Page 1


DOMUS Architects

Builders

555 Virginia Road, Concord, MA 01742

Development

978/369-0077

www.domus-inc.com


PHOTO MICHAEL J. LEE PHOTOGRAPHY


LANDSCAPE ARCHITECTURE • CONSTRUCTION • GARDEN SERVICES SUDBURY DESIGN GROUP has long been recognized as one of the leading landscape architectural firms in the region, working with discerning residential and commercial clients in the Greater Boston area, and throughout New England, for more than 50 years.

740 Boston Post Road | Sudbury, Massachusetts 01776 SUDBURYDESIGN.COM 978.443.3638 (MA) 401.789.5889 (RI)


AN AWARD WINNING FULL SERVICE RESIDENTIAL INTERIOR DESIGN FIRM Delivering Quality, Serving Clients AllValue Over and Service to New Discerning England Clientele and Beyond

PLEASE CALL US AT 617-236-2286 TO ARRANGE A CONSULTATION.

224 Clarendon Street, Suite 61 (CORNER OF NEWBURY STREET) Boston, MA 02116 Photography by Michael J Lee Photography

As seen in New England Home September/October 2010

224 Clarendon Street, Suite 61 www.lesliefineinteriors.com (CORNER OF NEWBURY STREET) blog.lesliefineinteriors.com Boston, MA 02116

www.twitter.com/lesliefineint www.leslieďŹ neinteriors.com www.facebook.com/lfine


Family Owned and Operated Since 1977 CARPET • HARDWOOD • LAMINATE • VINYL • AREA RUGS • CERAMIC TILE • STOCK-ROLLS REMNANTS • INSTALLATION • RUNNERS • CARPET & UPHOLSTERY CLEANING


Follow us on Twitter, Facebook, and read our blog

blog.ajrosecarpets.com NATICK

BURLINGTON

599 Worcester Road (Route 9 West) (508) 652-0770

136 Cambridge Street (Route 3A North) (781) 272-7600

w w w. a j rose ca r p e t s . co m


PREMIER DESIGN CENTER NORTH OF BOSTON

Cabinets • Countertops • Appliances • Decorative Hardware • Plumbing Fixtures • Flooring • Window Fashions

We invite you to visit The Atlantic Design Center, where our designers will create your dream.


DISCOVER YOUR VISION

Furniture • Accessories & Artwork • Wallpaper & Paint • Fabrics & Trimmings • Lighting Fixtures

627 US ROUTE ONE

YORK, MAINE

207.363.3004

www.atlanticdesignctr.com


MICHAEL FEIN

From the Editor

Musing on Change and Continuity 2010 WAS A YEAR OF UNUSUALLY CONCENTRATED CHANGE

in the world of high-end home-design magazines (at least in the U.S.). Between April and September, four of the most prominent national titles were all entrusted to new leaders. First, Dara Caponigro, formerly style director of Domino, took over as editor of Veranda. On the same day, Stephen Drucker left House Beautiful to take the helm at Town & Country; he was replaced by House Beautiful’s former style director, Newell Turner. Then, in June, the announcement came that Paige Rense would be retiring from Architectural Digest after almost forty years; in August that coveted editorial post went to Margaret Russell of Elle Decor. This left an opening at Elle Decor itself, of course, which was soon filled by the elevation of Elle Decor’s former executive editor, Michael Boodro. Just how substantive will be the eventual effects of all this apparent movement is not yet clear. As you may have noticed, the maneuvering included a lot of shifting around from one publication to another, and considerably less of what could be

considered an influx of new blood. Still, those of us addicted to the outpourings of that rarified little world will keep a sharp lookout for whatever new developments may be in train. At least one reverberation from that seismic shift was felt right here in New England. At the beginning of November, Alexis Contant, former vice president and general manager of the Boston Design Center, was snapped up by the new Architectural Digest team to join them as Editorial Projects Director. Therefore, further developments are in store locally as the new head of the BDC, Julie Rogowski, takes stock and begins to look forward. At a recent lunch I had with Julie and PR whiz Anne Lower, change was very much on the menu. But the changes we discussed over salmon and scallops are of a deeper and more systemic sort. Many parts of the design business are in a state of flux. What, for example, are the relative merits of selling retail versus the more exclusive, to-the-trade-only approach? How can the two modes coexist? Should designers now rely solely on hourly charges for their work and expertise, and phase out the traditional practice of marking up furniture and other purchases? How does the relationship between designer and client alter when almost everyone can browse online and even the most affluent are less interested in taking two-week buying trips to France? I’ve seen similar aspects of change reflected in the pages of this magazine. Styles, on average, are more eclectic. There’s a greater willingness these days to match, oh, a $20,000 table from Dessin Fournir with a $29 vase from West Elm. The good news is that this kind of thing can be done beautifully, given an intelligent approach, an educated eye and a certain flair—all still available from designers, regardless of how they do their billing. So despite the evolving mechanics of the business, the crux remains constant: talent. That’s something I see staying with us for a long time to come.

Kyle Hoepner, Editor-in-Chief khoepner@nehomemag.com

Corrections and amplifications: We inadvertently published a nonexistent Web address for Kathryn Corbin and Jeffrey Brown, the interior designer and art consultant in our November/December feature "Modern Love." To reach Corbin, email her at corbindesign@brown-corbin.com. Brown can be reached at jbrown@brown-corbin.com.

10

New England Home January/February 2011


inspiring design. brought home with Plush

7DLORUHGIRUPVHOHJDQW OLQHVSROLVKHGVXUIDFHV VLOYHUDQGJROGOHDILQJ

'RQJKLD Q HVLJ HQ' K F W .L 'DOLD

7KH0D UWLQ*UR XS

$QQ 6D FNV

/WG QQHU H U %  %LOOLH

Story Board:

'UHVV&RGH

www.bostondesign.com/consumer-access


Inside this Issue

66

Featured Homes

JANUARY/FEBRUARY 2011 • VOLUME 6, NUMBER 3

66 A Hollywood Ending A Los Angeles–bred designer blends influences

from east and west coasts to bring a sense of 1930s glamour to her own West Hartford, Connecticut, Tudor-style home. TEXT BY MEGAN FULWEILER • PHOTOGRAPHY BY BRUCE BUCK • INTERIOR DESIGN: TAMMY RANDALL WOOD, INTERIOR ARCHAEOLOGY

74 City Slick, Country Quiet All the amenities of life in the suburbs—from

parking to privacy to peace and quiet—find their way into a townhouse tucked in the heart of Boston’s Back Bay. TEXT BY ERIN MARVIN • PHOTOGRAPHY BY MICHAEL PARTENIO • ARCHITECTURE: DELL MITCHELL ARCHITECTS • INTERIOR DESIGN: CAROLINA TRESS BALSBAUGH, MANUEL DE SANTAREN, INC. • BUILDER: PAYNE/BOUCHIER • PRODUCED BY KYLE HOEPNER

82 New York State of Mind A young family’s New Hampshire loft is warm,

82

comfortable, child-friendly and every bit as big-city sophisticated as the Manhattan condo they left behind. TEXT BY PAULA M. BODAH • PHOTOGRAPHY BY MICHAEL PARTENIO • ARCHITECTURE: DANN N. BATTING, DANN NORRIS BATTING ARCHITECTURE • INTERIOR DESIGN: JEANNE DUVAL, TOWNE HOUSE INTERIORS • PRODUCED BY STACY KUNSTEL

NEW ENGLAND DESIGN HALL OF FAME Looking back at the year’s best party page 48

88 Two of a Kind Partners in the Boston design firm Gauthier-Stacy open

their homes for a side-by-side tour that reveals their distinctive personalities. TEXT BY STACY KUNSTEL • PHOTOGRAPHY BY LAURA MOSS • INTERIOR DESIGN: JIM GAUTHIER AND SUSAN STACY, GAUTHIER-STACY • ARCHITECT FOR JIM GAUTHIER: DOUG DOLEZAL • PRODUCED BY KYLE HOEPNER

Get weekly updates on

LUXURY HOME STYLE Sign up now for our e-newsletter at nehomemag.com/newsletter 12 New England Home January/February 2011

On the cover: Sleek and chic in black and white—with punches of bright orange—defines the living room in designer Jim Gauthier’s South End apartment. Photograph by Laura Moss. To see more of this home, turn to page 88.

74


New home in Kiawah, SC

New home in Kiawah, SC

Renovation in Scottsdale, AZ

DESIGNING YOUR HOME …AND YOUR HOME AWAY FROM HOME

Renovation in Naples, FL

Morehouse MacDonald & Associates, Inc. works regionally and nationally to craft our clients’ dreams into exquisite and timeless homes.

Morehouse MacDonald & Associates, Inc. Architects 3 Bow Street, Lexington MA • 781.861.9500 • morehousemacdonald.com


Inside this Issue

34

10 From the Editor 20 New at nehomemag.com

Art, Design, History, Landscape 23 Elements: Seeing the Light Sleek and minimalistic or encrusted with

crystals, there’s a hanging light fixture for every decor. EDITED BY CHERYL AND JEFFREY KATZ

Design Destination: Ramson House, Providence 30 34 Artistry: Vivid Imaginings Fantasy and realism make a dynamic duo in

the big, bright murals Coral Bourgeois crafts in her Pawtucket, Rhode Island, studio. TEXT BY FRANCES J. FOLSOM • PORTRAIT BY CHRIS VACCARO 42 Plugged In: Lighting the Way Once limited to discos and brake lights,

LEDs finally claim center stage BY SYDNEY SCHUSTER 130

People, Places, Events, Products 118 Trade Secrets: Safe and Sound Comings and goings (and a few surprises)

in the lives of New England’s design community. BY LOUIS POSTEL Special Marketing Section:

GREEN LIVING page 97

122 Design Life Our candid camera snaps recent gatherings that celebrate

architecture and design. 126 Calendar Special events for those who are passionate about fine design. Now in the Galleries Upcoming art exhibitions throughout New England 126 130 Perspectives New England designers Mark Christofi, Karen Davis and

Melissa Gulley put the fun in a game room. Wish List: Designer Honey Collins of Essex, Massachusetts, reveals a few of her favorite home products. 136 It’s Personal: Favorite finds from the staff of New England Home 137 138 New in Showrooms Unique, beautiful and now appearing in New England

For subscriptions call: (800) 765-1225 Letters to the Editor: New England Home 530 Harrison Ave., Suite 302 Boston, MA 02118 letters@nehomemag.com 14 New England Home January/February 2011

shops and showrooms. BY ERIN MARVIN 140 Resources A guide to the professionals and products in this issue’s featured

homes. 151 Advertiser Index 152 Sketch Pad A cozy pillow with a masculine touch designed by Fernanda

Bourlot of Simplemente Blanco in Boston.

23


EDITOR-IN-CHIEF

Kyle Hoepner khoepner@nehomemag.com HOMES EDITOR

Stacy Kunstel skunstel@nehomemag.com SENIOR EDITOR

Paula M. Bodah pbodah@nehomemag.com MANAGING EDITOR

Erin Marvin emarvin@nehomemag.com ASSISTANT ART DIRECTORS

Jared Ainscough jainscough@nehomemag.com Sorae Lee soraelee@nehomemag.com ASSOCIATE EDITOR

Kara Lashley klashley@nehomemag.com CONTRIBUTING EDITORS

Cheryl and Jeffrey Katz candjkatz@nehomemag.com Karin Lidbeck Brent klidbeck@nehomemag.com Louis Postel lpostel@nehomemag.com CONTRIBUTING WRITERS

Regina Cole, Caroline Cunningham, Megan Fulweiler, Robert Kiener, Christine Temin

The Designers Have Found Us.

Now It’s Your Turn! Contemporary, Traditional or Transitional New England’s leading source of Fine Art • The sole provider of artwork for: ‐ The 2007 and 2008 Boston Design Home ‐ The 2008 Boston Concept Home ‐ The 2009 Boston Home of Distinction • 2010 New England Design Hall of Fame Sponsor

J.TODD GALLERIES www.jtodd.com

Industry Partner of A.S.I.D. | A.S.I.D. Members enjoy special privileges

572 Washington Street, Route 16, Wellesley Square

781‐237‐3434 16 New England Home January/February 2011

CONTRIBUTING PHOTOGRAPHERS

Robert Benson, Bruce Buck, Tria Giovan, Sam Gray, John Gruen, Richard Mandelkorn, Laura Moss, Michael Partenio, Greg Premru, Eric Roth, James R. Salomon ••• Editorial and Advertising Office 530 Harrison Ave., Suite 302 Boston, MA 02118 (617) 938-3991 (800) 609-5154 Editorial Submissions Designers, architects, builders and homeowners are invited to submit projects for editorial consideration. For information about submitting projects, e-mail emarvin @nehomemag.com. Letters to the Editor We’d love to hear from you! Write to us at the above address, fax us at (617) 663-6377 or e-mail us at letters@nehomemag.com. Subscriptions To subscribe to New England Home ($19.95 for one year) or for customer service, call (800) 765-1225 or visit our Web site, www .nehomemag.com. Upcoming Events Are you planning an event that we can feature in our Calendar of Events? E-mail information to calendar@nehome mag.com, or mail to Calendar Editor, New England Home, 530 Harrison Ave., Suite 302, Boston, MA 02118. Parties We welcome photographs from designor architecture-related parties. Send highresolution photos with information about the party and the people pictured to pbodah@nehomemag.com.


All images by Peter Bart Photography

Uncompromising Quality with Unparalleled Service The symbol of excellence in architectural woodwork. WWW.SOUTHSHOREMILLWORK.COM 508.226.5500


BRADFORD

DESIGN, INC. A BUILDING & DESIGN COMPANY

PUBLISHER

Betsy Abeles Kravitz bkravitz@nehomemag.com SENIOR ACCOUNT EXECUTIVES

Andrea Kolden akolden@nehomemag.com Roberta Thomas Mancuso rmancuso@nehomemag.com Kim Sansoucy ksansoucy@nehomemag.com Robin Schubel rschubel@nehomemag.com Angela Stevenson astevenson@nehomemag.com Kathy Bush-Dutton kbushdutton@nehomemag.com PRODUCTION MANAGER

Glenn Sadin gsadin@nehomemag.com MARKETING AND ADMINISTRATIVE COORDINATOR

Kate Koch kkoch@nehomemag.com CIRCULATION MANAGER

Kurt Coey NEWSSTAND MANAGER

Bob Moenster ••• Editorial and Advertising Office 530 Harrison Ave., Suite 302 Boston, MA 02118 (617) 938-3991 (800) 609-5154 Advertising Information To receive information about advertising in New England Home, please contact us at (800) 609-5154, ext. 713 or info@nehome mag.com.

••• NCI Corporate Offices 2305 Newpoint Parkway Lawrenceville, GA 30043 (800) 972-0189 Home Design Division PRESIDENT

Adam Japko SENIOR VICE PRESIDENT, OPERATIONS

Stuart Christian DIRECTOR OF PUBLISHING OPERATIONS

Photo By Victor Neves

Where Fine Art & Fine Living Meet. Design and build your work of art with us today

Rick Higgins

CHAIRMAN/CEO

Daniel R. McCarthy CHIEF FINANCIAL OFFICER

Gerry Parker

401-231-0099 | WWW.BRADFORDDESIGNRI.COM

GENERAL COUNSEL

Susan Deese 18 New England Home January/February 2011


new@NEHOMEMAG.COM E-Newsletter Don’t forget to sign up for our weekly Design Discoveries editorial e-newsletter for the latest products, upcoming events and green ideas.

Enter to Win!

Content Updates

See more @ nehomemag.com Look for this box throughout each issue of New England Home for extra online features and content: before-and-after photos, expanded event and product listings, interviews, links and more.

We’re always adding new content to our Web site. Check out additional photos of work by Coral Bourgeois, the featured artisan in this issue (page 34), as well as more images of LED lighting used in residential applications, as discussed in our Plugged In department on page 42. To complement our Elements department on page 23, which features the newest in hanging light fixtures, editors Cheryl and Jeffrey Katz have put together a handy online guide to lightbulbs—explaining the different types of bulbs, when and where to use them, how much wattage you need and more. You’ll also find new home tours, an expanded events calendar and more.

20 New England Home January/February 2011

Through the end of February, anyone who visits our Web site can enter to win this pair of gorgeous Mogador Leather Hurricanes by Interlude Home, generously provided by Rinfret Home & Garden in Greenwich, Connecticut. Valued at $535 and made of iron, leather and glass, each lamp measures 11"W × 11"D × 18"H and is the perfect accessory to light up your interior! Sign up now at www .nehomemag.com!

Meet the Landscape Professionals Conversations with New England’s busiest and best landscape professionals.

Product Showcase The finest resources in New England for appliances, pianos, oriental rugs and building systems/kit homes.


Gary Sloan Photography

A NEW PERSPECTIVE. Take a fresh look at building your dream. This is the perfect time for a Woodmeister-crafted home or project... at an exceptional value you’ll love. Call us for a new perspective on your construction or remodeling project.

800.221.0075 . www.woodmeister.com . BOSTON . NEW YORK . NANTUCKET . NEWPORT


DAHER INTERIOR DESIGN BOSTON 617.236.0355

• •

ANDOVER 978.475.4970

www.DaherInteriorDesign.com


Elements The things that make great spaces

Edited by Cheryl and Jeffrey Katz

Seeing the Light Though our children—one a serious modernist and the other a staunch traditionalist—might once have disagreed, the most prized possession in our house is the dining room chandelier. Fanny, the modernist, found its gilt frame fussy, never mind the fact that it was from the 1920s. Oliver, the traditionalist, thought the Murano glass beads—okay, they are aqua—over the top. The chandelier was the first purchase we made after we renovated our house. We liked the idea that this curly, colorful fixture would hang over our hefty, sensible wooden table. We approached the purchase as one might buy a piece of costume jewelry or a pretty scarf— it was a charming bauble to complement a more serious piece. What we all underestimated was the power of light. Years later, after having shared many magical meals under the chandelier’s warm glow, it seems we’ve all seen the light. Larger Than Life The apparent size of a chandelier is not just a function of its measurements; it’s also about density. Though it’s true that this showstopping Murano glass and crystal chandelier is extra tall (it’s meant for a very highceilinged room), its narrow silhouette displays a delicious delicacy. The Torpedo Taif from Barovier & Toso is available in three different heights, with nine, twelve or eighteen lights, and in nine colors. $18,610–$45,624. THE MORSON COLLECTION, BOSTON, (617) 482-2335, WWW.THEMORSON COLLECTION.COM

January/February 2011 New England Home 23


Elements

1

1

Twinkle, Twinkle Crystals, those glittering jewels on a chandelier, are actually pieces of glass cut with many facets that act as prisms to refract light. The Glitterbox from Swarovski’s Crystal Palace collection comes in three sizes and uses twinkling 1-watt LEDs on the sides and constant 1-watt LED downlights. $16,000–$34,000. MONTAGE, BOSTON, (617) 4519400, WWW.MONTAGEWEB.COM

2

Sparkle Plenty Turn a small guest bathroom into a jewel box with Dennis & Leen’s aptly named Powder Room chandelier. Though small in size, it packs a punch with its adornments of lead or rock crystals. 15"D × 17"H. LEAD CRYSTAL $2,370, ROCK CRYSTAL $3,120. WEBSTER & COMPANY, BOSTON DESIGN CENTER, (617) 261-9660, WWW.WEBSTERCOMPANY.COM

3 2

The Art of the Unexpected Once the basic look of a room is established, finding the unexpected accessory can be a challenge (though one worth conquering). Of all a room’s accoutrements, a chandelier offers the most possibilities for surprise. To wit: the unusual, three-tiered Arctic Pear chandelier from Ochre, available in patinated bronze or nickel. 47¼"D. $11,125. NEENA’S LIGHTING, BOSTON, (617) 859-1700, WWW.NEENASLIGHTING.COM

3

24 New England Home January/February 2011


Cabinets by Martha Bovelli

cumar, inc. 69 norman street everett, ma p 617.389.7818 f 617.389.1755

Simply Inspiring Sur faces. At Cumar, we’ve sourced, crafted and installed the finest quality natural stone surfaces for seven generations. Today, we offer the area’s largest selection of natural stone surfaces, including granite, limestone, slate and some of the most exotic semi-precious materials you can find. Visit our warehouse today. And let your imagination run wild.

1.800.774.7818

www.cumar.com

69 Norman St.

Everett, MA

02149


Elements

1

1

Fit for a King Named after the palace of King Louis XIV, the Grand Trianon from Artecnica is made of lightweight post-consumer coated Tyvek and emits, from its folded slits, a soft checkerboard glow. 23"H × 28"D. $170. IN HOME,

2

Science Class A riff on those single-celled organisms we learned about in junior high, the Ameba Single, by Pete Sans for Vibia, is sleek and understated. It comes in two unassuming colors: white lacquer and charcoal gray. 17¾W" ×

EXETER, N.H., (603) 583-4889

11"H. $2,810. WOLFERS LIGHTING, ALLSTON, MASS., (617) 254-0700, WWW.WOLFERS.COM

3

All Tied Up Modern chandeliers defy definition. Not exactly standard issue, they often employ materials like aluminum, sandblasted glass, polypropylene or, in the case of the Leonardo hanging lamp from Santa & Cole, coated-paper strips of ribbon bound around a steel frame. 2'D, $2,600; 4'D, $4,000. CHIMERA, BOSTON, (617) 5423233, WWW.CHIMERALIGHTINGDESIGN.COM

2

26 New England Home January/February 2011

3


innovative, bold, authentic artisanship

Just in, our shipment of contemporary Indian hand-knotted rugs.

Since 1938 w w w . l a n d r ya n d a r c a r i . c o m

SALEM MA 63 FLINT ST. 800-649-5909 • BOSTON 333 STUART ST. 617-399-6500


Elements

1

1

Flower Power The Garland light, designed by Studio Tord Boontje and included in the permanent collections of both the Museum of Modern Art and the Victoria and Albert Museum, is made from one continuous metal strand that can be wrapped around a lightbulb any way you choose. Available in silver, brass, black or white. $70. ROCK PAPER SCISSORS, WISCASSET, MAINE, (207) 882-9930

2

Have a Ball Common design wisdom suggests a chandelier be hung over the center of the table. But with fixtures like Roberto Menghi’s Globo di Luce from FontanaArte, more than one just might be in order. The metallic, blown-glass globe hangs from a transparent cord. 11.4"H × 11.8"D, $749; 16.9"H × 17.7"D, $1,065. CASA DESIGN, BOSTON, (617) 6542974, WWW.CASADESIGNBOSTON.COM

3

Floating on Air Elegant and simple, the aluminum Allegro suspension lamp brings a sense of airiness to a room. Think of it as a modern birdcage and indulge in flights of fancy. It comes in several configurations and sizes, and in black, brown or gold. $3,868 AS SHOWN. ADDO NOVO, PORTLAND, MAINE, (207) 2212780, WWW.ADDONOVO.COM

2

28 New England Home January/February 2011

3


www.ElizaTan.com 978.429.8123

[I N T E R I O R S

[

ELIZA TAN


Elements • Design Destination

Ramson House, Providence

By Cheryl and Jeffrey Katz

At one time or another we’ve all asked ourselves, “Are these shoes too pointy?” “Is this tie too bright?” Granted, these are not big, burning queries. But let’s be honest, before we meet our public—oh all right, before we go to dinner with friends or catch a movie—we want to be sure we’re presenting an accurate picture of who we are, or at least who we want to be. Choosing accessories can be daunting, whether it’s the perfect necklace for that little black dress, the right scarf for a balmacaan or the ideal lamp for an end table. For those seeking help with that last need, there’s Ramson House. What began as an antiques shop in Newport, Rhode Island, more than thirty years ago has become an authority on all things illuminated. The shop stocks table and floor lamps, chandeliers and sconces, and offers a large selection of ready- and custom-made shades (as important a choice to a lamp as a baseball cap with a perfectly curved brim is to a teenage boy). In interiors, as in apparel, there seem to be two basic design camps. Those who like consistency—one “look” for the

jacket, the trousers, the shirt and the tie—might be drawn to rooms where the furniture and the accessories share a similar provenance or style. The other camp takes a mix-it-up approach, pairing, say, a T-shirt from the Gap with a skirt from Dior. When this sensibility extends to the home, there’s no telling what visitors might find: a huge crystal chandelier in the middle of an industrial loft, perhaps? Ramson House makes adherents of either school of thought happy. Period sconces and matching chandeliers suit people who prefer consistency in their decoration, while for those who want to pick something from both column A and column B, the shop holds myriad trims, beads and baubles to toy with. In fact, Ramson House will fashion a lamp from just about anything that can be drilled and wired. Whatever your style, proprietor Joan Zuerner and design consultant Andrea Martiesian will help you get just the look you’re after. OPEN TUESDAY–THURSDAY BY APPOINTMENT. 351 SOUTH WATER ST., PROVIDENCE, (401) 273-5700, WWW.RAMSON HOUSE.COM

30 New England Home January/February 2011


John Horner

We Make Wood Beautiful‌

Expert Stripping, Finishing & Restoration of Architectural Woodwork and Fine Furniture

178 Crescent Road | Needham, MA 781-449-1313 | www.waynetowle.com


Nannette Lewis Interiors | CBT Architects | Photographer: Richard Mandelkorn Studio

2008 Best of Boston速: Best Contractor | 2008, 2009 Best of Boston速 Home: Best Builder | 2010 Best of Boston速 Home: Modern Contractor

Thoughtforms www.t h o u ght f orms- corp. com | 978. 263. 6019 T o l e a rn more p leas e visi t Afte rthoughts our bl og a bout C u st om Ho me Bu ild in g: blog.thoughtfo rms- co rp.c om


OK , We

ADMIT IT. We Take Off a Few Days of the Year . 

happy new year from everyone at back bay shutter company!

BACK BAY S HUTTER C O. I NC . totally passionate about shutters速 (and shades too!) 78i.22i.0i00 www.backbayshutter.com Geographically flexible.


Artistry

Vivid Imaginings Fantasy and realism make a dynamic duo in the big, bright murals Coral Bourgeois crafts in her Pawtucket, Rhode Island, studio. TEXT BY FRANCES J. FOLSOM • PORTRAIT BY CHRIS VACCARO

W

ith a name that conjures an exotic shade of pinkish-orange, perhaps it’s only natural that Coral Bourgeois would use lots of rich, vivid color in her art. And given that she spent almost ten years making a living as a jewelry artist, it’s no wonder that the work she does today glitters like giant bits of jewelry for the home. • First-time visitors to Cade Tompkins Projects, the Providence, Rhode Island, gallery that represents Bourgeois, are floored by what they see. “They’re sort of bedazzled,” 34 New England Home January/February 2011

says gallery owner Cade Tompkins. “It’s such a visual blast, such an incredible surge of color, your eye tends to pop around all over.” • Bourgeois’s large-scale pieces defy easy categorization. Are they paintings or something else? Functional or pure art? All of the above, it turns out. Some of them hang on walls, sometimes singly but most often in multiples. Others have a purpose beyond their beauty, forming a kitchen backsplash, say, or taking the place of paint or wallpaper. “I would say they’re paintings, primarily,” Tompkins says, “but


SUSAN DEARBORN I N T E R I O R S,

I N C.

