012+,(*+-&#')/,&334#*/5()6#(#3%()&6#-+3+/2 )*+(G7+328$H(-/ (=*+(C#.=262C#=2>+(#$7(6-&&%$26#=2>+(C.-6+33(6-$6+.$2$8(=*+(!#.6-(7+""#(!2#$#(C.-I+6=(23B( 32$6+(=*+(-%=3+=B(>+.@(3=.%6=%.+7(#$7(6-$3=2=%=+(#(C2>-=#"(+"+&+$=(-/ (=*+(.+82-$#"(8->+.$#$6+(#6=2-$'()%36#$@( UHJLRQVLQFHWKHDFFRUGLQJO\ZLWKWKHUHJLRQDOSODQQLQJDFWDSSRLQWVDVSHFLÃ&#x20AC;F´FRPPXQLFDE =2-$(8%#.#$=++H(?2=*(=*+(=#3D(=-(-.8#$2J+(#$7(C.-&-=+(=*+(2$/-.&#=2-$(#$7(C#.=262C#=2-$(-/ ((=*+(GC%1"26H( 6-$6+.$+7(#$7(3=#D+*-"7+.3'(K-.+->+.(=*+(L%#.#$=++(#6=2>2=@(7+>+"-C3(?2=*(=*+(3%CC-.=(-/ (#(C.2>#=+(6*#.E 8+7( C#.=$+.3*2C( MN-62-"#1EO>>+$=%.#( %.1#$#P( 6*#.8+7( /-.( =*+( C#.=262C#=2>+( C.-6+33( &#$#8+&+$=( #$7( /-.( LQIRUPDWLRQGHOLYHULQJ$ZHEVLWHLVFUHDWHGZHUHLVSRVVLEOHWRÃ&#x20AC;QGRXWHYHU\LQIRUPDWLRQDQGGRFXPHQWV #1-%=(=*+(C#.D(C.-I+6=(#$7(?*+.+(23(C-3321"+(=-(+FC.+33(-C2$2-$3(#$7(27+#3(M???'C#.6-7+""#C2#$#'-.8P'()*+( #6=2>2=2+3(C.-&-=+7(1@(=*+(L%#.#$=++B(/.-&(:QQ;(%C(=-(:QQRB(#.+(&#$2/-"7(#$7(#CC"@(>#.2-%3(=--"3((-/ (=*+( 6-&&%$26#=2>+(C"#$$2$8(G=--"1-FH'(O&-$8(=*+3+(6-%"7(1+(.+6#""+7S Â&#x2021; 52=2J+$3(&++=2$8(*+"7(2$(=*+(>#.2-%3(&%$262C#"2=@(#2&+7(=-(2$=.-7%6+(=*+(C#.D(>232-$(#$7(=-(8+=(6.2=263B( 3%88+3=2-$3(#$7(C.-C-3#"3(-$(1+*#"/ (-/ (3-62#"(#6=-.3T Â&#x2021; 8%27+7(>232=3(#$7(?#"D3(2$(=*+(C#.D(7%.2$8(=*+(>#.2-%3(3+#3-$3B(#2&+7(=-(1%2"7(#?#.+$+33(#1-%=(C"#6+3( #$7(-CC-.=%$2=2+3(-/ (=*+(C#.DT( Â&#x2021; 3=.%6=%.+7(/-.%&(?2=*(=*+(2$*#12=#$3B(3%6*(#3(=*+((GC"#$$2$8(/-.(.+#"H(3+332-$(-.8#$2J+7(1@()%36#$@( A+82-$(7%.2$8(5.+#=2>2=@(U+3=2>#"(*+"7(2$(U"-.+$6+(2$(:QQRT( Â&#x2021; )*+&+(7236%332-$(8.-%C3(M+'8'(-$(?#3=+(=.+#=&+$=(C"#$=3(#$7(&#$#8+&+$=B(#8.26%"=%.+PT Â&#x2021; O%72-E>23%#"3(&+72#(#$7(6-&&%$26#=2-$(=--"3(C.-7%6=2-$' U%.=*+.&-.+B(#66-.72$8"@(?2=*(=*+(*28*+.(#==+$=2-$(C#27(=-(=*+(C*@326#"(7+328$(72&+$32-$(-/ (=*+(C#.D(.+E FRUGHGDIWHUDUHKHOGEHWZHHQ-XO\DQG'HFHPEHUWZRVKDUHGGHVLJQODERUDWRULHVDGRSWLQJWKH G6*#..+==+H( &+=*-7-"-8@'( )*+( "#1-.#=-.2+3( E=*#=( 3++( +3C+62#""@( =*+( 2$>-">+&+$=( -/ ( +FC+.=3B( .+82-$B( "-6#"( DGPLQLVWUDWLRQRIÃ&#x20AC;FHUVDQGWHFKQLFLDQVDVVRFLDWLRQVUHSUHVHQWDWLYHVDQGDÃ&#x20AC;QDOSXEOLFGHEDWHLQDQRSHQDVE 3+&1"@E((#""-?(/-.(#$(+//+6=2>+(/-6%3(-$(&#2$(7+328$(=*+&+3((/.#&2$8(=*+(C#.D(C.-I+6=(#$7(=*#=(?2""(%$7+.C2$( =*+(>#.2#=2-$(-/ (=*+(.+82-$#"(C*@326#"(C"#$VM3++(2&#8+(WP'

 %HVLGHVVRPHPDSVRI DQDO\WLFDOQDWXUHODERUDWRULHVDOORZHGIRUWKHGHÃ&#x20AC;QLWLRQRI WKUHHSHFXOLDUWKHPHVUHIHUUHGWR ( E(/+#=%.+3(-/ (=*+(/#.&"#$7(#$7($#=%.#"(#.+#3T ( E(+6-"-826#"(G&#=.2FH(-/ (=*+(#.+#3(6-$6+.$+7(1@(=*+(C#.D(C.-I+6=T ( E(3"-?(=.#6D(&-12"2=@($+=?-.D(3=.%6=%.+T(


!"#$%&'()*+(,-%.$#"(-/ (0.1#$23&(4(5-$/+.+$6+(!.-6++72$83


)*+(E#.=262E#=2-$(#6=2@2=2+3(E.-&-=+7(#$7(3=.%6=%.+7(-$(1+*#"/ (-/ ()%36#$A(.+82-$(3*-F(3-&+(E-32=2@+(+/? /+6=3(2$(=+.&3(-/ (E.-8.+332@+(.+"+@#$6+(#$7(#F#.+$+33(1%2"72$8G((2$(=*+(E%1"26(#8+$7#G((-/ (=*+(@#"%+(-/ (E+.2%.? 1#$(#.+#3(/-.(#("2@+#1"+G(#==.#6=2@+(#$7(@21.#$=(%.1#$(+$@2.-$&+$=(#$7("#$736#E+'()*#=(+3E+62#""A(E.-E-32$8( #$(H#6=2@+I(#$7(/-%$72$8(.-"+(-/ (=*+3+(#.+#3G(-EE-3+7(=-(=*+(=.#72=2-$#"(#EE.+62#=2-$(-/ (=*+&(#3(F#3=+(#$7( .+327%#"("#$73(=-(%3+G(#=(=*+(1+3=G(/-.(+$@2.-$&+$=#"(6-&E+$3#=2-$9'( J=(23(F-.=*($-=2$8G($+@+.=*+"+33G(=*#=(2$(=*+(E.-6+33(<%3=(7+36.21+7G(=*+(/#.&+.3(2$@-"@+&+$=(#$7(+&E-F+.? &+$=(.+&#2$3(3=2""(F+#K'()*#=(+3E+62#""A(6-$327+.2$8(=*+(E.-3E+6=(/-.(#($+6+33#.A(/%=%.+(<-2$=(6-$3=.%6=2-$( F2=*(=*+&(-/ (3*#.+7(#8.2?(+$@2.-$&+$=#"(E.-<+6=3G(#77.+332$8(=*+(&#$#8+&+$=(#$7(3=+F#.73*2E(-/ (E+.2%.? 1#$(#8.26%"=%.#"(#.+#3G("+@+.2$8(-$(=*+(6-$=+3=%#"(K$-F"+78+G(3K2""3(#$7(#6=2@+(.-"+(-/ (/#.&+.3(=*+&3+"@+3' L%6*(#(&#==+.(23($-=(-$"A(2&E%=#1"+(=-(E.+3%&+7("#6K3(-/ (=*+(E#.=262E#=2@+(E.-6+33G(1%=(2=(23(&#2$"A(7%+(=-(=*+( GLIÃ&#x20AC;FXOWLHVLQLQYROYLQJWKHDJULFXOWXUDODFWRUVWKDWHVSHFLDOO\LQSHULXUEDQDUHDVKDV\HWDVVXPHGDVH[SHFWHG RUXVXDODSURÃ&#x20AC;OHRI QRUHOHYDQFH7RWKLVIHHOLQJFRUUHVSRQGRQEHKDOI RI IDUPHUVZKDWWKDWRQHFRXOG GHÃ&#x20AC;QHDVVFDUFHDZDUHQHVVRI WKHLURZQVRFLDODQGHFRQRPLFUROHDQGDFRQVHTXHQWLDOVHQVHRI PLVWUXVWLQ =*+(E-33212"2=A(=-(1.2$8(#$7(.+E.+3+$=(=*+2.(E.-1"+&3(2$((=*+(E%1"26(E-"262+3(#8+$7#(BM#$(7+.(!"-+8*G(NOO9D'(

!" !"#$%&%'()*%+,%#)*&'-%.('%+/,0&/#*-%+/%0$*%#(/0*10%(.%0$*%2*3&0*%%40$&0%3*#&",*%0$*%5*#(/(678%(.%0$*%9&9*'%:%#&/;0%&##("/0%$*'*4% '*)&0*2%0(%0$*%0(%0$*%#)&+6*2%#(*1+,0*/#*-%+/%0$*%,&6*%<&'+&0+(/%&#0%(.%0$*%'*=+(/&)%9$7,+#&)%9)&/-%(.%0$*%9&'>%%9'(?*#0%&/2%(.% 0$*%$79(0$*,+,%#(/#*'/+/=%0$*%&2?",06*/0%@.('%,&.*07%'*&,(/,4%(.%0$*%&+'9('0%(.%A)('*/#*B%C$&0%%+,%&%6&00*'%0$&0-%&0%0$*%6(6*/0-% &)(/=,+2*%D+0$%,(6*%9'(3)*6,%&2<&/#*2%37%,(6*%#(/#*'/*2%6"/+#+9&)+0+*,-%$&,%,0(99*2%0$*%&26+/+,0'&0+<*%#("',*%(.%0$*% '*=+(/&)%9)&/%<&'+&0+(/%&/2%(.%0$*%9&'>%+0,*).B

!"#$%&'()*+(,-%.$#"(-/ (0.1#$23&(4(5-$/+.+$6+(!.-6++72$83


!"#$%&#'()*+,-.,)'-#/')0#'1#23..345,/#/)3+&11#36 #13+*'-#432*-*7'.*389# # .%&#&:/&)*&8+&#36 #/&)*,)2'8#')&'#36 #;)'.3 ;<#.<2$8(/.-&(#(.+3+#.6*=>.-?+6<(#6<2@2<A(.+"#<+7(<-(#(B27+.($#<2-$#"(.+3+#.6*(>.-8.#&(-$(#8.26%"<%.#"(>#.C3( OHDGHGE\8QLYHUVLW\RI )ORUHQFHVLQFHDÃ&#x20AC;UVW´FRDOLWLRQµRI ORFDODFWRUZDVHVWDEOLVKHGZLWKWKHIHD #<%.+(-/ (#$(2$/-.&#"(/-.%&E(B2<*(<*+(#2&(<-(>.-&-<+(#(1-<<-&D%>(7+328$(>.-6+33(/-.(<*+(6.+#<2-$(-/ (<*+( >+.2%.1#$(#8.26%"<%.#"(>#.C(-/ (!.#<-'(F+"#<+7(<-(*23(&#2$(&2332-$(#2&3(-/ (<*+(/-.%&(B+.+G Â&#x2021; >.-&-<2-$(#&-$8(62<2H+$3(-/ (#(#B#.+$+33(-/ (<*+(2&>-.<#$6+(-/ ((>+.2%.1#$(#8.26%"<%.#"(#.+#3(2$(<*+( -%<3C2.<3(-/ (!.#<-I Â&#x2021; 2$@-"@+&+$<(-/ (/#.&+.3E(B2<*(+$@2.-$&+$<#"(#$7(6%"<%.#"(#33-62#<2-$3E(2$(#(>#.<262>#<2@+(7+328$(>.-6+33E( #2&+7(<-(>.-&-<+(<*+(#8.26%"<%.#"(>#.C(#3(#$(2$<+8.#<+7(>*A326#"(>"#$$2$8E(#3(B+""(#3("-6#"(7+@+"->&+$<( #$7(>.-<+6<2-$(<--"I( Â&#x2021; #66-.72$8(B2<*(<*+3+(8-#"3G(.+#"2H#<2-$(-/ (6%"<%.#"(2$2<2#<2@+3(#$7(>.-&-<2-$(-/ (>.-?+6<3(#2&+7(<-(+$*#$D 6+(&%"<2/%$6<2-$#"(>+.2%.1#$(#8.26%"<%.+(.+"#<+7(<-("#$736#>+=+$@2.-$&+$<(.+8+$+.#<2-$(#$7(6.+#<2-$( -/ ($+B(+6-$-&26(>.-J2&2<A(36*+&+3(K2'+'(/--7(&2"+3(36*+&+3E(.+6.+#<2-$(#$7(.%.#"(*-3>2<#"2<A(/#62"2<2+3E( +<6L'( )*+(2$<+.#6<2-$(B2<*(%$2@+.32<AE(>%1"26(#7&2$23<.#<2-$3(#$7(>.2@#<+(3<#C+*-"7+.3E((>.-&-<+7(1A(<*+(/-.%&E(( #""-B+7(/-.(<*+(>.->-32<2-$(-/ (#(>*A326#"(36+$#.2-(+J>.+332$8(<*+(>#.C(@232-$E(*+">/%"(1-<*(/-.(<*+(>%1"26( HQYLVLRQLQJDFWLYLWLHVDQGWRHQKDQFHDÃ&#x20AC;UVWLQVHUWLRQRI WKHSDUNLGHDLQWKHVWUDWHJLFYLVLRQIRUWKHQHZ >"#$$2$8(<--"(-/ (!.#<-(&%$262>#"2<A(K3++(2&#8+3(MENL'

!"#$%&'((4(O2.3<(36+$#.2-(3<%72+3(/-.(<*+(#8.26%"<%.#"(>#.C(-/ (!.#<-(K3-%.6+(P+$8-E(5#"@+""2(MQQRL


!"#$%&'()*+(,-%.$#"(-/ (0.1#$23&(4(5-$/+.+$6+(!.-6++72$83

!"#$%&'('4(<%$262=#"2>?(-/ (!.#>-@(A>.%6>%.+(="#$@()*+(36+$#.2-(/-.(>*+(#8.26%">%.#"(=#.B(C3-%.6+D(!.#>-(<%$262=#"2>?E

$IWHU D ÀUVW SKDVH RI  ´DZDUHQHVV EXLOGLQJµ DQG SURPRWLRQ IRU WKH SDUN YLVLRQ DFWLYLWLHV OHDGHG GXULQJ #.-%$7(>*.++(?+#.3@(>*+(/-.%&(F#3(+3>#1"23*+7(2$(GHIH(%$7+.(#(/-.&#"(F#?@(F2>*(>*+(6.+#>2-$(-/ (J33-62#>2-$( -/ (3-62#"(=.-&->2-$(K>*+(!#.6-(J8.26-"-(72(!.#>-(J33-62#>2-$K(F2>*(#(&#$#82$8(6-%$62"(-/ (/-%$7+.(&+&K EHUVLQFOXGLQJUHSUHVHQWDWLYHVRI DVVRFLDWLRQVWKDWIRVWHUHGWKHIRUXPDFWLYLWLHVGXULQJWKHÀUVWSKDVH L>M3(F-.>*($->2$8(>*#>(>*+(!#.B(J33-62#>2-$(23(=#2.+7(#$7(3%==-.>+7@(#3(=.-N27+7(1?(2>3(3>#>%>+@(1?(>F-(6-$K VXOWDWLRQERGLHVWKDWDUHSLYRWDOLQGHÀQLQJLQLWLDWLYHVDQGVKDUHGSURMHFWVZLWKVWDNHKROGHUVWKH´6FLHQWLÀF >+6*$26#"(6-&&2>>++O(#$7(>*+(P5-&&2>>++(-/ (#8.26%">%.#"(#$7(/--73(-=+.#>-.3O'( J/>+.(2>3(/-.&#"(6-$3>2>%>2-$(>*+(!#.B(J33-62#>2-$(+$*#$6+7(2>3(-=+.#>2-$#"(#6>2N2>?@(+3=+62#""?(6-""#1-.#>2$8( F2>*()%36#$?(Q+82-$(#$7(!.#>-(!.-N2$6+(2$(=.-&->2$8(2$2>2#>2N+3(#2&+7(>-(3%==-.>(>*+(F27+.(=.-N2$62#"(#$7( .+82-$#"(=.-R+6>(KK(+3=+62#""?K(.+"#>+7(>-(>*+(!#.6-(7+""#(!2#$#(!.-R+6>(C3++((=.+N2-%3(=#.#8.#=*EK(#$7(2$(>.28K JHULQJRII DQGIRVWHULQJRSHUDWLQJLQWHJUDWHGSURMHFWVUHODWHGWRIDUPLQJDFWLYLWLHV,QWKLVODVWÀHOGLVZRUWK UHFDOODQRQJRLQJLQLWLDWLYHIRUWKHFUHDWLRQRI DORFDOZKHDWVKRUWIRRGVXSSO\FKDLQIRUÁRXUDQGEUHDG =.-7%6>2-$(%$7+.(S%#"2>?(8.-F2$8(.%"+3(C2'+'(#7-=>2-$(-/ (#8.#.2#$(.->#>2-$@(6*+&26#"(=.-7%6>3(%3+(.+7%6>2-$E(( #$7(F*+#>(>.#72>2-$#"(>.#$3/-.&#>2-$(&+>*-7(#66-.72$8"?(F2>*("-6#"(>.#72>2-$'()*#>(36*+&+(2$N-"N+(#>(>*+( PRPHQWPDQ\IDUPHUVDQGFUDIWVPHQRI WKHORFDOIRRGVHFWRUDQGDIWHUWKHÀUVWVXFFHVVIXOSLORWSKDVHLWLV $-F(72.+6>+7(>-F#.7(#(=*#3+(-/ (+$"#.8+&+$>(#$7(/%""(7+N+"-=&+$>'( 'HVSLWHLWVUHOHYDQWDFWLYLWLHVDQGWKHUHOLDELOLW\DFTXLUHGE\WKHDVVRFLDWLRQWRWKHSXEOLFLQVWLWXWLRQDQGORFDO VWDNHKROGHUVWKHDFWLYLW\DQGWKH3DUNSURMHFWUHDOL]DWLRQDUHVWURQJO\KDPSHUHGE\WKHGLIÀFXOW\WRFDUU\RQ 3%6*(#$(#6>2N2>2+3(F2>*(#(3>.%6>%.+(>*#>(23(1#326#""?(N-"%$>#.?("+#7+7(#$7(1?(>*+(.+"#>+7(=.-1"+&(-/ (#(3>.%6>%.+( WKDWJHWZHDNÀQDQFLDOPHDQVDQGDORZLQVWLWXWLRQDOSURÀOHHVSHFLDOO\LQEDUJDLQLQJZLWKSXEOLFSRZHUV

!"#$%&#'()*+,-.,)'-#/')0#'1#-2+'-#3&4&-2/5&6.#/2-*+78# # 529*-*:'.*26#-2+'-#12+*&.7;#12+*'-#+'/*.'-#'63#<.&))*.2)*'-#'33&3#4'-,&=#/)23,+.*26 T-F(=.+N2-%3"?(&+$>2-$+7(>*+(#8.2K%.1#$(7-&#2$(=-3+3(&#>>+.(-/ (=+6%"2#.(2$>+.+3>(#$7(-.282$#"2>?(2$(>*+( SK\VLFDOSODQQLQJDQGWHUULWRU\GHVLJQÀHOGV0RUHRYHUWKHVHDUHDVDOORZIRUDQHZYLVLRQDQGVWUDWHJ\DGK GUHVVLQJQHZ´SUR[LPLW\HFRQRPLHVµ 'DYH]LHV ÀWWLQJZLWKHQHUJ\VXSSO\WUDQVLWLRQVFHQDULRVDQG F2>*(&-.+(+S%2>#1"+(#$7(3%3>#2$#1"+(&-7+"3(-/ ("-6#"(7+N+"-=&+$>(#$7(=*?326#"(3+>>"+&+$>3(#33+>3(CU+F&#$( +>'(#"@(GHHVE'( 6XFKPDWWHUVÀQGDQFRKHUHQWWKHRUHWLFDODQGRSHUDWLRQDOUHIHUHQFHIUDPHZRUNRI LQWHUSUHWDWLYHDQGGHVLJQ 6*#.#6>+.(2$(>*+(12-.+82-$#"(&-7+"(#$7(2$(>*+(%.1#$(12-.+82-$(6-$6+=>(C)*#?+.@(GHHWX<#8$#8*2@(GHIHE'(J>(

