The Southern Explorer KZN 2024 Jubilee Edition # 25

celebrating our silver jubilee

The Southern Explorer Magazine and Route Guide have become synonymous with exploring the beauty, diversity and tourism opportunities on the KZN South Coast since its inception in 2002. Thanks to the support of Tourism KwaZulu Natal and formal regional tourism structures (South Coast Tourism and later the South Coast Tourism and Investment Enterprise), the Southern Explorer Magazine is recognised as the region's official tourism route guide, supported by extensive road signage.TheSouthernExplorerAssociationattributesmuchofitssuccess andlongevitytothefactthatitisanon-profitmember-ownedassociation withseveralofitsprofiledmembershavingbeenshowcasedforthelast22 years. Managed by a dedicated elected member committee, the publication and distribution of the magazine have been outsourcedsince 2008–thisyearbeingthe25thedition.

Lookingbackfromhumblebeginningstoawell-establishedbrand

MuchofthesuccessoftheSouthernExplorermagazinecanbeattributedtotherapid growth and development of tourism in the Ugu region over the last 22 years. From humble beginnings in 1998, a few product owners were able to build on a concept createdbytheMargatePublicityAssociation.By2008,theSouthernExplorerMagazine had developed into one of the top route and destination guides in South Africa. Togetherwiththe“Midland'sMeander”,“Route62Guide”andthe“CrocodileRamble”, the Southern Explorer has established itself as one of the top 4 publications in South Africa.

Tourism–theregion'seconomicdriver

Bythelate1990s,theSouthCoastofKwaZuluNatalhadestablisheditselfasoneofthe predominantandfavoureddestinationsofdomestictourists,withtourismintheregion beingbuiltonthebackofthemostamazingnaturalattributes.Initiallyknownbestfor its amazing swimming beaches and year-round mild climatic conditions, the South Coast developed into the beach destination of choice for thousands of South Africans andforeignvisitors.Naturally,associatedtourismattractionsdeveloped,andtheregion soon became known as the “Golf Coast” with the establishment of 11 superb golf courses. Beach and marine offerings have been amplified each year by the annual “SardineRun.”

Tourism and agriculture are the Ugu region's primary economic drivers accounting for a significant percentage of the region's employment. With agritourismbeingoneofthefastestgrowingtourismsectorsintheworld,theregion hastakenadvantageofopportunitiesinthissectorcreatinganumberofexciting tourismopportunities.Likewise,thedevelopmentofruraltourismhasalsoadded a new dimension to the region's tourism offering in the last few years creating a numberofjobs.

TheSouthernRenaissance

Giventherapidgrowthoftheregion,bothinfrastructureandserviceshavebeen stretched in the last 10 years resulting in the loss of market share to other domesticregions.Therehas,however,beenamajoreconomicawakeningofthe regional economy in the last 18 months, underpinned by the significant developmentoftheextensionoftheN2connectingDurbanwiththeCapeandthe fact that the region offers incredibly affordable opportunities. The new N2 freeway to be completed in 2027 will be an “economic game changer” for the region Significant investment has already come into the region with the development of a number of shopping malls, retirement properties and production facilities. The superb climate and wonderful lifestyle offerings have resultedinanumberofyoungfamilies“semi-gravitating”tothecoastsinceCovid. FormanyEuropeanvisitors,especiallyforgolfer“Swallows”,theSouthCoasthas become a second home, and the Southern Explorer is well positioned to amplify the“SouthernRenaissance”excitingtimeslieaheadfortheregion!

Onwardandupward

The Southern Explorer Association is excited about the future of the region and theincreasedvisitornumberswillgrowourlocaleconomyandsignificantlycreate morejobsandtourismopportunities.

The Southern Explorer Association is committed to the development of tourism amongstallcommunities,supportingdevelopmenttourism*andisdedicatedto unlockingbothhumanandeconomicopportunitiesandtourismpotentialinthe region. *Pages78and79

To all our visitors, we thank you for your support. We appreciate you and look forward to hosting you and being of service to you in the future. Please connect with us on our social media platforms: linktr.ee/thesouthernexplorerkzn. For accessibility and convenience, this publication is also available as a DIGIMAG whichyoucandownloadbyfollowingthelinkhttps://tsekzn.co.za/digimag.

We thank you for making use of our EXPLORE route guide and for making our regionyourdestinationofchoice!Welookforwardtohostingyouagainsoon.

Don't look back unless you can laugh, don't look forward unless you can dream Turkish Proverb

2,3

Celebrating our Silver Jubilee '25'

10,11 There is So Much to Sea and Do

16,17 South Africa's Bali

18-20 Dive Right In 26-29 Moments of Majesty

32,33 Eco-getaway of Choice

34,35 Samango Monkeys

36-38 Available Adventures

Dive Right In Unforgettable Sightings Adventures Available Gentler Pursuits

18 26 36 52

39 Bird Watching 40, 45 Travel Trends 52, 53 Tidal Pools

58, 59 5 Blue Flag Beaches

64-66 Unparalleled Golfing

72, 73 Wellness Tourism 76, 77 Onward and Upward ROUTES 6, 7 9-Route Overview 8, 9 The Wellness Way

12, 13 Route 1

Illovo BeachSezela 'Paradise Begins' 22, 23 Route 2 Bazley - Port Shepstone 'Uncover Traditions’

30, 31 Route 3 MarburgOribi - Ingeli 'Adventurer's Paradise'

40, 41 Route 4

Oslo Beach –Uvongo 'A Sea to Sky Paradise' 46, 47 Route 5 ManabaMargate 'Paradise Day & Night’ 54, 55 Route 6

Ramsgate –Ski boat bay 'A Perfect Piece of Paradise’

60, 61 Route 7

Southbroom –San Lameer 'Paradise on the Greens'

68, 69 Route 8 Trafalgar –Leisure bay 'A Pristine Paradise'

Unparalleled Golfing Wellness Tourism Discover Adventure

74, 75 Route 9

Port Edward –Wild Coast 'An Endless Paradise’

HELPING HANDS 6 Useful Numbers Emergencies, Police, Hospitals 21 Services

Copyright and Disclaimer

The Southern Explorer KZN (tsekzn.co.za) is published by Mindful Media Publishing (Pty) Ltd

No person, organisation or party can copy or reproduce the content on this site and/or magazine or any part of this publication without a written consent from the editors' panel and the author of the content, as applicable. The publisher, editor, authors and contributors reserve their rights with regards to copyright of their work.

The copyright includes (and is not limited to) the content and/or images used in any of the articles of this publication, The Southern Explorer KZN logo and any of its derivatives.

The content in The Southern Explorer KZN and its website and digital platforms are made available on the terms and conditions that the publisher, editors, contributors and related parties: Shall have no responsibility for any action or omission by any other contributor, consultant, editor or related party.

INLAND KEY

Tourist Centre

Museum

Walking Trail

Horse Riding

4x4 Trail

Mountain Biking

Game Drive

Abseil

Quads / Go-cart

View Site

Picnic Spot

Botanical Garden

Bird Watching

Animal / Reptile Farm

Farm Tour

Product produced & sold at establishment

Please call first

ocean KEY

Swimming Beach

Dive Site

Fishing Spot

Surfing

Canoe

Rafting

Tidal Pool

Shipwreck

Launch Site

Disclaim any and all liability and responsibility to any person or party, be they a purchaser, reader, advertiser or consumer of this publication or not in regards to the consequences and outcomes of anything done or omitted being in reliance whether partly or solely on the contents of this publication.

Are not responsible in any way for the actions or results taken by any person, organisation or any party on basis of reading information, or contributions in this publication, website or related platform.

The views, thoughts and opinions expressed in the magazine are those of the contributors and advertisers and do not necessarily reflect the views or positions of Mindful Media Publishing (Pty) Ltd and The Southern Explorer KZN magazine.

publisher@mindfulmedia.co.za

UNIQUE ROUTES

The KZN South Coast Has it all

This publication is the ultimate resource and destination route guide when planning and exploring the beauty, diversity and opportunities on offer. The KZN South Coast boasts 58 golden beaches, the highest number of Blue Flag Beaches in the province and has extensive nature reserves. The region is home to so many incredible assets: two world-class dive sites and home to 11 quality golf courses and is often referred to as 'The Golf Coast'. This diverse and well-loved part of Southern Africa remains a favoured destination for both leisure and business travel. The subtropical climate and diverse natural landscape also sets the scene as the de facto guide for agri-tourism, sustainable wellness travel and extreme adventure.

The KZN South Coast truly “has it all”

Ambulance 0800 647 911

National Sea Rescue Institute 082 990 5950 Fire Brigade & Traffic 039 682 5555

K9 Search and Rescue 082 469 6682

Snake Catcher 082 683 1604

Doctor 24hr Emergency KZN 074 583 8585 039 315 0607

Dental Studios

Coast Police Stations

Umkomaas Police 039 973 6112

Hibberdene Police

Southport Police 039 681 2366 emergencies

Scottburgh Police 039 978 9954 039 699 9801

Port Shepstone Police 039 682 9211

Margate Police 039 312 9800 039 311 5430

Coast Hosptals

Netcare Margate Hospital 039 312 7300

Shelly Beach Private Hospital 087 087 6115

Hibiscus Hospital P Shepstone 039 688 9960 Port Edward Police

CELL: +27 72 573 9361

EMAIL: explore@tsekzn.co.za

SOCIAL MEDIA: https://linktr.ee/thesouthernexplorerkzn

WEBSITE: www.tsekzn.co.za

Ixopo

Fromthe120kmcoastalstretchextendingtothelushhinterland, thereareunlimitedadventurestobehadontheSouthCoast!Fromseaside bathinganddeep-seadivingtohiking,bikingandextremesports,there’s somethingforeveryoneintheParadiseoftheZuluKingdom.

Thereisalsoawealthofuntappedpotentialwaitingforinvestorslookingtouncover unlimitedopportunities.SouthCoastTourism&InvestmentEnterprise(SCTIE) isidentifyingandunlockingthefulltourismandinvestmentpotentialofthisregion.

BREATHTAKING BEACHES -Put on your bathing suit and head to the South Coast for the ultimateseasideholiday.TheregionishometothehighestnumberofBlueFlagbeaches and tidal pools in the province, so you can enjoy protected, quality bathing conditions. There are wonderful rock pools alive with marine life for snorkelling, with the beaches renownedforgreatsurfingconditions

WORLD-CLASSDIVINGANDFISHING- Ifyou ’ rekeentotaketheplunge,theSouthCoasthas two world-renowned diving sites – Aliwal Shoal and Protea Banks – two of three Marine ProtectedAreasfoundintheregion Sharkcagedivingisabigattraction,whileanglerscan charter a boat for some deep-sea fishing in waters teeming with big game fish The winter monthsalsobringtheSardineRunAKA‘TheGreatestShoalonEarth’.And,betweenJuneand December,thousandsofmigratinghumpbackwhalescanbespottedfromtheshoreorwhale viewingdecksalongthecoastline.

SPORTSPLAYGROUND-Colloquiallyreferredtoas‘TheGolfCoast’,theSouthCoasthasa green for every golfer with no fewer than 11 golf courses dotted throughout the region. Keen hikers, birdwatchers, trail runners, mountain bikers, and 4x4 enthusiasts are also spoiltforchoice,withestablishedroutesfoundthroughoutthefarmlands,naturereserves andmore!UguSports&LeisureCentreisamulti-purposefacilitythatcatersforvarious sporting codes and recreational activities including music festivals, exhibitions, and businessfunctions.MargateSportsSchoolisanotherfacilityprovidingschoolsandclubs withfantastictrainingandrecreationalspaces.

