Aleading cliniciansaysthe transformationofthePrincessRoyal Hospitaltospecialiseinthedelivery ofplannedcareisakeyelementof planstoupgradeacutehospitalser vices across Shropshire, Telford& WrekinandmidWales.
DrSteveMcKew,divisionalmedicaldirectorforsurgery,anaesthetics andcancerattheShrewsburyand TelfordHospitalNHSTrust,saidthat thechangeswouldbringgenuineim provementstoservicesandreduce hospitalwaitingtimes
“Theywillmoderniseourservic esandsignificantlyreducedelaysto plannedsurgery andcancertreat mentwhilealsomakingtheservices muchmoreresilienttofuturepres sures,”hesaid.
Detailsofthededicatedplanned caresitehavebeenrevealed
Dr McKewsaidoperationsand procedurescouldtakeplaceallyear round, utilisingdedicated theatres andwards
Shorterwaitingtimeswillmean people canhavetreatment sooner, improvingtheirrecoveryand the services would be able to operate moreeffectively,ensuringthatthe rightstaff,equipmentandfacilities areavailable at theright time,he said.“Theseplansbuildonourex
citingrecentannouncementthat£24 millionisbeinginvestedinanew, purpose-built,plannedcarehubat thePrincessRoyalHospitalsitein Telford,whichwillprovidegreater accesstotheatresandrecoverybeds andincreasethenumberofsamedayoperationsall year round,”he said
“Delaystoplannedsurgeryhave arealimpactonthequalityofpeo ples’livesandtheirabilitytorecov er or startfurther treatment.The wayourservicesandresourcesare currently configured meansour staffstruggletoprovidethequality ofcarethatourpatientsneed.The challengeofmanagingthe risk of Covid-19infectionduringtherecent pandemicexacerbated theseproblems.Investingindedicatedplanned carefacilitieswillreducedelaysand helppeopletogetthecaretheyneed sooner.”
Theproposedtransformationof hospitalserviceswillseeemergency careandmaternityandwomen’sservicescentredattheRoyalShrews bury Hospital whilethe Princess Royalsitewillspecialiseinthedeliv eryofplannedcare
Football pitchissaved
Mickey is set forlightsfun
Aparalympicgoldmedallist is settotaketothestageforaChrist maslightscountdown
Paralympian Mickey Bushell MBEwillbeilluminatingthestreets ofDonningtoninTelfordthisweek endinthecountdowntoChristmas. ChairmanofDonningtonand Muxton Parish Council, Councillor TomHoof,saidhewasthrilledtobe welcomingthegoldmedallistforthe bigswitch-on.Headded:“Iamreal lygladwehavebeenabletobring backtheChristmasFestivalbackfor anotheryear.”Donnington’sfestival willtakeplaceonSundayfrom1pm to6pmatTheParade.Thelightswill beswitchedonat4.30pm
Fourth park givenaward
Aparkhas won aprestigious nationalaccoladeforthefirsttime, makingitthefourthintheborough todoso
DaleEndParkintheIronbridge Gorge,TelfordandWrekin,proudly raisedaGreenFlaglastweek
Theparkjoins theborough’s existingGreenFlagsitesinTelford TownPark,DawleyParkandHart shillPark,meaningTelfordandWrekinisnowhometofournationally recognisedtopqualityparks.
Councillor CarolynHealy said: “AsaGorgeresident,I’msoproudto seeaGreenFlagflyingoverourlocal park.It’safantasticsiteforresidents toenjoy.”
•Fully Welded uPVC Windows, Doors&Conservatories •Internally Glazed with high Security Locks •Composite Doors• Garage Doors •Fascias,Soffits &Guttering •BuildingExtensions WhyChooseA.P.H Windows? • AlluPVCproducts aremade in our ownfactory • Dealdirectwiththe owner • No pressureSalesmen Directly employed craftsmen • Full aftersalesservice • No depositrequired Ourshowroomisfullofideas to help youdecide on thestyle &design of your windows, doors and dreamconservatory Open Mon -Fri 9am-5pmSat 10am 3pm SHOWROOM OPENBY APPOINTMENT Good SupplyOnlyTrade Rates-1 Week Turnaround l direct with the Fu after sales s deposit required COULDFUTURE FITFIX DELAYS?
Report by Sue Austin
Lawley Lightmoor FC aredelighted atthecouncil’s U-turn Peoplepowerhaswonoutwith acouncil performing aU-turnon itsdecisiontokickayouthteamoff theirfootballpitch Nearly1,500peoplesignedapetitionafterTelford&WrekinCouncil toldLawleyLightmoorFCthatthey werenolongerabletousetheirpitch atHartshillPark Theclubandthecouncilmetto discussthesituationandthemeet ingresultedinanagreementthatthe clubcancontinuetousethepitchfor itsmatches Thursday, November 24, 2022 NEWS FEATURE SPORT Cancer van is unveiled Page3 Enigmatic wadingbirds Page 4 Davies aims to rule theworld Back Page www.telfordjournal.co.uk Price when sold £1.20 Theregion’s biggest free weekly newspaper
Newhomefor Post Office
Anewpermanenthomehas been foundfor aPostOffice whichwillopenafterChristmas
DawleyPostOfficeinTelford willnowbebasedatLifestyle ExpressonHighStreet
Thepostofficehad been basedatthe Co-oponHigh Street,butitsfuturewasputin doubtwhenthefirmannounced
it wasleaving thepremises Long-standingDawleybusi nessmanGurjinderSingh will become thepostmasteratthe postoffice,whichwillbehoused inpartofhisLifestyleExpress conveniencestore.
Telford&WrekinCouncil said it hasworkedwithGreat DawleyTownCouncilandlocal
councillorstosecureaperma nenthomeforthepostoffice.
Theauthoritysaiditwill supportMrSingh with the fit outofthenewpostofficeathis store.
MrSinghsaid:“I’mthrilled thatadealhasbeenagreedand I’mlookingforwardtorunning thepostoffice.”
Alocation hasbeen found
Stalkerhounded bus drivers afterrow over Covidmask
A“horrible” stalkerfol lowedandfilmedtwoterrified busdrivers,labelledthem“pae dophiles” on social mediaand madehoaxcallstopoliceabout suicide attempts at abus sta tion
TehfoorJaveed launched avendettaagainsttransport firmArrivaafterhewasasked toleaveabusfornotwearinga maskattheheightoftheCovid pandemic,Shrewsbury Crown Courtheard
The26-year-old,whohas78 previousconvictionswhichare mostlyforharassmentoffences or breachingcriminalbehav iourorders,avoidedanimme diateprisonsentence –even thoughJudgePeterBarrietold Javeedhisvictimswouldbe“as tounded”hewasn’tbeingsentto jail.
Javeed, of Victoria Avenue, Wellington,pleaded guilty to twochargesofintimidationand sixofmaliciouscommunication
Oliver Woolhouse, mitigat ing, said Javeed had learning difficultiesandhadbeendiag nosedwithautismbyadoctor. Javeed wasgiven a21-month prisonsentence,suspendedfor twoyears.
Javeed must also complete 250hoursofunpaidworkand 30rehabilitationactivitydays
Psychichelping good causes
PINE LODGE TYRE SERVICES Best at what we do! Plough Road, Wrockwardine Wood, Telford TF2 7AW Tel: 01952 371605 Please call for details ALL PRICES INCLUDE VALVES, BALANCE AND FITTING NEW TYRES 175-65-14£40 185-65-15 195-65-15 195-60-15 £40 205-55-16 £45 BRANDED TYRES 205-55-16 225-45-17 UniRoyal 245-45-18 £68 ALSO EXHAUSTS AND BRAKES All prices include VAT Many more in stock SpecialistGrills &Indian Curries HAPPY HOUR Mon& Tues All DayWed -Fri 12pm -4pm Carling, Strongbow&Worthington’s SERVING FROM 12PM, 7DAYSAWEEK Hop &Vine, High St,Hadley,TelfordTF1 5NG 01952 261596 www.hopandvine.co.uk £3 APINT * *T’s &C’s Apply Book now forChristmas / Office Party’s bookanad.shropshirestar.co.uk BOOKED FREE SOLD £15
NEWS TELFORDJOURNAL | THURSDAY,NOVEMBER 24,2022 2
Report by David Banner
Pet of the Week –Page 13 TV Guide –Page 21 THISWEEK
Apsychic medium will be connecting with spiritsinthe nameofcharitywhenhedoes ashowamonthforgoodcauses nextyear DaveAngelwillbedoingseveralshowsin2023,raisingmon eyforcharitiesincludingSevern Hospice,HopeHouse,Macmillan CancerSupport,SamaritansTel ford,AgeUK,TelfordMind,Dogs Trust, PDSA,Alzheimers Re searchUK,HelpforHeroesand theBritishHeartFoundation. Datesandvenuesareyetto beconfirmed,butDaveexpects tobedoingshowsatHorsehay GolfClub,BusinessBoutiquein MarketDrayton,TheOldFight ingCocksinOakengates, and HallGreenSpiritualistChurchin Birmingham. Dave,whoalsoworksatTel-
shortinterval Psychicmedium Dave Angel willbe doing aseries ofcharityshowsnextyear SEVEN-DAYFORECAST Thursday Friday Saturday Sunday Monday Tuesday Wednesday 6°/10° 6°/10° 7°/11° 7°/10° 7°/10° 7°/11° 7°/10° Low/high
fordTheatre,said:“Iwantedto dothistogivesomethingback. AslongasIcanhelppeople,I’ll keepdoingit.” Theshowswillbetwosets of around 45 minuteswitha
Acancercharityhasunveiled itslatestweaponagainstthedis ease–anew£95,000vantospread themessageofawarenessandpre ventionaroundthecounty.
Themoney forthe Lingen Daviesvan wasdonated by TelfordPlazaUK,andthevehiclewas officiallyunveiledbythecounty’s HighSheriff,SelinaGraham,and theMayor of TelfordCouncillor RajMehtaoutsidethecompany’s offices.Thecharityhasbeensup portingandenhancingservicesfor patientsattheRoyalShrewsbury Hospital’s Lingen DaviesCancer Centreformorethan40years.
Charityshop open again
Atown’sshoppershavebeen thankedfor theirsupportafter acharityopenedthedoorsofits new-lookshop.
SevernHospicehasspenteight weeksgivingamakeover to its Shifnalhighstreetshop,creating morespaceforthestockitsells
Threeofthe hospice’scom munity nurses attendedthe ribbon-cuttingceremonyand were abletothanksupportersfordonat ingtotheshopandbuyingfromit. CommunityshopmanagerClaire Henshawsaid:“Wehadafantas-
ticreopeningdayanditwasgreat towelcomebackfamiliarfacesas wellasnewcustomers.
“Shifnalresidentshavealways beensuchloyalsupportersofthe hospiceandourcommunityshop anditwas greattohearall the complimentsonournewlook.”
SevernHospicesaidtheshops arevitaltoitsfunding.Thechar ityhastoraise£2forevery£3it spends, andcustomers of its30 high street shopscontributed morethan£1milliontowardsits serviceslastyear
Itisalsonowworkingonrais ingawarenessaboutthesignsand symptomsofcancerincommuni ties throughoutShropshire, Telford,andMidWales.TheLiveLife service,whichwillbepromotedby thenewvan,hasthreemembers of staffwho attend large-scale communityevents,summerfairs, andcorporate networking,sharinginformationaboutcancerand encouragingpeople to seek help fromGPswithanyconcerns
NaomiAtkin, CEOofLingen Davies,saidtheLiveLifeServiceis acriticalpartoftheworktoassist with cancer prevention andim-
proveearlydiagnosisratesacross theregion
Shesaidthevanwillallowthe teamtoreachmorepeople,helping supportandadvisethemtoseek earlydiagnosiswhererelevant.
Shesaid:“TheLingenDavies Centreseesmorethan4,000new ly diagnosedpatientseachyear, andwithcurrentstatisticsstating oneintwopeoplewillgetcancer intheirlifetime,thenumberofpatientsweseewillonlycontinueto rise.Thisverygenerousdonation fromTelfordPlazaUKLtdhasen abledustopurchaseabrand-new, multi-purposevehicle.”
Plea issued over booster
TheNHSinShropshireisurg ingadultswithlong-termhealth conditionstotakeuptheofferof afreeflujabandCovid-19booster assoonaspossibletoprotectthem thiswinter
Thoseathigher risk of seri oussymptomsfromCovidandflu include peoplewithlungproblemsincludingasthmaorchronic obstructive pulmonarydisorder, peoplewithheartdisease,chronic kidneyorliverdisease,cancer,a
weakenedimmunesystemorpeoplewhohavehadastrokeorthose livingwithdementia
AlisonBussey,chiefnursingofficerforatNHSShropshire,Telford andWrekin,said:“Iurgepatients whoareatriskfromfluandCovid, particularlythosewithhealthconditions,tohavebothvaccinations toprotectthemselves,theirfamily andfriendsthiswinter.
“Havingthesejabsreducesthe chancesofcatchingfluandCovid
atthesametime,whichcouldbe dangerousorevenlifethreatening.
“Itissafetohavebothvaccines atthesametimeandifthisisof feredthenpleasetakeitup,but people mayneedtobookthem separately.Youdon’tneedtowait tobecontactedtogetvaccinated asyoucanbookonlineforaboost erorcontactyourGPpracticefor anNHSflujaboratapharmacy thatoffersone.”
Wedon’thavebigflashyadvertsorpushy salesman;we’reafriendly,localand ethicalfamilyrun-business. Weguaranteetobuyanyproperty,inany location,inanycondition,veryquickly withcash. We’llpayallyourfeesandthereare noviewings,boards,advertsorhidden charges. Giveusacallforaninstantguaranteed valuation.Wecanhaltrepossessions andhelpfixyourdebtproblems. Wecanbuytoday. WOULDYOULIKEMETO BUYYOURHOUSE? CallRamonanow01952301953 CARPETCLEANING AVAILABLE Email: directblinds1988@aol.com |Web: www.directblindsshropshire.co.uk EST 1988 30 yrs EXPERTISE! ALL TYPES OF QUALITY BLINDS, CURTAINS, SHUTTERS &AWNINGS FREE MEASURING &FITTING SERVICE FOR YOUR HOME,CONSERVATORY,OFFICE CALL US ON 01952 291 267 Beautiful showroom arrangedover 2floors arranged over Grate G fir ep la ce cen tre Open Monday -Saturday9am -5pm Sunday10.30am -2pm Castle Trading Estate, HolyheadRoad, Priorslee,TelfordTF2 9NP tel: 01952620189 www.grateideas.co.ukemail:info@grateideas.co.uk Extensive rangeofsolid fuel stoves. Full installation service available WINTER WARMERS NEWS THURSDAY,NOVEMBER24, 2022 | TELFORD JOURNAL 3
Vandeliversmessage of cancer awareness
Lingen Davies launchtheircancer awarenessvanafter amajordonation from TelfordPlazaUK
SevernHospicehasre-opened itsshop inShifnal
Anticipating Jesus’sarrival
CROSSTALK
Asachild,Ilovedtocountdown thedaystowardsChristmaswithan adventcalendar.Iamofanagewhere itwasunusualtofindtheoneswith chocolatein!
AsIgotalittleolder,Iwasgiv enanadventcandle;thisseemedto heightentheatmosphereofthesea son,butonmorethanoneofthose24 days,Ibecamedistractedandwould enduplettingthecandleburndown twoorthreedaysatatimeandIgot veryfrustratedthatitdisruptedthe adventroutine.Adventisallabout theanticipationofChristmas,when wecelebratethearrivaloftheChrist Child, Jesus. We recallthe events leadinguptohisbirthandreflect uponthedifferencehemakestohu manity2,000yearson
Butitisveryeasytobecomedis tractedandindoingsowecanmiss outonsomeofthepreparationand anticipationthatthisseasonbrings andthemessageithastooffer.
Whynottakethetimetoantic ipatethegiftofachildwhocame amongustoofferanewlifetoalland enablesustoconcentrateontheaspectsofourliveswevalue?
Anenigmaticwadingbird
ONTHEWILDSIDE
By Ben Waddams
Whenever Ipaint awoodcock, one of my commonest questions turnsouttobe:isthatasnipe?Myartisticfailingsaside,thatisnotapar ticularlyignorantquestiontoask.
Firstlythetwospecieslookfair lysimilar,secondlytheyarefound insimilarhabitatsandthirdly,that woodcockisknownas‘thesnipeof thewoods’.
This charismaticand enigmatic wading bird is foundmainlyin woodlands,whereassnipearenot Yetbothinterminglearoundwatersources.Itisathick-bodied, pigeon-sized bird with alongbill anditsbeautifulplumage,asIhave recentlydiscoveredtryingtopaint oneagain,providesalmostperfect camouflagewhenitisontheground, motionlessinleaflitterandisutterly cryptic.
Thewoodcockisacrepuscularbird, most active at dawn and dusk andfeeds by probingits bill into damp ground,eatingmainly earthwormsandbeetles.Itisinfact rarelyseenontheground;mainly duetothatextraordinaryanddiffi cult-to-paintcamouflage.Itisduring
itsbreedingdisplayflight,knownas roding,thatawoodcockismostfrequentlyseen.MalesundertakerodingflightsbetweenAprilandJune. Butinmypersonalexperience, Itendto‘flush’themunexpectedly fromboggyfieldmarginsorwood land fringes. Thesebrief glimpses arenolessspectacularandkeepsme searchingfor woodcock whenever
Ihavethechance.Thespecieshas beenhuntedandeatensinceRoman times.
Thewoodcockisared-listedspe cies.TheshootingseasonforitbeginsonOctober1
However, everywinterwesee aninfluxofcontinentalbirds.That meansthattheseasonmainlytargets ouralarmingly-decreasing,
resident,breedingred-listedwoodcocks.Thereisaneffortandapetitiononline,topushtheseasonback toDecember1,sothattheblindingly obviouslikelihoodofwipingoutour Britishpopulationdecreasesalittle It’snotrocketscience,pleasetakea look n Ben’sartworkcanbeseenin Callaghan’sandRowlesGalleries.
Showcasing winter interiors
CousinsFurnitureisinvitingyou toasneakpeekoftheirnewWinter CollectionforthelaunchoftheirWin terSalewhichstartsnextmonth.
Overthepast12months,thelocal family-run business hasbeenbusy building inspirational newdepartments,introducingmanyexcitingnew brands,whilstcontinuingtoshowcase theverylatestcollectionsinhomeinteriorsandinnovation
In living,Cousins hasenhanced itscollectionswithfamousbrand namessuchasGPlanand Parker Knoll,tocomplywithmodernliving ThenewHurstrangefromGPlanofferseye-catchingdesignandaddssophisticationtoanyspace.Withclean lines andgeometric detailing, Hurst embodiespureelegance.Withmodularoptions,Hurstofferstheopportu nitytobuildyourperfectcombination creatingabespokesofaforyourspace. Reclineroptionsareavailableacross therange
Indining,recenttrendsforopen-
plan,flexibleliving,hasledtoasignif icantincreaseinkitchendining.Cousinsisproudtodisplaynewcollections fromworld-leadingItalianbrandCalli garisacrossdiningtables,sideboards andevenaccessories.Knownfortheir moderndesign,everyCalligarisdiningtablehasthepotentialtoenhance theaestheticsofthediningspace.For those lookingfor space-saving op tions,Calligarisalsooffersdiningta bleswithinnovativeextendingmecha nismsthatallowyoutoaccommodate asmanyastenpeople.
Forthe bedroom, they have in troducednewcollectionsfromErcol, showcasedinbrandnewgalleries.The Monzabedroom rangeisacontemporaryupdateofclassicmid-century design.Chestsare constructedwith mitred corner joints andarounded undercutdetail,framingthechevron veneerdrawerfronts.Taperingturned legsandangledplinthrailsarepainted blacktohighlighttheirelegantshapes andcreateasenseoflightness
DAVISONFORKLIFT LTD YEWTREEFARM, A5,CRACKLEYBANK,SHIFNAL, TF118QT TEL: 01952915060 ALL AVAILABLE TO HIRE
FEATURES TELFORDJOURNAL | THURSDAY,NOVEMBER 24,2022 4
Woodcocks arefoundmainly inwoodlands whereassnipeare not
With LisaKnight
TwoShropshireresidentshavewon awardsfortheircommitmenttosupporting life-changingdementiaresearch.
KatieFosterwasnamedVolunteerofthe YearandStuartLambiewasnamedSportingSupporteroftheYearinAlzheimer’sRe searchUK’sinauguralsupporterawards.
Katie,70,isoneofAlzheimer’sResearch UK’s longest-servingfundraisersand volunteershavingsupportedthecharitysince 2008.Shewasinspiredtosupportdementia researchasherfather,Tim,whohadbeen aprisonerofwarforfiveyearsafterbeing capturedinthedefenceofDunkirkin1940, diedwithAlzheimer’sdisease
Katieischair of theAlzheimer’s Re searchUKShropshireFundraisingGroup, whichshehelpedsetupin2017.Thegroup hasraisedabout£115,000.Thegroupwas alsoamongthenomineesfortheGroupof theYearAward Sheisalsoaprominentspokesperson forthecharity,sharingherpersonalexperi encetoinspireotherstogetinvolved
Shesaid: “I wasbothastonishedand delightedtowinthisaward.Thereareso many othervolunteersupand downthe countrywhodosomuchforthisgreatcause.
“Alzheimer’sResearchUKisawonderful organisationfullofdedicatedprofessionals allfocusingonendingthe heartbreakof dementiaandIfeelreallyprivilegedtobe involvedwiththem.Icouldn’tdoanything withoutsuchincredibleandgeneroussup-
portfromsomanyShropshirebusinesses, organisationsandindividualswhoregularly andgenerouslyhelpmeandourhardworkingfundraisinggroupmembers.Theyareso numerousIcan’tpossiblynamethemall,but canIjustsay:ThankyouShropshire!”
Stuart,63,isastalwartmemberofthe Alzheimer’sResearchUK’s#TeamARUK community of runnersand apassionate advocateforthecharity’spartnershipwith parkrun.Havinggotintorunningthrough parkrun,hebegansupportingAlzheimer’s
ResearchUKbytakingpartinthecharity’s RunningDownDementiachallenge.Hehas sinceraisedthousandsofpoundsinhonour ofhisdad,Ian,whodiedwithAlzheimer’s diseasein2020.Heranthe2021London Marathonandthe2022EdinburghMarathonandisaimingtoruntheLondonMar athonagaininApril.
Hesaid:“I’mveryhonouredandhumbledtoreceivethisawardandIjustwant tosayamassivethankyoutoeveryonewho hassupportedmeinanyway.”