!"#$%&'()*+(,-%.$#"(-/ (0.1#$23&(4(5-$/+.+$6+(!.-6++72$83


WKHVDPHWLPHWKHFRQÁLFWVWKDWJHQHUDWHLQWKLVQHZGRPDLQFRQFHLYHGDVDQHZIRUPRI SXEOLFVSDFHFDOO IRUWKHHPSOR\PHQWRI VRFLDOLQFOXVLYHSUDFWLFHVLQWKHÀHOGRI SODQQLQJVXLWDEOHIRUWKHFRQVWUXFWLRQRI  $+<(/-.&3(-/ (#8.++&+$=3(#$7(6-$=.#6=3(/-.(=*+(>.-=+6=2-$?(.+8+$+.#=2-$(#$7(3=+<#.73*2>(-/ (=*+(>+.2%.1#$( /#.&"#$7(#.+#3(@5ABA(CDD9?()+..+3(+$(E2""+3(CDDFG'(!.#6=26+3(+3>+62#""H(/-6%3+7(-$(=*+(/#.&+.3(<2""2$8$+33( 'RQDGLHX  7KHWZRFDVHVEULHÁ\GHVFULEHGDUHSODFHGLQWKHSUREOHPDWLFFRQWH[WMXVWUHFDOOHGDQGDOORZWRGHHSHQ 2$(=*+(I=#"2#$(3-62#"(#$7(2$3=2=%=2-$#"(/.#&+<-.J?(3-&+(-/ (=*+(&#==+.3(.#23+7(=*#=(#.+(>2K-=#"(/-.(=*+(7+K+L "->&+$=(-/ (#$(+//+6=2K+(>"#$$2$8(#$7(7+328$(>-"26H' ,QWKHÀUVWFDVHWKH3DUFR$JULFRORGHOOD3LDQDVWDUWLQJIURPWKHLQLWLDWLYHSURPRWHGE\7XVFDQ\5HJLRQ 8-K+.$?(2$(6--.72$#=2-$(<2=*(-=*+.(&%$262>#"2=2+3?(23(7+K+"->+7(#(>#.=262>#=2K+(#$7(6-&&%$26#=2K+(>.-6+33( #2&+7(=-(32$8"+(-%=(=*+(J+H3(/+#=%.+3(+2=*+.(-/ (=*+(>#.J(>.-M+6=(#3(<+""(#3(-/ (=*+(1%2"7(*+.2=#8+(=-(>.-=+6=(#$7( HQKDQFHWDQNVWRWKHSDUN'HVSLWHWKDWXQGHUWKHLQFOXVLYHQHVVSRLQWRI YLHZWKHSURFHVVGHVFULEHGVKRZV 3=2""(3-&+("2&2=3?(#1-K+(#""(6-$327+.2$8(=*+("#6J(-/ (1#6J8.-%$7(J$-<"+78+(#1-%=(=*+(/#.&+.3(#$7(/#.&2$8( &#==+.3(#$7(>.-1"+&3'( N1-%=(=*+((3+6-$7(6#3+?(.+/+..2$8(=-(=*+(+$K232-$2$8(#$7(>#.=262>#=2K+(>.-6+33(/-.(=*+(N8.26%"=%.#"(>#.J(-/ ( !.#=-?(=*+(1-==-&L%>(#>>.-#6*(23(2$/-.&#"?(#$7(>#H3(>+6%"2#.(#==+$=2-$?(32$6+(=*+(-%=3+=?(#=(=*+(2$K-"K+&+$=( -/ (=*+(#8.26%"=%.#"(3+6=-.(3=#J+*-"7+.3'()*#=(2$(6"-3+(2$=+.#6=2-$(<2=*(&#$H(#33-62#=2-$3(3+$32=2K+(=-(=*+(#8.-( +$K2.-$&+$=#"(&#==+.3(#$7(=-(=*+2.(.+"#=2-$(<2=*(=*+(%.1#$(+$K2.-$&+$='()*#=(3+6-$7(#>>.-#6*(3++&3(=-(1+( >.-&232$8?($+K+.=*+"+33(2=(>%=(3=.-$8"H(2$(+K27+$6+?(7+3>2=+(=*+(+&>-<+.&+$=(#6=2K2=2+3(6#..2+7(-%=(1H(=*+( IRUXPIRUWKHSDUN WKHQEHFDPHDVVRFLDWLRQ WKHGLIÀFXOW\WRVXEPLWWRWKHSXEOLFDJHQGDWKHGHPDQGV /-.(#$(2$=+8.#=+7(>"#$$2$8(>-"26H(/-.(=*+(>+.2%.1#$(#.+#3?(#3(<+""(#3?(=*+(2&>-.=#$6+?(+3>+62#""H(2$(>.-3>+6=?( -/ (/#.&"#$7(>.-=+6=2-$(#$7(6#.+'( 'HVSLWHWKHUHPDUNDEOHOLPLWVRI ERWKWKHH[SHULHQFHVWKH\FOHDUO\SRLQWRXWVRPHDVSHFWVWRWDNHLQDFFRXQW 2$(7+#"2$8(<2=*(>"#$$2$8(#$7(7+328$(6-&&2=&+$=3(/-.(=*+(>+.2%.1#$(#.+#3'(B%6*(#3>+6=3(*28*"28*=(=*#=O( L=*+(6#>#12"2=H(2$(>.-7%62$8($+<(6-8$2=2K+(/.#&+3?(>"#6+(#<#.+$+33(#$7(J$-<"+78+(#3(>-3321"+(.+3%"=(-/ (=*+( >#.=262>#=+7(>"#$$2$8(#$7(7+328$(>.-6+33+3?(.+3%"=3(+33+$=2#"(2$(>%.3%2$8(#(3*#.+7(>+.2%.1#$(>#.J(>.-M+6=(=*#=?( RWKHUZLVHZRXOGWDNHWKHSURÀOHRI DVLPSOHWRSGRZQDQGPDQGDWRU\WRRORI GRXEWIXOHIIHFWLYHQHVVDQG %=2"2=HP( L(#8#2$3=(=*+(36#.6+(#==+$=2-$(#$7(%$7+.(.+>.+3+$=#=2-$(-/ (=*+(7+&#$73(3=+&&2$8(/.-&(=*+(#8.26%"=%.#"(3+6L WRULQWKHSXEOLFDJHQGDLWVHHPVUHOHYDQWWKHDGRSWLRQRI D´UDGLFDOSODQQLQJµDSSURDFK )ULHGPDQQ  DLPHGWRHQKDQFHWKHDZDUHQHVVDQGWKH´YRLFHµFDSDELOLWLHV +LUVKPDQQ RQEHKDOI RI WKHIDUPHUV +3>+62#""H(<2=*(.+3>+6=(=-(>%1"26(#6=-.3P( L(.+"#=2$8(=-(=*+(=<-(>.+K2-%3(>-2$=?(2=(3++&3(>2K-=#"(=*+(>.+3+$6+(-/ (#(Q=*2.7R(#$7(-.8#$2S+7(3%1M+6=?(1+=<+L +$(>%1"26(#$7(>.2K#=+(3>*+.+?(Q#8+$=R(#$7("2K+$+.(-/ (#(3*#.+7(7+328$(>.-6+33?(3%2=#1"+(/-.(=*+(+&>-<+.&+$=( >.-6+33(&#$#8+&+$=?(1%=?(#=(=*+(3#&+(=2&+?(+T%2>>+7(+$-%8*(2$(723>-3#"(-/ (+U>+.=23+(/-.(/++72$8(=*+(>#.=2L 62>#=+7((#8.2L%.1#$(>#.J(36+$#.2-(7+328$(#6=2K2=2+3(#$7(=-(Q1.278+(=*+(8#>R(1+=<++$(>%1"26(#$7(>.2K#=+(#6=-.?( +U>+.=(#$7(-.72$#.H(J$-<"+78+'( 7KHDGRSWLRQRI VXFKHOHPHQWVVHHPVWREHQRWQHJOLJLEOHLQVWHHULQJWKHDJULFXOWXUDOSDUNSURÀOHQRWDVD IXUWKHU´FRPPDQGDQGFRQWUROµDGPLQLVWUDWLYHHQWLW\EXWÀUVWRI DOODVDWRRORI WHUULWRULDOJRYHUQDQFHIRU =*+(Q8.#33(.--=R(>.-&-=2-$(-/ (#$(+//+6=2K+(*+.2=#8+(+$*#$6+&+$=(>-"26H(@E2.#33#&H?(CDDCG?(1#3+7(-$($-=( =.#7#1"+(#$7(=.#$3/+.#1"+(=+..2=-.2#"(K#"%+3'(()*#=(<2=*(=*+(#2&(=-(>%.3%+(#$(+$7-8+$-%3(7+K+"->&+$=(>#=*( IRUWKHJHQHUDWLRQRI DYHULWDEOH´WHUULWRULDODGGHGYDOXHµ 'HPDWWHLV DQGWRKDPSHU´H[RJHQRXVµGHL K+"->&+$=(>.->-3#"3(#$7(>.-M+6=3(=*#=(32&>"H(QT%#..HR(K#"%+3(/.-&(>"#6+3(#$7("-6#"(3-62+=H(@V#""2$-?(CDWDG( #$7?(2$(7-2$8(3-?((<+#J+$(+$K2.-$&+$=#"(#$7(3-62-(+6-$-&26(.+32"2+$6+(-/ (=*+(=+..2=-.2#"(3H3=+&(#3(<+""F' F( 0$7+.( =*23( >-2$=( -/ ( K2+<( 6-%"7( 1+( 2$=+.+3=2$8( 6-&>#.+( =*+( M%3( .+6#""+7( ( >.-M+6=( /-.( =*+( &%"=2/%$6=2-$#"( !#.6-( N8.26-"-(7+""#(!2#$#(X"-.+$6+L!.#=-(#$7(=*+(T%-=+7(#7M%3=&+$=(>.-M+6=(-/ (=*+(X"-.+$6+(52=H(#2.>-.=?(>"#6+7(M%3=( 2$(=*+(<+3=(-%=3J2.=(-/ (X"-.+$6+(#$7?(#=("+#3=(2$(-$+(-/ (=*+(3-"%=2-$3(/-.+6#3=+7(?(+$6-&>#332$8(>#.=(-/ (=*+((#8.2(L( +$K2.-$&+$=#"(#.+#(-/ (=*+(/%=%.+(>#.J'


!"#$%&'()*+(,-%.$#"(-/ (0.1#$23&(4(5-$/+.+$6+(!.-6++72$83


!"#$%&'()*+(,-%.$#"(-/ (0.1#$23&(4(5-$/+.+$6+(!.-6++72$83


!"#"$%&!'$()*'+,)&-&!'$()*'+,)&./0&1"#"$% 2',)'%%"&34"5'5" 6/$.,0,$*,&20/*,,("$%) 71/0,$*,8&7,409'0:-;9$,&<=>< !"#$%&'()*+(,-%.$#"(-/ (0.1#$23&4($'(564(7-"'5859:; <<<'="#$%&'$+>(?(@AAB(:65;C9DD; !.-E++F2$G3(=%1"23*+F(2$(HE>-1+.(59:;

?04'$&!'$()*'+,&@,#,1/+A,$5& '$(&B90'1&70"$%,)&"$&@,1C"&& I"#%F2#(J-3+""2(


7KH SDSHU LQWHQGV WR IRFXV RQ WKH FRQWHPSRUDU\ UHDOLW\ RI  SHULXUEDQ DQG UXUDO IULQJHV RI  'HOKL ,QGLD·V FDSLC >#"( E2>L'( !#.>2E%"#."L( 2>( #$#"L3+( >*+( *-%32$G( #"-$G( >*+( M#&%$#4( <*2E*( E#$( 1+( 3++$( #3( #( $+><-.N( -/ ( ( +E-CE-..2F-.3( #$F( %$E%">27#>+F( #.+#34( *-3>2$G( O-$+3( -/ ( >*2.F( "#$F3E#=+'( )*+( 2$-.G#$2E( G.-<>*( -/ ( >*+( &+>.-=-"23( *#3( E#%C 3+F( >*+( 12.>*( #$F( >*+( F+7+"-=&+$>( -/ ( >+..2>-.2+3( >*#>( *#7+( G27+$( .23+( >-( #">+.$#>27+( =.#E>2E+3( -/ ( 3>+<#.F3*2='(( 7KHSHUPDQHQFHRI DJULFXOWXUDOSUDFWLFHVLQWKHVHVSHFLÃ&#x20AC;FDUHDVDUHQDWXUDOFRQWLQXDWLRQVRI WKHFODVVLFDOEHKDYLRXUV >*+(@$F2#$(E%">%.#"(>.#F2>2-$(#$F(2>3(3+>>"+&+$>3(E-$323>(-/ (#(*23>-.L(-/ (.%.#"(F+7+"-=&+$>(#$F(#$(+E-$-&L(1#3+F(-$( /#.&2$G(72""#G+3(#$F(-$(#G.2E%">%.#"(&+&-.2+3'(@$(>*+3+(=+.2C%.1#$(O-$+34(1+><++$(>*+(E-%$>.L32F+(#$F(>*+(E2>L4(>*23( $+<(N2$F(-/ (+$E-%$>+.(G+$+.#>+3(#($+<(*L1.2F2O#>2-$(-/ (#.E*2>+E>%.+4(3=#E+3(#$F($#>%.#"(3L3>+&3'



<$(=*+("#3=(>+#.?(=*+(%.1#$(7+@+"-A&+$=(-/ (=*+(<$72#$(62=2+3(*#3(=#B+$(#(72.+6=2-$(72//+.+$=(/.-&(=*#=(-/ (#""( -=*+.(A#.=3(-/ (=*+(C-."7'()*23(.+/+.3(=-(=*+(D%+3=2-$(-/ (%.1#$("#$736#A+($+8-=2#=2-$E(2$(=+.&3(-/ (6%"=%.+(#$7( 3-62#"2=>(#$7(2$(=+.&3(-/ (-.8#$2F#=2-$(#$7(-66%A#=2-$#"(/-.&3(-/ (=*+(=+..2=-.2+3' )*+(A*+$-&+$-$(23(.+"+@#$=(#$7(#6=%#"(6-$6+.$2$8(*23(6#.+(-/ (=*+(%.1#$(3*#A2$8(#$7(-/ (=*+(2&#82$#=2-$( /-.(=*+(/%=%.+(7+@+"-A&+$=(-/ (=*+(8"-1#"(62=2+3'(52=2F+$3?(2$(%.1#$(<$72#(=-7#>?(#.+(2$(=*+(&273=(-/ (#(A+6%"2#.( 6%"=%.#"(&-&+$=(6#%3+7(#"3-(1>(=*+("21+.#=2-$(-/ (=*+(+6-$-&>(#=(=*+((1+82$$2$8(-/ (=*+(G:H3' )*23(*#3(6.+#=+7(&%"=2A"+(@232-$3(-/ ("2/+(1>(*+28*=+$2$8(=*+(72@27+(1+=C++$(.26*(#$7(A--.?(1+=C++$(%.1#$(#$7( UXUDO)RUWKHÃ&#x20AC;UVWWLPH,QGLDQVVWDUWHGWRKDYHDFFHVVWRJOREDOPDUNHWVDQGDVDFRQVHTXHQFHZHUHRIIHUHG #(6"+#.(A+.6+A=2-$(-/ (=*+(72//+.+$6+3(1+=C++$(6%"=%.+3(#$7(1+=C++$("2@2$8(3=>"+3' )*+(C-."7H3(6%..+$=(=+$7+$6>(23(=-C#.73(3%3=#2$#12"2=>(#$7(+6-"-8>?(.+/+..2$8(=-(.%.#"(#$7((%.1#$(1-%$7#.2+3'( )*23(=+$7+$6>(#2&3(=-(82@+(#($+C(3=#.=(=-(=*+(3>3=+&(-/ (%.1#$I#8.26%"=%.+?((&#B2$8(&-.+(.+#"23#1"+(=*+(A-3I 3212"2=>(=-(1%2"7(3%3=#2$#1"+(3>3=+&3(2$(=*+(.232$8(A#.=3(-/ (=*+(62=>'( 5HJDUGLQJWKHVSHFLÃ&#x20AC;FFDVHRI ,QGLDLQ0DUFKLQ0XPEDLWKHUHZDVDV\PSRVLXPRUJDQL]HGE\&RI "%&12#( 0$2@+.32=>(+$=2="+7(J0.1#$( <$72#( K:L:M( *23=-.>?( =+6*$-"-8>( #$7( 6-&&%$2=>( /-.( 3%3=#2$#1"+( %.1#$( /%=%.+3NO'XULQJWKHPXOWLSOHFRQIHUHQFHVPDQ\SDSHUVZHUHSUHVHQWHGZLWKWKHJHQHUDODLPWRÃ&#x20AC;QGDZD\ =-(.+6-$62"+(=*+(8--7(+//+6=3(-/ (8"-1#"2F#=2-$(C2=*(=*+(A.-A+.(%3+(-/ (=+6*$-"-8>(#$7(.+&#2$2$8(#"28$+7(C2=*( WKHKLVWRU\DQGKHULWDJHRI WKHFLWLHV7KHÃ&#x20AC;QDOJRDOZDVWRGHYHORSDV\VWHPIRUXUEDQVXVWDLQDELOLW\DQGWR #""+@2#=+(A-@+.=>' P&-$8(=*+($%&+.-%3(6-$=.21%=2-$3?(&>(2$=+.+3=(C#3(3A#.B+7(1>(=*+(2$=+.@+$=2-$3(=*#=(C+.+(A.-A-3+7(1>(=*+( O( Q-.+(2$/-.&#=2-$(.+8#.72$8(=*+(3A+#B+.3(#$7(=*+(3>&A-32%&(6#$(1+(/-%$7(*+.+


!"#$%&'()*+(,-%.$#"(-/ (0.1#$23&(4(5-$/+.+$6+(!.-6++72$83

<#$+"(-/ ((=>2?+"2*--73@(*23A-.B(#$7(A.#72A2-$'C()*+(#.8%&+$A3(<.+3+$A+7@(*#?+(7+?+"-<+7(A*+(A*+&+(.+"#A+7( A-(*-D(A*+(<-3321"+(.+#"2E#A2-$(-/ (#(128(#.6*2A+6A%.+@(6#$(1+(A*+(6#%3+(-/ (723<"#6+&+$A3(#$7(/-.6+7(.+&-?#"3( DQGOLQNHGWRLWDUHÁHFWLRQRQWKHJOREDOL]DWLRQLQLWVHOIWKDWZLWKLWVHFRQRPLFDOÁX[HVLVFKDQJLQJWKH "2?+"2*--7(3A.#A+82+3(-/ (A*+(%.1#$(.+327+$A3@(#6A2$8(#A(A*+(+$7@(A*+($+6+332AB(A-(2$?+$A($+D(F%+3A2-$3(.+"#A+7( A-(A*+(#66+33(-/ (A*+(3-62-G6%"A%.#"(27+$A2A2+3(-/ (A*+(<"#6+3' )*+("-$8GA+.&(8-#"(-/ (A*+3+(#.8%&+$A3(23(A-(7+?+"-<(#($+D(%.1#$(#<<.-#6*(2$A.-7%62$8(2$$-?#A2?+(6-$6+<A( -/ (7+328$(#$7(<-"262+3' )*+(F%+3A2-$(&-.+(*-A@("2$H+7(D2A*(A*+(I$72#$(62AB@(23(A*+(3#&+(/-.(72//+.+$A(#.+#3J(/.-&(A*+(+6-"-82+3(-/ ( HYHU\GD\DFWLRQWRWKHUHODWLRQVWKDWQHFHVVLWDWHFUHDWLYLW\WRÀQGQHZDQGLQWHUHVWLQJVROXWLRQVIRUWKHXUEDG $2AB@(#3(D+""(#3(A-(2$A+8.#A+(A.#72A2-$#"(*+.2A#8+(2$(A*+(6-.<%3(-/ (A*+(62AB(2$(#$(-.8#$26(#$7(.+3<+6A/%"(&#$$+.'( I$(K-"H#A#(/-.(+L#&<"+@(M&2A#?#(N*#AA#6*#.B#(.+<-.A+7(#(3+.2+3(-/ ((2$2A2#A2?+3(1#3+7(-$(A*+(%3+(-/ (#.A3(#$7( 6.#/A3(<.-7%6A3(#3(#(6*#$$+"(A-(<.-?27+(3%3A#2$#1"+(7+?+"-<&+$A(/-.(A*+("-6#"(.+82-$#"(6-&&%$2A2+3O(A*2$H2$8( A*#A(A*+(3%<<-.A(A-(A*+(.%.#"(2$7%3A.2+3(6#$(1+(#(D#B(A-(6-$A2$%+(A*+("2$H(1+AD++$(.%.#"(?2""#8+3(#$7(A*+(62AB'( $OVRLQ'HOKLGXULQJWKHFRORQLDOSHULRGDGLIIHUHQWDSSURDFKWRWKHXUEDQLW\ZDVEHJXQ,QWKLVYLHZWKH 62AB(D-%"7(1+(6"+#$(#$7(-.72$#A+@(&-72/B2$8(A*+(?232-$(-/ (A*+(<%1"26(3<#6+3@(A*#A(%$A2"(A*#A(<+.2-7(D#3(&-.+( 6-$$+6A+7( D2A*( A*+( .%.#"2AB@( #$7( D2A*( #""( A*#A( 2&<"2+3J( #8.26%"A%.+@( #$62+$A( H$-D"+78+( #$7( #.A3( #$7( 6.#/A3( <.-7%6A3(/.-&(A*+(?2""#8+3'().#72A2-$#"(+"+&+$A3(#.+($-A(#"D#B3(6-$327+.+7(#3(#($#A%.#"(<#.A(-/ (A*+(%.1#$( 2&#82$#.B("#$736#<+@(1%A(A*+B(#.+(7++<"B(6-$$+6A+7(D2A*(A*+(+6-"-8B(-/ (+?+.B7#B("2/+' P-(A*+(6-$3+F%+$A(6-$A.#3A(A-(A*+(6-$3A.%6A2-$(-/ (A*+(3*-<<2$8(&#""(#$7(A*+(3%1G%.1#$(.+327+$A2#"(6-&<"+L@( 23(A*#A(A*+(3%..-%$72$8(%.1#$(<%1"26(#.+#3(3*2/A(/.-&(A*+(<#3A(3<-$A#$+-%3(-66%<#A2-$3(-/ (A*+(A+..2A-.B'( Q+8#.72$8(A*+(6.#/A3&+$@(/-.(+L#&<"+@(A*+(6*#""+$8+(23(A-(6.+#A+(#(3<#6+(A-(<.-A+6A(A*+(.+"#A2-$3*2<(1+AD++$( 6.#/A3(#$7(A*+(<%1"26(%3+(-/ (A*+(A+..2A-.B@(#1"+(-/ ($-A(6-?+.(#$7(+.#3+(/.-&(A*+(%.1#$("#$736#<+(#"3-(A*+( ?23%#"(6-$263(-/ (A*+(.%.#"(-.282$3(#$7(-/ (A*+("-6#"(A.#72A2-$3'( $QRWKHUUHVHDUFKWKDWZDVGHYHORSHGVRPH\HDUVDJRIURPWKH&6+'HOKLVSHDNVWRWKH,QGLDQUHDOLW\ 7KLVUHVHDUFKFRPSDUHGDQGUHÁHFWHGXSRQWKHGLIIHUHQFHEHWZHHQ,QGLDDQG%UD]LOLWLVQDPHG6(783 !.-R+6AS'()*+(.+3+#.6*(/-6%3+7(-$(A*+(&#.82$#"2AB(#$7(A*+(+$6-%$A+.3(1+AD++$(/-.&#"(#$7(2$/-.&#"(#$7( 1+AD++$($#A%.+(#$7(*%&#$(%.1#$(#.A+/#6A3'( )-(1+(&-.+(<.+623+(A*+(<.-R+6A("--H+7(#A(A*+(6*#$8+3(A*#A(3-62#"(+L6"%32-$3(#$7(8"-1#"2E#A2-$(*#7(<.-7%G 6+7(2$(A*+(<--.(#.+#3'(IA("--H+7(#A(A*+(8+$+.#A+7(3<"2A(1+AD++$(%.1#$(.+#"2A2+3(#$7(A*+($+D($#36+$A(2$A+.G .+"#A2-$3*2<(1+AD++$(%.1#$(#$7(<+.2G%.1#$'()*+(.+3+#.6*(A+#&(D#3(72?27+7(2$(AD-J(A*+(3"%&(A+#&(#$7(A*+( IRUHVWWHDP7KHFRPSDUDWLYHDQDO\VLVLQVLGHWKHVOXPZDVFRQGXFWHGE\E\SHRSOHIURP'HOKLDQG0XPEDL /-.(I$72#(#$7(/.-&(P#-(!#%"-(/-.(N.#E2"'()*+(A+#&(D#$A+7(A-(%$7+.3A#$7(A*+(A+..2A-.2#"(&#AA+.3(#$7(A-(&#H+( *B<-A*+3+3(#1-%A(A*+($+D(<-"2A263(?#"27(2$(32&2"#.(6-$A+LA3'()*+(/-.+3A(A+#&(6-$6+$A.#A+7(-$(A*+(3A%7B(-/ ( P#-(!#%"-(#$7(T%&1#2@(-13+.?2$8(*-D(6+.A#2$(+6-"-826#"(&+#3%.+3(-/ (<.-A+6A2-$(#.+($+6+33#.B(A-(<.+3+.?+( A*+(12-72?+.32AB(.+3+.?+3(#"-$8(A*+(%.1#$(&+A#1-"23&'(U/ (6-%.3+(A*+(.+3+#.6*(-.8#$2E+7(2$(A*#A(D#B(D#3(#$( H[SHULPHQWWRÀQGDEHWWHUZD\WRSURFHHGLQWKLVSDUWLFXODUPRPHQWRI GLVSXWHEHWZHHQUXUDODQGXUEDQ &#.82$3'(( )RUWKHVSHFLÀFFDVHRI ,QGLDIURPWKHUHZDVDQHZSROLWLFLQLWLDWLYHWKDWFOHDUO\GHÀQHGWKH6(=WKH 3<+62#"(+6-$-&26(E-$+3@(/-.&#"2E2$8(2$(A*23(&#$$+.(A*+(2$#%8%.#A2-$(-/ (A*+3+($+D(#.+#3@(D*26*(2$6.+#3+7( A*+(A+$32-$(1+AD++$(E-$+3(-/ (A*+(62AB(#$7(A*+2.(%3#8+3' )*23(723<%A+@(-/ (6-%.3+@(23(<#.A(-/ (#(D27+.(6-$?+.3#A2-$(#1-%A(+$?2.-$&+$A#"(233%+3(#$7(-/ (3-62-(3<#A2#"( R%3A26+J(D*+.+(A*+(%.1#$(8.-%<(23(6"#2&2$8(A-(<.+3+.?+(A*+(8.++$(1+"A(#.-%$7(A*+(62AB(#$7(A*+(<--.(<+-<"+( #.+(#2&2$8(A*+((#66+33(A-(A*+(62AB' )*+B(D#$A(A*+(.28*A(A-("2?+@(A-(*#?+(#$(*-%3+(#$7(<.-A+6A(A*+2.("#$73(#$7(A*+2.(/.++(%3+'()*+(<.-1"+&3(A*#A( DUHSUHVHQWLQWKHVHERUGHUDUHDVHVSHFLDOO\LQLQIRUPDOVHWWOHPHQWVDUHFRPPRQLQ'HOKLDVLQ0XPEDLEXW #"3-(2$(#(&#$B(-A*+.3(8"-1#"(&+A.-<-"23+3'( S( )*+(.+3%"A3(-/ (A*+(<.-R+6A(6#$(1+(/-""-D+7(-$(A*+(D+132A+J((*AA<JVV3+A%<'63*G7+"*2'6-&V