EXTREME ADVENTURES - The dramatic geographical features and many nature reserves setthebackdropforsomeultimateadrenaline-inducingactionsuchaswakeboarding, Lake Eland suspension bridge, abseiling, ziplining, microlighting, and helicopter flips. It’s also home to the Wild 5 Gorge Swing, the world’s highest swing of its kind off Oribi Gorge. And, if motorsports are more your speed, then visit Dezzi Raceway in Port Shepstone,theonlyMotorsportSouthAfrica(MSA)-approvedracingtrackintheprovince.

HISTORICANDCULTURALATTRACTIONS-Thereareincredibleruraltourismattractionsin the Paradise of the Zulu Kingdom. The KwaNzimakwe and Nyandezulu experiences combineoutdooradventurewithlocaltraditionintheruralheartland,withtheUmzumbe RiverTrailandWezaTrailguidedwalksthroughthehinterland.Explorethefarmlandsand samplefreshproduceontheAgri-Tours,learnaboutZulucultureatNteleziMsaniHeritage Centre,orexperienceauthentictownshiplivingontheGamalakheTownshipExperience. Visit local outstations established by Trappist monks in the 1880s along the Mission Tourism Route or discover ancient San artwork at the KwaXolo Caves Adventures. The region is also home to several historical shipwrecks with the São João Monument foundinPortEdward.

APLACEFORWORKANDPLAY-PortShepstoneisthebusinesshuboftheregion,withthe SouthCoastfastbecomingakeybusiness,eventsandinvestmentdestination.Thelaunch of the Ugu District One Stop Shop here facilitates investment by reducing barriers to businessintheregion.Uncoverinvestmentpotentialacrosskeyeconomicsectors,from agriculture and manufacturing to real estate and the ocean economy. With its quality venuesandestablishedtourismofferings,theareaisfastestablishingitselfasakeyMICE destinationwhereworkmeetsplay.

UncovertheSouthCoast’stourismandinvestmentofferingsthroughourwebsite.

•Followuson-META/Facebook,InstagramandX/Twitterat-‘infosouthcoast’•

• LinkedIn-‘SouthCoastTourism&InvestmentEnterprise’• • YouTube-‘SouthCoastTourism’•

Known as the Paradise of the Zulu Kingdom, the startoftheexquisiteKZNSouthCoastisfoundjust 40minutessouthofDurbanalongtheN2.Uncover adventure starting at Umkomaas while exploring the many unique sites along the way that make thisathrillinglydiversedestination.

Just5kmoffthiscoastyou’lldiscoveroneoftwodive sites found here, both considered some of the top dive sites in the world Aliwal Shoal – which is also one of three Marine Protected Areas on the KZN South Coast – is a thriving ecosystem where long-termconservationofitsinhabitantsisapriority.

This is a must for freedivers, scuba divers, and shark cage divers with the average dive site 12.5 metres deep Here, you’ll discover ragged-tooth sharks,hammerheadsharks,Zambezisharks,copper sharks, and bronze whalers. Aliwal Shoal has also beenuncoveredashometoanumberofthehighly endangeredshortfindevilrays

This world-class dive site is named after the three-masted Aliwal ship that narrowly missed hitting the shoal in 1849. While this ship was lucky, others didn’t fare so well. Advanced divers can exploretheshipwrecksofsomelessfortunatesailors: theSSNeboandtheMVProduce

Tourismestablishmentshaveeverythingyouneedto make this the ultimate holiday experience Whether you ’reanadvanceddiverorlookingtocompleteyour firstcertifieddivecourse,thisiswheretheadventure begins! But if exploring the ocean by boat is more yourcupoftea,thenyoucancharteroneandspend a few hours dolphin watching, enjoying an ocean safari,or deep-seafishing.

Stopinatoneofthemanylaidbackseasidetowns found along this stretch of the KZN South Coast, withScottburghapopularholidaydestination The expansiveScottburghBeachisidealforsoakinginthe sunshine,withnumeroustidalpoolsalongthisstretch makingthisanidealspotforprotectedswimming

Head inland to Ubumbano Farm, a family-owned co-operative that forms part of the AgriTours experience Makeabookingtoenjoyaguidedfarm tour while sampling macadamia nuts, bananas, spinach, sweet potatoes, mealies, and green beans. Head to the Farm Stall to purchase freshly made macadamia nut and rocket pesto, macadamia nut biscuits and brittle, and steamed mealie bread beforeenjoyingashadedpicnic.

You can also choose from a series of birdwatching hikes, trail runs, and mountain biking routes in the region’sthreestunningnaturereserves

Andthisisjustthestartofparadise…

Begins Paradise

kelso pennington sezela

ENDLESS SUMMER ON THE SUNNY SOUTH COAST

The Blue Marlin Hotel, just 40min south of Durban, is one of KwaZulu-Natal's South Coast's most iconic hotels boasting exquisite sea views. The hotel offers over 100 rooms with comfortable accommodation and a range of facilities to suit your needs. Pamper yourself at the on-site Mangwanani Dream Spa with a rejuvenating treatment that is guaranteed to revilatise your body and soul. Stunning subtropical gardens, superior service, sparkling pools and the warm Indian Ocean on your doorstep, make this your ideal family holiday getaway.

South Coast KZN, South Africa's Bali

The Place of Perpetual Travellers, Digital Nomads and Earth Pilgrims

The small island of Bali has nestled itself safely inside my heart in a way that no other place could. After living in Bali and returning to South Africa, we desired to find a space to settle that would set our spirits alive in the same way that the small island had done. This is when we decided to move to the South Coast. We had already decided before we had even left Bali.

At the end of the day, people don't travel to Bali to take photos on swings overlooking the rice fields or swim beneath turquoise waterfalls, eat tropical food and drink coffee made by the Balinese, or visit monkeys in some of the richest jungles on the equator. Bali is filled with digital nomads, people who work from a space of freedom and who choose to explore the world whilst creating and offering up their services online.

The Deep Transformation of Africa

Bali has its own unique energetic signature, one that cannot be matched by any other space. Its lush jungles sit on the equator, which makes it the perfect space for growing rice and tropical fruits. It has two seasons: rainy and not-so-rainy. Africa, on the other hand, has one of the richest and most powerful

energetic signatures I have felt. There is a deep presence and spirit that resounds beneath the earth, some even say it was the birthing space of mankind. It is a space of fire and deep transformation – and our winters on the Highveld can attest to that. The South Coast, on the other hand, carries a rich balance of both these signatures of Bali and Africa. There is a sacred and quiet fire within the winter – the land dries and the trees shed partially for winter. It is gentle and subtle, yet still as powerful. Bali is indeed a space of great spiritual connection, but it cannot be matched by the power that is held within Africa, particularly within the South Coast of KZN.

Jungles and Pristine Natural Surroundings

For those who are looking for a physical comparison – yes, the South Coast has always reminded me of Bali. It is wild, free and pristine in every sense of the word. There is an organic opulence that permeates the space, with wild rivers, forested belts, mountainous spaces, and an ocean that comes alive no matter the season. The natural surroundings instil a sense of calm and peace, which is why so many travellers choose the South Coast for summer and winter vacations.

Whether you are travelling for the warm summers settled on the beach, a spring hike near Oribi Gorge, or a season of whale and sardine watching in the winter, every season is eclipsed by a unique kind of beauty that cannot be replicated anywhere else across South Africa. This was the first thing we fell in love with and the first reason why we moved here. We loved to be beside the natural streams, to see the sun hit the gossamer wings of the dragonfly as it settled upon a lily pad, to see the natural glow of a firefly beside the river at night (yes, it happens, we have already experienced this within our garden). By gazing at the South Coast with new lenses, you may begin to feel that the magic is abundant and larger than anything you previously dared to dream would be possible. It all starts with a shift in perspective and a deep appreciation for the natural beauty that eclipses our coastlines.

Monkey Forest – Monkey Forest Everywhere

Ever dreamed of walking down the winding pathways of Monkey Forest before skipping over to the Jatilu with rice fields in Tabanan? Well, on the South Coast you can walk through monkey forest any day, any time. The wild vervet monkeys that are present on the coastline are plentiful. Although it is strongly advised to not feed them in any way, we would like to invite you to settle beneath the trees and simply admire how they approach life. While there, your eyes may even spot a water monitor, the natal water snake, or a blue kingfisher. Oribi Gorge has some of the best hiking trails, allowing visitors to get lost in the flora and fauna for hours on end. Is deep forest vegetation not up your alley? No worries, the south coast is home to many hidden jewels in the form of beaches that are hidden away down side roads, between rocks and amongst quaint little suburbs, five of which are blue flag beaches.

Textures, Interiors and Natural Artefacts

From hand-woven baskets and local items curated by artisans, to indigenous fruits picked by local growers

and displayed in fruit and veggie markets, the south coast brings the natural kingdoms to life and then shares them with all who walk upon her soil. Drawing in tourists from across South Africa, it's easy to see why this rich essence of Africa is celebrated far and wide. Come rain or shine, this rich paradise never fails to deliver. Celebrated for having the warmest winter in Africa, it is a season-by-season haven for digital nomads, families, and solo travellers.

Tantalising the Taste Buds

From small boutique hotels to quaint Airbnb's, to restaurants owned by locals – the South Coast offers up some of the best when it comes to food. From burgers to gin, to authentic Italian pasta, ribs and curry - there is something for every taste bud along the South Coast coastline. If you are wanting to experience coffee grown in the humidity and mountains of our very coast, then you are in for a treat.

The Connection of Hearts

“A place is less about the place and more about the people” – said every well-versed traveller always. I will always remember that this was the one thing that stood out in Bali – it was the kind, gracious, and loving energy that emanated from the locals that made us feel at home and accepted. The island has always offered itself up for tourism as a space for weary visitors to rest and heal. Over time, I have come to see that the south coast does the same.“ Kerry Killan

Kerry is a conversion copywriter and launch strategist for wellness brands, coaches and creatives and owns a boutique copywriting studio, Meraki Messaging www.merakimessaging.com

DIVE RIGHT IN...

Oceanic sanctuaries for the soul

Reefs and pieces of ocean heaven dotted along the southerncoasthavebeenbeckoningseaexplorers from all around the world for centuries into its depthsofazurewonder,wildlifeandawe.TheSouthCoast is commonly known for its vibrant beach landscape and holiday getaways, but a lesser known attraction lies in the liquidworldwherewhalesongscallandaweightlesspause in time brings you back into alignment with the ineffable beautyandcolourfulmysteryofourlocalmarinelife.

ThecoastlineofKwa-ZuluNatalsparkleswiththeepitome of unforgettable adventure that saltwater swimmers and freedivers far and wide come in search of. A mission to exploretheunderwatercoastalsanctuariesthatlayinwait isajourneythattendstobesynonymouswithhealing.Find more than you bargained for among the multicoloured mazesanddon'tbesurprisedifyouareledtodeeperparts of your own heart in the process. Time spent traversing these waters has a way of attuning you to the palpable rhythmofslowlivingtheoceanicspaceflowswith.