Digiland House, Stafford Park 12, Telford, Shropshire TF3 3BJ 01952 238790 ShopInstore or Onlineatour Digiland OutletWeb Storewww.outletweb.co.uk Open : Mon-Fri 09:00-18:00 Sat 10:00-17:00 Sun losed 5 minutes from Telford Town Centre! retail@digigroup.co.uk Outlet Store Smartwatches from £20 32 inch TV’s from £99.99 Smartphones from £24 Digital Signage from £134 PC Monitors from £69 Laptops from £119 UP TO 40% off QLEDTV’s UP TO 40% off OLEDTV’s 8K TV’s from £729.99 UP TO 50%OFF Samsung Galaxy Phones UP TO 50%OFF Selected Laptops SALE BIGREDUCTIONS...ENDS30TH NOVEMBER!!! ith ludin n “comf USE YOUR LOFT Access your loft safely and easily with Bison loft stairs. A“gas” strut mechanism requiring just fingertip control makes opening and closing your loft stairs exceptionally easy •Fully manufactured by us in the Midlands •Free Survey •‘Bison’ loft ladders, only available from us •Full 5year parts & labour guarantee •The only product available with a safety handle in the loft •Fitted in approx 2hours (including making theopening larger) • NEW:Now available in white no painting required* • NEW:Now complete with “comfort” feet to protect carpets and wooden floors. NEW:Long SafetySide Handles We also fit loft flooring, lighting and roof windows. Over 15,000 Installations Safety hand rail Unique to Bison Price includes twohandles inside the loft &one side handle £450 Specialofferfor limitedtime £335 (inclVAT) QuoteRefXX Price includes twohandles inside the loft andone side handle www.bisonloftladders.co.uk The Loft Stairs Company, Unit 60, Atcham Industrial Estate, ShrewsburySY4 4UG Freephone 0800 389 1281 or mobile friendly 01743 761499 *At extracost. All major credit cards accepted Access your loft safely and easily with Bison loft stairs. AHydraulic strut mechanism requiring just fingertip control makes opening and closing your loft stairs exceptionally easy •Fully manufactured by us in the Midlands •Free Survey •‘Bison’ loft ladders, only available from us • Full 5year parts &labour guarantee • The only product available with a safety handle in the loft • Fitted in approx 2hours (including making the opening larger) • NEW:Now available in white no painting required* • NEW:Now complete with “comfort” feet to protect carpets and wooden floors. • Price is for afitted unit up to 24 inch es wide and in aplaster board ceiling £450 Special offer for limited time £365 (inclVAT) Quote Ref XX Over 20,000 Installations The Loft Stairs Company, Unit 60, Atcham Industrial Estate, ShrewsburySY4 4UG Freephone 0800 389 1281 or 01743 761499 *At extra cost. All major credit cards accepted
pair
Supporting
honoured
Report by MatthewPanter
Inspired –KatieFoster
NEWS THURSDAY,NOVEMBER 24,2022 | TELFORDJOURNAL 5
Stalwart–StuartLambie
Therewill always be lessonswecan learn
Therewillbemanyfamiliesin TelfordwhoarerelievedbytheGovernment’s decision in theAutumn Statementtoincreasebenefitsand pensionsinlinewithinflationand to increase theminimum wage to £10.42
Therewasalsoextrafundingfor educationandfortheNHSandthe energypriceguaranteeschemewas extended.
Itis,however,nosurprisethat workingpeopleonaverageincomes arefeelinghithardbytheeconomic crisis.Livingstandards arefalling andtaxation is at thehighest it’s beenfor70years.Weareinexcep tionalcircumstances
TheLabourPartyseektoblame thecrisisonthe Government,but theyarewrongtodosoandthey knowit.Yes,theConservativeshave beeninGovernmentforthelast12 years,butwehavejustexperienced aseriesofunprecedentedglobaleconomicshocks,forwhichnoeconomy couldbeprepared
Thefinancialcrisisin2008led toprolongedrecessionthattookus adecadetorecover.AConservative Governmentachievedthatrecovery, restoringgrowthandconfidenceto theeconomy.Thenin2020camethe pandemicandtheenormousfinan cialresponseneededtosupportfam
WORKINGFORYOU
WithLucy Allan MP
ilies andbusinesses;national debt soared.ThewarinUkrainefollowed on,immediatelyforcingupglobalen ergyprices,aswellasdrivingupthe costofotherstaplessuchasgrain. Asamajorimporterofenergy,there wasnowaywecouldavoidinflation, nowatitshighestfor40years,nor therecession whichhas followed Onceagainfamiliesandbusinesses areneedingunprecedentedGovernment support. Many Governments tacklingtheseglobalproblemsare beingforcedtoincreasetaxes to fundsupportschemes
ThemeasurestakenintheAutumnStatementaretoughmeasures foraConservativeGovernment to take.PeoplewilljudgethisGovernmentonitsresponsetothesemultiplecrises.Isitfair,isitnecessaryand doesitdothejobofrestoringgrowth andconfidencetooureconomylong term?Therewillalwaysbelessons to be learnedwiththe benefit of hindsight,butIbelievethathistory willshowthisGovernmentdidwhat wasright
Deckingthe halls
TALKINGTELFORD
WithRob Smith
It’sthattimeofyearagain:the periodofnotbeingabletomovefor aChristmaslightsswitch-onsome whereinTelford
Theendofspookyseasonisthe unofficialstartinggunforChristmas preparation,andwithinafewweeks townsalloverShropshirearedeclaringthefestiveperiodopenwiththeir owncelebratoryevents.Telfordbeingwhatitis,thatmeansindividual townsandcommunitiesallgettheir ownchancetoholdabigswitch-on.
Wellingtonwasoneofthefirstto gettheballrollingthisyear,withthe maineventheldlastSaturday.Iam onlyslightlyembarrassedtoadmitI missedthememobeforeIjusthap penedtobeinthetowncentre–as someonewithoutayoungfamilyor anabundanceofChristmasspirit,I hadn’tmarkeditoutinmycalendar
ThefirstIheardofanythingout oftheordinarywasturningoutof thetunnelfromthebusstationand noticingthefirststrainednotesof musicoverthe PA system.Then I turnedanothercornerandspotted theChristmastreeinthesquare–andgiantversionsofMickeyMouse andtheElfonaShelftoy.Notone
forwhomChristmas cheercomes readily,myfirstinstinctwhenIspot tedthe6ftelfwastotryandavoid makingeyecontactwhileleavinga wideberthinthehopesofnotbeing offeredaseasonaldealonmybroad bandorsimilar.Butasmallgaggleof nearbychildrenhadnosuchreservationswhentheycameacrossthese giantmascots
Thepint-sizedrevellersshrieked withdelightwhentheyspottedgi antversionsofthetoys they have no doubt been familiar with from ayoungage.They strode rightup tothemascotsandtriedtoengage theminconversation,thesubtleties ofwhichImissed.Thetoysweren’t
greattalkers,but seemed to keep thechildrenentertainedenoughby stealingtheir hats andposingfor photos
Itwasallgreatfunanditwill makefondmemoriesforthosechil dren–andfornothingmorethanthe priceofaday’scostumehire.Ididn’t tryandgetintoSanta’sGrotto(I’m notsureIwouldhavesatisfiedthe entrypolicy)butthelongqueuefull ofexcitedfamiliesseemedtosuggest theChristmasspiritisaliveandwell inWellington
Andifyou missedout?Not to worry,you’reinTelford-Ironbridge, MadeleyandDonningtonareallhav ingtheirswitch-onsthisweekend
I ofWgh We k nd Epdf s eo Wigh Hou ePar y E.pdf ISLE OF WIGHT WEEKEND Departing Fri 24 Feb‘23 Letuswhisk youaway to the Isle of Wight fora perfect weekend to relaxand rejuvenate.Tailored forthose who seek adventurebythe sea and have adesiretoexplore! With an included visit to the historic town of Newport and an optional ‘Round the Island’ tour Your breakincludes Return coach travel and ferry crossings from Telford 3nights at theChannel View Hotel, Sandown with dinner &breakfast Entertainment on one evening ExcursiontoNewport Optional excursion to Cowes, Yarmouth &Ventnor (£10pp) 4Days by Coach only £149.99 Single Supplement £45 ISLE OF WIGHT HOUSE PARTY Departing Fri 10 Mar ‘23 Treatyourself to abreak away to the Isle of Wight with its dramatic whitecliffsand pretty resorts, and be prepared forfun and amusements by the bucket (and spade)load! There’salsoafabulous drinks offer to enjoyatour hotel on this lovely short break. Your breakincludes Return coach travel and ferry crossings from Telford 3nights at theHolliers Hotel, Shanklin with dinner &breakfast Happyhour beforedinner every evening Entertainment some evenings ExcursiontoNewport &Ryde Optional excursiontoCowes, Yarmouth &Ventnor (£12pp) 4Days by Coach only £199 Single Supplement £45 in association with Formoreinformation or to book, please call: or visit online at: 033numbersare free within inclusiveminutes packages otherwise standardrates apply Operated by Just Go HolidaysLtd.Coachpackage holidaysand shortbreaks aresubjecttoJustGo! Ho idaysterms and conditions. Your booking is protected by Bonded CoachHolidays (BCH)and the Association of BondedTravel OrganisersTrustLimited (ABTOT); thisis a government approvedconsumerprotection scheme.Tours offeredsubject to availabilityand government guidelines. Errors and omissions excepted. Pricesper person, basedontwo people sharing adouble/twin room.Callsto033 numbersare free within inclusiveminutes packages otherwisestandard ratesapply. 03332 342 529 justgoholidays.com/WOL Quote WOL Your weekly newspaper WOL_2022-11-21_TelfordJournalSeries_16x4(1)_Just ONE STOP ROOFING TheFlatRoofSpecialists • Rubber,Fibreglass &Felt • Re-pointing &Chimneyrepairs • Fascias &Guttering TAKE ADVANTAGE OFOUR OFFER ReplaceyourflatroofMakingEPDM (Rubber)yourchoiceforalong lasting,weatherproof&highslip resistantmembrane,withalifespan of50years. GETITFORTHESAMEPRICE ASFELT whichonlycarriesa10yearguarantee ReplaceyourflatroofwithEPDM (rubber)andaddaskylightor lantern,givingextralighttoyour roomstarting. FROMASLITTLEAS£400! Insurance back guaranteed offered Family business est. 35 years All repair work undertaken. HomeproInsurance Backed Guarantee FREEPHONE 0800 0855277 •07538 471274 www.onestop-roofing.co.uk onestoproofinguk@gmail.com
OPINION TELFORDJOURNAL | THURSDAY,NOVEMBER 24,2022 6
Christmascame toWellington lastweekend
VOTED MOBILITY RETAILER IN THE UK NO.1 www.ableworld.co.uk Voted UK’s no.1 Mobility Retailer 2019, by Access &Mobility Professionals NHS Vouchers Welcome Where Applicable *VAT Exempt -Ask for Details MRP- Manufacturers Recommended Price Previous Price -Sold for 28 days in onths at our Nantwich Store Insurance/Warranty is arranged by Ableworld UK Ltd and provided through Mark Bates Ltd t/a Premier Care, Premier House, Londonthorpe Road, Grantham, Lincs, NG319SN who are authorised and regulated by the Financial Conduct Authority. FRN308390. Calls made to this number may be recorded for monitoring and quality purposes FREEPH 0800 54 STAIRLIFTS RECONDITIONEDSTRAIGHT FROM £495 NEW STRAIGHT FROM £1495* NEW CURVED FROM £3295* £369 FROM ONLY RISER RECLINERS 3LUCKYCUSTOMERSWILLWIN BACK THE COST OF THEIRSTAIRLIFT Heated LapBlanket FoldingWooden Tray Strolley TrolleyJolly Boot Scooter Sock Aid SashaRiser Recliner SAVE £21 GIGREAT FT IDEA • Helpstoimprove circulationalleviates musclepain • Ideal forkeeping cosy on cold nights • Wipe-clean finish on table topfor convenience • Allowsyou to enjoy food &drink in bed HALF PRICE GREAT GIFT IDEA GIGREATFTIDEA SteelTri Wheel Walker • Offers excellentcomfort • Features anti-entrapment sensors • MaxUserWeight: 18 stone • Ideal fortransferring meals &otheritems aroundthe home • Clip on/off traysfor easycleaning • Fullyheightadjustable to suit the users needs • Dismantles into • MaxRange:10m • MaxUserWeigh e WITH BUILTIN ANTIENTRAPMENT SAVE £150 SAVE £40 SAVE £200 INCLUDES FREE BAG • Offers excellentmanoeuvrability • Includesa bag, basket andremovable tray • Reducesthe need forbending • Lightweightand easy to use SAVE £10 CRACKIN’PRICE £499* CRACKIN’PRICE £599* CRACKIN’PRICE £29.99 CRACKIN’PRICE £49.99* CRACKIN’PRICE £2.99* * * ST OFSTAIRLIFTS TENFITTED WITHINDAYS DELIVERED CRACKIN’PRICE £59.99* CRACKIN’PRICE £14.99 HALF PRICE
It’s approaching10 years since JasonFoxparkedupinacliff-topcar park,onthebrinkofendinghisown life
“Iwashavinganightmareofa day–couldn’tsee thepurpose of anything,workwasn’tgood,I’dhad amassive argument,and just felt ‘What’sthepoint?’,”herecalls
“I’dbeeninthemilitaryfor20 years.Iusedtobeawesomeatsome thing,andwithoutthatIfeltmaybe my usefulness on theplanetwas over. ”
Duringthat20-yearcareerinthe MarinesandSpecialForces,Foxexperienced“high intensitywarfare” andsaw colleagues killed andinjuredonaregularbasis.
Buthe’dlosthis‘militarymojo’, andaftercountlesstherapysessions, hecametoacceptthatadiagnosisof PTSDandmedicaldischargewasthe ‘leastworst’option
Thrustbackintocivilianlifeat theageof36,forthefirsttimesince leavingschool, themundanity of everyday living –booking dentist appointments, filingtax returns,
By Andy Richardson
livingfulltimewithapartner–was abiggerchallengethanthelifehe’d known.
Withoutthe brotherhood and supportnetwork providedbythe militarywayoflife,Jasonstruggled tofindanewidentityandthatstrug gleledhimtothatclifftop
“Lookingback,Idon’tknowwhat stopped me,” the46-year-old said “ButIguessIjustwasn’tquiteready togiveup
“Ihadawordwithmyself,real isedthingshadtochangeandthat momentofhonestywasarealdefin ingmoment.”
Fromthere,Jason‘gotridofneg ativity’ in his life,and ‘went on a journeytofindtherightpeople’to helphimmoveforwards
Fighting back from thebrink, Foxfoundanewpurposeanddrive –partlythroughfoundinghismental health charityand partly through hisTVcareerafterbeingapproached asoneoftheexpertsforSAS:Who
DaresWins,ashowhe’sbeenwith sinceitlaunchedin2015.
Ithasalsobroughthimfameand thechancetotellhisstoryandhelp others,withaspeakingtour–Life atTheLimit–comingtovenuesin ourregionearlynextyear.Foxand theteamweren’tsoldontheorigi nalideaofcondensingtheprocessof SpecialForcesselectionintoaweek’s filming.Instead,theyofferedtouse elementsofthatselectionprocessto createauniquecoursethatwould drawoutthekeyattributesneeded forSpecialForcessuccess–witha largefocusonphysicalandmental strength
“Initially,SAS:WhoDaresWins wasabitofanexperiment–noone knewiforhowitwouldwork,orhow peopletakingpartwouldrespondto it,”hesaid
“It’sbeenphenomenaltoseehow both civilians andcelebrities have thrown themselves into theshow overtheyears.Iamsurprisedathow bigit’sbecome,andveryproudofit too.What’salsobeensurprisingis whatI’velearnedfromtheexperi
ence–nottojudgepeople,togive peopleanotherchance.Anditdoes helptofillthe‘gap’leftfrommilitary life.Whenwe’reoutfilming,there’sa teamofpeopleallworkingtogether togetajobdoneundersometough conditions.
“It’snothing like as toughasI wasusedtointheSpecialForces,but wearestillworking24-hourdaysin extremeenvironments, pullingtogether,challengingourselves.”
That’s somethingofanunder statementwhenyouconsidersome ofFox’sanecdotes…Havingapistol heldtohisheadbyPabloEscobar’s personal hitman,helicoptercrash es in unnamedwarzones, or gun battleswherethe30-strongsquad is surrounded by 200-plus enemy fightersand ‘one of theladsdies straightaway’.
Likemanyyoung men, Fox reachedthe end of his school life andfoundhiswayintothemilitary Hisdadwasanex-Marine,soithad alwaysbeenapartofhislifeandhe knewtheoptionwasthere.
Raisedona1980scouncilestate
in Luton, teenageFox wasleaning towardsthewrongsideofthetracks andrecognisedheneededtomake somechanges.
EnlistingafterhisGCSEsseemed afairlyobviouschoice.
“I hatedschooland wanted to leavehome,andthequickestwayto dothatwastoenlist.Ijustwantedto seemoreoftheworld,”heexplained, drawntothechancetogetoutthere and‘docoolstuff’,ashedescribes muchofwhatfollowed.
“I’vehadsomeincredibleexperi ences–somegood,somebad–andI genuinelyfeelhonouredthatpeople wanttohearaboutthem,”hesaid “Frombehind-the-scenesanecdotes of filming,some hilarious, others brutal;andwhatit’sreallylikewhen youcomefacetofacewithnotorious killers, drug cartels, Mexicanwar lordsandhitmen,thisisanoholds barredaccountofmylifetodate.
“LifeAtTheLimitisaveryhonest accountofwhathasbeenalongand difficultjourney.”LifeAtTheLimitis playingatTelford’sOakengatesTheatreonFebruary2.
47NewStreet,WellingtonTF11LU FREEParkingParkingatrearaccessedviaWellingtonbusstation Forallofyourmobilityrequirementsvisitusat: •MobilityScooters•Stairlifts •RiserChairs&Beds •Wheelchairs&Walkers •BathingAids •Service&Repair CallFree 08009991925 Getyour Scooter Winter ready Book in for your service with us now! Ex-soldier shares theincredible true storyofalifespent rightatthe limit
Jason Foxenjoyeda 20-yearcareerinthe Marines and SpecialForcesHeisone of theexpertsforSAS: WhoDares Wins
FEATURES TELFORDJOURNAL | THURSDAY,NOVEMBER 24,2022 8
Celebsputthrough their paces
BlackFridayscam warningisissued
ABlackFridaywarningtobeawareofscamart istshasgoneoutfromafinancialexpert Whilsttheremaybesomegreatbargains,Shrews bury-basedJustCreditUnioniswarningagainstgettingcaughtbyonlinescammers.
Thefirmalsopointtothetemptationtooverspend andthatmanydealsmaynotbeasgreatastheyfirst appear.“BlackFridayseesafrenzyofdealsanddis counts,butalsoahugeriseinfraud,”saidSteveBar ras,JustCreditUnionbusinessdevelopmentofficer
JustCreditUnionhasputtogethersomehintsand tipstohelppeopleavoidgettingcaughtout.Keyac tionsthatcanbetakentostaysafe.
Research thesellertocheck they aregenuine; sticktotrustedwebsites;keepyourpin,passcode andpasswordsasecret;avoidenteringcarddetails onsharedandpubliccomputers.
College offering T-levels
TelfordCollegeoffersalivelyandsupportivecam pusthathasbeenpurpose-builttoofferawiderange ofcoursechoices–includingacademic,vocational,ap prenticeshipsandmore.
T-levelcourseswillbeofferedinSeptember2023 Thenewvocationalqualificationsaretheequivalent tothreeA-levelsinUCASpointsandrecognisedbyall universities
Initially, thecollege will be offering T-levels in health,scienceanddigital,whichwillexpandinSep tember2024
TelfordCollege’sapprenticeshipteamiscontin uouslynetworkingwithlocalemployerstogivestu dentsachancetogainvaluablequalificationsalong sidereal-worldworkexperience
Part-timeadultlearningcoursesareofferedfor thosewhofancyacareerchangeormaynothavehad theopportunitytodosowhentheyfinishedschool.
Coursesrangefromlevel2-5,andincludeaccount ing,education,hairdressing,healthandsocialcare andhumanresources.
Ifyoucan’tordon’twanttophysicallygotocol lege,thereareseveralshortcoursesthatcanbedone onlinewhereyouwillgainalevel2or3qualification
Thecollege’snextopeneventisonWednesday,No vember30,from5pmuntil7.30pm.
TheadultopeneventisonSaturday,December10, from10amuntil12.30pm.Tobookaplace,seewww telfordcollege.ac.uk/join-us/open-events/our-open events/
Ifyou’dpreferamoreindepthlookatthefacilities TelfordCollegehastooffer,orifyou’refeelinganxious aboutstartingcollege,youcanalsobooka1:1tourby emailingmarketing@telfordcollege.ac.ukorbycall ing01952642200
Amarathon effort
Ashopmanagerhasraised£2,000for charityaftercompletingsevenmarathonsin sevendays
IanFord,manageroftheUp&Running shopinShrewsburytookonthechallengeto raisemoneyforthecompany’schosenchari ty–HeartResearchUK
HestartedonNovember5,andcovereda totaldistanceof183.4milesoversevencon secutivedays.Clockingupthefinalmiles, IanarrivedbackattheUp&Runningshop in Shrewsbury welcomedbackbyfamily, friends,colleaguesandlocalresidents.
Todate,witharisingtotal,Ianhasraised
£2,000forHeartResearchUK,whichwillgo towardsfundingvitalmedicalresearchinto theprevention,treatmentandcureofheart disease.
Oncompletinghismammothtask,Ian said:“Thisisprobablythehardestchallenge I’veeverundertaken–yet!Daysixwaspar ticularlydifficult,withtheachesandpains reallysettingin,butthethoughtofthegen erouscharitydonationskeptmegoingwhen Ineededitthemost.
“I’mdelightedtohaveraisedsomuchfor HeartResearchUKandwouldliketothank everyonewhohaskindlydonatedsofar.”
Morethan10,000ticketshavealreadybeen soldfornextyear’sCampBestivalatWestonPark, saystheorganiser
FormerRadio1starRobdaBank,whoorgan isesthefour-dayfamilyfestivalwithhiswifeJosie, saiddemandhadbeenhugefollowingthesuccess oftheWestMidlands’firstCampBestivalwhich wasstagedinAugust.Theline-upfornextyear’s eventwillincludeEurovisionstarSamRyder.
Paynothing fora year. No deposit. Interest free.