Traditional • Transitional Contemporary • DESIGN

EST. 1979

|

ALLIED ASID

|

MEMBER BBB

|

508.653.9800

|

WWW.DEARBORNDESIGN.COM


Artistry they use elements of collage—beads and resins and other applications.” However one might describe them, the works are a logical next step in the artist’s career. Born in Louisiana, reared in New Jersey and educated at North Texas State University, Bourgeois moved to New York City in the 1980s intending to focus on drawing and painting. She had some success, showing her work in city galleries while waiting on tables to make ends meet. On the side, she began crafting fanciful earrings. “Costume jewelry and art jewelry were really in at that time,” she recalls. She hit on a winning formula:

36 New England Home January/February 2011

hand-painted paper designs that she cut out, glued onto lightweight wooden disks and painted with epoxy resin. Neiman Marcus quickly became a client, and before she knew it, Bourgeois was running a jewelry company that at one point had fifteen employees. Success was welcome, but there was one problem. “I wasn’t happy,” she says simply. “I’m an artist at heart. Here I was, tied to the fashion trade where several times a year the jewelry line changed. I felt I was constantly reinventing the wheel.” Coincidentally, she says, jewelry trends moved in a new direction. “People wanted either fine jewelry or really inexpensive

jewelry. Mine was neither.” She was still enchanted with the process she devised, however, and began to think about trying it out on a larger scale. In 1992, she and her husband moved to a nineteenth-century townhouse in one of Providence’s historic districts. In a new city and without the pressures of her own business, Bourgeois began the next stage of her career. Initially, Clockwise from left: New she continued Orleans (2005), acrylic working on paint, jewels, modeling wood, design- paste on wood with epoxy ing and making resin, 13' × 9'; Stripes and Swirls (2004), acrylic decorative paint, jewels on wood, pieces for the 12' × 7'; Red Letters and home. “I cut it, Plates (2005), acrylic paint, jewels, modeling painted it and paste on ceramic plates decorated it with epoxy resin, 10' × 5' with leftover sequins, gemstones and cut glass from my jewelry business,” she explains. Local interior designers soon caught wind of her work and began commissioning her to make pieces for their clients. She switched to a ceramic tile base to take advantage of tile’s more standard sizing, but quickly decided tile was too heavy to use on a large scale. “My pieces started getting much bigger, and even a one-footsquare tile is really heavy,” she notes. “Plus, I hate to grout.” Nowadays, Bourgeois uses mediumdensity fiberboard (MDF). “I wanted


Art completes the Home. Enhance your distinctive home with paintings from New England’s foremost galleries.

Quidley & Company offers contemporary realism and traditional oil painting by today’s leading artists. Visit us today at 118 Newbury Street, between Clarendon & Dartmouth, or call to arrange an in-home consultation.

26 Main Street Nantucket, MA 508.228.4300

&Company

Quidley

www.QuidleyAndCo.com

118 Newbury Boston, MA 617.450.4300


Artistry

to the stair risers with animal prints to a bathroom where the walls are covered with a mural of women of the 1930s,” she says. In a den she sheathed the doors of a bookcase with white pearlescent tiles. something “I’ve even covered a bureau with images of flat and smooth, old album covers: Janis Joplin, the Beatles, like tile, but not so John Lennon, Sonny and Cher. My husheavy,” she says. “MDF can be used in a band and son are musicians, so they use lot of places tile would be used.” To make it to store sheet music.” her pieces, Bourgeois draws the initial deIn other people’s houses, she takes her sign on paper. Working in her studio in a cue from the homeowners. One client converted mill building in Pawtucket, mentioned she was a quilter, Rhode Island, she cuts MDF Clockwise from above: so Bourgeois fashioned a into the sizes she needs, lays Musical Chest (2007), them on the floor like a jigacrylic paint, jewels, epoxy backsplash in a quilt pattern resin, 42"H × 42"W × of one-inch tiles in blues, saw puzzle and affixes the 30"D; Mainland (2006), golds and reds. For a homepaper designs to the boards. acrylic paint, jewels and owner who loves music, she “Then I add beads, gemepoxy resin on MDF, 10' created a wall mural featuring stones, metal-cut stamp15'; Blue Lady (2008), × acrylic paint, jewels, mod- images of Bruce Springsteen, ings . . . whatever. The last eling past, epoxy resin on Bob Dylan, Jerry Garcia, steps are painting the pieces MDF, 12' × 12' guitars, a piano and musical and coating them with layers notes surrounded by brilliantly colored of epoxy resin,” she explains. “You don’t peacocks, starbursts and checkerboards. know what the color or texture will be Today, Bourgeois’s work is moving tountil the resin sets, then—surprise.” ward yet another, larger stage. She still Her own home stands as a gallery of her does art pieces to hang on walls and muwork. “I’ve covered everything, from the rals for people’s homes. But increasingly, kitchen with tiles depicting Moorish scenes 38 New England Home January/February 2011

she makes large-scale pieces for commercial clients. She has created murals for hospitals, restaurants and hotels around New England and in such far-flung places as Egypt and Dubai. At Boston’s Liberty Hotel, the former Charles Street Jail, a nineteen-foot-tall mural with a 1930s prison theme sits between the escalators that run from the street level to the lobby. No matter the theme, her work always blends realistic and fantastical images. “The dynamic of the real and not real is what makes Coral’s art so interesting,” Tompkins notes. Asked where she gets her inspiration, Bourgeois says, “It springs from deep within me, by constantly thinking about the project, where it’s going, who will see it.” As for a favorite among her designs, she says, “It’s whichever one I’m working on. I get deep into my work; I’m always in the moment.” • Editor’s Note Coral Bourgeois is represented by Cade Tompkins Projects, Providence, R.I., (401) 751-4888, www.cadetompkins.com. To see more of the artist’s work, go to www.coral bourgeois.com.


trust

We’re into building things.

dreams

www.fhperry.com

508-435-3062


D Randolph Foulds Photography

CUSTOM WINDOW TREATMENTS | FURNITURE | LIGHTING | FLOOR COVERINGS | ACCESSORIES

www.decdens.com/newengland | 1-800-255-5879 | DesignerAnne Fawcett

We Listened and Beautiful Happened


LANDSCAPE ARCHITECTS AND SITE PLANNERS newpor t, rhode island

401.848.2750

w w w. k a t h e r i n e f i e l d . c o m


Plugged In Staying on top of developments in home technology BY SYDNEY SCHUSTER

FREDERICK CHARLES

Lynn, Massachusetts. White LEDs (actually blue diodes painted with fluorescent phosphors) were introduced in the 1990s, but the color was inconsistent and too blue for general lighting purposes. “When California Title 24 came out and energy efficiency started to be popular with the green movement,” says Dearborn, “the lighting industry started looking for something new. Companies like Philips Color Kinetics coated LEDs with a phosphor so they emit a warmer, whiter color. And you can dim them. You’re basically looking at 9 and 14 watts replacing 50 and 65 watts.” “Older generations of LEDs had problems with heat and color until the government got involved with standards,” agrees Steve Brand, owner of Wolfers Lighting in Allston, Massachusetts. As a direct result of regulation, LEDs now come in new forms such as strips, cans and pendants, with consistent white color suitable for task and general residential lighting. LEDs are a big hit under cabinets as an alternative to halo-

Lighting the Way Once limited to discos and brake lights, LEDs finally claim center stage. FOR HALF A CENTURY, LIGHT-EMITTING DIODE (LED) TECH-

nology was mostly a solution in search of a problem. The Swinging Sixties invention produced light, but not enough for illumination. It came in any color you liked—as long as it was red, green or blue. LEDs were quickly relegated to the ignoble realm of remote controls and Christmas decorations. In short, they were never a contender to replace incandescent fixtures. Until now. Seemingly overnight, the latest generation of LEDs has shrugged off forty-five years of market torpor, thanks to new fixtures suitable for whole-house applications. And you can put them in places you wouldn’t dare put fluorescents. Other pluses: superior life span, durability and energy efficiency, with none of the recycling issues that plague compact fluorescent bulbs. So what happened? In a nutshell, government intervention. In 2008, California Title 24 redefined energy efficiency standards for lighting, and the U.S. Department of Energy issued IESNA LM-79, its new standards and testing guideline. “Two years ago nobody used LEDs residentially, because there was no product. LEDs were used more in nightclubs and restaurants, situations that didn’t require white light,” says Lucy Dearborn, owner of Lucía Lighting & Design in 42 New England Home January/February 2011


Plugged In client wanted it to feel light and bright all the time. We mounted a little LED fixture in the soffit, behind the sheers. The lights were two inches away from the fabric.” The magic is in the engineering. The diodes are surrounded by metal that dissipates the heat. The rest is the power supply. LED light is actuated by a driver mounted between the appliance and the electrical source (which can be either AC or battery). One 12-volt unit, Left: Baccarat's first LED says Dearborn, can power 150 crystal chandelier. Bottom left and previous page bot- feet of LED strip lighting. Dearborn recently designed tom: An all-LED home in Beverly, Massachusetts, lit a kitchen lit entirely by LEDs. by Wolfers Lighting. BotTwo years ago? Impossible. tom right and previous “There are LED recessed page top: Lighting comes lights now that give a ton of from more than 3,000 linear feet of dimmable, lowlight,” she says. “The underprofile LED fixtures from counter lighting is amazing. Philips Color Kinetics Literally, it’s as skinny as tape— one-half inch wide and one-sixteenth inch deep. It’s hardwired and installed with double-stick tape. The driver is mounted inside the cabinet.” “There continues to be improvement in the types of LEDs and the choices of color. It’s evolving,” says Brand, who recently was involved in lighting one of the first allLED homes (in Beverly, Massachusetts, designed by Cleantech Homes). He attributes LEDs’ newfound popularity, in large part, to maintenance—or rather, lack thereof: “You’re talking a lifetime of 40,000 to Lucia Lighting & Design 50,000 hours, compared with (781) 595-0026, www.lucialighting.com 1,000 to 2,000 on an incanWolfers Lighting descent bulb.” (617) 254-0700, Says Dearborn, “There’s www.wolfers.com Light Insight Design Studio a serious happiness factor (617) 268-1122, that comes with not having www.light-insightdesign.com to change lightbulbs.” •

FREDERICK CHARLES

gen, which can dangerously overheat. You’ll find it highlighting art collections and architectural details such as coves and baseboards. It’s even cropping up in places previously off limits to any kind of lighting, in ways fluorescent can’t even touch (literally). Try drapes. And carpets. “We’ve been doing LED lighting for curtains,” says Lana Nathe, owner of Light Insight Design Studio in Boston. (Nathe also used LEDs in a wine room where traditional lighting would’ve cooked the vino, and for dramatic cove lighting in Boston’s Old North Church.) “There are LEDs you can incorporate into rugs, like a sparkle effect,” she says, citing the glittering carpet by Philippe Starck at the Paris headquarters of Baccarat (which just introduced the first LED crystal chandelier). Dearborn is illuminating textiles, too. “We recently used LEDs to backlight the fabric in some very beautiful, lineny blinds. It was in a small room, and the

44 New England Home January/February 2011


Behind every design, t h e re ’s a s t o r y. To hear this one, call 800.834.6654.

ZEN Associates, Inc. The balance of art, science and nature. At ZEN Associates there’s a reason behind every stone, every texture, every color, every angle and every thing we do. From our award-winning Landscape Design to our Construction, Interior Design and Maintenance services, no one puts more thought into it, so you get the most out of it. Boston | Washington DC | zenassociates.com | 800.834.6654


Anthem® cast iron undercounter sink shown with Parq ® bridge faucet

Franklin:

(508) 528-0006

Mashpee:

(508) 539-8704

Lynn:

(781) 592-1200

Newton:

(617) 630-0100

Marlborough:

(508) 481-4221 FERGUSON.COM

*Subject to credit approval and minimum purchase. ©2010 Ferguson Enterprises, Inc. All Rights Reserved.

APPLIANCES

PLUMBING


Let us ORCHESTRATE your dream. For the perfect products for your kitchen or bath, stop by a Ferguson showroom. It’s where you’ll find the largest range of quality brands, a symphony of ideas, and trained consultants to help orchestrate your dream. With showrooms from coast to coast, come see why Ferguson is recommended by professional contractors and designers everywhere.

PASSIONATE PEOPLE

LIGHTING

CABINETS


The fourth Annual New England Design Hall of Fame ®

O

®

On the evening of November 11, 2010, influential members of the New England design community came together to honor and celebrate seven of our region’s finest architects, interior designers and landscape designers. The mood was set with stunning arrangements by Winston Flowers. Our Homes Editor, Stacy Kunstel, was emcee for the night, looking spectacular in a floor-length dress by Kate Towers with styling provided by Dean Mellen for Patrice Vinci Salon. The event kicked off with a scholarship presentation to The New England School of Art & Design at Suffolk University. We then spent the evening cheering on Thomas Catalano, David J. Hacin, Manuel de Santaren, Eugene D. Lawrence, Katherine Alexander Field, Keith LeBlanc and Roger Lussier as they accepted their awards and were inducted into the New England Design Hall of Fame.

2

3

4

5

6

7

8

9

10

1. Boston’s State Room was the perfect setting for an unforgettable evening 2. Crown Point Cabinetry’s Brian Stowell, Carole Stevens and Mark Wirta with John P. Margolis, Margolis Incorporated 3. Howard Raley of Flavin Architects and New England Home’s Erin Marvin 4. Architect David Sharff, New England Home’s Kim Sansoucy, Jill Breed of David Sharff Architect, P.C. and Debra Burke, Clarke Distributors 5. New England Home’s Adam Japko and wife Dr. Elizabeth Spatola flank Peggy Dowcett, Coldwell Banker 6. Brian Stowell, Mark Wirta and Bob Davis of Crown Point Cabinetry with inductee Thomas Catalano 7. Inductee Katherine Alexander Field 8. Ken Bertram of Herrick & White, Meichi Peng Design Studio’s Meichi Peng and Suphoj Chancheaw and Jim Catlin, Herrick & White 9. Roomscape’s Cameron Snyder and Mercedes Aza flank Jim Raftus, Clarke Distributors 10. The South Shore Millwork team with New England Home’s Robin Schubel 48 New England Home January/February 2011

PHOTOS BY TARA CARVALHO AND DAMIEN HICKEY

1


OUR LOOK, MADE EASY We provide in-store and in-home design services. From measurements to floorplans, our talented design associates will create a tasteful design plan to make your home the most comfortable place on the planet. To get started, call or come in today.

FEATURING: Tatum 99” Sofa 99”w x 41”d x 32”h ($3500) $2595, Liana Chair 26”w x 35”d x 34”h ($1040) $775, Mondrian Rectangular Cocktail Table 58”w x 24”d x 16”h $1245, Mondrian Round Side Table 28”w x 28”d x 22”h $870, Mondrian Étagère 28”w x 14”d x 70”h $1745, Horizon 8’ x 10’ Rug in Vanilla $1595, Traverse Table Lamp $365

FURNITURE

+

LIGHTING

+

RUGS

+

ACCESSORIES

+

BOSTON 142 Berkeley Street Boston, MA 02116 / Tel: 617.266.0075 / mgbwboston.com NATICK 395 Worcester Street / Route 9 Natick, MA 01760 / Tel: 508.650.1400 / mgbwnatick.com

PHOTOGRAPHY


The fourth Annual New England Design Hall of Fame

®

awards and gala 11.11.10

1

2

3

4

5

6

9

10

11

1. New England Home’s Stacy Kunstel 2. Mariette Barsoum, Jane Scammon and Magued Barsoum of Divine Kitchens 3. Raphael JaimesBranger, Eliot Wright of Eliot Wright Workroom, Leslie Saul of Leslie Saul and Associates and Webster & Company’s David Webster 4. Chip Webster of Chip Webster & Associates and Kim Goodnow, Woodmeister Master Builders 5. Kurt Hakansson and Mark Haddad of Haddad Hakansson, New England Home’s Betsy Abeles Kravitz and Kim Sansoucy and Donna Spanos, RiverBend & Company 6. Barbara Kotzen of Kotzen Interiors, Carol Catalano, inductee Thomas Catalano and Melanie Kaplan, Boston Design Guide 7. The 2010 inductees: Roger Lussier, Katherine Alexander Field, David J. Hacin, Keith LeBlanc, Eugene D. Lawrence, Manuel de Santaren and Thomas Catalano 8. Woodmeister’s Kim and Ted Goodnow flank Evan Struhl, Cutting Edge Systems 9. Jamie Radell, Rick and Joanne Salvucci and Mike Wheeler of Ferguson Enterprises 10. Danielle Jones and Scott Wilson of Snow & Jones 11. New England Home’s Kyle Hoepner and Betsy Abeles Kravitz 50 New England Home January/February 2011

PHOTOS BY TARA CARVALHO AND DAMIEN HICKEY

8

7


Look Closer. What aren’t you seeing?

The Best Technology You’ll Never See

©

Architects and interior designers go to great lengths to minimize the visual impact of common devices like receptacles, structured wiring jacks, lighting control keypads, etc. At Cutting Edge Systems, with the help of TRUFIG, we can help to make those devices disappear into the design of the space. TRUFIG is a revolutionary mounting system that allows items such as light switches, electrical outlets, phone/data jacks, volume controls, loudspeakers, and more to fit flush with the finished wall surface. To view our solution, visit www.cuttingedgehome.com/trufig and call us for help on your next project!


The fourth Annual New England Design Hall of Fame

®

awards and gala 11.11.10

2

4

5

6

7

3

PHOTOS BY TARA CARVALHO AND DAMIEN HICKEY

1

8

GOLD SPONSORS

9

10

1. Inductee Manuel de Santaren 2. Barbara Goldberg of Mitchell Gold+Bob Williams 3. Inductee Roger Lussier with his sister, Muriel Perra, and designer Gary McBournie 4. Back Bay Shutter Co.’s Bill Morton, Nancy Sorenson and Steve Kontoff 5. New England Home’s Kim Sansoucy with gold sponsors Marble and Granite 6. Andrew Terrat, Barbara Goldberg, John Trifone and Steve Elvaz of Mitchell Gold+Bob Williams with ASID president-elect Jane Hassan and current ASID president Barbara Bradlee 7. Caroline Levine and inductee Eugene D. Lawrence 8. Designer Leslie Fine and Chris Magliozzi, BayPoint Builders 9. FBN Construction’s John DeShazo and Finley Perry, F.H. Perry 10. Phyllis and Bob Totaro and Sean Farrell of J. Todd Galleries 52 New England Home January/February 2011

SILVER SPONSORS Snow & Jones • Back Bay Shutter Co. • F.H. Perry Builder • Divine Kitchens • Crown Point Cabinetry • Cutting Edge and Lutron • Cocktail Sponsor: South Shore Millwork • Hostpitality Sponsor: FBN Construction • Gallery Sponsor: J. Todd Galleries


AGift From Nature Marble and Granite, Inc. has the largest inventory of unique stones, Caesarstone and Curava (recycled glass) in New England. We take pride in customer service to both homeowners and the trade to help you choose a spectacular countertop that will last for many years to come.

www.marbleandgranite.com | westwood, ma | milford, ct


(calm & cool)

29 ELLIS ROAD WEST NEWTON, MA 02465 617-527-3433 WWW.SHULMANINTERIORS.COM 46


How would you feel if your construction project was actually completed on time?

Shouldn’t it be fun? www.baypointbuilderscorp.com 617-614-0595


TMS ARCHITECTS New England Design Redefined

Founded in 1986 by John Merkle and William Soupcoff, TMS Architects has grown into one of New England’s highest profiled and trusted architectural firms, serving both residential and commercial clients in numerous communities across industries and sectors. With a list of projects that includes renovations of The Wentworth By The Sea Hotel and The Portsmouth Music Hall as well as numerous residential projects, TMS has been involved in some of the most recognizable and historic venues in the area. The firm has always been driven by the idea of upholding New England’s unique and rich architectural heritage. TMS has also been guided by the principle that improving the structure of a building inevitably means improving its efficiency and has been practicing green design for twenty-six years. Sustainable architecture is not new; it is good design that incorporates all as56 Special Advertising Section

pects of sound environmental practices. Because of TMS’s decades-long commitment to sustainable design, their expertise and creativity can guide clients through the process of incorporating green practices into a renovation, addition or new construction. TMS Architects understands that dreams come in different sizes but all are special. So, we start with a simple question… what is your dream? We will work with you every step of the way on your next building project, whether it is improving the energy efficiency in your current home, designing an addition or renovation or creating a new home for you and your family—regardless of the site or size.


Portfolio of Fine Architecture

TMS Architects One Cate Street, Portsmouth, NH (603) 436-4274 www.tmsarchitects.com Special Advertising Section 57


DAVID SHARFF ARCHITECT, P.C. A Tradition of Timeless Design

Building or transforming your home should be a collaborative process and deliver a discerning design solution tailored to your needs. Since 1995, David Sharff Architect, PC has been implementing this approach in partnership with our clients to deliver award-winning designs for new homes, whole house renovations, additions and interiors. Trough the thoughtful integration of beauty and function, form, space and material, we instill the feeling that, while fresh, beautiful and new, antique or modern, “this feels like it has been here forever.� Our extensive experience in residential architecture and interiors results in a sensitive integration of new and old,. David Sharff Architect, PC offers a client-focused, relationship-driven approach to working with you to achieve architectural excellence, thoughtful transformations and sensible designs based on how you live in and use your home. 58 Special Advertising Section


MICHAEL J. LEE (5)

Portfolio of Fine Architecture

David Sharff Architect, P.C. ARCHITECTURE AND INTERIORS

David Sharff Architect, P.C. 67 West Street, Medfield, MA (508) 359-5737 www.davidsharffarchitect.com Special Advertising Section 59


HUTKER ARCHITECTS, INC. Creating Heirlooms Worthy of Preservation

Hutker Architects, Inc. (HA), founded in 1987, has designed more than 200 Heirloom Homes and is a full service architectural and interior design firm providing in-depth design strategies, comprehensive project coordination and site-specific construction observation. With offices located on Cape Cod, Martha’s Vineyard and Nantucket, HA has become the premier, high-end residential architecture firm for the Cape and islands, while exhibiting a substantial body of residential, commercial and institutional work stretching across the New England area. The firm’s thirty-person professional staff comes from a variety of backgrounds, utilizing their wide range of experience to continually refine the company’s values of quality craftsmanship and material ethics in the creation of a new regional vernacular. Such strength of talent and intimate knowledge of the locale makes HA predominantly qualified for the design of projects within 60 Special Advertising Section

New England’s natural and historical environments. Hutker Architects brings a passion for the profession of architecture that extends to every aspect of a project. Devoting thoughtful attention to each new challenge, the HA team applies innovation to tradition in the pursuit of solutions for different and unique requirements. Employing this new regional vernacular brings architect and client together in discovering project scope, design vision and architectural opportunities, fostering a collaborative spirit that enhances and promotes the design process. The result is a creative and balanced architectural response that is integral to its environment, eminently functional and embodies the specific imagination and lifestyle of the client.


Portfolio of Fine Architecture

Hutker Architects, Inc. Martha’s Vineyard (508) 693-3344 Cape Cod (508) 540-0048 Nantucket (508) 228-3340 www.hutkerarchitects.com Special Advertising Section 61


SALLY WESTON ASSOCIATES Architecture, Planning, Interior Design

Sally Weston Associates specializes in traditional residential architecture. Our firm has established a reputation for fine architectural design and we are dedicated to listening and understanding our client’s needs, desires and wishes and budget constraints. In addition, we are dedicated to thinking through solutions that will meet the owner’s needs now, in the future and throughout a family’s many changes. We take great pride in our projects, whether a new private residence, a renovation/ addition or an historic renovation. Our commitment to architecture through creativity, flexibility and thoroughness is reflected throughout our work and our relationships with clients and consultants.

62 Special Advertising Section


Portfolio of Fine Architecture

SALLY WESTON

A S S O C I A T E S

Sally Weston Associates 222 North Street • Hingham, MA (781) 749-8058 Special Advertising Section 63


POLHEMUS SAVERY DASILVA Timeless Design. Exceptional Craftsmanship.

The spectacular beach, dune and seascapes of New England engender great passion for the place. We at Polhemus Savery DaSilva Architects Builders consider ourselves blessed to be able to work in the region and to be able to create houses like the one depicted here for clients who share this passion. As an integrated design/build firm we combine a love of New England with a passion for creative design, exceptional craftsmanship, functional success, superior service-centered management and budget and schedule control. We do this with single source accountability so our often-busy clients can avoid the potentially contentious scenario of typical construction relationships. While our clients are diverse, their need for clear, direct communication, a trustworthy relationship and hasslefree project management is universal.

64 Special Advertising Section

Our design/build model is a powerful one that fulfills these needs and has served our clients well. In the words of one client quoted in an article about his house, “I always felt confident that the design concepts could be turned into reality because of the harmony that existed inside the firm.” In another article, a client praised our “ability to blend the artistry of architecture and design with precise construction.” We are proud to offer this unique service throughout New England while at the same time offering nationally recognized award-winning architecture. In the words of Robert Stern, Dean of the Yale School of Architecture, “The work of Polhemus Savery DaSilva beautifully melds the traditions of New England with the way we live today, affirming that an architecture of place trumps an architecture preoccupied with passing trends.”