To all the magic seekers that are making their way to our paradise of perfect winters and crystal conditions, here is the ultimate bucket list for freediving, scuba diving, and snorkelingontheSouthCoast:

AliwalShoal:Arguablythemostfamousdivingspotalong the South Coast, Aliwal Shoal is a submerged reef located about 5 kilometers off the coast of Umkomaas. As the crown jewel of the South Coast, this submerged reef off Umkomaas reveals a mesmerizing tapestry of life, from graceful reef sharks to elusive moray eels and vibrant tropical fish But the true allure lies in the seasonal migration of ragged-tooth sharks, offering divers an exhilaratinginteractionwiththesemajesticcreaturesfrom JunetoNovember.Thismarineprotectedareaisrenowned foritsdiversemarinelife,includingreefsharks,morayeels, turtles,andcolourfultropicalfish.

Protea Banks: Venture offshore from Shelly Beach to discover Protea Banks, a realm of primal beauty. Here, a towering underwater pinnacle draws in a mesmerizing array of sharks – bull sharks, tiger sharks, and hammerheads,tonameafew.Advanceddiversaretreated toheart-poundingencounterswiththeseapexpredatorsin their natural habitat, making Protea Banks a must-visit for theadventurershuntingformagicmoments.

Landers Reef: Nestled near Port Shepstone, Landers Reef invites divers of all levels to explore its shallow depths. A riot of colour awaits beneath the surface – vibrant corals, swayingsponges,andakaleidoscopeofreeffish.

TheTopDivingSitesYouJustCannotMiss:

It'sahavenforunderwaterenthusiasts,whethersnorkeling amidstthecoralsorcapturingthebeautythroughacamera lens.LandersReefpromisesavisualfeastforthesenses.

South Pier, Umkomaas: Ideal for shore diving, the South PierinUmkomaasisaversatilesitesuitablefordiversofall levels. The calm waters and gentle currents create an excellent environment for exploring the diverse marine ecosystem, which includes coral gardens, gorgonian fans, and a variety of reef fish. Keep an eye out for sightings of moray eels, stingrays, and nudibranchs hiding among the rockyformations.

South African Freedive Champion and Guiness World Record Holder of the longest underwater kiss, Beth Neale, shared some insight on the benefits she's found in the depths of the ocean. “Freediving demands focus and presence. It's a form of moving meditation that cultivates an intimate connection with the marine environment. Not only is it a reminder of our symbiotic relationship with the planet,butitalsohasauniquecapacitytohealbothbody and mind. The deep, rhythmic breathwork induces a state of relaxation, reducing stress levels and promoting overall well-being.Combinedwiththetherapeuticeffectsofbeing in nature, freediving becomes a holistic healing modality thatnurturesthesoulandrejuvenatesthespirit.”

Whenaskedwhichdivingspotisherfavourite,Bethsaidit was difficult to pick one but shared a memorable experienceatAliwalShoal,“I'vefreedived28metersdown and swam through over 20 ragged-tooth sharks while having a potato bass follow me around and seeing a hammerheadsharkaswell.Justmagical.”

AFewInsiderTips:

Diving Conditions: Expect a subtropical climate, characterizedbywarmtemperaturesthroughouttheyear. Thewatertemperaturesrangefromaround19°Cinwinter to 25°C in summer, making it conducive to diving throughout the year. Visibility can vary depending on weather conditions and seasonal factors, but it often exceeds 20 meters (65 feet), offering clear views of the underwaterlandscape.

Best Time to Dive:

While diving is incredible year-round, thebesttimetovisittheSouthCoastofKwaZulu-Natalfor divingisduringthedryseason,whichtypicallyspansfrom May to September. During this period, the weather is generally mild, and underwater visibility tends to be at its peak. However, diving is still remarkable during the wet season(OctobertoApril),withwarmerwatertemperatures andthepossibilityofencounteringuniquemarinespecies.

It's no secret that the ocean is salted with therapeutic effects, but diving and scuba enthusiasts know this secret intimately Saltwater, well known for its rejuvenating properties, also has a remarkable ability to alleviate stress and anxiety. It's believed that this is due to the negative ions present in ocean air, which promote feelings of positivityandvitality.Saltwaterimmersionsalsoencourage circulation, reduce inflammation, and boost the immune system.

We hope to see you soon along the South Coast, where oceanic sanctuaries for the soul meet wanderlust-filled journeysofself-discovery.

TheKZNSouthCoastretainsitstitleofhavingthe highest number of Blue Flag beaches in the province,andthreeofthesecanbefoundhereat Southport, Umzumbe, and Hibberdene. With its year-roundsubtropicalclimate,youcanrelaxon the golden sands, and dip in the warm Indian Ocean,atanytimeoftheyear

Take a drive inland to uncover more of the KZN South Coast’s unique heritage at the vibrant Ntelezi Msani Heritage Centre in Umzumbe. This creative arts centre was established in honour of the liberation stalwarts arrested at Mthwalume in 1906 after protestingtheunjustBhambathaPollTaximposedby thecolonialgovernment.

The centre is a celebration of the region’s rich African history, providing an authentic local experience and insightintothesouloftheregion Learnmoreaboutthe originsoftheZulukingdom,discovertheartofZulustick fighting, and find out about Zulu herbal treatments. Here you can also learn more about Isivivane seNkosi uShaka, the traditional pile of stones left by Zulu warriors to honour their ancestors Guests can now participate in this cultural ritual, leaving a part of themselvesontheKZNSouthCoastforever.

There are also excellent point and beach breaks along the KZN South Coast, attracting top surfers from around the world Take your board over to ScottburghorStMichael’s–bothwithpilotBlueFlag status - or Lucien, Margate, Southbroom, or Port Edwardbeaches,allofwhicharesurfinghotspots.

There are also learn-to-surf schools that will have you ‘hanging 10’ in just a few lessons And, if you ’ re lookingtotryanotheraquaticsport,thenyou ’ respoilt for choice with canoeing, stand-up padding and kitesurfing(inthelatterpartoftheyear)allonoffer. Otherwise,simplygrabyoursnorkelandswimamong the many flourishing rock pools and reef sections found along these beaches, with resident dolphins justwaitingtoputonafrolickingdisplay.

Known as the business hub, Port Shepstone is found at the mouth of the Umzimkhulu River Suited to business and leisure getaways, this coastal retreat boastsmodernamenities.Forthenauticalhistorians, there’s the Port Shepstone Maritime Museum filled with relics that sailors used at sea, as well as fascinatingshipwreckmemorabilia

Cu al Traditions Uncover

Mtwalume’s best kept secret, Seaside Escapes, awaits! A stone’s throw from the beach, all units boast the full ocean vista with a 180 degree frontline sea view, and can comfortably accommodate 25 guests. Escape with us!

082 555 5361 | info@seasideescapes.co.za | FB: @Seasideescapesmtwalume www.seasideescapes co.za | 170 Buccaneers Walk, Mtwalume, 4186

Rustic chalets make the little seaside village of Umzumbe a restful holiday haven. Perched on the mountainside overlooking the majestic Indian Ocean, our secure Resort is set among the indigenous forest between the picturesque rolling hills of the countryside. Enjoy self-catering accommodation with us.

039 684 6291 | reservations@umzumbechalets.co.za

2 Station Rd, Umzumbe, Hibberdene | wwwumzumbechalets.co.za

Nestled along the dune forest on one of the most gorgeous beaches in KZN. This surfers sanctuary is on a serene and sub tropical, private property with beach front access • Clean & comfortable for all budgets • Communal living or Private Bali-style Bungalows

Enchanted Venue for Every Occasion

211 THE BEACH HOUSE

Taste the sweetness of Halal Hospitality at Sugar Beach Resort located in Elysium on the South Coast of Durban KwaZulu – Natal. The Resort has 22 Rooms, Conference Centre, Boardroom, Restaurant, Spa, Games Room, Rock Pool, Jungle Gym, BBQ and Picnic Areas.

MOMENTS OF MAJESTY

Whale watching has become a beloved pastime globally, especially along KZN's southern coastline Loved by locals and enthusiasts worldwide, the region offers exceptional shore-based viewingopportunities.

What is it about witnessing these ocean creatures that leavessuchaprofoundimpressiononallonlookers?Firstly, the sheer size and majesty of the largest marine mammal known to man is awe-inspiring. They glide gracefully throughthewaterwithagrandeurlikenootheranimal.But most of all, they give us a glimpse into the symmetrical magic, rare beauty and indisputable intelligence of their ecosystem.Infact,whalesarereveredinmanyindigenous cultures as symbols of wisdom, resilience, and our profound bond with nature They are often seen as guardiansandprotectorsofearth'smysteries.

The south coast of KwaZulu-Natal (KZN), a region nestled along the Indian Ocean, serves as a prime habitat for variouswhalespeciesduringtheirannualmigrations.From mid-May to late November, species including humpback and southern right whales can be spotted along the KZN coastline.Thesewhalesundertakelongjourneysfromtheir feedinggroundsintheAntarctictowarmerwatersnearthe equatorforbreedingandcalving.

Whale watching enthusiasts are in the know of vantage points along the coast, perfect for experiencing sightings of these magnificent creatures. Some insider spots for whalewatchingalongtheKZNcoastinclude:

RamsgateWhaleDeck:Apurpose-builtdeckprovidesan elevated platform for optimal whale watching opportunities.

Shelly Beach Whale Watching Platform: A designated platform offers unobstructed views of the ocean, perfect forspottingpassingwhalesduringthemigrationseason.

Port Shepstone Lighthouse: A lighthouse offering a scenic setting for whale watching with expansive views of thecoastline.

UmtentweniWhaleDeck:Anotherdeckbuiltbythelocals for the community and visitors to enjoy each other's companywhileviewingtheocean.

Jaxx Restaurant: offering uninterrupted views of the oceanwhileyoutreatyourtastebuds.

Hibberdene Whale Viewing Point: A designated whale viewing point near the beach, providing a convenient location for spotting whales while enjoying the coastal scenery.

Thewhalechasersoftheworldaresignificanttotourismin theKZNsouthcoastregion,thereforeampleopportunities forwhalesightingsareprovidedbothinrestaurantoptions thatboastanoceanview,aswellas,seasideroadsforslow journeysalongthecoastline. (Continues on page 28...)

Port Edward Whale Watching Tower: A whale watching tower, allowing visitors to enjoy panoramic views of the oceanandspotwhalesfromahighervantagepoint.

Beyond the ordinary, Fish on the River is a market style, semi self service restaurant serving the most succulent seafood. Relax on our deck and enjoy the magnificent view while indulging your taste buds.

071 538 0962 | fishontheriver1@gmail.com | FB: @seafoodbestseafood | Spillers Wharf, Old Mill Road, Port Shepstone, KZN South Coast

INDULGENZ GELATERIA & COFFEE SHOP

Gelateria Coffee Shop VISIT US FOR YOUR GELATO & COFFEE INDULGENCE.

Come and enjoy a scoop of our handmade gelato or enjoy a relaxing breakfast/lunch with freshly brewed coffee. We have wheel-chair friendly indoor and outdoor seating and a Kids Zone.

083 646 9571 | info@indulgenz.co.za | claudiadavey@gmail.com www indulgenz.co.za | 70 Casuarina Road, Sea Park, 4241

With an abundance of opportunities to catch a sighting, you're guaranteed to get some viewings when embarking on a coastal marine safari, whether you're the unintentional, dreamy ocean onlooker or the stalwart whale-watcher with binosinhand.So,hereareafewthingstokeepyoureyeoutfor:

Water Spouts: Keep watch for subtle disturbances on the water's surface, indicating the presence of a whale just beneath. These "blows" or exhalations often create small ripples or patches of calm water, providing clues to their whereabouts.

Dorsal Fins: Scan the horizon for the distinctive shape of a whale's dorsal fin breaking through the surface. These fins can vary in size and shape depending onthespecies,butthey'reusuallyvisiblewhenthewhaleswimsnearthesurface.