Black
Frid
0% APR REPRESENTATIVE. CREDIT SUBJECT TO STATUS DEFERRED INTEREST FREE CREDIT AVAILABLE ON ALL ORDERS OVER £500 IN-STORE ONLY. SUBJECT TO STATUS ALL BALANCES MUST BE PAID BY OCTOBER 2023 OR BY DATE SPECIFIED AT THE TIME OF PURCHASE WRITTEN DETAILS ON REQUEST. OFFER NOT AVAILABLE ON CLEARANCE ITEMS OR IN STORE CONCESSIONS THIS OFFER IS SUBJECT TO AVAILABILITY AND CHANGES WITHOUT NOTICE
HUGE STOCKS FOR QUICK DELIVERY At least 25%off Everything ENDS MONDAY | COUSINSFURNITURE.CO.UK NEWS THURSDAY,NOVEMBER 24,2022 | TELFORDJOURNAL 9
DUDLEY
| BIRMINGHAM | NEWCASTLE-UNDER-LYME | SHREWSBURY
Festival tickets aresnapped up
IanFordcompletes hischallenge
Town settostepintoChristmas
Families areexpected to flocktoNew port town centre this Friday forawhole host of festivefun.
TheChristmas lights will be switched on at 6pminwhatis considered oneofthe town’s biggest annual events anda traditionalline-up of festive en tertainmentisplanned
Theeventstartsatapproxi mately 4pmand will rununtil around 8pm.
Winner
Thelights will be turned on by thewinnerofthe Newport Town Council’sannualChristmascardcompetition,Town Mayor Councillor IanPerry andFatherChristmas himself
Theofficialswitch-on of thelightswill take placein thetownsquareand will be preceded by theChristmas Parade whichleavesthe town councilofficesatthe Guildhall at around 5.50pm
Theparadewill be ledbythe SalvationArmyBand, followed by Santaand hissleigh,the Mayor,the competitionwinner andcastmembers from Nova Panto’s‘Beauty &the Beast’
“The switch-onevent is aboutbringingthe community together to celebratethe count-
down to Christmas with their friendsand family,” said Mr Perry.
“Weare hoping that lots of peoplewillcome along, take part andjoininthe fun.”
St.NicholasChurch will host theirtraditionalChristmas carol serviceat6.30pm after theofficialturn-on andresi dents andvisitorsare invitedto attend
NOVAFMwill be providing musicinthe town square Followingthe lights switch on at 6pm, Santawill be outside St Mary’s Church in hissleigh, courtesy of Rotary Lite,and will hand outsweetstochildren at theevent.The reindeer will be stationed nearby at Butter Cross, andchildren will be able to have theirphotographs taken with them
NewportEventsCompany is holdinga ChristmasMarket alongStMary’sStreet,where a range of stalls selling fine food, Christmas gifts, candles, confectionery andvarious festive refreshments will be on sale to temptvisitors.
Thereis also expected to be a smallfun fair in LowerBar as part of theChristmas Market entertainment.
Celebrate Christmas
businessestoo. CallintoourofficeontheHighStreetorspeaktoone ofourTeamon01952281060. Furtherdetailsareavailableat www.ClarkesLaw.co.uk
Choose us foryour Christmasparty LilleshallHousehas it all; great food, beautiful surroundings, luxurious overnightstays and just therighttouchofglamour! Party nightsare availablethroughoutDecember and include adelicious 3course meal within our beautiful Chapters restaurantfollowedbyafestive disco–for just£33pp LunchwithSanta LilleshallHouse&Gardens,NearNewport,ShropshireTF109AT Lilleshallhouseandgardens Lilleshallhouseandgardens To makeanenquiryorbooking, visit lilleshallhouse.co.uk or call us on 01952 603003 Taking placeinthe stunningLilleshall House, this festivetreat includesa 2course mealand agiftfor all children over3yearsold.It’sthe perfectday formaking festivememoriesand being together at this specialtime of year Theprice is £22.50 foradults, £14for children over3yearsold and under3’s eatFREE! CHRISTMAS &NEWYEAR SORTEDFOR £100 LARGELUXURYHAMPER £100 2-2.5kgTurkeyCrown|1.5kgBeefTopside 2kgGammonJoint|1.5kgPorkLoinJoint 500gStreakyBacon|500gPigsinBlankets 1PorkPie|1JarofGooseFat|GourmetStuffing Alsoavailabletoorder: ChristmasPoultry–WholeTurkeys,Gees SuperRoasters,GalaPies,ChristmasPorkPies, SpecialityPiesandCookedMeats Tel: 01952 583232 Messageuson £20DEPOSITREQUIRED MoonshineandFugglesis afamilyrunbusinessbased inpicturesqueIronbridge, Shropshire. Foundedona‘TrueLove’of Gin,Whisky,RumandLocal Alesalongwithotherspirits andalcoholicdrinks. Weaimtoprovideyouwith trulyexcellentserviceand greatproductchoice. 6TheSquare,Ironbridge,Shropshire,TF87AQ 01952433626 |www.moonshineandfuggles.com @moonshineandfuggles |@moonshineandfuggles SALES, SERVICE, REPAIRS& ACCESSORIES Bike Tek, TheSquare, Newport, TF10 7AG www.bike-tek.co.uk •01952 825795 NOW OPEN in Wellington Sonia welcomes you to the new salon Brows. Waxing. Facials. Eyebrows. Massage. Hair& Make Up Appointments and Walk ins available OPENING OFFER UNTIL END OF NOVEMBERLIKE AND SHAREMYPAGE EYEBROWS HALF PRICE 15aMarket Square, Wellington, TF1 1BU 07454 136884 ClarkesSolicitorsareproudtobeassociatedwith NewporthavinghadapresenceintheTownformany years.Asafirm,webringlegalexpertisetolocal residentsandbusinesses,offeringfriendly, professionaladviceinall areasoflaw Onapersonallevel,ourstaffeitherliveintheTownor innearbysurroundingareasand,assuch,uselocal
���� ����������� �� ������ ������ ���������� ���������������������� ������ ������� ������ ������� ��������� �������� ��� �� ����� ������ ��� ����� ����������������� ���� ��������
CHRISTMAS TELFORDJOURNAL | THURSDAY,NOVEMBER 24,2022 10
Crowds gather at apreviousswitch-on eventinNewport town centre
www.telfordcollege.ac.uk 01952 642200 I Your Career StartsHere... Scan to Register UPCOMING OPEN EVENTS: Wednesday 30th November 2022 5pm -7.30pm Adult Open Event: Saturday 10th December 2022 10am -12.30pm Or Book a1:1 Tour
Curseofitchy feet is always keepingmeonthe move
Herselfisconstantlymoaning atme“can’tyousitstillforfivemin utes?!”whichIfindsomewhatdis concertingasIsuddenlyrememberedaveryimportantjobneeded doinginmyworkshop-shed.
Asforitchyfeet,it’strue,and nothelpedbytheintrusiveTVadvertsbreakingupyourconcentra tion,Ihavetogetup,whichmeans avisittotheArmitageShanks,or getabrewgoing.Unfortunately
it’sthecurseofthenowretired, ex-workingman. Shethrowsa real stropas I ambleinwhile sheisimmersed inherTVsoaps,“ForGod’ssake sitdown”.Ican’t,it’simpossible, itreallyis.EvenwhenIameyeball-deepintoagoodbook,eventuallyafterabout20minutesor so,Ihavetostop,standup,walk aboutforabit,raidthefridgeand thenresumereading.It’sacurseit
Mistakes should notberepeated
ThePrime Minister’s talk of “difficultdecisions” will remind manyinlocalauthoritiesofsimilarcommentsmadebackin2010 whenausteritywasunleashed.
Governmentcannotrepeatthe mistakesofausterity.Duringthe decadeofcutsafter2010,itwas thepoorestandmostvulnerable inourcommunitieswhosuffered most
Someofthepoorestareashad lesstospendthantheirhugelevel ofneed.Fundingsystemstolocal authoritiesarenotfitforpurpose andtheirorthodoxmoneysystem doesn’tworkforall.
Vitalworkmusttakeplaceon significanthealthinequalities.The Covidpandemichasmassiveim-
plicationsforpoorerareas.Waitinglistsaregrowingandstagnat ingforlocalservices
Cuttingimportant preventa tive services passes problems down thelinetoacute services, whereworse outcomes forlocal peoplearemoredeadlyandcostly
Localauthoritiesareverydifferent places to 2010,thanksto austerityanddisastrouspolitical incompetence from both main parties.
Wemusthavegreaterinvest mentinpoorerareasandstopunevenfundingallocationsonceand forall.Grantfundingtothepoorestlocalauthoritiesmustincrease.
Nameandaddress supplied
reallyis,thereisnoknowncure, becauseitdoesn’tmatterwhatyou sayaboutretirement,thetruthis, youwillbeworkingharderatbe ingamanofleisure,thanyouwere goofingoffwhenyouwerework ingforaliving.It’snothelpedby theconstantshoutsof“Thisneeds fixing-replacing-painting”.Isthere noendtothispurgatory?
Nameandaddresssupplied
Requests at Christmas
DearFatherChristmas,Uncle NorbertandIrealiseyouarevery busyatthistimeoftheyear,but aswehavebothbeenverygood “boys”,wewonderedifyoucould arrangefor thefollowing “presents”tohappenin2023
Canyoumakesureinthefuturethatallthewritingonfood packagingisbigenoughsothatit canactuallyberead!
And,whileyouareatit,that anyinstructionsonhowNOTto blowupyournewtellyareclearer!
Canyou stop anyonebeing interviewedonthetellyfromansweringaquestionwith“Abso lutely!”And,whileyouareatit, stop people whodeliver food to yourtablefromsaying,“Enjoy!”
PeterSteggles,Shropshire
French system is waytogo
Economicdisaster.Nopointin statingtheobvious!
No pointinblaming Brexit, LizTruss,orindeedtheverylarge numbersofpeoplewithdafteco nomictheories
Theonlythinglefttospeculate onishowwecanrestructurefor thefuture.Howcanwebuildavi ablefoundationonwhichtoplace thefutureoffinancialservicesand looktopreservingaviableherit
agefor future generations? One thingthatdidstrikemewasthe antiquatedstructureof‘Oxbridge style’qualificationsofourpoliti cians
Forexample, Liz Trussgraduatedinpolitics,philosophyand economics.Obviouslyacatastrophewaitingtohappen
Iwouldspeculatethatcurrent disciplinesneedrestructuringto theFrenchsystemwhichismore
intensebothinconceptandapplication
TheFrenchevencreatedaTV series called“ecoledepouvoir” whichroughlytranslatedmeans “schoolofpower” so they have actually translated conventional economicdisciplineintoasubject initsownrightandregarditas such
RobinLloyd,Shropshire
2022 Little Helpers SANTA’S LITTLEHELPERS PHOTOCOMPETITION PRIZEDRAW AllchildrenwhoappearintheSanta’s LittleHelperphotospecial,willbe enteredintoaprizedrawtowinoneof five£50SmythsToysGiftCards Goodluck!!! PHOTOSUPPLEMENT Allthephotossubmittedbytheclosing date,willbeshowcasedinSanta’s LittleHelpersphotospecialwhichwill beprintedintheShropshireStaron Wednesday,December72022. NOTE:AphototakenonyouriPhoneorAndroid phoneshouldbeofsufficientquality ENTERNOW Wearecallingonallparents/guardianswith childrenaged10yearsoldandundertosend inafestivephotooftheirlittleones. GetintotheChristmasspiritearlyandsendin apictureofyourchildinafestivecostumeor outfit,itcouldbeSanta,aLittleElforReindeer thechoiceisyours!! EntriesareopenuntilSunday,November27 2022.Formoredetailsandtosubmityourphoto goto:santaslittlehelpers.shropshirestar.com �������� ����������� ���� ������ ��� ���� ��������� �������� ��������������������������� ���� ����� ���� ������� ���������� ������������������ ������ �� ����� ������ ��������� ������� ���� �������� ���� ������� ����������� ������������������ ��� ������������������ ����������� ������ ������������������ ���������� ���� ����������� �������������������� ���� ����� ������������ ������ ���������������������������� ������������� ��������� ���� ��������� ����������� ������������������������������ ������������� ����������� �������� ������ ���� ��� ���� ����� �������� ���� �������� ���� ������� ������� ������� �������������� ������������ ������������������ ���������� ������ ������ ��������� ������� �� ������ ���������������� ������� ������������� ������ �������� ������� �� ���� �� ��� ������������ ������������ �������� ����������������� ������������ ������� ������ ������������� �������������� ��������� ����� �������������� ������ ���������� ���� �������� ������ ������� ���� ������ ��������� ��������� ���������������� ������������ �� ���������� �� �������� ��������� ������ �� ���� ���������� ���������� ����������� �������� ���� ����������� �� ��� ������ ���� ������� ������� �������� �� ���� ������ ���� ��������� ���� �������� ���� ������� ������ ���� �������� ���� ������� ������� ������� bookanad.shropshirestar.co.uk BOOKED FREE SOLD £50
LETTERS TELFORDJOURNAL | THURSDAY,NOVEMBER 24,2022 12 Code of Practice: Our policy is to correct errors as soon as we can. The Journal adheres to the Editors’ Code of Practice, which can be seen at www. ipso.co.uk. If you areunhappywith the accuracy of astory, write to The Editor, TelfordJournal, Midland News Association, 51-53 Queen Street, Wolverhampton, WV1 1ES. If we cannot reach aresolution contact Ipso at complaints@ipso.co.uk or by post at Ipso, c/o Gate House, 1Farringdon Street, London, EC4M 7LG
By email: daniel.morris@mnamedia.co.uk By post: Readers’ letters Midland News Association 51-53 Queen Street Wolverhampton WV1 1ES Letters must include afull name and address. The Editor reserves the right to condense letters. Distribution
experiencing delivery problems with the TelfordJournal? Get in touch with our customer service team today. Email: ssstarservice@shropshirestar.co.uk. Please include your name, address, postcode and contact number or call freephone 0800 146540 Monday to Friday 10am to 4pm (Callback service available).
GETINTOUCH
Areyou
BluWith Dogs Trust
Name:Blu Breed:Pugcross Age:8
Bluisachirpyeight-year-oldPug crosswhoisonthelookoutforaloving foreverhomewherehecanrelaxand enjoylife.
Bluisfairlyactive andenjoysa gentle potter in thegreat outdoors soaccesstoagardenandquietwalks
wouldhelpthiswonderfulchapsettle intohisforeverhome.Bluenjoysfuss butonlyonhistermssowouldbene fitfromahands-offapproachinitially untilhehasbuiltabond.Hehaslived withanotherdogpreviouslyandcould livewithanotherdogagain.
IfyoucanofferBluacalm,loving, adult-onlyhomewherehecanrelax, please go to https://www.dogstrust org.uk/rehoming/tofindoutmore.
LYNNE SMIT URCHSTOKE £300 2ND - ALICE PHOTOCOMPETITION SOPHIE DEAN, SHAWBURY £500 1ST - MILO , RE £200 3RD - TERRY
FEATURE THURSDAY,NOVEMBER24, 2022 | TELFORD JOURNAL 13 REGGIE
MEETTHEWINNERS
Therehas been an overwhelming responsetothe Shropshire Star Pawtrait Pets competition2022. With 453petsshowcased,the hunt wason to find this year’s most popular pet. Nearly 204,000votes were received andcounted, proving ittobeanextremely popular competition Thewinner, takingthe crownofthe Shropshire Star Pawtrait Petof theYear2022 is Milo thecat,who liveswithSophie Dean in Shawbury.She receives thetop prize of £500 Congratulations! In second place, taking home £300 is Lynne SmithfromChurchstoke whonominatedher catAlice Finally,inthirdplace, winning £200 is Indie Pugh the proudowner of TerryArthurPugh thehamster from Shrewsbury Thank youtoallthe participantsinthis year’s competition andcongratulations again to our top threewinners, Milo, Aliceand Terry.
Reggieisafour-year-oldLakeland Terrier who enjoys theoutdoors, swimming,climbing rocks and treesandloves hisfamily,saidownerThomasPrice.Petofthe Weeksubmissionscanbesentto daniel.morris@mnamedia.co.uk
Gota health
I
fyou’refeelingunwellorhaveno ticedahealthissue,don’twaitforit togetworsebeforeyouseekhelp. TheNHSwantstoseeyouandhelp yougetthecareyouneed Formoreminorproblems,goingto nhs.ukwill help you find your best nextstep.Ifit’smoreurgent,goto111 nhs.ukorcall111(seebelow).
Youcanalsovisitapharmacy.The highlytrainedteamswhoworkinphar maciescanprovidereassurance,treat commonillnessesandgivehealthcare advice.Itsservicesarefree,andmany areopenlateandatweekends.
Pharmacyteamscangiveadviceon minorillnessessuchascoughs,colds andstomachaches Theyalsoknowif youneedtobereferred to your GP practice–andcanevenhelpyouget anappointment
It’sgoodtoknowwhichserviceyou needandhowtoaccessit
NHS 111 ONLINE
If youhaveanurgentbut notlifethreateningmedical problem, NHS 111onlinecanhelp.Accessitonlineat 111.nhs.ukorvia alinkonthe NHS app.Dependingonthesituation,the servicewillreferyoutoalocalservice thatcanassistyou:connectyoutoa nurse,pharmacistordoctor;tellyou howtoget anymedicineyou need; provide self-careadviceor, if severe, askyoutoheadtoin-personurgent caresuchasA&E.
PHARMACY
Apharmacist can give advice on aches,pains,coughsandcoldsaswell ascheckingsymptomsandproviding servicessuchasbloodpressuretests. There’snoappointmentneeded,soif you’refeelingundertheweather,don’t waitforittogetworse–walkin.
GP PRACTICE
When youcontactyour surgery, the receptionistteamwillassessyouand ensure youget help from theright medicalprofessional.Mostsurgeries have ateam of otherhealth professionals,includingnursesandphysios, toensureyougettherightcarequickly
Reena Barai, 44,has been runningher family business, SG BaraiPharmacyinSutton, for18 years, andshe is always happy to helpanyone who comesinfor adviceabout ahealthissue
“Wesee awide rangeof illnesses: coughs,colds,eye infections… but alsoother things that people areworried about, likemoles andunusual bowel symptoms,” Reena explains
“Pharmacists areexperts in minorillnesses andrecognising what we call ‘red flags’ormore serious symptoms.Our family have be in pharmacyfor andwe’ve built linkswithour GP practices an thehospital. So someone come in and Ithink th really need to A&Ethatday, Ican advise them about that.”
“Our team are trainedto respond to symptoms,” Reena adds
“Theyknowhow to askthe right questions and refertoGPs if necessary.
“Wealsospend alot of time talking to our patients about self care, becauseoften you don’t need to seeadoctor and youcan just look after yourself by doing simplemeasures at home –whether that’s drinking lots of fluids,resting or taking paracetamol.”
Communitypharmacies alsooffer services such as bloodpressurechecks, andthe morning-after pill, which is free in s.
in and see sfreeand on’t need appointment,” Reena. st pharmacies aprivate nsultation room, you’re worried out discussing something embarrassing, youcan always asktospeak to one of the pharmacy team in private.”
“Alotofhealthissuesareseasonal, sowemightseecoughsandcolds throughthewinter,andhayfever relatedissuesin thespringorsummer. Otherwise, thethingswedeal withcouldbeany thingfromsportsrelatedinjuriesto diarrhoea, dental problems,earache andissueswith eyesight. It’s so varied,and could relatetoanything fromheadtotoe.
“Patients are oftenunaware of theservices you can getfroma pharmacy That’s whyweare keen toeducatepeople about thewhole
healthcaresystem. Pharmacists haveregularcontactwithpatients and,inaway,weareajackofall trades.Wedeal with so many issues that we know when we need to direct someoneto,say,a doctororanoptician,orwhenwe can deal with it ourselves.
“Patientsoften gototheirGPinitially,butinmany casestheir issue couldbedealt withbyapharmacist There’sno need to make an appointment.
“It’squick,easy and accessible andwewillbe
‘Our team are trained to respond to symptoms’
We deal with so many issues that we know whentodirect someoneto, say,a doctor or dentist, or when we can deal with it ourselves
‘Patients are often unaware of the services we provide’
worry? Getit sorted
IF YOU’RE NOTFEELING WELL, DON’TWAITFOR IT TO GETWORSE. HERE’S HOWTOACCESSTHE BEST TREATMENTFOR YOU
now
Your local pharmacy canhelp you with anything from advice on aches and pains to ablood-pressure check
Sanjeev Panesar, 36, from Pan Pharmacy in Sheldon, Birmingham, is keen to spread the word
able to advise very quicklywhetherwecan helpyou.Ifwecan’t,we willpointyou in the direction of theright person
This
article is part of apaid-forpartnershipwith
BenTuffour owns England’s oldest pharmacy,Reavley ChemistinBurford, Oxfordshire, which openedin1734.
“I would always encourage people to seek adviceattheir pharmacy,”saysBen.“So many of thepeople whocome here formedical advicealready come to us forother things, so they arefamiliar withusand feel comfortableasking
“Patients mayalsoget referred to their pharmacyvia their GP.Theyget aprivate one-to-one meetingwiththe pharmacist, andtheydon’t have to wait foranappointment.
“We’ll always go the extra mile to ensure we’regiving therightcare– and in some ruralareas pharmacieseven provide adelivery serviceto housebound patients
“Ifpeople getintothe habit of coming to the pharmacywith minor illnesses, notonlycan it can save themtime,but it could also mean thattheyget
treatmentbeforethe problem becomesmoreserious.
Wealsodoflujabs, and some pharmacies cangiveCovidboosters too. At my pharmacy wealsoofferarangeof privateservices.” 96% of people canget to their localpharmacywithin 20 minutes bl t d i W l d j b 11.5k communitypharmacies in England 20m Covid vaccinesdelivered at 1,500 pharmacysites 84% of adults visita pharmacyatleast onceayear 4.8m flujabsdeliveredat pharmacieslastwinter Source:National Pharmacy Association &
‘Wealways go that extra mile’
“Wealsohavethe knowledge to referthemonifnecessary, and to theappropriateservice–which again helps everyone.It’s about gettingthe right care at the rightplace.” HM Government
It couldmean they’re treatedbefore the problem turnsinto something more serious
Seeking advice at apharmacy for minor illnesses couldsave youtime
3,000 namesrememberedasTreeof LightAppealhitsimpressive£22,000
By Daniel Morris
This is ourthird list of names thatarebeingrememberedaspart ofthisyear’sTelfordTreeofLight Appeal
RunbythefourRotaryClubsof Telford&District,theTreeofLight enablesthecommunitytoremember theirlovedonesandsupportlocal charitiesoverthefestiveperiod.
Inreturnforaminimum£5donation,namesaredisplayedaround thetreeinTelfordShoppingCentre TheyarealsoprintedintheTelford Journalinbatcheseachweek.
So farinthisyear’scampaign, 1,300applicationshavebeenpro cessed, with 3,000 loved ones remembered anddonations amount ingto£22,000.