!"#$%&'()*+(,-%.$#"(-/ (0.1#$23&(4(5-$/+.+$6+(!.-6++72$83


!"#$%&'"(#%)* ,Q'HOKLWKLVFRQWURYHUVLDOSKHQRPHQRQRYHUWKHXVHDQGRI WKHDSSURSULDWLRQRI VSDFHKDVEHFDPHVWURQ< JHULQWKHODVW\HDUV7KLVPLJKWEHGXHWRWKHXUEDQPRGLÀFDWLRQWKDWWKHFLW\ZDVREOLJHGWRVXSSRUWIRU =*+(5-&&-$>+#"=*(?#&+3'()*23(*#3(#%8&+$=+7(=*+(@+6%"2#.2=A(-/ (/.#8&+$=#=2-$(#".+#7A(=A@26#"(-/ (=*23(62=A'( 'HOKLZDVIRUPHGRI DPHUJHURI FRQWLJXRXVYLOODJHVDQGVWLOOWRGD\DELJSDUWRI WKHFLW\LVRFFXSLHGE\D >27+(>2"7(/-.+3=B(8.++$(@#.C(#$7(8#.7+$3(=*#=(#.+(&2D+7(>2=*(*-%32$8(+$6"#E+(#$7(6-"-$2+3' 'HOKLKDVRQHRI WKHELJJHVWRUQLWKRORJLFDOUHVHUYHH[LVWLQJLQWKHZRUOG 2QHRI 'HOKL·VPRVWXQLTXHWUDLWVLVWKHSHFXOLDUFRQÀJXUDWLRQWKDWFKDUDFWHUL]HVLWVVKDSHDQXQSUHGLFWDEOH DOWHUQDWLRQRI DUFKLWHFWXUHJUHHQVSDFHVFRPPXQLFDWLRQ·VFKDQQHOVÁ\RYHUVVWUHHWVDQGQHZQHLJKERXUKR< RGVJURZQXSRQO\IRUUHVLGHQWLDOSXUSRVH7KHSDWFKZRUNRI XUEDQODQJXDJHJHQHUDWHVDQXQGHÀQHGXUEDQ "#$736#@+'()*23(23(/+7(1A(=*+(2&#82$#.2+3(-/ (=*+($+>(.26*B(=*#=(#.+(6-&@"+=+"A(2$(-@@-32=2-$(>2=*(=*+(.+#"2=A( =*#=(23(#">#A3(3=.-$8"A(6-$$+6=+7(>2=*(=*+(@#3=(-/ (=*+(6-%$=.A'(F2=%#=2-$3(8+$+.#=+7(/.-&(=*+(#13+$6+(-/ ( 3+$32=2E+(6.2=+.2#(#.+($-=(#1"+(=-(3%88+3=(3-"%=2-$3(=-(@.-&-=+(#(3%3=#2$#1"+(7+E+"-@&+$=' 'HOKLQHHGVDZHOOSODQQHGVROXWLRQVDEOHWRIRUHVHHIRULWVFRPSOHWHWHUULWRU\DFRPSOH[V\VWHPRI QHZ 3@#6+3(#$7($+>(27+#3(#2&+7(=-(2$6"%7+(#.6*2=+6=%.+(2$(=*+(>27+.(E232-$(-/ (3%3=#2$#1"+(7+E+"-@&+$=(#$7(#"3-( =-(2$6"%7+(2$=+""28+$=(*A@-=*+323(#2&+7(=-(6.+#=+(#(3@#6+(/-.(72#"-8%+(#$7(+$6-%$=+.(/-.(=*+(2$*#12=#$=3'( )*+(62=A(23(/-.&+7(/.-&(3+E+.#"("#$8%#8+3(#$7(#.6*2=+6=%.+3G(/.-&(=*+(H-8%"(.%2$3B(=-(=*+(I.2=23*(6-"-$2#"( VW\OHWLOOWRWKHDUULYDOWRWKHFRQWHPSRUDU\H[SUHVVLRQRI WKHVKRSSLQJPDOODQGRI WKHQHZHGLÀFDWLRQV =*#=(#@@+#.3(#3(#(128(&#33(-/ ((1%2"72$83(>2=*-%=(#$A("-826(-/ (#+3=*+=26'( )*+(@--.(@+-@"+(6#$(1+(3++$(#3(#$2&#"3G("2C+(7-83(=*+A(3@+$7(=*+2.($28*=3(3"++@2$8(#"-$8(=*+(.-#73B(-=*+.3( WDNHUHVWLQWKHLUULFNVKDZVRURQWKHEHQFKRI WKHLUPRELOHVKRS'XULQJWKHGD\WKH\DUHDVIDVWDQGODER< ULRXVDVDQWVRUVTXLUUHOV7KHFRQWHQWRI WKHLUHPRWLRQVWKHVLJQVRQWKHLUIDFHVDQGWKHREMHFWVWKDWGHÀQH =*+2.("2E+3B(#.+(6-&@"+=+"A(#"2+$(/.-&(=*+(&#=+.2#"(=*#=(6-&@-3+3(=*+(3-%"(-/ (=*+($+>(&277"+(6"#33(2$*#12=#$=3( -/ (=-7#AJ3(62=A'( )*+(E23%#"(6"#3*(23(#"3-(+E27+$=G(1+=>++$(=*+(&+=#"(-/ (=*+(&+=.-(3=#=2-$(#$7(=*+(>--7(-/ (=*+(NRRFDK(=*#=( 3-&+=2&+(#.+(2$3=#""+7(2$(=*+(+$=.#$6+(-/ (=*+(&+=.-'( )*+(*%8+(#7E+.=23+&+$=3(-/ (L-8%+(=*#=("--&(-E+.(=*+(3"%&3(#.+(#(6-$=.#3=2$8(E23%#"(+"+&+$=G(=+3=(-/ (=*+( #13+$6+(-/ (6#.+(2$(=*+(3A3=+&3(-/ (@"#$$2$8B(#"3-(2$(=*+(3&#""(#.+#'(M-(#==+$=2-$(/-.(=*+(72//+.+$=($++73(-/ ( =*+(3-62#"(8.-%@3'(H-E2$8(>2=*2$(=*+(72E+.3+(#.+#3(-/ (=*+(62=AB(=*+(/.#8&+$=+7(1-7A(1+6-&+3(E2321"+' N=( 23( "2C+( #( =+..2=-.A( >*+.+( =*2$83B( @+-@"+( #$7( #.6*2=+6=%.+( #.+( &+.8+7( =-8+=*+.( >2=*-%=( #$A( =*-%8*=( =-( =*+2.( $+6+332=2+3( #$7( @.2-.2=2+3B( =*+( 3@#6+( #$7( =*+( 27+#3( -/ ( %.1#$( #+3=*+< =26( >#3( +#=+$( 1A( =*+( @->+./%"( +6-$-&26( +"2=+3B( =*#=( #.+( 8.->2$8( 2$( =*+( 3-62#"( #$7( 6%"=%.#"( 3A3=+&'( 2QHRI WKHPRUHLPSRUWDQWLVVXHVIRU'HOKLLVFRQVHTXHQWO\WRLWLWVJUHHQFRXQWHUSDUWDQLGHQWLW\WKDWFDQ 1+(=*+("2/+"2$+(-/ (2=3(3%3=#2$#1"+(/%=%.+(2$(=+.&3(-/ (6-$=+$=2-$(1+=>++$(%.1#$(#$7(.%.#"(233%+3'

+#)"',()%-"&.'(/)%/"0&12 &0)"3('40$%. )*+( >-.7( O3=+>#.73*2@P( 6-&+3( /.-&( =*+( =+.&( 3=+>#.7B( &+#$2$8( =-( =#C+( 6#.+( -/ ( =*+( 72$$+.( #$7( -/ ( =*+( RWKHU GRPHVWLF DIIDLUV RI  WKH KRXVHKROG :LWK WKH SDVVLQJ RI  WLPH WKH VWHZDUG KDV EHFRPH WKH ÀJXUH >*-(=#C+3(6#.+(-/ (=*+(@#33+$8+.3(-$(=*+(#2.(@"#$+B(2$(=*+(=.#2$(-.(2$(=*+(3*2@'(N$(8+$+.#"B(#(3=+>#.7(23(3-< &+-$+(>*-(6#.+3(/-.(=*+(#//#2.3(-/ (-=*+.3B(#33%&2$8(=*+(.+3@-$3212"2=A(#$7(=*+(#==+$=2-$(-/ (=*+2.(=*2$83'( )*23(3@"2=(1+=>++$(6-&@#6=(%.1#$(Q-$+3B(128(8.++$(@#.C3B(#8.26%"=%.#"(#.+#3(#$7(#1#$7-$+7("#$736#@+3(*#E+( @+.&2==+7(=*+(12.=*(#$7(=*+(8.->=*(-/ ((#"=+.$#=2E+3(@.#6=26+3(-/ (3=+>#.73*2@' N=(*#3(@.-"-$8+7(=*+(@+.&#$+$6+(-/ (#8.26%"=%.#"(1+*#E2-%.3($+6+33#.A(=-(/-.(3%.E2E#"(-/ (=*+(6%"=%.#"(#$7( 3+=="+&+$=(=.#72=2-$(=*#=(23(&#7+(1A(=*+(*23=-.A(-/ (.%.#"(7+E+"-@&+$=(#$7(/.-&(#$(+6-$-&2+3(&#7+(1A(E2"< "#8+3(#$7(#8.26%"=%.#"(&+&-.2+3'( )*+(@.#6=26+(-/ (3=+>#.73*2@(6#$(1+(3@-$=#$+-%3B($-=(3%1R+6=+7(=-(#$A(.+8%"#=2-$3(#$7(3-&+=2&+3(#66-&@#< $2+7(1A(=*+(.+#"2=A(-/ (+6-<6-..27-.3'()*+(+6-<6-..27-.3(#.+(+D23=+$=(2$(2=3+"/B("2C+(#(@#.=(-/ (=*+(3*#@+(#$7(-/ ( K( (N$/-.&#"(3*-@(-$(>*++"3(


!"#$%&'()*+(,-%.$#"(-/ (0.1#$23&(4(5-$/+.+$6+(!.-6++72$83

WKHQDWXUHRI WKHFLW\EXWLQVDPHFDVHVWKH\FDQEHDOVRSURMHFWHGVSHFLÃ&#x20AC;FDOO\IRUWKHZHOOQHVVRI WKHFLW\ <$(=*+(3+6-$7(6#3+(#.+(3=.#=+82+3(7+328$+7(=-(>+.&2=(=-(=*+(?2"7("2/+(=-("2@+(2$(2=3+"/A(6.+#=2$8(1%11"+3(-/ ( $#=%.+A(#(>#33#8+(1+=?++$(=*+(%.1#$(?-."7(=-(=*+($#=%.#"(-$+'((<$(+#6*(6#3+(#($+?(3B3=+&(23(=+3=+7C(/-.(7+D &-$3=.#=+(*-?(%.1#$2=B(6#$(7+@+"->(#($+?(?#B(-/ (1+2$8A(*-3=2$8(2$327+(2=3(1-7B(#"3-(=*+(.%.#"(+"+&+$=3' 7KHRXWORRNIRU'HOKLLWVHHPVJRRG7KHUHDUHPDQ\SURVSHFWVDQGSRVVLELOLWLHVWRHPERG\WKHQHZK\EULD 72E#=2-$(#&-$8(=*+(8"-1#"(&+=.->-"23(#$7(=*+($+?(8.++$(%=->26(62=B(/-.(=*+(=*2.7(&2""+$$2%&'

!"#$%"&'"%()&*%&+,-.* 5-$327+.2$8(=*+(>.#6=26+(-/ (VWHZDUGVKLS(#$7(=*+(HFRFRUULGRUVLQ'HOKLLWLVLQWHUHVWLQJDQDO\VHWKHEDQNVVLGH -/ (=*+(F#&%$#'(( G"-$8(=*+(.2@+.(7%.2$8(=*+("#3=(B+#.3A(&#$B(+@+$=3(*#@+(*#>>+$A(2$6"%72$8(@2-"+$=(.+&-@#"3(=-(1%2"7(#($+?( $+28*1-%.*--7(/-.(#=*"+=+3(/-.(=*+(5-&&-$?+#"=*(H#&+3A(#(6-$3=.%6=2-$(-/ (12-72@+.32=B(>#.IA(#$7(3+@+D .#"(->+$(7236%332-$3(#1-%=(=*+(/%=%.+(-/ (=*+(J#K$%(L#()2"#(6-"-$B'((<=(23(#()21+=#$(5-"-$BA(=*#=("2+3(-$(=*+( F#&%$#(1#$IC((/.-&("-$8(=2&+(=*+.+(#.+(#(.%&-%.3(=*#=(?2""("2I+"B(1+(7+3=.-B+7(/-""-?2$8(=*+(J#3=+.(!"#$( >.+@232-$3(=-(1%2"7(#($+?(%.1#$(+M>#$32-$3'( 2QLQFRPPHPRUDWLRQRI (DUWK'D\DQDVVRFLDWLRQFDOOHG'HOKL*UHHQVRUJDQL]HGDQ8UEDQ(FRWRXU( WRUHFRQQHFWWKHFLWL]HQVZLWKWKHFLW\·VQDWXUDODUHDV7KHLQLWLDWLYHZDVSODQQHGLQSDUWQHUVKLSZLWK'HOKL 1#3+7(+$@2.-$&+$=#"(8.-%>3(#$7(?2=*(#("-6#"(#33-62#=2-$(=*#=(6#.+3(/-.(3=.++=(6*2"7.+$(#$7(=++$#8+.3'


'HOKL*UHHQVRUJDQL]HGWKH8UEDQ(FRWRXUDORQJWKH<DPXQDULYHUDQGWKHULGJHRI 'HOKLERWKFRQVWLWXWLRD $#"(+"+&+$=3(-/ (=*+($#=%.#"(#3>+6=(-/ (=*+(62=B' 7KHULYHUDQGFLW\·VJUHHQFRUULGRUV ZLOGRUWDPHG DUHVLJQLÃ&#x20AC;FDQWHOHPHQWVIRU'HOKLDQGUHSUHVHQWDQLQD 6.+721"+(+$6-%$=+.(/-.(=*+(12-"-826#"(/%=%.+(%.1#$(=.#$3/-.&#=2-$'((O%&#$3A(#$2&#"3(#$7(#(@#.2+=B(-/ (>"#$=3( 6-+M23=(2$(=*+3+(12-"-826#"(E-$+3A(7+@+"->2$8(#$(2$6.+721"+(>-=+$=2#"2=B'( )*+((FRWRXUZDVRUJDQL]HGRQEXVVWDUWLQJIURPWKH'HOKL8QLYHUVLW\KHDGHGWRWKHEDQNRI WKHULYHUDQGWKH /#&-%3(1#..2+.(-/ (P#E2.#1#7'(<=(3=->>+7($+#.(=*+(!-$=--$(Q.278+A("-6#=+7(@+.B(6"-3+(=-(=*+()21+=#$(R%#.=+.( -/ (J#K$%(L#()2"#'()*+(3+6-$7(>#.=(-/ (=*+(7#BA(=*+(1%3(#66-&>#$2+7(=*+(8.-%>(=-(=*+(.278+(-/ ((L#&#"#( S+*.%A(#(128(/-.+3=(2$(=*+($-.=*+.$(>#.=(-/ (=*+(62=B'()*+(%.1#$("#$736#>+(#"-$8(=*+(F#&%$#(1#$I3(23(%$2R%+( /-.(&#$B(.+#3-$3'()*+(.2@+.(23(-$+(-/ (=*+(&-3=(2&>-.=#$=(723=2$8%23*2$8(+"+&+$=3(-/ (=*+(62=B(#$7(#"3-(#( VLJQLÃ&#x20AC;FDQWFXOWXUDODQGVSLULWXDOV\PEROLFDOHOHPHQW7KHUHLVQRWHQRXJKVSDFHKHUHWRWUHDWWKHVDFUHGYDOXH -/ (=*+(?#=+.(/-.(=*+(<$72#$(>->%"#=2-$(1%=(-/ (6-%.3+(?+(6#$(3#B(8+$+.#""B(=*#=(?#=+.(23(-$+(-/ (=*+(&-.+( 2&>-.=#$=(+"+&+$=3(/-.(=*+(<$72#$(3>2.2=%#"2=B' 7KH<DPXQDKDVDTXRWLGLDQSUHVHQFHLQWKHOLYHVRI WKHFLWL]HQVWKH\SHUIRUPULWXDOVDQGSUD\HUVSXULÃ&#x20AC;FDD =2-$(#$7(+@+.B7#B(#6=2-$3("2$I+7(?2=*(=*+(%3#8+(-/ (=*+(?#=+.'

!"#$%&'()*+(,-%.$#"(-/ (0.1#$23&(4(5-$/+.+$6+(!.-6++72$83


,W·V QHFHVVDU\ KHUH WR PDNH D UHÁHFWLRQ RQ WKH ULYHU LQ LWV VHOI  DQG LQ KLV WRGD\ HFRORJLFDO VWDWXV( <#&%$#(2=(23(6#""+7(=*+(7+#7(.2>+.(1+6#%3+(23(3++&2$8"?($-("2/+(2$(2=3+"/@(A.-1#1"?(1+6#%3+(=*+.+(23($-(-B?8+$' C$(D#?(EFGE@(=*+(H2$7%3=#$()2&+3@(A%1"23*+7(#$(#.=26"+(+BA"#2$2$8(=*#=(#2.I6-$72=2-$2$8(3?3=+&3(-/ (&+=.-( =.#2$3(#$7(-/ (=*+(A.2>#=+(*-&+3(2$(=*+($-.=*+.$(A#.=(-/ (=*+(62=?:@(*#7(1++$(#//+6=+7(1?(=*+(=-B26(8#3+3(+&2=I WHGE\WKHULYHU7KLVGDPDJHZDVFDXVHGE\DVLJQLÀFDQWORRVHRI SROOXWHGPDWHULDOIURPWKH6KDKGDUDGUDLQ #//+6=2$8(J5(3?3=+&3@(.+/.28+.#=-.3@(6--"+.3@(8-"7(#$7(32">+.(K+L+".?(#$7(6#.3'(M++7"+33(=-(3#?@(=*23(A-""%=2-$( 23(#"3-(+B=.+&+"?(*#.&/%"(=-(*%&#$3' 5DZL$JDUZDO7LOO.UDXVH1LQD.DOHQEDFKFXUDWHGDQDUWSURMHFWLQ'HOKLDQGLQ+DPEXUJ,WZDVDQLQLWLDI WLYHWREULQJDWWHQWLRQWRWKLVÁXYLDOSDUWRI WKHFLW\DQDUWLVWLFZRUNGHVLJQHGWRWKH<DPXQDDQGWKH(OED N2>+.'((()*+(<#&%$#(.2>+.(L#3(-$6+("-$8(#$7(A-L+./%"@(+B=+$72$8(-$(=*-%3#$7(O2"-&+=+.3(/.-&(=*+(!#""#( YLOODJHWR%DGDUSXU,WSDVVHGWKURXJKWKHFLW\RI 'HOKLIRUPDQ\NLORPHWHUV%HIRUHDUULYLQJWRWKHEDUUDJH RI :D]LUDEDGDORQJWKHEDQNVLWSDVVHVWKURXJKPDQ\YLOODJHVDQGFXOWLYDWHGÀHOGVWLOOWKHSODFHZKHUHWKH LQKDELWDQWVRI 'HOKLUHFHLYHGWKHLUGULQNLQJZDWHU J/=+.(=*#=(A-2$=(=*+(.2>+.(=.#$3/-.&3(7.#3=26#""?@(1+6-&2$8(6-&A"+=+"?(A-""%=+7(#$7(7#$8+.-%3(=-(=*+(*%&#$( A+-A"+(L*-("2>+($+#.'()*+(=*-%8*=3(=-(=*+(8#.7+$(#"-$8(=*+(.2>+.@(2$(=*+()21+=#$(6-"-$?@(#.+(8+$+.#=-.3(-/ ( #$(2&A-.=#$=(P%+3=2-$Q(L*#=(=*+(A+-A"+(6#$(.+#""?(.+6+2>+(2$(=+.&3(-/ ($%=.2+$=3(/.-&(=*+(>+8+=#1"+3(8.-L$( 2$(=*23(3+L#8+(7%&A' )*+("#3=(#.=23=26(+>+$=(-.8#$2R+7(2$(C$72#(#$7(2$(S+.&#$?@(2$>-">2$8(S+.&#$(#$7(C$72#$(#.=23=3@(L#3(#$(2$2=2#I =2>+((=-(3*-L(=*+($#=%.#"(A-=+$=2#"(-/ (=*#=(A"#6+3(=*.-%8*(#.=23=26(A2+6+3(2$=+."#6+7(L2=*(=*+(27+#(-/ (+6-"-8?9 )*+(A.-K+6=(L#3(=-=#""?(&#7+((#6.-33(=*+(%3+(-/ (3-"#.(+$+.8?(#$7(T6-I/.2+$7"?(/%+"(#$7(#""(=*+(&#=+.2#"(%3+7( 1?(=*+(#.=23=3@(L+.+(.+6?6"+7' 7KHSUHVVLQJTXHVWLRQRI WRGD\LVKRZWRLPSURYHWKHULYHUDQGNHHSÁRRGVSODLQVWKDWHPEDQNDQGWKHULYHU 6"+#$'(C=(23($+6+33#.?(=-(+7%6#=+(#=((=*+(+6-"-8?@(=*+(+?+3(-/ (C$72#$3' $IWHUWKHZRUNVVWRUPSRVW&RPPRQZHDOWK*DPHVWKHFLW\LVLQDUHÁH[LYHPRRGWU\LQJWRGHYHORSDJRRG 3-"%=2-$(=-(.+2$>28-.#=+(*+.(3=.-$8(.+"#=2-$(L2=*($#=%.+'(U(/.-&(#"L#?3(2$327+(=*+(&-"7(-/ (=*23(%$2P%+(62=?V' W2O+(N#>2(J8#.L#"(L.-=+Q((7KHLGHDRI HTXLW\DQGGHPRFUDF\DUHGHHSO\LQWHUODFHGZLWKWKHLGHDRI HFRORJ\7KLVLVWUXH ZKHWKHUZHVSHDNRI ZDVWHIRUHVWGHVWUXFWLRQDQGULYHUV'(UJ8#.L#"@(EFGGV

!"#$%&'(#)$*+,%$,-)%(#./(.#,-)#0(&1&,%2 )*23(#.=(A.-K+6=(-$(=*+(.2>+.(.+&2$73(=-(=*+(62=?(*-L(2=(23(1+6-&2$8(2$6.+#32$8"?(&-.+(%.8+$=(=-(.+6-$62"+( #.6*2=+6=%.+@($#=%.#"(3?3=+&(#$7(%.1#$(2&#82$#=2-$(=-(A.-A-3+(#($+L(#$3L+.(/-.(2=3(/%=%.+' 5-$327+.2$8( =*#=( 2=( 23( 2$6.+#32$8"?( &-.+( 2&A-.=#$=( =-( A.+>+$=( =*+( L2"7( %.1#$2R#=2-$@( =*#=( 6-$3=#$="?( +#=3( A2+6+3(-/ ("#$736#A+@($-=(=#O2$8(2$(6-$327+.#=2-$(=*+(.26*$+33(-/ (*%&#$(6-&A"+B2=?' )*+(A-=+$=2#"(-/ (#($+L(6-$6+A=(-/ (#(12-I-.8#$26(62=?(-.(12-I"-826(62=?(23(%$7+.+3=2&#=+7@($-=($-=2$8@(.+#""?@( =*+(*-&-8+$-%3(36*+&+(L*+.+(*%&#$@(#$2&#"3(#$7(#""(=*+(-=*+.("2>2$8(+"+&+$=3(+B23=(2$(-$+((1.+#=*2$8( 3?3=+&(L2=*(=*+(#.6*2=+6=%.+(#$7(=*+(&#332>+(2$/.#3=.%6=%.+(-/ (6-&&%$26#=2-$' 5HIHUULQJWRWKHSDUWLFXODUFDVHRI 'HOKLLWLVHYLGHQWWKDWQHZÁ\RYHUVWKHPHWURDQGWKHF\FOLQJSDWKVH[LVW L2=*-%=(#$?(A*?326#"@(3+$32=2>+(.+"#=2-$3*2A(L2=*(=*+(8.++$(R-$+3(-.(L2=*(=*+($+L(%.1#$2R+7(+$6"#>+3(=*#=(#.+( 1%2"7%A(.+6+$="?'()*+?(#"3-(28$-.+(=*+(*23=-.26#"(27+$=2=?(-/ (=*+(62=?' C=( 23( $+6+33#.?( =-( .+&+&1+.( =*+( =+#6*2$83( -/ ( !#=.26O( S+77+3( #$7( =-( 2$6-.A-.#=+( =*+( 2&A-.=#$6+( -/ ( *23( UHVSHFWIRUWKHHFRORJ\/RRNLQJWRZDUGVWKHIXWXUHRI 'HOKLWRGD\WKHJUHHQNQRZOHGJHPXVWDSSOLHGWR 7+>+"-A($+L(3A#6+3(/-.(=*+(12-I-.8#$26(8.-L=*(-/ (=*+(62=?' J/=+.(=*+(128(6.2323(#$7(=*+(#.6*2=+6=%.#"(/#2"%.+(=*#=(/-""-L+7(=*+(.+#"2R#=2-$(-/ (=*+(5-&&-$L+#"=*(S#&+3@( =*+(62=?(23(=-7#?(.+#7?(=-(7+>+"-A($+L(27+#3(#$7($+L(A.-K+6=3(2$(#(&-.+(3%3=#2$#1"+(&#$$+.@(K%3=(3=#.=2$8( /.-&(*+.(+B23=2$8(3=#=%3'( :( (C$(=*+($+28*1-%.*--7(-/ ((D#?%.(X2*#.@(X#3%$7*#.#(T$6"#>+(#$7(M-27#' 9( )-(7++A+$(=*+(2$/-.&#=2-$3Q(*==AQYY?#&%$#I+"1+'-.8Y.2>+.I62=?Y