Tail Flukes: Watch for the telltale sign of a whale diving below the surface, indicated by the upward curve of its tail flukes as it prepares to descend. This fleetingglimpsecanhelpanticipatewherethewhalemightresurface.

Bird Activity: Keep an eye on seabirds such as gulls, terns, or shearwaters, as they often gather around areas where whales are feeding. Their aerial movements and sudden dives can lead you to the presence of feeding whales below.

Whale Sounds: Listen attentively for the haunting melodies of whale songs, which can sometimes be heard underwater or even from the surface on calm days.Thesevocalizationscanprovidefurtherevidenceofnearbywhaleactivity.

Whale sightings can, of course, vary greatly depending on numerous factors, such as the time of year, weather conditions, and individual whale behavior. However,therehavebeenmanyremarkablewhalesightingsreportedalongthe KZNsouthcoastovertheyears.

Somememorablesightingsinclude:

• Raresightingsofbluewhales,thelargestanimalsonEarth,occasionallypass throughthewatersofftheKZNcoastduringtheirmigrations.

• Breaching events, where whales leap out of the water, are always an incredible marvel to witness and can be considered highlights of whale watchingexperiences.

• Encounters with mother whales and their calves, especially southern right whalemothers,whichoftenseekshelteredbaysalongthecoasttonursetheir young.

While specific sightings may stand out to individuals based on their personal experiences,everywhalesightingalongtheKZNsouthcoastoffersauniqueand unforgettableglimpseintotheworldofthesegracefulmarinegiants.

Ontheotherhand,theprizedpresenceofwhalesinthelocalcommunityserves asareminderoftheimportanceofmarineconservationeffortstopreservetheir naturalhabitatforfuturegenerationstoenjoy.Whalewatchingtourismisavital sectorintheecotourismindustry,particularlyalongtheSouthCoast.Thisregion has become a magnet for travellers flocking to the breathtaking coastline for unforgettableencountersbutalsotobeapartofthelocalcultureof preservation.

Theareaisrichwithoceanloversandearthprotectorswho are working together to nurture conservation efforts and align community development with sustainable marine safeguarding.

In South Africa, the rise of whale watching tourism has, in fact, been particularly remarkable, outpacing other forms of tourism in growth rate. This surge not only brings revenueandemploymenttocoastalcommunitiesbutalso servesasacatalystforinboundtourism.

Beyond economic benefits, responsible whale watching offers invaluable opportunities for education and conservation. By incorporating informative elements into the experience, tourists gain a deeper understanding of marineecosystemsandtheimportanceofpreservingthem.

As the global demand for responsible and ethical tourism continues to rise, the significance of whale watching as a sustainable and enriching experience cannot be overstated.By harnessing the attractionof marine wildlife, we support the local economies that largely contribute to the conservation of marine ecosystems, ensuring that the magic of whale watching endures for our grandchildren andtheirs.

CanyoupictureyourselfonthecoastalshoresofKZN,with the ocean breeze on your face, gazing out at the horizon, only to witness nature demonstrate its dance with utter beautyinaworldsodifferentfromourdailyreality?

It's a breathtaking sight that offers a momentary perspectivewithalastingimpression.Onethatsuggestswe broadenthehorizonsofourpsychetoworldsbeyondours soasnottogettoodeeplyembeddedinthechallengesin our small corner of life. Our human experience is full of uphills and downhills that mirror the rise and fall of the ocean in many ways. A nuance you will surely find in the southern coastal communities of KZN is that time spent observing or exploring the vast blue world that tickles its shores is time spent gracefully lifting above the weight of individualadversity.

As summer fades in the Antarctic and these magnificent creatures journey thousands of kilometers to their breedinggroundsnearMozambique,besuretomakeyour way to the coastline to witness the spectacle of their pilgrimage. Mid-May to late November is the perfect time to pass the shores of KZN and be struck by the raw power and rugged beauty of these marine behemoths. Each sighting, whether it's a breach or a tail slap, leaves an indeliblemarkontheheartthatwillhaveyoujoiningallavid whaleloversaroundtheglobe.

BOTH SCHOONERS AND JAXX ARE SITUATED AT THE TWENI ABINGDON SPAR CENTRE

If you’re looking for outdoor adventure, look no furtherthantheKZNSouthCoast!Cliffs,cascading waterfalls, lagoons, and nature reserves set the backdropfortheultimateadventure Firstupisthe 8km Weza Hiking Trail starting in the iKhwezi rural area. A trained local guide will take you across two amaKhosi areas before finishing at the MkhobaWaterfall.

The nearby farming town of Harding, set against the Ingeli Mountain Range, provides you with direct accesstothescenicIngeliForest Thereareavariety ofhikingandrunningtrailsthroughtheforest,from18 to 30 kilometres, taking you past resident wildlife, birding,streams,andwaterfalls

Thrill-seekerswillenjoyatriptoOribiGorgewhichis teeming with local wildlife inhabiting grasslands, wetlands,andcoastalforests Getharnessedintothe WildGorgeSwing,thehighestswingofitskindinthe world!HereyoujumpoffLehr’sWaterfallanddrop55 stories(securelystrappedofcourse!)

You could also abseil down the 110-metre cliff face alongsidethewaterfall,orembarkontheWildSlideazipliningadventure165metresabovethetreetops Don’t forget to try the 84-metre suspension bridge, 100metresofftheground.

EnjoyasafariatLakeElandGameReservewhereyou can encounter wildlife in their natural habitat Have an up-close experience on a game drive, go hiking, mountain biking, or even horse riding There’s also a dedicated4x4trackfortheadventurousatheart!

Coffeeloverscangetafixofdelectable100%Arabica atThorntonCoffee.Originallyasugarplantation,this family-run coffee farm produces the most delicious beansforauniquelyAfrican-flavouredbrew

Bird watchers cannot miss the chance to visit the Vultures View Hide near Oribi Gorge Nature Reserve

This is an ecologically significant site where the endangeredCapeVulturesgathertofeed,mateand nest–allofwhichcanbesafelyviewedbybirders

AdventureawaitsyouontheKZNSouthCoast!

PARADISE UNCOVER AN Adventurer’s

Eco-getaway of Choice

TRoute 3

hosewithanadventurousspiritwillfindfulfilmentwithintheKZNSouthCoast,wheretheextremenaturallandscape provides the perfect setting for both adrenaline-inducing experiences and simple appreciation of the natural splendourofthisdiverseandcompellingpartorourworld.

MountainsideadventurescanbefoundatOribiGorgethroughWild5Adventures.Notforthefaint-of-heart,adventures hereincludeTheWildGorgeSwing-a55-storeyplunge,theworld'shighestcanyonswing–aswellastheWildAbseildown a 110m cliff face alongside Lehr's Waterfall. Those who want something more sedate - but just as picturesque and exhilarating can try the Lake Eland's zip line, the longest in Africa, or view the gorge from the suspension bridge and lookout.ThereisalsotheincredibleLeopardRocksetonarockyinclinewithsweepingviewsoverthemajesticUMzimkhulu RiverGorge.

There is extensive hiking, mountain biking, birdwatching and 4x4 trails and excursions through the region's numerous nature reserves, conservancies and game reserves. Among these are TC Robertson Nature Reserve, Umdoni Park Nature Reserve,VernonCrookesNatureReserve,OribiGorgeNatureReserveandLakeElandGameReserve.

Withanextensivevarietyofterrestrialhabitats,fromwetlandenvironmentstoforest,woodland,grasslandandsavannah, as well as aquatic habitats ranging from rivers and lakes through to estuaries and ocean reefs – the KZN South Coast is home tosome of theplanet's most incredibleanimal species. And,unsurprisingly,therehabilitationandconservationof thesecreaturesandtheirhabitatsformanimportantpartofthearea'seco-tourisminitiatives.

Other winged creatures that thrive along the coast are the almost 500 bird species residing here, 64 of which are nearendemicorendemic,aswellas67classifiedasreddataspecies.Therearemanylocalbirdingclubsthatwelcomevisitors–fromnovicestoworldlytwitchers-andtheOribiVultureViewingHideisamust-visitsitetocheckouttheresidentbreeding colonyof200CapeVultures.

The Samango Monkey

IfyouareintheOribiGorgeNatureReserve(Route3)ortheUmtamvunaNatureReserve(Route9)you'reinthe right place to catch a glimpse of the samango monkey that is the inspiration for the Southern Explorer Association'smascot.

About25percentlargerthanthevervetmonkey,thesamango (insimango inisiZulu)hasagreyface,blackarms,grey, shaggybodyfurandawhitish'collar'.Themaleslackthestrikingbluecolouringofthescrotumthatissonoticeableon thevervet.

Therearethreesubspeciesofsamangomonkeys(knownfurthernorthasSykes'orbluemonkeys).Thoseyouwill seehere, Cercopithecus albogularis labiatus,arethesouthernmosttypeandfoundalmostexclusivelyinthetwoSouth Coastreserves.

Withtailsabout30percentlongerthantheirbodiestoassisttheirbalance,theyareincrediblyagilewhenclimbing and leaping between trees. They spend most of their time in the forest canopy and, though they do forage on the groundfromtimetotime,theyneverstrayfarfromthetrees.

Agriculturalandurbanexpansioninrecentyearshasresultedinforestsinsomeareasbecomingnotmuchmore thanscatteredpatchesoftrees,withnoconnectingcorridorsbetweenthem,isolatingthemonkeycoloniesfromone another and limiting their range. A 2016 report warned that isolated samango populations were at risk of local extinction,thoughtheSouthCoast'scoloniesaresafelysettledinprotectedareas.

Samangomonkeysareactiveduringthedayandspendthenighthighupinthecanopyoflargetrees.Theyspend mostofthedaylighthoursforagingandfeedingbuttheyalsoengageinsocialactivitiessuchasgroomingandplaying. Their preferred diet is fruit, for which they forage in the indigenous forest. They have also been seen to feed on leaves, flowers, bark, gums, fungi, seeds, insects and other animal matter. When foraging in the trees, samango monkeyssometimesdropfruit,makingitavailabletoterrestrialanimalssuchasbushpig,duikerandporcupine.

A monkey troop consists of a number of females and their younger offspring, led by one dominant male. Male youngstersareevictedfromtheirfamilygroupsbeforereachingmaturityandfrequentlybandtogetheruntiltheyare readytochallengearesidentmaleforbreedingrightswithhisgroupoffemales.Thesefightscanbeprettyviciousand it'sunusualforamaletoretaindominanceformorethantwoorthreeyears.

Groupsizesvaryconsiderably,asdothesizesoftheterritoriestheyclaim.Whilethemalesfightfordominance,the femalesareaggressiveindefenceoftheirterritories.Theyreachsexualmaturityataroundsevenyearsandbreedevery twoorthreeyearsthereafter.

Samangomonkeysuseavarietyofsoundstocommunicate.The'boom'call,whichthemaleemits,mostfrequently atduskanddawn,isalow-pitchedcallthatcarriesfarintheforestcanopy.Itisthoughttobeawarningtointruders. Twoothercallshavebeendescribedapredatoralarmsanditwouldseemthatoneisusedtowarnofaleopardinthe vicinity,whiletheotheralertsthegrouptothepossibilityofanattackfromtheair.Samangomonkeysalsoproducea varietyofsqueals,whistles,screamsandscreeches.

Their main predators are leopards, the larger eagles, rock pythons and caracals. Venomous snakes such as black mambas,spittingcobrasandpuffaddershavealsobeenknowntokillsamangomonkeys,butnotoften.