Portfolio of Fine Architecture

Polhemus Savery DaSilva Architects Builders 101 Depot Road, Chatham, MA 02633 (508) 945-4500 www.psdab.com Special Advertising Section 65


A blaze in the cast-stone fireplace renders the vast fireside room cozier. Facing page: A limestone table anchors a fireside room seating area. 66 New England Home January/February 2011


A Hollywood Ending A Los Angeles–bred designer blends influences from east and west coasts to bring a sense of 1930s glamour to her own West Hartford, Connecticut, Tudor-style home. Text by Megan Fulweiler • Photography by Bruce Buck • Interior Design: Tammy Randall Wood, Interior Archaeology

January/February 2011 New England Home 67


A

ction! A door opens to reveal an entry hall so spacious it could serve as the lobby of a grand old hotel. Still, the ambience is warm, welcoming and even a trifle sexy. It’s not what the audience—in this case, houseguests— would expect to find in West Hartford, Connecticut, even in a landmark 1928 home like this one. But then, this is the kind of story around which films could be made. It all began three years ago when interior designer Tammy Randall Wood pulled up the drive. Stoner Mansion, as the house has always been 68 New England Home January/February 2011

known in these parts, stood forlornly at the end. Uninhabited for a decade, the place exuded a rescue-me vibe that Wood found hard to resist. She peered through the cobwebbed windows and fell totally in love. The raccoons frolicking in the master bedroom and the basement so full of aged mechanicals it resembled “the belly of the Titanic,” as Wood puts it, were of no relevance. “The craftsmanship was incredible,” says the intrepid designer. “The whole thing took my breath away. I was completely awestruck by the cast-stone fireplace that’s big enough to stand in. I just kept telling myself, ‘I can do this, I can do this.’ ”


The family’s Papillon, Trixie, perches on a custom sofa in the sunny conservatory, where antiques and modern pieces happily coexist. Facing page top: The living room’s drapes inspired the home’s palette. Facing page bottom: A whimsical sculpture gives the slate-tiled room garden-like flair.

And so she did. But it was more than just a renovation. The lovely house presented an opportunity for the designer, who runs her bicoastal firm, Interior Archaeology, from West Hartford and Beverly Hills, California, to mesh east- and west-coast influences in a home of her own. Old friends and clients are well familiar with her talents. But a wide-eyed Yankee visiting for the first time might need a moment to soak up the fresh, California-inflected rooms. Considering the house’s 13,000 square feet, the renovation was a major undertaking. The scale was huge (100 yards of fabric for living room curtains!), and every surface warranted help. “We had

to pick along, but we did it,” says Wood. Even the vintage boiler is back and chugging like a champ. Happily, there were good surprises, too. In addition to the glorious woodworking, Wood and her

The designer peered through the cobwebbed windows and fell totally in love. husband, David—the former president of Bose and now CEO of a Los Angeles–based company—were thrilled to discover some modern plusses like a topnotch elevator, closets that light up at the opening January/February 2011 New England Home 69


Upholstered chairs boost dining room comfort. Below: The dining room sideboard is crotch mahogany. Facing page top: The handsome woodwork throughout the house is original, including the paneled wall along the home’s main staircase. Facing page bottom: Velvet benches flank the gracious entry.

of the door and hidden roll-up screens in the iron casement windows. Less fun memories, like weeks of incessant banging and dust, have dimmed. The authentic Tudor-style house has returned to being a star. Wood’s penchant for mixing antiques with newer pieces, keeping patterns to a minimum and putting it all together against a rich but subdued backdrop has imbued the larger-than-life house with livability and style. “I search for a spark when I’m beginning a project,” the designer says. “Here, it was the Colefax linen I chose for the living room curtains. I could 70 New England Home January/February 2011


live with this pattern for a hundred years.” The living room, bedecked with those curtains and damask-covered chairs, certainly comes across as timeless. It’s in the massive fireside room that a bit of Hollywood glamour comes into play. The huge stone fireplace that first claimed Wood’s heart is coupled with a pair of French reproduction chests, neoclassic gilt mirrors, a Michael Taylor table and a horn chandelier. “I love antiques, but to make them shine you have to combine them with contemporary furnishings,” Wood explains. “Also,

you have to edit. I could have put in twice as much furniture all around, but I wanted the architecture to be in the forefront.” Her talent for juxtapositions carries over to the sunny dining room as well. Guests hunker down at an 1850 Duncan Phyfe dining table. A 1920s sideboard is the stage for a pair of antique Chinese porcelain vases. At night, sconces that are original to the house shed a romantic light over it all. Nearby neighbors—the butler’s pantry, the gleaming cook’s kitchen (with its Christopher Peacock cabinetry) and the cheery breakfast room— January/February 2011 New England Home 71


are newly outfitted with antique terra-cotta floors. In the last, the rustic tile becomes an inventive foil for a delicate Pierre Frey wallcovering. “Wherever something is feminine, you need something masculine,” Wood says. Obviously, that also explains the leather dining chairs and the bold chandelier constructed of iron horseshoes. More notable still is the conservatory. Who would think, for instance, to marry antique Jacobean chairs with two more of Michael Taylor’s forward-thinking tables in such a spot? Yet, once Wood points out that the silhouettes of Taylor’s creations speak to the chairs’ barley-twist legs, it makes 72 New England Home January/February 2011

perfect visual sense. The primitive nineteenth-century carpenter’s trunk in their midst looks as contented as a sleeping cat. And one more personal and provocative fillip: a harp belonging to Wood’s daughter-in-law invites strumming in the corner. Wood is a native of Los Angeles and the daughter of a movie director, so it’s not surprising that a hint of 1930s Hollywood elegance underlies her schemes. Whereas the master suite might simply have been tailored and comfortable, she added a cashmere rug in tones of lush cocoa and icy blue, raw silk curtains and hand-blocked linen shades. The couple’s bed is her design. Generously propor-


Lush materials define the master bedroom. Facing page top: An Italian neoclassical table sits at the foot of the contemporary staircase. Facing page bottom: The breakfast room hosts a Swedish sideboard.

tioned Barbara Barry console tables serve as nightstands and help maintain order. And since every ultimate retreat must have a fireplace, there’s one here in the sitting area. The couple’s private domain also includes two baths and the designer’s wardrobe room, along with David’s walk-in closet. It all makes for a very genteel, yet efficient, suite—not a bad combination for this busy pair, whose days whiz by in a flurry of meetings and deadlines. But then, there are those precious occasions when the family takes times to gather. In a house of this magnitude, it would have been understand-

able had Wood devised a some-rooms-are-offlimits scenario. Instead, her work affirms that, incredible architecture and stunning trappings aside,

A hint of 1930s Hollywood elegance underlies Wood’s schemes. this is their home—an environment that’s as joyous and nurturing as it is glamorous. What better ending could such a tale ever hope to have? • Resources For more information about this home, see page 140. January/February 2011 New England Home 73


The living room is traditionally formal with its Gustavian 22-karat gold leaf chandelier, circa-1770 mirror and eighteenth-century Louis XVI fauteuil armchairs. Facing page: This photograph by Candida HÜfer is part of the couple’s contemporary art collection.


City Slick, Country Quiet All the amenities of life in the suburbs—from parking to privacy to peace and quiet—find their way into a townhouse tucked in the heart of Boston’s Back Bay. TEXT BY ERIN MARVIN • PHOTOGRAPHY BY MICHAEL PARTENIO • ARCHITECTURE: DELL MITCHELL ARCHITECTS • INTERIOR DESIGN: CAROLINA TRESS BALSBAUGH, MANUEL DE SANTAREN, INC. • BUILDER: PAYNE/BOUCHIER • PRODUCED BY KYLE HOEPNER

C

City living isn’t always conducive to raising a family: noisy streets disturb a peaceful night’s sleep, cramped living quarters leave little room for privacy and parking often seems like an urban myth. Not to mention that dark back alleys make a poor substitute for a grassy backyard. No wonder many families make the move to the suburbs. • Having lived in Boston’s Back Bay for more than seventeen years, the owners of this townhouse wanted just such luxuries, but they didn’t want to uproot their young family. Together

with their Boston-based team of professionals— architects Dell Mitchell and Jeffrey Heyne, designer Carolina Tress Balsbaugh and builder Payne/Bouchier—the homeowners embarked on a complete gut renovation to create a suburban oasis in the heart of the city. • The owners wanted to retain the traditional elements of their home, designed by Peabody & Stearns in the late nineteenth century, but update it with modern amenities and flexible, functional space for both family living and entertaining friends. The January/February 2011 New England Home 75


home’s 5,600-plus square feet stretch over four floors, and its slightly fatter footprint gives it a roomier feel than the typical narrow Boston townhome. Mitchell expanded the ceiling heights, relocated the stairwell and added a skylight to bring in as much natural light as possible. With its elegant oval shape, rich red carpeting and warm mahogany handrail, the graceful new stairway spills out in welcome as you step inside the front door. In addition to the stair, Mitchell and her team designed all of the home’s woodwork, paneling and plasterwork, as well as most of the cabinetry and built-ins. “There are a lot of classical influences in the things we selected,” says Mitchell, citing the traditional rosette motif on the stairway and the string moldings and cartouches in the dining room as just two small examples. “We had an idea about making it feel graceful, using a lot of curves that are incorporated in both subtle and more obvious ways,” she notes. “It took a very fluid, very detail-intensive design to accomplish that.” Fluid, in fact, describes the overall layout; rooms on the first floor are connected by massive, mahogany pocket doors that slide smoothly in and out (“like butter,” quips Mitchell). Closed, they create privacy between spaces; open, they allow for a continuous loop of circulation. “We wanted to create a lot of spaces that worked for different scenarios,” says the owner.

The owners, contemporary art enthusiasts, wanted the house to serve as a backdrop for their collection. Now, the family can host large soirées that flow from room to room, intimate dinner parties centered in the dining room or casual get-togethers that take advantage of outside areas. A warm, inviting yellow—the owner calls it “a happy color”—coats hallway walls, and white molding ties every room together. The only exception is the library, which is done entirely in figured anigre, a contemporary take on the more traditional mahogany usually found in such spaces. Balsbaugh was attentive to the owners’ love of color; rather than painting the entire house different shades of vanilla, she incorporated red, sage green, indigo and gold. Pops of color accent the formal living room, where a reproduction Coco Chanel sofa upholstered in gold and pearl-gray bouclé fabric and accented by rosecolored silk velvet pillows sits beneath a photo by Candida Höfer that depicts the plush red seating and opulent neo-Baroque architecture of the Palais Garnier in Paris. The owners, contemporary art enthusiasts, wanted the house to serve as a backdrop for their 76 New England Home January/February 2011


The starburst pattern on the dining room oor is made of three types of wood: bubinga, wenge and white riftsawn oak. Facing page top: A foyer wall is lined with 144 monoprints from The Shapes Project by Allan McCollum. Facing page bottom: Architect Dell Mitchell designed the graceful, oval shaped staircase.


A circle intersecting rectangular lines within the woodwork on the library ceiling is one of many classical details throughout the house. Facing page top: Kitchen cabinetry was custom designed by Dalia Kitchen Design. An iron door leads to the adjacent courtyard (facing page bottom).


collection, and plaster moldings conceal art lighting throughout the house. In striking contrast to the light palette of the living room, the octagonal dining room has walls cloaked in a deep aubergine glaze. Balsbaugh hired an artist to paint the room as if working on an oil painting; it took seven layers and about three weeks to dry. White sheers block the alley views, and mirrored shutters can be closed to reflect the entire room. “It’s like being in a jewel box,” says the owner. Above the living and entertaining spaces, the master suite is a serene refuge with its luxurious taupe and blue velvet-upholstered walls, creamy damask wool-silk carpet and blue embroidered curtains. Nineteenth-century Chinese vase lamps sit atop mirrored nightstands on each side of the bed, and a silk velvet chaise invites midday lounging. The owners’ two daughters share the top floor, their bedrooms connected by what Balsbaugh calls a “Jill and Jill” bathroom. Each room is decorated in the girl’s favorite colors—one celadon and lavender, the other yellow and pink. The older girl’s room has an eighteenth-century canopy adapted to fit a queen-size

The owners wanted to retain the traditional elements of their home but update it with modern amenities. bed, while the younger sleeps under a custom candystriped silk baldachin. Sweet dreams come easy in this house: bedrooms are outfitted with blackout shades (which Mom can open from her bedroom to slowly wake the girls each morning), and the entire house is soundproofed to muffle city noises, making it as quiet as evening in the suburbs. As part of the renovation, the kitchen was moved to the lowest level; the architects excavated a foot down in order to give the room loftier ceilings. The stairway leading downstairs was carefully constructed to help incorporate the kitchen into the rest of the house, with a small oval window cut into the side that allows people sitting at the kitchen table to see who’s going up or coming down. “The fact that they had children is the reason we worked so hard to make the kitchen feel connected,” says Mitchell. “We wanted it to feel

January/February 2011 New England Home 79


Soft velvet wraps the master bedroom’s walls. Facing page top: A built-in designed by Mitchell surrounds a Louis XVI desk in the older girl’s bedroom; Mitchell also fashioned the ceiling niche with its custom-painted sky mural. Facing page bottom: French wallpaper and matching curtains bedeck the “Jill and Jill” bathroom.

like the heart of the home, even though it’s down on the lowest level.” Beneath cream-colored cabinetry, the backsplash boasts hexagon-shaped honey onyx tile, while the

table. “I wanted it to be beautiful but sensible,” says Balsbaugh. “I didn’t want someone to go hysterical if you spilled something.” The ground-floor kitchen affords the homeowners another suburban luxury not often found in the city: the ability to drive right up to the door to tote groceries inside without having to trudge up and down stairs. The large driveway pulls double-duty as a favorite play area for the owners’ daughters and their neighborhood friends, and a courtyard garden off the

The entire house is soundproofed, making it as quiet as evening in the suburbs. kitchen island is topped with Costa Esmerelda granite. A laminated stripe fabric cushions oak barstools, and faux-leather chairs gather around the kitchen 80 New England Home January/February 2011


kitchen gives the family plenty of room to grill outdoors. High above the city, their roof deck offers beautiful views of the Charles River. And parking? The owners actually have more than enough; they turned their garage into a home gym. An elegant aesthetic, plenty of square footage, guaranteed quiet nights, family-friendly outdoor spaces and even private parking—all in one of Boston’s best neighborhoods. This suburban-like city dwelling truly has it all. • Resources For more information about this home, see page 140. January/February 2011 New England Home 81


The owners’ art collection shines against a neutral backdrop. The homeowners brought in the chandelier and designer Jeanne Duval located toss pillows to match the glass precisely. Facing page: A gallery sits just off the foyer.

New York State 82 New England Home January/February 2011


A young family’s New Hampshire loft is every bit as big-city sophisticated as the Manhattan condo they left behind. TEXT BY PAULA M. BODAH • PHOTOGRAPHY BY MICHAEL PARTENIO • ARCHITECTURE: DANN N. BATTING, DANN NORRIS BATTING ARCHITECTURE • INTERIOR DESIGN: JEANNE DUVAL, TOWNE HOUSE INTERIORS • PRODUCED BY STACY KUNSTEL

n first thought, a move from New York City to Portsmouth, New Hampshire, may seem as big a leap in lifestyle as in geography. Sure, Portsmouth is a city, but its designation as such may be all it has in common with the Manhattan neighborhood this young family previously called home. Here, the pace is slower, the views are prettier and getting two youngsters to their various after-school activities is a breeze. And yet, thanks to their particular living quarters—a spacious loft on the top floor of a onetime factory building—and a designer who

O

of Mind

January/February 2011 New England Home 83


appreciated her clients’ sophisticated tastes, the homeowners’ new place is every bit as polished and urbane as any big-city penthouse suite. Initially the fifth-floor unit was one large space, giving the couple the opportunity to configure it to suit their family. With architect Dann N. Batting of Chester, New Hampshire, they drew up a plan that separates the 3,300square-foot area into two distinct zones. A turn to the left from the entry leads to the public spaces, beginning with a gallery that gives visitors their first clue that the homeowners are serious art collectors. On this exterior side of the unit, the kitchen, dining room and living room occupy a long, open expanse that ends with views of Portsmouth Harbor. The spacious master suite tucks into the left corner, offering views of both the harbor and the downtown rooftops. Taking a right from the entry leads to the unit’s interior and the children’s rooms, guest room, media room and an office. Batting’s work usually involves more traditional design, but he welcomed the challenge of meeting the homeowners’ requirement for a clean, modern look free of the pilasters and moldings New Englanders often seek. The new walls are unadorned, save for a slender metal reveal around door casings and where walls and ceiling meet. “The client was pretty adamant that he was looking for a clean, almost museum-quality look, with no architectural detail to detract from the art,” Batting says. “It’s a challenge in an old building, where the floors and walls aren’t perfectly even. People think this modern look is easy, but it’s harder when you can’t use moldings to cover up the vagaries of an old building.” Clean and modern hardly means devoid of character, though, as the hexagonal foyer—an idea suggested by Batting and welcomed by both clients and interior designer Jeanne Duval of Jaffrey, New Hampshire—makes clear. Duval ramped up the “wow” factor even To the serene more by designing a marble floor in background, shades of gray and white that gives the ilthe designer lusion of three dimensions. “It’s dynamadded the ic,” says the homeowner. “It’s like an Escher painting, and it’s in tune with the occasional rest of the place.” jolt of The owners’ collection of contemporary bright red. art formed the starting point for Duval’s interior design, which she describes as “sleek and modern, but at the same time, glamorous.” Because many of the works of art are large and colorful, Duval settled on a neutral backdrop, covering the walls of the public spaces with a Benjamin Moore color called Revere Pewter. “It’s a very soft color,” she says, “not really brown or tan or gray—just a great color.” The streamlined kitchen sticks to the neutral theme 84 New England Home January/February 2011


The sleek kitchen gets a dose of drama from a Lucite chandelier. The painting next to the kitchen is by designer Jeanne Duval. Facing page top: A Joseph Carini rug and suede-cushioned chairs warm the dining room. Facing page bottom: A Coke-bottle-green slab sink in the powder room.


with its white Silestone countertops and walls of marble tile with horizontal stripes in shades of gray. Local cabinetmaker Woody Huntington and Duval worked closely to make sure the cabinets were just the right shade of not-quite-black. “Woody is very much a perfectionist,” says Duval. “I wanted a hint of the brown oak to show through the black, and he spent a lot of time coming up with just the right finish.” A drum-shaped light fixture made of interlocking rings of Lucite hangs above the island, lending a bit of sparkle to the room. Neutrals, once again, predominate in the dining and living room, where leather suede chairs cozy up to a glass-topped dining table and the contemporary sofas and lounge chairs from Duane Modern wear upholstery in a soft wheat color. To this serene background, Duval added the occasional jolt of bright red. In the kitchen a Joseph Carini rug, one of several the owners brought from their previous home, brings a touch of warm color with its vivid red floral design on a pale background. And between the kitchen and formal dining area, a breakfast spot fairly blazes with its chairs covered in fire-engine-red velvet surrounding a glossy B+B Italia table. Red plays a larger role in the master suite, where the color has morphed into a paprika hue in the carpet and bedding. In an especially clever stroke, one end of the bedroom has a glass slider that leads to a sun-drenched sitting room with a cozy sofa and chairs outfitted in purple velvet. With the sliders open, the sitting room is part of the bedroom. Close the sliders and open a pocket door on the perpendicular wall and the room becomes an extra seating area for entertaining. Double-sided draperies hang at the slider, showing a sumptuous gray silk on the bedroom side and, from the sitting room, a contemporary swirled pattern in pale neutrals. Tiny iridescent In the mostly white master bath, tiny iritiles glow descent tiles glow in a rainbow of pale pasin a rainbow tels, illuminated by a glamorous fixture that looks like a shower of light above the white of pale marble tub. White glass tops the tub as well pastels under as the vanities, whose wooden drawers and a shower cabinets have been covered with multiple of light. layers of brilliant white lacquer. “They’re just smashing,” says Duval. For the husband, who grew up in New Hampshire, moving to Portsmouth was something of a homecoming. For his wife and children it was a whole new adventure, one they’ve embraced. It seems that small-city life in a home with big-city sophistication is just right for this family. • Resources For more information about this home, see page 140. 86 New England Home January/February 2011


The sitting room is accessible from the master bedroom or the living room. Facing page top: The family cat, Kiddo, perches on the white glass deck of the master bath tub. Facing page bottom: Royal purple covers antique sofas in the sitting room.


TWO OF A KIND Partners in the Boston design firm GauthierStacy open their homes for a side-by-side tour. TEXT BY STACY KUNSTEL • PHOTOGRAPHY BY LAURA MOSS • INTERIOR DESIGN: JIM GAUTHIER AND SUSAN STACY, GAUTHIER-STACY • ARCHITECT FOR JIM GAUTHIER: DOUG DOLEZAL • PRODUCED BY KYLE HOEPNER

Y

ou would think that two people who can finish one another’s thoughts and intuit each other’s design decisions, who attended the same college and have worked together for more than a decade and a half, might share similar approaches to living—especially given that they reside a few floors from one another in the same South End apartment building. • Not so for Jim Gauthier and Susan Stacy, partners in the Boston interior design firm Gauthier-Stacy. While the two have fashioned enough spaces together to fill volumes of home magazines, their own places put their differences on display as soon as you walk in their front doors. • Those who know them can see immediately that the

88 New England Home January/February 2011


Sleek and chic in black and white deďŹ nes the living room of Jim Gauthier’s apartment. Facing page: Though the design partners live in the same building, two very different styles emerge in the entryways of Jim Gauthier (top) and Susan Stacy (bottom).


Their own places put their differences on display as soon as you walk in their front doors.

90 New England Home January/February 2011


Art creates the pattern in Stacy’s neutral-toned living room. Facing page top: A sleek tray disguises the rarely used cooktop in Gauthier’s kitchen. Facing page bottom: The antique table in the center of Gauthier’s living space can take on the role of dining or coffee table.

divergence in their homes echoes the differences in their personalities. Mirrored walls reflecting a modern twig-like table and a tangerine-colored lamp in Gauthier’s foyer stand in striking contrast to the traditional chest and collection of framed intaglios gracing the entry to Stacy’s space. He’s the gregarious public persona for their fourteenyear-old firm, while his more introverted partner prefers to keep her life beyond the business ensconced in private family time with her husband, Tom Shanahan, and their two young children. Flashes of drama play out in Gauthier’s 1,100square-foot abode, where chocolate-colored walls and heavy black floor-to-ceiling shutters screen the living area from the bedroom. A twelve-foot

linen-covered sofa is astonishingly long, yet it goes practically unnoticed among the other overscaled pieces. “A friend said to me, ‘Are you high?’” Gauthier recalls with a laugh. “But most people don’t realize how big the sofa is until they’ve taken in the whole room.” “The architecture of the apartment is all a modern interpretation of really classic detailing,” notes Gauthier, who worked with Boston architect Doug Dolezal on the home’s layout and architectural details. “Doug took all the things I loved and interpreted them in a more modern way,” says the designer. Traditional interpretation doesn’t always mean conventional execution, though. The tile-lined January/February 2011 New England Home 91


Where his rooms and their functions meld into one another, her spaces are more defined.

92 New England Home January/February 2011

bathroom doesn’t have a door on it, and kudos to the visitor who can actually find the kitchen, which functions more as an urbane backdrop for takeout rather than a place to make actual food. “I planned it that way,” Gauthier says. “I sit at the bar all the time. I set up my computer there, look at the view, watch TV, eat dinner.” A custom tray hides the cooktop, while the paneled refrigerator disappears into cabinetry. A wall-mounted faucet hangs over a sink just large enough to chill a champagne bottle. Clearly, the apartments of Gauthier and Stacy are set up for single versus family life. Where his rooms and their functions meld into one another, her spaces are more clearly defined. “I wanted formality in the entry foyer so it felt like you were walking into a house,” she explains. “A mudroom helps keep the house sorted. The kitchen”—a full-size version with a small breakfast area at one end—“is a good place for the kids to hang out because their rooms are right down the hall.” More traditional bones, the whisper of a color palette, a mix of antiques, darkened floors and layers of artwork and collections lend old-world sophistication to Stacy’s home. “It’s so Susan...it’s so Susan,” says Gauthier. “White, funky, eclectic—so Susan. She loves neat art and neat things and loves to collect stuff, but she doesn’t like clutter. White and tan and taupe are so Susan.” “I love art,” agrees Stacy. “It’s a huge part of me and my house and who I am. I had an artist as a mentor and have a lot of his pieces. My house is eclectic, and I live with things I love whether they work or not.” The work of that mentor, Tom Rowlands, hangs throughout the apartment, along with boxes, shells, stones and hats that define the surfaces not used for living. A collection of milliner’s molds fills four built-in shelves on either side of a doorway between the entryway and the living room. In the master suite a fabric screen divides the sleeping area from the bathroom, but it’s used more to regulate


Stacy wired a Balinese umbrella to serve as a whimsical chandelier in her dining area. Facing page: French doors separate Stacy’s master suite from the living area.

January/February 2011 New England Home 93


light than for privacy. “I don’t like the idea of being relegated to a tiny room with a tub in it,” says Stacy. She also wanted a formal dining area, but the 2,100-square-foot apartment didn’t allow for anything larger than an alcove. Stacy made the most of the space with an L-shaped banquette covered with a linen cushion and sprinkled with throw pillows. “It’s amazing how much better manners are when you eat in the dining room,” she says. Above the contemporary round dining table hangs a Balinese umbrella, lending a touch of whimsy. As is evident in their work for clients, Stacy and Gauthier have a talent for repurposing everyday objects. “I liked the idea of something besides a chandelier. The umbrella is more me, less typical of what you would expect to find,” Stacy says. It’s that talent for creating unexpected moments—along with a shared strong work ethic—that brought the two of them together. Cape Cod–raised Stacy and Berkshires-bred Gauthier both attended the University of Massachusetts at Amherst, but their paths didn’t cross there. While Stacy cut her teeth on commercial interior design, working for Ben Cook at Trade Winds and in California, Gauthier started at Bierly-Drake Associates, thinking he would spend his career there. It wasn’t until Stacy also went to work at Bierly-Drake that the two met. It was a match made in heaven. “We’ve always worked well together,” says Gauthier. “We bring different things to the table. I can’t imagine not working with Susan.” It should be noted that what you see in their homes is not necessarily what you would get in hiring their firm. “Our aesthetics never come into play in a client’s decisions,” says Stacy. “We just ask, ‘What’s going to be the best thing for the job? What’s going to push it to the next level?’ Our entire taste is taken off the table.” Even so, their work for clients is typically beautiful, comfortable and as chic as their own homes. • Resources For more information about this home, see page 140.

94 New England Home January/February 2011


Gauthier created texture on the bedroom walls by adding raised wood paneling and hanging plenty of art. Facing page top: A contemporary footed table stands in front of a bank of mismatched pillows in Stacy’s bedroom. Facing page bottom: Gauthier upholstered the guest bed niche in herringbone linen with nailhead trim.

January/February 2011 New England Home 95


Are you tired of fossil fuel prices spiraling upward every year - even as oil companies set new records for profit? Then switch to a WaterFurnace geothermal heat pump. A WaterFurnace geothermal system uses the clean, renewable energy stored in your backyard to save up to 70% on heating, cooling and hot water. It’s the environmental equivalent to planting an acre of trees or taking two cars off the road. It’s good for the environment, it’s great for your budget and thanks to a 30% federal tax credit, now is the best time to act. Call Coneco Geothermal Systems right now for more information.