!"#$%&'()*+(,-%.$#"(-/ (0.1#$23&(4(5-$/+.+$6+(!.-6++72$83


!"#"$"%&"' A8#.B#"(C'D(E(FGHH(I(<DPXQD(OEHFRQWHPSRUDU\ÁRZVÁXLGVWLPH'(E(#$(#.;D(+6-"-8@(#$7(362+$6+(3+&2$#.(;-(.+J 2&#82$+(6-&&-$(8"-1#"(K%+3;2-$3(6-$/.-$;2$8(.2L+.3(ID((.+M-.;(#L#2"#1"+(-$"2$+((( A8#.B#"(C'D(E(FGHH(I(7KH<DPXQD8QFHUWDLQ5LYHUD((.+M-.;(#L#2"#1"+(-$"2$+((((( $URUD5DQG5DMSXW9  *DVHVGDPDJHG$&VLQQHDUE\DUHDV+LQGXVWDQ7LPHV1HZ'HOKL1RLGD =#@(ND(FGHF((((((((((((( O#;-%6*+(P'DEFGHHI(/DFULVLGHOODFLWWjVHFRQGR6HUJH/DWRXFKHD(3%&&#.@(/.-&(;*+(;+Q;(-/ (;*+(6-$/+.+$6+D(R)*+( #.6*2;+6;%.+(-/ (#(B+""(;+&M+.+7(+$L2.-$&+$;S(1@(P+.8+(O#;-%6*+D(-$(HTJFG(=#@(FGHH( U"2L+#%(P'D(E(FGG9(I(3HULXUEDQLVDWLRQLQ7DPLO1DGXDTXDQWLWDWLYHDSSURDFK3XEOLFDWLRQRI WKH)UHQFK5HVHDUFK,QVWL )$)&*D(#L#2"#1"+(-$"2$+

!"#$%&'()*+(,-%.$#"(-/ (0.1#$23&(4(5-$/+.+$6+(!.-6++72$83


!"#"$%&!'$()*'+,)&-&!'$()*'+,)&./0&1"#"$% 2',)'%%"&34"5'5" 6/$.,0,$*,&20/*,,("$%) 71/0,$*,8&7,409'0:-;9$,&<=>< !"#$%&'()*+(,-%.$#"(-/ (0.1#$23&4($'(564(7-"'5859:; <<<'="#$%&'$+>(?(@AAB(:65;C9DD; !.-E++F2$G3(=%1"23*+F(2$(HE>-1+.(59:;

6RPH5HÁHFWLRQVRQWKH5HODWLRQVKLS 4,5?,,$&2,/+1,&/. &5@,&7/905,,$5@&6,$590:8& 6"5:&'$(&A,00"5/0:& I$>-$+""#(!2.#3

8QLYHUVLWjGL)LUHQ]H'837 #$>-$+""#=2.#3J*->&#2"'2> 7HO

!+-="+(-/ (>*+(/-%.>++$>*(E+$>%.K(3*-<+F(>*+2.(#<#.+$+33(-/ (("#$F3E#=+(#$F(>*+2.(#12"2>K(>-(E-$>.-"($#>%.+'()*+(E-$C $+E>2-$(1+><++$(E2>K(#$F("#$F3E#=+(-%>32F+(2>3(<#""34(F+$->+3(#(3+$3+(-/ (1+"-$G2$G(>-(="#E+4(>*+(.-"+(-/ (-=+$(3=#E+34( E#.+/%"(-13+.7#>2-$(-/ ($#>%.+(1K(#.>23>34(<+"/#.+(E-$F2>2-$3(-/ (>*+(+$72.-$&+$>4(>*+(3+$3+(-/ (3+E%.2>K(#$F(3#/+>K(>*#>( >*+(E2>K(-//+.3'( )*+(.+"#>2-$3*2=(1+><++$(=+-="+4($#>%.+(#$F(E2>K(3*-<3(2>3(3>.+$G>*(2$(2>3(32&="2E2>K(G27+$(1K(=+-="+L3(#12"2>K(>-(G.#3=( >*+2.($+<(.-"+(2$(>*+(<-."F(<2>*(#(1.-#F(7232-$'

!"#$%&"'()*#)+,()-./0+((#+,)&(#+/01)+,0./2,)"0+)"#$)3*+(0"+/0( 7KHUHZHVKDOOKHDUWKHFKDQWRI ELUGVKDYHVLJKWRI YHUGDQWKLOOVDQGSODLQVRI FRUQÀHOGVXQGXODWLQJOLNHWKHVHDRI  9.++3(-/ (#(9*-%3#$7(3-.93:(9*+.+(#"3-(;+(3*#""(*#<+(#("#.8+.(<2+;(-/ (9*+(*+#<+$3=(;*26*=(*-;+<+.(*#.3*(9-(%3;#.7=(>+9( 7+$>($-9(9*+2.(+9+.$#"(1+#%9>:(9*2$83(/#2.+.(/#.(/-.(+?+(9-(.+39(-$(9*#$(9*+(7+3-"#9+(;#""3(-/ (-%.(629>'(@-.+-<+.=(;+(3*#""( 9*+.+(1.+#9*+(#(/.+3*+.(#2.'(A'HFDPHURQ=(B=(2$9.-7%692-$C

D29*(9*+3+(;-.73(/%""(-/ (1+#%9>(#$7(#7&2.#92-$(/-.(;*#9(3%..-%$73(*2&=(E-66#662-(7+36.21+3=(2$(9*+(2$F WURGXFWLRQRI WKHÀUVWGD\RI WKH'HFDPHURQ=(9*+(6-%$9.>327+(#.-%$7(9*+(629>(-/ ((G"-.+$6+H(9*+(2&?-.9#$6+( -/ ( $#9%.+( +&+.8+3( 2$( ?+-?"+( -/ ( 9*+( /-%.9++$9*( 6+$9%.>'( G"-.+$6+=( #3( 9-"7( 1>( 9*+( *239-.2#$3( I2""#$2( #$7( E-66#662-=(;#3(3%..-%$7+7(1>(#(.2$8(-/ (*-%3+3(2$(9*+(*2""3(;*+.+(6292J+$3(%3%#"">(3?+$9(9*+(3%&&+.'()*+( 7+36.2?92-$3(-/ (9*+(*239-.2#$3(3*-;(9*+(?#332-$(-/ (9*+(G"-.+$92$+(6292J+$3(/-.($#9%.+'(!+-?"+(&-7+""2$8(9*+( DUHDDURXQGWKHZDOOVZLWKDKLJKDHVWKHWLFVHQVHWKH\FUHDWHGÀHOGVKRXVHVDQGJDUGHQVHQKDQFLQJLQWKLV ;#>=(9*+(+K%2"21.2%&(-/ (#("#$736#?+(6-$9+&?"#9+7(2$(1+#%9>(#$7(2$(.26*$+33=("#$736#?+(2$(;*26*(?+-?"+(#.+(2$( ?+./+69(*#.&-$>(;29*($#9%.+'(L""(9*23(3*-;3(3+$3292<29>(#$7(#99+$92-$(9-(M+9+.$#"(1+#%9>N=(9-(#99#2$(/++"2$83(-/ ( *#??2$+33(/.-&(6-$9#69(;29*(1+#%9>(#$7(9*+(<#.2+9>(-/ (?"#6+3'(O#9%.+(1+6-&+3(#(?"#6+(9*#9(82<+3(;+""F1+2$8( DQGKHDOWKDOOWKHVHQVHVDUHVWLPXODWHGDWDOOWLPHVE\VSLFHVDQGÁRZHUVSDODFHVDQGFKXUFKHVWKHFKLUSLQJ -/ (12.73(-.(9*+(;-.73(-/ (9*+(39-.>9+""+.(2$(9*+(3K%#.+3(#$7(39.++93'(!+-?"+(6-&+(2$9-(6-$9#69(;29*($#9%.+(#$7( #??.+62#9+(293(;-$7+./%"(.26*$+33' P#$736#?+=(2$(293(+$92.+9>=(23(3++$(;29*($+;(+>+3H(;*#9(+&+.8+3(2$(9*+("29+.#.>(#$7(#.923926(+Q?.+332-$3(23(9*+( .+"#92-$3*2?(1+9;++$(?+-?"+=(629>(#$7($#9%.+=(3++$(;29*(#(1.-#7(<232-$(2$(#$(-.7+.">(#$7(6-&?.+*+$32<+( /.#&+;-.R' S#%3+.(3#>3(AS#%3+.=(TUUV=(?'TWC(9*#9(9*+(+$92.+(/-%.9++$9*(6+$9%.>(23(&#.R+7(1>(X2-99-Y3($#9%.#"23&(#$7(*23( 7KH*LIWRI WKHFRDW(3*-;3(#""(9*+(6-&?"+Q29>(-/ (9*+(6-$6+?92-$(-/ (9*+(?+.2-7'(Z9'(G.#$623Y3(*+#7(23("-6#9+7(.28*9(( 1+9;++$(9*+(9;-(&-%$9#2$3:(9*+("#$736#?+(9#R+3(%?(#"&-39(9;-(9*2.73(-/ (9*+(36+$+'()*23(*28*"28*93(9*+(#692F <29>(#$7(+$+.8>(-/ (9*+(6292J+$Y3(;-."7(9*#9(23(6-$39#$9">(-$(9*+(&-<+H(9*+(629>(-$(9*+(*2""(3%..-%$7+7(1>(;#""3( 3*-;3(#(3+?#.#92-$(1+9;++$(9*+(%.1#$(#$7(.%.#"("#$736#?+(#$7=(#9(9*+(3#&+(92&+=(%$7+.36-.+3(?+-?"+Y3(#12"29>( 9-(6-$9.-"($#9%.+(#$7(9*+(8.+#9(#12"29>(-/ (9*+(2$*#129#$93(9-(2&?.-<+(#$7(+Q?"-29(9*+(?"#6+(2$(;*26*(9*+>("2<+'( )*+(9-;+.3(*#<+=(2$(9*+(%??+.(?#.9=("-882#3(#$7("#.8+(;2$7-;3(9*#9(2$726#9+(2$9+.+39(2$(9*+("#$736#?+(-%9327+( 9*+(;#""3H($#9%.+(6#$(1+(-13+.<+7(#$7(#7&2.+7(/.-&(9*+(*28*+39(?-2$9'()*+(;#""3(6.+#9+(#(1-%$7#.>(1+9;++$( 2$327+(#$7(-%9327+=(#(?.-9+692-$(#8#2$39(?-3321"+(#99#6R3=(1%9(#9(9*+(3#&+(92&+(#(6-$$+692-$(;29*($#9%.+H(2$( IDFWWKHUHDUHROLYHWUHHVFXOWLYDWHGÀHOGVIDUPKRXVHVYLOODVDQGFRXQWULHVQH[WWRWKHFLW\ZDOOV !+-?"+(-/ (9*+(/-%.9++$9*(6+$9%.>(3*-;(#($+;(2$9+.+39(2$(2$72<27%#"29>'(O#9%.+(23$Y9(3++$(#3(#(7#$8+.-%3(?"#6+=( 1%9(#(?+#6+/%"=(32&?"+(#$7(*#.&-$2-%3(?"#6+'(,Q7KH0LUDFOHRI WKHVRXUFH=(#(/.+36-(-/ (9*+(Z9-.2+3(-/ (Z9'(G.#$623( LQWKH8SSHU&KXUFKLQ$VVLVLZHFDQVHHUHIUHVKLQJZDWHUWKDWÁRZVEHWZHHQURXJKURFNV1RWRQO\GLG X2-99-(?#2$9(9*+(3-%.6+(;29*(6"+#.(;#9+.=(;*-3+(/.+3*$+33(3++&3(9-(6-$9.#39(;29*(9*+(#.2729>(-/ (9*+(8-"7+$( .-6R3=(1%9(*+(#"3-(7+?269+7(9*+(;-$7+.(2$(7236-<+.2$8($#9%.+(#3(#(3-%.6+(-/ (.+/.+3*&+$9=(6*#.&=(36*-"#.3*2?=( #$7(.+3+#.6*H(;+(6#$(3++(9*+3+(+&-92-$3(2$(9*+(>-%$8(&#$Y3(+>+3'(


!"#$%&'()*+(,-%.$#"(-/ (0.1#$23&(4(5-$/+.+$6+(!.-6++72$83

!"#$%&'((4(<2-==->()*+(<2/=(-/ (=*+(6-#=>(?@A:BC@A:9D>(E33232>(F#32"26#(-/ (G='(H.#$623>( 0II+.(5*%.6*

J#=%.+>( &-.+-K+.>( #3( 3-&+( 7-6=-.3( #.8%+7( 2$( =*23( I+.2-7>( L#3( 6-$327+.+7( #( *+#"=*M( I"#6+'( !+-I"+( 3*-L( =*+2.(#12"2=M(=-(7-&2$#=+($#=%.+(1M(2&I.-K2$8(=*+(N%#"2=M(-/ ("2/+>(%=2"2=M(L-.O(#$7(I.-7%6=2-$P(L+(6#$(3++$( WKLVLQDJULFXOWXUDOWUDQVIRUPDWLRQVLQFXOWLYDWLRQLQWKHXVHRI ZDWHUZLWKDUWLÀFLDOFDQDOVSRQGVDQGPLOOV 7KHDELOLW\WRREVHUYHQDWXUHLVUHÁHFWHGLQWKHFLW\&LWL]HQVUHDOLVHWKDWWKHLUXUEDQFUHDWLRQLVLQÁXHQWLDO L-$7+./%"(#$7(#6627+$=#"(2$($#=%.+'(!+-I"+(=.#$3/-.&(L*#=(=*+M(*#K+(#.-%$7(=*+&>(L2=*(3+"/C6-$362-%3$+33>( 6-%.#8+>(L2=*(6%$$2$8(#$7(6#I#62=M>(=.M2$8(=-(6.+#=+(#(L-."7(/-.(2=3($++73'(!+-I"+(&-7+""+7(=*+(62=M(/-""-L2$8( -.-8.#I*M>(2$(6-$/-.&#=2-$3(-/ (%.1#$(3=.++=3(#$7(-/ (3N%#.+3' Q#""+7(62=2+3(6-$=.21%=+7(=-(#(.+K2K#"(-/ (6-&&+.6+'().#7+(.-%=+3(L+.+(7+K+"-I+7(=*#$O3(=-(=*+(62.6%"#=2-$( -/ (2&I-.=#$=(I.-7%6=3(3%6*(#3(3I26+3(#$7(32"O3(/.-&(=*+(R.2+$=>(3O2$3>(L--"(#$7(+K+$=3>(2'+'(/#2.3' S#$7(#$7(3+#(.-%=+3(8.+L(7%+(=-(8.+#=+.(8+-8.#I*26#"(O$-L"+78+>(.+3%"=2$8(/.-&(72//+.+$=(*23=-.26#"(#$7( FXOWXUDOHYHQWVVXFKDVWKH$UDELQÁXHQFHRQERWKWKH(DVWDQGWKH:HVWWKHVSUHDGRI WKHPRQDVWLFRUGHU WKH&UXVDGHVDQGSLOJULPDJHVWRWKH+RO\/DQGFRQÁLFWVEHWZHHQWKH2WWRPDQ7XUNVDQGWKH%\]DQWLQHV WKHXQLÀFDWLRQRI $VLD·VSHRSOHE\WKH0RQJROVDQGWKHDVFHQWWRWKHWKURQHLQE\.XEODL.KDQZKRVH .+28$(&#.O+7(=*+(#I-8++(-/ (T-$8-"(I-L+.'( )*23(.+O2$7"+7(2$=+.+3=(2$(=*+(&M3=+.2-%3(I+-I"+(-/ (=*+(R.2+$=>(1-=*(/.-&(#(.+"282-%3(I-2$=(-/ (K2+L(#$7(#( 6-&&+.62#"(-$+'(U=(I%3*+7(L+3=+.$(&+.6*#$=3(=-(=*+(H#.(V#3=>(2$6"%72$8(T#.6-(!-"->(L*-(L.-=+(,O0LOLRQH>( #(3=-.M(L*26*(3*-L3(72//+.+$=(*%&#$(32$8%"#.2=2+3(L2=*(2&&+$3+(#$7(K#.2+7(-.2+$=#"(L-$7+.3>(L*-(3*-L(=*+( 1.+#7=*(-/ (K232-$(#$7(=*+($++7(/-.(%$7+.3=#$72$8(#$7(6-&I#.23-$' )*+(72//%32-$(-/ (6-&&+.6+(1.-%8*=(=*+(62.6%"#=2-$(-/ (/-.+28$+.3W(I.-7%6=3(2$=-(+K+.M7#M("2/+P(=*+.+(L+.+(

!"#$%&'()*+(,-%.$#"(-/ (0.1#$23&(4(5-$/+.+$6+(!.-6++72$83


3<26+3(=*#=(6#&+(/.-&(=*+(>#3=?(@=*+.+(A+.+($%&+.-%3(#<-=*+6#.2+3(2$(B2+$#(#$7(2$(C"-.+$6+(=*+.+(A#3(=*+( $UWRI 'RFWRUVDQG3KDUPDFLVWV ZLQHVVXFKDV9HUQDFFLD(/.-&(&RUQLJOLD(@'HFDPHURQ?(D?(EF(#$7(G.++H(A2$+( @'HFDPHURQ?(II?(EF'(

!"#$%&'((4(G2-==-?(I$()*+(J2.#6"+(-/ (=*+(3-%.6+?(@KEL:MKELNF?(O332M 32?(P#32"26#(-/ (B='(C.#$623?(0<<+.(5*%.6*

*URZLQJQHHGVLQÁXHQFHGWKHHQODUJHPHQWRI FRPPHUFHDQGWKHGHYHORSPHQWRI SURGXFWLRQWKLVEURXJKW #1-%=(=*+(+&+.8+$6+(-/ (#(3<2.2=(-/ (.#=2-$#"(-.8#$23#=2-$(=*#=(A#3(=-(1+(<.+7-&2$#$=(2$(=*+(+$=2.+(2$=+""+6=%#"( #$7(&#=+.2#"("2/+(-/ (<+-<"+(-/ (=*+(/-%.=++$=*(6+$=%.Q' !+-<"+(-/ (=*+(/-%.=++$=*(6+$=%.Q(*#7(#(<.-/-%$7(3+$3+(-/ (1+"-$82$8(=-(<"#6+3R(=*+(62=Q(A#3(#7&2.+7(#$7( #.=23=3(.+<.+3+$=+7(.+#"(<"#6+3(A2=*(+ST%232=+(<.+6232-$'( !+-<"+U3( #3<2.#=2-$3( A+.+( =*+( 32V+( -/ ( =*+( 62=Q?( <-A+.( #$7( 6-$=2$%+7( 8.-A=*( -/ ( =*+( 62=QR( =*+Q( 1%2"=( 62=2+3( 1+6#%3+(-/ (=*+(2$6.+#3+(2$(<-<%"#=2-$'()*+(62=Q(8#W+(=*+(3+$3#=2-$(-/ (#(3#/+(#$7(3+6%.+(<"#6+?(3-"272=Q(#$7( UHÀQHPHQWZHDOWKDQGSRZHU O.=23=3(3*-A+7(=*+2.(<#332-$(/-.(=*+(#.=A-.H(-/ (#(62=QR(=*+(62=Q(A#3(#(3<#6+(-/ (<+-<"+U3(6-$3=.%6=2-$?(62=2V+$3( ZHUHSURXGRI WKHLUFUHDWLRQZKLFKGHVFULEHGDQGUHSUHVHQWHGPDJQLÀFHQFH$UWZRUNPDGHUHIHUHQFHVWR .+<-.=3?(=-(=*+(2&<-.=#$6+(-/ (<"#6+3(#$7(=*+2.(.-"+(2$(3-62+=Q?(.+#"23=26(7+36.2<=2-$3(#$7(#.6*2=+6=%.#"(#$7( $#=%.#"( .+<.+3+$=#=2-$3'( O1-W+( #""?( =*+( $++7( /-.( &++=2$8( #$7( 2$=+.#6=2$8( 7%.2$8( A-.H7#Q3( #$7( /+#3=( 7#Q3( +&+.8+3?(#3(7-+3(=*+(2&<-.=#$6+(-/ (3<#6+(2$(=*+(62=Q(#$7(2$(=*+(6-%$=.Q327+(-%=327+(-/ (=*+(A#""3'