Man is also not kind to the samango monkey. Apart from habitat loss through deforestation, the illegal trade in skins and carcasses has also taken its toll. Researchers in other areas have received requests for samango skulls and hands from traditional healers, suggesting that they are used in traditional medicine. The Red List of Mammals of South Africa, Swaziland and Lesotho lists C. a. labiatus as vulnerable, as does the IUCN (International Union for ConservationofNature)RedList.However,ontheSouthCoast,wearefortunatetohavesafe,protectedindigenous forestareaswhereoursamangofriendscanlivetheirlivesasNatureintended.

Welcometotheirworld.Enjoytheircompany.ButDON'TFEEDTHEM!

Informationsource:https://www.sanbi.org/animal-of-the-week/samango-monkey/

ADVENTURES AVAILABLE

It's the roads enclosed in lush green abundance, a constant reminder that you are on a bumpy road stretching along a subtropical paradise. It's the expansesofglisteningshoresthatshimmerwiththemagic of a mermaid's haven. It's the coarse sand distinctive to secludedbeaches,slippingthroughyourfingersinanarray ofbrokenshellsandseasidestories.

It'stheicecolddrinkandlocalfish'nchipsonadeckonlya fewfeetfromtheocean.Allowingyoutofeastyoureyeson Natal'shorizonofdreamswhileyoueatyourheartoutona SouthAfricanfavourite.

There is so much adventure to be found along the South Coast but I think you'll agree with the local nuance that exploring the little details in between the big moments is whereyou'llfindjustasmuchmagic.

The hum of the ocean, the kiss of sun ray and an atmosphereofeaseandcommunityinthesecoastaltowns that invites families from near and far to immerse themselves in the wonders of nature. Adventures through theSouthCoastpromiseadiverseselectionofdiscoveries fromancientcavestosoaringcliffsandsaltythrills.

Here's a bucket list to keep you busy as you indulge in thebestofthebest:

Mac Banana Estate & Adventures - Port Edward: UncoveraworldofculinarywondersandfamilyfunatMac Banana Estate. With its four restaurants, including the

Life always begins with one step outside of your comfort zone

Shannon L. Alder “

renowned pancake house, it's a feast for the senses. Plus, delve into over 20 thrilling activities like the Zip Rope AdventureParkandtheserenebutterflydome.

KwaXolo Caves Adventures – KwaXolo, near Margate: EmbarkonajourneythroughtimeandheritageatKwaXolo Caves Adventures. Hike through ancient mountainside trailsadornedwithSanartwork.Experiencetheexhilaration of ziplining and traverse suspension bridges amidst breathtakinggorgeviews.

Lake Eland Game Reserve - Oribi Gorge: Step into the pristinewildernessofLakeElandGameReserve,spanning5 000 acres of diverse ecosystems Encounter giraffes, wildebeest and zebras as you explore by vehicle, guided drive, hike, or cycle. Enjoy amenities like a coffee shop, picnicsitesandan80msuspensionbridge.

The Pont Water Holiday & Water Sport Resort - Port Edward: Immerse yourself in aquatic adventures at The Pont, the ultimate summer getaway on the Umtamvuna River. From speed boat rides to leisurely barge cruises, there's something for everyone. Relax in chalets, savour cocktailsandsoakupthePortEdwardsun.

Wild 5 Adventures - Oribi Gorge: Experience heartpounding adventures amidst breathtaking vistas at Wild 5 Adventures. Feel the rush of a 110m abseil, embrace the thrill of the Wild Swing, or explore quad biking trails and guided hikes Get your adrenaline fix in this scenic wonderland.

Umzimkulu Boat Cruises - Port Shepstone: Sail alongthetranquilwatersoftheUmzimkuluRiverandbask inthebeautyofPortShepstone.Rentkayaksorembarkon enchanting sunset cruises departing from Spiller's Wharf. Lettheriver'sserenitycaptivateyoursoul.

Selsdon Park Estate – Trafalgar: Experience Trafalgar Beach like never before with horseback rides offered by Selsdon Park Estate. Explore coastal forests and farmlands withexpertguidesleadingtheway.Perfectforridersofall levelsseekingauniquebeachadventure.

NPS Adventures – Umzumbe, near Port Shepstone: Discover authentic African experiences on the rural outskirts of Umzumbe with NPS Adventures. From camping and hiking to paintball and quad biking, there's adventure at every turn Unwind amidst breathtaking landscapesandindulgeinlocalcuisine.

World of Wings Flight School – Craigieburn: Take flight and marvel at the scenic beauty of the KZN South Coast withWorldofWingsFlightSchool.Soarabovelandscapes inaBantamtwo-seateraircraftormicrolight.Exploreiconic landmarksandtheWildCoastfromabird's-eyeview.

Vulture Hide – Oribi Gorge: Explore the Oribi Vulture Viewing Hide nestled within Oribi Gorge. Join a two-hour guided tour for a captivating encounter with a thriving colony of over 200 Cape Vultures, offering a glimpse into theirnaturalhabitat.

SharkCageDivingKZN–Scottburgh:Encounter majestic apex predators up close with shark cage diving experiencesatAliwalShoal.Snorkelwithsharksorobserve them from the safety of a boat. Witness Blacktips, Dusky sharksandmoreintheirnaturalhabitat.

AirtrackAviation–Margate:

EmbarkonaerialadventureswithAirtrackAviation'sscenic helicopter and airplane flights departing from Margate Airport. Enjoy panoramic views of the KZN South Coast, from Durban Harbour to the Marine Protected Area at AliwalShoal.

Dino Park SA - Port Shepstone: Embark on a prehistoric journeyatDinoParkSA,KwaZulu-Natal'sonlymini-Jurassic jungle.Wanderthroughpathwayssurroundedbylife-sized dinosaurs in a tropical jungle setting. Perfect for families anddinosaurenthusiastsalike.

Reptile Farms - South Coast KZN: Enhance your adventure with a visit to one of the captivating reptile farms. Explore Pure Venom Reptile Park in Shelly Beach, Riverbend Crocodile Farm in Southbroom, and Crocworld ConservationCentreinScottburgh,whereyou'llencounter anarrayoffascinatingreptilianinhabitants.

Umtamvuna River Lodge - Port Edward: Experience the thrill of water sports at Umtamvuna River Lodge, home to someofthecountry'sbestwakeboardingandwakeskating instructors.Enjoy speedboatrides, stand-uppaddlingand tuberidesamidststunningriverlandscapes.

Aqua Planet - Shelly Beach: Embark on an ocean safari withAquaPlanet,apremiercharterdiveoperator.Diveinto the Marine Protected Area at Protea Banks and encounter majesticsharksintheirnaturalhabitat.Joindivecoursesled by experienced instructors with a 100 per cent safety record.

Umzumbe River Trails – Umzumbe: Embark on a hiking andheritageadventurethroughthelushhinterlandsofthe KZNSouthCoast.Exploreguidedtrailsandenjoyauthentic culturalexperienceswithlocalclans.Idealforhiking,biking and horseback riding enthusiasts seeking an immersive outdoorexperience.

AFewAdditionalMagicExperiencesYou'llFind:

• Surfing

• HorsebackRiding

• QuadBiking

• FreeDiving

• ScubaDiving

• Hiking

• Fishing

• OceanStrolls.

And, of course there's the golden Golf Coast, boasting 11 world-class golf courses, impressing both leisure seekers and serious golfers alike. Set against the backdrop of the South Coast's subtropical canvas, it's the perfect place to blendrelaxationandadventure.

Remember that adventure is not just about the destinations you reach, but the experiences you gather alongtheway.FromthetranquilwatersoftheUmzimkulu RivertothebreathtakingheightsofOribiGorge,everystep inthisregionholdstheancientstoryofmankindexploring nature'sbeauty.

Packyourbagsandbringasenseofwonder.Letthemagic oftheKZNSouthCoastsweepyouoffyourfeet!

BIRD WATCHING KZN SOUTH COAST

The KZN South Coast offers several diverse habitats making it home to well over 400 bird species, 64 of which are endemicornearendemicand67reddataspecies–trulyabirder'sparadise!Habitatsincludecoastalandwetland environments,Afromontaneandrichsubtropicalforeststhatoverlapgivingrisetoadiverse,unique,andrewarding birding experience. Highlights for visiting birders may include sightings of the Knysna Woodpecker (Northern most population in SA), Magpie Manikins, Narina Trogons, African black oystercatchers, Kittlitz's plovers, African Broadbills, CapeVultures,Black-rumpedButtonquails,GrassOwls,Broad-tailedWarblers,Pale-crownedCisticolas,Short-TailedPipits, CapeParrots,BlueSwallows,CrownedEaglesandPalm-nutVultures(Southernmostbreedingpair).

EXPLORE THE TOP 15 BIRDING SPOTS

While the following exciting birding hot spots are recommended, most are public facilities, however, some are privately owned and you are requested to call before visitingtoconfirmaccess,openingtimes,directions,safety,andanyotherinformation thatwillmakeyourbirdingexperiencemorepleasurable.

• EmpisiniNatureReserve–Umkomaas–0399730093

• CrocworldConservationCentre–Scottburgh–0399761103

• T.C.RobertsonNatureReserve–Scottburgh–0620025190/0399751679

• UmdoniParkTrustGolfClubandNatureReserve–Pennington–0399751615

• VernonCrookesNatureReserve–Umzinto–0399742222

• OribiGorgeNatureReserve–OribiGorge–0398451000

• OribiVultureViewHide–OribiGorge–0728933794

• LakeElandGameReserve–OribiGorge–0396870395

• Weza–NgeleForest–Harding–0395530600

• SkylineNatureReserve–Uvongo–0393150112

• RiverbendCrocodileFarm–Southbroom–0393166204

• MpenjatiNatureReserve–Trafalgar–0393130531

• RedDesertNatureReserve–PortEdward–0396950460

• Culley'sDam–PortEdward–0725508303

• UmtamvunaNatureReserve–PortEdward–0393112383

Sources:www.birdlife.org.za,www.kznwildlife.com

Named for the many shells found along this stretch of coast, Shelly Beach is the start of an unmatchedoceanexperience Just75kilometres offshore you’ll find another world-class dive siteatProteaBanks.ThisiconicMarineProtected Area consists of a series of caves, ridges, pinnacles, and amphitheatres creating an underwateradventurezone.

YoucancharteraboatfromShellySkiboatCluband dive into these waters which are home to Zambezi sharks, tiger sharks, hammerhead sharks, blacktips, andraggies You’llalsogetthechancetoviewgiant manta, sting, and marble rays in their natural environment Whether scuba diving, freediving, snorkelling,orfishing,avisittoProteaBankswillbea memorableexperience

Once you ’ ve explored the world below, look to the skies and enjoy the unexpected kaleidoscope of almost 500 bird species that nest along the KZN South Coast. Whether you ’ re an avid birdwatcher looking for that elusive Magpie Mannikin, or a novicetwitcherwantingtogetstartedintheworld of birding, there’s no better place to explore than thisunexpectedparadise

The popular South Coast Birding Route, which is a sub-section of the Southern KZN Birding Route, takes you through coastal forests where you can look out for the iridescent greens, golds, and reds ofindigenousspecies.