(508) 443-5011 www.coneco.com

visit us online at waterfurnace.com

©2010 WaterFurnace is a registered trademark of WaterFurnace International, Inc. *Based on ARI13256-1 (GLHP - Part Load Ratings)


GREEN LIVING

Creating the Green Home in New England

PHOTO BY JUDSON ABTS, COURTESY OF NATIONAL LUMBER/KITCHEN VIEWS

From the reclaimed pine floors to the water conserving faucets, Energy Star appliances and no-VOC finishes, Jessica Williamson of Kitchen Views Custom designed this kitchen to be as green as possible.

SPECIAL MARKETING SECTION

A GREEN MAKEOVER BY DIANE M. STERRETT


GREEN LIVING [GREENGOODS] Anderson Insulation What would you do with 4,288 beer bottles? Anderson Insulation would insulate a 3,000-square-foot home! As a leader in ecofriendly insulation techniques and materials, Anderson Insulation helps architects, builders and homeowners insulate better and make the earth a greener place. One of Anderson’s favorite materials is Knauf EcoBatt, made with post-consumer recycled glass such as beer bottles. And thanks to the product’s plant-based binder, it releases no VOCs, no formaldehyde and no phenol, resulting in healthier air quality. Anderson is the only insulation contractor in New England certified by the NAHB Research Center for its installation practices. www.andersoninsul.com

ARCO, LLC ARCO implements sustainable building practices essential to the environment and integral to the performance, look and feel of all of their projects. Over the past years ARCO has built a reputation as one of the newest premier general contracting teams offering clients the best of all worlds: in-house architectural design, cutting-edge, pro-environment construction methods and a collaborative team approach with architects and designers to create more efficient and healthier homes. They are dedicated to sustainable building practices and continuing education to ensure a design of lasting beauty that is in complete harmony with your site and your lifestyle. www.arcollc.com

Boston Architectural College The Sustainable Design Institute at the Boston Architectural College (BAC) offers the most comprehensive sustainable design curriculum in the country. This faculty-led, interactive, graduate-level instruction features a fully online format. It offers the opportunity to learn about the many ways in which buildings interact with the natural environment and the choices available to make that interaction positive. Courses can be taken individually or as part of the Sustainable Design Certificate programs, which include the Certificate in Sustainable Residential Design. Please consult the BAC’s sustainable design Web page for schedules, detailed course descriptions, prerequisites, tuition information, faculty bios and registration information.

www.the-bac.edu/green

98

SPECIAL MARKETING SECTION

W

Want to be a little greener? We’ve gathered some easy, eco-friendly ideas for a room-by-room green makeover Mother Earth will love. Do a lot or a little—it’s up to you.

nKitchen Let’s start in the kitchen, since it’s the number-one do-over room in the house and there’s an eco-friendly option for everything. For cabinetry, you have three main green categories to consider: reclaimed, renewable and Forest Stewardship Council (FSC) certified. Reclaimed wood has been remilled from previously used salvaged timbers, preventing the lumber from becoming waste while also preserving living trees. “Renewable woods, such as bamboo and lyptus, are considered green because they are rapidly renewable resources with a significantly shorter growth life,” says Jessica Williamson, AKBD and green design specialist at Kitchen Views Custom in Newton, Massachusetts. “But neither is made in the U.S. If a customer is trying to be green, I recommend sourcing materials as locally as possible. Crystal cabinets and Greenfield cabinetry are both made in the U.S. and offer green options.” Nearly all wood species grown in the U.S. are FSC-certified, she says. That means the lumber was harvested using responsible forestry and replanting practices. Other green cabinetry features to look for are no added urea formaldehyde in the boxes and a no-VOC finish on the outside for healthier air quality. Options abound for eco-friendly countertops, including PaperStone, IceStone and Eco by Cosentino. “These products have become more readily available lately,” Williamson says. “One newer option called Okite is made from quartz and contributes to LEED points if you’re going for certification. I’ve also done many more wood countertops lately; people like the texture and are trending toward a more natural, organic look.”


85 years of dishwasher know-how just received its highest honor... Ranked Highest in Customer Satisfaction. J.D. Power and Associates ranked Miele “Highest in Customer Satisfaction with Dishwashers�

Serving all of New England 978.448.8555 www.riverbendandcompany.com blog.riverbendandcompany.com

Miele received the highest numerical score for dishwashers in the proprietary J.D. Power and Associates 2010 Kitchen Appliance StudySM. Study based on 15,853 total responses measuring 18 brands and measures opinions of consumers who purchased dishwashers from a retail store or their new-home builder during the previous 24 months. Proprietary study results are based on experiences and perceptions of consumers surveyed in March-April 2010. Your experiences may vary. Visit jdpower.com.


AT ANDERSON INSULATION, WE MAKE SUSTAINABLE CHOICES. That’s why we’re proud to use Knauf EcoBatt ® Insulation. In fact, Knauf EcoBatt Insulation contains over 40% post-consumer recycled glass from bottles collected at curbside. And as a result, we put about 2700 recycled bottles into every home we insulate, so they’re not only comfortable and energy-efficient, they’re also more sustainable. Make the right choice, too. Call Anderson Insulation for all your insulation needs.

Serving New England, Rhode Island, Southern New Hampshire, Southern Maine and Massachusetts Since 1949 1-800-472-1717 www.andersoninsul.com


“Winter is the time for comfort, for good food and warmth, for the touch of a friendly hand and a talk beside the fire: it is the time for home.� ~Dame Edith Sitwell

342 Great Road - Route 2A Acton, MA 01720 978.263.0100

301 Newbury Street - Route 1N Danvers, MA 01923 866.784.7178

www.FirstRugs.com Antique, Decorative & Contemporary Rugs | Expert Restoration, Repairs & Cleaning


GREEN LIVING [GREENGOODS] Boston Green Realty, LLC Boston Green Realty is Greater Boston’s premiere boutique green real estate firm specializing in luxury and high-performance green homes. As the first Certified EcoBrokers® in Massachusetts, Leland and Suzanne DiMeco bring a green point of view to all their real estate sales. With extensive training in how to identify and promote a home’s green features, they help buyers find homes that are healthy, comfortable and cost-effective, explaining which energy efficiency features to look for and the pitfalls to avoid. By calculating the dollar value of improvements, they also help homeowners, builders, developers and investors ensure that their green home or project doesn’t go undervalued.

www.bostongreenrealty.com

Coneco Geothermal Use the earth’s free, renewable energy for heating, cooling and hot water with an earth-friendly geothermal system. You could save up to 70 percent on your energy bill! As turnkey providers, the geothermal engineering experts at Coneco Geothermal will guide you to the right solution and manage each step of the process— from initial consultation and design through drilling/trenching, radiant floor heating, ductwork, electrical, plumbing, system start-up and maintenance. A system can be configured for either new construction, an existing home or larger commercial applications. In fact, Coneco helped the National Park Service convert two National Memorial buildings from oil to a new geothermal solution. www.coneco.com

Crown Point Cabinetry Crown Point Cabinetry handcrafts the finest quality custom cabinetry for the entire home. Period styles include Shaker, Arts and Crafts, early American, Victorian, transitional and contemporary. Finishes include the eco-friendly Estate Eggshell paints from Farrow & Ball as well as Genuine Old-Fashioned Milk Paint. Your cabinetry can be designed and built from FSC-certified lumber or any of Crown Point Cabinetry’s vintage or reclaimed wood species. All custom, available direct, nationwide. www.crown-point.com 102

SPECIAL MARKETING SECTION

Another thing she recommends for a green kitchen are efficient appliances. “Use as many Energy Star–rated appliances as possible. The refrigerator and dishwasher are especially important. The dishwasher should have a light wash cycle option that uses less water.” Bottom line: it doesn’t take a lot of effort to be more energy conscious and environmentally friendly in the kitchen. Something as simple as adding a convenient bin to sort recyclables saves you time and may help you recycle more.

nBath An environmental issue that’s quickly becoming a global concern is water usage, and that’s where your bathroom fixtures can help. “There is some really great toilet engineering going on at companies like Toto and Kohler. The new ones use 1.28 gallons per flush, versus the 1.6-gallon standard from the early ’90s. And the dual flush uses half the amount of water when you’re flushing only liquids,” says Robin Brenner, owner of Billie Brenner, Ltd., a showroom at the Boston Design Center specializing in plumbing and door hardware. The other trend she sees is people giving up a master bathroom tub and using the shower instead for that spa relaxation experience. Anyone really thinking green will also forgo the dozen body sprays and choose a low-flow rain showerhead. “They have engineered a way to approximate the experience with 2.5 gallons per minute instead of 10 gallons per minute,” Brenner reports. For the tub itself, Brenner touts Wetstyle’s cool green options. All their soaking bathtubs, lavatory sinks and vessel sinks are crafted by hand from Wetmar, the company’s eco-friendly natural stone composite material. When choosing a vanity, you’ll find that many manufacturers have incorporated sustainable materials, paints and stains. Look for FSC-certified


GREEN LIVING [GREENGOODS] First Rugs Furnishing your home with chemicalfree, eco-friendly materials can result in healthier air quality as well as beautiful rooms. First Rugs has a large collection of all-natural, unbleached/undyed wool rugs in varying dimensions, up to palace size. Known as Gabbeh, these rugs are woven of handspun wool in knot styles from coarse-naïve to very fine. See thousands more hand-knotted wool and silk rugs from First’s world-class collection—including antique, decorative and contemporary rugs from Iran, Pakistan, Romania, India, Egypt and Tibet—at the company’s showrooms in Acton and Danvers, Massachusetts. www.firstrugs.com

The Granite Group/The Ultimate Bath Showrooms Through their exclusive showrooms, The Ultimate Bath Showrooms, The Granite Group offers cutting-edge energy-efficient products such as Buderus boilers and Grundfos pumps. Through a partnership with Buderus boilers and heating systems, The Granite Group has focused on using solar panels for domestic hot water. The Buderus solar flat plate collector saves homeowners up to 60 percent on fuel costs. And Grundfos is the world leader in developing pumps that use less than a 25watt light bulb and will save up to 12,000 gallons of water. In addition, The Granite Group has partnered with Kohler on their Save Water America campaign (www.savewateramerica.com) to raise water-conservation awareness and help people save water at home. www.theultimatebathshowroom.com

Housewright Construction, Inc. Housewright Construction creates beautiful structures with cost-efficient green value built into quality construction. They begin by fabricating a state-of-the-art thermal envelope, verified with thermography, so you know they deliver the performance they promise. Housewright incorporates energy efficiency in every aspect of the construction process. The company’s professionals assess your building site, then develop the most effective HVAC strategies and offer local, sustainable building materials. The dynamic nature of green building demands ongoing education. To bring you the best resources, Housewright’s people stay current by attending workshops and cultivating partnerships with specialists in related technologies. Let Housewright show you how beautiful and affordable green can be. www.housewright.net 104

SPECIAL MARKETING SECTION

woods and low- or no-VOC finishes. For the finishing hardware touches, Brenner likes SpectraDécor. “They’ve always been ahead of the curve with beautiful eco-friendly hardware and tile made from recycled materials like glass, cork and eco-resin,” she says. Indeed, the company’s recycled glass and lead-free pewter knobs and pulls are positively luminous. Even your bathroom walls can be greener, with tiles made from coconut shell processing scraps or shells reclaimed from seafood processing plants that resemble mother of pearl.

Room nMedia With the multiple large-display televisions, DVRs and cable boxes in today’s homes, reducing energy use is the fastest way to go green in the media room. If you’re in the market for a new television, your first option in the decision tree is usually “LCD or plasma?” “To a media specialist like me, plasma performs better, but they are nowhere near as efficient as an LCD,” says Dennis Jaques, systems designer at Maverick Integration in Bedford, New Hampshire. “Plasmas use phosphorous like the old CRTs did. LCDs use LED lights and save a lot more energy. But if you really want the look of a plasma, the new ones are more efficient. Look for one with the Energy Star label— Panasonic offers a model that has met that qualification. There are more and more electronics coming out as Class D, which has a low energy circuit that produces the same amount of power using less energy.” An energy initiative passed in California last year will have a trickle-down effect for the rest of the country. The new regulation requires that any device in a standby mode, such as a television that’s plugged in but not turned on, cannot use more than six watts of energy. That’s about one tenth the amount of power draw, Jaques says. Continued on page 110


Craftsmanship. Integrity. Value.

Our experienced staff includes National Association of Homebuilders Certified Green Professionals.

5365 Main Street Newbury, Vermont 05051 802-866-5520


It’s really what you don’t see that matters

Contact Xtreme Audio & Video to see how we can add more excitement and simplicity to the technology in your home with one of our state of the art systems.

888-987-6281 | W W W.XTRE M E - AV. C O M


Join us for a week in

italy

May 9-15, 2011

Enjoy excursions to:

Carrara, Tuscany and Florence Visit a marble stone quarry, the healing waters of the Equi Terme, a Chianti winery and Accademia where the famous statue of David stands. Trip includes: • Round trip airfare and hotel accomodations • 3 nights in Viareggio and 2 nights in Tuscany • Lunch and wine tasting in Tuscany • 3 dinners hosted by Stone Technologies • Breakfast daily

Innovation. Building Blocks for

Call Guy Fodera at 877.545.9474 for more details.

YOUR DESIGN STARTS HERE.

Visit Our Showroom with an Indoor Slab Selection Area: 5 Draper St., Woburn, MA 01801 Showroom Hours: M - F (8am - 5pm) | Thurs (5pm - 7:30pm) by apmt | Sat (9am - 2pm) Call Toll Free: 877.545.9474

www.stonetechonline.com


Gary Hall Photography

GREEN LIVING

CASE STUDY: A VERMONT VACATION VENUE BY DIANE M. STERRETT

Architect: Jeff A. Stetter, AIA, Gossens Bachman Architects, Montpelier, Vermont • General Contractor: Ennis Construction, Ascutney, Vermont • Home: 4 bedrooms, 3 baths, 2,400 square feet, plus detached garage and studio • Site: 5 acres amid 81 acres of perpetually protected mountain land Challenge: A young Boston family wanted a contemporary vacation house in the woods with a real connection to the outdoors and built in the most environmentally friendly way possible. Solutions: A highly insulated building envelope that achieved a 54 HERS Index rating, durable and locally sourced materials, a whole-house ventilation system and low-VOC paints and products. The Approach: Architect Jeff Stetter’s first principle in building green is reducing the home’s energy load so it doesn’t need a lot of fuel. His clients embraced that idea for their sporadically used vacation home. “We discovered these clients were really like-minded, which proved great for the project. For the insulation package we used spray foam and extruded rigid insulation. Ennis [the contractor] 108

SPECIAL MARKETING SECTION

did a lot of air sealing and caulking, and used double studs,” Stetter explains. Every insulation detail was seen to, including the concrete fireplace hearth. Although it appears to extend directly outside, it’s padded with three inches of rigid insulation to make it thermally efficient. The walls are insulated to R-40 rather than the typical R-19, and the numerous windows are triple-paned. Though some walls have a 40 percent glass ratio—a result of the homeowner’s desire to connect to the landscape—the project still achieved a 54 HERS rating certified by the Vermont Energy Investment Corp. “A HERS of 100 is the typical codecompliant American home, so this home is 46 percent more efficient than a typical home,” Stetter explains. With such a tight building, a wholehouse energy recovery ventilation system

was important. The unit the homeowners installed conserves energy by capturing heat from exhausted air and using it to pre-heat the incoming fresh air. On the home’s steep, easterly facing site, the team’s biggest challenge was to capture the view and as much sunlight as possible for passive solar gain. “We worked to get as much daylight in there as possible so they don’t have to have the kitchen light on all the time,” Stetter says. “They get some nice solar gain in the morning, and with a tightly insulated shell it doesn’t need much more.” Stetter’s favorite green aspect is the home’s variety of durable materials, such as locally quarried slate, maple floors, fiber cement siding and western red cedar. “They’re products that are going to last a hundred years, and they require less maintenance.” The Result: A vacation home that could be described as a tree-house for grownups, a family camp where growing children can enjoy fresh air and explore the great outdoors.


Custom. Period. Furniture that fits. True custom cabinetry. The perfect fit for your New England home.

800-999-4994 • www.crown-point.com


GREEN LIVING [GREENGOODS] Kitchen Views Custom and Kitchen Views at National Lumber Kitchen Views proudly offers their discerning clients Omega Cabinetry, which has earned certification in the groundbreaking Environmental Stewardship Program. This certification authenticates Omega’s high level of commitment to the environment and sustainability of natural resources. Choose from a wide selection of door styles, available with custom finishes in many wood species. There are fashionable selections for the outside, such as mullion inserts, and intelligent storage solutions for the inside. All within exceptionally built all-wood cabinetry and exclusive Omega Armor finishes that combine the best of fine furniture and easy care. Omega's solid wood case construction makes your cabinetry ready for a lifetime of use. www.kitchenviews.com

LaBarge Homes LaBarge Homes, a general contracting business specializing in custom homes, has been providing high-quality green building, hurricane-resistant construction and Energy Star–rated homes since 1996. LaBarge, an NAHB Certified Green Professional, uses Insulating Concrete Forms (ICF) to create beautiful homes that honor all architectural styles while providing an energy-efficient environment, with greater design flexibility, comfort and aesthetic advantages than conventional construction. ICF construction provides structural stability and a healthier living environment while reducing energy consumption by approximately 40 percent. Though ideal for high-wind oceanfront homesites, ICF can be used for all energy-efficient homes, additions and pools.

www.labargehomes.com

Maverick Integration At the 1984 Consumer Electronics Show, the phrase “smart home” was born. Twenty-five years later, technology is finally catching up to aspiration as the “smart grid” becomes a reality. Beyond home theaters and big screens, Maverick Integration automation systems can help you be greener by reducing your energy consumption. Since lighting accounts for 20 percent of your energy bill, Maverick offers lighting control systems that go beyond dimmers into the realm of learning your lighting habits, turning lights off when you’re not there and saving you big energy, which means big money. Come explore green home technology that adds convenience with Maverick. www.maverickintegration.com

110

SPECIAL MARKETING SECTION

Continued from page 104

“I also have a television that draws only 40 watts when it’s on, where the norm for that size three years ago would have been 440 watts.” But the biggest energy culprit in the media room is the DVR/cable box, because it has to be on 24/7 to record shows. “It’s a mini-computer with a hard drive and operating system drawing 400 watts, versus the very basic digital transport adapter box that draws 16 watts. It adds up, especially when you have multiple systems,” Jaques explains. The green choice here is to forgo the DVR, or turn it off when you’re away. Programming a vacation mode makes automating your home’s electronics easy. “You hit one button when you leave and the whole house goes into a hibernation mode, so the only things running are the essentials like the fridge,” Jaques says. Smart home automation systems that can adjust lights, temperature, drapes and audio/video components are particularly effective for vacation homes that are closed up for a long period of time. “It’s the same idea of turning off the non-essentials, but the system learns the activity of your household while you’re there, then replays your lighting sequences as if you were living there but trimmed to 50 percent. It beats the single lamp on a timer hands down for security purposes,” Jaques says.

Room nLiving There’s no reason not to have a totally green living room from floor to ceiling. Start with an EcoSmart ventless fireplace for ambience. It burns bioethanol, a renewable carbon-neutral fuel, and comes in many striking designs, from standalone pieces to fireplace inserts. When it burns, it gives off carbon dioxide and water vapor, just like when a person exhales, explains David Sanborn, owner of EcoModern Design in Boston. If you like the look of wood for your walls, there are more than 200 varieties of FSC-certified or reconsti-


 P P P' > OH A H F > < H F I: G R' < H F

Enter the New Era In Smart Living



Tomorrow’s Innovation for Today P^e\hf^mh^ohAhf^%ma^lfZkmZiikhZ\amh[^Znmb_neer]^lb`g^]%jnZebmr \hglmkn\m^]%ab`ai^k_hkfbg`E>>=Ahf^l'?bgZeer%Zg^p`^g^kZmbhgh_ Z__hk]Z[e^%^g^k`r^_Û\b^gmahf^lpab\aZk^l^glbmbo^mhma^^gobkhgf^gm' ;nbem[reh\Ze\kZ_mlfZg_^Zmnkbg`ebfbm^]^]bmbhg]^lb`gl[rik^fb^k Zk\abm^\ml%hnklbfiebÛ^]ikh\^llh__^kl_Zlm]^ebo^krZmZ_Zbkikb\^' :[^mm^kpZrmh[nbe]maZmbllnlmZbgZ[e^Zg]^q\^imbhgZe' Lbfierinmma^ahf^^oheo^]'

>qi^kb^g\^ma^^ohenmbhgbgBgghoZmbo^Ahf^=^lb`gZm3 PPP'>OHAHF><HFI:GR'<HF ^ohAhf^Hg^<Zm^Lmk^^mIhkmlfhnma%G^pAZfilabk^111&,21&-,.,

@KHA>Zg]Ma^NembfZm^;ZmaLahpkhhflZk^Ikhn]mh[^ ^ohAhf^llhe^lniieb^kh_ienf[bg`lniieb^lZg]Ûqmnk^l

`kha^Zf^kb\Z'\hf

ma^nembfZm^[Zmalahpkhhf'\hf


Conveniently Simple. Perfectly Elegant.

Central Music

Central Casting

150 Bear Hill Rd. 384 Route 101 Waltham, MA 02451 Bedford, NH 03110 781.890.1177 603.490.1177

www.maverickintegration.com

Central Video

weâ&#x20AC;&#x2122;re here Design

Music

Theatre

Lighting

Control

Telecom

Electrical


Locations across New England 1-800-370-WOOD (9663) BenjaminMooreExperts.com


(4'')4''0#0&$'#76+(7. 0-$#%106'569+00'4 +0%*#6*#/

#(#/+.;(4+'0&.;-+6%*'0

7UXH 6WRULHV

/''61746#.'06'&&'5+)06'#/QPNKPGCVMKVEJGPXKGYUEQO


DZRUGIURP%UDQG\6RX]D #UUKUVCPV)GPGTCN/CPCIGTQH-KVEJGP8KGYUQPYQTMKPIVJTQWIJVJGNGCPVKOGU

O

ur parent company, National Lumber, was founded in a challenging economic environment in 1934, and has grown strong through three generations of family ownership and management by working hard every day. By being smart, flexible and innovative, we help our customers thrive in both the lean times and the busy times. That work ethic continues today at all the Kitchen Views showrooms, and we take it with us wherever we travel to serve our customers. Whether our customer is a homeowner looking to design their dream kitchen, a remodeling contractor looking for a project partner to work with their clients, or a builder working on multi-unit residences or custom homes, Kitchen Views has the experienced design team and quality products to exceed expectations.

$TCPF[5QW\C &GUKIPGTCPF #UUKUVCPV)GPGTCN/CPCIGT

â&#x20AC;&#x153;Cookie cutters are for baking projects,

Tell us your dream and weâ&#x20AC;&#x2122;ll show you how we can make that dream come true within your budget. Cookie cutters are for baking projects, not kitchen design. We design your kitchen to fit your individual needs and preferences, for a kitchen that is as unique as you and your family. Our wide selection of products and creative, innovative designers make it all possible.

%UDQG\ Brandy Souza,

not kitchen design.â&#x20AC;?

Assistant General Manager

ABOUT KITCHEN VIEWS & SHOWROOM LOCATIONS -KVEJGP8KGYUUGTXGUFKUEGTPKPIJQOGQYPGTUCPFUGCUQPGFDWKNFKPIRTQHGUUKQPCNUYKVJPKPGUJQYTQQOUĹ?UGXGP KP/CUUCEJWUGVVUQPGKP0GY*CORUJKTGCPFQPGKP4JQFG+UNCPF1WTFGUKIPVGCOEQPUKUVUQHVCNGPVGFFGUKIPGTU YKVJCTCPIGQHFGUKIPUV[NGUCPFGZRGTKGPEG;QWECPNGCTPOQTGCDQWVVJGOVJTQWIJVJGKTQPNKPGRQTVHQNKQU

-+6%*'08+'95%7561/-+6%*'08+'95#60#6+10#..7/$'4 0GGFJCO5V 0GYVQP/# 8+'9=?

%GPVTCN5V $GTNKP/# 

4GCEJCNNUJQYTQQOU CV&'5+)05 QT

2GCTUQP$NXF )CTFPGT/# 

/CRNG5V /CPUĹżGNF/#   9GND[4F 0GY$GFHQTF/# 

0GGFJCO5V 0GYVQP/#   /CUQP5V 5CNGO/# 

*KIJ5V $QUECYGP0*  2QUV4F 9CTYKEM4+ 

.QQMHQTVJKUKEQPVJTQWIJQWVVJGOCIC\KPG+VKUCPKPFKECVQTVJCVVJGUVQT[[QWCTG TGCFKPIJCUCFFKVKQPCNEQPVGPVQPNKPG)QVQMKVEJGPXKGYUEQOUVQTKGUHQTRTQĹżNGU CFFKVKQPCNRJQVQITCRJUXKFGQUCPFCTVKENGUKP-KVEJGP8KGYUOCIC\KPGRCUVKUUWGU

CXCKNCDNGKP2&(HQTOCV QHVJGRGQRNGCPFMKVEJGPUHGCVWTGFKPVJKUDTQEJWTG

%18'4(4'')4''00GGFJCO*QOG&GUKIPGT,GUUKEC9KNNKCOUQP#-$& -KVEJGP8KGYUCPF-KVEJGP8KGYU%WUVQOCTGFKXKUKQPUQH0CVKQPCN.WODGT8KUKVMKVEJGPXKGYUEQOHQTFGVCKNU(QTEQOOGPVUQTKPHQTOCVKQPYTKVGVQ -KVEJGP8KGYU0GGFJCO5V0GYVQP/#GOCKNKPHQ"MKVEJGPXKGYUEQOQTECNNZ


522072

*52:

 WLSV IRUD

IDPLO\IULHQGO\NLWFKHQ 

2TQXKFGXCTKQWUJGKIJVUQHUGCVKPIVQGCUKN[ CEEQOOQFCVGGXGT[CIGITQWR



%QWPVGTVQREQTPGTUUJQWNFDGTQWPFGFVQ RTGXGPVKPLWTKGUFWTKPIEQNNKUKQPU



$WKNVKPUVGRUVQQNUECPDGEQPEGCNGFWPFGT ECDKPGVUVQGZVGPFGXGT[QPGĹ?UTGCEJ



6JGNCVGUVUCHGV[NCVEJGUWUGOCIPGVUYKVJ URGEKCNMG[UCPFJKFFGPNQEMU  +PFWEVKQPEQQMVQRUQPN[JGCVOCIPGVKERQVU CPFRCPUDWVFQPĹ?VRTQFWEGCFFKVKQPCNJGCV



â&#x20AC;&#x153;When planning, keep in mind that kids are going to get bigger really fast, but these design features will always be useful.â&#x20AC;?