!"#$%&'()*+(,-%.$#"(-/ (0.1#$23&(4(5-$/+.+$6+(!.-6++72$83

<3(3++$(2$(=2->>-?3(/.+36-+3(#$7(2$(>*+('HFDPHURQ@(>*+(62>A(1+6#&+(#("2B2$8(-.8#$23&@(#66-.72$8(>-(>*+($++73( -/ (>*+(C+-C"+'(<3(#(.+3%">(-/ (C-C%"#>2-$(8.-D>*@(*-%3+3(D+.+(+$"#.8+7@(3>.++>3(#$7(3E%#.+3(1+6#&+(F#(&++G >2$8(C"#6+(1+>D++$(62>2H+$3(#$7I(>*+(&#2$(6+$>.+(-/ (>.#7+@(D2>*(>*+(-C+$2$8(-/ (&#.J+>3'( K%.>*+.&-.+@(3>.++>3(D+.+($#&+7(#66-.72$8(>-(>*+(72//+.+$>(>AC+3(-/ (L-13@(/-.(+M#&C"+(1#J+.?3(3>.++>@(-.(>*+( &+>#"D-.J+.?3(3>.++>'(<$->*+.(2&C-.>#$>(#3C+6>(2>(23(>*#>(>*+(3>.++>3(*#7(D+""3(D2>*(/.+3*(D#>+.' )*+(3>.++>3(#$7(3E%#.+3(1+6#&+(>*+(C.2$62C#"(&++>2$8(C"#6+(1+>D++$(62>2H+$3@($->(-$"A(/-.(6-&&+.62#"(C%.G C-3+3(1%>(#"3-(/-.(6%">%.#"(+M6*#$8+' )*+(>-D$(D#3(#(*%1(-/ (#6>2B2>A@(D2>*(3>.++>3(#$7(3E%#.+3(#"D#A3(/%""(-/ (#6>2B2>AN(D2>*(3*-C3(2$(>*+(3>.++>3(#$7( &#$A(>#3J3(D+.+(7+#">(D2>*(2$(/.-$>(-/ (*-%3+3(#$7(#"-$8(>*+(D#A@(3-(62>2H+$3(J$+D(>*+2.(B#.2+>A'()*+(62>A( 1%3>"+7(D2>*(#6>2B2>A@(6-"-%.3@(3-%$73(#$7(36+$>3'(O#..-D(3>.++>3(D+.+(-$"A(/-.(C+7+3>.2#$3@(>*23(+$#1"+7(>*+&( >-(6-$>2$%+(>-(6#..A(-%>(>*+2.(-%>7--.(#6>2B2>2+3' <""(.-#73(D+.+(B#.2+7@(D2>*(3&#""(B#.2#>2-$3(2$(*+28*>@(&#>+.2#"(-/ (6-$3>.%6>2-$@(>*+(3JA"2$+(-/ (>*+(.--B+3(#$7( >*+(-C+$2$83(-/ (7--.3(#$7(D2$7-D3@(>*%3(&#J2$8(+B+.A(C#.>(-/ (>*+(62>A(C#.>26%"#.(#$7(%$2E%+' )*+(6"+#$"2$+33(-/ (>*+(.--&3@(+3C+62#""A(2$(>*+(B2""#3(#$7(C#"#6+3@(3*-D3(#>>+$>2-$(>-(*A82+$+(#$7(>-(3&+""3(#3( ZHFDQVHHLQWKHLQWURGXFWLRQRI WKHÀUVWGD\RI WKH'HFDPHURQ@(PD2>*(8#""+.2+3@(*#""3(#$7(6*#&1+.3@(723C-3+7( #.-%$7(#(/#2.(#$7(3C#62-%3(6-%.>@(+#6*(B+.A(/#2.(2$(2>3+"/@(#$7(>*+(8--7"2+.(>-(3++(/-.(>*+(8"#73-&+(C26>%.+3( D2>*(D*26*(2>(D#3(#7-.$+7(Q'(R$(*-%3+3(2>(D#3($+6+33#.A(>-(*#B+(8--7(3&+""3@(2$(/#6>(D+($->+(>*+(C.+3+$6+(-/ ( 8#.7+$3(-B+.(>*+(1+7.--&(F'HFDPHURQ@(S@(TI(P(R(3*-%"7("2J+(>-(*#B+(#("2>>"+(1+7(&#7+(%C(-$(>*+(>+..#6+(1A(*23( .--&(#$7(-B+.(*23(8#.7+$@(D*+.+@(*+#.2$8(>*+($28*>2$8#"+3(32$8@(#$7(1+2$8(2$(#(&%6*(6--"+.(C"#6+@(R(3*-%"7( 3"++C(&%6*(1+>>+.(>*#$(2$(A-%.(.--&Q' K%.>*+.&-.+@(>*+(2&C-.>#$6+(-/ (C+.3-$#"(6#.+(D#3(+B27+$>N(C.2B#>+(1#>*.--&3(D+.+(-$"A(2$(#(/+D(*-%3+3( #$7(C%1"26(1#>*.--&3(D+.+(72//%3+7(2$(>*+(62>A@(D*26*(3*-D3(>*+(#CC.+62#>2-$(/-.(6"+#$"2$+33' U++>2$83@(+3C+62#""A(-/ (("-B+@(D+.+(/#B-.+7(2$(>*+(1#>*.--&@(#3(D+(.+#7(2$('HFDPHURQ(FSRRR@(:VIN(2$(>*23(6#3+( ZDWHULQWKHEDWKZDVVFHQWHGZLWKRLQWPHQWVRI PRVVDQGÁRZHUV7KHVXSSO\RI GULQNLQJZDWHUZDVDOVRD 6-""+6>2B+(/%$6>2-$'(!+-C"+(>--J(D#>+.(/.-&(3>.+#&3@(3C.2$8(D#>+.@(D+""3(#$7(/-%$>#2$3(>*#>(D+.+(#""(2$(3&#""( 3E%#.+3N(>*23(8#B+(>*+(-CC-.>%$2>A(>-(+$6-%$>+.(->*+.3(#$7(3-62#"2H+' )*+(62>A(/-""-D+7(>*+("-826(-/ (3-62#"("2/+(D2>*(+M6+C>2-$#"(#>>+$>2-$(>-(>*+(3+$3+3N(>*+.+(D+.+(36+$>3(-/ (8#.G GHQVRQWKHJURXQGÁRRURI KRXVHVXVHRI IUDJUDQWÁRZHUVDQGZLGHO\FXOWLYDWHGKHUEVVFHQWVRI VSLFHVLQ WKHVWUHHWVDQGWKHVPHOORI IUHVKFXWKD\WKDWVSUHDGLQWKHÀHOGVLQHDUO\VXPPHU 6LJKWDQGKHDULQJZHUHJUDWLÀHGE\SOHDVDQWVRXQGVOLNHZDNLQJXSWRWKHFRFNFURZRUWZLWWHULQJRI ELUGVRU >*+(3-%$7(-/ (>*+(1+""(+B+.A(*-%.'(R$(>*+(3>.++>3(>*+.+(D#3(6-$>2$%-%3(&%326(82B+$(1A(3>-.A>+""+.3@(1A(6*-2.3( -/ (C.-6+332-$3@(1A(C.#A+.3(-/ (&-$J3@(1A(>*+($-23+(-/ (D#>+.&2""3' 'XULQJWKHQLJKWWKHUHZDVVLOHQFHDQG\RXFRXOGVOHHSTXLHWO\6RXQGVFDSHRXWOLQHGDJULWW\VWLPXOXVIRUDFWLG YHGDLO\OLIHGXULQJWKHGD\DQGDVLJQLÀFDQWVLOHQFHGXULQJWKHQLJKWIRUVOHHSRUIRUPRQDVWLFSUD\HU'XULQJ WKHGD\\RXFRXOGJRWRÀHOGVRUWRZRRGVRQWKHEDQNVRI WKHULYHUVRULQQHDUE\JDUGHQVWKHFRXQWU\VLGH -//+.+7(#(D+#">*(-/ (C.-7%6>3(#$7@(/.-&(&-.$2$8(>-($28*>@(C+-C"+(D-%"7(6-&+(#$7(8-(2$(#$7(-%>(-/ (>*+(D#""3( D*+.+(>*+(D27+(7--.3(D+.+(-C+$(#""(7#A'( <""(>*+(1%2"72$83(-/ (>*+(62>A(D+.+(C#2$>+7(D2>*(1.28*>(6-"-.3N(>*+3+(6-"-.3(#66-&C#$2+7(&#$(2$(+B+.A7#A("2/+'( <(B23%#"(3>2&%"%3(D#3(#"3-(82B+$(1A(>*+(C.-7%6>3(-/ (>*+(&#.J+>3(-C+$(>-(>*+(#2.(-.(1A(C+-C"+(D*-(D-.J+7(2$( >*+(3>.++>3'(WB+.A>*2$8(3>2&%"#>+7(>*+(3+$3+3@(D2>*(6.+#>2B2>A(#$7(#(36*--"(-/ (27+#3' X2/+(1"-33-&3(2$(>*23(+MC#$32-$(-/ (3+$3+3N(D2>*-%>(2>@(>*+(C%"3+(23(3"-D+.@(&%36"+(>-$+(23("-D+.@(C+.*#C3(>*#>( 3#&+(7+32.+(>-("2B+(3%66%&13'(!+-C"+(6-%"7$?>(6"-3+(>*+2.(+A+3(>-(3%6*(1+#%>AN(>*+(62>A(D#3(#.>D-.J@(#$7(>*+( 7.+33(-/ (2>3((62>2H+$3(7%.2$8(*-"27#A3(.+3+&1"+7(#(8#.7+$(2$(1"-33-&(FU%&/-.7@(YVV;@(C'(TZI'(

!"#$%&'()*+(,-%.$#"(-/ (0.1#$23&(4(5-$/+.+$6+(!.-6++72$83


!"#$%&'('_*%RFFDFFLR'HFDPHURQF&RG3DULJ,WF <'=(>'?'@'=(!#.282

( )*+3+(3+$A2&+$A3(#.+(+B#"A+7(2$(A*+(8#.7+$3'()*+C(D+.+(1-.$(/.-&(A*+(6-$A#6A(1+AD++$($#A%.+(#$7(6%"A%.+E( *%&#$2AC(D2A*(D237-&=(3A%7C2$8(A*+("#D3(-/ ($#A%.+=(6.+#A+7(1+#%A2/%"(F"#6+3=(3-%.6+3(-/ (F+#6+(#$7(3#"<#A2-$=( D*+.+(F+-F"+(6-%"7(+36#F+(/.-&(*%&#$(F#2$(#$7(A.#8+7C(-/ (A*+(F"#8%+(A#G2$8(.+/%8+(2$(A*+(1+#%AC(-/ ($#A%.+( DVZHVHHLQWKHLQWURGXFWLRQRI WKHÀUVWGD\RI WKH'HFDPHURQ' >-66#662-(3*-D3(#""(A*+(C-%$8(F+-F"+H3(D-$7+.(#A(3++2$8(A*+(1+#%AC(-/ (A*+(8#.7+$E(A*+C(+$A+.(A*+(8#.7+$(#A( #(3"-D(F#6+=(2$(-.7+.(A-(+$I-C(A*+(F"#6+(7-&2$#A+7(1C(+B6+FA2-$#"(*#.&-$CE 7KHDVSHFWRI WKLVJDUGHQLWVIDLURUGHUWKHSODQWVDQGWKHIRXQWDLQDQGWKHULYXOHWVWKDWÁRZHGIURPLWVR FKDUPHGWKHODGLHVDQGWKHWKUHH\RXQJPHQWKDWZLWKRQHDFFRUGWKH\DIÀUPHGWKDWWKH\NQHZQRWKRZLW 6-%"7(.+6+2<+(#$C(#66+332-$(-/ (1+#%AC=(-.(D*#A(-A*+.(/-.&(6-%"7(1+(82<+$(A-(!#.#723+=(2/ (2A(D+.+(A-(1+(F"#$A+7( -$(+#.A*'(J>-66#662-=('HFDPHURQ=(KKK=(2$A.-7%6A2-$L'( )*.-%8*(A*+3+(D-.73=(A*+(F+-F"+(-/ (A*+(/-%.A++$A*(6+$A%.C(3*-D(*-D($#A%.+(#$7(*%&#$2ACH3(D-.G(6#$(A-8+M A*+.(1+6-&+(+33+$6+(#$7(1+#%AC(2$(F+./+6A(*#.&-$C=(D+#"A*(#$7(#(3-%.6+(-/ (F"+#3%.+(/-.(A*+(&2$7=(6.+#A2$8=( D2A*(3G2""(#$7(#AA+$A2-$(A-($#A%.+=(#(!#.#723+(2$(D*26*(A-("2<+'(


!"#$%&'()*+(,-%.$#"(-/ (0.1#$23&(4(5-$/+.+$6+(!.-6++72$83

!"#"$"%&"' <#==23=2(>'?(@ABBCD(,FRQRORJLDHGHFRORJLDGHOJLDUGLQRHGHOSDHVDJJLR?(E2.+$F+?(G"36*H2'( <#I#$7#""(J'?(@KLLCD(*LRWWRHJOLXPDQLVWL?(J2"#$-?(,#6#(<--H' <-66#662-(M'?(@KLLAD('HFDPHURQ?(#(6%.#(72(N2==-.+(<.#$6#?()-.2$-?(>2$#%72' <.#$72(5'?(@ABB9D(7UD0HGLRHYRH5LQDVFLPHQWR6FULWWLVXOO·DUWH?(J2"#$-?(,#6#(<--H' 5#.72$2(E'?(J28"2-(J'?(@ABBAD(1RVWDOJLDGHOSDUDGLVR,OJLDUGLQRPHGLHYDOH?(O-&#P<#.2?(Q#=+.F#' 5"#.H(R'?(@KL9AD(,OSDHVDJJLRQHOO·DUWH?(J2"#$-?(M#.F#$=2'( 'DYLGVRKQ5  6WRULDGL)LUHQ]H?(9(S-""'?(E2.+$F+?(T#$3-$2' 'HORUW5  /DYLWDTXRWLGLDQDQHO0HGLRHYR?(O-&#P<#.2?(Q#=+.F#' *LRVHIÃ&#x20AC;'  *LRWWR$UFKLWHWWR?(J2"#$-?(>72F2-$2(72(5-&%$2=U'( M.-*&#$$(V'?(ABB;D(/DFLWWjPHGLRHYDOH?(O-&#P<#.2?(Q#=+.F#' W#%3+.(V'?(@ABBKD(6WRULDVRFLDOHGHOO·DUWH?(S-"'XX?()-.2$-?(>2$#%72'( Q+(M-// (,'?(@ABB;(#D($OODULFHUFDGHO0HGLRHYR?(O-&#(<#.2?(Q#=+.F#' ( ( (((((@ABB;(1D(,O0HGLRHYR$OOHRULJLQLGHOO·LGHQWLWjHXURSHD?(O-&#(<#.2?(Q#=+.F#' ( ( (((((@ABB;(6D(/·XRPRPHGLRHYDOH?(O-&#(<#.2?(Q#=+.F#' ( ( (((((@ABB;(7D(,OPHUDYLJOLRVRHLOTXRWLGLDQRQHOO·2FFLGHQWHPHGLRHYDOH?(O-&#(<#.2?(Q#=+.F#' J2"#$2(O'?(@ABBKD(/·DUWHGHOSDHVDJJLR?(<-"-8$#?(X"(J%"2$-' J%&/-.7(Q'?(@ABB;D(!"#$%&'%("#)*&&*#$+'',?()-.2$-?(>2$#%72' ( ( ((((((((@ABBAD(/DFLWWjQHOODVWRULD?(J2"#$-?(<-&Y2#$2' T+.+$2(>'?(@ABB;D(6WRULDGHOSDHVDJJLRDJUDULRLWDOLDQR?(O-&#(<#.2?(Q#=+.F#' 9LOODQL*  &URQLFD?(E2.+$F+?(!+.(2"(J#.8*+.2' Z-YY2(J'?(@KLL[D(6WRULDGHOJLDUGLQRHXURSHR?(O-&#(<#.2?(Q#=+.F#' (")"%*+()*+(.+/+.+$6+3(=-(<-66#662-\3('HFDPHURQ?(1](N2==-.+(<.#$6#?(>2$#%72(+72=2-$(-/ (KLLA?(#.+(2$726#=+7( 1](O-&#$($%&+.#"3(/-.(=*+(7#]3(#$7(=*-3+(V.#13(=-(=*+(3=-.2+3(#$7(=-(36#$(=*+(=+I=(%32$8(=*+($%&1+.(-/ ( 3=+Y3(2$726#=+7(1](=*+(6%.#=-.'( ([DPSOH,, 'D\7ZR6L[WKQHZVQXPEHULQJVWHS S WZHQW\Ã&#x20AC;YH

!"#$%&'()*+(,-%.$#"(-/ (0.1#$23&(4(5-$/+.+$6+(!.-6++72$83


!"#"$%&!'$()*'+,)&-&!'$()*'+,)&./0&1"#"$% 2',)'%%"&34"5'5" 6/$.,0,$*,&20/*,,("$%) 71/0,$*,8&7,409'0:-;9$,&<=>< !"#$%&'()*+(,-%.$#"(-/ (0.1#$23&4($'(564(7-"'5859:; <<<'="#$%&'$+>(?(@AAB(:65;C9DD; !.-E++F2$G3(=%1"23*+F(2$(HE>-1+.(59:;

?"$"@9@&!"#"$%& !#-"-(I+3>.2$+.

'LSDUWLPHQWRGL$UFKLWHWWXUDH3LDQLÀFD]LRQH'LDS !-"2>+E$2E-(F2(I2"#$-4(=#-"-'&+3>.2$+.J=-"2&2'2> )+"'(95'5;DDKLD;((C(;59'9:DDL5L

I2$2&#"(#.E*2>+E>%.+(=+.E+27+F(#3(#(>.%+(>.#$37+.3#"(3>.#$F(>*#>(E-&12$+3(E%">%.#"4(3-E2#"(#$F(*23>-.2E#"(=-2$>3(<*2E*(#.+( 7+.M(F23>#$>(1+><++$(>*+&'(N(<#M(-/ (=.#E>232$G(#.E*2>+E>%.+(1M(>#O2$G(E#.+(-/ ("#$F3E#=+(#$F(=-32>27+(E.2>2E23&(-/ (P1%C "2&2EQ(E-$3%&=>2-$(-/ (.+3-%.E+34(+$72.-$&+$>(#$F(+$+.GM'(N(>--"(#1"+(>-(E-&="M(>*+(1#32E($++F3(<2>*-%>(.+F%E2$G(>*+( R%#"2>M(-/ (=.27#>+(#$F(3-E2#"("2/+4(3+#.E*2$G(#(=-3321"+(#">+.$#>27+(>-(>*+(%3+(-/ ("#$F'()*+(3&#""(3E#"+(#.E*2>+E>%.+(72+<+F( #3(#(=#.#F2G&(-/ (#(1.-#F(E-$E+=>(-/ (3%3>#2$#12"2>M4(<*2E*(G-+3(1+M-$F(+S=+.2&+$>#>2-$(-/ ($+<(&#>+.2#"3(#$F(>+E*$-C "-G2+34(2$E"%F2$G(E-$E+=>3(3%E*(#3(=.-=+.(#$F(G.#F%#"(3-E2-C+E-$-&2E(F+7+"-=&+$>'(N(>--"(-/ (=.#E>2E#"(.+3=-$3+(>-( >*+(%.G+$>($++F3(-/ (3-E2+>M(#$F(+$72.-$&+$>4(.+F23E-7+.2$G(=.#E>2E+3(2$(F23%3+(#3(3+"/CE-$3>.%E>2-$(#$F(3+"/C3%=="M4(-/ ( +$+.GM(#$F($-%.23*&+$>'()*+(1+3>(=.#E>2E+3(/-.(#$(#$>*.-=-"-G2E#"(3%3>#2$#12"2>M4(+7+$(1+/-.+(>*+(>+E*$-"-G2E#"(-$+'

!"#"$%$&'"("#) ;!+.62<(7-112#&-(2&=#.#.+(#(=+$3#.+($+2(>+.&2$2(72(%$#(3>.%>>%.#(#.>26-"#>#(6*+(3#==2#(6#?#.3+"#(6-$(%$#(&-">+="262>@( 72(%$2>@(#(=266-"#(36#"#A'(B.$3>(C.2+7.26*(D6*%&#6*+.E(FG:H ;!+.6*I("J#$8+"-(3=-3>#?#(2(=266-"2(-88+>>2E(62-K(6.+#?#(?2#(?2#(=266-"2(3=#L2E(&#(6.+#?#(%$(>+33%>-(+$>.-(6%2("#(3%#(?2>#(32( 3?-"8+?#(&-">-(728$2>-3#&+$>+''A(M2-?#$$2(N26*+"%662E(OPPF( ;Q"(=.-8+>>-E(3+8%+$7-(2"(=#.#728&#(+$>.-=26-E(6-$82%$>#&+$>+(#"(=+$32+.-(7+""J+33+.+E(7-?.+11+(3#=+.(=+$3#.+(=2R(2$( >+.&2$2(72(7+6-"-$2LL#L2-$+(7+""-(3=#L2-E(6-$>.21%2.+(#(%$#(.27%L2-$+(7+2(6#.26*2(#&12+$>#"2A(S26-"#(B&+.TE(OPFP(

)*+( =.-=-3+7( #6>2-$( 2$( >*+( 3>%7T( ;"2?2$8( >*+( >+..2>-.T( U( 2$*#12>+7( "#$736#=+3( V( GA( 23( =#.>( -/ ( #( .+3+#.6*( =.-W+6>(X*26*(#2&3(>-(#$#"T3+(>*+(#.6*2>+6>%.#"(=.-W+6>(-$(#(3&#""+.(36#"+(#3(#(.+"#>2-$#"(=#.#728&(X2>*(>*+( UHIHUHQFHHQYLURQPHQW´0LQLPDOOLYLQJµLVWKHGHÀQLWLRQJLYHQWRWKLVPRGHO/LYLQJWKHODQGVFDSHLQIDFW 23($->(-$"T(>*+(+Y="#$#>2-$(-/ (#$(#6>2-$E(1%>(#"3-(#$7(#1-?+(#""(#(X#T(>-(=-32>2-$(T-%.3+"/ (#$7(>*+$(>-("2?+'(Q>( *#3($->(-$"T(>-(7-(X2>*(>*+(3*++.($%&1+.(U(X*26*(23(>*+(6-$3+Z%+$6+(U(1%>(=.2&#.2"T(6-$6+.$3(>*+(Z%#"2>#>2?+( 3=*+.+E(3>#.>2$8(/.-&(>*+(.+"#>2-$3*2=(#$7(1+*#?2-%.(>*#>(X+(#.+(#1"+(>-(+3>#1"23*(X2>*(>*+(+$?2.-$&+$>(>*#>( .+6+2?+(%3' C.-&(>*23(6"-3+(.+"#>2-$3*2=E(&-.+(=*T326#"(>*#$(6-$6+=>%#"E(1+82$3(>*+(+Y=+.2+$6+(X*26*(Q(*#?+(>.2+7(>-( FRQYH\DVHHPLQJO\GLVWDQWSRVLWLRQDWÀUVWVLJKWKRZHYHUFORVHWRWKHWKHPHVVXJJHVWHGE\WKHVHPLQDU 7KHUHVHDUFKZKLFKRYHUWKH\HDUVKDVWDNHQDVFLHQWLÀFQDWXUHÀQGLQJLQOLWHUDWXUHLQVLGHDQGRXWVLGHWKH GLVFLSOLQHUHIHUHQFHVDQGDFNQRZOHGJPHQWVÀUVWO\H[SORUHGH[DPSOHVRI VRPHW\SRORJLHVSUHVHQWRQWKH 6-%$>.T327+("#$736#=+'(Q$(/#6>E(2/ (>*+(36-=+(>-(X*26*(2>(.+/+.3(6-&+3(/.-&(3=-$>#$+-%3(#.6*2>+6>%.+E(-$+(>*#>( [+.$#.7(\%7-/3]T(6#""+7(;^.6*2>+6>%.+(X2>*-%>(#.6*2>+6>3A_(2$(>*+(*23>-.T(-/ (;"+#.$+7A(#.6*2>+6>%.+(>*+.+(#.+( +?27+$6+3(>*#>(3-&+*-X(2>(/-""-X+7(>*23(3#&+(=#>*' Q>( 23E( >*+.+/-.+E( =-3321"+( >-( 7+36.21+( N2$2&%&( `2?2$8( #3( #( 3&#""( 36#"+( #.6*2>+6>%.+( 6#=#1"+( -/ ( 1%2"72$8( #( 1.-#7(6-$6+=>(-/ (3%3>#2$#12"2>TE(>*#>(8-+3(1+T-$7(+Y=+.2&+$>#>2-$(-/ ($+X(&#>+.2#"3(#$7(>+6*$-"-82+3E(2$U 6"%72$8(6-$6+=>3(3%6*(#3(=.-=+.(#$7(8.#7%#"(+6-$-&26E(3-62#"(#$7(>+..2>-.2#"(7+?+"-=&+$>E(#1"+(>-(6-&12$+( 6%">%.#"(#$7(3-62#"(.+#"2>2+3(/#.(1+>X++$'(^(3-.>(-/ (!"#$%&'##$(!)($+>X-.]'()*+(3>%7T(+Y#&="+3(*#?+(.+?+#"+7( >*+($#>%.#"(%3+(-/ (&#>+.2#"3(#$7(1%2"72$8(3T3>+&3(>*#>(>-7#T(X-%"7(1+(6#""+7(-.8#$26E(#3(>*+T(1+"-$8(>-(>*+( 32>+E(>*+T(6-&+(/.-&(>*+(3-2"'()*+(+33+$>2#"(=.->+6>2-$(-/ (>*+(+$?2.-$&+$>E(-/ (>*+("#$736#=+E(X#3(#(.+3%">( -/ (>*23(1+*#?2-%.'(!#.#7-Y26#""TE(2>(X#3(>*+(1%2"72$8(=.-6+33(X*26*(X#3(=.->+6>2$8(>*+("#$736#=+E(2$7++7E( X*26*(X#3(6.+#>2$8(2>'(N#$T(1%2"72$83(X+.+(+Y>.+&+"T(3&#""E(%3+7(/-.(1#326E(2&&+72#>+($++73'()*+(.+=+>2>2-$( -/ (>*+(3#&+(>T=-"-8TE(-/ (>*+(3#&+(3>.%6>%.#"(3T3>+&E(-/ (>*+(3#&+(&#>+.2#"3E(-/ (>*+(3#&+(3*#=+E(=.-7%6+7( #(.+3-$#$6+(X2>*(>*+(="#6+E(X2>*(>*#>(="#6+E(#3(2/ (2>(*#7(#"X#T3(1++$(>*+.+E(2$7++7E(#3(2/ ($#>%.+(#66-&=#$2+7( >*+(*%&#$(#6>2-$'(aQ&#8+(Fb C.-&(>*23(=-2$>(-/ (?2+X(X+(6#$(6-$327+.(&26.-(U(#.6*2>+6>%.+(#(>T=-"-8T(X2>*-%>("2&2>3E(X*+>*+.(1T(>*+( /%$6>2-$#"(-.(>*+(6-$3>.%6>2?+(#3=+6>3'(^(&-7+"(X*26*(6#$(1+(#=="2+7(2$(72//+.+$>("#T-%>3(#3(3*-X$(1T(>*+( &#$T(&#$2/+3>#>2-$3(2$(>*+(>+..2>-.2+3(X*+.+(X+("2?+E(2$(>*+($%&+.-%3(+Y#&="+3(-/ (*23>-.26(#.6*2>+6>%.+E(2$( WKHDUFKLWHFWXUDOGHEDWHDQGLQWKHFRQWHPSRUDU\DQGDFDGHPLFÀHOGVH[SHULPHQWDWLRQV$OOH[DPSOHVRI  VPDOODUFKLWHFWXUHÀQGLQJWKHLURZQVWUHQJWKLQWKHLUUHODWLRQVKLSZLWKWKHPXOWLIDFHWHGFRQWH[WHFRQRPLF VRFLDOWHUULWRULDODQGFXOWXUDO,WLVXQGHUWKLVSHUVSHFWLYHWKDWPLQLPXPOLYLQJPD\EHXVHIXOWRUHÁHFWRQD "#.8+.(36#"+E(2$?-"?2$8(>*+(="#$$2$8(>--"3' Q/ (X+("--](#>(-%.(>+..2>-.2+3(X+(.+#"2L+(>*#>(2$(>*+("#3>(7+6#7+3(>*+(=.#6>26+(-/ (>+..2>-.2#"(="#$$2$8(*#3(3%//+.+7( IURPDFRQWUDGLFWLRQEHWZHHQSURMHFWDQGLWVLPSOHPHQWDWLRQ'HVSLWHWKHPXOWLSOHUHJXODWRU\LQVWUXPHQWV X+(*#?+(X2>$+33+7(#$(+$?2.-$&+$>#"(7+3>.%6>2-$(%$&#>6*+7(>-(->*+.(*23>-.26#"(=+.2-73'(Q>(23(>.%+(>*#>(#""( 1+8#$(X2>*(2$7%3>.2#"2L#>2-$(#$7(>*+(3%13+Z%+$>(+6-$-&26(1--&E(1%>(2>(23(+Z%#""T(>.%+(>*#>(>*+("#$736#=+( =.->+6>2-$(*#3(1++$(7+"+8#>+7(>-(>*+("#X(2$3>+#7(-/ (>*+(6#.+(-/ (2>3(2$*#12>#$>3'(`--]2$8(#>(>*+($->(&%6*(