History, culture, and outdoor adventure convergein Gamalakhe, with the recently launched Gamalakhe Township Experience taking you on a tour of the township and beyond Starting with Tin Town, the oldest part of the township where locals will share stories of forced removals, history, and tradition. This ‘Kasified’ Experience also includes a taste of authentic local flavours including shisanyama, townshipkotas,burgers,andchips.Thenheadinto the hinterland for a guided hike across the Vungu River and along the Mjika River where sightings of localbirdlifeandsceneryarecaptivating

AnotherepicoutdooradventureistheKwaNdwalane Experience Found just 9 kilometresinland of Shelly Beach,alocalguidewillleadyouonadriveorhike –whateveryourpreference.TraversetheNtantana Mountain which boasts spectacular views of the 80-metre-high Nyandezulu Waterfall, all the while learningaboutthearea’sincredibleheritage .

Uncover adventure above and below on the KZNSouthCoast.

FROM SEA TO Paradise Sky

ADVERTISERS ON ROUTE 4

Beachfront holiday accommodation. Fully equipped self-catering holiday chalets with direct access to St Mikes swimming beach. Walking distance to restaurants and shops.

083 628 7945 | emerald@venturenet.co.za | Oslo Beach to Uvongo FB: @emeraldcoveSA | IG: @emerald.cove | www.emeraldcove.co.za

Foranunforgettablegetaway,indulgeinourchoice ofself-cateringorbedandbreakfastoptionsoffering excellentaffordability.Air-conditionedrooms,Wi-Fiand ourfullpowerandwaterbackupsolutions,ensuresthe perfectblendofcomfortandrelaxation. Bookyourstaywithustoday!

3b,NorthRoad,OsloBeach,PortShepstone|wwwmydencoza 0396826096|A/H0645110209|myden.reception@gmail.com

Escape to paradise. We at Van Heerden Letting treasure your dreams of enjoying a perfectfamilyholidayasmuchasyoudo. With a comprehensive portfolio of self-catering holiday flats and houses in Shelly Beach, St Michaels-On-Sea, Uvongo, Manaba Beach and Margate, we have something for you.

039 315 1313 | office@vanheerdenletting.co.za | FB: @VanHeerdenLetting www.vanheerdenletting.co.za | Corner Marine and Bond Street Uvongo

Beach, Paddle Boats and a Waterfall

Uvongo

VAN HEERDEN LETTING

Travel Trends

for 2024, 2025 and Beyond…

Nowthatthetravelindustry(andushumans)seem to be awakening from the post-Covid slump, full recognitionof the truevalue of our freedom and timeseemstobecatchingupwithmanyofus.Freedom,in lightofpost-travelbans,butalsothankstotheallowances of new normal remote and hybrid working arrangements, andtherealisationofjusthowshortandunpredictablelife really is. Many travellers now get to explore new places whilefulfillingtheirworkobligationsandhittingthatsweet spot of work-life balance. Here are a few travel trends showingupthisyearandbeyond…

'Showus,don'ttellus'Sustainability

While sustainability and green travel continue to be contributing factors to the lodges and experiences guests are choosing, it's no longer enough to merely state that you're sustainable but rather invite your guests to experience it. Thanks to the European Union's Corporate Sustainability Reporting Directive coming into play, establishmentscannolongergetawaywithgreenwashing to entice guests. Invite guests 'back of house' and turn it into an experience of involving them in where their sustainability cents are going, specifically when the practices show respect and responsibility for surrounding communities fighting climate change. Some examples haveincludedinvitinggueststoplantindigenoustreeson

and around the property or volunteering in your conservationprojectsduringtheirstay.

SilenceisGolden

Living in a world where constant messages, sounds and demands are flung at us in malls, shops, restaurants and even tours; the overstimulated amongst us seem to be craving experiences that immerse us in quiet, natural spaces with a complete lack of sound and utter solace. I would hazard a biased guess that we, as parents, would crave these silent retreats and experiences most of all. Experiences like silent retreats, quieter hotels (for adults only), and silent walks are becoming more popular and invite the opportunity to really invite quiet into your life, reset and immerse yourself in the surrounding sounds of nature.

Slowtravel

In an age of instant gratification where multi-tasking is leading us to burnout and exhaustion, less is becoming more when it comes to travel itineraries. In the same way thatmonotaskingissaidtohavevariouspositiveeffectson our creativity, productivity and quality of what we are focusingon;slowertraveltooneorfewerplacesallowsus to deeply connect with the area, the community and the spaceswearevisiting.

Itavailstheopportunitytoaskourselveshowwetrulyfeel here and now and really enjoy present moments as opposedtofranticallyracingthroughacitytohitallmajor sightseeinghighlightsandreturningexhausted.

Meaningful,TransformativeExperiences

Transformative travel took centre stage awhile back and continues to be a motivating factor for how travellers choose their destinations, journeys and experiences. As humans, we long to be moved, surprised, empowered, inspired and even educated as we explore Passively experiencing an itinerary for pure entertainment is no longerasdesiredandguestswanttoreturntransformedin somemeaningfulway,e.g.,learningalanguage,cookinga dish with a local and/or being a part of transforming the spacetheyvisitedinapositiveway.

Storytelling

Storytellinghastheabilitytoconnect,convertandinspire. Allbrands,notjustthosewithinhospitalityandtravel,have to tap into their heartfelt narrative which hopefully connects with the shared values of their guests and aligns them with their core reason for travelling. Beyond the obvious, travelling can mean many things to different people: peace, time, connection, companionship,

exploration,ease,escapeandmore.Andwithvastamounts of options to choose from, those possibly sharing a powerful local narrative with global significance while offering an opportunity to be a part of it can be the most powerfulwaytosellanexperience.

MultigenerationalTripsandPrivateGroupTravel

The trend of groups of families and friends renting villas and private accommodation spaces remains a post-Covid trend.Emptynestersfindthemselvesnolongerhemmedin byschoolholidays,solofemaletravellersover50lookingto getaway and grandparents accompanying their grown childrenandgrandchildrenonholidaystoshareinthejoy, familybondingandchildcare.

House-swapping

In true 'The Holiday' movie style, alongside the rise of remote working, travellers now have the freedom to work fromanywhereintheworldandmoveaboutratherfreely. Butwiththerisingratesofhotelsandhomerentals,thiscan get expensive for digital nomads. House swapping is gaining more popularity, especially with websites like https://livekindred com/, making it a safe and more trustworthyoptionnottomentionwaymoreaffordable.

By Lauren Manual

039 940-2111

Make that elusive catch on the KZN South Coast! Anglers are spoilt for choice with the varietyoffishinghotspotsfromtheshorelineto deep-seafishingandevenfreshwateroptions

FromthewarmIndianOceanandmanyfishingpiers, through to the dams, streams, and rivers winding throughout, every body of water is teeming with fishspecies

YoucancharterafishingboatfromShellyBeach,and try your hand at catching anything from yellowfin tuna, amberjack, and king mackerel through to dorado,skipjack,sailfish,andmarlin.

Then it’s time for some fun in the beautiful town of Margate, an all-in-one holiday hotspot that keeps youentertaineddayandnight!TheMargateBeachis afamily-friendlyseasideretreatwithTheWalpoleBay TidalPoolinMargateknownforprotectedbathing.

TakeatourwithaMargateRickshaRideandmakea memorable moment at the Selfie Frame! You can also experience the local flavours in the form of artworkondisplayattheMargateArtMuseum

When the sun goes down, the action doesn’t stop in Margate where there are fantastic spots for dining, relaxing,anddancing.

Another gateway to the KZN South Coast can be found here, at the newly-revamped Margate Airport. Thisisagreatwaytoaccesstheregiondirectlyfrom Joburg, with rental cars available to further explore thearea. Iftakingtotheskiesisadream,theoption to charter a flight to see the area from a different pointofviewisalsoanoption

This accessibility alongside the KZN South Coast’s many conference facilities, ample accommodation, and great outdoor experiences make this an ideal MICE destination. Everything from intimate business meetings to large-scale events can be easily accommodatedhere.

EnjoysunnydaysandbrightnightsontheKZN SouthCoast.

ParadiseDay & Night

Step into Serenity Hills: an innovative residential oasis meticulously crafted for eco-conscious living and fortified by unparalleled security measures. Here, we invite you to embrace an active, holistic lifestyle - pets included! With exclusive mountain bike trails, scenic walking paths, and plans for on-site medical facilities, a clubhouse, and award winning dining options, Serenity Hills promises a secluded haven where loved ones gather to thrive. It is not just a home it is a lifestyle. With over 60% sold in phase 1, it is your time to claim your slice of serenity - It is yours to own. It is a place to be truly yourself.

Inspired by travels around the world - from Spanish dinner parties, late-night brasseries in France and Italy, and just simple good cooking at afternoon eateries in Southern Africa and Asia. The Packshed menu is based on these experiences, using earthly techniques such as wood grilling, hot and cold smoking, and when it feels right, offering fusion styled dishes from all over the world.

The perfect wedding venue, with picturesque views and impeccable facilities – we offer a one stop location for all your celebration requirements. Have you visited our Farm Stall? We have collaborated with Sweet Gang & Friends to bring you a farm stall full of interesting foods, gifts, art and baked items right from The Packshed & Sweet Gang kitchens. A must visit!

Sweetdale Night Market takes place on the last Friday of every month. Guests can expect live music, unique food stalls, delicious drinks and lots of amazing artisanal and craft stands selling handmade products. This community driven event is family and pet friendly. It is an all-weather market with covered areas, lighting and seating. Market times are 6pm to 10pm. Lots of secure parking available, fully operational during load shedding and free entry.

serenityhills co.za | Serenity Hills, Old Izotsha Road, Margate, KZN South Coast, 4275

Whether you’re looking for a brief escape, a suitablelocusforaworkingtriporafamily-fun holiday, La Côte d’Azur is the best choice for high-end, affordable hotel accommodation in Margate. Offering the perfect combination of luxury, location and high-end service, to make magical and lasting memories. wwwfirstgroup-sa.co.za/la-cote-d-azur | 1 Manaba Beach, Margate +27 39 312 8170 | +27 39 3125121 | LaCoteReservationist@firstgroup-sa.co.za

BOOKING ESSENTIAL

Come, fly with us! We offer scenic helicopter flights of surrounding areas and charter services to destinations both near and far. We are ideally situated within a scenic paradise, providing views of quaint coastline towns, rugged hinterland gorges and the majestic unspoiled Wild Coast. Add another level to your special occasions or events with tailor made packages!

079 890 3988 (Daniél) | aviation@airtrack.co.za | Margate Airport | 30 51’ 38”S 30 20’36”E FB: @AirtrackAviation | IG: @airtrack_aviation | www.airtrackaviation.co za

Margate

Shelly Beach

Manaba

Gentler Ocean Pursuits

WIn the 21 Tidal Pools on the KZN South Coast

hilemanyvisitorsgravitatetotheSouthCoastfortheexcitementofsurfing,diving(withorwithout sharks) and big game fishing, others seek more relaxing pastimes. Along with having the highest numberofBlueFlagbeachesinthewholeofKwaZulu-Natal,thecoastlinebetweenPortEdwardand Scottburghalsoboaststhehighestnumberoftidalpools–21inall.Andthesearewhatattractthosewhofavour gentlerpursuits.

Cleaned by the wild waves at high tide and protected from the fury of the ocean as it recedes, the tidal pools offersafebathingfortheelderly,splashyfunfortoddlersandachancetogetupcloseandfamiliarwithsomeof thesmaller,fascinatingdenizensofthesea.Donamaskandsnorkelandobservetheeverydaylifeofthesmall fishes,crabs,shellfishandmarineplantsthatmaketheirhomeamongtherocks.

Let'stakeatourofsomeofthebest-lovedpools.