SevernHospiceandHopeHouse Children’s Hospices will receive themajorportion of fundsraised. Theremainder will be shared by ShropshireProstateCancerSupport Group,2nd WellingtonScouts,Tel fordAfterCareTeam,Telford&Wre kinYoungCarersServiceandJayne SargentFoundation
Amongthenamesremembered are:
SidneyJohnAdams;GeorgeAdaway;Barry Alcock;Tom Alcock; MaryAlder;KennethAlford;Derek Allder; BernardAllen; CharlesAllen;GeoffreyAllen;Herbert&Olive Allen; LilianAllen; Robert Allen; Anderson;Bernard Archer;Dennis Archer;WilliamArcher;Jack&Nora Aston;Albert&MaryWinifredAt kins;MarthaAtkins;KathleenAus tin.
Brenda& Howard Bailey;Hor aceBailey;KenBailey;Mum&Dad Bailey;PhilipBailey;Barry Baker; Eric&MurielBall;ElsieBarker;Jane &RegBarnes;Percy&IvyBarnes; DeniseBarnsley; Noreen Barnsley; DellaBartlett-Smith;KathBaumber; ChristineBaxter;JohnBayley;Lilian Bayley;FredBaynham;DoreenBed borough.
HildaIrene &PhilipBeddoes; AnnBeech;Mona&Don Beeston; ScottBeeston;AnthonyBengree; FlorrieBengree;CharlesLBennett; Dolly&JackBennett;EricBennett; MaryJBennett;JohnBetts;Iris&Len Bevan;DavidBeynon;GeorgeBey non;LucyBeynon;LilianBick;James Biddulph;Kath&EricBiddulph; WinifredBiddulph;PaulineBiggs.
GeorgeBingham;KennethBingham;WendyBingham;JohnBirbeck; SueBirbeck;AlanBlair;;GaryBlair; ;JackBlakemore;JoanBlinkhorne; DerekBolt;FrederickBould;Pheobe Bould;JoeyBradley;LolBrayne;Pat Brayne;Grace &Mac Bridgwater; George &NoraBright; Margret& JackBrittain.
FrankBrookes;HaroldBrookes; HildaBrookes;RobertBrookes;Ada Brothwood;Gordon Brothwood; HoraceBrothwood;GeorgeBrown; Mabel Brown; TomBrown;David Browning;GrahamBufton; Peter Bunning;Jim &MaisieBurn; Ar chie&DylisBurnett;KeeliBurnett; HeatherButler; Audrey Bystrnski; Karl Bystrnski;Derek Bytheway; Frank&MarionBytheway.
Fred Cadman;Janet Cadman;
TerryCapell; AgnesCarlile;David Carlile; Sandra Carrington; Albert Carter;AndrewCarter; Arthur S. Carter;Colin Carter;Ruby Cart er;Simon P. Carter;JohnCaswell; MaryCaswell;HarryCharles;Vera Charles;LucyChinn;WalterChinn; GavinThomasJohnChurm
Albert Clarke;IrisClarke; Tom &Phyllis Clarke;Peter Clifford; Maurice&IrisClowes;GaryColes; Albert Colley;Alf Collingham;Vio letCollingham;MarieLouiseCollis; LilianCooper;TerryCoppage;Fami lyCowens;DaveCox;;WilliamCox; Winifred Cox; Jean Crookes; Emily &John(Jack)Cruise;EmmaCulling; AlfieCureton.
GertieDarrall;EileenDavey;Alice&BillDavies;AliceDavies;Geof feryAllanDavies;GillDavies;Glyn Davies; Gwen &Ray Davies; Jack Davies;Ken&JoanDavies;Leonard &Gwendolin Davies; PeterDavies; WinnifredDavies;Jack&JoanDaw son; Edwin(Ed)Deakin; Eileen & Charlie(Sonny)Deakin;GertDeakin;Caleb &CarterDixon;Brian Doveston;Mary&Ern Doveston; Annie&Ted Downing; SirFrancis Drake; FrankDuce; Daphne Duck ett;EthelDuckett;EvelynDuddell; HowardDuddell;JohnDuddell;Ruth Dyer
Alek Eaton; ElizabethEaton; Edward Eccleston; Gordon Edger ton; LeeAnthony Edmonds;Grace &JoeEdwards;JeanEdwards;Tom Edwards;AlanElcocks;MarieEllis;
ElaineEllison;CliveEvans;Doris& ArthurEvans;George&MarianEvans;RobertEverton;James&Doris Eveson
DaveFall; ;Betty &Peter Falshaw; May&JohnFarmer; Barry Fenn;GeorgeFernley;DerekFerri day;John(Jack)Fidler;Josephine(Jo sie)Fidler;GrahamFinch;Christine Firmstone;Ed&BettyFitzsimmons; DarranFletcher;JohnFord;JoanForest;VicForest;DaveForsyth;Mar jorieFoulkes;June&BillFrancis; AlanFrench;AlbertFrench;Ethel& GeorgeFrench;MeganFrench;Violet Fylan.
JimGalloway; Edward Garbett; ChristopherGaston;JanGaut;;AnthonyGernon;ErwinGetkahn;Margaret Getkahn; RichardGetkahn; MarjorieGillespie;MaggieGodding; SueGodding;ByronGeorgeGollings; RubySophiaGollings;JohnRichard Goode;VioletElizabethGoode;Lau rence&GeoffGough;PeterRobert Gray;Allen Green; Horace Green; WilliamGriffiths;WinifredGriffiths; JohnFGroucott;PaulGrubert;Alice MableGuest;HerbertGuest;Bertha &CyrilGuy.
ChristopherHackman;Mabel Hackman; AmyHadfield;Harold Hadfield;AliceHail;;Charlie&Al iceHail;CharlieHail;CarolynHale; DavidThomasHall;HarryHanson; LilianHanson; Jean Harbour; Eric Harding; DorisHardwick; Luther Hardwick;Irene Hardy; Graham Harper;WalterHarper;Enid&John
Harris;SamuelHarris;LindseyHarrison;DanielleHarvey.
Betty&GeraldHatch;EricHatch er;AnnieHaughey;Malcolm Hay; MaryHay;;CliveHayles;EsmieHayles;RomaHaynes;EileenHayward; Gladys Hayward; Noah Hayward; Mary Heighway;AndrewHickin; PatrickHiggins;GordonHigginson; MarthaHigginson;GrandadRHig ley;NanHHigley;Peggy&Charlie Hill.
PeterHill;;SybilHitchin;Barry Hodgkinson;WilliamHodgkinson; Robert Hoggins; Donald Holden; AustinHolford;JoanHolford;Harry Holleyhead; Marjorie Holleyhead; JaneHollis;Betty&DerrickHolmes; AgnesHowdle;DennisHowdle;John Howells;Emrys&JoyceHughes;JanetteHughes;PercyWiliamHughes; KathleenHyland Enid&RexIngham;HarryIsaacs; JennyIsaacs.
Betty&Tom Jackson; Florence Jackson;HarryJackson;StuartJackson;AnnieJames;HaroldJames;Allan&TrudyJesson;ErnestJohnson; JeanJohnson;NicolaJohnston;Craig AnthonyJones;Gwen&EddieJones; JanetJones;JoanneJones;MaryHele naJones;NeilJones;Norman&Jes sieJones;OliveJeanJones;Patricia Jones; TrishJones; Arthur &Kath Jordan;FamilyMembersJoyce;Julia Joyce Noah &AnnieKelsey;Norman &RubyKelsey;JosephKeys;Martin Keys;VeronicaKeys.
TonyLadd;DonLaing;IvyLaing; John Laing; PeterLamble; Sydney Latham;GladysLawrence; Samuel Lawrence;Jeannette Leach; MalcolmLee;EdithLees;JosephLees; KevLees;;AntoinetteLegg;William Legg;TomLewis;GrahamLloyd;Jul ieMarieLloyd;MaryLochrie;John Long;Mum &Dad Long;Dorothy Love;EliLove;;Milly&WesLovett; BerylLowe;Joyce&JohnLowe;Bill Luter;;DebbyLynam;EileenLynam.
KathrynMacDonell;Dennis Machin;Marlene Machin;Lynda MacKenzie;AlexanderMacPherson; Neil&AnnieMacPherson;Gwen& JohnMadeley;EdgarMagness;Elsie Magness; DaveMaiden; TomMal pass;Leslie(lesum)Mansell;Peter Mansell;BelaMarkus;EdnaMarsh; SandraAnneMarsh.
TimMarsh;JemmaMarshall;AliceMartin;BertMartin;FlossMartin; WalterMartin;StellaMason;Freder ickMayer;EdwardMcCallin;Joan McCallin;FrancisMcGlynn;Marga retMcGlynn;DoreenMcNamara; JamesMcNamara;Mary&Bernard McPartland;SharonMcPartland; JohnMeadows;Vi&GeorgeMiddle; PeterMiles;Lucy&SuzieMills.
RhodaMinton;RichardMinton; JamesMobberley;JoyceMobberley; DesmondMolloy;NickyMolloy;Mi chael Monaghan; Florence Moore; DonaldMoreton;Betty&MickMor gan;Irene Morgan;Dennis Morris; Freda Morris; George Ernest Morris;HarrietMorris;GeorgePatrick Moscrop; BarbaraMulligan;Jane Mulligan;Michael Mulligan;Peter Mulligan;Ada Mumford; AlfMum ford;JohnNottage&KathleenMary Murray;KathleenAliceMurray
Alan Nash; Jennie& George Nash; Trevor Neville; Christopher Noon;Irene Noon;FredNorthall; RoseNorthall; RoyNorthall; Tom Northall;TonyNorthall; Graham Norton;BeulahNotley;RegNotley GreggerO’Shea; Arthur Oakes; BettyOakes;ElizabethOakes;David Oare;MavisOare;JimOsborne;Lil Osborne;RoyOvery.
Georgena Packman; Herbert Packman;ElsieMayPadmore;Harry Padmore; Alva Palmer;Doreen Palmer;LeonardPalmer;StefanPa nasiuk;ElsieParry;DavidParsons; MickyParsons;WilliamParton;Su sanPayne;RogerPerry.
John Phaisey;Bernard Phillips; DoraPhillips;GeorgePhillips;Keith Pickavance;John&MurielPicken; MauricePicken; EmilyPickering; EricPickering;VioletPickering;Wil fred Pickering; Alan PercyPierce; DerekBrianPierce;ElizabethPierce; GertrudePierce;PercyPierce;Sally Pierce;ReginaldPlant;RuthPlant; StephaniePlant;DavidPorter;Den nis Potter;JohnPotts;RosePotts; Martin Pritchard; Mary Pritchard; WilliamPugh;BryanPumford
George Quantock; Sheila Quan tock;ThomasQuinn
BryanRatcliffe;James Henry Ratcliffe;MaryAnnRatcliffe;Karen Reid;MargaretReilly; Paul Reilly; Nicholas Adam Rhodes;Barbara &JohnRice;EdnaRice;;Hamilton Richards;Harry Richards;Alice Rickus;JohnRickus;ShaneRixom; SharonRixom;AliceRoberts.
TheTreeofLightcanbefound inTelfordShopping Centre
FEATURE TELFORDJOURNAL | THURSDAY,NOVEMBER 24,2022 16
BLACKFRIDAY ���� THIS FRIDAY (TOMORROW) 9am –6pm EVERYITEM IS REDUCED! FOR ONE DAYONLY ��� ��� ������ USE CODE BF10 ������������������������� 111 Holyhead Rd,Ketley,TelfordTF1 5DS Telephone 01952 610 316
Affordable andexoticwinter sunatoffbeatdestination
Switchingoff themotor of our roughandweatheredwoodenboat, SenegaleseguideSoguiWadeinvites ustolistencarefully.Glidingsilently throughamazeofmangrovesinthe SaloumDelta,ourattentionisdrawn toanunusualsnappingsound,akin toemberscracklinginafire.
Thestrangesyncopation,Sogui insists, is thesound of oysters breathing.Clingingtoexposedroots of mangroves, stringsofshellfish performasymphonythat’ssurprisinglysoothing.It’soneofthemany newdiscoveriesImakeonaweek’s holidaytoSenegal
Wedged betweenthe emerald rainforestsofthe Gambia andorange desert dunesofMauritania, thiscoastalcountrybulgesintothe AtlanticOceanatthemostwesterly pointoftheAfricancontinent
It’sanoffbeatholidayoption,al thoughit’ssettobecomeoneofthe most affordable,easilyaccessible andexcitingwintersun destina-
By Sarah Marshall
tions, thankstonew direct flights launchedbyTUIearlierthismonth ConnectingLondonGatwickwith Senegal’scapitalDakar,injustover sixhours,weekly flights will run betweenNovemberandMay,startingataround£800forsevennights all-inclusive.Hoveringbetween29 35C,temperaturesaremuchhigher thantheCanaries,there’s11.5hours of daylight during winter andno timedifference.
Promisingsun,sea,sandanda touchofsafari,here’sthelow-down onwhattoexpect A75-minutedrivefromDakar’s BlaiseDiagneInternationalAirport, thenew 522-room RIUBaobab on Pointe Sarene is TUI’smainhotel partner, andwas one of thekey driversforpersuadingthepackage tour operator to invest in this region.Large,luxurious roomswith
ocean-facing balconies(andafew suites with privatepools)linethe length of agolden beach, strewn withpalmsandthatchedcabanas.
Aspaandmoderngymareset alongsidepoolsandaswim-upbar, whereDutch,French, Britishand Senegalese families bathewith flutesofProseccoorglassesofcrisp rosewine
Acolossalbuffetisaccompanied byspecialitysushiandItalianres taurants,bothpre-bookablebutin cludedintheprice.
Awaterpark with slides and children’s entertainment attracts families, butthe hotelmanages to maintain asmart,upscale atmosphere.
Goingonsafaricanbeeye-wa teringly expensive. ButinSenegal, there’sanopportunitytoseesome ofAfrica’smostcharismaticspecies inoneofthecountry’ssixnational parks.Admittedly,thebest,Niokolo-Koba,isa500kmdrivesouth
Explorer’s Antarcticlegacy
Regardedasone of Britain’s greatestexplorers,ErnestShackle tonhasinspiredmillionsofpeople tovisitAntarcticaandtheislandof SouthGeorgia
Famously,oneofhisownexpeditionsendedinneardisasterwhen hisship,theEndurance,wasstuckin theice,writesSarahMarshall
Foralmosttwoyears,thechar ismaticleaderand his menwere stranded,remarkablysurvivingand eventuallyreturningtosafety
Earlierthisyear, Shackleton’s shipwasfinallydiscoveredaspartof anexpeditionlaunchedforthecentenaryyearofhisdeath.
Aheadofherownguestlectur ingtripinthe icysouth,his clos estsurviving relative,Alexandra Shackleton,sharesherthoughtson
thediscoveryandthelegacyofher grandfather.
Howdidyoufeelwhenthe En durancewasdiscovered?
“I wasthrilled. It wasthe secondattempttofindher.She’s3,000 metresdeepintheWeddellSea.Be causeicehaspreservedher,she’sin excellentcondition.”
Whoownstheshipnow?
“Shebelongstome.Shewasoriginallyinsuredfor£15,000,sowhen shesank,itwenttotheinsurance companies.Theyhadnointerest.So shenowbelongstomyselfandmy firstcousin.She’salsoprotectedun derTheAntarcticTreaty.”
Howelsehaveyou been commemoratingthecentenaryofyour grandfather’sdeath?
“I’vebeenmakingafilminIre
landaboutthecabinwherehedied Areplicaofthatcabinwillbepartof thefirstdedicatedpolarShackleton museumintheworldatAthyHeritageCentre.Areplicaboatwillalsobe there.Itwillopenin2023.”
What are your lasting memo riesofAntarctica?
“It’sa wonderful placeworth preserving.WhenIwent the first time,Iwentintohishutonmyown andtherewasthesmellofwoodand leather.Itwasasifhehadstepped out.”
n Alexandrawillbejoininga22dayvoyagewithPolarLatitudesto Antarctica,theFalklandsandSouth Georgia, departing UshuaiainArgentinaonDecember22.Pricesfrom £15,415ppinatripleshare,excludingflights.Seepolar-latitudes.com
Privately-ownedBandiaReserve is areasonablecompromise–althoughnotallanimalsarenativeto Senegal.Seegiraffes,elands,zebras andevenrhinosonsimplegame drives throughacaciaand baobab forests, finishing at avisitor cen treoverlookingalakeheavingwith crocodiles
Moreinterestingfromaconservation perspective is theTortoise VillageinNoflaye.RunbytheAfrican ChelonianInstituteNGO,theproject focusesonbreedingendangeredsul catatortoises,tobereleasedintothe wild.Manyofthehard-shelledresi dentshavebeenrescuedfromapet tradefuelled by traditional beliefs theseanimalscancureasthmaand bringgoodluck.
DailylifeinSenegalisasbright, boldandcolourfulasthepatterned kitengefabrics hangingfromcraft stalls.Walkingaroundavillagemar ketgivesasharpinsightintolocal living.Men wearing floatytunics
andconicalhatsselllivestock,while womeninpeplumdressesandoversizeddesignersunglassessitbehind mountains of meltingsheabutter andsacksoverflowingwithpeanuts
More affronting aremedicinal stalls coveredinlizardskins,pig tusksanddriedmonkeyheads.
Visiting aformerslave house mightseemmorbid,butatriptothe HouseofSlavesmuseumonUnesco WorldHeritageSiteGoreeislandis bothapoignantexperienceandim portantlessoninunderstandingAf rica’spast
A20-minuteferryridefromDa kar,theprettyislandisfilledwith artist studios, seaside restaurants andcafes.Butbetweenthemid-15th andmid-18thcenturies,20million slaveswereloadedontoshipsfrom hereandsentacrosstheAtlantic.
Anyupset,however,isbalanced bythesightofsomanySenegalese peoplevisitingthesitetobetterunderstandtheirownhistory
The swim-uppoolbar at the RIUBaobab
Goree Island inSenegal,whichhouses the House ofSlavesmuseumCartusedtocarry tourists
TRAVEL TELFORDJOURNAL | THURSDAY,NOVEMBER 24,2022 18
SarahMarshall atabaobab tree
Tourists ontheAntarctic Peninsula
ARROWPOINTRETAILPARK BRIXTONWAY SHREWSBURY SHROPSHIRE SY13GB 01743469333 www.outletx.co.uk FREECARPARKING DELIVERYAVAILABLE LOCAL&NATIONWIDEDELIVERYARRANGED CASH&CARRYAVAILABLEONEVERYITEM 0%FINANCE STOCKCHANGESDAILY 1000s OF ITEMS ON SHOW&AVAILABLE WITH HUGE SAVINGS ON EVERYTHING 10000SQFTSUPERSTORE MON-SAT9AMTO5PM SUNDAY 10AMTO4PM DISCOUNTFURNITURESUPERSTORE EXTRA10% OFFEVERYTHING PRE-CHRISTMAS DELIVERY GUARANTEED OXFORDOTTOMANDOUBLEBED RRP£1299 OURPRICE£499.99 BLACKFRIDAYSALE£449.99 TEXASCORNERSOFA RRP£2500 OURPRICE£999.99 BLACKFRIDAYSALE£899.99 MAYFAIROTTOMANKING-SIZEBED RRP£1399 OURPRICE£549.99 BLACKFRIDAYSALE£494.99 KANSAS&OHIOSOFAS 2SEATERRRP£499OURPRICE£199.99 BLACKFRIDAYSALE£179.99 KANSAS&OHIOSOFAS 3SEATERRRP£599OURPRICE£299.99 BLACKFRIDAYSALE£269.99 ALSO AVAILABLE IN KING &SUPER KING ALSO AVAILABLE IN DOUBLE &SUPER KING AVAILABLE IN VARIOUS COLOURS AVAILABLE IN VARIOUS COLOURS AVAILABLE IN VARIOUS COLOURS 1000’SOFITEMSIN-STOREWITHUPTO80%OFFRRP’S! EVERYTHINGISINSTOCK-IMMEDIATEDELIVERYAVAILABLE-NOWAITING-NOLETDOWNS WHATYOUSEEISWHATYOUBUY E-CHRIS STOREWITHUP FRIDAY 25TH NOVEMBER TO MONDAY 28TH NOVEMBER DISC
(6)
It provides the guidelines for movement (7)
Catch for Finn’s gate? (9)
Dexterous, having the correct workmen (5-6)
It’sfar from common knowledge that 100 lose the knack (5,6)
Killing result of joke on Spanish capital (9)
What the star at water-sport might skim? (7)
Box not returned to vehicle (6)
Rome’ssignalling code (5)
There’san animal in papa’s stable
HAMMONDS FURNITURE RESTORATION Do youhavetired or damagedfurniture anddon’t want toreplace? Ioffer afullrestoration service forall furniture items such as;Repolishingdamaged surfaces,repairs and reglueing, spring replacement, recovers. 25 yearsof qualityservice Call John on 01952 511 942 L ve poo Fe ryC os TheM r ey&Ande onBoa L E LIVERPOOL &SOUTHPORT Departing Mon 13 Feb‘23 Join us fora wonderful short break to the vibrant city of Liverpool wherethere’splentytoexplore–fromits glorious maritime history and rejuvenateddockside to itsbustling city centreand TheBeatles connections. Your breakincludes Return coach travel from Telford 4nightsatthe Adelphi Hotel, Liverpool with dinner &breakfast 2for 1bar (6pm-9pm) on selected drinks Free time in Liverpool Excursion to Southport Optional excursion to Chester(£12pp) 5Days by Coach only £179 Single Supplement £60 FOLKESTONE &COASTAL KENT -GOING SOLO Departing Mon 6Mar ‘23 Join us on ahassle-free trip to Folkestone,featuring a fabulous hotel and visits to Broadstairsand Margate; the perfect trip down memory lane! With everything taken careof, this is awonderful chancetoenjoy some sea air and exploreKent in friendly company. Your breakincludes Return coach travel from Telford 4nightsatthe Grand Burstin Hotel, Folkestone with dinner &breakfast 2for 1bar (6pm-9pm) on selected drinks Entertainment every evening Excursions to Broadstairs, Whitstable,Sandwich &Margate Going Solo hostatthe hotel Optional excursiontoCanterbury (£12pp) 5Days by Coach only £249 No Single Supplement in association with Formoreinformation or to book, please call: or visit online at: 033numbersare free within inclusiveminutes packages otherwise standardrates apply Operated by Just Go HolidaysLtd.Coachpackage holidaysand shortbreaks aresubjecttoJustGo! Ho idaysterms and conditions. Your booking is protected by Bonded CoachHolidays (BCH)and the Association of BondedTravel OrganisersTrustLimited (ABTOT); thisis a government approvedconsumerprotection scheme.Tours offeredsubject to availabilityand government guidelines. Errors and omissions excepted. Pricesper person, basedontwo people sharing adouble/twin room.Callsto033 numbersare free within inclusiveminutes packages otherwisestandard ratesapply. 03332 342 529 justgoholidays.com/WOL Quote WOL Your weekly newspaper WOL_2022-11-21_TelfordJournalSeries_16x4(2)_Just TriPaveConstructionLtd Dr20%off Paives& tios • Block Paving • HardLandscaping • Driveways • Patios • Fencing 01952897938 /07462571860 www.tripaveconstructionltd.co.uk Auctioneers&Valuers Brettells FINAL CALL FOR ENTRIES ANTIQUE SALE To Be Held 22ndNovember Alreadyconsigned is a largeentry of Chinese and Oriental Ceramics,European andChinese Bronzes,Vintage Port,GeorgianVictorian and later Collectables etc. Please contactuson01952 815925 to organise afreepre-sale appraisalauction@brettells.com BOOKED FREE bookanad.shropshirestar.co.uk SOLD £15 PUZZLES TELFORDJOURNAL | THURSDAY,NOVEMBER 24,2022 20 Each number in the grid represents adifferent letter of the alphabet and every letter of the alphabet is used. Use the given letters to the right of the main grid to start you off. LAST WEEK’S SOLUTION: 5 1 8 8 7 4 6 2 9 8 4 1 3 5 2 9 4 2 7 3 5 1 6 2 8 5 2 4 6 4 9 8 Fillinthe grid above so that every column, every rowand each ofthe 3x3 boxes containsall the digits from 1 to 9. 1 3 6 4 7 8 9 2 5 2 5 3 8 9 1 4 6 7 7 6 2 5 1 4 8 9 3 6 1 7 8 2 4 3 5 9 7 2 6 9 4 8 5 3 1 8 4 1 3 5 7 9 62 3 6 5 7 8 2 1 9 4 4 8 2 1 6 7 9 5 3 2 7 3 4 9 6 5 1 8 LAST WEEK’S SOLUTIONS > 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 W P M Q U V K S H Z A T J G L I X Y O C F E N B D R 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 U R Across Down Quick Clues: 1. Suggestion (11) 9. Embrace (3) 10. Burning (9) 11. Rule (5) 13. Dispossess (7) 14. Apple (6) 16. Meal (6) 18. Regular (7) 19. Dilate (5) 20. Lifeless (9) 21. Skill (3) 22. Festival (11) 2. Mat (3) 3. Anut (5) 4. Stable (6) 5. Crush (7) 6. Begin (9) 7. Curative (11) 8. Barrenness (11) 12. Involve (9) 15. Venerate (7) 17. Damage (6) 19. Dulcet (5) 21. Fuss (3) 12 3456 78 910 11 12 13 14 15 16 17 18 19 20 21 22 LAST WEEK’S CROSSWORDSOLUTIONS: CRYPTIC –Across:1 Hath; 3 Solstice; 9 Raw deal; 10 Green; 11 Poltergeists;13 Pariah; 15 Pirate; 17 Missionaries; 20 Credo; 21 Piccolo;22 Dithered; 23 Isle.Down:1 Hornpipe; 2 Towel; 4 Oblige; 5 Significance; 6 Inertia; 7 Erne;8 Generalstore; 12 Seashore;14 Raiment;16 Couple; 18 Icons; 19 Acid QUICK –Across:1 Dope;3 Aspiring;9 Proverb; 10 Chill; 11 Right-handman;13 Eraser; 15 Unwell; 17 Deliberation; 20 Tread; 21 Pillage;22 Passport; 23 Less. Down: 1 Departed;2 Prong; 4 Subway; 5 Incidentally;6 Imitate;7 Gale;8 Get the wind up;12 Blinkers; 14 Ageless; 16 Pepper;18 Image; 19 Stop Across Down Cryptic Clues: Choose either quick or cryptic clues both fitthe same grid. 1. 1000 different vessels used in maternal art (11) 9. There’ssome in the Antarctic, evidently (3) 10. Spinster taken in by confusing dials gets the sack (9) 11. Many,many entertainers? (5) 13. Dealers in suits? (7) 14. Husky-voiced
16. The
18. First-class
19. Tricky
20. Former
21. Article
22. Quite
2. The
is
3. Conceals
4. The
5.