T

he Oâ&#x20AC;&#x2122;Driscoll family was kind enough to share their story, so that others can see how their new, larger, family-friendly kitchen has increased their joy in having everyday moments with each other and provide them with plenty of space for gathering dozens of relatives many times throughout the year. With planning by a Kitchen Views designer, the saws came out, some walls came down, and two smaller rooms in their Sharon, Massachusetts home became the kitchen of Lori Oâ&#x20AC;&#x2122;Driscollâ&#x20AC;&#x2122;s dreams. When planning, keep in mind that kids are going to get bigger really fast, but these design features will always be useful. One key reason for building this large, open kitchen and dining space was that the whole family could be at home in it, Lori said. â&#x20AC;&#x153;I wanted a place where we could all be together.â&#x20AC;? â&#x20AC;&#x153;Iâ&#x20AC;&#x2122;m one of seven. My husbandâ&#x20AC;&#x2122;s one of four. We have big parties,â&#x20AC;? Lori said, exuding a mix of deep satisfaction and barely restrained enthusiasm. You can see a video interview in the True Stories section on the Kitchen Views website and hear Loriâ&#x20AC;&#x2122;s story first-hand. *5 %#$+0'64;5EJTQEM %1706'46125-Q\OWUITCPKVGHQTVJGRGTKOGVGTCPFC EWUVQOOCFGEJGTT[EQWPVGTVQRHQTVJGKUNCPF


Gentle Breezes in Chatham, Massachusetts

G

reen materials beautifully designed by Jessica Williamson, AKBD, of Kitchen Views Custom made this Chatham vacation home an awardwinner in the 2010 NKBA competition. The homeowners share that â&#x20AC;&#x153;itâ&#x20AC;&#x2122;s incredibly efficient, and it feels peaceful and joyful at the same time.â&#x20AC;? The homeowner wanted an efficient, beautiful understated kitchen, but â&#x20AC;&#x153;didnâ&#x20AC;&#x2122;t want people to come in and say, â&#x20AC;&#x2DC;Thatâ&#x20AC;&#x2122;s the designer kitchen.â&#x20AC;&#x2122; â&#x20AC;? The family also wanted â&#x20AC;&#x153;to stay as green as we could. Itâ&#x20AC;&#x2122;s how weâ&#x20AC;&#x2122;ve always tried to live.â&#x20AC;? Since Williamson is an expert in blending environmental and aesthetic considerations, the finished kitchen is everything they hoped for it to be. Crystal Greencore cabinetry is free of added formaldehyde and the style is reminiscent of an old country kitchen. Vermont slate was used for the perimeter countertops and reclaimed beech wood was used for the island top. *5 %#$+0'64;)TGGPEQTGD[%T[UVCN %1706'461258GTOQPV5NCVGCPF4GENCKOGF$GGEJ9QQF

â&#x20AC;&#x153;Itâ&#x20AC;&#x2122;s incredibly efficient, and it feels peaceful & joyful at the same time.â&#x20AC;?

,GUUKEC9KNNKCOUQP#-$& -KVEJGP8KGYU%WUVQOKP0GYVQP

0CVKQPCN-KVEJGP$CVJ#UUQEKCVKQP


&Z'ZE E

,OK_^SP_V

G

reen building is not only in the news, it’s now in the kitchen. Our green products expert, Jessica Williamson, AKBD, has received rave reviews from Robert Glazer for her kitchen and bath design work in his new green home in Needham. His interest in green building led to the development of Free Green, a website and blog disseminating information and actual building plans for green homes. On the Free Green website in the Needham Home Blog, Robert explains, “Our ‘green’ kitchen was designed by Jessica Williamson at Kitchen Views Custom in Newton, MA, who has been amazing. Jessica was able to incorporate all of our requests, including a stone arch, which proved complicated, and other preferences including places to keep our toaster, microwave and coffee pot out of sight.

“...we were impressed with their designers’ attention to detail and knowledge of green cabinet products” We chose Kitchen Views because we were impressed with their designers’ attention to detail and knowledge of green cabinet products. Kitchen Views’ approach to design is different from that of other vendors. Their designers are really kitchen designers rather than kitchen cabinet designers; they design your kitchen with the

whole house in mind, focusing on all of the details beyond just the cabinets, including lighting, appliances, fi xtures, colors, impact on nearby spaces, etc. It’s hard to explain this difference unless you have seen it firsthand.” Jessica explains that, “other kitchen designers they consulted had told Robert that the stone arch over the stove could not be done, but I found the way to make it happen. This stone work is intregal to their home design as it mirrors the fireplace in the adjoining room.” She recommended GreenQuest by Crystal cabinets because they are built with FSC certified wood species, no added urea formaldehyde boxes, and low-emitting water-based finishes. Caesarstone Quartz was chosen for the main kitchen island and countertops. They had seen this product on display during their first visit to the Kitchen Views Custom showroom in Newton and really loved it. As Robert shares on his blog, “Caesarstone is an engineered material that provides a more uniform look than granite. It does not need to be sealed and is scratch and heatresistant. The other nice benefit is that it has no toxic or emitting materials and is non-porous which helps prevent surface mold and microbes. We really liked the honed look and natural color versus polished granite. It works better for the day to day realities for a kitchen with three kids.” For more blog entries like the one shared above, visit the Needham Home Blog at freegreen.com. *5

%#$+0'64;)TGGP3WGUVD[%T[UVCN %1706'46125%CGUCTUVQPG3WCTV\


5HDO6ROXWLRQV T 4'5174%'5;17%#064756

rusted resources are an important part of what Kitchen Views provides to homeowners and contractors. The amount of information available online today can be overwhelming. When you want someone you can trust to guide you through the noise to the important facts and informed design choices, Kitchen Views is that trusted source. On our website in the main navigation area you will find a link called â&#x20AC;&#x153;Getting Startedâ&#x20AC;?. In that section you will find PDF files of our 10 Tips for a Smoother Design Journey and a Measuring Guide. Then you can peruse our past issues of Kitchen Views magazine for inspiration and further information on product selections. In any of our showrooms you can pick up a printed copy of the Kitchen Views Design Guide (shown at right). From planning suggestions including thinking about what you need versus what you want in your new kitchen, to considerations for selecting materials, this guide will help you to begin the design journey. *5

T

o give you an idea of what youâ&#x20AC;&#x2122;ll find at our diverse showrooms across New England we hope you will visit us online and read some of the insights from our knowledgable and talented designers. Kitchen Views provides real solutions for every cabinetry design challenge. Whether you are a homeowner or contractor, remodeling a kitchen or planning for a new home, Kitchen Views has valuable information freely available to you on the Kitchen Views blog. On our blog, Kitchen Views designers share their insights along with design knowledge, topical photos, real life experiences and new product information for your consideration. The following is just a sampling of some of the helpful information you will find. The Kitchen Views blog can be found via a link on our home page and directly online at kitchenviews.wordpress.com. *5

9QQFITCKPUECPDGUWDVNGQTQDXKQWU7PFGTUVCPFKPIVJG FKHHGTGPEGUDGVYGGPYQQFURGEKGUYKNNJGNR[QWVQUGNGEVVJG QPGVJCVYKNNUWKV[QWTUV[NG#PQVJGTKORQTVCPVEQPUKFGTCVKQP KUVJGFKHHGTGPEGUQHFQQTQXGTNC[QTKPUGV1HEQWTUGVJGTGKU VJGYKFGUGNGEVKQPQHFQQTUV[NGUHTQOYJKEJVQEJQQUGCPF ĹżPCNN[VJGEJQKEGQHĹżPKUJGU

.GCTPJQYECDKPGVT[KUEQPUVTWEVGFRNWUKPUVCNNCVKQP QRVKQPFGVCKNU(KPFQWVCDQWVEQPUVTWEVKQPQHVJGECDKPGV DQZGUYKVJDTKGHFGUETKRVKQPUQHVJGUVTGPIVJUQHXCTKQWU OCVGTKCNUVJCVECPDGWUGF

8KUWCNK\G[QWTMKVEJGPRNCPU;QWĹ?XGDGGPNQQMKPICV RKEVWTGUKPOCIC\KPGUCPFQPNKPGFTGCOKPICDQWV[QWTPGY MKVEJGP1PEG[QWEQOGKPVQC-KVEJGP8KGYUUJQYTQQOQWT FGUKIPGTUECPJGNR[QWXKUWCNK\GJQY[QWTEJQKEGUYKNNNQQM KP[QWTCEVWCNURCEGYKVJEQORWVGTTGPFGTKPIU

2CVKGPEGKUTGSWKTGFFWTKPIEQPUVTWEVKQP$WVYJGP[QW WPFGTUVCPFVJGRTQEGUU[QWĹ?NNUGGKVĹ?UVKOGYGNNURGPV&QKPI COCLQTTGPQXCVKQPRTQLGEVKUCLQWTPG[#NNITGCVLQWTPG[U TGSWKTGRNCPPKPIRTGRCTCVKQPCPFCIQQFOCR;QWT-KVEJGP 8KGYUFGUKIPGTYKNNDGVJGTGVQJGNR[QWFTCY[QWVJGOCR CPFCPUYGT[QWTSWGUVKQPUCNQPIVJGYC[


5HDO6ROXWLRQV L (14%1064#%6145#0&*1/'190'45

#TEJKVGEV/CTM.CYVQPCPFFGUKIPGT-[TC.CYVQP QH.CYVQP&GUKIP5VWFKQ

ong before the first power saw is plugged in to begin most major kitchen renovations, a critical team has to come together â&#x20AC;&#x201D; the designer, who will plan how the new kitchen will look and work, and the architect, whose job at minimum is to handle underlying structural issues. When a great team is formed, there are real solutions for the contractors who will produce the project and for the homeowners who will live in the finished rooms for years to come. Such is the case with Brandy Souza, expert kitchen designer and assistant general manager of Kitchen Views showrooms across New England, when she works with Kyra and Mark Lawton, a husband-and-wife architecture/design team in South Dartmouth (LawtonDesignStudio.com). For many years, Brandy and Kyra Lawton in particular have combined forces on a variety of projects both in and out of the kitchen. Where oneâ&#x20AC;&#x2122;s work ends and the otherâ&#x20AC;&#x2122;s begins can be tough to sort out, but the results are stunning and a pleasure for the homeowners. â&#x20AC;&#x153;We always come up with a fresh idea for each new project,â&#x20AC;? says Brandy. â&#x20AC;&#x153;We want to take a design as far as we possibly can and we donâ&#x20AC;&#x2122;t want it to look like anyone elseâ&#x20AC;&#x2122;s.â&#x20AC;? The effectiveness of their design partnership is the result of balancing Kyraâ&#x20AC;&#x2122;s very contemporary style with Brandyâ&#x20AC;&#x2122;s more traditional style, and appreciating the otherâ&#x20AC;&#x2122;s views. They share knowledge gained from various design experiences, and find the perfect solution for each individual homeowner. The trio have collaborated on several homes designed by Mark Lawton. In addition to kitchens, they have designed master suites, a wet bar/lounge, game and media rooms. â&#x20AC;&#x153;We would be friends even if we didnâ&#x20AC;&#x2122;t work together. I trust her,â&#x20AC;? Kyra said. â&#x20AC;&#x153;She goes the extra mile the way I go the extra mile.â&#x20AC;? And so they do, from one project to another, from the Boston suburbs to the shores of Rhode Island. *5

;QWECPTGCFVJGNQPIGTCTVKENGQHVJKUVTKQĹ?UEQNNCDQTCVKQPU %QNNCDQTCVKXG%TGCVKQPUKPVJG(CNNKUUWGQH-KVEJGP 8KGYU/CIC\KPGCXCKNCDNGKP2&(HQTOCVQPQWTYGDUKVG

$TCPF[5QW\C &GUKIPGTCPF #UUKUVCPV)GPGTCN/CPCIGT


5HDO6ROXWLRQV

 6'56+/10+#.5(41/#%1064#%614#0&#*1/'190'4

â&#x20AC;&#x153;I renovate homes, brownstones, and other property throughout Greater Boston and my customers need help making a lot of decisions. Especially in the kitchen â&#x20AC;&#x201D; cabinets, colors, everything! Itâ&#x20AC;&#x2122;s a relief to have the expert designers at Kitchen Views guide my clients through it all, saving me a ton of work and time. With their industry experience, creativity and product knowledge, there are no delays, no hassles. They know how to work with contractors and talk to homeowners, so I can concentrate on my core business.â&#x20AC;? ,QG9JKVG&GXGNQRGT4GOQFGNGT/GVTQ4GCNV[$QUVQP/#

â&#x20AC;&#x153;The Kitchen Views website features portfolios full of real homes and their magazine articles help jumpstart ideas. I went to Kitchen Views for new cabinetry and got so much more: a personable, helpful designer who made the whole process a dream come true. She came to see the space firsthand, offering ideas I wouldnâ&#x20AC;&#x2122;t have thought of. The dogâ&#x20AC;&#x2122;s dish is now hidden in the cabinet toekick and you canâ&#x20AC;&#x2122;t even tell where my refrigerator is. We didnâ&#x20AC;&#x2122;t expand, but somehow everything is exactly where I need it to be, in a fabulous and functional design that I love!â&#x20AC;? *QOGQYPGT-CVJGTKPG-QVKMCPFUQP0GYVQP/#

HMENJHSBGDMUHDVR BNL  #$2(&-2Ă&#x201E;  JHSBGDMUHDVR VNQCOQDRR BNL JHSBGDMUHDVR BNL


GREEN LIVING [GREENGOODS] Pellettieri Associates, Inc. Protecting water quality is essential to sustaining the health of our environment. From shoreline restoration to capturing parking lot runoff, Pellettieri Associates has been a leader in implementing sustainable technologies that capture, filter and infiltrate runoff. With extensive knowledge of best management practices (BMPs), LEED-certified design, rain gardens and pervious paving technologies, Pellettieri Associates takes great pride in providing innovative design solutions that exceed industry standards. www.pellettieriassoc.com

RiverBend & Company RiverBend & Company focuses on all types of high-quality appliances including Miele dishwashers, which are exceptionally quiet, durable and environmentally friendly— using as little as 1.2 gallons of water per cycle. “Miele products are high quality and very green,” says Donna Spanos, coowner. “We feel good about selling these appliances because they are good for the environment. Their energy savings, longer life span and higher level of performance ultimately result in fewer replacement costs for both the appliance itself and the items you put in it.” RiverBend offers qualitative consultations to define the right products for the lifestyle needs of its clients. www.riverbendandcompany.com

Stone Technologies, Inc. In an expanding world of eco-friendly surfaces, Stone Technologies offers many beautiful options. Curava, made of clay pottery fragments and 100 percent recycled glass in a cement base, features unique designs in an array of vivid colors and patterns. Or, consider Okite, a compound of natural aggregates with the unique physical and mechanical characteristics of natural quartz, certified by Greenguard for a healthy living environment. See all your choices in the company’s Woburn, Massachusetts, warehouse, which displays full slabs of stone. It’s an excellent opportunity to view the stone’s unique texture, movement and color patterns before your countertops are custom fabricated and expertly installed.

www.stonetechonline.com

114

SPECIAL MARKETING SECTION

tuted wood veneers that glue on like wallpaper. You can also use the material to wrap columns and posts. If you’d rather have your wood on the floor, Sanborn likes EcoTimber’s new strand-woven poplar called Last Dance. “It’s a prefinished solid hardwood flooring that’s urea and formaldehyde-free so it meets indoor air quality standards. They shred the material and compress it under extreme heat and pressure. And you can stain poplar—this one has gray, purple, green and red tones, and it’s really pretty.” There are completely organic furniture choices, too. Start with an FSCcertified wood frame, formaldehydefree adhesives, reclaimed metal for the components inside, natural latex rubber cushions and organic fabrics. Every element of a sofa—from the smallest screw to the pillows—can be environmentally friendly. For lighting fixtures, EcoModern Design carries Eleek, Inc., fixtures made from 100 percent recycled materials such as recycled cast aluminum or bronze, available in all shapes and styles. For lower energy use, consider CFL or LED bulbs. (See our Plugged In department on page 42 for more on LED lighting.)

nBedroom By reducing off-gassing and allergens in the bedroom, going green can enhance a good night’s sleep. Natural latex mattresses made from rubber tree sap have a resilient, cushiony feel that alleviates pressure points. “They are hypoallergenic, dust mite-resistant and chemical-free. They pass the fire retardant test because the ticking is made with wool, and wool doesn’t burn,” explains John Muccino, owner of The Organic Mattress in Sudbury, Massachusetts. Plus, they meet Greenguard’s strict indoor air quality requirements. You don’t have to give up comfort for a green pillow, either; several options are available depending on


VERMONT

B

oston Green Realty, LLC

Massachusetts 1st Certified EcoBrokers® 229 Berkeley St., Boston www.bostongreenrealty.com

ANTIQUE WORLD’S FINEST S E R P E N T I N E

N

ewly Constructed High Performance Green Home Located in Newton Centre

vtverde.com (802) 767-4421

Located at 227 Homer Street in Newton Center, this 7 BR/7BA home contains the latest in green technology and luxury living combined. This custom built 10,000SF home includes GEOTHERMAL HEAT & COOLING SYSTEMS, which has reduced its carbon footprint by 90%. GREEN FEATURES INCLUDE: Spray foam insulation, On-demand Tankless hot water systems, Solar tube for natural daylight, Premium LED & CFL lighting, Motion activated room lighting, High-End Cork flooring, Bamboo Floors, Drought resistant landscaping and Reclaimed locally sourced stone. LUXURY FEATURES INCLUDE: Kosher Gourmet Kitchen, Elevator, Fitness Room, Library, Theatre Room, Carriage House, and Outdoor Fountain. All this is in walking distance of Newton Center, a large upscale shopping destination for the western suburbs of Boston.

Offered at $3,800,000 www.227homer.com | Leland DiMeco 617-966-2475


GREEN LIVING [GREENGOODS] Vermont Verde Antique Vermont Verde Antique is the world’s finest serpentine and has been quarried in Vermont for more than 100 years. Serpentine is an extremely durable stone with the look of marble, yet it is harder and less porous than many types of granite. It will not fade, stain or etch like other green marbles and can be used for any project inside or outside the home. Locally quarried in an environmentally sensitive manner, Vermont Verde Antique can assist in gaining LEED points. A long building life cycle and the ability to be recycled into other products are major considerations for LEED and other green certifications. www.vtverde.com

Xtreme Audio & Video Homeowners who desire to use less energy have long been stumped by a lack of real-time data. How can you reduce your energy use without knowing where it’s currently being used? With the introduction of Viridian software, homeowners finally have a complete energy management system that includes all their home technology. Xtreme AV can now integrate your home control for real-time energy usage with the ability to schedule events for lights, shades and HVAC, as well as major appliances like the dishwasher, washer/ dryer, refrigerator and irrigation system. Let the Xtreme AV team show you how to save some green while protecting the environment and living a much more energy-efficient lifestyle. www.xtreme-av.com

ANDERSON INSULATION Boston, (800) 472-1717 www.andersoninsul.com ARCO, LLC Chestnut Hill, Massachusetts (617) 304-6567 www.arcollc.com BOSTON ARCHITECTURAL COLLEGE Boston, (617) 585-0101 www.the-bac.edu/green BOSTON GREEN REALTY, LLC Boston, (617) 262-3075 www.bostongreenrealty.com

FIRST RUGS Acton, Massachusetts, (978) 263-0100 Danvers, Massachusetts, (978) 739-9033 www.firstrugs.com

MAVERICK INTEGRATION Bedford, New Hampshire, (603) 490-1177 Waltham, Massachusetts, (781) 890-177 www.maverickintegration.com

THE GRANITE GROUP/THE ULTIMATE BATH SHOWROOMS Thirteen showrooms across New England (800) 258-3690 www.theultimatebathshowroom.com

PELLETTIERI ASSOCIATES, INC. Warner, New Hampshire, (603) 456-3678 www.pellettieriassoc.com

HOUSEWRIGHT CONSTRUCTION, INC. Newbury, Vermont, (802) 866-5520 www.housewright.net

CONECO GEOTHERMAL Bridgewater, Massachusetts, (508) 443-5011 www.coneco.com

KITCHEN VIEWS CUSTOM AND KITCHEN VIEWS AT NATIONAL LUMBER Nine showrooms across New England (508) 337-4467 www.kitchenviews.com

CROWN POINT CABINETRY Claremont, New Hampshire, (800) 999-4994 www.crown-point.com

LABARGE HOMES West Harwich, Massachusetts (508) 432-6360 www.labargehomes.com

116

SPECIAL MARKETING SECTION

your firmness preference. “Natural latex pillows are kind of bouncy. There are organic cotton fiber pillows that compress about 50 percent, and organic wool that compresses about 30 percent,” Muccino says. Again, no harmful chemicals means you won’t breathe in VOCs from your pillow all night. For a totally healthy bed, don’t forget the sheets, comforters and blankets. Muccino says the key is to look for natural fibers: certified organic cotton, certified organic wool or Eco-Wool, which is processed with no carbonization and no bleaching. The Organic Mattress carries a complete line of eco-bedding, even for the baby’s crib. There are so many green alternatives it’s impossible to cover them all here. Ask your designer or contractor to work with you to build in as many green options as you desire. But no matter which room you’re redoing, beware of greenwashing. “I encourage people to speak to someone in the business. There are a lot of myths and misinformation out there, and it’s our job to ferret out what’s true and what’s not,” says Williamson from Kitchen Views. •

RIVERBEND & COMPANY Groton, Massachusetts, (978) 448-8555 www.riverbendandcompany.com blog.riverbendandcompany.com STONE TECHNOLOGIES, INC. Woburn, Massachusetts, (781) 358-6500 www.stonetechonline.com VERMONT VERDE ANTIQUE Pittsford, Vermont, (802) 767-4421 www.vtverde.com XTREME AUDIO & VIDEO Pelham, New Hampshire, (888) 987-6281 www.xtreme-av.com


the-bac.edu/green

ONLINE COURSES & CERTIFICATION

Sustainable Residential Design Certificate Interact with expert faculty in small, graduate-level classes COURSES INCLUDE The Zero Energy Home: What, How and If Green Residential Remodeling and Renovation Solar Energy: Design with the Sun Residential Energy Modeling EDUCATION PROVIDER

Our Partner

The Sustainable Design Institute at the Boston Architectural College 320 Newbury Street Boston MA 02115 USA

ce@the-bac.edu +1 (617)585-0101

Building sustainable practice

arco

llc

design + build 51 Mount Alvernia Road Chestnut Hill, MA 02467 T: 617 304 6567 W: www.arcollc.com Facebook: arcollc

general contracting I design I management I renovations I additions I maintenance


Trade Secrets Who’s doing what, when, where and how in the New England design business

MICHAEL FEIN

BY LOUIS POSTEL

Safe and Sound PICTURE IT: THREE BOYS PLAYING TAG IN A WIDE ALLEY.

They dart between garbage cans and cardboard boxes, hiding in long, late-afternoon shadows. “Home!” cries a blond tyke. Breaking away from the others, he gloms on to a utility pole, embracing the boys’ base as though it were the last marble column left standing in the sack of Rome. “Home . . . safe!” If only that deep sense of safety were so easy to come by for us grown-ups. What makes us feel safe, like we’re truly home? We often hear people say, “This place is my sanctuary”—the adult equivalent of that utility pole in the alley. Hug it and it hugs you back. In short, that’s the designer’s biggest challenge: to create a home that holds the client in its wide embrace. • • • Perhaps the most marvelous thing about the restoration field is that it brings scary, broken-down homes—places you wouldn’t want to get near—back to life. Indeed, they can even hug you back. Pieter Roos, executive director of the Newport Restoration Foundation, deserves a lot of credit for resuscitating one of the largest collections of eighteenth-century buildings anywhere Pieter Roos in the United States. “Poverty preserves,” Roos writes in his just-published book, Extraordinary Vision: Doris Duke and the Newport Restoration Foundation. In 1960s Newport, only the 118 New England Home January/February 2011

curious or very well informed trod the back streets of Newport, where “rank upon rank of dilapidated wooden buildings hid under the accumulated crust of centuries of neglect, their true faces completely obscured.” Under Roos’s guidance, the foundation has completely restored eightythree buildings and turned Newport into a “world-class preservation showcase” according to the National Trust for Historic Preservation, which gave the Newport group its Trustees Emeritus Award for Excellence in a ceremony held in Austin, Texas, last October. • • • While some homes beckon to us from beneath the rubble, other homes lie deep down within us, vague ideas waiting to be coaxed out by a savvy designer. “People don’t trust themselves in general. And they particularly mistrust their artistic sides. I try to influence clients to trust themselves while letting me help them think differently,” says Keith Musinski, former director of interiors Keith Musinski for Siemasko + Verbridge who now runs his own firm, Equilibrium, in Beverly, Massachusetts. “I become their design muse, but they have the ownership. It’s always gratifying for a designer to witness a cocooning couple turn to each other and exclaim, ‘Why couldn’t we have figured this out ourselves?’ ” • • • Brent Zeigler of FourPly Studio in Boston makes a specialty of helping clients arrive at such exclamation points. Case in point: his work for a Back Bay couple who wanted a formal dining room they planned to use only a few times a year. They also had a new baby who would soon be in need of play space. Zeigler’s unusual but smart solution was to design a built-in banquette the length of one dining room wall. The Brent Zeigler child opens the upholstered seats one Sunday morning, and voila—there are her dolls, blinking and groggy from being kept up during her folks’ dinner party the night before. • • • Unique detailing certainly plays a key role in transforming a mere house into a haven. “The most efficient way to build a shelter is a box. That’s why detail is everything,” says Mike Connor of Connor Homes as he leads a visitor on a tour of his 150,000-square-foot plant in Middlebury, Vermont. An interior arch with lovely inlay patterns is almost ready for the paint room; when it eventually arrives at the job site, the massive piece will snap into the walls without a hitch. Connor points out one of the computerized saws in action. These high-tech tools appear to signal a new era, or perhaps the return of a former one. “In the ’30s and ’40s people started giving up on the idea of traditional, labor-intensive detailing. It was just too ex-


Whether it’s it’s rare, relaxed or or right away... Whether rare, relaxed right away...what whatyou youwant, want,we wemake make happen. happen.

rugs, carpeting, rugs, carpeting,windows windowsand andthe thepeople peoplewho who know know them NATICK: 549 Worcester Road (Rte 9) 508.651.3500 M/T/F/Sat 10-6, W/Th 10-9, Sun 12-5 HANOVER: 1344 Washington Street (Rte 53) 781.826.0010 M/T/W/F 10-6, Thu 10-9, Sun 12-6

www.doverrug.com 1.800.doverrug


Trade Secrets

the bath expert Billie Brenner Ltd

VITRAFORM 617.348.2858 Boston Design Center Suite 429

The new way to quality furniture

Shop on-line to see now. •s Shop see all all our our inventory inventory and and find find what what you want want now. Quality furniture furnitureyou youno nolonger longerneed? need?We Weare arethe thebest bestplace placeto tosell. sell. •s Quality s Constanly changing invetory of quality furniture at wholesale prices. • Constantly changing inventory of quality furniture at wholesale No wait. wait. See See it, buy it, enyoy it it Now. Now. •s No it, pick-it pick it up up (or (or we we deliver) and enjoy 781.826.5114

s

RTE. 53, HANOVER, MA

120 New England Home January/February 2011

pensive, everyone thought. Now it’s possible to have it again, but by computer.” As the ultimate sign of approval, the Winterthur Museum in Delaware has teamed with Connor to create a line of houses based on its archives: the WinMike Connor terthur Country Home Collection. The first models in the catalogue include the Hampton Court, the Mordington, the Gate House and the Hottenstein. • • • Trade Secrets caught up with interior designer Elizabeth Brosnan Hourihan of Carpenter & MacNeille in Essex, Massachusetts, as she waited in a client’s driveway for a van of newly acquired art. Buying original art makes some of her clients anxious, she says. “They feel it’s only for the very rich or very educated, not for them.” One of New England’s most knowledgeable designers, Hourihan recalls her own anxious experience with original art—in the form of the Greek Parthenon. There she was, as part of a program at Christie’s London, writing a paper on that timeless, bone-white cradle of Western design and architecture, the utility pole our civilization clings to even now. And what did Hourihan discover? The Parthenon was a replica. Those oh-so-clever ancients had actually copied in marble form a wooden original that had been destroyed in the Elizabeth Brosnan Hourihan Persian invasion in 480 b.c. No wonder clients are nervous about distinguishing between the real, the fake and the faux! • • • What, then, makes a home a sanctuary? A sense of classic proportions, respect for fine craftsmanship and attention to detail surely have something to do with it. But there’s a less tangible ingredient, too: something unique to the homeowner that makes things feel just right. Designers and architects specialize in defining that special something for each of their clients. With them as our guides, we can all find our way safely home. • Keep in Touch Help us keep our fingers on the pulse of New England’s design community. Send your news to lpostel@nehomemag.com.