!"#$%&'()*+(,-%.$#"(-/ (0.1#$23&(4(5-$/+.+$6+(!.-6++72$83

.+#33%.2$8(+//+6;3(-/ (;*+("#3;(;*2.;<(<+#.3=(;*+(.+3%";(2$(/.-$;(-/ (%3(>.-&>;(%3(;-(3++?(3-"%;2-$3(1<(@%+3;2-$2$8( ;*+(A3<3;+&B(;*#;(*#3(6.+#;+7(;*+3+(>*+$-&+$#'()*+(3+#.6*(/-.($+C(>.-3>+6;3(*#3(1+6-&+(;*+3+("#3;(/+C( <+#.3(6*#""+$8+'(D33-62#;2-$3(#$7(-.8#$2E#;2-$3(*#F+(.#23+7(;*+(#;;+$;2-$(#$7(/%+""+7(;*+(7+1#;+=(1%;(/-.($-C( ;*+(.+#"(+//+6;3(#.+("#;+(2$(6-&2$8=(+3>+62#""<(2$(-%.(72362>"2$+=("#$736#>+(7+328$=(&-.+(#$7(&-.+(723;#$;(/.-&( ;*+(.+#"(+//+6;3'(G;(23(3+"/H6.2;2623&(1%;(#"3-(+$6-%.#8+&+$;(;-(/#6+(#$7(3-"F+(;*+(+$F2.-$&+$;#"(>.-1"+&(C2;*( ;*+(;--"3(-/ (7+328$' )*+(3;%7<(-/ (&2$2&%&("2F2$8(C#$;3(;-(.+>.+3+$;(#(F2#1"+(#";+.$#;2F+'()*+(+//-.;(23(;.<2$8(;-(3++(;*2$83(/.-&( #(72//+.+$;(>-2$;(-/ (F2+C'()*+.+(#.+(2$(/#6;(#33%&>;2-$3=(2$(;*23(&-7+"=(C*26*(#.+($-;(6-F+.+7(1<(3+72&+$;#.<( 7<$#&263(#$7(#>>"2+7(;-(;*+(8-F+.$&+$;(-/ (-%.(;+..2;-.2+3'(I2.3;(-/ (#""=(;*+.+(#.+($-("%6.#;2F+(.+#3-$3=(&#$( 1%2"73(/-.(*2&3+"/ (#$7(C2;*($#;%.+=(#$7(;*+.+(23($-;(;*+(>-33212"2;<(-/ (A1%2"72$8(;-(3+""'B(J23;-.26#"(+K#&>"+3( ;+#6*(2;=(1%;(#"3-(;*+(32&>"+(/#6;(;*#;("2F2$8=(2$;+$7+7(2$(;*23(C#<=(23(2;3+"/ (#(>+.3-$#"(#6;=(#$7(;*+.+/-.+(6#$( -$"<(1+(8--7(/-.(;*+(>+->"+(C*-(8+$+.#;+3(2;'(G;(23("2?+(#(8#.&+$;L($-(-$+(C2""(1%<(#(8#.&+$;(/-.(*2&3+"/ (#$7( ;*+$(3+""(2;(/-.(3>+6%"#;2F+(>%.>-3+3'(M#$#82$8(#(;+..2;-.<(A/.-&(#1-F+B=(-$(;*+(6-$;.#.<=(&++;3(+6-$-&26( "-826=(>-"262+3(#$7(&#$#8+&+$;(-/ (+$F2.-$&+$;#"(.+3-%.6+3(#33-62#;+7(C2;*(F262-%3(6<6"+(>.-6+33+3'(N-%( C-%"7(;*2$?(;*#;(O/-.(;*+(3#&+(.+#3-$3(-/ (;*+(8#.&+$;P(#(&-.+(72.+6;("2$?=(/.-&(1+"-C=(6-%"7(2$7%6+(;*+( $+6+33#.<(.+3>+6;(/-.(-%.(6-&&-$(C+""L(;*+(+$F2.-$&+$;(;*#;(#""-C3(%3(;-("2F+'(I-.(;*23(.+#3-$=(.+7236-F+.+7( >.#6;26+3(#3(3+"/H6-$3;.%6;2-$(#$7(3%3;#2$#12"2;<(H(%$7+.3;--7(#3(*%&#$(1+*#F2-%.(#3(C+""(#3(;+6*$-"-826#"( ->>-.;%$2;<(H(1+6-&+(2&>-.;#$;'(Q*2"+(+$F2.-$&+$;#"(+&+.8+$62+3(*#F+(2$6.+#3+7(;*+("+F+"(-/ (#;;+$;2-$(;-( +$+.8<(3%>>"<=(;*+(6-""+6;2F+(6-$362-%3$+33(23(3;2""(/#.(#C#<'(G(#&(;*+.+/-.+("+7(;-(1+"2+F+(O#$7(&#$<(3;%72+7( +K#&>"+3(>.-F+(2;P(;*#;(C*+.+(;*+.+(23(#(72.+6;(C-.?(H($-;(2$;+.&+72#;+7(H(1+;C++$(&#$(#$7("#$7=(;*#;(6#$( +#32"<(#33%.+(;*+(>.+3+.F#;2-$(-/ (+$F2.-$&+$;=(1<(+$3%.2$8(A;*+($++73(-/ (>.+3+$;(8+$+.#;2-$3(C2;*-%;(6-&H >.-&232$8(;*+(>-33212"2;<(-/ (/%;%.+(-$+3(;-(&++;(;*+2.(-C$'( AN+3=(1+6#%3+(;*+(72.+6;(#6;2-$(-$(;*+(;+..2;-.<(2$7%6+3(#(A;.+#;&+$;B=(>.+F+$;2$8(-.(#;("+#3;(3"-C2$8(7-C$( ;*+(+$F2.-$&+$;#"(723.%>;2-$(O*<7.-H8+-"-826#"(#$7(#+3;*+;26P(3++$(2$(;*+3+(<+#.3=(;*#;(*#3(#(6-&&-$(&#;.2K( 2$(#$(#$;*.->-6+$;.26(#6;2F2;<=(1#3+7(&-.+(-$(;*+(+K>"-2;#;2-$(-/ (6#>2;#"(.#;*+.(;*#$(-$(2;3(>.+3+.F#;2-$(#$7( +$*#$6+&+$;'()*+.+/-.+=(2;(23(3%.>.232$8(*-C(;*+(C-.73(-/ (;*+(R+.&#$(S6-$-&23;(S.$3;(I.2+7.26*(T6*%&#H 6*+.(*#F+($-;(1++$(>%;(2$;-(>.#6;26+L(AU+;V3("--?(&-.+(6"-3+"<(#;(;*23(3-H6#""+7($#;%.#"(6#>2;#"'(O'''P(G(#&(3%.+( ;*#;($-(-$+(C2""(7+$<(;*#;(C+(#.+(;.+#;2$8(2;(#3(2/ (2;(C+.+(#$(2$6-&+=(C*2"+(2;(23=(C2;*-%;(#(7-%1;=(#(6#>2;#"'(G/ ( C+(;.+#;+7(2;(#3(#(6#>2;#"=(C+(3*-%"7(6#.+(/-.(2;3(6-$3+.F#;2-$=(3-(C+(3*-%"7(7-(+F+.<;*2$8(2$(-%.(>-C+.(;-(;.<( ;-(&2$2&2E+(;*+(6%..+$;(.#;+(-/ (6-$3%&>;2-$'B I.-&(;*+(>-2$;(-/ (F2+C(-/ (;+..2;-.2#"(>"#$$2$8=(2;(C-%"7(&+#$(.+7%62$8(;*+("#$7(%3+(1%;(#"3-(O#$7(>+.*#>3( +F+$(1+/-.+P(6*#$82$8(;*+(C27+3>.+#7(->2$2-$(C*26*(;-(#("-C+.(;+..2;-.2#"(+&>"-<&+$;(O%$7+.3;--7(#3(>.-H ;+6;2-$P=(6-..+3>-$73(#(8.+#;+.(3#/+8%#.7'()*23("#3;(3;#;+&+$;(&#<(#>>+#.(2$6-$323;+$;(1+6#%3+(<-%("-3+(328*;( -/ (;*+(2&>-.;#$6+(-/ (;*+(72.+6;(.+"#;2-$3*2>(C2;*(;*+(+$F2.-$&+$;'(W%;(;*+$(*-C(;-(*-"7(;-8+;*+.(;*+3+(;C-( HOHPHQWV"$QGPRUH´EXLOGOHVVRUEXLOGPRUH"µ$QHDV\DQVZHUPLJKWEHWREXLOGOHVVDQGLQKDELWPRUH 2$(;*+(3+$3+(-/ (>.-;+6;2-$'(D(C27+3>.+#7(723;.21%;2-$(-/ ("2F2$8(C2""(*#F+(;*+(2&&+72#;+(+//+6;(-/ (>.-;+6;2$8( ;*+(+$F2.-$&+$;'()*+(8-#"(C-%"7(1+(;-(.+#3328$(#(36#"+=(C*26*(&+#$3=(-$6+(#8#2$=($-;(;-(6-$6+2F+(;*+(;+..2H ;-.<(#3(#(723;#$;(+"+&+$;=(1%;("+;(2;(3%&(%>(;*#;(A*%&#$(72&+$32-$B(C*26*(1+"-$83(;-(;*+("#$736#>+(3<3;+&=( 7.#C2$8(6"-3+.(;*+(>+->"+(;-(;*+(;+..2;-.<'(G3($-;(+K6"%32F+"<(#(72362>"2$+V3(#3>+6;=(3-&+;*2$8(6-$6+.$2$8(X%3;( #.6*2;+6;%.+=(1%;(#"3-(#(3-62#"(>.2$62>"+'(T2$6+(G(7+#"(C2;*(;*+(;*+&+3(-/ ("#$736#>+=(-/ ("2F2$8(;*+("#$736#>+=(G( *#F+(;*+(2&>.+332-$(;*#;(;*23(#3>+6;(23(6.%62#"=(1+6#%3+(2;V3(2$(;*+(72.+6;(#$7(>*<326#"(.+"#;2-$3*2>(C2;*(#.6*2H WHFWXUHWKDWPDQÀQGVLWVSURSHUVL]HDQGLWLVLQWKHSK\VLTXHRI VSDFHWKDWKH·VDEOHWRUHDFWWRLQÁXHQFH ;-(1+(#//+6;+7' )*#;V3(C*<(M2$2&%&(U2F2$8(&#<(.+>.+3+$;(#(>-3321"+(C#<(-%;=(+3>+62#""<(2$("28*;(-/ (;*+(;+#6*2$83(-/ (#(;.#72H ;2-$'(G$(/#6;=(2$(*23;-.<=(;*+(.+"#;2-$3*2>(1+;C++$(&#$(#$7(*23(;+..2;-.<(/-%$7+7(2;3(.--;3(-$(&%;%#"(+K6*#$8+'( Q*2"+=(-$(;*+(-$+(*#$7=(;*+(+$F2.-$&+$;(C#3(%3+7(#3(#(.+3-%.6+(/-.(;*+("2F+"2*--7=(-$(;*+(-;*+.(*#$7(H(/-.(

!"#$%&'()*+(,-%.$#"(-/ (0.1#$23&(4(5-$/+.+$6+(!.-6++72$83


9*23(3#&+(.+#3-$(#$7(/-.(9*+(2&:-.9#$6+(9*#9(9--;(:"#6+(<(2$*#129#$93(9--;(6#.+(-/ (9*#9(+6-"-826#"(3=39+&>( ?*26*(&#2$"=(&+#$9(9-(#69(2$(9*#9(:"#6+>(?-.;>(:.-9+69>(@#"%+(#$7(#""(.+3%"9+7(2$(#(&%9%#"(+A6*#$8+'()#$821"+( /+#9%.+3(-/ (9*23(B.%"+C(?#3($-9(-$"=(9*+(:.-7%693>(1%9(#"3-(#$7(3:+62#""=(9*+(:.+3+.@#92-$>(9*+(&#2$9+$#$6+( #$7(9*+(-.8#$2D#92-$(-/ (9*+(.+"+@#$9(#.+#'(E.6*29+69%.+(/-""-?+7(9*23(:#9*'()*+.+(?#3($-(6-$39.%692-$(9*#9( ?#3($-9(1-.$(/.-&(9*+(&#9+.2#"3F(6*#.#69+.239263(#$7(/.-&(9*+(1%2"72$8(9.#7292-$3(-/ (9*+(:"#6+'(G-9(-$"='(H$( 9*+(&-39(-/ (6#3+3(I2/ ($-9(9-9#""=J(29(?#3(1%2"9(B-$(9*+(6*+#:C>(1=(+A:"-292$8(9*+(*%&#$(.+3-%.6+3(-/ (#(/#&2"=>( #(6-&&%$29=(#$7>(?*+.+(:-3321"+>(-/ (#(32$8"+(2$72@27%#"'()*+(-.282$(23(:.-1#1"=(9-(1+(/-%$7(2$(9*+(*#129( -/ ( 3+"/<&#7+( #3( .#:27>( 2&&+72#9+( #$7>( $-9( "+#39>( 6-$@+$2+$9( &+#$3'( H/ ( 9-7#=( ?+( +#32"=( "2$;( 3%39#2$#12"29=( 9-(9+6*$-"-826#"(#3:+693>(2$(9*+(:#39(29(?#3(#(%3%#">(?27+3:.+#7(#$7(3*#.+7(:.#6926+'(H9(?#3($-9(:-3321"+(9-( 1%2"7(#(/#.&(?29*(72//+.+$9(&#9+.2#"3(9*#$(9*+(62.&-"-(?--7(#$7(9*+(7-"-&29+(.-6;>(#3(29(?#3(2$6-$6+2@#1"+( 2$(K#.72$2#(9-(1%2"7(#(3*+"9+.(?29*-%9(%32$8(9*+(L-6;.-3+>(,%$2:+.(#$7("-6#"(8.#$29+'()*23(&+9*-7(*#3(82@+$( .23+(9-(?27+3:.+#7(6#3+3(?*26*(:.-7%6+7(+A#&:"+3>(.+"#9+7(9-(9*+2.(8+-8.#:*26#"(36-:+(#$7>(32&%"9#$+-%3"=>( :#.#""+"(9-(-9*+.(6#3+3(2$(-9*+.(32&2"#.(+$@2.-$&+$93'(M+(6#$(6-$327+.>(/-.(+A#&:"+>(9*+(6.-33</+.92"2D#92-$( 9*#9(6-&12$+3(9*+(#.6*29+69%.+(-/ (9*+(N+729+..#$+#$>(/.-&(O.++6+(9-(!-.9%8#"(@2#(H9#"=(#$7(K:#2$'(PH&#8+(QR( M*#9(&#99+.3(&-39(23($-9(-$"=(9*+(6"2&#926>(8+-"-826#"(-.(:.-7%692-$(32&2"#.292+3>(1%9(9*+(7+328$(#$7(&+< 9*-7-"-826#"(:.2$62:"+3(9*#9(*#@+(3%::-.9+7(9*+3+(#.6*29+69%.+3>(H(&+#$(9*+(#12"29=(9-(9.#$3/-.&(9*+(B9#;2$8( :"#6+C(2$9-(#(B9#;2$8(6#.+C(-/ (9*+(9+..29-.='(S.-&(9*+3+(6-$327+.#92-$3(29(6#$(1+(6-$6"%7+7(9*#9(9*+(&#9.2A( -/ (9*+(&2$2&%&("2@2$8(23(7%+(9-(9*+(.%.#"(?-."7'(E""(9*+(#1-@+(+A#&:"+3(3*-?(#$(#8.21%32$+33(#692@29='()*23( ZDVKLVSXUSRVHWRVXSSRUWDQGIDFLOLWDWHWKHZRUNRI WKHPDQRQWKHHDUWK$QGWRGD\",WLVIURPWKHVRFLDO 233%+3(9*#9(2$(9*+("#39(7+6#7+($+?(9.+$73(*#@+(8.-?$>(.+"#9+7(9-(2$9+.$#92-$#"(6--:+.#92-$(#$7(+$*#$6+&+$9( RI WKHODQGVFDSH,QWKHÀUVWFDVHQRQJRYHUQPHQWDORUJDQL]DWLRQVDQGSULYDWHDVVRFLDWLRQVHQGHDYRXUWR #77.+33(#$7(3-"@+(3-62#"(#$7(9+..29-.2#"(6.2926#"(329%#92-$3>(2$(9*+(3+6-$7(6#3+>(9*+.+(23(#(8.-?2$8(6-$@2692-$>( +3:+62#""=(2$($-.9*+.$(T%.-:+>(9*#9(9*+(+$*#$6+&+$9(-/ (9*+(+$@2.-$&+$9(6#$(:#33(9*.-%8*(#(3=39+&(-/ ( PLFURLQIUDVWUXFWXUHVXSSRUWLQJWRXULVWÁRZVEXWDOVRORFDOFRPPXQLWLHV,QVRPHFDVHVWKHVHWZRPRGHV &+.8+>(?-.;2$8(#"3-(-$(9*+(.+6-$39.%692-$(-/ (9*+(27+$929=(-/ (#(:"#6+' )*+.+(#.+(#"3-(-9*+.(.+#3-$3(?*=(?+(6#$(9*2$;(#1-%9(9*+($++7(/-.(#(.+$+?#"(#$7(#(:+.:+9%#92-$(-/ (3&#""( 36#"+(#.6*29+69%.+'()*+(9*+&+(-/ (&2$2&%&(#.6*29+69%.+(6-%"7(1+(%$7+.39--7(#3(#(9--"(-/ (6-$6.+9+(.+3:-$3+( WRWKHQHHGVRI DVRFLHW\LQÁX[7KHWLPHVZHOLYHLQDUHFDXVLQJDUHWKLQNLQJRI GHVLJQDQGFRQVWUXFWLYH VWDQGDUGVDVZHKDYHOLYHGIRUWKHODVWWZHQW\\HDUV'HVSLWHDJUDGXDOLQFUHDVHRI ODQGHPSOR\PHQWWKHKRX< 32$8($++73(.+"#9+7(9-(+$@2.-$&+$9#"(#$7(3-62#"(+&+.8+$62+3(2$6.+#3+>(9*+("#9+39(-.282$#9+7(/.-&(9*-3+(#9=:26#"( ÀJXUHVRI RXURZQWLPHV7KLQNRI ZRUNLQJVWXGHQWV\RXQJFRXSOHVSUHFDULRXVZRUNHUVVLQJOHSDUHQWVEXW #"3-(9-(9+&:-.#.=(#$7(9*+$(9-(9*+(&-12"29=(#3(#($+6+33#.=(6-$7292-$(9-(?-.;(#$7(2&:.-@+(9*+2.(-::-.9%$292+3( #$7(;$-?"+78+(I3++(2$(9*23(.+8#.7(9*+(:#:+.(9*#9(,#U%+3(E99#"2(*#3(7+726#9+7(9-(9*+($-&#726(&#$J'()-(9*23( ?#3(#77+7(9*+(#"?#=3(2$6.+#32$8(7+&#$7(-/ (B$-$<39#$7#.7C(*-%32$8>(#1"+(9-(&++9(9*+(1#326($++73(?29*-%9( .+7%62$8(U%#"29=(-/ ("2/+>(:.2@#9+(#$7(3-62#"'(G-?>(2$(/#6+(-/ (9*+3+(%.8+$9($++73>(?*#9(?+(&28*9(6#""(B9.#$3< #.6*29+69%.+C>(1#3+7(+33+$92#""=(-$(#(B9+&:-.#.=(39#=C>(29(&#=(1+(#$(2$39.%&+$9(9-(82@+(6-$6.+9+(#$3?+.3(9-( 9*+3+($++73'(H9(23(6"+#.(9*#9(#($+?(?#=(-/ ("2@2$8(&%39(1+(6"-3+"=(.+"#9+7(9-(#($+?(?#=(-/ (2$*#1292$8>(&#2$"=( .+:.+3+$9+7(1=($+?(3-"%92-$3'()-(7-(9*23(?+($++7(9-(6*#""+$8+(9*+(B*#1293C>("+823"#92@+(1+/-.+(6-$39.%692@+>( 9*#9(3-62#""=(#$7(#"&-39(1"2$7"=(?+(*#@+(9#;+$V(9-(2$@-"@+("-6#"(8-@+.$&+$93(#3(6%39-72#$3(-/ (6292D+$3F($++73( #$7(;++:+.3(-/ (9+..29-.=(?*+.+(9*+(@2.9%-%3(#692-$3(1+6-&+(&-.+(#$7(&-.+($+6+33#.='


!"#$%&'()*+(,-%.$#"(-/ (0.1#$23&(4(5-$/+.+$6+(!.-6++72$83



!"#"$"%&"' >6*%&#6*+.(G'(H'=(IBCFFJ(3LFFRORqEHOOR=(K2"#$=(08-(K%.32#(G72@-.+(>'L'M' N%7-/3OE(P'=(IF:9QJ(($UFKLWHFWXUHZLWKRXWDUFKLWHFWV1HZ<RUN'RXEOHGD\ &RPSDQ\,QF*DUGHQ&LW\ M@@#"2(,'=(IBCC9J(/·XRPRQRPDGH=(K2"#$=()*+(>+6-$7(N+$#233#$6+(3'.'"'