Starting from the south, the natural tidal pool at Palm Beach, just north of Port Edward, is a relatively large expanseofcalmwater,protectedfromthecrashingwavesallaroundit.Ithaseasyaccesstotheseaforthose whoaremoreadventurous.

Southbroombeachhasavarietyoftidalpools,ofwhichGranny'sPoolsarethemostpopular,withsafebathing for children and the surrounding rocks to explore. The main tidal pool is larger and a popular spot for snorkelling.

Ramsgate'stidalpoolhastheaddedattractionofbeingadjacenttoagrassypicnicsitewhereyoucansitand watchactivitiesinthepoolandtheocean,withoutgettinglargeportionsofsandinyoursandwiches!

Margate beach's tidal pool is spacious and accommodates a large number of swimmers, with or without snorkels. The pool is safe and perfect for families with small children. There is also a second tidal pool to the northofLucienBeach,accessiblefromLiliecronaBoulevardinManaba.

Uvongo,atthemouthoftheIvunguRiver,hasarguablythemostspectacularbeachontheentirecoast.Theriver hasawaterfallthatplunges23metresdownintothelagoon,creatingoneofthedeepestlagoonsinthecountry. TherockycoastlinenorthofUvongo,uptoStMichael'sbeach,boaststidalpoolsateitherend.

Uvongo,atthemouthoftheIvunguRiver,isarguablythemostspectacularbeachontheentirecoast.Theriver hasawaterfallthatplunges23metresdownintothelagoon,creatingoneofthedeepestlagoonsinthecountry. TherockycoastlinenorthofUvongo,uptoStMichael'sbeach,boaststidalpoolsateitherend.

SouthportbeachhaslongbeenafavouritewithlocalpeopleandusedtobeoneoftheSouthCoast'sbest-kept secrets.BlueFlagstatushasmadeitmorewidelyknownbutithasn'tlostitsnaturalcharm.Thetidalpool,with itssloping,sandybottom,isabigpartoftheattractionforadultsandchildrenalike

Apartfromthewonderfultidalpools,theKZNSouthCoasthasavarietyofnaturalrockpoolsontheshoreline whichareidealforsnorkellinganddiscoveringlocalmarinelife.

Tidalpoolsare,bytheirverynature,atthemercyofwindsandtidesandtheirdepthmayvaryconsiderablyfrom oneseasontothenext.Butifyoufindthatoneistooshallowforanenergeticswim,ortoodeepforyourtoddler, it'snotveryfartothenextone.Havefunexploring!

ExperiencetheKZNSouthCoastonfootwithahike along the Ramsgate Marine Ramble. Set off on thissuperb6-kilometrestrollatthestartingpoint justbeforethecoastaltownofMargate,andtake inthegloriousviewsoftheoceanwhileexploring mangroves,tidalpools,anddunes.

Navigate the path using the easy-to-follow signs along the length of the route, and replenish your energy with a stop at one of the area ' s famous restaurants,TheWaffleHouse.

ThebesttimetoexperiencetheRamble–andalot of the KZN South Coast’s shoreline – is during the wintermonthswhenTheGreatestShoalonEarth–theSardineRun-arrives WhiletheannualSardine Run can be spotted anywhere along the KZN South Coast, depending on their movement, the Ramsgate Marine Ramble is a great spot for some quality viewing. The largest biomass migration on the planet brings with it a host of hungry marine predatorsfromtheland,sea,andskies

This ocean spectacle attracts seine netters who catchthesardinesfordeliciouslocalcuisine,while thebiggergamefish,dolphins,sharks,andwhales join in the feeding frenzy Overhead, seabirds will torpedo themselves into the mass, leaving with beaksbrimmingwithsilvertreasure.

You can also catch the action from an elevated overview such as the Ramsgate Whale Deck RelaxherefromMaytoNovemberwhenhumpback whales spray and breach as part of their annualmigration

But no matter the time of year you visit, Ramsgate is a nature-lovers paradise, from the popular RamsgateBeach,RamsgateLagoon,andNoelQuarry Tidal Pool to the Butterfly Valley and numerous nature reserves that are home to hundreds of bird speciesandindigenouswildlife

This is also an artistic coastal village with a long history of renowned South African artists emanating fromRamsgate’sshores.

Partakeinaonce-in-a-lifetimeexperienceonthe KZNSouthCoast.

of Paradise A Perfect Piece

the place of artists, collectors and dreamers...

GOOD NEWS...

TheKZNSouthCoastishometothe'highestnumberofBlueFlagbeachesintheprovince.TheBlueFlag programme is an ecological distinction acknowledged worldwide to celebrate beaches that uphold stringentcriteriaencompassingsafety,hygiene,amenities,environmentalawarenessandmanagement excellence.

Boastinganarrayofseasideescapes,'TheParadiseoftheZuluKingdom',isabeachsideholidaydestinationnot to miss. “We are happy to announce that our beaches are clean, safe and ideal for those seeking a relaxed seasideadventure.Thistimeofyearisextraspecialforbeachvisitorsastheannualhumpbackwhalemigrationis underway,”saidSouthCoastTourismandInvestmentEnterprises(SCTIE).

Thewell-establishedcoastlineoffersampleopportunitiesforswimming,adventuringandleisurelyunwinding. Speckled with legendary hot-spots for surfers and divers, the South Coast has patches of paradise in plenty, whetheryouareonetoplungeintotheoceandepthsorjustgetyourtoeswetontheshores.

IfyouplanonjoiningthediverseflockofsaltairenthusiaststhatarrivetoexploreKZN'sBlueFlagtreasureson themostuntouchedandpristineshores,thenhereisthelist:

• MarinaBeach

• TrafalgarBeach

• SouthportBeach

• UmzumbeBeach

• HibberdeneBeach

Marina and Trafalgar Beaches have been additionally honoured for their long-standing ranking in excellent care.MarinaBeach,acoastalgem,celebratedanunparalleled20-yearreignundertheBlueFlagprogramme,an exclusivedistinctionunmatchedanywhereelseinSouthAfrica.Meanwhile,TrafalgarBeachglintswithitsown charm,commemoratingadecadeofBlueFlaghonours.

Ifthatwasn'tinvitingenough,thetropicalparadiseofKZN'sSouthCoastisdottedwithnumerousenchanting tidalpools,deemedtobehiddentreasuresasgoodasgold.Snorkelamidststunningcoastalvistasandelevate your vacation experience with SCTIE's Beach-to-Beach Adventure Hike, a 38km guided journey through the magicofKZN'sestuariesandlushcoastalforests,teemingwithlocalwildlifeandechoesofmaritimehistory.Fall inlovewiththelocalartalwaysfindingitswaytothecoastalregionsorimmerseyourselfinthepristinewatersof theMarineProtectedAreas,AliwalShoalandProteaBanks,renownedasdivinghavens.

Youroceanicexperiencewillbeaccompaniedbyexceptionalchoicelocalcuisineandalivelyatmosphere,this specialplacehasearneditsreputationasaparadiseforseasidelovers.Whetheryouseekrelaxation,adventure, or simply a breathtaking view, South Coast's beaches stand ready to welcome you. The shoreline promises endlessexcitement,thepeoplepromiseheartwarmingcamaraderieandthewaterspromiseanunforgettable aquaticadventure.

Don'tforgettopackyoursunscreenforyourvisittothegoldenshoresofadreamy,sandybeachgetaway.We hopetoseeyouontheSouthCoast,wherememoriesaremadeandthebeautyofnatureawaits.

Trafalgar

Marina Beach

Southport

Umzumbe

Hibberdene

The KZN South Coast is referred to as The Golf Coast–forgoodreason.Whetherforworkorplay, theKZNSouthCoastisahole-in-onedestination, boasting 11 immaculate golf courses, many of which weave in among coastal forests with the mostmagnificentseaviews

In this stretch alone, you can tee off from either San Lameer or Soutbroom golf courses The San Lameercourse,locatedinthe200-hectarenature conservancy, has an 18-hole championship golf courseandanine-holepitch-and-puttcourse.

You can also finish off your round with a dip in the nearbyMarinaBeach,anotherBlueFlagbeachwith a wonderful tidal pool Adjacent to the Indian Ocean is the 18-hole Southbroom Golf Course, surrounded by the lush coastal vegetation of FrederikaNatureReserve.

Once you’ve played a couple of rounds here, why not try one of the other nine courses? These include UmkomaasGolfCourse,ScottburghGolfClub,Selborne Golf Estate, Umdoni Park Golf Club, Port Shepstone Country Club, Margate Country Club, Port Edward Country Club, Wild Coast Sun Country Club, and –movinginland–HardingCountryClub.

While visiting the area, a trip to Southbroom Beachisamust,withthenearbyImbezaneLagoon great for swimming and water sports Otherwise, enjoy ascenic walk along Southbroom’s Bushbuck Trail established by the Southbroom Conservancy, lookingoutforlocalbirdlifeandwildlife.

This quaint seaside village overflows with culture, with delightful antique shops, art galleries, and farmstallsjustwaitingtobeexplored,anda variety offine-diningestablishmentsatyourdisposal

Southbroom is also home to Riverbend Crocodile Farm, the first commercial crocodile farm in South Africa which is now home to one of the finestselectionsofwineintheregion,andanart gallery showcasing the works of leading South Africanartists.

For something different, go on the KwaXolo Caves Adventures near Southbroom, an expedition into a range of caves adorned with preserved San cave paintingsthatareover100,000yearsold.

ThegrassisalwaysgreenerontheKZNSouthCoast.

Paradise

Voted No 1 on-course Pro Shop by SA Top 100 courses. Offering great personal service, a friendly welcome, good advice & comprehensive range of golf related goods and quality apparel. Head Professional Derek James has been voted the SA PGA Top Teaching & Top Club Professional numerous times and is recognized worldwide for his unique teaching ability.

Sheena James 083 302 7252 | + 27 039 316 6051 | Eagle Road, Southbroom play@southbroomgolfclub.co.za | www.southbroomgolfclub.co.za

SOUTHBROOM PRO SHOP

Unparalleled Golfing Choices

in a Sub-tropical Paradise

Hidden amidst the coastal splendour of KwaZulu-Natal lies a treasure trove coveted by golf enthusiasts worldwide– the illustrious 'Golf Coast'. Shroudedin mystery yet reveredby those in the know, this stretchof paradiseoffersagolfingexperiencethattranscendsmereleisure.

As you venture through KZN's subtropical paradise, an idyllic backdrop of the Indian Ocean will accompany you, offeringdazzlingspectaclesalongyourjourney.TheSouthCoastoffersunparalleledconvenience,allowinggolfersto transition seamlessly between captivating courses that vary in both challenge levels and conditions, while being locatedwithinanhour'sdriveofoneanother.

Bustlingamenities,BlueFlagbeaches,world-classdivesites,healthandwellnessfacilitiesandnaturereservesmakethis coastal region the ideal location for family-friendly exploration. Accommodationsspanthespectrum,fromquaintbeachsidecottages to luxurious resorts. Be sure to book in advance and don't be surprised if you leave with more golfing friends than you arrived with. The warm and welcoming atmosphere is what you will find stretching from the Umkomaas Golf Club in theNorthtoTheWildCoastSunGolfClubinthesouth.