6.
7.
19.
21.
Codeword Sudoku Double Crossword 1. To whichcountry do the Cyclades belong? 2. What name is given to the long loincloth traditionally wornby Hindu men? 3. Which Americanactor won aBest Actor Oscar for To Kill aMockingbird? 4. Which US government agency of volunteers was founded by John FKennedy in 1961? 5. El Pais is adaily newspaper of which country? 6. Which Mediterranean islandwas invaded by Turkish troops in 1974? 7. What name is given to amusical composition for four instruments? 8. Which town is the administrative centreof Kent? 9. With what sort of books isKarlBaedeker associated? 10. Which English poet wrote The Rime of the Ancient Mariner? Last week’ssolutions: Quiz: 1 Salt; 2 One; 3 The Lancet; 4 Orange juice; 5 Thomas Jefferson; 6 Cyanide; 7 Magog; 8 The Brontës; 9 Dan Quayle; 10 Magnitude. Niner: SNOWFIELD Each number from 1 to 9 represents adifferent letter.Solve the clues and insert the letters in the appropriate squares to discover awordwhich uses all nine letters. 1 2 3 4 5 6 7 8 9 58694427 gives amusical term 1768537 gives amusical voice 1734 gives amusical composition Niner Quiz BRAIN GYM No.715
ashore (6)
words of Cyril’ssongs? (6)
backing for troubled reign in Africa (7)
sort of entertainment? (5)
farm machine used for removing something (9)
you and I take in reverential fear (3)
informal, having neither entrance fee nor difficulty (4,3,4)
mineral
found in foreign parts (3)
skins (5)
outcome of trouble for Ulster?
8.
12.
15.
17.
(3)
SATURDAY
End of Watch (2012) (BBC1, 11.50pm)
An openingcar chase, shot throughapolicewindscreen, ends inbloodshedandofficersBrianTay lor(JakeGyllenhaal)andMikeZav ala(MichaelPena)are re-assigned toanotherpartofthecityandtold mock-seriously“nottokillanybody bytheendoftheweek”.Butwhen BrianandMikeuncoveratrafficking operationrunbyalocalcartel,they aremarkedfordeath.
SUNDAY
Mogul Mowgli (2020) (BBC2, 10.15pm)
BritishPakistanirapperMCZed (RizAhmed)isonthecuspofhisfirst worldtour,butisinvolvedinascuf flewithafanandistakentohospi talanddiagnosed with an autoim mune disease. An experimentalprocedureoffershim alifelinebut the procedurefliesin thefaceofhisfa ther’sbeliefs.
SirSimonlookingback onhistoryofalifetime
Simon Schama’s History of Now(BBC Two, 9.15pm, Sunday)
Aswellaswritingabouthistory, SirSimonSchamahaslivedafairbit ofittoo.Bornin1945,onthenight ofthebombingofDresden,hewon ascholarshiptotheprivateHaber dashers’Aske’sBoys’SchoolinCrick lewoodat11beforestudyinghistory atChrist’sCollege,Cambridge.
Schama then workedfor short periodsas alecturerinhistory at Cambridge,andwrotehisfirstbook, PatriotsandLiberators,whichwon theWolfsonHistoryPrize.
In1980,Schamatookupachair atHarvardUniversity,butreturned totheUK20yearslater,havingbeen commissionedbytheBBCtoproduce a15-partseriesofTVprogrammes TheresultwasAHistoryofBritain.
Sincethen,hehasmadeseveral otheracclaimeddocumentarypro grammes,buthislatestprojectisapparentlyhismostpersonalprojectto date,ashelooksbackatthehistory thathasplayedoutinhislifetime.In
thefirstofthreeprogrammes,here vealsthestoriesofartistsandwrit erswhohavebeenattheforefront ofthefightfortruthanddemocracy, oftenatgreatpersonalcost.
InDecember1936,ayoungEng lishman,EricBlair,betterknown asGeorgeOrwell,headedtoSpain
tojointhoseriskingtheirlivesfor freedom.WejoinhissonRichardin Barcelona,totellthestoryofhowa campaignofmisinformationbySta lincostthelivesofmanyofOrwell’s friendsand comrades. Theexperi encefedintothecreationofhisliterarymasterpiece,1984.
EastEnders (BBC1)
JaninegivesMicksomeupsetting news.KatfindsthatAlfiemovedin duringherabsence–andmanagedto lose£30,000ofPhil’smoney.Rocky, Mitch,BobbyandFreddiestagean intervention when they discover Harvey hasbeensending Sophia money.
Coronation Street (ITV)
Harvey offers Nick themoney tobuyDebbie’sshareofthebistro. He initiallyturns it down,until it becomesclearthecouplehavebeen conned.Stephen(ToddBoyce)lands ajob as adeliverydriverbefore launchingadevious scheme that couldendangerAudrey’slife.Sum merhasamiscarriage.
Emmerdale (ITV)
AftertellingVictoriathe truth about thespeedingticket, David agreestorepeathisconfessiontothe police–butit’stoo late andshe an nounces it’s over.
Bernicestruggles to controlher emotions, leading hertofearshehas dementia
Bournemouth&Weymou h Epd Nor o kCoun ryMus cBreak Epdf in association with OperatedbyJustGoHolidays Ltd. Coach package holidays andshortbreaksare subjecttoJustGo! Holidaysterms and conditions. Your bookingisprotected by BondedCoach Holidays (BCH) andthe Association of Bonded Travel Organisers TrustLimited(ABTOT); this is agovernment approvedconsumer protection scheme.Toursoffered subject to availabilityand government guidelines. Errors and omissions excepted. Pricesper person, based on twopeoplesharing adouble/twin room. Calls to 033numbersare free withininclusive minutes packages otherwise standardrates apply Formoreinformation or to book, please call: or visit us online at 033numbers arefreewithin inclusive minutes packages otherwise standardrates apply TelfordJournalSeries Your weekly newspaper FLYING SCOTSMAN CENTENARY SteamTrain Experience Departing Sat18Mar ‘23 All aboard! TheFlying Scotsman celebrates its100th year anniversary in 2023 andyou’reinvited on this extraspecial centenary experience to enjoyanunforgettable tripback to the heyday of thegolden ageofsteam. Don’t missout! Your breakincludes Return coachtravel from Telford Overnight stay at aselected 3or4-star hotelwith breakfast &dinner Train journeybehindthe FlyingScotsman on the East Lancashire Railway Admission to the Bury Transport Museum En-routevisittoLiverpool 2Days by Coach only £149 Single Supplement £35 BOURNEMOUTH &Weymouth Departing Mon 20 Mar ‘23 Take agreat-valuetrip to stunning Dorset and thebeautifulsouth coast, whereweexplorethe nautical atmosphereofneighbouring Poole andthe traditional seasideresorts of Swanage and Weymouth –witha 2for 1bar offeratour hotelthrowninfor goodmeasure! Your breakincludes Return coachtravel from Telford 4nights at aselected hotel in Bournemouth withdinner &breakfast 2for 1bar (6pm-9pm) on selected drinks Excursions to Poole, Swanage &Weymouth Optional excursiontoNew Forest includingLyndhurst, Brockenhurst& Lymington(£12pp) 5Days by Coach only £199.99 Single Supplement £60 NORFOLK CountryMusic Break Departing Mon 20 Mar ‘23 Get your Stetsonsatthe ready! Joinusfor acountry music break at theWarner Corton Coastal VillagenearLowestoft withfabulous live music entertainmentevery night.Enjoy toe-tapping performances plus excursions to Aldeburgh and the Norfolk Broads –yee-ha! Your breakincludes Return coachtravel from Telford 4nightsatthe Warner Corton CoastalVillage,near Lowestoft with dinner &breakfast Livecountrymusicentertainment every evening ExcursionstoAldeburgh &the NorfolkBroads by coach Optional excursion to Norwich (£13pp) 5Days by Coach only £329 Single Supplement £100 Quote WOL justgoholidays.com/WOL 03332 342 529 TV GUIDE THURSDAY,NOVEMBER 24,2022 | TELFORDJOURNAL 21
at endofwatch
life
Gyllenhaal
Audrey’s
in danger?
Editor’s weekend pick
Films for the weekend
Your guide to the soaps
SirSimonSchama infrontofPicasso’s GuernicaforHistoryofNow
EndofWatch Todd Boyce
Howtomakeyourgarden glow this festiveseason
GloweventsatRHSgardens,Kewand otheroutsidespaceswhichprovidespectacularlightfestivalsinwintermakeforagreat eveningout–buthowaboutbringingalittle bitofthatsparklehome?
Therearelotsofwaystomakeyourown gardenglow,usingoutdoorfairylights,lanternsand uplighting in warm,welcoming tones,tocheerthecoldnightsandgetyou intothefestivespirit
Herearesomeexpertstips
“Ratherthanthinkdecoration,thinkat mospherefirst,andthemoodandthefeeling youwantwhenyouareinthegarden,”suggestsdesigner Andrew Duff (andrewduff gardendesign.com),co-chairofthecouncilof theSocietyofGardenDesignersanddirector oftheInchbaldSchoolofDesign.
“Ifyouareafterarelaxed,festive,soft look,howareyougoingtoachievethat?It mightnot necessarilybecovering atree withfairylights.Youmightwanttodoitina moresubtleway.”
KevinMartin,headoftreecollectionsat Kew,says:“Oneofthebestwaystoaddfes tivelightstoyourgardenistowrappealight
By Hannah Stephenson
LEDsaroundthetrunkandbranchstructure ofanytreesinyourgarden.Thiswillbring interestintoyourgardenthroughthelong darknightsofwinter.Itwillalsoaccentuate thelovelystructureofthetree.
“Anotherwayistouseuplightersonthe ground,pointingdirectlyupthrough the canopyandhighlightingthetrunk.Again,be suretouseLEDs
“Good treestolight up in thewinter monthsare birches, with theirstriking whitebark.Anothergreattreetohighlight withlightsisTibetancherry,withitsstrikingred bark.Acers,especially snakebark maples,canalsoworkwell.”
Duffsuggests:“Rollingupaballoffairy lightsandstickinganumberofthoseina treesotheylooklikehugesnowflakescan bereallyeffective.Youcanalsogetlarge snowflake-shapedlights,whichareoftenso lar-panelled,chargingthroughthedayand thencomingonatnight,whichcanbeagood alternatives.” Duff adds:“Lanterns arean
excellentidea.Youmightbeusingcandlesin lanterns.Youcouldevenuseascentedcandle withaChristmasfragrance.”
Thinkwarmcolours,suggestsMatthew Pottage,curatorofRHSGardenWisley(rhs org.uk).“Selectawarmwhitelightwitha slighthueofyellowinitforawarmandtraditionallook,”hesays.“Purewhitelightshavea colderandmorestarkappearance,whichcan say‘winter’asopposedto‘Christmas’.”
Duffadds:“I’magreatfanofstickingto onecolour,whetherit’swhitesoroffwhites, butnothingsaysChristmaslikeredoutside Maybeyoumakeallthelightsinyourtrees red,whichcanproduceabeautifulredglow. Butwhenyoustartmixingalotofcoloursit fallsapartabit.”
Aswellaslightinguptrees,baublescan behungonthestemsofdeciduoustrees
“Nothing says Christmaslikeabauble, andweneedtohavefun,butmaybejuststick tooneortwocoloursonatree,”Duffsuggests. “WearenottryingtocreateaChristmastree –that’shappeninginside–sothesimplerit is,thebetter.”Seerhs.org.ukorkew.orgfor detailsofRHSGloworKewevents.
Keepingbeddingniceand fresh
Accordingtotheexperts,youmightwant torefreshyourbeddingmoreoftenthanyou think,writesSamWylie-Harris
“Generally,youwillbeabletotellwhen it’stimetoreplaceyourpillow,howeverIalwaysrecommendreplacingthemeveryone to twoyears,” says ChrisTattersall, sleep expertandmanagingdirectoratWoolroom (thewoolroom.com).
“Theygetwornoutsurprisinglyquickly,asonaverage,thepillowdoesitsjobfor 2,500hoursayear(around100days).”
He says certaintypes of pillowslast longerthanothers,duetothematerialsused in production.For instance,antimicrobi altextileslikelinen,wool,andhempoffer naturaldefence againstbacteria, mildew, mould,andothermicrobes
Fabio Perrotta,directorofbuyingat Dreams(dreams.co.uk),agrees:“Togetthe mostoutofyourpillows,it’sadvisedtore-
placethematleastonceeverytwoyears. Thisisbecauseovertimetherewillbea buildupofdustmitesandthepillowismost likelytohavelostalotofitselasticity,mean ingitwon’tprovideadequatesupport.”
Perrottasaysduvetsshouldbereplaced everytwotofiveyears.Therearewaystotry andextendthelengthofaduvet’slife–such asusingaprotector,whichcanbewashedto protectfromstainsanddustmites.
Tattersall says:“Duvets should be re placedroughlyeveryfiveyears.Likepillows, iftheyarefilledwithmorenaturalfibres, theyneedn’trequirereplacingsooften,eg. woolisself-cleaning.”
Howdoyouknowwhenit’stimefora change?Thereareseveralwaystotellit’s timeforanewpillow,suggestsTattersall. “Theobvioustraitsincludeitstartingto smell,turningyellowandstainsonthepil low–thiswillbefromsweat.”
Aerials Carpet &Upholstery Cleaning Carpentry Decorating TERRY BROADHURST Painting &Decorating City &Guilds Qualified Interior &Exterior Fully Insured FREE QUOTES Clean &Reliable Service Telephone 01952 610681 Mobile 07742 453541 42StaffordStreet,StGeorges,Telford Call: 01902 410268 /07850 330251 TV Link Ltd AERIAL &TV SPECIALISTS We repair allkinds of TVs, Plasmas, LCD, 8out of 10 problems fixed on the spot FREE QUOTES ANYAREA DIGITALAERIALS SKYDIGITAL CCTV CAMERAS FITTED TV’s Wall Mounted andset up HD TV’s From £99-ManySizes -Delivered We nowrepair Laptopsand Mobile phones 271016424 TED LCD 2 ANY TV REPAIRS FREE QUOTES 56A High Road, Willenhall WV12 4JQ www.tvlinkltd.co.uk TV’sFrom £129 -ManySizes -Delivered We all kinds of TVs, Plasmas, LED AASSystems TV Aerials ExtraTVpoints Repairs Same dayservice and free quotes Agenuine local family business built on recommendation 01952812931 AA DIGITAL AERIALS 01952 743943 07584 560260 AERIALS, SATELLITES, CCTV. ALL AREAS. FREE QUOTES. ALLWORK GUARANTEED The Original Paul Fraser Carpentry Tel: 01952 525063 (night) Mobile: 07866 377945 (day) Full Carpentry Service l Doors supplied &fitted l Full maintenance service l Lock replacements l Repairs to uPVC windows &doors, reglazes l 30 years experience Contact Paul QUALITYPAINTING &DECORATING WEOFFERAPROFESSIONALSERVICEWITHALLWORKGUARANTEED FREEQUOTES CALLINTERDECON 07778817778 ANYTIMECARDPAYMENTACCEPTED Carpet& Upholstery CLEANING WEOFFERAPROFESSIONAL ANDQUALITYSERVICEFREEQUOTES Cardpaymentaccepted CallIntercleanon 07778817778anytime To advertise in Local Specialists and reach thousandsofpotential customers call 01952 288813
HOMES TELFORD JOURNAL | THURSDAY,NOVEMBER24, 2022 22
Illuminatedpassagewayscanlookgreatinjust one colour Lanternsand starlights canadd atmosphere
Itmay be time forarefresh
Gardening Plastering Plumbing Property Maintenance Roofing Driveways &Patios Solar Power Logs Blinds Double Glazing Services Building Plans Personal Scrap Vehicles Window Specialists Stairlifts Carpet Cleaning Driveways Electrical Is your roof leaking? Specialists in: • Re-roofing • Tiling • Slating • Flat Roofs • Gutters & Fascias • OAP Discount • FREE Quotes We will beat any written quote TELFORD ROOFING &GUTTERING 01952 271370 • 07791 190642 15% discount with this advert Landline: 01952 324300 Free: 08005353596 Mob: 07735 559 134 www.jpricecontractors.com Now Offering Insurance Back Gaurantees JPriceRoofingLtd BEFORE AFTER NOTJUSTROOFS! Check ourWebsite Shots DIY SOS ALL YOUR PROPERTY MAINTENANCE l Bathrooms l Kitchens l Guttering l Roof Repairs l Supply +Fit Tv Aerials Most DIY jobs catered for NOJOBTOOBIGORSMALL •CALL FOR AFREE QUOTE Tel Ken Tinsley: 01952 404805 • Mobile: 07944 109250 email: shots321@gmail.com •Part ‘P’ registered •Warranty available •Out of hours service available •Small jobs •Fuse board upgrades •Full and part re wires Call Bill for afree quote 07871926721 www.wdsaunders-electrical.co.uk Friendly and reliable service ELECSA APPROVED www.electriciansintelford.com Call Bill for Free Estimate Call Ryan on 07733 778 960 Shropshire maintenance services Installation and maintenance of: •Showers •Bathrooms •Kitchens and Tiling •Power flushing •Heating systems •Landlord certificates from £55+VAT •Boiler installs from £1300 And all your plumbing needs Over 20 years experience All building work undertaken MILLS BUILDERS NO JOB TOO SMALL •GUARANTEED WORK • FREE QUOTES Telford 01952614421 Mobile 07533656914 • Home Extensions •Bathrooms •Wood Flooring •Kitchen Installations •Fencing •Tiling • Plastering •Plumbing •FlatRoofs •Window Fitting Barn Dried Logs For Sale All below20% moisturecontent Woodsureapproved 1Tonnebagsand transitloadsavailable Skiphire Fencingsupplied&erected Call J.P Skips Telford 07974 569 939 Want to save money on your energy bills? 01902 932385 www.nealenergysolutions.com MCS and HIES accredited Solar Experts WINDOW REPAIRS Sealed units, hinges, handles and total replacements Call Lion Home Improvements: 01952 796927 07771 415 628 Double glazing giving you Double you MISTY WINDOWS? LET THE SPECIALISTS TAKE CARE OF IT... Windows andDoors, Double glazing Installations &repairs including leaks, squeaks and locks Call Mathesonand Brown for more information more 07539 216 615 Freephone 0800 956 2453 Block Paving, Paving, Slabbing, Tarmacadam, Brickwork Turfing, Fencing, Landscaping FREE QUOTES Freephone 0800 048 4138 01952 426042/07553 930047 LOCAL &FRIENDLYSERVICE www.masterdrivesconstructionltd.co.uk Now manufacturer of PERFECT FIT BLINDS Available in ahuge range of fabric colours and designs No drilling! No screwing! Child safe Easilyremovable forcleaning Call Phil on 01952 240 222 • email sales@telford-blinds.co.uk • www.telford-blinds.co.uk • Verticals • Rollers Wooden Venetian Blinds • Faux Wood Blinds • Venetian Blinds Vision Blinds • Remote Control Roller Blinds Local Family Run Business We are now doing pleated bifold doors Suppliers and Installers -CompositeDoors -Aluminium Bi-folds -Aluminium Bi-folds -Plastic Windows &Doors -Plastic Windows &Doors -Glass Repairs -Window /Door Locks -Residential Installer 01952541119 07545396661 Town and CountryShropshire Email: Townandcountryshropshire@yahoo.com Free quotes: 07973 848 438 /0800 0340 344 CONSERVATORYROOF LEAKING? Call us today,before it gets worse! •Misty units •Broken locks •Door repairs •Conservatory leaks &repairs LOCAL RELIABLE SERVICE 20 YEARS EXPERIENCE ALL WORK GUARANTEED SCOTTS WINDOWAND DOORREPAIRS FOCUS OF THE WEEK Based in the Shrewsbury and Shropshirearea, Master Drives Construction Ltd is your local installer of driveways, patios, and landscaping. We take great pride in providing atopquality bespoke service, whether laying anew driveway, patio or working on alandscaping project. We work forboth residential and commercial customers. If you’relooking for block paving, gravel, resin bond, or Tarmacadam, get in touch. We putour customers at the heart of our business and aim to achieve maximum customer satisfaction. We have the knowledge and expertise to provide areliable solution for whatever your needs and promise to provide you with the most up to date, durable designs to ensureyou have abeautiful home. Choose us as your go-to driveway and landscaping company in Shrewsbury Our crew is courteous, not only to you, but also your needs and your neighbours. We do our best to make sureyour work is done professionally and quickly.Our speed is due to our high level of expertise. Rest assured, we do not cut corners on any project. Visit our website www.masterdrivesconstructionltd.co.uk for moreinformation or call us on: Mobile 07553930047 |Office 01952426042. Freephone 08000484138 MASTERDRIVES CONSTRUCTION LTD AFTER BEFORE Professional PLASTERING Service •Plaster repairs •Coving •Damaged walls &ceilings repaired/ over skimmed •Small plastering jobs •Semi retired Over 35 years experience Call Nigel for aFREE quote 07979 724 506 •Patios•Driveways•Fencing •Tarmacing•Brickwork•Repairs •Cleaning&Sealing•Resin •Gravelling•Landscaping •Turfing •IndianStone •Flagging•Fascias•Soffits •Guttering 01952 898753 / 07450 937834 info@shropshiredrivewaysandpatiosltd.co.uk www.shropshiredrivewaysandpatiosltd.co.uk AllWork Undertaken /FullyInsured ONSITE DRIVEWAYS LIMITED DRIVEWAYS|PATHS |PATIOS BLOCK PAVING|TARMAC CONCRETE |SLABBING ALL WORK GUARANTEED FULLYINSURED FREE NO OBLIGATION QUOTATIONS &ADVICE Tel: 01785 878 533 Mob: 07787 426 085 www.onsitedriveways.co.uk GROUTFIX &PROPERTY MAINTENANCE YourlocaltrustedSpecialist •WeClean•Re-grout •Re-sealShowers, Bathroomsetc •Jetwashing•Gardening •Locks•RefitMisted orUPVCWindows •Deepcleaning www.groutfix.co.uk 07982304399 ADAM DESIGN BuildingPlans Drawnand submitted to council 01902 620200 / 07841654037 Email: adamdesign@sky.com Pardy’s Carpet Cleaning: Get in touch today! T: 01630 642878 M:07870 770426 email:pardy. gary1@yahoo.com www.pardyscarpetcleaning.com A1 AUTOBREAKERS J.M.S TOP PRICES PAID Payment on collection CARS-VANS MOT FAILURES Skips Supplied FOC •Collection Service FERROUS &NON FERROUS METALS WANTED 01952 580736 07931 996955 Licenced to take your end of life vehicles Certificate of Destruction Issued T&C’sapply REGULAR GARDEN MAINTENANCE WEEKLY, FORTNIGHTLY&MONTHLY Tree felling, pruning, shaping, fencing, driveways, slabbing, turfing, stump removal, hedge trimming, lawn mowing, Call Josh for afreequote 07825 588284 JCGardenServices@yahoo.com www.jc-gardenservices.co.uk TREE SURGEON & LANDSCAPING Garden Services JC WREKIN STAIR LIFTS •New lifts from £1699 with 2years warranty •Reconditioned lifts from £799 with 12 months warranty •Rentals available 01952 405397 07897 273617 To advertisein Local Specialists and reach thousands of potential customers call 01952 288813 and askfor your local branch
BEARD
Maureen June
Of Hadley,Telford.