!"#$%&'()*+(,-%.$#"(-/ (0.1#$23&(4(5-$/+.+$6+(!.-6++72$83


!"#"$%&!'$()*'+,)&-&!'$()*'+,)&./0&1"#"$% 2',)'%%"&34"5'5" 6/$.,0,$*,&20/*,,("$%) 71/0,$*,8&7,409'0:-;9$,&<=>< !"#$%&'()*+(,-%.$#"(-/ (0.1#$23&4($'(564(7-"'5859:; <<<'="#$%&'$+>(?(@AAB(:65;C9DD; !.-E++F2$G3(=%1"23*+F(2$(HE>-1+.(59:;

?"%"5'1&@,*A$/1/%",)&!'$()*'+,&?,)"%$& B04'$&690'5/0)A"+ I#//#+"+(!J

'LSDUWLPHQWRGL$UFKLWHWWXUDH3LDQLÃ&#x20AC;FD]LRQH !-"2>+E$2E-(F2(K2"#$-4(+(&#2"(.#//#+"+'=+L=-"2&2'2> )+"(M;D(95'5;DD'NO998/#P(M;D(95'5;DD'NO;N

@$( >*+( E%..+$>( /.#&+<-.Q( -/ ( F2G2>#"( >+E*$-"-G2+3( /-.( #.E*2>+E>%.+( #$F( %.1#$( F+32G$4( >*+( /-""-<2$G( +33#R( S%+3>2-$3( WKHÃ&#x20AC;JXUHRI WKHGHVLJQHUDVSURPRWHURI HQYLURQPHQWDOFRQWHQWVLQRUGHUWRWULJJHUVSDWLDOLQFOXVLRQDQGDZDUHQHVV >-(+$*#$E+(.+32"2+$E+(#$F("27#12"2>R(2$(E-$>+&=-.#.R(E2>2+3'()*+(E%.#>-.(23(#(/#E2"2>#>-.(-/ (E-&="+P(=.-E+33+3(-/ (>.#$C 3/-.&#>2-$(#$F(.+G+$+.#>2-$(<*-(.23+3(>+..2>-.2#"(233%+3(E#.+/%""R(3+"+E>2$G($#..#>27+3(TF#>#U(#$F(G+-G.#=*2+3(T="#E+3U( #3(E-&&-$(="#RG.-%$F(/-.(>*+(2&=.-7+&+$>(-/ (>*+(%.1#$(=+./-.&#$E+'()*+(F+32G$(3>.#>+GR(=.-=-3+F(%$F+.(>*+3+( FRQGLWLRQVLQWHUSUHWVWKHFLW\DVDVSDWLDODJHQGDWKDWLQWHUZHDYHVVRXUFHVUHVRXUFHVDQGDJHQWVIRUDPRUHSURÃ&#x20AC;FLHQW %3+(-/ (>*+(#7#2"#1"+(3=#E+4(+3=+E2#""R(>*+(-$+($->(E-$E+=>%#"2V+F(-.("+/>-7+.'()*+(=.-W+E>(1+E-&+3(>*+$(#(E*.-$-G.#=*R( -/ (>*+(F2//+.+$>(>+&=2(-/ (>*+(="#E+34(#""-<2$G(&%">2="+(3E+$#.2-3(-/ (%3+(#$F(E-$7+.32-$(-/ (E*-3+$("-E#>2-$3(E-%="+F( <2>*(=*R32E#"(-=+.#>2-$(-/ ("#$F3E#=+(F+32G$(#$F(>+..2>-.2#"(>.#$3/-.&#>2-$'

!"#$%&'()*'+",7KHFKRLFHWRSURSRVHWKHZRUG´FXUDWRUVKLSµDVDNH\ZRUGIRUWKHUHQHZDORI WKHSURIHVVLRQDOÀJXUHRI WKH DUFKLWHFWLQFXUUHQWWLPHVFRPHVDIWHUDUHÁHFWLRQRQWKHSROLWLFDODQGHFRQRPLFVLWXDWLRQLQZKLFKWKHFDSL; <#"23<26(3=3<+&(#$7(<*+(%.1#$2>+7(?-."7(*#3(3"-?"=(/#""+$(2$(<*+("#3<(6-%@"+(-/ (=+#.3A(/-""-?2$8(#(.+&#.B#1"+( VWDWHRI FULVLVRI WKHPDMRUÀQDQFLDOVWUXFWXUHVDQGWKHLQHIÀFLHQF\RI WKHUHODWHGOHJLVODWLYHERG\ $QHZW\SHRI ÁH[LELOLW\OLJKWQHVVDQGRSHQQHVVVHHPVWREHQHHGHGLQRUGHUWRUHFRQQHFWDYDLODEOHUH; 3-%.6+3(?2<*(<*+2.(%3+.3A(723<.21%<2$8(8--73(#66-.72$8(<-($+6+332<=(#$7(<*+(@-33212"2<=(-/ (.+%32$8(#$7(.+<%.; $2$8(<*+(+$+.8=(+&@"-=+7(2$(<*+(<.#$3/-.&#<2-$(@.-6+33+3' C$(<*23(1#323A(<*+(2$D+3<&+$<(2$(2$$-D#<2-$(.+3+#.6*(#$7(7282<#"(<+6*$-"-82+3(*#3(.+6+$<"=(1+6-&+(#(6-&&-$( @.#6<26+(/-.(&#$=(-@+.#<-.3(2$(<*+(3+6-$7(#$7(<*+(<*2.7(3+6<-.A(7%+(<-(<*+(@-33212"2<=(-/ (2$6.+#32$8(8.-?<*( #$7(7+D+"-@&+$<(+E@"-2<2$8(2$<+""+6<%#"(#$7(2&&#<+.2#"(.+3-%.6+3("2B+(7#<#(#$7(<*+(2$<+.$+<(/-.(<*+(2&@.-D+; &+$<(-/ (<*+(@+./-.&#$6+(-/ (<*+(@.-7%6<2-$'( FD+$( 2$( 62<2+3( 3%6*( 2$3<.%&+$<3( *#D+( 6#%3+7( #( 3*2/<( -/ ( @#.#728&( 2$( <*+( ?#=( @"#$$+.3( #$7( 7+328$+.3( 6#$( DSSURDFKWKHSK\VLFDOVSDFHDQGLWVFRQÀJXUDWLRQ,I ZHWKLQNDWWKHLQFUHDVLQJLQWHUHVWWKDWORFDODGPL; $23<.#<2-$3(*#D+(3*-?$(/-.(<*+(7+328$(-/ (3&#.<(62<2+3A(-.(/-.(@.-G+6<3(/-.(<*+(7282<#"2>#<2-$(-/ (<*+2.(&#G-.( %.1#$(3+.D26+3A(<*23(@.-D+3(#(.+7%6+7(6#@#62<=(-/ (<*+(%.1#$(3<#B+*-"7+.3(<-(+6-$-&26#""=(3%@@-.<(@*=326#"( <.#$3/-.&#<2-$3(-/ (<*+(1%2"<(+$D2.-$&+$<'( 7KHDUFKLWHFWDVDFUHDWLYHSURGXFHURI NQRZOHGJHDQGLQWHUSUHWHURI WKHFLW\LVLQYROYHGLQWKHUHGHÀQLWLRQ -/ (<*+(1-%$7#.2+3(-/ (*23(72362@"2$+3(#3(6-$<+$<(3+"+6<-.(#$7(-@+.#<-.A(7236+.$2$8(<*+&+3(#$7(3<.#<+82+3(<-( 7236"-3+(<*+(.+3-%.6+3(*277+$(?2<*2$(<*+(<+..2<-.=(#$7(<*+(<-@-8.#@*=(-/ (-%.(62<2+3(+E@"-2<2$8(7282<#"(<+6*$2; TXHVRI GHVFULSWLRQDQGFRPPXQLFDWLRQ$FFRUGLQJWR5DRXO%XQVFKRWHQWKHÀJXUHRI WKHFXUDWRULQWURGX; 6+3(#(72//+.+$<(@+.3@+6<2D+(-$(<*+(&2332-$(-/ (<*+(#.6*2<+6<A(.+72.+6<2$8(*23(3B2""3(-/ (3@#<2#"(&#$2@%"#<-.(#$7( -.8#$2>+.(<-?#.7(<*+(7+328$(-/ (6-&@"+E(%.1#$(@.-6+33+3(H:IJJA(@'(KILM'()*+(#.6*2<+6<(@.+3+$<3(2$(/#6<(<?-( <=@+3(-/ (+E@+.<23+A(<*+(#12"2<=(2$(.+#72$8(<*+(&-.@*-"-8=(-/ (%.1#$(6-$8"-&+.#<2-$3(#$7(1%2"72$83(#$7(<*+( 6#@#62<=(<-(+$D23#8+(<*+2.(2&#8+(#$7(<*+2.(6*#$8+(-D+.(<*+(<2&+'(5%.#<-.3*2@(&+#$3(#(72362@"2$#.=(+$6-%$<+.( 1+<?++$(#(72//+.+$<(?#=(-/ (6-&&%$26#<2$8(#(3@#6+(2$(<*+("28*<(-/ (<*+(6#.+(/-.(-%.(*#12<#<A(+E@.+332$8(-%.( 2$<+.+3<(/-.(-%.(+$D2.-$&+$<#"(/-3<+.2$8(3@#<2#"(#?#.+$+33(#$7(B$-?"+78+'(5+7.26(!.26+(#$<262@#<+3(<*23(6-$; 72<2-$(2$(<*+(<+E<()*+(N$D2321"+(O#$7?26*A(#.8%2$8(<*#<(P&#B2$8(<*+(@-<+$<2#"(-/ (<*23(2$D2321"+(726<2-$#.=(-/ ( @-33212"2<2+3(?-.B(/-.(-$+(2$D-"D+3(<*+(.+G+6<2-$(-/ (<*+(.-"+(-/ (#.6*2<+6<%.+(#3(#(&+.+(2&@.-D+.A(#(/-.&#"( +$.26*+.(-/ (<*+(+$D2.-$&+$<(#3(2<(#<(@.+3+$<(+E23<3Q(H:IIKA(@'J:M'(R.6*2<+6<%.+(+&1-72+3(*+.+(<*+(3*#@+(-/ ( 6-&@"+E(@.-6+33+3(-/ (#6<2-$3(1+<?++$(%3+.3(#$7(#8+$<3(?2<*2$(<*+(3@#6+A(&-D2$8(#?#=(/.-&(<*+(<.#72<2-$#"( /-6%3(-$(<*+(3-"+(&#B2$8(-/ (1%2"72$83' )*+(#<<+&@<(-/ (<*+(#.6*2<+6<;6%.#<-.(23(<.#$3D+.3#"(#$7(2$6"%32D+A("-$82$8(<-(<*+(3+#.6*(/-.(.+3-%.6+3A(2$<+"; "+6<%#"(#3(?+""(#3(&#<+.2#"A(1%2"72$8(3@#<2#"(3<.#<+82+3(-/ (3%@@"=(#$7(723<.21%<2-$(#66-.72$8(<-(#(6-""#1-.#<2D+( #$7(2$<+.7+@+$7+$<(#@@.-#6*(<-(#""(<*+(-<*+.(72362@"2$+3'()*+(6%.#<-.(23(2$(6*#.8+(-/ (2$D+3<&+$<(#$7(/%$7; UDLVLQJYHQWXUHVZKLFKHPHUJHWRUDLVHFRQFHUQVDQGTXHVWLRQVIRUWKHEHQHÀWRI WKHXUEDQHQYLURQPHQW DQGLWVLQKDELWDQWV+LVÀJXUHEHFRPHVVLPLODUWRWKHRQHRI DGRFWRUZKRZRUNVIRUWKHZHOOEHLQJRI KLV @#<2+$<3A(1-<*(@*=326#""=(#$7(@3=6*-"-826#""='(S23(&2332-$(2$D-"D+3(#?#.+$+33(#$7(2&@.-D+&+$<(-/ (<*+(1%2"<( +$D2.-$&+$<(#3(?+""(#3(<*+(#12"2<=(<-(6-$D+=(3@#<2#"(6-$6+@<3(#$7(#8+$7#(<-?#.7(%3+.3(#$7(3<#B+*-"7+.3A( 1%2"72$8(6-$3+$3%3(<*.-%8*(6--@+.#<2-$(#$7(+E6*#$8+'(

.$-'*)*%*/$0*'$1&/),-/2$32"(4,*'+ N$/-.&#<2-$(<+6*$-"-82+3(#$7("#$736#@+(7+328$(@.+3+$<(2$<+.+3<2$8(.+"#<2-$3*2@3(2$(<*+(&+<*-7-"-826#"(#@; @.-#6*(<-(<*+(@.-G+6<A($-<#1"=(2$(<*+($+6+332<=(<-(#$#"=>+(#$7(7+D+"-@(6-&@"+E(3=3<+&3(<-(82D+(#$(#$3?+.(<-( <*+($++73(-/ (D#.2-%3(%3+.3A(-D+."#@@+7(6.2<26#"2<2+3A(&%<#1"+(.+T%2.+&+$<3(/.-&(<*+(<+..2<-.=(#$7(<*+(D#.2-%3( HFRV\VWHPVLQYROYHG7KHLVVXHVUHODWHGWRFRQWHPSRUDU\FLWLHVDUHRIWHQGHPDQGVRI GLIÀFXOWLQWHUSUHWDWLRQ #$7(&#$#8+&+$<A(?*26*(#.+($-<($+6+33#.2"=(.+/+.#1"+(<-("-6#"(-.(@-"2<26#"(1-.7+.3A(*-?+D+.(3<.-$8"=("2$B+7( <-(<*+(@*=326#"2<=(-/ (<*+(2$*#12<+7(+$D2.-$&+$<'


!"#$%&'()*+(,-%.$#"(-/ (0.1#$23&(4(5-$/+.+$6+(!.-6++72$83

;(7+328$(#<<.-#6*(=*#=(#2&3(=-(+&1.#6+(3%6*(6-$72=2-$3>(3*-%"7(.+/+.(=-(=*+(6-$3=.%6=2-$(-/ (#(<.-=-6-"(#3( #(6-$6+<=%#"(3=.%6=%.+(?2=*2$(?*26*(=*+(#.6*2=+6=@6%.#=-.(6#$(3%.A+B(#$7(-.8#$2C+(=*+(1+*#A2-.(-/ (&%"=2<"+( DFWRUVDQGYDULDEOHVLQDÁH[LEOHDQGRSHQZD\7KHSURWRFROLVDVHTXHQFHRI DFWLRQVUHODWHGWRDFHUWDLQ $%&1+.(-/ (#8+$=3(?*-(+$#6=(=*+2.(1+*#A2-.3(#"-$8(#(=2&+"2$+'()*+(%3+(-/ (<.-=-6-"3(#3(7+328$(8%27#$6+(/-.( VSDWLDOHQYLVDJHDQGFRQÀJXUDWLRQDOORZVDVPRRWKLQWHUFKDQJHEHWZHHQWKHWKUHHZRUOGVFRQFHSWXDOL]HGE\ D.+8-.B(E#=+3-$F(=*+(<.-=-6-"(2$=+$73(=-(2$=+."-6G(=*+(?-."7(-/ (=*+(&#=*+&#=26#"(&-7+"3(H!"+.-&#I>(?2=*( =*+(?-."7(-/ (=*+(+A-"%=2-$(HJK=+.$#"(?-."7I>(=*.-%8*(=*+(L$=+.$#"(?-."7(-/ (27+#3(#$7(6-$6+<=>(=*+(?-."7(-/ ( =*-%8*=3'( JK#&<"+3(-/ (<.-=-6-"3(+K<"-2=+7(2$(%.1#$(#$7(#.6*2=+6=%.#"(<.-M+6=3(#3(#(&+#$3(=-(-<+$(=*+(7+328$(<.-6+33( WRJHQHULFXVHUVDQGVWDNHKROGHUVFDQEHIRXQGLQWKHZRUNRI WKH%ULWLVKÀUP5*-.#(/-.(=*+(+$+.8B(&#3=+.@ <"#$(-/ (=*+(5*2$+3+(62=B(-/ (N2#&+$>(-.(=*+(.+6+$=(<.-M+6=(<.-<-3+7(1B(J6-"-826(O=%72-(/-.(=*+(2$3=#""#=2-$( P'Q'R')'0'O'(5B1+.8#.7+$>(%32$8(3-62#"(&+72#(#$7(#"8#+(<"#$=#=2-$3(HE%""2A#$=>(STUSI'(E%=(2=(23(<.-1#1"B(2$( =*+(=.#72=2-$(-/ (=*+(;&+.26#$(.+<.+3+$=#=2A+3(-/ (=*+(V#$736#<+(#$7(J6-"-826#"(0.1#$23&(&-A+&+$=(=*#=( =*23(=B<+(-/ (W3B3=+&26(=*2$G2$8X(23(<#.=26%"#."B(<.-&-=+7(#$7(#<<"2+7(=-(%.1#$(<.-M+6=3'(L$=+.+3=2$8(#.+(=*+( <#.#728&3(<.-<-3+7(1B(,#&+3(5-.$+.(#$7(*23(8.-%<(Y2+"7(Q<+.#=2-$>(2$(*23(<.-M+6=(Y.+3*(Z2""3(/-.(=*+(.+@ FODLPRI WKHJDUEDJHGXPSRI 6WDWHQ,VODQG1HZ<RUN :DOGKHLP RUKLVFROODERUDWLRQZLWK'LOOHU DQG6FRÀGLRIRUWKHZRUOGUHQRZQ+LJK/LQHLQ1HZ<RUN7KHSDUDGLJPVFRQWDLQHGLQ$ODQ%HUJHU'URVV O6#<+F([#3=2$8(V#$7(2$(0.1#$(;&+.26#(HSTT\I(#"3-(-//+.(A#"27(&-7+"3(-/ (<.-=-6-"3(/-.(=*+(#6=2A#=2-$(-/ ( <.-6+33+3(-/ (+6-"-826#"(#$7(3-62#"(.+8+$+.#=2-$(2$(6.2=26#"(#.+#3'( )*+(3=.#=+826(2$=+8.#=2-$(-/ (3B3=+&26(7+328$(#$7(=*+(A2.=%#"(?-."7(-/ (7#=#(#$7(2$/-.&#=2-$(6#$(%3+(7282=#"( =+6*$-"-82+3(=-(2&<"+&+$=(=*+(#6=2A#=2-$(-/ (<.-6+33+3(-/ (3<#=2#"(.+6"#2&'(;(3=#=+(-/ (6-$$2A#$6+(3*-%"7(1+( +3=#1"23*+7(1+=?++$(=*+(2$=+./#6+>(=*+(<.-M+6=(#$7(=*+(%3+.3>(/-.(=*+(%3+.(=-(/++"(2$=+.+3=+7(#$7(2$A-"A+7(2$( WKHDFWLYDWLRQRI WKHSURMHFWLWVHOI7KHGHVLJQRI WKHLQWHUIDFHFRXOGUHÁHFWRQWLPHDVDPDMRUYDULDEOHIRU =*+(7+A+"-<&+$=(-/ (=*+(-<+.#=2-$'()*+(72//%32-$(-/ (2$/-.&#=2-$(#$7(36+$#.2-3(-/ (%3#8+(#"-$8(#(=2&+"2$+( 6#$(/.#&+(#(<#.#""+"(1+=?++$(<"#6+3(#$7(<+-<"+]3(#8+$7#(2$=+8.#=2$8(-$+(?2=*(=*+(-=*+.>(2$(-.7+.(=-(&#G+( =*+(<%1"26(3<#6+(#$(+//+6=2A+(3<#6+(/-.(<+-<"+]3(+K<.+332-$(#$7(#&%3+&+$='(Y2$#""B(#(6-$$+6=2-$(?2=*(=*+( <*B326#"(+$A2.-$&+$=(3*-%"7(1+(3-%8*=(1B(=*+(2$=+./#6+(#3(2/ (=*+(A2.=%#"(#&12+$6+(-/ (7282=#"(2$/-.&#=2-$(?#3( *#A2$8(#(=#6=2"+(.+3-$#$6+(-$(=*+(1%2"=(+$A2.-$&+$='

!"##$%&#'( 5%..+$=( 2$/-.&#=2-$( #$7( 6-&&%$26#=2-$( =+6*$-"-82+3( #&<"2/B( =*+( <-33212"2=B( -/ ( %3#8+( #$7( 72//%32-$( -/ ( <.-=-6-"3(/-.(=*+(62=B(=*.-%8*(7282=#"(2$=+./#6+3(#$7("-6#=2A+(&+72#'(L=(23(=*+$(/-.(=*+(#.6*2=+6=@6%.#=-.(=-( 6#.+/%""B(6*--3+(=*+(+"+&+$=3(*+(?#$=3(=-(2$6"%7+(2$(=*+(<.-=-6-"(/-.(=*-3+(#<<"26#=2-$3>(2$(-.7+.(=-(*#.&-@ QLFDOO\FRQGXFWWKHXVHUVWRZDUGWKHGLVFRYHU\RI DVSHFLÀFTXDOLW\RI WKHODQGVFDSHDKLGGHQDPELWLRQRI  =*+(8+-8.#<*B(-.(#(6#<=2A#=2$8(*23=-.B(+&1-72+7(2$=-(=*+(=-<-8.#<*B(-/ (-%.(62=2+3'(L$(=*23(?#B>(=*+(#<<"26#@ =2-$(3*-%"7(.+6.+#=+(#(3+$3+(-/ (6-$$2A#$6+(=-?#.7(=?-(<-3321"+(72.+6=2-$3F(6-$$2A#$6+(1+=?++$(%3+.3(#$7( 2$=+./#6+3(H=*+(%3+.(1+6-&+3(W#7726=+7X(=-(=*+(%3+(-/ (=*+(2$=+./#6+I>(#$7(1+=?++$(=*+(A2.=%#"(#<<"26#=2-$(#$7( =*+(&#=+.2#"(?-."7(-/ (#.6*2=+6=%.#"(+"+&+$=3(H7#=#(#.+(+K=.#<-"#=+7(/.-&(=*+(.+#"2=B(1B(3+$32$8(=--"3(?*26*( #.+(+&1-72+7(2$(=*+("#$736#<+>(#$7(?*-3+(#""-6#=2-$($++73(=-(1+(6*-3+$(#$7(7+328$+7I'(

!)*"#"+*&),)*+(6-"-$2C#=2-$(2$(62=2+3(-/ (#A#2"#1"+(3<#6+3U(-/=+$(*#<<+$3(#66-.72$8(=-(=*+(#12"2=B(-/ (<+-<"+(=-(6-$6+<@ =%#"2C+(#$7(.+6-8$2C+(=*+(<"#6+3(=*+B(#.+(#1-%=(=-(-66%<B'(;"3->(=*+(#<<.-<.2#=2-$(-/ (#(3<#6+(?*26*(23(<%1"26( RUVHPLSXEOLFLVFRQFHQWUDWHGLQVSHFLÀFWLPHVRI WKHGD\IROORZLQJDWLJKWVFKHGXOHRI HYHQWVDQGHQJDJH@  )RU D GHÀQLWLRQ RI  WKH ´DYDLODEOH VSDFHµ VHH DOVR 5DIIDHOH 3p   2UJDQL]HG 1HWZRUNV DQG WKH LPDJH RI  =*+( J%.-<+#$( #.6*2<+"#8-'( )-?#.73( #( $+?( 8+-<-"2=26#"( 36+$#.2-( #$7( 2=3( .+"+A#$6+( 2$( =*+( <+.6+<=2-$( -/ ( =*+( 1%2"=( +$A2.-$&+$=>(^+$26+>(L0;^'

!"#$%&'()*+(,-%.$#"(-/ (0.1#$23&(4(5-$/+.+$6+(!.-6++72$83


&+$;3(;*#;(+#6*(<+.3-$(6#.+/%""=(#$$-;#;+3(-$(*23(#8+$7#'( )*+( -<<-.;%$2;=( 82>+$( 1=( 3-62#"( &+72#( #$7( 2$/-.&#;2-$( ;+6*$-"-82+3( *+"<3( ;*+( %3+.3( 2$( 6-2$6272$8( ;*+2.( #8+$7#(?2;*(;*+(-$+(-/ (;*+(7+328$+7("#$736#<+@(8+;;2$8(;*+&(;-(A$-?(2;3(2$$+.(.*=;*&3@(;.288+.+7(+6-"-826#"( #$7(3-62#"(<.-6+33+3@(;*+(+&+.8+$6+(-/ (1-;;-&B%<(+>+$;3(-/ (3<#;2#"(;.#$3/-.&#;2-$@(#$7(;*+(<-33212"2;=(/-.( $+?(3;#A+*-"7+.3(;-(3+;;"+(2$(%$+C<+6;+7("-6#;2-$3'()*+(<.-D+6;(-/ (7282;#"(;+6*$-"-82+3(#$7("#$736#<+(7+B 328$(7.#?3(#(6*.-$-8.#<*=(-/ (;*+(62;=(#$7(2;3(2$*#12;#$;3(;-(<.2&+($->+"(?#=3(#$7(;2&+3(/-.(+$6"-3%.+(#$7( #//+6;2-$(.+"#;+7(;-(#(<%1"26(3<#6+'((((

!"#$%&'()'*+,",#' 'LJLWDOGDWDDUHLPPDWHULDOLQIRUPDWLRQZKLFKFDQKDYHDUHOHYDQWHIIHFWRQSK\VLFDOHQYLURQPHQWVLI UHIHUB .+7(;-(;*+(%3+(-/ (&#;+.2#"("#$736#<+3(#$7(3<#6+3'(E66+33212"2;=(#$7(%3#8+(-/ (#(<"#6+(6#$(+$#6;(;*+(/.%2;2-$(-/ ( WKHVSDFHE\GLIIHUHQWÁX[HVRI XVHUVRYHUWKHWLPHIRUGLIIHUHQWSXUSRVHV2QWKHORQJWHUPVXFKÁX[HV FRQÀJXUHWKHVSDFHDFFRUGLQJWRSUHIHUUHGWUDMHFWRULHVWKDWLQWHUFHSWYDULRXVW\SHVRI UHVRXUFHVIROORZLQJ ;*+($++73(-/ (;*+(3#&+(%3+.3' )*+(#?#.+$+33(#$7(;*+(&#$#8+&+$;(-/ (;*+(7+>+"-<&+$;(-/ (6+.;#2$(&28.#;2-$3(#$7(&->+&+$;3(?2;*2$(;*+( 62;=(6#$(1+(#(%3+/%"(7+328$(2$3;.%&+$;(/-.(;*+(;.#$3/-.&#;2-$(-/ (6+.;#2$(3-62#"(#$7(+$>2.-$&+$;#"(1+*#>2-.3'( 5-%<"2$8(;*+(7282;#"(<.-D+6;(?2;*(#(&#;+.2#"(+C;+$;(;*#;($++73(;-(1+(3*#<+7(#$7(7+>+"-<+7(F;*+("#$736#<+G(6#$( 1+(#$(+//+6;2>+(3;.#;+8=(/-.(;*+(.+8+$+.#;2-$(-/ (6.2;26#"($+8"+6;+7(#.+#3'()*23(?-%"7(#""-?(#(7+8.++(-/ (#7#<B ;#12"2;=(#$7(7+627#12"2;=(-/ (;*+(<"#$(;-(;*+(&#D-.(-<+.#;-.3@(?2;*-%;(2&<-32$8(#(*2+.#.6*26#"($-.(+>-"%;2-$#.=( /.#&+?-.A@(#66-.72$8(;-(#(6-""#1-.#;2>+(#<<.-#6*' (