New and Noteworthy The results are in for the first annual Bulfinch Awards, and the winners are an esteemed group. The New England chapter of the Institute of Classical Architecture & Classical America sponsored the awards—named for Bostonian Charles Bulfinch, the first native-born professional architect in America—to recognize the best work of architects to preserve and advance the classical tradition in the New England region. We’re proud to say many of these talented pros have been featured in our pages, and several have been inducted into the New England John DaSilva Design Hall of Fame. Congratulations to Ivan Bereznicki Associates of Cambridge, Massachusetts; Dell Mitchell Architects of Boston; Polhemus Savery DaSilva Architects Builders of Chatham, Massachusetts, who took home three awards; woodworker Philip C. Lowe of Beverly, Massachusetts; The S/L/A/M Collaborative of Boston; Keith LeBlanc Landscape Architecture of Boston; SLC Interiors of South Hamilton, Massachusetts; and Wilson Kelsey Design of Salem, Massachusetts. Chief Warrant Officer Ed Ivers was about to depart on his second tour of Afghanistan while his wife, Major Nikki Ivers, had just returned. The New England chill was setting in. Enter Snow and Jones Plumbing and Heating Supply of Norwell and South Yarmouth, Massachusetts. The firm teamed with Rinnai Corporation and South Shore Heating & Cooling to contribute a combination boiler for home heating and hot water to the soldiers’ Sandwich, Massachusetts, home. That’s what Trade Secrets calls a warm show of thanks. The Room to Dream Foundation’s Festive Table event at Shreve, Crump and Low last November was a pretty way to help the foundation in its mission to make the worlds of chronically ill children a little brighter. “Working for them is a fantastic experience,” says Erin Gates, a Bostonbased designer who has worked with the foundation, and who was among many designers lending their talents to this year’s event. “You get to let your imagination run wild while coming up with a room that will really ‘wow’ a little kid who is having a tough time.

Creating New England’s Finest Landscapes Landscape Construction | Masonry | Maintenance

Landscape architecture by Morgan Wheelock Inc.

21A Trotter Drive | Medway MA 02053 800.794.5480 | 508.533.8700 | f: 508.533.3718 www.rpmarzilli.com

January/February 2011 New England Home 121


Design Life Out and about in celebration of design and architecture in New England

after getting inspired by FESTIVE TABLES at Boston’s Shreve, Crump and Low, the annual fundraiser for the Room to Dream Foundation. Area designers fashioned lovely table settings to raise money for the organization, which creates healing environments for chronically ill children. There was a lot of celebrating of New England design talent these past few months, from the winning designers at the IFDA DESIGNER SHOWCASE AWARDS, announced at IFDA New England’s annual dinner at the Viking Center showroom in Westwood, Massachusetts, to the talented architects who took home the first annual BULFINCH AWARDS sponsored by the Institute of Classical Architecture & Classical America. We were delighted to help honor the winners, many of whom have had their work featured on our pages. Our imaginations ran wild as we scoped out AUTÉNTICO, the gorgeous new mosaic showroom just opened in Waltham, Massachusetts, by the folks at Marble and Granite. Our own Kyle Hoepner acted as moderaShould tor for “The Greenest Building is Alyour party be ready Built,” a GREEN SYMPOSIUM here? Send photographs hosted by the Boston Architectural or high-resolution images, with information about the College. A panel of experts in archievent and the people in the tecture, sustainability and historic photos, to New England Home, preservation led a lively discussion 530 Harrison Ave., Suite 302, Boston, MA 02118, or e-mail of the pros and cons of preserving images and information to and adapting older buildings. pbodah@nehome Speaking of older buildings, the mag.com. DANVERS HISTORICAL SOCIETY held its first fundraising design event at the historic Tapley Memorial Hall in the North Shore town. Area designers and artists came together to create vignettes in a nod to both the town’s past and present.

GREEN SYMPOSIUM From left to right: Mark Landry and Bob Lafond • Frank Shirley • Jeff Stein, Mark Price and Rebecca Williams • Gary Voorhees and New England Home’s Kyle Hoepner

122 New England Home January/February 2011

From left to right: Beverly Rivkind, Chris Kay and Shirin Tahsilli • Thom Glynn and Karen Dzendolet

FESTIVE TABLES From top to bottom: Dennis Duffy, Erin Gates, Michael Ferzoco and Stefan Nathanson • Darlene Gentle, Kathleen Sullivan Elliott, Taniya Nayak, Eric Steven Jacobs and Nancy Haas

KATIE MCKAY

WE HAD THE BEST-DRESSED HOLIDAY TABLES THIS SEASON

IFDA DESIGNER SHOWCASE AWARDS




You could be enjoying Burkeâ&#x20AC;&#x2122;s uncrowded slopes and the recreationrich natural wonderland of the Northeast Kingdom this season. Only one home left in Phase II at $695,000 ($275/SF). Now taking reservations on phase III starting at $849,000. Â&#x152; Ski to/from your door Â&#x152; Luxury 2,526 and 3,496 sq. ft. homes Â&#x152; Breathtaking views Â&#x152; Major planned improvements for Burke Mountain Â&#x152; Recipient of the 2010 Best of the Best ENERGY STAR Award by Efficiency, Vermont

6WDU3OXV(1(5*<()),&,(1&<5$7(' 5HIUHVKLQJ8QFURZGHG'LIIHUHQW

Â&#x152;EHDUSDWKWRZQKRPHVFRP




Design Life

BULFINCH AWARDS

JULIA CUMES PHOTOGRAPH (4)

From top, left to right: Francine Joseph, Peter Polhemus and John and Sharon DaSilva • John Haven, Anne Lucius, Liza Bouton, Andrew Arbaugh, Chris Shirazi and Thomas Race • Sheldon Kostelecky, Lee Reid, John Kelsey and Susan Close • Don Bartels, Paul Chebiniak and Ryota and Yoshi Uchida • Brooks Wright, Jeffrey Heyne and Michael Tyrell

AUTÉNTICO From top to bottom: Gian Luca Fiori and New England Home’s Betsy Abeles Kravitz • New England Home’s Kim Sansoucy and Betsy Abeles Kravitz with Felipe Liscoki and Gian Luca Fiori

DANVERS HISTORICAL SOCIETY From top, left to right: Sandra and Richard Biondi • Erick Masaitis, Ann Chapdelaine and Andrew Teixeira • Mary Donovan, Eric Roth and Karen Nascembeni • Rosanne Palazola • Irma Jimenez and Miguel-Angel and Lauren DeLaCruz • Ireme Kucinski and Yvonne Blacker 124 New England Home January/February 2011


603.654.2004

www.nllandscapes.com


Calendar Special events for people who are passionate about design

Now in the Galleries

JANUARY 15

The Lay of the Land: A Celebration of Art Acquired by the Friends of the Collection (1983–2010)

Little Plans, a documentary tracing Burnham’s role in urban planning and the City Beautiful movement. A panel discussion with film director Judith McBride and a panel of architects, developers and planners will follow. The film screening and panel discussion are free; a small fee will be charged for the post-event reception. Wentworth Institute of Technology, Blount Auditorium, Boston; (617) 951-1433; www.architects .org/lectureseries; 6 p.m.; free

Through May 8

Featuring approximately thirty works, this exhibition will focus on landscapes—including paintings, watercolors and prints by a diverse group of artists such as Harrison Bird Brown, Charles Codman, John Calvin Stevens, Robert Henri, Will Barnet and Waldo Peirce—acquired through the generosity of the Friends of the Collection. Portland Museum of Art, Portland, Maine; (207) 775-6148; www.portlandmuseum .org; 10 a.m.–5 p.m. Tues.–Thurs. and Sat.–Sun., 10 a.m.–9 p.m. Fri.; $10

21 Northern New England Spring Home Show

Through January 23

The Northern New England Spring Home Show is a great place to discuss your home improvement ideas with experts in home design, flooring and heating and cooling systems and to learn about new building techniques and materials. Radisson Center of New Hampshire, Manchester, N.H.; (978) 534-0587; www.homeshownet.com; 1–9 p.m. Fri., 10 a.m.–9 p.m. Sat., 10 a.m.–5 p.m. Sun.; $8

Chase Young Gallery Boston (617) 859-7222 www.chasegallery.com Bernd Haussmann January 5–30 Work by Bernd Haussmann including mixed media on canvas and paper and oil on acrylic.

Howard Yezerski Gallery Boston (617) 262-0550 www.howardyezerskigallery.com Denise Marika January 7–February 8 Showcasing work by video installation artist Denise Marika

Diane Birdsall Gallery Old Lyme, Connecticut (860) 434-3209 www.dianebirdsallgallery.com Elizabeth Enders January 8–February 19 Large paintings and watercolors including new botanicals and a small collection of landscapes and drawings

The Harrison Gallery

22

15

Boston Antiques and Design Show and Sale Through January 16

One of the larger antique shows in the area, the festival will present more than 160 dealers with antiques from the eighteenth to twentieth centuries, including Federalist and Victorian furniture, European and Asian ceramics, china, sterling silver, art, estate jewelry, collectibles and antique toys. Shriners Auditorium, Wilmington, Mass.; (781) 862-4039; 10 a.m.–5 p.m. Sat., 11 a.m.–4 p.m. Sun.

19 Make No Little Plans: Daniel

Burnham and the American City Few architects have had more impact on the American city than Daniel Burnham. View a film screening of Make No

BAEC Home and Garden Show A multitude of vendors from the home building, remodeling, interior decorating, energy savings and landscaping industries will exhibit at the Builders Association of Eastern Connecticut show. Mohegan Sun Arena, Uncasville, Conn.; (800) 294-7469; 10 a.m.–9 p.m. Sat., 10 a.m.–5 p.m. Sun.; $12

23 An Exchange with Sol LeWitt Through March 31

The story of Sol LeWitt’s exchanges with other artists is widely known, the act of exchange a seemingly integral part of his conceptual practice. In addition to encouraging the circulation of artworks through a gift economy that challenged the art world’s dominant economic model, LeWitt’s exchanges with strangers have the same qualities of generosity, and risk, that characterized his work in general. This is a call to those

Send notice of events and gallery shows to Calendar Editor, New England Home, 530 Harrison Ave., Suite 302, Boston, MA 02118, or by e-mail to calendar@nehomemag.com. Photos and slides are welcome. Please submit information at least three months in advance of your event. 126 New England Home January/February 2011

Williamstown, Massachusetts (413) 458-1700 www.theharrison gallery.com Gracia Dayton January 8–31 Lexington, Massachusettsbased Dayton depicts landscapes and scenes in various media

Through January 23

Kim Denise February 5–28 Denise is fascinated with the play of light, which is reflected in her vibrant still life paintings

Silvermine Galleries New Canaan, Connecticut (203) 966-9700 www.silvermineart.org New Members Exhibition January 9–February 18 Silvermine Guild group show


8EVE7LE[ (VMROW8EFPI

4EVG1SRGIEY 7MKREXYVI'LEMV

1SI

0EFVEHSV6IXVMIZIV46-')0)77


Calendar who share an affinity with Sol LeWittâ&#x20AC;&#x2122;s legacy as a conceptual artist, to anyone who has ever wondered, â&#x20AC;&#x153;What would Sol LeWitt like?â&#x20AC;? The show is shared with Cabinet in Brooklyn, New York. MASS MoCA, North Adams, Mass.; (413) 662-2111; www.massmoca.org; 11 a.m.â&#x20AC;&#x201C;5 p.m. (closed Tuesdays); $15

^[T]T_ Self expression, vision, and quality craftsmanship are the elements of Garry Kalajianâ&#x20AC;&#x2122;s handcrafted creations.

ZQ_SP

26 Sustainable Preservation:

Greening Existing Building Jean Carroon FAIA, LEED of Goody Clancy talks about the power of adaptive reuse to move us toward sustainability. She draws upon H.H. Richardsonâ&#x20AC;&#x2122;s Trinity Church and 1970s strip-mall supermarkets as case studies as well as her book, Preservation: Greening Existing Buildings. A book signing follows the lecture. Trinity Church, Copley Square, Boston; (617) 951-1433; www.architects .org/lectureseries; 7 p.m.; $15

Craftsmen Retail Candle Holder: Garry Kalajian

Galleries feature contemporary and ďŹ ne craft by

29 Greater Portsmouth Home Show Through January 30

like Garry.

Find the areaâ&#x20AC;&#x2122;s top home improvement companies at the Greater Portsmouth Home Show. Homeowners are encouraged to bring their plans for new home building or remodeling to the home show for one-on-one contact with the experts. Frank Jones Center and United Bingo Hall, Portsmouth, N.H.; (978) 5340587; www.homeshownet.com; 10 a.m.â&#x20AC;&#x201C; 6 p.m. Sat., 10 a.m.â&#x20AC;&#x201C;5 p.m. Sun.; $6

XLVP] Shop online or in one of our Retail Galleries.

nhcrafts.org

FEBRUARY CENTER SANDWICH CONCORD HANOVER LITTLETON MEREDITH NASHUA NORTH CONWAY WOLFEBORO

Save the Date! League of NH Craftsmenâ&#x20AC;&#x2122;s Fair August 6-14, 2011

128 New England Home January/February 2011

16 Designing Urban

Transformation What is the paradox of urbanism, and how do we address it? Aseem Inam, PhD, associate professor of urbanism at Parsons the New School for Design and fellow at the Center for Ethics and Transformative Values at MIT, proposes conceptual and pragmatic shifts in urbanism to better fulfill its potential. Boston Public Library, Rabb Lecture Hall, Boston; (617) 951-1433; www .architects.org/lectureseries; 6 p.m.; free

19 Greater Nashua Home Show

The League of NH

master craftsmen

and arenâ&#x20AC;&#x2122;t we glad! Lyman Estate Greenhouses, Waltham, Mass.; (781) 8911985; www.historicnewengland.org; 10 a.m.â&#x20AC;&#x201C;4 p.m.; free

7

Camellia Blooming Season at Lyman Estate Through March 6

Take a mini tropical vacation without leaving New England: visit the nineteenth-century camellia house, part of the Lyman Estate greenhouses, where the century-old trees will be in full blossom. Camellias propagated from the Lyman trees will also be for sale. Cultivation of camellias was a serious pastime for Boston gentry at one pointâ&#x20AC;&#x201D;

Through February 20

Industry experts gather at the Greater Nashua Home Show to present everything from kitchen and bath appliances to windows and siding. Radisson Hotel, Nashua, N.H.; (978) 534-0587; www .homeshownet.com; 10 a.m.â&#x20AC;&#x201C;6 p.m. Sat., 10 a.m.â&#x20AC;&#x201C;5 p.m. Sun.; $6

24 18th Annual Rhode Island

Spring Flower & Garden Show Through January 27

Showcasing more than thirty garden displays and 250 larger-than-life garden marketplace vendors, this event attracts upwards of 30,000 visitors every year. Guest speakers, special events and childrenâ&#x20AC;&#x2122;s activities round out the fun. Rhode Island Convention Center, Providence; (401) 272-0980; www.flowershow.com; 10 a.m.â&#x20AC;&#x201C;8 p.m. Thurs., 10 a.m.â&#x20AC;&#x201C;9 p.m. Fri.â&#x20AC;&#x201C;Sat., 10 a.m.â&#x20AC;&#x201C;6 p.m. Sun.; $18

24 New England Home Show Through January 27

More than 500 experts will be on hand for this mother lode of home improvement ideasâ&#x20AC;&#x201D;featuring everything from flooring to lighting to siding for your home. Interactive cooking demonstrations, a furniture-building zone and a specialty food area complete the fourday event. Seaport World Trade Center, Boston; (508) 823-0389; www.new englandhomeshows.com; noonâ&#x20AC;&#x201C;9 p.m. Thurs.â&#x20AC;&#x201C;Fri., 10 a.m.â&#x20AC;&#x201C;9 p.m. Sat., 10 a.m.â&#x20AC;&#x201C;6 p.m. Sun.; $12

See more @ nehomemag.com Find additional and expanded listings of events and gallery shows. Click on â&#x20AC;&#x153;The Design Lifeâ&#x20AC;? and then â&#x20AC;&#x153;Calendar of Events.â&#x20AC;?


asid ne. Visit org /fin us at dad esig ner

When your to do list exceeds your can do list. Color Specifications Lighting Expertise Fabric Selection Spousal Negotiations Delivery Coordination Style Guidance Space Planning Product Knowledge Shopping Nightmares Layout Efficiencies Budget Management Value Comparisons Complementary Patterns Code Regulations Building Permits Lifestyle Appraisal Fashion Forecasting Purchasing Experience Contractor Communication Project Records Problem Solving Installation Supervision Trend Consultation Time Savings Tested Solutions Design Direction Material Specifications

Personal, professional design help is a click away.

www.asidne.org

NEW ENGLAND The American Society of Interior Designers New England Chapter One Design Center Place I Suite 544 I Boston, MA 02210 617-261-3995 I 617-261-7591 FAX

www.asidne.org


Perspectives Fresh outlooks on design and resources

A Game Room: Tables

• Designers bring a sense of fun to the game room • Wish List: Honey Collins reveals a few of her favorite things • It’s Personal: Finds from the staff of New England Home

MARK CHRISTOFI

Late-1800s Billiard Table “I like this old pool table because it’s real, it’s honest. It comes from Blatt Billiards, which restores old tables to perfection.” THROUGH MARK CHRISTOFI INTERIORS

MELISSA GULLEY

Hudson Table from Hickory Chair “This table is so striking with its contrast-painted edge. The lines and shape are simple—modern yet traditional— making it a versatile piece for dining or gaming.” AILANTHUS, BOSTON DESIGN CENTER, (617) 4825605, WWW.AILANTHUSLTD.COM

When Mark Christofi begins a project he takes into account the house—its architecture, history and geography—as well as his client’s personality and lifestyle. “An architect can develop a style and that’s why people go to him or her,” he says. “In design, it really has to be about the house and the clients, not the designer.” MARK CHRISTOFI INTERIORS, READING, MASS., (781) 944-5667, WWW.CHRISTOFIINTERIORS.COM

130 New England Home January/February 2011

KAREN DAVIS

Karl Springer Game Table “This piece has the classic lines of a Parsons table, but it’s wrapped in embossed lizard leather and hides a backgammon board. It is both stylish and practical for an old-fashioned night of cards, puzzles or a roll of the dice.” THROUGH DAVIS RAINES DESIGN


Let us show you.

Every client has a vision of what they want. Our designs begin with that vision. They unfold from our creative ability to see opportunity, such as having a wonderful view of the ocean while enjoying a relaxing soak, and our ability to see solutions to problems, like how to add extensive living space to an historic home without changing its streetscape appearance. We listen. We see. We create.

15 0 S t a n i f o r d S t r e e t ‡ B o s t o n ‡ M a s s a c h u s e t t s 0 2114 Te l e p h o n e: 6 17. 3 6 7. 5 9 75 ‡ W e b s i t e: w w w. b a t t l e a r c h i t e c t s . c o m


Perspectives

Wallcovering

MARK CHRISTOFI

Felt Wallcovering from Stark “I used this on the walls of the same room I used the Blatt table in; it just felt right. It’s in synch with and has the same vocabulary as the table. And it was sort of tongue in cheek to use billiard cloth on a billiard-room wall.” BOSTON DESIGN CENTER, (617) 357-5525, WWW.STARKWALLCOVERING.COM

KAREN DAVIS

Weitzner Ltd.’s Newsworthy Wallcovering “This is the perfect wallpaper, literally, for a media or game room. I love the subtle texture and colors that come from using actual newsprint, providing a unique and playful backdrop for an evening’s entertainment.” THROUGH DAVIS RAINES DESIGN

MELISSA GULLEY

Karen Davis’s work has taken her across the country, as well as to Canada, Europe and Asia. Her ability to assist in the construction as well as the design process and to fabricate custom pieces brings a client’s vision and the setting into an easy balance. DAVIS RAINES DESIGN, WASHINGTON, CONN., (860) 868-0880, WWW.DAVISRAINESDESIGN.COM 132 New England Home January/February 2011

Zebras in Masai Red from Scalamandré “This hand-painted wallpaper is great for a game room, making it come alive with rich, warm color, fun spirit and great contrast. I might even pair it with a zebra hide rug underfoot. This is a game room—might as well have as much fun as possible.” BOSTON DESIGN CENTER, (617) 574-9261, WWW.SCALAMANDRE.COM


Gift Certificates For The Holidays Now Available

Now offering Wedding Gift Certificates custom designed for your wedding website. Register early! Also check out our â&#x20AC;&#x153;wedding bowlsâ&#x20AC;? for a unique wedding gift!

SINCE 1973

Stephen C. Staples' creative art furniture would be a great addition to any investment portfolio.

508.695.1155

www.CreativeArtFurniture.com

Timeless. Classic. Modern.

Kristen Rivoli interior design 781-729-0405 krivoli@rivoliinteriordesign.com www.rivoliinteriordesign.com


Perspectives

Lighting

KAREN DAVIS

Carlyn Single Pendant Lamp “I love that this fixture can be customized with different metal finishes or a Farrow & Ball paint color to fit the mood of the room. It provides a focused yet diffused light on any game or occasional table.” URBAN ELECTRIC CO. THROUGH DAVIS RAINES DESIGN

MARK CHRISTOFI

Navarre Light from Ironware International “I like the simplicity of this fixture. It comes across as strong and architectural, and in that way could be perceived as contemporary.” WEBSTER & COMPANY, BOSTON DESIGN CENTER, (617) 261-9660, WWW .WEBSTERCOMPANY.COM

MELISSA GULLEY Melissa Gulley, who has worked as a designer for more than twenty years, is this season’s interior designer on This Old House. She also writes DesignTrackMind.com, a design blog. MELISSA GULLEY INTERIOR DESIGN, NEWTON, MASS., (617) 797-4570, WWW.MELISSAGULLEY.COM

134 New England Home January/February 2011

Currey & Company’s Annandale Pendant “This fixture, with its antique-mirror interior, lets light bounce around. It gives the room the right amount of sparkle without being too decadent and provides great light for gaming.” NEENA’S LIGHTING, FIVE BOSTON-AREA LOCATIONS, (888) 995-2677, WWW.NEENASLIGHTING.COM


Comfortably sumptuous furniture, lighting, textiles and accessories for your exceptional coastal home

www.CottageandBungalow.com

Antique Pool Table Sales and Restorations 343 MEDFORD STREET, SOMERVILLE, MA 02145 800-479-1661 www.bostonbilliards.net


Perspectives • Wish List What are some things you’d love to use in a project?