Passed away peacefully at the Royal Shrewsbury Hospital on November 12, 2022, aged 84 years.
Beloved Wife to the late Eric,Devoted Mum to the lateStephen anda Much LovedNan, Great-Nan and Mother-in-law,who will be sadly missed by all her Family and Friends and the wider Hadley community
Funeral Service 3.30pm Tuesday,November 29, at Hadley Methodist Church followed by aprivate Committal Service.
Family flowersbyrequest but if desireddonations for Age U.K. would be much appreciate dvia www.memorygiving.comora collection after the Service in Church.
Inquiries to
NICHOLLS Brian William Of Stirchley
Sadly passed awayatThe Princess Royal Hospital on November9,2022,aged 81 years.
Devoted Husband of Doreen, much loved Dad of Suzanne and Warren, Grandadof Hailey and Avery.
Funeral Service 2.30pm Thursday, December 1, at Telford Crematorium.
Family flowers only by request but if desired donations for Diabetes UK which can be given online at www.memorygiving.com would be appreciated.
All inquiries please to
STEINERT
Tony (Peter Anthony)
Of Muxton, Telford Gill, Gemma, Katie, Adam and Milo are devastated to announce thatTony losthis courageous battle against Cancer on November 15, 2022.
He was surrounded by his loving Family as he slipped peacefully awayto join his Lord and Saviour He will be missed by all who knew him.
God bless, sleep tight, until we meet again my darling.
X
ACelebration of Life to be held at St.John’s Church, Mu xto no nT hu rs da y, December 8at11am
Fo llowed by as hort Committ al at Te lfor d Crematorium, at 12.30pm.
Family flowers only please.
OAKLEY
Hilda Rosemary
Donations if desired to be shared between the Severn Hospice and The Lingen Davies Unit at The Royal ShrewsburyHospital for which pur pose a collection boxwill be provided in Church.
All inquiries to
HUGHES
Diane Patricia
Formerly Crowther nee Cowley
Passed away surrounded by Family at the Princess Royal Hospital on November 1, 2022, aged 70 years, of Aqueduct, Telford. Formerly of Chasetown.
Dearly loved Partner to Ian, Mum to Charlotte, expectant Nan, Mother-in-law to Eddie, and Step-Mum to Louise. Beloved Sister,Aunty,GreatAunty,Nieceand Friend. Former employee of the Express &Star and the Shropshire Star
Celebration of lifeat Telford Crematorium on Monday,November 28, 2022 at 11.30am, followed by afternoon teaand Diane’s favourite music at the Mill, Leighton. All welcome. Memorial at South Shrop shireRemembrancePark at alater date.
Diane will be greatly missed by all who knew andloved her.Familyflowers only please. Donations, if desired, willbegratefully received towards Macmillan Cancer Support, Cancer Research UK and UK Sepsis Trust.
All inquiries please to
(known as Rose) Of Wellington. Passed away peacefully on November 9, 2022 at Severn Hospice, Telford. Aged 81 years.
Beloved Daughter of the late Robert George Hatton and Sarah Ellen Hatton and Wife of the late John Barry. Loving Mum of Sharon, Lorraine, Chris and Kim and amuch lovedNan and Great-Nan who will be sadly missed by all her Family and Friends.
Funeral Service at Telford Crematorium on Tuesday, November 29, 2022 at 10.30am.
Family flowers only by request but if desired donations to the Severn Hosp ice would be appreciated.
All inquiries please to
Of Wrockwardine Wood, Telford.
Passed away peacefully at home surrounded by her Family on November 10, 2022. Aged 90 years.
Abeloved Wife of the late Arthur
Amuch loved Mum to Valand Andy
Dear Nan to Amy and a Great-Grandmother to May Dearly loved and sadly missed by all her Family and Friends.
Funeral Service to be held at Holy Trinity Church, Wrockwardine Wood on Tuesday,December 6, 2022, at 12.30pm. Followed by a Committal Service at Telford Crematorium.
Family flowers only please.
Donations if desired for the Severn Hospice for which purpose acollection boxwill be provided in Church.
Inquiries to
WARD Marjorie (Marj)
On Oc tober 29, 202 2, peacefully in her sleep, at her home, MarjorieWard, of Ash Street, Highley, Nr Bridgnorth, aged 96 years.
The beloved Wife of Dan, the loving Mother of Rogerand Adrian, Mother-in-law of Paula and Tracy and avery dear Nan, Great-Nan, Sister and Aunt.
Muchloved, Marjoriewill be sadly missed by all her Family and Friends.
Fu ner al Ser vic ea nd Interment at The Parish Church of St. Mary, Highley, on Friday,November25, at 1pm.
Fa mily flowers only by request please but donations for Esme’s Umbrella (a Charity to raise awa ren ess of Ch arl es Bonnet Syndrome) are being gratefully received, for which purpose acollection boxwill be provided at the Church, or onlineatwww.perryand phillipsfunerals.com
All inquiries to
Funeral Services Acknowledgements FENN’S MEADOW GREEN BURIALS ECO/GREEN BURIALS &INTERMENT /SCATTERING OF ASHES
880 002 www.shropshiregreenburials.co.uk
Deaths
Tel01948
TITLEY
Brenda
Brian Blizard
Don Bulmer
Peter Gardiner
Sally Gwilliam
Phillip Jones
Sidney Murphy
Glyn Price
Barbara Robert
Susan Rollins
Rober Tonks
Ross Vickers
Ann York
YOUCAN NOW BOOKONLINEAT BOOKANAD.SHROPSHIRESTAR.CO.UK OR CALL US ON 01952244244 HERE TO SHARE YOUR TODAYS, TOMORROWSAND YESTERDAYS Whetheryou’recelebrating aspecialoccasionor rememberingalovedone we’reheretohelp. Justcalluson01952244244 Ourlinesareopenbetween 8.30amand5.30pm MondaytoFriday ClosedSaturdaysand BankHolidays DAILYDEADLINES • Before4.00pmMonday toFridayforthenext day’sedition • Before4.30pmFriday forMonday. • Subjecttochange BankHolidays Family ANNOUNCEMENTS Family ANNOUNCEMENTS OURTEAMARE HERE TO HELP YOUPLACE YOUR ANNOUNCEMENT 01952242424 Family ANNOUNCEMENTS Telephone: 01952242424 CREATE ALASTING MEMORY OF YOUR LOVEDONE BY PLACING AN ANNOUNCEMENT TELFORDJOURNAL | THURSDAY,NOVEMBER 24,2022 24 FAMILY ANNOUNCEMENTS
Bikes Antique Fairs Car Boot Sales Caravans/ Motorhomes Elderly &Disabled Elderly &Disabled Caravans Wanted 13 16 20 28 29 30 31 32 39 33 35 34 38 43 47 51 52 53 57 48 61 44 45 54 65 68 72 83 78 73 74 69 79 84 75 76 36 37 42 49 50 59 60 63 64 70 71 77 82 80 81 85 86 87 1234 17 21 25 56 14 26 7 22 8 18 910 15 11 19 23 24 27 40 41 46 55 56 58 62 66 67 12 ACROSS 13.Rehearse (3,7) 14.Putforward (7) 15.Performed (6) 16.Comfort (6) 17.Depart (4,3) 18.Chaplain (5) 19.Retailed (4) 20.Coach (5) 21.Clever (5) 22.Turn (6) 23.Awaken (5) 28.Dressed (7) 30.Soon (7) 33.Rival (9) 36.Metal (6) 38.Wrong (5) 39.Frightening (5) 40.Suppose (6) 42.Chopped (5) 43.Cover (7) 44.Deduce (6) 46.Goals (4) 49.Incite (4) 51.Stop (6) 53.To come (2,5) 55.Jam (5) 59.Fastener (6) 60.Stopping device (5) 61.Clear (5) 62.Believe (6) 63.Truly (9) 65.Told (7) 66.Dress (7) 70.Animal (5) 71.Recompense (6) 73.Ponder (5) 75.Bang (5) 80.Previously (4) 82.Go off (5) 83.Game (7) 84.Fighting (6) 85.Touching (6) 86.Going down (7) 87.Capsized (6,4) DOWN 1. Inconvenienced (3,3) 2. Direct (8) 3. Endeavoured (5) 4. Practices (7) 5. Necklace (6) 6. Cutlery item (5) 7. Chest (6) 8. Vie (7) 9. Obstinate (10) 10.Saw (5) 11.Ordains (4,4) 12.Healthy (4) 24.Cooked (7) 25.Centre (5) 26.Hoped (7) 27.Varieties (7) 29.Vague (5) 31.Lift (5) 32.Guide (4) 34.Parent (6) 35.Nip (4) 37.Now (7) 41.Cover (7) 45.Source (6) 47.Behaviour (7) 48.Broke (7) 50.Ordinary (7) 52.Try(4) 54.Find (5) 56.Adhere (5) 57.Raise (4) 58.Fight (5) 60.Nonsense (10) 64.Realised (6,2) 67.Gift (8) 68.Show (7) 69.Partner (7) 72.Field (6) 74.Tell (6) 76.Plant (6) 77.Big (5) 78.Pulls (5) 79.Captured (5) 81.Time (4) Crossword S:ACROS 13 Run through; 14 Propose; 15 Played; 16 Solace; 17 keTa off; 18 dre;Pa 19 Sold; 20 Stage; 21 art;Sm 22 Rotate; 23 Rouse; 28 Clothed; 30 Shortly; 33 ender;Cont 36 Copper; 38 Amiss; 39 ing;Aw 40 Assume; 42 Hewed; 43 er;Shutt 44 Reason; 46 Ends; 49 Urge; 51 Arrest; 53 In store; 55 Stick; 59 Button; 60 Brake; 61 redit;2C;6naiPl 63 Sincerely; 65 Ordered; 66 Bandage; 70 Beast; 71 Reward; 73 Brood; 75 Knock; 80 Once; 82 Addle; 83 Marbles; 84 Action; 85 Moving; 86 Sinking; 87 rnedTu over ut:1PDOWN out; traight;2S ;4edri3T Customs; hoker;5C poon;6S offer;7C 8 Compete; eadstrong;9H 10 Spied; 11 Lays down; 12 ll;We 24 Steamed; 25 Heart; 26 usted;Tr 27 Strains; 29 Loose; 31 Hoist; 32 Lead; 34 ther;Fa 35 Bite; 37 Present; 41 Sheathe; 45 Spring; 47 Manners; 48 Snapped; 50 Routine; 52 Stab; 54 ace;Tr 56 Cling; 57 Rear; 58 Scrap; 60 Balderdash; 64 edCash in; 67 Donation; 68 geant;Pa 69 Consort; 72 Domain; 74 Relate; 76 Clover; 77 Large; 78 Drags; 79 ken;Ta 81 Noon. CROSSWORD BEST SATURDAY BOOTSALE 6am Onwards NowB4176 Rabbit Run, by T.F.M Between Dudley and Telford, WV15 5LS 07890 267041 ★★ ★★ STAIRLIFTS RECONDITIONED STRAIGHT from £495* NEWSTRAIGHT from £1495* NEWCURVED from £3295* (Includesfitting&warranty) &Remove Stairlifts up to £500paid on Har,dicare, AgeUK, Acorn& Brooks (subjecttoage) FREEPHONE 0800 096 5499 ELECTRIC WHEELCHAIR Ster lingLittle Gem,4wheel, £300. Telephone 01952 813997 /07470 029827. ★★★★★★★★★★★★★★★★★★★★ ★★★★★★★★★★★★★★★★★★★★ ★ ★ ★ ★ ★ ★ ★ ★ ★ ★ ★ ★ ★ ★ ★ ★ ★ ★ ★ ★ ★ ★ ★ ★ ★ ★ ★ ★ ★ ★ ★ ★ ★ ★ ★ ★ Any Age or Condition *CASH *WAITING* Immediate collection Call Bill on 07825 325 913 All Caravans Wanted CITROEN RELAY SUNLINER CAMPER Two berth 2011 New MoT Fully equipped. Winter bargain £15,500, may take PX. Bridgnorth 07496 172252. EXCEL G-LOGIC wheelchair carries upto 130kg, 3years old, good con dition. £150 ono. 01743 350153. ANTIQUECOLLECTORS &VINTAGE FAIR UTTOXETERRACECOURSE (WOODLANEUTTOXETER)(SATNAVST148BD)SIGNPOSTEDA50 SATURDAY3RD& SUNDAY4THDECEMBER. 100+STALLS INSIDE+OUTSIDE PITCHES. SATURDAY8AM-4PMSUNDAY10AM-4PM ADMISSION£2CHILDRENFREE PLENTY OF FREE PARKING ANTIQUEFORUM 07921659798/01782393660 FOLLOW US ON TWITTER 1 FAMILY 2 LEISURE TIME Visit: bookanad.shropshirestar.co.uk BOOKED FREE SOLD £80 PLACE YOUR ITEM FORFREE UP TO £250 01952244244 8.30am -5.30pmMon -Fri.ClosedSat/Sun and Bank Holidays Desktop,tablet& mobile bookanad.shropshirestar.co.uk Family 1 LeisureTime 2 Home &Services 3 Pets &Animals 4 Business &Farming 5 Property 6 Jobs 7 Motoring 8 Public Notices 9 Personal 10 Index PLACEYOUR ITEM FORFREE UP TO £250 Visit: bookanad. shropshirestar.co.uk Simply pressthe free advert icon Sorry, no pets,gunsorlivestock Private advertisersonly. TO ADVERTISE TELEPHONE 01952244244 VISIT: BOOKANAD.SHROPSHIRESTAR.CO.UK Motoring Property Homes& Services Pets Family Jobs what’son THURSDAY,NOVEMBER 24,2022 | TELFORDJOURNAL 25
NOTICE TO READERS
NOTICE TO ADVERTISERS
Advertisers
BREEDING CAGE
NOTICE TO READERS
Please be awarethat when purchasing apuppy there are some simple guidelines you can follow to ensure that you are not purchasing from a Puppy Farmer: 1. Try to ensure you visit the puppy whilstitisstill with its Mother.
2. Do not arrange to collect a puppy from any other location than that of the breeder.
3. Ensure that you are given any KC documentation, if pedigree.
Whilst Midland News Association publications take great care to avoid publication of advertisements from Puppy Farmerswecannot acceptany liability should readers purchase from this kind of establishment.
Items For Sale Items Wanted Plumbing &Heating Removals House Clearances In Your Garden Pets Corner Guns &Dogs Gardening Services Property Maintenance Roofing Blinds Handyman Services Driveways &Patios Furniture Aerials Full Time General Accommodation To Let GUTTER REPLACEMENT /Repairs, Exterior Painting, Jetwashing Fencing, Turfing, Garden Clearance &Gardening 07967 720740 NEIL THE ODD JOB MAN for allthose jobs youHATE! BASED IN TELFORD Gardening Gutter cleaning &repairs Jet spraying Shed Re-Felting &Painting Call Neil for a FREE estimate 01952 272354 07588 897768 www neiltheoddjobman.co.uk ALL OTHER WORK CONSIDERED BRETTELLS specialise in House clearances. Free Appraisal. Probate and Insurance Valuations for solici tors. 01952 815 925 From tap washers to complete installations, Call 07772 106 270 (Based in Telford) Visit: www.aaaps.co.uk Credit cards accepted REGULAR GARDEN MAINTENANCE WEEKLY, FORTNIGHTLY&MONTHLY Tree felling, pruning, shaping, fencing, driveways, slabbing, turfing, stump removal, hedge trimming, lawn mowing, Call Josh for afreequote 07825 588284 JCGardenServices@yahoo.com www.jc-gardenservices.co.uk TREE SURGEON &LANDSCAPING Garden Services JC (T&CsApply ALL TRADERS Claimyour FREE ADVERT Now! CallClaireSmith: 01902319661 claire.smith@expressandstar.co.uk ASS ISTED NEUT ERING / SPAYING (DOGS) For more infor mation phone between 10am -6pm 07553 245566. SPECIALISTS IN ALL TYPES OF ROOFING &EXTERIOR PAINT WORK •Firestone Rubber Cover •FlatRoofs •Leaking Roofs •UPVC Fascias, Soffits &Cladding•Chimney Repairs Maintenance 01952899148 07867842091 FREE quotes Jones’sProperty Fully Registered Company Aname you can trust. We are aFamily run business 25% off with this advert! office@jonesspropertymaintenance.co.uk www.jonesspropertymaintenance.co.uk AFULL GARDENING SERVICE All jobs covered and undertaken. Call Alan on 07754 569378. WANTED Air Guns, Shot Guns, Antique Guns Etc, Vintage Animal Traps &Taxidermy 07968 624202 Driveyourself to anew career. Jointhe Arriva Buses familyatTelford Depot andbecome abus driver: Apply todayat arrivabusjobs.co.uk or email telfordjobs@arriva.co.uk Full and parttime positionsavailable, withpotential overtime Health assuranceprogrammeto support employees and theirfamilies Free BusTravelfor employees, partnersand children Full training provided for trainee drivers AERIAL/SKYSPECIALIST ANY TV REPAIRS Digital Aerials Fitted Sky &TVWall Mounts Free Quotes. 7days 07850 330251 SAYCE’S OAKENGATES ALL FRIDGES,FREEZERS,FURNITURE, BEDS AND GARDEN ITEMS,ETC HOUSE CLEARANCES Saleable Items Collected Free Call Debbie on 01952 610337 or 07966 432751 Topqualityverticalblinds Roller blinds,Senses roller blinds,Venetian blinds Wooden blinds,Faux Wood blinds,Visionblinds Available in ahuge range of fabric colours and designs NOWMANUFACTURERS OF PERFECTFIT BLINDS We arenow doing pleatedbifold doors 01952 240 222 email sales@telford-blinds.co.uk www.telford-blinds.co.uk Paul Myler Transport 07729 697 353 paulmylertransport@hotmail.co.uk
BASICS REMOVAL Value,reliable, Almost anything, almost anywhere
ABACK TO
must ensure that they meet all necessary legal require ments for owning and using guns.