-'*%.,(*$)"$'.%'*(/+)(*0")$')(1)2",%*03(4%&",(5)'',670")$ )*+(/-""-?2$8(6#3+(3;%7=(23(#(7.#/;(<.-D+6;(6-$6+2>+7(/-.(;*+(&%$262<#"2;=(-/ (H2"#$(2$(6-""#1-.#;2-$(?2;*( !-"2;+6$26-(72(H2"#$-('$6W8@(;*+(I.++$(52;=(J;#"2#(/-%$7#;2-$K(#$7(;*+("#$736#<+(#$7(#.6*2;+6;%.#"(<.#6;26+( /$1''()*+(<.-<-3#"(#2&3(;-(82>+(;-(;*+(62;=(-/ (H2"#$(#(/.#&+?-.A(/-.(;*+(7+>+"-<&+$;(-/ (3&#.;+.(3;.#B ;+82+3(-/ (%.1#$(.+8+$+.#;2-$(+C<"-2;2$8(7282;#"(;+6*$-"-82+3(#$7(&-$2;-.2$8(3=3;+&3(+&1-72+7(?2;*2$(;*+( 8.++$("#$736#<+(-/ (;*+(1%2";(+$>2.-$&+$;' )*+(<.-<-3#"(23(1#3+7(-$(#(7%#"(#<<.-#6*(?*26*(3++3(2$;+8.#;+7(>2.;%#"(#$7(<*=326#"(-<+.#;2-$3(#3(6-&<"+B &+$;#.=(+$;2;2+3(/-.(;*+(7+328$(-/ (3&#.;(#$7(3%3;#2$#1"+(3;.#;+82+3(-/ (%.1#$(.+6"#2&'()*+(2$;+.7+<+$7+$6=( +3;#1"23*+7(1+;?++$(;*+(;?-(+"+&+$;3(-/ (;*+(6-&<-32;2-$(2$;+$73(;-(+C<.+33(;*+(2$6"%32>+($#;%.+(-/ (;*+(;?-( PRGHOVIRUWKHIXOÀOOPHQWRI WKHSXUSRVHVRI UHJHQHUDWLRQRI XUEDQFULWLFDOLWLHVIROORZLQJDPHWKRGZKLFK 23(1-;*(2$;+.#6;2>+(#$7(-<+$'

5)'',(70")$(8&", 7KHSURMHFWFRQVLVWVLQWKHUHDOL]DWLRQRI DJUHHQQHWZRUNRI SDUNVDQGRSHQSXEOLFVSDFHVLGHQWLÀHGDURXQG &+;.-<-"2;#$(#.+#(-/ (H2"#$@(2$6"%72$8($+8"+6;+7(#.+#3@(<.+3+$;2$8(<#.;26%"#.(+$>2.-$&+$;#"(#$7(%.1#$(6.2;2B 6#"2;2+3'()*+($+;?-.A(?2""(*#>+(2;3(/-6%3(-$(#($%&1+.(-/ ($-7+3@(6#""+7(L&#.;(52;=(!-2$;3@(?*+.+(#(.+&#.A#1"+( 6-$6+$;.#;2-$( -/ ( 3+.>26+3@( 2$/-.&#;2-$@( #$7( "-823;26( /#62"2;2+3( ?2""( .+<.+3+$;( ;*+( 3;#.;2$8( <-2$;3( ;-( 3<.+#7( 8--7(<.#6;26+(2$(;*+(7+328$(-/ (;*+(%.1#$("#$736#<+(#$7(;*+(<%1"26(.+#"&'()*+(3=3;+&(?2""(1+(2&<"+&+$;+7( #$7(#6;%#;+7(+C<"-2;2$8("-6#;2>+(&+72#(#$7(7282;#"(;+6*$-"-82+3(;-(8+$+.#;+(<.-6+33+3(-/ (+$>2.-$&+$;#"(2&B <.->+&+$;@(#$7(1+;;+.&+$;(2$(%.1#$(#66+33212"2;=(#$7(%3#12"2;='( I.++$(L&#.;(!"#$(FJ&#8+(MG(?2""(2$;+.6-$$+6;(8.++$(.#72#"(6-..27-.3(;*#;("2$A(;*+(6-$3-"27#;+7(*23;-.26#"(6+$B ;.+(-/ (;*+(62;=(?2;*(2;3(<+.2<*+.=(#$7(2;3(#8.26%";%.#"("#$7@(#(.2$8(-/ (<#.A3@(-"7(?#;+.?#=3(#$7(3N%#.+3(#.-%$7( ;*+(6+$;.+@(#$7(;*+(L&#.;(52;=(!-2$;3@(;*.-%8*(#$(+C;+$32>+(#<<#.#;%3(-/ (<#;*3(#$7(.-%;+3(/-.(3%3;#2$#1"+( DQGHFRORJLFDOPRELOLW\ ELNHVKDULQJJUHHQSXEOLFWUDQVSRUWVSHGHVWULDQSDWKZD\VDQGF\FOHODQHV 'LJLWDO K( )*+(6-$;+$;3(.+"#;+7(;-(;*+(I.++$(L&#.;(!"#$(*#>+(1++$(7+328$+7(1=(E$7.+#3(O2<#.(#$7(E$$#(E.2-"2(/-.(I.++$(52;=( J;#"2#'((


!"#$%&'()*+(,-%.$#"(-/ (0.1#$23&(4(5-$/+.+$6+(!.-6++72$83

;+6*$-"-82+3(#$7(3+$32$8(3<3;+&3(=2""(1+(+&1+77+7(=2;*2$(;*+(8.++$($+;=-.>(;-(+#3+(;*+(3?#;2#"(?+./-.&#$@ 6+(#$7(;*+(#66+33212"2;<(;-(6.2;26#"("-6#;2-$3'

!"#$%&$"'( ")'(*"%+,"-%.,"/+(.%)*.01*0.$) )*+(&#2$(-1A+6;2B+(-/ (;*+(6-$3;.%6;2-$(-/ (;*+($+;=-.>(=2""(1+(;*+(6-$3-"27#;2-$(-/ (;*+(?%1"26(3?#6+(=2;*2$( ;*+(62;<(-/ (C2"#$D(2$;+.?.+;+7(#3(#(6-""+6;2B+(&++;2$8(3?#6+(-/ (+E6*#$8+(#$7(=+""1+2$8D(#(?"#6+(=*+.+(%.1#$( ?+.&+#12"2;<(#$7(?-.-32;<(6#$(1+(/-3;+.+7D(#$7(#("-6#;2-$(/.-&(=*26*(;*+(62;<(2;3+"/ (6#$(1+(.+@;*-%8*;(#$7( .+8+$+.#;+7'( F%6*(3<3;+&(=2""(1+(6*#.#6;+.2G+7(1<H Â&#x2021; I28*(#B#2"#12"2;<(-/ (3?#;2#"(2$/-.&#;2-$(#$7(#=#.+$+33(J;*+(6-$;.21%;2-$(-/ (;*+(;+6*$-"-8<K Â&#x2021; !.+7-&2$#$6+(-/ ($#;%.#"(+"+&+$;3(+3?+62#""<(=2;*2$(;*+(1%2";(+$B2.-$&+$;(J;*+("#$736#?+K Â&#x2021; Â&#x2021; )*+(#6;%#"(2$;+.6-$$+6;2-$(-/ (#""(;*+3+(3?#6+3D(=2""(1+(6.+#;+7(1<(A-2$;3(#$7($-7+3(-/ (#(7-%1"+(#$7( 2$;+8.#;+7($#;%.+H( Â&#x2021; L+#"(#$7(?*<326#"(J*#.7(2$/.#3;.%6;%.+K(M(;*+(7+328$+7("#$736#?+D(=2;*(?+7+3;.2#$(.-%;+3(#$7(6<6"+("#@ $+3D(8.++$(3<3;+&3(-/ (B#.2-%3(36#"+(#$7(N%#"2;<D(?#.>3(=2;*(?%1"26(3+.B26+3(=2;*(;+6*$26#"(;--"3(/-.(;*+( ?.-7%6;2-$(-/ (.+$+=#1"+(+$+.8<(J3-"#.(?#$+"3D(=2$7(/#$3KD(12>+(3*#.2$8(?-2$;3D(#.+#3(;-(3;-?(1<(#$7( .+6-8$2G+(;*+(6-&?"+E2;<(-/ (;*+(62;<(#$7(2;3(+$B2.-$&+$;'((( Â&#x2021; O2.;%#"(#$7(2$/-.&#;2-$#"(J3-/;(2$/.#3;.%6;%.+K(M(3+$32$8(#$7(&-$2;-.2$8(3<3;+&3(/-.(3+"+6;+7(?#.#&+@ WHUVDQGLQGLFDWRUVÃ&#x20AC;[HGRUPRYDEOHIRUWKHSXEOLFDGPLQLVWUDWLRQWRDFWXDWHJRYHUQDQFHSURFHVVHVIRU ;*+(.+8+$+.#;2-$(#$7(;*+(;.#$3/-.&#;2-$(-/ (;*+(62;<D(3&#.;(?*-$+(#$7(;#1"+;(#??"26#;2-$(6-$6+2B+7(#3( #$(-?+$(3-%.6+(?"#;/-.&(/-.(;*+(%3+.(;-(+E?.+33(?.+/+.+$6+3(#$7(1+*#B2-.3(#$7(;-(#66+33(3+.B26+3(#$7( 2$/-.&#;2-$(.+"#;+7(;-(;*+(62;<(#$7(/#62"2;2+3(-//+.+7(1<(;*+(?.-A+6;'

23%.*"4$5"/+*$.(%1$" )*+(F&#.;(P+<(2$;+./#6+(=2""(1+(7+328$+7(;-(&#>+(%3+.(/.2+$7"<(#$7(6%3;-&#1"+(#""(;*+(/+#;%.+3(?.+3+$;+7( E\WKH*UHHQ6PDUW3ODQWKDWWKHXVHUVFDQEHQHÃ&#x20AC;WIURP$FHUWDLQOHYHORI LQWHUDFWLYLW\ZLOOEHDOORZHGIRU ;*+(%3+.3(;-(.+?-.;(?.+/+.+$6+3(#$7(2$;+.+3;3(.+"#;+7(;-(;*+2.(#6;%#"(%3+(-/ (;*+(?%1"26(.+#"&'(Q$/-.&#;2-$(#$7( 7#;#(6-""+6;+7(#$7(72//%3+7(1<(;*+(#??"26#;2-$(=2""(1+(#B#2"#1"+(/-.(/.++(/-.(#""(;*+(3;#>+*-"7+.3(2$B-"B+7(;-( #6;%#;+(;*+(R.++$(F&#.;(!"#$D(/-""-=2$8(7+32.+3(#$7(#&12;2-$3(=*26*(1+"-$8(;-(;*+(%.1#$(6-&&%$2;<'()*+( SODQZLOOUHSUHVHQWDVHWRI JHRUHIHUHQFHGJXLGHOLQHVRI SRVVLEOHVSDWLDOFRQÃ&#x20AC;JXUDWLRQVWKDWZLOODVVXPH B#.2-%3(3*#?+3(#$7(;.#A+6;-.2+3D(#7#?;2$8(;*+2.(3;.%6;%.+(#66-.72$8(;-(;*+(/++73(.+6+2B+7(1<(;*+(%3+.3(#$7(;*+( 3;#>+*-"7+.3'(( )*+(#??"26#;2-$(=2""(?.-B27+(#(3+.2+3(-/ (>+<(3+.B26+3(#$7(2$/-.&#;2-$D(/%$7#&+$;#"(;-(7236"-3+(;*+(?-;+$;2#@ "2;2+3(8#;*+.+7(=2;*2$(;*+(62;<(#$7(;*+(R.++$(F&#.;(!"#$H Â&#x2021; Q$;+.#6;2B+( &#??2$8( -/ ( ;*+( R.++$( F&#.;( !"#$( J8.++$( 6-..27-.3D( 8.++$( .2$8( #$7( 3&#.;( 62;<( ?-2$;3KD( 6-$;#2$2$8(#""(;*+(2$/-.&#;2-$(.+"#;+7(;-(;*+(#B#2"#1"+(3+.B26+3D(?#;*3(#$7($-7+3(-/ (&-12"2;<'(S#6*(%3+.( =2""(1+(#1"+(;-(/.++"<(2$;+8.#;+(;*+(?"#$(+E?.+332$8(.-%;+3(?.+/+.+$6+3(#$7(#??.+62#;2-$(-/ (;*+(6*-3+$( "-6#;2-$3' Â&#x2021; 'DWDDQGLQIRUPDWLRQUHODWHGWRWKHHQYLURQPHQWDOTXDOLW\RI WKHSODFHVWKHFRQGLWLRQRI SHFXOLDULW\ #$7(;*+(?-3321"+(6.2;26#"2;2+3(-/ ($+8"+6;+7(#.+#3D(+E?"-2;2$8(;*+($+;=-.>(-/ (3+$3-.3(#??"2+7(;-(+#6*(3&#.;( 52;<(!-2$;' Â&#x2021; I23;-.26#"( #$7( 6%";%.#"( 2$/-.&#;2-$( /-.( ;-%.23&( #$7( ;*+( $#B28#;2-$( -$( ;*+( ;+..2;-.<D( ;*.-%8*( &-$%@ &+$;3(#$7(3<3;+&3(-/ ($#;%.#"23;26(#;;.#6;2-$3(723?+.3+7(2$(;*+(%.1#$(.+82-$(-/ (C2"#$' Â&#x2021; 'DWDUHJDUGLQJDFFHVVLELOLW\DQGSRVVLELOLW\RI DSSURSULDWLRQLQVSDFHDQGWLPH FKURQRJUDSK\ RI SDUNV .-%;+3D($#;%.#"(+$6"#B+3D(=#;+.=#<3D(%.1#$(#""-;&+$;3(+;6' Â&#x2021; T+23%.+(-??-.;%$2;2+3D(2$6"%72$8(6%";%.#"(+B+$;3D(?+.&#$+$;(-.(;+&?-.#.<D(#.;23;26(+E?.+332-$3(.+"#;+7(;-( ;*+(?%1"26(3?#6+3(-/ (+$6-%$;+.(#$7(+E6*#$8+'

!"#$%&'()*+(,-%.$#"(-/ (0.1#$23&(4(5-$/+.+$6+(!.-6++72$83


‡ 'LJLWDONH\VWRDFFHVVELNHVKDULQJDQGJUHHQSXEOLFWUDQVSRUWVZLÀVSRWVSXEOLFVHUYLFHV ‡ !-33212"2;<(-/ (3*#.2$8(2$/-.&#;2-$(=.-7%6+7(1<(;*+(%3+.3(#$7(;*+(3+$32$8($+;>-.?(/-.(#$#"<;26(#$7(=.-@ &-;2-$#"(=%.=-3+3A(1-;*(/-.(/.++(-.(-$(#(/++(6*#.8+A(-$(;*+(1#323(-/ (=%1"26B=.2C#;+(2$;+.+3;' )*+(%3+.(>*-(7->$"-#73(;*+(#=="26#;2-$(>2""(1+(#1"+(;-D( ‡ E$;+.#6;(>2;*(;*+(7+328$+7("#$736#=+A(#66+332$8(2;(>2;*(&-.+(#>#.+$+33(-/ (;*+(3-%.6+3(#$7(;*+(.+3-%.6+3( -//+.+7(1<(;*+(F.++$(G&#.;(!"#$A(>2;*(;*+(=-33212"2;<(-/ (=#.;262=#;2$8(2$(7+6232-$(&#?2$8(#$7(%.1#$( ;.#$3/-.&#;2-$(=.-6+33+3' ‡ !.-C27+(=.+62-%3(2$/-.&#;2-$(-$(+&+.82$8(=#;;+.$(-/ (%.1#$(.+6"#2&A($+>(6-$;+$;3(#$7(=.+/+.+$6+3A( 2&&+72#;+"<(.+"+C#$;(#$(-=+$(=.-6+33(-/ (8-C+.$#$6+(-/ (;*+(62;<A(#$7(;-(C+.2/<(#$7(.+C23+(;*+(=.-H+6;(2$( 2;3(7+C+"-=&+$;' )*+(-==-.;%$2;<(82C+$(;-(;*+(%3+.3(;-(3*#.+(2$/-.&#;2-$(#$7(6-&&+$;3(-$(;*+(="#$(#$7(-$(2;3(+"+&+$;3A( >2""(#""->(#(6-$3;#$;(.+C232-$(#$7(C#.2#;2-$(-/ (;*+(7+328$+7(3;.%6;%.+A(#66-.72$8(;-(;*+(#&12;2-$3(-/ (+#6*( FRQWULEXWRUVIRUWKHEHQHÀWRI DPRUHKRVSLWDEOHKDELWDWERWKQDWXUDODQGDUWLÀFLDO

!"#$%##"&'()'*($&'$+%#"&'# )*+(*277+$(=-;+$;2#"(#$7(;*+(3%66+33(-/ (#(="#6+(23(#">#<3(.+"#;+7(;-(;*+(#12"2;<(/-.(2;3("#$736#=+(;-(+I=.+33( DQGFRPPXQLFDWHLWVTXDOLWLHVWKURXJKYDULRXVFKDQQHOVDFFRUGLQJWRLWVVSHFLÀFFKDUDFWHULVWLFVZKDWFRQ@ VWLWXWHVLWVFRQWH[WZKLFKUHVRXUFHVDUHH[SORLWDEOHDQGDYDLODEOHKRZÁH[LEOHDQGKRZLQWHJUDWHGZLWKD 8.+#;+.(3;.%6;%.+(-.(3<3;+&(;*+("#$736#=+(23'( )*+(2$;+.>+#C+(-/ (7282;#"(;+6*$-"-82+3(#$7("#$736#=+(7+328$(6#$(8+$+.#;+(#(;<=+(-/ (=.-H+6;(>*-3+(6-&&%@ QLFDELOLW\LVUHPDUNDEO\LQWHQVLÀHGDQGDXJPHQWHG7KHVSUHDGRI LQIRUPDWLRQDQGGDWDDERXWDSODFHWKH 2&&#;+.2#"(+//+6;(-/ (;*+(%3+(-/ ("-6#;2C+(&+72#(+&1-72+7(>2;*2$(;*+("#$736#=+(6#$(2$6.+#3+(;*+(-==-.;%$2;<( -/ (1%2"72$8(3=#;2#"(#>#.+$+33(#$7(#==.+62#;2-$(#&-$8(2;3(%3+.3' )*+("#$736#=+(23(*+.+(2$;+.=.+;+7(#3(#(12@72&+$32-$#"(;*26?(;+I;%.+(-/ (.+"#;2-$3*2=3(1+;>++$(#8+$;3(-=+.#@ WLQJLQFROOLGLQJFRPSOH[V\VWHPV $OOHQ DQRSHQÀHOGZKLFKLVÁH[LEOHHQRXJKWRUHFHLYHDQGORFDWH "-$8( =.-6+33+3( -/ ( 3=#;2#"( ;.#$3/-.&#;2-$( #$7( .+8+$+.#;2-$'( )*+( -=+$$+33( -/ ( ;*+( "#$736#=+A( 2;3( 6-$3;#$;( 7<$#&23&A(#$7(;*+(.+C+.321"+($#;%.+(-/ ((2;3(+"+&+$;3(#.+(;*+(/%$7#&+$;#"(=.+&23+3(/-.(2;3(=+./-.&#$6+(#3( =.++&2$+$;(=*<326#"(&+#$3(/-.(%.1#$(.+6"#2&'(J"3-(;*+("#$736#=+(23(#1"+(;-(;.288+.(=.-6+33+3(-/ (+6-"-826( PHWDEROLVPDQGUHJHQHUDWLRQIRUWKHEHQHÀWRI PXOWLSOHHFRV\VWHPV7KHDUFKLWHFWFXUDWRUVKRXOGEHKLJKO\ #>#.+(-/ (;*23(6#=#62;<(>*+$(#==.-#6*2$8(#($+>(=.-H+6;(-/ (;+..2;-.2#"(C#"-.2K#;2-$'( L2$#""<A(#(=.-H+6;(2$;+.+3;+7(2$(2$;+.6+=;2$8(;*+(C2.;%#"(>-."7(-/ (;*+(2$;+.$+;(#$7(3+$3+7(7#;#A(3;#.;2$8(/.-&( ;*+(&#;+.2#"(6-$72;2-$(-/ (#.6*2;+6;%.+(#$7(;*+("#$736#=+A($++73(;-(+&1.#6+(;*+(27+#(;*#;(+C+.<(="#$(7+328$+7( #(=.2-.2A(3*-%"7(1+(2$(3-&+(>#<(#7#=;2C+(#$7(+72;#1"+A(2$(-.7+.(;-(#13-.1(6*#$8+3(#$7(;.#$3/-.&#;2-$3(3%=@ =-.;+7(1<(;*+("#$736#=+'(J(="#$(8+$+.#;+7(32&="<(#$#"<K2$8(;*+(.+#"2;<(/.-&(;*+(=-2$;(-/ (C2+>(-/ (2;3(=+.6+=@ ;21"+(6*#.#6;+.23;263A(>2""(#">#<3(1+("+33(-1H+6;2C+(#$7(2$6"%32C+(;*#$(#(=.-H+6;(;*#;(;+$73(;-(2$6-.=-.#;+(=#.;2@ 62=#;+7(-=2$2-$3A(=.+/+.+$6+3(#$7(3*#.+7(1+"2+/3'()*+(=.-H+6;(3*-%"7(#""->(7282;#"(;+6*$-"-82+3(#$7(3+$32$8( 3<3;+&3(;-(#66-&="23*(;*+(="#$A(=.-C272$8(2$/-.&#;2-$(7+.2C+7(/.-&(8+$+.26(%3+.3(#$7(3;#?+*-"7+.3(M%$7+.( ;*+(3%=+.C232-$(-/ (;*+(6%.#;-.B=%1"26(#7&2$23;.#;-.N(;*#;(6#$(&-72/<(#$7(2&="+&+$;(;*+(7+C+"-=&+$;(-/ (2;3( ;-=-8.#=*26(=#;;+.$(#3(>+""(#3(2;3(8+-&+;.26(3;.%6;%.+'(


!"#$%&'()*+(,-%.$#"(-/ (0.1#$23&(4(5-$/+.+$6+(!.-6++72$83

!"#$%&'((4(:2"#$-(;.++$(<&#.=(!"#$>(?#882(@+.72(#$7(A$8.#$#882'(B$("#$736#C+(#$7(%.D 1#$(C.-E+6=(F*26*(F2""(1+(=*+(3=#.=2$8(.+/+.+$6+(/-.(7+G+"-C&+$=(-/ (:2"#$(;.++$H<&#.=

!"#"$"%&"' ())*' B""+$(<'>(IJKKKL(3RLQWV/LQHV'LDJUDPVDQG3URMHFWVIRUWKH&LW\>(M+F(N-.O>(!.2$6+=-$(B.6*2=+6=%.#"(!.+33' P#=+3-$(;'>(IJK9QL(6WHSVWRDQ(FRORJ\RI 0LQG'(5*26#8->(0$2G+.32=R(-/ (5*26#8-(!.+33' P+.8+.(B'>(IQSSTL('URVV6FDSH:DVWLQJ/DQGLQ8UEDQ$PHULFD>(M+F(N-.O>(!.2$6+=-$(B.6*2=+6=%.#"(!.+33' P%.O+(B'>(IQSS9L(1HWZRUN3UDFWLFHV(M+F(N-.O>(!.2$6+=-$(B.6*2=+6=%.#"(!.+33' 2EULVW+8  $%ULHI +LVWRU\RI &XUDWLQJ>(U-$7-$>(,!?(?2$82+.' !-.=%8#"2(,'>(IQSSSL(6HOI2UJDQL]DWLRQDQGWKH&LW\(M+F(N-.O>(<C.2$8+.' !.26+(5'>(IQSSTL(5H&3>(V%.26*>(P2.O*W%3+.'( 6KDQH'*  8UEDQ'HVLJQVLQFHD*OREDO3HUVSHFWLYH>(M+F(N-.O>(X2"+RH<-$3' <*+CC#.7(:'>(IQSJJL'(6HQWLHQW&LW\>(M+F(N-.O>(:A)(!.+33'( X#"7*+2&(5'>(IQSSTL'(7KH/DQGVFDSH8UEDQLVP5HDGHU>(M+F(N-.O>(!.2$6+=-$(B.6*2=+6=%.#"(!.+33'( +$,-&."' P%$36*-=+$(?'>(H(B7#&3>(,(IQSJJL'(7RXFKLQJWKH6HFRQG6NLQ*DPH6HW0DWFK,, /"01'-,"' P%""2G#$=(U'>(IQSJQL'+25786D&\EHUJDUGHQ>('RPXVZHE(


!"#$%&'()*+(,-%.$#"(-/ (0.1#$23&(4(5-$/+.+$6+(!.-6++72$83


Atti della XV Conferenza Nazionale SIU SocietĂ Italiana degli Urbanisti Pescara, 10-11 maggio 2012

Lâ&#x20AC;&#x2122;Urbanistica che cambia. Rischi e valori

by Planum. The Journal of Urbanism ISSN 1723-0993 | n. 27, vol. 2/2013

Conference Proceedings Living landscapes | Full Papers Section 8 | by Planum n.27 vol. 2/2013  

Living territories Defining areas for intervention is the first step in planners' and designers' activities. The regional approach in selec...

Conference Proceedings Living landscapes | Full Papers Section 8 | by Planum n.27 vol. 2/2013  

Living territories Defining areas for intervention is the first step in planners' and designers' activities. The regional approach in selec...