LARA TOMLIN

1

Honey Collins, Essex, Massachusetts Lenora Wilcox Collins—better known as Honey—got an early start in the design field. As a child in Atlanta, Georgia, she tagged along as her mother, a noted interior designer herself, shopped the Decorative Arts Center. What better way to learn about good design and fine furnishings? Those early, happy memories were the seed that grew into Collins’s belief that “your home should be a reflection of all the things you love.” Whether she’s designing a loft in New York City or a waterfront home on the New England coast, Collins holds to the same philosophy, blending antique and contemporary pieces to create environments that are warm and inviting. “Rooms should have classic bones updated with modern colors and textures,” she says of her penchant for mixing old and new. The spaces she designs reflect the geniality of her southern roots and the practicality of New England for a result that is classic, yet full of warmth and personality. HONEY COLLINS INTERI-

2 3

4

OR DESIGN, ESSEX, MASS., (978) 758-1145, WWW.LWCINTERIORS.COM

1 Klysmos Chair by Ironies “I love the combination of this chair with the Fromental wallpaper. It would make a fabulous and chic dining room. The chair is hand-pieced polished bone, and the texture and color are amazing.” STUDIO 534, BOSTON DESIGN

5

CENTER, (617) 345-9900, WWW.S5BOSTON.COM

2 O. Henry House Sofa “This is not your average sofa. It’s classic with a twist!

STUDIO 534

3 Phillip Jeffries Lacquer Wallpaper “Lacquered walls are so rich and dramatic, but it’s hard to find someone who really knows how to do it well. Phillip Jeffries has made it easier by creating a wallpaper that gives the same effect.” WEBSTER & COMPANY, BOSTON DESIGN CENTER, (617) 261-9660, WWW.WEBSTERCOMPANY.COM

6

4 Palomino Promenade Rug from Kyle Bunting “This hide rug is so wonderful. It’s a unique piece that can be used in very traditional or modern spaces. I love the texture and warmth a hide rug can bring to a room.” WEBSTER & COMPANY 5 Christopher Spitzmiller Lamps “These handmade ceramic lamps are very classic shapes drenched in intense and modern color. You could have a very neutral palette, then wake up the room with these fabulous lamps.” ICON GROUP, BOSTON DESIGN CENTER, (617) 428-0655

6 Fromental’s Sylvaner Wallcovering “I am dying to use this hand-painted chinoiserie wallpaper. It has a classic design but a modern color palette. The pattern and color do not overwhelm you but rather invite you into the space.” STUDIO 534 136 New England Home January/February 2011


It’s Personal • Perspectives Favorite finds from the staff of New England Home

Stacy Kunstel, Homes Editor I will never look at a kitchen the same way again. Curved stainless steel, beautifully hand-carved wood and pewter-infused concrete make up the amazing new kitchen line being carried exclusively at Dalia Kitchen Design at the Boston Design Center. Designer Dalia Tamari first encountered the pieces, with their Louis XV legs and convex cabinetry, while at a design show in Italy and immediately fell for their juxtaposition of classic and contemporary. I love the line for its country-meetsindustrial feel. Its carved cement countertops are roughly fused together with molten strips of pewter; stainless-steel cabinets open to reveal custom wooden drawers, each with special plate holders and areas for pots and pans. It’s incredibly organized, chic and oh-how-unexpected! DALIA KITCHEN DESIGN, BOSTON DESIGN CENTER, (617) 482-2566, WWW.DALIAKITCHENDESIGN.COM

Erin Marvin, Managing Editor Surely my wardrobe would be all the more fabulous simply for being stored inside the edgy yet glamorous Paravent Wardrobe, a limited-edition piece from the new Jean Paul Gaultier collection for Roche Bobois. I wouldn’t usually be drawn to such a contemporary line of furniture, but I’ve had a soft spot for the French fashion designer since he dressed Madonna back in the ’90s (though my own attire remains considerably more conservative than her coneshaped corsets). The tall, mirrored, chrome-and-aluminum articulated trunks on wheels unhinge in the middle to reveal Gaultier’s signature tattoo motif. Those panels in turn open to reveal hanging space, shelving and two drawers along with three internal mirrored flaps. There’s plenty of storage space for clothing, shoes and accessories, no matter what your personal style may be. $16,434. ROCHE BOBOIS, BOSTON, (617) 742-9611, WWW.ROCHE-BOBOIS.COM

Kara Lashley, Associate Editor Of all the reasons to be a kid again, here’s a compelling one: the chance to totally rock in the iglooplay Mod Rocker. Rhode Island School of Design grad Lisa Albin paid close attention to her “design consultants”—her two young daughters—to create the iglooplay collection, which features equally stylish (and eco-conscious) tables, chairs and foam pods. Available in maple veneer, cherry stain or walnut veneer (shown here), the too-cool-for-school rocker has a wide, low-slung form that Albin adapted from African stools. But don’t be fooled by its pint-size proportions: the Mod Rocker isn’t just for the preschool set. Even grown-ups can admire its clean, sculptural lines, as welcome in the living room as the playroom. And thanks to its heavy-duty molded plywood construction, it’s sturdy enough for Mom or Dad to get in on the fun. Ask nicely, and the hip tyke in your life might let you sit a spell. 12" × 9¼" × 25". $345. RISD WORKS, PROVIDENCE, (401) 277-4949, WWW .RISDWORKS.COM

January/February 2011 New England Home 137


New in the Showrooms Unique, beautiful and now appearing in New England shops and showrooms BY ERIN MARVIN

3

2 1

6

5

4

1 Designer Mindi Poston Gay and architect Derek Rubinoff recently opened MPG Home Design in a renovated motorcycle repair shop—apt digs for showcasing artwork and vintage furniture refurbished and reupholstered in house (such as this glam Hollywood Regency settee). The duo also offers architectural and interior design services. NEWBURYPORT, MASS., (978) 462-7500, WWW.MPGHOMEDESIGN.COM

2 If it’s five o’clock somewhere, it’s cocktail time. Entertain in style with the Ekke tapas bowls from Teroforma. Available at Nahcotta, this system of stackable, handcrafted stoneware bowls is ideal for serving hors d’oeuvres. After the party, top the whole set with the lid and pop it in the fridge to store leftovers. PORTSMOUTH, N.H., (603) 433-1705, WWW.NAHCOTTA.COM

138 New England Home January/February 2011

3 Dove & Distaff Interiors Rug Gallery is now carrying these great indoor/outdoor rugs from Company C. Designed for patios, terraces, porches and decks, these stylish yet sturdy polyester rugs can hold their own against the elements. They’re inspired by the same color sense and sunny spirit as Company C’s beloved indoor rugs. WAKEFIELD, R.I., (401) 284-1170, WWW.DOVEANDDISTAFFRUGGALLERY.COM

4 We were instantly smitten with the Chablais Vase table lamp, reminiscent of 1940s–1960s Danish pottery yet undeniably chic today. New from Vaughan and available through Webster & Company, it’s shown here with a 15" Bedford Drum lampshade in Natural Linen. BOSTON, (617) 261-9660, WWW.WEBSTERCOMPANY.COM

5 The latest trend in fireplaces is not what but where: with today’s sleek new designs and slick technology, you can heat up any room in style. Napoleon Fireplace’s Torch GT8 Direct Vent model, available through Anderson Fireplace, is perfect for tight spaces thanks to its slim, single-flame design. ABINGTON, MASS., (800) 472-1717, WWW.ANDERSON FIREPLACE .COM

6 Part of BoConcept’s 2011 Collection, the new Imola chair, designed by Henrik Pedersen, boasts “lines that are playful, yet luxuriously comfortable, and embody modern-day purity of design.” Pedersen created both high-back and low-back versions, which are available in a wide variety of color and fabric options. CAMBRIDGE, MASS., (617) 588-7777, WWW.BOCONCEPT.COM


New in the Showrooms

7

8

9

12

10

11

7 Twelve Chairs is a new home furnishings shop/design studio in Boston’s Fort Point neighborhood. Owners Roisin Giese and Miggy Mason believe that “beautiful design and respect for the planet don’t have to be mutually exclusive,” as evidenced by these stylish yet sustainable wood mirrors, whose handsome frames are made from old factory parts. BOSTON, (617) 701-3496, WWW.TWELVECHAIRSBOSTON.COM

8 Originally designed by Jared Wheeler for John Lyle (formerly Lyle & Umbach), this sleek desk, available from Furn & Co., is outfitted with a frosted glass work surface—just right for a modern home office. Hidden casters allow for easy movement; slide two desks together to form a round conference table that seats twelve. BOSTON, (617) 342-1500, WWW.FURNCO.US

9 One of the newest designs from Thos. Moser, the Meridian dining table was inspired by the Shaker ideal that beautiful objects should be rooted in social conscience. The company unveiled Meridian in response to customer requests for a round, solid-top table that’s scaled for smaller spaces. Available in ash or cherry.

11 The new VanDyke buffet at Mitchell Gold + Bob Williams is a “retrospective nod to the midcentury design movement.” Its compact size makes it an attractive addition to a dining room, but it’s equally at home in an entryway. It has an L-shaped brass base and legs, plus two adjustable interior shelves. BOSTON AND NATICK,

FREEPORT, MAINE, (207) 865-4519, WWW

MASS., (617) 266-0075 AND (508) 650-1400,

.THOS MOSER.COM

WWW.MGBWHOME.COM

10 Allergic to animals? Then you need this Pett, new from Diesel’s Successful Living collection with Foscarini and available at Circa50. Exactly what kind of creature this unconventional lamp is we’re not sure, but its clean, angular lines and the relief vanes on the diffuser hint at a reptilian personality. MANCHESTER CENTER, VT., (877) 247-2250, WWW.CIRCA50.COM

12 The rumors are true: our friends at Marble and Granite have just opened the Auténtico mosaic tile showroom, featuring an amazing selection of avant-garde stone tile and dimensional mosaics that can turn any room into a work of art. The showroom itself is a real showstopper and definitely worth a visit. WALTHAM, MASS., (781) 894-1081, WWW.AUTENTICO.COM January/February 2011 New England Home 139


Resources A guide to the products and professionals in this issue’s featured homes

A HOLLYWOOD ENDING PAGES 66–73 Interior designer: Tammy Randall Wood, Interior Archaeology, West Hartford, Conn., and Beverly Hills, Calif., (860) 561-5339, www.interiorarchae ology.com Painting and wallpaper installation: Lapore Painting, Rocky Hill, Conn., (860) 989-5283 Drapery and art installation: Narus Installations, Southington, Conn., (860) 620-7309 Pages 66–67: Chests by EJ Victor through Interior Archaeology; gilt mirrors by Neirmann Weeks, Millersville, Md., (410) 923-0123, www .niermannweeks.com; swivel chairs by EJ Victor from Interior Archaeology with fabric by Quadrille, New York City, (212) 753-2995, www.quadrillefabrics.com; drapery fabric by Coraggio, Bellevue, Wash., (800) 624-2420, www.coraggio.com; sofa by Interior Archaeology; sofa table and coffee tables by Michael Taylor, San Francisco, Calif., (415) 558-9940, www.michaeltaylordesigns.com; leather chairs and Spot ottomans by Baker through Interior Archaeology; square and rectangular ottoman by Julian Chichester through Interior Archaeology with fabric by Groves Brothers, Fort Worth, Tex., (817) 921-4450, www.grovesbros .com; antler chandelier by Arte De Mexico through Interior Archaeology; chaise under staircase from Brunschwig & Fils, White Plains, N.Y., (914) 684-5800, www.brunschwig.com; Spiral Spot table by Michael Taylor; console table by Baker through Interior Archaeology. Pages 68–69: Conservatory carpet by Safavieh through Interior Archaeology; Spiral Spot tables by Michael Taylor; chandelier by Panache, Los Angeles, Calif., (323) 441-9600, www.panachedesigns.com; drapery fabric by Libas Ltd., Los Angeles, Calif., (213) 747-2406, www.libassilk .com; shade fabric from Decorator’s Walk through F. Schumacher, New York City, (800) 523-1200, www.fschumacher.com; custom design sofa and round marble top table by Krieger Ricks through Interior Archaeology. Pages 70–71: Dining table, chairs and server from the Designer’s Collection of Antiques, Old World Weavers, Stark, New York City, (212) 3557186, www.old-world-weavers.com; dining chair fabric from V&A Museum at The Martin Group, Boston Design Center, (617) 951-2526, www .martingroupinc.com; Roman shade fabric from Decorator’s Walk through F. Schumacher; carpet by Bokara through Interior Archaeology; breakfast room wallpaper by Pierre Frey through The Martin Group; ceramic urns and compote by Thomas Pheasant for Baker through Interior Archaeology; benches in entry by Interior Archaeology; frames by Krieger Ricks, cast limestone jardinières by Haddonstone and carpets by Safavieh all through Interior Archaeology. Pages 72–73: Stairway carpet by Safavieh through Interior Archaeology; center table 140 New England Home January/February 2011

from Interior Archaeology; Living room drapery fabric by Colefax & Fowler from The Martin Group; chairs, sofa, coffee and round lamp tables by Baker through Interior Archaeology; chair fabric by Nina Campbell through The Martin Group; sofa fabric by Old World Weavers; master bedroom chairs, night tables and lamps by Baker through Interior Archaeology; bed by Interior Archaeology; drapery fabric from Libas Ltd.; shade fabric from Decorator’s Walk through F. Schumacher; carpet by Safavieh through Interior Archaeology.

CITY SLICK, COUNTRY QUIET PAGES 74–81 Architects: Dell Mitchell and Jeffrey Heyne (project architect), Dell Mitchell Architects, Boston, (617) 266-0201, www.dellmitchell architects.com Interior designer: Carolina Tress Balsbaugh, Manuel de Santaren, Inc., Boston, (617) 3306998, www.manueldesantaren.com Builder: Payne/Bouchier, Boston, (617) 4454323, www.paynebouchier.com Kitchen cabinet and island design: Heather Kahler, Dalia Kitchen Design, (617) 482-2566, www.daliakitchendesign.com Draperies and pillows: Eliot Wright Workroom, Boston, (617) 542-3605 Art curator and placement adviser: Manuel de Santaren, Manuel de Santaren, Inc. Page 74: Dennis & Leen antique chandelier through Webster & Co., Boston Design Center, (617) 261-9660, www.webstercompany.com; fire screen from Matthews & Parker, Scarsdale, N.Y., (914) 723-8887, www.matthewsandparker.com; mirror and sconces from Bernd Goeckler Antiques, New York City, (212) 777-8209, www .bgoecklerantiques.com; Dutch commode by Rose Tarlow through Webster & Co.; Louis XVI Fauteuil armchairs from Helen Higgins Interiors, Boston, (617) 723-5654, upholstered in Glant linen through Webster & Co., with trim by Scalamandré, Boston Design Center, (617) 574-9261, www.scalamandre.com, upholstered by Star Upholstery, Malden, Mass., (781) 324-3201; ottoman upholstered in Safari leather by J. Robert Scott, New York City, (212) 755-4910, www.jrobertscott .com, from De Angelis Custom Furniture, New York City, (212) 348-8225; Marshall Field club chairs by De Angelis Custom Furniture in Travers cotton damask from Webster & Co. and Bullion trim from Scalamandré; Cynthia tea table from J. Robert Scott; panels by Lee Jofa, Boston Design Center, (617) 428-0370, www.leejofa .com, with rods, rings and finials by Joseph Biunno Ltd., New York City, (212) 688-6121, www .antiquefurnitureusa.com, with trim from Old World Weavers, Boston Design Center, (617) 357-5525, www.old-world-weavers.com; Conrad shades through M-Geough, Boston Design Center, (617) 451-1412, www.m-geough.com; rug from Tai Ping Carpets, New York City, (212) 9792233, www.taipingcarpets.com; throw from B.Hive, Boston Design Center, (617) 790-6350, www.bhiveshowroom.com.

Page 75: Photo by Candida Höffer through Manuel de Santaren; Chanel reproduction sofa in bouclé from Zimmer + Rohde, New York City, (212) 758-7925, www.zimmer-rohde.com, from De Angelis Custom Furniture; X coffee table by David Iatesta through Studio 534, Boston Design Center, (617) 345-9900, www.s5boston.com; throw pillows in from Clarence House, New York City, (212) 752-2890, www.clarencehouse.com, with trim from Scalamandré. Page 76: Console from Reymer-Jourdan Antiques, New York City, (212) 674-4470; Christian Liaigre Grume bench from Holly Hunt, New York City, (212) 755-6555, www.hollyhunt.com; monoprints are from The Shapes Project by Allan McCollum through Manuel de Santaren. Page 77: Chandelier and sconces from Nesle, Long Island City, N.Y., (212) 755-0515, www.nesle inc.com; walls glazed by Raphael JaimesBranger, Boston, raphael@raphaeljaimesbranger .com, www.raphaeljaimesbranger.com; Paxton House table by Rose Tarlow through Webster & Co.; dining chairs from Bernd Goekler Antiques; art above fireplace by Ellsworth Kelly through Manuel de Santaren; Blanc Faience jar collection by Dessin Fournir through The Martin Group, Boston Design Center, (617) 951-2526, www.themartingroupinc.com. Page 78: Leather inserts on ceiling from Edelman Leather, Boston Design Center, (617) 3301244, www.edelmanleather.com, by Soft Walls Associates, Boston, (617) 482-5498; carpet from AM Collections New York, New York City, (212) 625-2616; sheers from Kravet, Boston Design Center, (617) 449-5506, www.kravet.com; shades through M-Geough; Chow coffee tables from Richard Shapiro/Studiolo, New York City, (212) 486-1811, www.studiolo.com; custom sofa from Richard Shapiro; floor lamp and armchairs from Bernd Goeckler Antiques, in Townsend Indigo Blue leather through Donghia, Boston Design Center, (617) 574-9292, www.donghia.com, upholstered by Star Upholstery . Page 79: Cabinets and island by Dalia Kitchen Design; honey onyx hexagon tile from Urban Archaeology, Boston Design Center, (617) 7374646, www.urbanarchaeology.com; caramel onyx slab backsplash above stove from Interior Stone, Waltham, Mass., (781) 893-6900, www.interiorstone.net; Waldorf pendant above island from Ann-Morris Antiques, New York City, (212) 755-3309; pendant above breakfast table from Webster & Co.; Henley barstools by Rose Tarlow through Webster & Co.; dining chairs by Rose Tarlow through Webster & Co., upholstered in Red Pepper urethane leather by Mayer Contract Fabrics, Indianapolis, Ind., (317) 267-2626, www.mayerfabrics.com; New Classics Creations dining table from The Martin Group; outdoor dining table chairs by Michael Taylor Designs, New York City, (646) 497-1502, www.michaeltaylordesigns.com; cushions by Sunbrella, www.sunbrella.com; Formations hurricane lamps through Webster & Co. Pages 80–81: Master bedroom walls upholstered in Chamois velvet from Donghia and Bluebell silk velvet from Koplavitch & Zimmer by Soft Walls; headboard fabric by Brunschwig & Fils, Boston Design Center, (617) 348-2855, www.brunsch wig.com; John Himmell mirrored night tables and Chinese lamps from Webster & Co., with shades from Blanche P. Field; Cowtan & Tout


Jan Gleysteen Architects, Inc.

Custom Homes Additions Renovations

310 Washington Street Wellesley Hills, MA 02481

Boston Home

T E W

781 416 7007 sanfordcustom@aol.com sanfordcustom.com

2009 Best of Boston Builder, West

New England Architectural Finishing

A Commitment to Quality and Satisfaction Artisan-quality custom staining and finishing, precise color-matching, refinishing and restoration of period and new architectural woodwork, cabinetry and fine furniture.

114 Pond Street, Seekonk, MA 02771 508.222.0000 â&#x20AC;˘ 617.442.9400 nearchitecturalfinishing.com


Resources

Family Owned & Operated Since 1984

curtain panels from The Martin Group; chaise lounge from Ailanthus Ltd., Boston Design Center, (617) 482-5605, www.ailanthusltd.com; carpet from Tai Ping Carpets; small â&#x20AC;&#x153;Frogâ&#x20AC;? chair from Michael Taylor Designs, in Botticelli silk from Ailanthus; Louis XV chandelier from Nesle; Holland and Sherry pillow and throw from B.Hive; custom multi-stripe wool carpet from Tai Ping Carpets; Louis XVI desk by Rose Tarlow through Webster & Co.; curtains and valances in Brunschwig & Fils with Nina Campbell trim andsheers; Vaughan sconces and floor lamp from Webster & Co.; crystal chandelier from MGeough; built-in desk surround and bookshelf by Dell Mitchell Architects; bathroom wallpaper and curtain fabric from Anna French, Newark, N.J., (800) 379-6587, www.annafrench.co.uk; Herbeau mirror from Billie Brenner Ltd., Boston Design Center, (617) 348-2858, www.billiebrennerltd .com; tile from Waterworks, Boston Design Center, (617) 951-2496, www.waterworks.com.

Cabinetry for every room of your home %FTJHOt4BMFT4FSWJDFt*OTUBMMBUJPOt3FNPEFMJOHt3FGBDJOH

tDBCJOFUHBMMFSZMUEDPN $VNCFSMBOE)JMM3PBEt8PPOTPDLFU 3*

142 New England Home January/February 2011

NEW YORK STATE OF MIND PAGES 82â&#x20AC;&#x201C;87 Architect: Dann N. Batting, Dann Norris Batting Architecture, Chester, N.H., (603) 887-0086, www.dnbarch.com Interior designer: Jeanne Duval, Towne House Interiors, Jaffrey, N.H., (603) 532-4189 Cabinetry: Woody Huntington, D.S. Huntington, Hancock, N.H., (603) 525-6687 Contractor: International Contractors, Portsmouth, N.H., (603) 436-8556 Pages 82â&#x20AC;&#x201C;83: Sofas and club chairs from Duane Modern, New York City, (212) 625-8066, www.duanemodern.com; carpet from CariniLang, New York City, (646) 613-0497, www .carinilang.com; chandelier from Antiqueria, New York City, (212) 227-7500, www.antiqueria .com; painting over sofa by Alejandro Santiago from the ownersâ&#x20AC;&#x2122; collection; gold sofa pillows from Towne House Interiors; small toss pillows from Koo de Kir, Boston, (617) 723-8111, www.koo dekir.com; planter and silver vase from JANUS et Cie, Boston Design Center, (617) 737-5001, www.janusetcie.com; coffee table and chrome lamps from Lobel Modern; cube side tables by Karl Springer from Lobel Modern, New York City, (212) 242-9075, www.lobelmodern.com. Page 84: Dining table, chairs and sideboard from Moura Starr, New York City, (212) 219-1110, www.mourastarr.com; chandelier by Bocci, Vancouver, British Columbia, Canada, (604) 639-5185, www.bocci.ca; carpet from CariniLang; tabletop items from JANUS et Cie; powder room tiles from Artistic Tile, Nashua, N.H., (603) 886-1920, www.theperfecttile.com; Antilia glass sink from The Granite Group, Manchester, N.H., (603) 518-1501, www.thegranite group.com; faucet from Kohler through the Granite Group; vanity by Woody Huntington. Page 85: Rug from Carini-Lang; red bowl from JANUS et Cie; wall tile and Silestone counter-


tops from Artistic Tile; painting by Jeanne Duval; red chairs by Maxalto for B+B Italia through Montage, Boston, (617) 451-9400, www.montageweb.com. Page 86: Rug from Koo de Kir; Thassos marble floor tile and Madreperla glass mosaic wall tile from Artistic Tile; Kohler tub and faucet from The Granite Group; sitting room sofas with velvet from F. Schumacher, Boston Design Center, Boston, (617) 338-5062, www.fschumacher .com; sculpture by Gerry Friedman from the owners’ collection. Page 87: Bedding from Stella, New York City, (212) 233-9610, www.stellastore.com; bed and chair from Poltrona Frau, New York City, (212) 777-7592, www.poltronafrau.com; bronze lamp and vase from Towne House Interiors; drapes in Norbar silk by Kathleen Sterling through Towne House Interiors; rug from Carini-Lang.

Interior designers: Jim Gauthier and Susan Stacy, Gauthier-Stacy, Boston, (617) 422-0011, www.gauthierstacy.com Architect for Jim Gauthier: Doug Dolezal, Doug Dolezal Architecture, Boston, (617) 542-4422 Carpeting in Susan Stacy’s home: Stark, Boston Design Center, (617) 449-5506, www.stark carpet.com Upholstery in Susan Stacy’s home: McLaughlin Upholstering Company, Everett, Mass., (617) 389-0761, www.mclaughlinupholstering.com Draperies in Susan Stacy’s home: Finelines, Peabody, Mass. (978) 977-7357, www.finelines .com Page 88: Orange lamp from Machine Age, Boston, (617) 464-0099, www.machine-age .com; twig table from ICON Group, Boston Design Center, (617) 428-0655. Page 89: Secretary from Antiques on 5, Boston Design Center, (617) 951-0008, www.antiques on5.com; slipper chair fabric from Pindler and Pindler through Berkeley House, Boston Design Center, (617) 451-6874, www.berkeleyhouse .com; slipper chairs upholstered by McLaughlin Upholstering Company; dining table from Berkshire Home & Antiques, Great Barrington, Mass., (413) 644-9262, www.berkshireantiques .com; carpet from Christoval Carpet, San Angelo, Tex., (800) 583-3161, www.christoval carpet.com; framing by Artful Framing, Allston, Mass., (617) 782-5131. Page 91: Pendant lights above bar from Crate & Barrel, www.crateandbarrel.com. Page 94: Leather nightstand designed by Gauthier-Stacy and upholstered by McLaughlin Upholstering Company; silver lamp from Gauthier-Stacy; paper-backed linen wall covering by Ralph Lauren Home, Boston, (617) 424-1124, www.ralphlaurenhome.com. Page 95: Silver lamp from ICON Group; bed and nightstand from Room and Board, New York City, (212) 334-4343, www.roomandboard.com •

PHOTOS BY ROBYN IVY PHOTOGRAPHY

TWO OF A KIND PAGES 88–95

renovation planning interior design decoration

Patti Watson 401 . 423 . 3639 tastedesigninc.com

CALL FOR NOMINATIONS Seeking the hottest up-and-coming design talent in

*ARCHITECTURE *ACCESSORIES *FURNITURE *INTERIORS Enter now at www.nehomemag.com/5UNDER40 Presenting Sponsor

January/February 2011 New England Home 143


raveis.com

“The Best Website in Real Estate” 2 00,000+ L i s ti ngs • Sol d Propert i es • A l l Local Housing Da ta & Gr aphs • All MLS Ope n House s

10 million world-wide visits annually Visit raveis.com & type in MLS# for multiple photos/detailed descriptions on these homes

West Hyannisport, MA $6,500,000 MLS#21002887, Jonathan Matel, 508.221.1770

Ridgefield, CT $5,295,000 MLS#98474758, David Everson, 203.246.7150

New Canaan, CT $4,500,000 MLS#98455662, Denise Gannalo, 203.981.7927

Westport, CT $3,995,000 MLS#98465336, Jillian Klaff, 203.858.2095

Harwich Port, MA $2,875,000 MLS#21009798, Amy Brady, 508.221.5071

Stamford, CT $2,799,000 MLS#98460137, Marianne Broekmeijer, 203.913.6068

Groton Long Point, CT $2,640,000 MLS#E243060, Kathryn Roy, 860.235.3490

Rowayton, CT $2,498,500 MLS#98478357, Fran Burger, 203.209.6152

Rowayton, CT $2,300,000 MLS#98459592, Kristi Law, 917.576.6638

Westport, CT $2,269,000 MLS#98481606, Marilyn Heffers, 203.221.2137

Fairfield, CT $2,249,000 MLS#98479365, Leena Krook, 203.685.1148

Bedford, NY $2,195,000 MLS#3031506, Anthony DeBellis, 914.618.1737

Duxbury, MA $2,050,000 MLS#71144821, Michael Gill, 781.831.0341

Sherborn, MA $1,850,000 MLS#71153966, Nora Lynch Smith, 508.245.2626

Fairfield, CT $1,793,000 MLS#98478542, Jeanette Dryburgh, 203.246.1168

For more information on these and other luxury homes or to speak to an Exceptional Properties Specialist, call 877.298.2780.


raveis.com

“The Best Website in Real Estate” 2 00,000+ L i s ti ngs • Sol d Propert i es • A l l Local Housing Da ta & Gr aphs • All MLS Ope n House s

10 million world-wide visits annually Visit raveis.com & type in MLS# for multiple photos/detailed descriptions on these homes

Stamford, CT $1,749,000 MLS#98478381, Phyllis Doonan, 203.363.7142

New Canaan, CT $1,595,000 MLS#98396086, Dody Whitehurst, 203.858.6366

North Chatham, MA $1,550,000 MLS#21009465, Phyllis Power, 508.237.1406

Sherborn, MA $1,459,900 MLS#71061386, Nora Lynch Smith, 508.245.2626

Marblehead, MA $1,395,000 MLS#70981877, Steve White, 781.690.6433

Brookfield, CT $1,395,000 MLS#98461854, Patty McCarthy, 203.733.7006

Stamford, CT $1,350,000 MLS#98477416, Mark Denham, 203.253.0896

Stonington, CT $1,325,000 MLS#E242953, Debra Chamberlain, 860.415.0217

Marblehead, MA $1,295,000 MLS#70927976, Steve White, 781.690.6433

Hingham, MA $1,275,500 MLS#71158263, Denise Marshall, 617.875.7774

Ridgefield, CT $1,200,000 MLS#98476228, David Everson, 203.246.7150

Southbury, CT $1,095,000 MLS#L136376, Stacey Matthews, 860.868.9066

Norwalk, CT $950,000 MLS#98477754, Jeanette Dryburgh, 203.246.1168

Centerville, MA Starting at $595,000 MLS#21008756, Frank DeStefano, 508.280.7300

Woodbury, CT $1,750,000 MLS#98456319, Stacey Matthews, 860.868.9066

.83 Acres of Land - Walking Distance to Beach

For more information on these and other luxury homes or to speak to an Exceptional Properties Specialist, call 877.298.2780.