It is an offence under the Accom modation Agencies Act 1953, for an agency to charge afee simply for the registration of your require ments and/or supplying particulars of premises to let. HAVE YOU CHECKED your advertisement today? We would respect fully remind advertisers that it is their responsibility to inform the publish ers of any mistakes or inaccuracies on the first day of publication.
Ironbridge Road Madeley Telford TF7 5HX I b id R d M d l T lf d 3 Passionateaboutlearning Haberdashers’ Abraham Darbyiscommitted d to protecting children and young people. All poosts working with children, young people and vulnerable adults will be subject to an enhanced DBS check(including acheck of the Barred List) and essential pre-employment checks. DESIGNNATED SAFEGUARDING LEAD We are looking to appointa Deputy Designated Safeguarding Lead to supportthe Lead DSL andexisting safeguarding team in dealing with anychildprotection and safeguarding concerns that arise at the academy. Ideally the successful candidatewill be fully qualified and experienced, howeverfull training and supportwillbeprovided.The role will also involveworking with the Assistant Vice Principal to support Looked AfterChildrenand their families/carers. Further information and an application pack are available from ourwebsite: https://www.haberdashersabrahamdarby.co.uk/support-staff-vacancies/ If youwish to discuss the post in more detail or wish to visit us, please contact MrsBithell, Assistant Vice Principal/Lead DSL Email: angela.bithell1@taw.org.uk Tel: 01952386064. Theclosing datefor applicationsis3pm on Friday2nd December 37 hoursper week,term time +1week Grade 5, Point9(£12.8790 per hour) subject to payaward LOGS ASH Split ready to be sea soned for next year. £70 pick up load. 07877 816100. UNUSUAL SPROCKER PUPS White+red/caramel markings. homebred.Ready 3/12. Must be seen £800 07703752004 WANTED AIR RIFLES and air pistols and accessories by private collector. Will pay up to £200, cash waiting, will collect. 07884 966977. 01743 630105 •01952 928107 • Block Paving • Walls &Patios • Tarmac • Landscaping • Turfing • All types of groundworks • Cleaning, Sealing &Repairs www.drivebuildpaving.co.uk BROSELEY FLATS TO RENT Birnbeck Housing Association have ashort open waiting list for 2bedroom flats to rent Contact: 02082018484 FURNITURE FOR SALE Due to downsize Two seater settee, DFS, grey, as new condition, £150. King Size Bed, base and headboard, new, £195. Solid Oak furniture, sideboard, TV Unit, smallcupboard and nest of tables, price on application. Small bedroom cabinets, £15. Telephone 01746 767856. 3 HOME& SERVICES 4 PETS & ANIMALS 6 PROPERTY 7 JOBS FORGREAT BUSINESS RESULTS CALL 01952244244 TELFORDJOURNAL | THURSDAY,NOVEMBER 24,2022 26
ALUMINIUM
For parrots, 6ft x3ft x3ft, 3/4 mesh 16G, sliding trays at bottom and middle door, can make 2boxes,very good condition £150 ono. 01746 552279 after 4pm.
Public Notices Cars Over £1500 Cars Over £1500 Classic Cars Motorbikes Cars Under £1500 Scrap Vehicles Scrap Vehicles Full Time General A1 AUTOBREAKERS J.M.S TOP PRICESPAID Payment on collection CARS-VANS-MOT FAILURES Skips Supplied FOC•Collection Service FERROUS &NON FERROUS METALS WANTED 01952 580736, 07931 996955 Licenced to take your endoflife vehicles Certificate of Destruction Issued T&C’sapply WANTED Cars, Vans &4x4s Scrap Damage,Faulty Vehicles &MoT failures Min. £130 to £5,000 (T&C Applies) INSTANTPAYMENT TooGood to Scrap Minimum Paid £200 to £5,000 TopPrices Paid for Quality Used Vehicles ANY AREA -ANY TIME 01743 620618 Free ring back service 07506 110313 salop vehicleremovals@gmail.com 1hour collection service Unwanted Vehicles Removed FREE CHEAP CARSFOR SALE Vehicle RecoveryService from £30 ABSOLUTELY all Classic vehicles wanted from 1940 to 1994, any condition, cash paid. 07973 798488. BoroughofTelford&Wrekin The Council proposes to makethe Borough of Telford& Wrekin Winifreds Drive, Donnington (TemporaryProhibition of Traffic) Order 2022 under the Road Traffic Regulation Act1984, in order to undertakedrainage upgrade works. The order becomes operational from the 5/12/22. The following road is affected: Winifreds Drive,DonningtonfromjcnofWinifredsDradjtono10WinifredsDrtoo/sno12 WinifredsDr.Alternativerouteswillbesignedonsite.Themaximumdurationis18 months,buttheworksareexpectedtobecompletedbythe16/12/22. Anthea Lowe,AssociateDirector: Policy&Governance. TemporaryRoadClosure NoticeTCC-07724/11/22 TWCLP03816 LEGAL /PUBLIC NOTICES For convenience you may email any advertising requirements. Please send emailto publicnotices@ mnamedia.co.uk or call Suzanne Cooper on 01902 319695. Please include aname and contact number for confirmation of receipt. OUR ADVERTISERS are reminded that it is an offence under the Scrap Metal Dealers Act 2013 to buy scrap cars/metal for cash. ADVERTISERS ARE REMINDED that the Business Advertisements (Disclosure) Order of 1977 requires that advertisements must clearly differentiate between Private and Trade. RENAULT CLIO DYNAMIQUE 2010, 1.5 DCI, Diesel, 60.4mpg, Colour Beige, £30 road tax. Other Features: alloys, CD player, car mats included. ££1,400 01952 505205 HYUNDAI 130 2010, 50,000 miles, very tidy, petrol, owner no longer needs acar. £2,700 ono 07967 649874. BoroughofTelford&Wrekin TheCouncilproposestomaketheBoroughofTelford&WrekinFrameLane,Doseley (Temporary Prohibition of Traffic) Order 2022 under theRoadTrafficRegulation Act1984, in ordertoundertake manhole chamber works. The order becomes operationalfromthe5/12/22.Thefollowingroad isaffected:FrameLane,Doseley between property No.13and property No.19. Alternativerouteswill be signed on site. The maximumduration is 18 months,but the worksare expected to be completedbythe9/12/22.AntheaLowe,AssociateDirector:Policy&Governance. TemporaryRoadClosureNoticeTCA-07724/11/22 TWCLP03824 MITSUBISHI SHOGUN WARRIOR 3.2TD Seven Seater Top of the range Long MoT, 102,500 miles Outstanding condition, first to see will buy £5,500. Bridgnorth 07496 172252. VAUXHALL MERIVA AUTOMATIC DIESEL 1686cc MoT May 17, 2023, 81,000 miles, regular service, 4new recent tyres, runs well, reluctant sale due to health. SOLD MITSUBISHI OUTLANDER GX 5DI-D AUTOMATIC 63 reg, diesel Seven seats, 2owners MoT, 2023. Service history. Sunroof, Alloys. Many Extras. Black, with black leather interior Towing kit. Excellent condition. £7,999. 07836 204450 deolsuk@hotmail.co.uk KYMCO AGILITY Motor scooter, 50cc, 2011 reg, 3,500 miles, new battery, new carburettor, MoT til May 2023, good condition, used daily, £350. 07800 664486. Ironbridge Road Madeley Telford TF7 5HX 3 I b id R d M d l T lf d Passionateaboutlearning Haberdashers’ Abraham Darbyiscommitted d to protecting children and young people. All poosts working with children, young people and vulnerable adults will be subject to an enhanced DBS check(including acheck of the Barred List) and essential pre-employment checks. TEACHINNG ASSISTANT We are seeking to appointanexperienced and enthusiastic level2 Teaching Assistant to supportpupilswithsocial, emotional and mental health needs(SEMH) in our on-siteAlternativeProvision Centre (“ADAPT and Thrive”). 33.25 hoursper week,term time only Grade 3, Point3(£10.2380per hour) subject to payaward To startbyJanuary2023 or sooner Further information andanapplication form areavailable from our website: https://www.haberdashersabrahamdarby.co.uk/support-staff-vacancies/ If youwish to discuss the post in more detail please contact: MrsCPrice (Vice Principal forSEND) Tel- 01952386000email- clemency.price1@taw.org.uk Applications should be returned to theHRManager: email- deborah.tudor@taw.org.uk The closing datefor applicationsis3pm on Friday2nd December We reserve the right to closethisadvertisement early if we receiveahigh volume of suitable applications. VAUXHALL COMBO CDTI VAN 2012 SWB 120000 miles 2owners mot Oct 2023, service history. Timing chain, EGR valve replaced, very good condition. £2,950 ono 01743 367172. FORD KA 1.3 52 reg., wine, 57,000 genuine miles, 12 months MOT, PAS, CD, excellent condition, drives superb. £995 ono 01743 440556 /07783 431565. LAND ROVER FREELANDER 2 2011, 55323 miles, Great condition. 9stamps in the book, genuine parts used. Serviced 2 thousand miles ago. 12 months MOT. Great colour, metallic blue with cream interior. Two keys. Super clean, auto. one owner, satnav. £8,999 07966752663 SKODA OCTAVIA Ambiente, 1.6, FSi petrol, 5dr hatchback, 2007, 109K, silver blue metallic, new battery and starter motor, owned from new, FSH, good condition, 8months MoT, £1,995. 01547 550283. 8 MOTORING 9 PUBLIC NOTICES LOOKINGFOR A CAR? FINDITWITHCLASSIFIEDS Search hundredsofquality newand used carstoday! Visit: classifiedads.shropshirestar.co.uk TRADELOCAL: 01952288844 SELL LOCAL: 01902244244 BOOK ONLINE: bookanad.shropshirestar.co.uk BUY, SELL &TRADE LOCALLY 24/7 ONLINE Only£9.99 From£25.99* Price includes 6nights in print and online SELL YOUR CAR QUICK WITH A PIC! DATE // TIME *CheaperthanEbay/checked2017. Private advertisersonly SELL YOUR UNWANTED ITEMS from £9.99* TRADE LOCALLY Reach 80,000 potential customers CHEAPER BOOKED FREE bookanad.shropshirestar.co.uk SOLD £15 THURSDAY,NOVEMBER 24,2022 | TELFORDJOURNAL 27
Changesare keytoCorolla’s success
BILLMcCARTHY
Estate cars or tourers have evolvedfromlarge barges to thesleek and stylish.
They marrycoupe-likestyling, with little compromise on interior space,witheye-catchingprofiles.
Recently upgraded,itseems hard to believeCorolla hasbeen around since1966and hasbeenthe best-selling carinthe world
So incrementalchangehas been thekey to itssuccess
It nowfeaturesthe newToyota SmartConnect+multimediasys tem, newtrims,colours andaspe cialnew version of theCorolla Trek TouringSports, apumped-upmore muscular version of theestate.
It looksgood with aswooping, coupe-likeprofile andlarge low set grillecomplemented by slim head lightclusters. Therearfeaturesa more steeplyraked rear screenand onthismodel,twinexhaust pipes
Theinterior features theupgraded ToyotaSmart Connect+ which provides much faster response and provides newfunctions andoperates 2.4times faster than thepre vioussystem.
It is operated viathe eight-inch centraltouchscreen to give instant access to aseriesofsmart connect ed services, includingcloud-based navigation with continuous, “always on”trafficinformation
The“HeyToyota” voicecontrol requests canoperate themultime diaand navigation
Software updatesare madeseamlessly over theair,and easy smartphoneintegrationisprovidedvia AppleCarPlay,withwirelesscon nection, andAndroid Auto by con nector
Allspecs come with automatic rear camera,LED headlights,heated frontseats with this range-topperall kindsofbells andwhistles like18-inch alloywheelsBi-LED headlights andpart-leatherseat
upholstery.The soft-touch finish, satinchrome trim andpiano black finish give thecar apremium feel andisacomfortable placetobe. Boot capacity is 581litreswith theseats in place, whichexpands dramatically in true estate fashion with therearseats folded
Theone-touch remote lever folds therearseats to create afully flat floor, whilesidewallstorage pock etsbehindthe rear wheelhousings addextra capacity
Expertsinhybridtechnology with theintroductionofthe Prius,
thetwo-litre petrolengine/electric motorhybridset-updeliversgood pace andeconomy delivered viaa CVTtransmission.
Engine andmotor combinetodeliver180bhp,which propelsthe car to 60mphinaroundeight seconds with claimedeconomyofbetween 50 and60mpg
Ride andhandlingare goodfor abig car, with theride firm feeling composedand capableofdealing comfortablywithall butthe worst surfaces
Toyotahas stuckwithself-charg-
inghybrids,which meansthere is no need to worry over finding charging points
They complement otherplug-in andfull electric models with alloffering thebenefitoflower taxation andbenefit-in-kindtaxation.
AllToyotas provideextensive safety kitand theCorolla offers driver andfront passengerfront andsideairbags,driver’s knee airbags andfull-lengthcurtain shield airbags
Otherfeatures includePre-Col lision System,adaptive cruise control, lane departurewarning and Road Sign Assist,which recognis es road signsand commands and showsthemonthe centraldisplay
FACTFILE
TOYOTA COROLLA SPORTS TOURER EXCEL2.0 HYBRID
Price: £36,260
Mechanical: 180bhp,1,987cc, 4-cylinder petrol engine andelectric motor driving front wheels viaaCVT automaticgearbox
Maxspeed: 112mph 0-62mph: 8.1seconds
Combined mpg: 50-53
CO2emissions:118g/km
Warranty: 5yrs/100,000 miles
Porscheaddsnew baby to 718range
Porsche hasintroduced astrikingnew StyleEdition to its718 Cayman and Boxstermodels.
Setapart from therestofthe range through itsRubystar Neoexterior colour–which harksbacktothe 964-gen eration911 CarreraRS– theStyle Edition incorporates 20-inchgloss black alloywheelsand blacksport tailpipes ThePorsche name is emblazonedat thebackinhigh-gloss silver, too.
On theconvertible 718Boxster Style Edition, theBoxster letteringisembossedabove thesidewindows
Buyers opting forthe 718Style Edition canchoosefromone of twono-cost packages –one whiteand oneblack Both featuredecorative stripesonthe luggagecompartment lidatthe front, as well as decorative letteringrunning alongthe side of thecar
Thereare also blackand whitehigh
glosspaint finishes forthe wheels.
TheStyle Editioncarsalso geta blackleather interior packagewith contrast stitching, as well as illuminateddoorsillsand thePorsche crest appliedtothe headrests. Allcarscome with an upgraded levelofstandard equipment,too,including Bi-Xenon headlights with LEDdaytime running lights, AppleCarPlay andcruisecon trol. Dual-zoneclimate controlis in cluded as standard too, as is aheated multifunctionsteering wheel.
TheStyle Editionis basedupon entry-levelversionsofthe Boxster andCayman, whichusesafour-cylinderturbocharged petrolenginewith 295bhp and380Nm of torque, driven to therearwheelsthrough astand ard-fitsix-speed manual gearbox Porsche’s PDKautomatic canbe fit tedas an optional extra,too
DATE // SELL YOUR CAR QUICK WITH A PIC! 01952244244 bookanad.shropshirestar.co.uk Only£9.99 6nights in print and online* *CheaperthanEbay/checked 2017.Privateadvertisersonly CHEAPER THAN* 3GREAT REASONSTOSELL YOUR CARWITHCLASSIFIED: 1. NO HIDDENCOSTS -the price yousee is theprice youpay 2. Over 680,000 potential buyers each week 3. CheaperthanEBAY!* MOTORING TELFORDJOURNAL | THURSDAY,NOVEMBER 24,2022 28
Leonie is making amark in themiddleofthe park
JOEEDWARDS
Having takenuprefer eeingonawhim, Leonie Pryorisnow thriving in theworld of rugbyand hopes many others will follow suit.
Pryor,fromBurwarton,admits shewas ‘quite late’torugby and afteran injury forced hertostep away from playing, sheturnedto officiating
What wasonlyoriginallyintended to be ahobby to keepher involved in thesport hasnow turned into a full-timerolewiththe RFUand the chance to be involved in elite-level fixtures –havingservedasan as sistantreferee forthe rugbysevens at theCommonwealthGames in the summer
“I wasquite late to rugby. Istart ed playinginmyearly 30s, got smashedabout afew times, and then decidedtoget into refereeing afterakneeoperation –thanksto an injury on therugby pitch,”ex plainedPryor
“WhenIdid thecoursein2015, Ionlythought I’dgo anddoafew kids gamesatthe localclub.
“I didn’t have anyambitions to do anything else.The chairman of the NorthMidlandssociety,though, just said ‘why wouldn’t you do senior rugby?’
“I kind of shrugged my shoulders andwentwiththe flow, andit’sgone onfromthere
“I’vehad four Women’sPremier ship Cupgames whichI’vebeen refereefor,and I’ve been thefourth officialfor theEngland/Ireland women’s fixturein theSix Nations.
“Lastyear, Iwas assistantref eree at theRed Bull Sevens at St George’s Park,which wasunder Covidrestrictionsand awarm-up eventfor theOlympics.
“I’vebeenassistant refereeing at men’sNationalLeague2.Ilove
beingpartofthe team of matchofficials forthese fixtures,it’sa fan tastic opportunitytoworkwithand learnfromrefereesoperatingat higher levelsofthe sport.”
Pryor’srise from grassroots rugby to refereeing professional fix tureshas seen herentrusted with thedevelopment of young match officials
TheRFU areaimingtoboost participationin women’s rugbyand developmorereferees, with various courses availableacrossthe coun try.
“I runthe YoungMatch Official
programmeat theNorth Midlands society,” said Pryor. “It’sopento anyone.There’s ayoung girl I’ve coachedthrough that programme whonever playedrugby
“She’d been told by aboy at school that ‘girls can’treferee’, andnow sherefereessenior men’sgames.So, that’s pretty cool. She’sdefinitely provedhim wrong.
“Wecoach andmentorthose youngsterscomingthrough,and I also work forthe RFUas aMatch OfficialDeveloper
“I started that in Januaryofthis year.Sodoing aref’s course on a
whim to stay in thegamehas led to aprofession, beinginvolvedin coaching andmentoring refereesat alllevelsofthe community game.”
Pryor callsherself the‘weeref eree’and is awell-respected figure amongfellowofficials andplayers alike.
The five foot (not your stereotyp ical referee) 40-year-oldevenspent herlastbirthdayrefereeinga Wolverhampton first-team matchand lovesthe camaraderiethatcomes with it
“That’swhy Igiveupalot of my free time to go anddoit,”saidPry or
“There wasa game last season at Ludlow wheretheywereplayingHereford, so it couldhavebeen quiteaclash.
“Ludlow won24-0 andIhad both teamspraisingme. Iwentintothe clubhouseafterwards andhad three oldboysfromHerefordtelling me what agreat game I’dhad and how much they enjoyedit.
“That’sjustthe icingonthe cake if you canget praise from thelosing team
“I’vehad agood laughand made some amazingfriends alongthe wayhad greatexperiences both and offthe pitch, despitegetting into it quitelate.
“I have to thankNeilReid-Warrilow, whoisalso from Shropshire, forhis help.Hehas takenmeunder hiswingand coachedmefor thelast fewyears, Iwouldn’tbewhere Iam withouthis guidance andencouragement.”
On otherspotentially followingin herfootsteps, sheadded: “There’ll be massiveopportunitiescoming down thelineand thegrowthofthe women’sgameis farexceeding any otherpart of thegame. Especially nowthe RFUhavewon thebid to host WorldCup 2025
“It’sgrown exponentially, really, andit’samazing to seewhatgetting into refereeing does foryoung wom en’s personal growth anddevelop ment,asithas done forme.”
Champions are playingcatch up in thetitle race
ChelmarshBare in danger of finishingoutside thetop two of theBridgnorth &District SnookerLeaguefor the first time in 34 years.
Acrushing4-1 defeat at the handsofleaders Broseley B, leaves thereigningchampions five points offthe pace andneed ingtoplaycatch up in orderto keep theiruniquerecordintact.
Andonthisoccasionthe 4-1 windid not flatterBroseley.It wouldhavebeen5-0 if it hadnot been fora blackballwin from Gary Smithagainst Andy Car son.
Pete Thompson, Mick Bre zwyn,Eddie Mullardand Paul Lloyd allcruisedtovictory as Broseley Bextendedtheir lead at thetop ofthe tabletothree points whileChelmarsh B slippedtofourth.
Chelmarsh’sdefeatallowed ChelmarshSc andMaddocksto move up in to second andthird positions –bothteams also win ning 4-1against Broseley Aand Woodfieldrespectively.
ForChelmarsh, Carl Walker wasincruise controlagain as he beat Andy Garbett. Meanwhile, ChrisPetford, IanPostans and TerryAskew didnot find it quite so easy when playingagainst BrianEdwards,NeilCaswell andGaryWatson.
Matt Smout, whohas been in fine form of late,earnedBrose leytheir consolation by beating Matt Judd.
Maddocks’sDan Morris, Tom Maxfieldand JamesBrennan were never troubledintheir threeframesagainst Woodfield’s RichardCastle, JasonMor risand Luis Ferraro. Maxfield knockedinthe highestbreak of thenight, 48
Paul Harper knew that he wasinagameplaying against Callum Drewettbut managedto pull through, whileNeilPearson wasMaddocks’sonlycasualty, losing to Pete Hyland
St.John’sAcontinued their recent return to topformwitha 5-0 cruise againstAlveley C. Dave Summers,MartinLip pitt andTim Steele were never troubled; thebestperformance coming from Summerswho re corded a33break when beating SteveColdecott
ShifnalTownFCLadieshavebeen
Football fever is currently sweeping thenationwiththe World Cupunder wayand Veezu– which operates acrossthe SouthWest of Englandand as Go Carz in the Midlands as well as AmberCarsin Leedsand Dragon TaxisinWales hasalwayschampionedfootballat alllevels.
Although theWomen’sWorld Cupdoesn’t take placeuntil 2023, ShifnalTownFCLadies, whoplay in West Midlands Regional Women’s Football League,are looking forwardtotheir ownfuture fix turesin theirnew Go Carz-spon soredawaykit
Fans visiting ShifnalTown’s AcoustafoamStadium home ground mayalsospotGoCarz’s brandedbanner.
MariaBell, captainofShifnal FC Ladies said:“Thenew kitspon soredbyGoCarzhas helped boost morale afteratough fewyears for sport.
“We’re really grateful to have a biglocal brandonboard andhope thekit brings us luck at this season’sawaygames.”
Graham Hoof, Go Carz Regional Director,said: “We’re delightedto have been able to supportShifnal Town FC Ladies with newkit.It’s importanttousthatwegive back to thelocal community, andhope ourefforts help theteamhave everysuccess.”