Gloucester, MA

Essex, MA

Hamilton, MA

6SHFWDFXODU RFHDQ YLHZ HVWDWH ZLWK SDWK WR SULYDWH beach. This residence has been fully renovated and feaWXUHVSHULRGGHWDLOVDQGIRUPDOOLYLQJDUHDVQHZIDPLO\ room, gourmet kitchen, master suite with deck, and adGLWLRQDOEHGURRPVDQGEDWKVRQQGDQGUGOHYHOV7KLV SURSHUW\DOVRRIIHUVDJXHVWFRWWDJHVWXQQLQJSRRODQG SRROKRXVH$3,350,000

6SHFWDFXODUSDQRUDPLFYLHZVDQGDFFHVVWRPDUVKZDWHUVIURPWKLV7LPEHU)UDPHUHVLGHQFHVHWXSRQDSULYDWHDFUHORW7KLVKRPHIHDWXUHVDQRSHQÃ&#x20AC;RRUSODQ and offers a living room with beams and stunning stone ¿UHSODFHZUDSDURXQGSRUFKHVDQGEHGURRPVDQG IXOOEDWKV$OVRRIIHULQJDOHJDOEHGURRPDSDUWPHQW $1,143,000

³3KHDVDQW +LOO )DUP´ 3UHVWLJLRXV HVWDWH VLWHG RQ  DFUHVZLWKH[TXLVLWHJDUGHQVGHVLJQHGE\)/2OPVWHG 7KLV UHVLGHQFH IHDWXUHV SHULRG GHWDLOV WKURXJKRXW DQG RIIHUV  ¿UHSODFHV  EHGURRPV  IXOO  KDOI EDWKV JXHVWFDUHWDNHU FRWWDJH LQJURXQG SRRO SRRO KRXVH tennis court, tea house, green house and gazebo. $6,400,000

JJ

Barrett

& C O M PANY

Beverly Farms, MA

Magnolia, MA

2FHDQIURQW1DQWXFNHWVW\OHH[SDQGHG&DSHZLWKVWXQning views from Manchester to Marblehead. This residence affords ocean views from almost every room and IHDWXUHV D IRUPDO GLQLQJ URRP OLYLQJ URRP ZLWK ¿UHSODFHIDPLO\URRPZLWK¿HOGVWRQH¿UHSODFHWKDWÃ&#x20AC;RZV WRWKHNLWFKHQGLQLQJDUHDDQGIDQWDVWLFSRROZLWKYLVWD ocean views. $6,300,000

2FHDQIURQW 5R\DO %DUU\ :LOOV &DSH ORFDWHG LQ 0DJQROLDZLWKSDQRUDPLFRFHDQYLHZV7KLVUHVLGHQFHIHDWXUHVDOLYLQJURRPZLWK¿UHSODFHHDWLQNLWFKHQIDPLO\ URRPIRUPDOGLQLQJURRPPDVWHUVXLWHZLWKRI¿FHDQG GHFNDVZHOODVEHGURRPVEDWKDQGEHGURRPVXLWHRQ WKHQGOHYHO/DUJHSOD\URRPZLWKKDOIEDWKRQORZHU level. $1,700,000

SPECIALISTS IN REALTY SERVICES

Manchester, MA

Rockport, MA

Hamilton, MA

6WDWHO\ 9LFWRULDQ SHUFKHG RQ  DFUHV ZLWK ¿HOGVWRQH IRXQGDWLRQ ZDOOV DQG SHULRG GHWDLOV LQFOXGLQJ RUQDWH ¿UHSODFHV KLJK FHLOLQJV DQG VZHHSLQJ VWDLUFDVH 7KLV UHVLGHQFHIHDWXUHVHOHJDQWOLYLQJDQGGLQLQJURRPVSDQHOHGOLEUDU\DQGRIIHUVEHGURRPVDQGEDWKVDQG RIIHUV XQOLPLWHG SRWHQWLDO $ VHSDUDWH FDUULDJH KRXVH awaits renovation. $2,395,000

Panoramic ocean views from this sunny, one level home RQ D SULYDWH VSDFLRXV ORW 7KLV KRPH IHDWXUHV D ¿UHSODFHGOLYLQJURRPEHGURRPVIXOOEDWKVDQGDIDEXlous deck and offers an additional legal one bedroom UHQWDO DSDUWPHQW ZLWK OLYLQJ URRP NLWFKHQ EDWKURRP SULYDWHHQWUDQFHDQGDGHFNZLWKRFHDQYLHZV $1,550,000

Custom Colonial home sited on 5+ acres overlooking the Miles River offers traditional elegance with state-ofthe-art systems. This new 6,500 sq ft residence features KLJK FHLOLQJV  ¿UHSODFHV DQG D SURIHVVLRQDO NLWFKHQ ZLWKSDQWU\2IIHULQJEHGURRPVLQFOXGLQJPDVWHUDQG DXSDLUVXLWHV$ORZHUOHYHOZLWKJDPHURRPRIIHUVDFFHVVWRLQJURXQGSRRO $2,800,000

Nahant, MA

Manchester, MA

Wenham, MA

2FHDQIURQW 6KLQJOH VW\OH HVWDWH ZLWK VSHFWDFXODU YLVWDVRIWKH%RVWRQVN\OLQH6LWHGRQDDFUHSHQLQVXOD WKLV FRPSOHWHO\ UHQRYDWHG UHVLGHQFH IHDWXUHV VWXQQLQJ 3RJJHQSRKONLWFKHQVVXQNHQOLYLQJURRPEHGURRPV IXOOEDWKVDQGKDOIEDWKVLQFOXGLQJDVWXQQLQJPDVWHU VXLWH$OVRLQFOXGHGLVDQRFHDQIURQWJXHVWFRWWDJHZLWK kitchen and full bath. $5,900,000

&RPSOHWHO\UHFRQVWUXFWHGLQWRZQ9LFWRULDQEHDXWLIXOO\ DSSRLQWHGZLWKFXVWRPGHWDLOV7KLVKRPHIHDWXUHVPDKRJDQ\Ã&#x20AC;RRUVFHQWUDODFJUDQLWHNLWFKHQZLWK¿UHSODFH EHGURRPVDQGEDWKVLQFOXGLQJD¿UHSODFHGPDVWHUEHGURRP2IIHULQJD%HDFRQ+LOOJDUGHQDQGDUG Ã&#x20AC;RRUGHFNZLWKYLHZVRXWWR0LVHU\,VODQG $1,175,000

&XVWRP 6KLQJOH VW\OH &RQWHPSRUDU\ VHW RQ D  DFUH knoll with quality details throughout. This beautiful residence features a dramatic foyer, gourmet kitchen, dinLQJURRPOLYLQJURRPZLWKJDV¿UHSODFHIDPLO\URRP DQGDJUHDWURRPZLWK¿UHSODFH2IIHULQJDEHGURRPV DQG  EDWKV LQFOXGLQJ D ¿UHSODFHG PDVWHU VXLWH DQG guest wing. $1,998,000

www.jbarrettrealty.com 0DQFKHVWHUE\WKH6HD0$  Â&#x2021; Beverly Farms, MA 01915   Â&#x2021;*ORXFHVWHU0$  




West WestYarmouth Yarmouth

355 GREAT ISLAND ROAD 355 GREAT ISLAND ROAD

Chatham Chatham

$5,200,000 $5,200,000

214 STAGE ISLAND ROAD 214 STAGE ISLAND ROAD

$4,750,000 $4,750,000

New waterftont construction on Great Island. An architechural New waterftont construction on Great Island. An architechural masterpiece. This 4500 square foot seaside home with waterviews masterpiece. This 4500 square foot seaside home with waterviews from every room offers the ultimate in craftsmanship, appointments from every room offers the ultimate in craftsmanship, appointments & finishes. 4 bedrooms and 4 1/2 baths & a state-of-the-art kitchen. & finishes. 4 bedrooms and 4 1/2 baths & a state-of-the-art kitchen.

Magnificent panorama of Stage Harbor and Nantucket Sound all Magnificent panorama of Stage Harbor and Nantucket Sound all the way to Great Island. Stylish Contemporary Cape is nestled in the way to Great Island. Stylish Contemporary Cape is nestled in a superb coastal setting. 4 bedrooms, 4 full and 2 half baths, 2 a superb coastal setting. 4 bedrooms, 4 full and 2 half baths, 2 fireplaces, and much more. Stunning ocean sunsets! fireplaces, and much more. Stunning ocean sunsets!

Yarmouth Port Office Yarmouth Port Office

Chatham Office Chatham Office

508.362.3000 508.362.3000

Chatham Chatham

West Dennis West Dennis

12 WHEATFIELD LANE

508.945.0990 508.945.0990

$3,995,000

326 MORRIS ISLAND ROAD

$1,825,000

12Fabulous WHEATFIELD LANE custom home on 2+ acres with over 500$3,995,000 feet frontage

326 MORRIS ROAD Chatham beachISLAND house with saltwater views from$1,825,000 almost ev-

on Basscustom River. Features deepwater saltwater Fabulous home on include 2+ acresa with over 500dock, feet frontage pool, separate guest cottage, and garages for 4 cars. 7 bedon Bass River. Features include a deepwater dock, saltwater

ery window. Like house new Contemporary Cape withfrom an open floor Chatham beach with saltwater views almost evplan that is great for entertaining. All 3 second floor bedrooms ery window. Like new Contemporary Cape with an open floor

rooms, 7 bathsguest and acottage, granite &and marble kitchen. pool, separate garages for 4 cars. 7 bed-

havethat full baths. fully furnished. plan is greatOffered for entertaining. All 3 second floor bedrooms

rooms, 7 bathsPort and Office a granite & marble kitchen. 508.362.3000 Yarmouth

have full baths. Chatham OfficeOffered fully furnished.

Yarmouth Port Office

Chatham Office

508.362.3000

kinlingrover.com kinlingrover.com

508.945.1856

508.945.1856

Cape Codâ&#x20AC;&#x2122;s best address Cape Codâ&#x20AC;&#x2122;s best address


COLDWELL BANKER

I N T E R N A T I O N A L®

The Luxury Div ision of Coldwell Banker Residential Brokerage MANCHESTER-BY-THE-SEA, MASSACHUSETTS

WESTON, MASSACHUSETTS

$5,850,000. Built in 1879 as one of the North Shore’s grand summer cottages overlooking Singing Beach and the Atlantic Ocean, “Jutland” was restored in 2004 to preserve the outstanding natural beauty and architectural integrity of the property. Offering a 3-car garage, a heated pool and pool house. Lynda Surdam, (978) 526-7572

$3,795,000. Architecturally-designed Shingle-style residence on a pristine 1.8± setting in a coveted south side enclave. Features 8,300 square feet, two-story foyer, custom gourmet kitchen, four bedrooms including a master suite, finished lower level with a cinema, exercise room, and game room. Kathryn Alphas-Richlen, (781) 894-5555

GILFORD, NEW HAMPSHIRE

MILTON, MASSACHUSETTS

$10,000,000. A remarkable home with a sandy beach and a dock for three boats. Features include kitchen with a breakfast nook, a theater, billiard room, gym, two offices, two family rooms, wet and dry saunas, patio with fireplace, nine garages and a carriage house. Susan C. Bradley, (603) 493-2873

$1,600,000. The Roger Sumner House c.1678, one of Milton’s oldest, wears its years well. Young owners have brought it to a level of comfort and luxury unusual for a home of any age while still retaining its antique charm. Set on 2.2 acres with a year-round pool/guesthouse. Josephine McCloskey / Julianne Bridgeman, (617) 696-4430

EAST GREENWICH, RHODE ISLAND

HINGHAM, MASSACHUSETTS

$1,150,000. A beautiful grand entrance leads to this majestic brick estate. Features include a chef’s kitchen, two-story great room, four bedrooms including a sumptuous master suite, lower level with a media room, kitchen and bath leads to the backyard oasis with a heated pool, hot tub and gardens. Janis Cappello, (401) 884-8050

$3,595,000. Exquisite 1937 residence set on a 2.35 acre lot with park-like grounds in downtown Hingham. This classic home offers over 5,500 square feet and original details which have been masterfully preserved include a gracious staircase, hard pine floors, detailed moldings, French doors and fireplaces. Tara Coveney, (781) 749-4300

VISIT NEWENGLANDMOVES.COM TO VIEW OUR LUXURY COLLECTION ©2011 Coldwell Banker Real Estate LLC. Coldwell Banker® is a registered trademark licensed to Coldwell Banker Real Estate LLC. An Equal Opportunity Company. Equal Housing Opportunity. Owned and Operated by NRT LLC. We are pledged to the letter and spirit of U.S. policy for the achievement of equal housing opportunity throughout the Nation. We encourage and support an affirmative advertising and marketing program in which there are no barriers to obtaining housing because of race, color, religion, sex, handicap, familial status or national origin.


Connecting buyers and sellers in the historic Metrowest communities of Concord, Carlisle, Lexington, Lincoln Sudbury, Harvard and surrounding areas for over 15 years.

PEGGY DOWCETT, REALTOR® T 978 369-1000 | C 978 302-3988 email: peggy@peggydowcett.com blog: www.peggydowcett.com

Lets buy or sell your next home together. Lets make your dream a reality. Call me and we can get started today! As a tech savvy real estate agent, I utilize all forms of media to help you buy or sell your home. Contact me today for a free market analysis of your target areas or your specific property.

11 Main Street | Concord MA 01742 www.NewEnglandMoves.com

prudentialCT.com

Deep River Distinctive Contemporary 3 bedroom Ranch in glorious 6 acre setting across from the Connecticut River. 2 lots. 2600+ sqft., crisp open spaces, walls of glass, high ceilings. An exquisite home in a captivating location. $1,100,000

Haddam Stunning 6,000 +S/F Colonial. Open floor plan. Hugh Kitchen/BBar. 5 bedroom, 4+ bath, 3 car gar. Poss. Au Pair/In-Law. 5+ ac. Additional 2500+S/F walkout lower level with movie theater. Poss. Horse property. $799,000

Killingworth Classic Early Eighteenth Century 10 room, 3 bedroom post and beam Cape. Open and bright spaces, 5 fireplaces. 12 serene acres. A guest house, garage with studio and pool complete this delightful country estate. $1,085,000

www.288RiverRoad.com Maureen Nelson • 860-767-2133

www.66OxbowRoad.com Marie Coughlin 860-301-2425

www.282ParkerHillRd.com Maureen Nelson 860-767-2133

E XCLUS I V E . E XACT I N G. E XCE PT I O N A L . © 2010, An independently owned and operated member of The Prudential Real Estate Affiliates, Inc. Prudential is a service mark of the Prudential Insurance Company of America. Equal Housing Opportunity.


Wareham MarionWaterfront Village Contemporary

Masterpiece

This Contemporary home, set on over 13 acres in

Located in the heart of Marion Village, this lovely antique East Wareham, offers gorgeous waterviews of Shell Pointhome Bay blends modern amenities thein charm of3,250 a classic antique. and surrounding marsh.with Built 1989, its square feet Built infirst 1900 butmaster thoroughly 6 years 3-1/2 ago, baths, this include floor suite, 3renovated additionaljust bedrooms, home is complete with 5dining bedrooms, 3 den full with baths,gas formal dining laundry room, formal room, fireplace, room, sitting room, gourmet and new room.views. High and large living room with kitchen gas fireplace andfamily spectacular ceilings,kitchen hardwood floors,granite radiantcountertops, heat, and custom woodwork Modern includes Thermador ovens, and Sub-Zero refrigerator. complete withtolarge abound in this special home. Also French doors lead the finished gorgeous walk-out basement, wrap-around patio, and 3 carinclude garage .75 acre professionally landscaped deck, lot. Exterior features with unfinished roomsbluestone above. Alarm generator, wrap-around front porch, patio, system, and in-ground swimcentral outdoor shower, andlisted workshop. ming pool. Thisvacuum, house has it all! Exclusively at $895,000.

Professional landscaping adds to this private, serene home.

Exclusively listed $895,000.00 Exclusively listed at at $1,600,000

Back Bay - Masterfully crafted Single Family home on quiet, tree lined street. This ultra luxurious home is newly constructed to the highest of standards. A modern, yet traditional home offers an unmatched quality of living. Featuring smart house technology, four stories, five bedrooms, a formal dining room with a full auxiliary kitchen, elevator to every floor, private roof deck, one full garage and one full covered parking space. $8,950,000. 7Exeter.com

Beth Dickerson, 617.510.8565 Beth.Dickerson@SothebysRealty.com, BethDickerson.com

Tel: 508-748-0020 Fax: 508-748-2337

CORNICE REALTY, LLC GORGEOUS OFFICE SPACE FOR RENT!

NEWPORT

$4,900,000 {{ÎÊ iiÛÕiÊÛi˜ÕiÊUÊfx]Óää]äää Historic Swanhurst Manor built in £nx£]ʜ˜iʜvÊ̅iʜÀˆ}ˆ˜>Ê£Óʓ>˜Ãˆœ˜ÃÊ œ˜Ê iÜ«œÀ̽ÃÊ v>“i`Ê iiÛÕiÊ Ûi°Ê

œ“«iÌiÞÊ ÀiÃ̜Ài`Ê ÜˆÌ…Ê ÃÌ՘˜ˆ˜}Ê `iÌ>ˆÃÊ œ˜Ê £°xÊ >VÀiÃÊ œvÊ Ã«iVÌ>VՏ>ÀÊ “>ÌÕÀiʏ>˜`ÃV>«i`Ê}>À`i˜Ã°Ê Lynn Creighton 401.345.6886

William Raveis CHAPMAN ENSTONE REAL ESTATE t MORTGAGE t RENTALS

RAVEIS.COM {™Ê iiÛÕiÊÛiÊUÊ iÜ«œÀÌ]Ê,ÊUÊ{䣰n{È°Înää lynn.creighton@raveis.com

Peach Hill Professional Building: 2227 Mineral Spring Avenue, North Providence, RI. Newly renovated building in Centredale Village with modern amenities and a historic look. Offers walk to town and bus, easy highway access. Complete with inlay hardwood floors, crown molding, and round ceiling. Lease includes parking, storage, security system. First and second floors available. Each floor is approximately 1000 SF (common areas not included) and available in individual leases or in combination. Please contact Cornice Realty to make arrangements for a tour. Brokers welcome.

401-354-4720 | Cornice@ureach.com


Advertiser Index A helpful resource for finding the advertisers featured in this issue

Divine Kitchens Inside back cover

Patrick Ahearn Architect, LLC 43

A.J. Rose Carpets 6–7

Domus Inc. Inside front cover–page 1

Pellettieri Associates Inc. 103

American Society of Interior Designers 129

Dover Rug 119

Polhemus Savery DaSilva 64–65

Anderson Insulation 100

Eliza Tan Interiors 29

Prudential Connecticut Realty 149

Arco, LLC 117

F.H. Perry Builder 39

Quidley & Company 37

Atlantic Design Center 8–9

Ferguson 46–47

R.P. Marzilli & Company, Inc. 121

Back Bay Shutter Co. Inc. 33

First Rugs, Inc. 101

RiverBend & Company 99

Battle Associates 131

Furniture Consignment Gallery 120

Sally Weston Associates 62–63

BayPoint Builders 55

Gibson Sotheby’s International Realty 150

Sanford Custom Homes 141

Bear Path 123

The Granite Group 111

Snow and Jones 19

Bensonwood Homes Back cover

Housewright Construction 105

South Shore Millwork 17

Billie Brenner Ltd 120

Hutker Architects 60–61

Stone Technologies 107

Boston Architectural College 117

J Barrett & Company Real Estate 146

Sudbury Design Group 2–3

Boston Billiard Emporium 135

J. Todd Galleries 16

Susan Dearborn Interiors 35

Boston Design Center 11

Katherine Field and Associates, Inc. 41

Susan Shulman Interiors 54

Boston Green Realty 115

Kinlin Grover Corporate 147

Taste Design Inc. 143

Bradford Design, Inc. 18

Kitchen Views at National Lumber 113

Thoughtforms 32

Kristen Rivoli Interior Design 133

TMS Architects 56–57

LaBarge Custom Home Building 112

Vermont Verde Antique Marble Co. 115

Landry & Arcari 27

Wayne Towle Master Finishing & Restoration 31

Cabinet Gallery Ltd. 142 California Closets 15 Coldwell Banker—Concord 149 Coldwell Banker Previews International 148 Coneco Geothermal 96 The Converse Company Realtors 150 Cornice Realty 150 Cottage and Bungalow 135

League of N.H. Craftsmen 128 Leslie Fine Interiors, Inc. 4–5 Lynn Creighton Realtor 150 M. Gabaree Lampshades 142

William Raveis Real Estate HQ 144–145 Woodmeister Master Builders 21 Xtreme Audio & Video 106 Zen Associates 4

Marble and Granite Inc. 53

Creative Art Furniture c/o Staples Cabinet Makers 133

Maverick Integration Corp 112

Crown Point Cabinetry 109

Mitchell Gold + Bob Williams 49

Cumar Inc. 25

Morehouse MacDonald & Associates 13

Cutting Edge Systems 51

National Lumber 113

Daher Interior Design 22

New England Architectural Finishing 141

David Sharff Architect, P.C. 58–59

Northern Lights Landscape 125

Decorating Den Interiors 40

Parc Monceau 127

New England Home, January/February 2011, Volume 6, Number 3 © 2011 by Network Communications, Inc. All rights reserved. Permission to reprint or quote excerpts granted by written request only. New England Home (USPS 024-096) is published 6 times a year (JAN, MAR, MAY, JULY, SEP, NOV) by Network Communications, Inc. 2305 Newpoint Parkway, Lawrenceville, GA 30043 (770) 9627220. Periodical postage paid at Lawrenceville, GA, and additional mailing offices. POSTMASTER: Send address changes to New England Home, PO Box 9002, Maple Shade, NJ 08052-9652. For change of address include old address as well as new address with both zip codes. Allow four to six weeks for change of address to become effective. Please include current mailing label when writing about your subscription. January/February 2011 New England Home 151


Sketch Pad Design ideas in the making

THESE PILLOWS CAME ABOUT as a result of a combination of different needs. We were making a masculine living room and needed accessories that could be in light tones but be very male-looking at the same time. Also, we wanted to include some of the materials, like cowhide and lots of natural wood, that were already being used in the rest of the room. So we designed this cushion. Starting with a very thick organic cotton twill fabric as a base, we added suede cords on top of it, weaving them together to keep the lines straight and create a kind of criss-cross pattern. When that was done we added wooden elements—a kind of little wooden spool—in a diagonal orientation, to break up the vertical and horizontal grid that the cords made and soften the effect a bit. Finally, an invisible zipper was put in . . . and voilà, our new creation was finished! FERNANDA BOURLOT, SIMPLEMENTE BLANCO, BOSTON, (617) 734-3669, WWW.SIMPLEMENTEBLANCO.COM

152

New England Home January/February 2011


Where does the kitchen end and the living space begin? From a fresh translation of traditional to new concepts that create a ďŹ&#x201A;uid transition between the kitchen and the rest of the living space, Mariette Barsoum and her Divine team approach every project with a keen ear. Offering custom solutions from Leicht, Porcelanosa and endless styles to give form to your thoughts, Divine brings your project to life. Divine invites architects, designers and homeowners to explore a whole new way to think about the home.

EXQUISITE DESIGNS

TURN-KEY KITCHEN & BATHROOM RENOVATION

WESTBOROUGH

UNPARALLELED SERVICE

40 Lyman Street Westborough, MA 508-366-5670 180 Linden Street Wellesley, MA 781-235-5650

WELLESLEY AT LINDEN SQUARE

www.divinekitchens.com


Experience a Bensonwood

I

f youâ&#x20AC;&#x2122;re looking for a home that celebrates your active lifestyle, consider the high performance home that involves you in all the senses: a Bensonwood. Imagine a home that works and plays as hard as you do. Besides dazzling your eyes and anticipating your needs,s, itâ&#x20AC;&#x2122;s it s

saving you a third to a half in energy costs. Most importantly, its quality is measured in centuries and its beauty is timeless. To learn more about the homes that dwell in you, call one of our professionals at 877.203.3562 or visit us online at bensonwood.com. Your Bensonwood experience is than you think. closer th

www.bensonwood.com b d

New England Home  

January/February 2011

Read more
Read more
Similar to
Popular now
Just for you