AndalthoughRob Powell’s game wasalittlescrappy at the start, a31break from himend ed anythreatfromReg Burton KevinHawkins completedthe St.John’sroutbybeating Chris Jepson.
St.John’sBclimbed twoplac es afterbeatingAlveley B4-1
On song forthe away team were JasonBrown andKevin Smith, whoonlyallowed their opponentsacombined totalof just seven points
Wins forMikeCrawley and Pete Williamswerealittlemore challenging. Mark Jones put up agood fight andmighthave made it 5-0 hadthe finalblack gone hisway.Thatwas potted by Martin Coffey JnrtoearnAlveleytheir consolation
RefereeLeonie Pryorismaking impressivestrides in therugbyworld
handed aliftafteragreeingasponsorshipdealwithprivate hiretaxi firm Go Carz
–Shifnal
Ladies lineup in theirnew playing kit
ShifnalLadieshandedapick-me-upwithGoCarzdeal Starsinstripes
Town
joe.edwards@mnamedia.co.uk
SPORT THURSDAY,NOVEMBER24, 2022 | TELFORDJOURNAL 29
Owen eases to impressive win on homesoil
Telford’sMacauleyOwenex tended hisrecordto5-0 with a decision victoryagainst fellow lightweightEduardo Valverde in FrankWarren’sBTSport show at TelfordonSaturday.
BCBPromotions-managed Owen madethe perfectstart in hishome town,sending his Spanishadversarytothe can vasmidway throughthe open inground thanks to abeautiful straightlefthand.
TheSpaniardremainedde fiantthroughoutthoughand showed some serioustoughness to make it throughtothe final bell as he continuedtobemet by abarrage of shotsfromthe BCB fighter.
Owen started targetingthe body of hisopponentinthe later rounds andhehad successdoing so,withthe Nicaraguan-born Valverde’s grimaces worsening with each shot that landed It wasnot to be though as the experienced Valverdemanaged to getthrough theroundsand denyOwenwhatwould have been hissecondstoppagewin in theprofessionalranks.
The25-year-old dominatedall sixroundsand cruisedtoadom inant points triumph– referee ChrisDeanscoredthe contest 60-53infavourofthe southpaw
No change at the topasrivalswin
Park Rangersand TelfordScaffold ingServicesare stillneckand neck at thetop of theTelford Sunday Football League PremierDivision –bothwithperfect starts andsepa ratedbyaone goal difference
They both won4-0 this week Park away to MadeleyCCand the Scaffs at home to Polonia Telford.
TF3travelled to ShifnalImpe rialsand won3-1 andSandbrook Vaults entertainedApleyUnited andwon by thesamescore
Rose &Crown also maintained theirperfect startatthe topofDi vision Onewitha6-1 winatBell& Bails. Second andthird-placed AFC Phez andFCQueenslostgroundaf tersharing thespoilsinathrilling 4-4draw.
AFCWrekinclosedthe gapon thosetwo with adecisive 6-0win at WenlockOSA andTurf’svisit to CottageSpringended earlythrough playerinjurywiththe scorestand ing5-0 in theirfavour.
TheUnicorn took thespoilsby theodd goal in nine at Wrockwar dine Wood Juniors.
Shifnalseeingdoubleafter successful year on course
Shifnal golferssnatched thedouble in theLadies County ScratchLeague andMinileagueinwhat wasa fittingend to a successfulyear.
Overcoming Llanymynechin the County ScratchLeague final, Shif naltravelled to Ludlow Golf Club forthe clashand returned home victorious with a2-1 success.
TheMinileagueteamalsore turned home with atitle,having beaten Market Draytoninthe final of thecompetition
Both sidescompleted theday with twowins, leaving thematch to be decidedbythe aggregatenumber of holes –which went Shifnal’sway by one.
nnn n
Stafffroma Shropshire insur ance companyare celebratingafter winningacharity golf challenge namedinmemoryofa much-loved former colleague.
TheteamfromHenshalls Insur ance Grouptookonateamfrom ThrogmortonAssociatesWealth Management to competefor The BryanCutterCup at Shrewsbury Golf Club
Andthisyear, it wasthe Hen shalls teamthatwas victorious, bringing home thecup that’s named forBryan Cutter –adirectorofthe firm whodiedafteralongand cou rageous battle with cancer
ThrogmortonAssociatescovered thecosts of theevent andHenshalls have madeadonationof£250to SevernHospiceinBryan’s memory on behalf of everyone taking part Martin Pitchford, forHenshalls, said:“TheBryan Cutter Cupisa wonderfulway to honourBryan’s life andhis memory andithas now become an annual eventthatweall look forwardtoand whichcreates
GOLF sports@mnamedia.co.uk
some really positive friendly rivalry.
“We’dliketothank everyone whotookpart this year,and we’re delightedtohavepippedthe Throg mortonAssociatestothe postby just asinglepoint in theend
“The daywas playedingreat spirit with lots of laughs andban ter, andwe’dliketothink that Bry an waslooking down on us as we broughthis cuphome forthe first time ever.”
Nick Jones,fromThrogmor tonAssociates, said:“It’s always apleasuretojoinour friendsfrom Henshallsfor such an enjoyableand positive day.
“Weweredisappointed to have missed outona hat-trickofwinsas we hadwon both thepreviouschal lenges,but we’llbebackstronger andwell-prepared fornextyearand determined to getour handsback on thecup.”
Golf returns
Arscott Club Captain’sDrive-In: 1 RichardSaunders(17)40pts;2 JohnBunting (10) 39pts; 3Patrick Cudmore(5) 39pts; 4Peter Oakley (21) 39pts.
Ladies’fourclubs anda putter: 1JaneO’Brien (10) 18pts; 2AnneHill (12) 15pts; 3Liz Grif fiths(15)14pts.
Llanymynech
Ladies’12-Hole Stableford: 1Tanya Cook 26pts; 2Ruthie Lockyer 25pts(on countback)
Wrekin
Seniors’ Winter Stableford 2 (9 Hole). Division One: 1Allan Rogers 21/7;2 Phil Fulloway 19/7; 3DaveRobinson19/7. Division Two: 1Keith Gray 22/11; 2Neil McLeod 19/11; 3David Rogerson 18/11.
Scottreaches topofParks association
Shropshirebowls supremoPhil Scotthas nowreached thetop of thetreeinthe BritishParks asso ciation
He waselected presidentofthe body foraminimum term of one year at itsAGM on Saturday AndMalpas-basedScott is al readyBritish Parks’ generalsecre tary,chief executiveand junior or ganiser, whilehis wife Marieisits registrarand ladies secretary.
Having aserving BritishPresi dent meansNorth Shropshire will host theBarlows-backed Senior Merit finals on August 27,inad dition to theJunior andUnder-25 Merits on July 23, thejunior five-a side teamevent in September and an open pairsonOctober 1. Scott, whoisalso chairman of theShropshireassociation and Whitchurch League amongstmany
things,said: “There’s nota lottore port from theBritishParks’annual meeting.
“The only rule change that passed wasthe veterans inter-coun ty will be moving to atwo-day event rather than averylongone dayer. Honararia wasincreased by 10 per cent in line with CPIand allofficers were re-elected,althoughchairman CraigMcGuiganwishestostand down duetoworkcommitments but will carryonuntil areplacementis found.”
n Shropshire bowlskingCallum Wright hasnot enjoyed themost successfultrips up theM6since the main season finished
Butthe 36-year-oldreigning BritishSenior Meritchampionhas signed up foranother journeynorth next month to play in aspecial pro motion
TheShrewsburystarwill play in theChristmas Handicap Invitation 16 at theRed Lion,Westhoughton, Bolton –the home of theBritish Professional Panelwhere he played so many timeslastwinter.Wraight will be joined by step-fatherRich GoddardonSaturday, December 17, in aline-up that includes fellow big guns SimonCoupe,Wayne Ditch field, Noel Burrows, Mike Leach andJoshMordue.
“It’san11amstart with afan tastic fieldof16and thedrawto be made on theday,” said aPanel spokesman.
Wraight’slatestventure to the Winter Sweeps at Cleckheatonlast week endedwithanagonising 21-20 firstround loss to Ross Ingham,the eventual winner of the£160 first prizebeing Yorkshirecountyman Stuart King
Shifnal’stitle-winningScratch League team of RosMoore, Alex Peters,Ann Peters andFernClark gettheir hands on theleague champions’shield
Macauley Owen lands apunch (Pic:QueensberryPromotions)
SPORT TELFORDJOURNAL | THURSDAY,NOVEMBER 24,2022 30
Henshallscelebrate, from left:Mitch Gough,Adrian Burton,Simon Burdon, Neil Atkinson,MartinPitchford,Mark Freeman andPeter Richardson
Presidentrole for Phil Scott
Morris is themainman forfree-scoringStretton
Church StrettonTownled the wayasthe goals flowed inthe lat estround of SalopLeisure League games.
PremierDivisiontitle hopefuls Strettonfound theirshootingboots to record aresounding 11-0 win againstErcallColtsJuniorsEvo lution
HarryMorristookthe individual plaudits with afour-goal salvo JamesHillwas also in fine form ashebagged ahat-trick whileDean Richards struck twice. Benjamin Hartshorne andMatthew Cole roundedoff thescoring
Butdespite hittingthe goal trail, second-placed Strettonare still playingcatch-upinthe titlerace.
That’s because leadersDawley Town made it aperfect 10 wins from 10 league games.
PreesUnitedwerethe latest side to be sweptaside as they were beat en 5-0
Daniel Beddows andCharlie Knowlessharedtop billing for Dawley with twogoals each.Jeff Watkinswas also on target Ludlow movedupintothe top threeonthe back of a4-0 triumph at home to Broseley
MorganMillardand RyanClarke both foundthe netin firsthalfwith HarryJones andJames Byattadd ingfurther goalsafter thebreak
GobowenCelticcontinued their recent free-scoring form with a comfortablesuccess away to MadeleySports.
They took theirgoaltally to 22 in theirlastthree outingsthanks to a7-2 win.
LewisJones bagged a first-half trickand then addedafourthafterthe break.EdRogers(two) and LouisMorrisjoinedhim on the scoresheet,whileCraig Picken and
Madeley.
TomGalewas ahat-trick hero forMorda United in theirvictory againstShrewsburyUp&Comers
Jordan Gerrard also foundthe nettocompletea4-0 win.
MatthewStuartand JatonVer nonwereontargettoearnWrock wardineWood Juniorsa2-0 suc cess at home to St Martins.
Therewas just onematch in Division
Shrewsbury Club Tour eventproved to be asmash hit
TheITF WorldTennisTourevent held at TheShrewsburyClub–thebiggest indoor women’s tennis tournament staged inthe UK since 1995 –has been hailed an outstand ingsuccess
TheBudgenMotorsW100tour nament featured five players cur rently ranked in theworld’s top 100and waswellsupported by local tennis fans,withacapacitycrowd of more than 500peopleenjoying finals day.
Theeventalsoattracted excellent backingfromthe Shropshirebusiness community.
Dave Courteen, TheShrewsbury Club’s managing director,saidit’s only possible to bringsuchhigh-profile events to thetownbecause of thesupport theclubreceives from around thecounty.
Thetournament, part of the Lawn Tennis Association’s Performance Competitions Calendar, whichaimstoprovide enhanced playingopportunities forBritish players,featured five playerscur rently ranked in theBritish wom en’s top10.
Courteensaid: “The LTA’sdelighted with how thetournament wasstaged. Ithink it exceeded theirexpectationsinterms of all theinteraction andthe events we held around thetennisinthe hospitality marquee opposite themain entrancetothe club
Sportshall League action is finallybackontrack
afterafalltocompletethe twolap race then laterreturning to the tracktowin the five-lap event.
“That’skey in why they wanted to bringthe eventtoShrewsbury becausetheyknowthe local community really respond, including thebusinesscommunity with their excellentsupport
“Itwas agreat eventfromour perspectiveand we aregratefulfor allthe supportfromthe sponsors Withoutthem, theevent wouldnot have happened
“Wehavehad greatfeedback from theLTA andtheyare really keen to come back to Shrewsbury with anotherevent.”
MarketaVondrousova wonboth thetournament’ssingles anddou bles titles
TheShropshireYoung Athletes Sportshall League returned aftera two-year breakwithalmost 80 athletes compet ingagainst each otherat WilliamBrookesSchool, Much Wenlock.
Theleaguehas traditionallyinvolved four competingclubs hosting one meetingwhere under11, 13 and 15 youngsterscompletein indoor runningand fieldcompetitions.
Covidprevented theleaguefrom functioningfor thelasttwo years, whileachangeofleagueorganiser also presented several challenges to theevents returning.
However,great co-operation betweenthe clubsensured asuc cessfulreturntoaction. Oswestry Olympiansheadcoach ChrisTid ridge took on themantleofco-ordi nating theleaguewhileBrankaSukara-FieldingofTelford AC agreed to organise the firstmeeting.Wen lock Olympiansprovidedthe appro priate equipment
Shropshireisfortunateinhav
ingseveral experienced athletics officials whoare regularlyselected to officiate at national events and they made themselves availableensuring thechildren benefitted from having ahigh qualitystarter,timekeepersand track judges to explain theprocedurestothem.
Themeeting startedwithrun ning events both on the flat and over hurdlesbeforethe hall was transformedfor fieldevents. These preparechildrenfor thetradition al outdoortrack and fieldseason andthismeetingincludedvertical jump,standinglongjump, standing
triplejump, chestpushand speed bounce.Other events such as shot put, soft javelin throw&balance testwill featureinfuturemeetings
Therewas no doubtingthe enthusiasminthe hall with tremendous vocalsupport from parents, coaches andother athletes.Thisroseto acrescendoduringthe finalevents whichwerethe fiercely contested relays
Theoutstanding performeron theday wasTelford’s KadishaNwa chukwa,who wonall of her events, whileDulcieRoach of Oswestry showed greatbraverygetting up
Speaking afterthe meeting, co-ordinatorTidridge expressed hisdelight at seeing theevent re turn aftertwo years. He said “The atmosphere in theSportshallalone made allthe effort organising the meetingworthwhile. It wasgreat to seealmost80athletesparticipating in arange of events and, above all, enjoying themselves
“Manyhavestakedclaimsfor se lectionfor theShropshireCounty team forthe West Midlands Cham pionshipstobeheldonMarch 19, though we hopetoarrange further meetingsbeforeteams are final ised.”
Tidridge waskeentothank everyone involvedin theorganis ingand onthe dayand thespirit of co-operation betweenthe clubs whichenabled it to take place.
Though theleaguedid not run last year,itwas possible to fielda county team at theWestMidlands Championshipswhere Oswestry Olympians’ Elliot O’Connor was thetop under-15 athleteacrossthe West Midlands
“Itwould be greattosee aShrop shireathlete follow in hisfootsteps thisyear”,concluded Tidridge
Vondrousova,who reachedthe 2019 French Open final, beat Eva Lysinthe singles final, before part nering Miriam Kolodziejova to vic tory in thedoubles final.
Vondrousova then went straight from ShrewsburytoGlasgow to represent theCzech Republicinthe BillieJeanKingCup Finals
Courteenadded: “The tourna ment wasabig step up from anythingwe’re organisedbefore, both in termsofthe organisation and also thequality of theplay.
“Weshouldn’t underestimatethe qualityofthe tennis we saw. Anum berofplayers competingherewill be in thetop 40 in theworld within thenextyear.
“Wehad aWimbledon semi final istfromearlier this year,Tatjana Maria, playinginShrewsbury, so thetenniswas incredible andthe levelofsupport wasamazing
“We’ve never hadsuchbig attend ancesthroughoutthe week and fi nals daysoldout when we also put in extra seating.
“I am grateful to theteamhereat TheShrewsburyClubfor how hard they worked. We also really appreci atethe supportfrommembers.”
TheTelfordACteam lineup alongsidetheir coachesatWilliamBrookes School and,right, Telford’sKadishaNwachukwa whowon allofher events
Luke Hester repliedfor
Oneand that sawBrown Clee bagtheir firstthree-point haul of theseasoncourtesy of ahard fought 2-1win on theroadatLla nymynech
SPORTSHALLLEAGUE sports@mnamedia.co.uk SPORT THURSDAY,NOVEMBER 24,2022 | TELFORDJOURNAL 31
TheOswestryOlympiansSportshall squadlineup for aphotograph
DAVIES AIMING TO RULE THEWORLD
Liam Davies has set his sightonworld domination afterbeing crowned EBUEuropeanSuper Bantamweightchampion in hishometownof Telford.
TheBCB Promotions-managed boxer,who trains with hisfather Tristan, also addedthe WBCInter national titletohis collection with a unanimous decision victoryagainst Romanian Ionut Baluta
Davies headlinedFrank Warren’s BT Sportshow at theTelford International Centre in frontofa raucous home crowdand followingan otherimpressivevictory he is ready foranother step up
“Itisamazing andanother step up in my career,” said thenew dou blechampion.“Iam13 fights in andI’vewon theEnglish,the WBC, Britishand European titles.
“I’vegot to give myself credit,but Iwillbeback in thegym soonand I’ve conqueredBritain,I’vecon quered Europe andnow let’sgofor theworld.WithBTbehindme, why not?”
The26-year-old dominatedthe earlyroundsas he used hisheight andreach to maintain control.
Thelefthook-uppercut combina tion continuedtohavesuccess for Davies as he walked theshorter Baluta on to short, sharpshots Davies didhavetodealwithalate onslaughtfromhis opponent,but executed hisgameplantoperfection to claima 116-112, 117-111,118-110 decision
“I felt comfortableall theway.I hurt my handsonhis head, andI hadablister that bloody hurt mov ingabout,” said Davies.“ButIgot thejob done, Idoneitinmyhome town as main eventand I’ve got FrankWarrenand allthe teamget ting behind me
“Lookatall thepeoplesupport ingme. Moneycan’t buythat, mem oriesfor life.
“I cruisedthrough the fight again. Idon’t thinkI’vereallybeen tested yetand Iamready foranoth er step up.Iamready to go up and up andup.
“I am levels aboveeveryone else, I’ve dusted everyone in theBritish rankings andEuropeanrankings andIwantthese big fights.The sky’sthe limitand Iwanttotouch thestars.Iamready forwhatever.”
Tigers tastevictory andthendefeat
selves up andwin theshootout.”
ButLeeds gained revengethe following nightinShropshire.
Wilkin:Win was forBucks fans
KevinWilkin reserved special praise forAFC TelfordUnited supporters whosaw theirside record a firstcompetitive win sinceAugust, winning2-1 at KingsLangley in theFATrophy.
“I’m delighted,and most pleasedfor thesupporters, who travelled in strong numbers again,”saidthe Bucksboss.
“We’ve notgiventhemalot to cheerabout this season andit’s forthose people that you most want to achieve.”
Wilkin sawhis teamsecurea firstvictory underhis steward ship in dogged fashion, over turninga1-0 deficittowin with captainMatty Brown’sdramatic injury-timeheadedwinner
“Itwas never goingtobean easy tie,”addedWilkin. “Credit to KingsLangley –they’ve asked questionsofusand couldprob ably countthemselves as alittle unfortunate
“We’ve allbeenonthe endof thosesituationsinthe course of ourcareers, andIcan understandhow disappointingthat canbe, butwhenyou’reonthe rightsideofit, it’s agreat feel ing, andit’snicetobeintothe hat(forthe next round).”
TheBucks fell behind on 17 minutes when JamesKaloczi headed home from afree-kick Kobe JaeChong levelledfor thevisitorswitha stunning strike from 25 yards.
Andwiththe clockticking into sixminutes of addedtimeand thethreatofa penaltyshootout, Browngrabbedthe winner
been even better forthe Tigers
“Tobehonest, we should have wonitinregulationtimewiththe powerplayopportunitywehad in the finalminutes,” he said.“We then should have wonitinovertime with anotherpower play chance but wehad thecharacter to pickour
With DeakanFielder,Jonathan Weaver,NickOliver, ScottMcKen zieand Jack Watkinsstill out, Ti gers addedshort term loanees Jar od Dickensonand Ross Kennedyto theirlineup.
Tigers bagged theopening goal through JasonSilverthornbut the visitors then took charge
Lawley Square,LawleyVillage,Telford,Shropshire.TF3 5BZ | 01952 324476 FRESHCHICKENCOOKEDDAILY11.00amto11.00pmIncludingBankHolidays&Weekends.EatIn,TakeawayandDelivery.MinDeliverySpend£15withinTelford FORFASTDELIVERYORDERAThttps://Lawleychicken-cottage.com/Menu/6892/chicken-cottage-telford MILKSHAKES 9FLAVOURS£3.25, TUTTIFRUTTI£3.50 6PIECE BOXDEAL 6PIECECHICKEN,4REGULAR FRIES,1.5LBOTTLE £13.99 KIDSCHICKEN FILLETBURGER MEAL£3.50 SMLFRIES, SMLDRINK&SAUCE PERIPERIHALF GRILLED CHICKENMEAL CHIPSANDDRINK (CHOICEOFRICE,POTATOES) £7.99 3MUSKETEERSSEASONALOFFER (MEALFOR3)3PCSBREADED CHICKEN,3CHICKENFILLET BURGER,3REGULARFRIES, 1.5LTRDRINKBOTTLE £16.99 MEGACOTTAGE FRIEDBOX 6PIECECHICKEN,2BREADED FILLETBURGERS,4SPICEY BREADEDWINGS,4STRIPS, REGPOPPERS,2SIDES,6FRIES £28.99 NEW INFERNO WHEN YOUORDER ON OURAPP ORDER DIRECT WWW.CHICKENCOTTAGE.COM INF 5S MEAL INFERNO BU INFERNOBITES MEAL £6.49EACH MEAL BLAZING FOR ALIMITED TIME ONLY
PublishedbyMidland News Association Ltd, 51-53QueenStreet,WolverhamptonWV1 1ES. Registered at the PO as anewspaper NEWSPAPERS SUPPORT RECYCLING Therecycled papercontent of UK newspapersin 2021 was65.7% Pricewhen sold £1.20 Thursday, November 24,2022
sport
TelfordTigersendured amixed weekendagainst NIHL National League leadersLeedsKnights Tigers claimeda penaltyshoot outsuccess in Leeds on Saturday nightbut were then broughtdown to earththe followingday when they lost thereturnclash 5-1atthe TelfordIce Rink Brodie Jesson andVladimir Luka were on target forTigersduringa 2-2drawinthe firstclash, before
wasthe hero of theshootoutwiththree saves.
coachTom Watkinsfeltthe result should have
netminderBradDay
Head
JasonSilverthorn Pic: SteveBrodie
BOXING sports@mnamedia.co.uk
Liam Davies celebratesfollowing hisvictory Pic: QueensberryPromotions
97 71 35 21 54 949 47 Leonie calling the shotsin therugby world –see Page 29