Umkomaas Golf Club

With its 18-hole course offering sweeping ocean views and a challenging terrain, Umkomaas Golf Club is known as more than just a golf course, it's a sanctuary for enthusiasts seeking a true coastal escape. Nestled within lush forests that provide a welcome shield from the coastal winds - which can challenge even the most seasoned golfer - Umkomaas Golf Club is renowned for its warm hospitality. The third oldest course in KwaZulu-Natal, it offers long fairways that entice 'big hitters' as well as short, strategicholeswhichdemandprecision.Yet,amidstthetrials,there'splentyoffuntobe hadandanundeniableatmosphereofcamaraderie.

Scottburgh Golf Club

ScottburghGolfClubinvitesplayerstoexperiencetheallureofSouthCoastKZN'ssemilinkscourse.Withitsbreathtakingoceanvistasandchallengingterrain,this18-holegem promisesanexhilaratingroundofgolfforvisitorsofallskilllevels.Theparfour18thhole, affectionately known as the 'white knuckle hole,' presents a thrilling climax to your round, requiring attentive skill to conquer. Players can expect narrow fairways, strategicallyplacedbunkersandever-changingcoastalwindsthattesttheirmettlewith eachswing.Beyondthefairways,theclubhousebustleswithlocals.

Selborne Park Golf Estate

Designed by Denis Barker, Selborne Park Golf Estate is a refined 18-hole parkland course set against the backdrop of coastal forests. It offers an oasis for golfers and natureenthusiastsalikewithbirdlifeandbuckabounding.Themanicuredfairwaysare complemented by sea views and undulating greens that demand your best shots. Players are rewarded with soothing sounds of nature and nearby amenities offering world-classdining,spatreatmentsandluxuryaccommodation.

Umdoni Country Club

With a noteworthy commitment to conservation, Umdoni Country Club is a historic coursesnakingthroughlushcoastalforestsalongsidethesea.Umdonioffersaunique blend of challenge and natural beauty, allowing golfers to see beyond the fairway on optionalguidednaturewalks.ViewwhalesanddolphinsfromtheiconicBothaHouseor relax at the clubhouse, where panoramic views of the surrounding landscape provide theperfectbackdropforrecountingtheday'strialsandtriumphs.

Port Shepstone Country Club

Port Shepstone Country Club offers a taste of golfing history with its scenic 18-hole course nestled between the sea and the uMzimkhulu River - a course that promises a round of golf unlike any other. The front nine delight, with lush foliage and winding fairways, while the back nine present a more challenging landscape, complete with waterhazardsandcoastalwinds.Theclubwasfoundedbyagroupofpassionategolfers and the course's layout, with its mix of challenging holes and stunning views, offers a memorableexperienceforgolfersandnatureenthusiastsalike.

Harding Country Club

Establishedin1978,HardingCountryClubisacommunity-runcountryclubwithaninehole golf course. This unassuming course may be modest in size but offers a warm welcomeandstunningviewsofruralSouthAfrica.Thecourseoffersarefreshingchange ofpaceforplayersofallabilitiesandpromisesaroundofgolfthatisbothrelaxingand enjoyable.Visitorscanexpectalaid-backatmosphereandopportunitytakepartinlocal community events. It is advisable to call the Harding Country Club prior to travelling throughtoHarding.

Margate Country Club

Embark on a golfing adventure at Margate Country Club, where scenic beauty meets challengingplay.Their18holescatertoplayersofallabilitiesandofferadiversecourse layout in the familiar South Coast bush. Get ready for an exhilarating round featuring fivechallengingparthreeholes,includingtheiconic11thsignatureholethatrequiresa preciseteeshotoverabreathtakingravine.Thepicturesquewaterfeaturesattractlocal birdlife and there are stunning views of the surrounding hills. Known as the friendliest pubontheSouthCoast,the19thholeguaranteesawarmwelcome.

Southbroom Country Club

SouthbroomCountryCluboffersablendofeleganceandexcitementnestledinanidyllic seaside village. The fairways seamlessly blend with the ocean, lush bush and quaint residential homes. The clubhouse, positioned above the 18th green, offers stunning surroundings to take in. Renowned for its enjoyable play, Southbroom has been voted SouthAfrica'smostfungolfcoursetwice.Whilethecourseisnotlong,precisionoffthe tee is crucial, especially on iconic holes like the 115m, par three, fourth. The course providesabirdwatcher'sheaven,withglimpsesoflocalwildlifeandaguaranteeofboth challengeandenjoyment.

San Lameer Country Club

Set within a golfing estate, San Lameer Country Club offers carefully manicured greens andbreathtakingviews.Visitorscanenjoyaroundofgolfamidsttheresidentwildlifeor relaxattheclubhouse,takinginthetranquilsurroundingsandwarmhospitality.Prepare yourself for a thrilling challenge, where every hole offers a tight and strategic layout. Navigate through narrow fairways, large bunkers, challenging doglegs and numerous waterhazards,allsurroundedbydevilishlythickroughthatwillputyourskillstothetest. Whileweatherconditionscanaddanextralayerofdifficulty,theyonlyservetoinspirea greatersenseofaccomplishment.

Port Edward Country Club

PortEdwardCountryCluboffersaffordabilitywithoutcompromisingonquality.Withits aesthetic nine-hole course and pleasant sea views, it offers golfers an experience with a novelchangeofpace.Despiteitsunderstatedappearance,thisnine-holecourseoffersa surprising level of versatility, thanks to strategically placed double tees that allow for an 18-holeround.Navigatethroughwaterhazardsonfourholes,undulatingterrainandthe vexingcoastalwinds.Yourrewardawaitsatthelegendary19thhole.

The Wild Coast Sun Country Club

The Wild Coast Sun Country Club is as much an undertaking as it is an unforgettable experience. This world-class course features expansive fairways, oversized greens and a plethoraofobstacles,includingbunkers,ravinesandwaterhazards(includingawaterfall). Factor in the ever-present coastal winds and you have the recipe for a challenging yet immensely enjoyable round of golf, set in striking surroundings that will captivate both amateurs and seasoned players alike. The course's layout has a unique charm that will leave a lasting impression, with its mix of long and short holes. After a round, the distinguishedclubhousepromisesnottodisappoint.

The epitome of golfing excellence lies on KZN's Golf Coast, where these distinguished destinations await avid players seeking an unparalleled experience. Embrace the opportunity to create lasting memories that transcend the game itself, leaving an indelible mark on your golfing journey

More than just Golf at Southbroom Golf Club!

Welcome to Southbroom Golf Club, where the views are spectacular, the course is playerfriendly and the community is like family. Southbroom Golf Club offers a wonderful outside patio where you and your family can enjoy breakfast, lunch and dinner, cocktails at sunset and views of the golf course and Indian ocean that go on for miles.

We also offer Full Membership, Social Membership and Associate Membership.

Visitors are welcome at our club house. Tel: 039 31 66026 | www.southbroomgolfclub.co.za |

Horse lovers will find a home on the KZN South Coast. This stretch has some of the world’s most majestic horses, with expert equestrians ready to give you a guided horseback tour of the farmlandsandcoastalforests.

Located between two Blue Flag Beaches – Marina Beach and Trafalgar Beach - you’ll even get the chancetorideonthesegoldensandsand,ifyou’re lucky,spotadolphinortwo.Whetheryou’relooking to enjoy a solitary ride, a family day out, or a romanticexcursion,thisistheplacetodoit

You can also hike within the pristine 60-hectare MpenjatiNatureReservewhichconsistsofavariety of ecological habitats and biomes such as dune forests, grasslands, and wetlands. With such an expanseofhabitats, youcanbesuretocomeacross several indigenous birds, as well as the various wildlifethatresideheresuchasthereclusiveredand greyduiker

Established hiking trails allow you to navigate the reserve, including the 12-kilometre Impithi Trail along the south bank of the Mpenjati River; or the longer 1.8-kilometre Yengele Trail that takes you throughtheduneforests.

TheKwaNzimakweMulti-Trailsgivesyouthechance to hike, bike, or enjoy a 4x4 adventure traversing the Mpenjati River Valley This is a unique local rural tourism offering that lets you experience the natural and cultural heritage of the hinterland while expanding the geographical footprint of the tourismeconomy

Coffee lovers must stop in at Mpenjati Coffee, which forms part of the AgriTours and is brewing some of the region’s best blends with farm tours and coffee tastings on offer Another great AgriTour stop is Secret Sithela, a birdwatcher’s paradise set withinamagicalindigenousforestwithfreshlygrown organicproduceonoffer.

Forarelaxedseasideretreattorevitalisebodyand soul, then it’s worth visiting Leisure Bay which can be found alongside Glenmore Beach and Munster The site has ideal swimming, snorkelling, and fishing spots, with plenty of rock pools to keep the littleonescaptivated

GetbackintonatureontheKZNSouthCoast.

Paradise A Pristine

The Munster Motor Museum is going like Verstappen Both cars and artifacts have grown tremendously. It is a must visit for any motoring buff! Our vintage shoppe offers original and unusual gifts. Open 10am-3pm Wed, Sat, Sun out of season. Every day in season.

082 579 6387 / rod@kinsey.co.za | www.classiccarsmotorcycles.co.za 816 Monty Sawyer Drive, Munster

This tranquil, eco- friendly establishment is a living, natural library with forest trails, bird watching and Permaculture gardens. Enjoy our self catering accommodation with a swimming pool, dam for fishing and boating and beach proximity.

083 430 1258 | info@secretsithela.com | www.secretsithela.com 816 Monty Sawyer Drive, Munster

We offer the coffee experience from Bean to cup. Based at our processing rooms where you can enjoy the full coffee tour explaining how coffee is made and the process we follow getting you that perfect cup of coffee We also have a café where we offer breakfast and light meals and delicious cakes all while sitting enjoying our beautiful views of the neighbouring farms. Des 083 440 4431| Leigh 083 419 0391 tasty@mpenjaticoffee co za | @mpenjatic coffee P310 (Old Main Road), Munster |wwwmpenjaticoffee co za

Since 1984 a family of three generations have been growing, harvesting and roasting 100% pure Arabica coffee. Visit Beaver Creek for a Crop to Cup coffee tour and bottomless coffee tasting. Sample their delicious coffee and enjoy a meal at the farm café. For the adventurous; you can enjoy the scenic MTB and hiking trails on offer. Coffee Tour is on daily at 12pm, booking essential in holiday season.

039 311 2347 | sales@beavercreek.co.za | @beavercreekcoffee @beavercreekcoffee | www.beavercreek.co.za | Izingolweni Road, Port Edward

You will find this gem before Port Edward on the Lower South Coast, KZN. MAC BANANA offers something for every family member - great restaurants to fill your bellies, activities for the adventurous, a world-class food emporium farm stall with wellsourced products to stock up on, a petting zoo, and so much more awaits your arrival. To top it off, everything is situated on a beautiful banana farm!

Your family holiday will not be completed without a stop at MAC BANANA!

Wellness Tourism, Why It Matters?

The Global Wellness Institute reported that “wellness tourism” is expected to grow more than any other wellness sector, increasing by about 20.9% by 2025 to become a $1.1 billion slice of the economy. The hospitality industry is taking notice and so should we! www.globalwellnessinstitute.org

Wellness tourism is voluntary travel to worldwide destinations for the purpose of promoting health and wellbeing through the nurturing of body, mind and spirit. It refers to travelling for health and wellbeing reasons. The wellness tourism economy includes all expenditures that tourists make during a trip to improve or maintain their wellbeing.

The wellness tourism industry has been revolutionised due to a global surge in interest in fitness, health, wellbeing, and increased consumer disposable income post-Covid leading players in the hospitality sector are capitalising on this trend by catering to conscious consumers.

There is also a global increase in demand for wellness lifestyle habitats and estates, which can be defined as living or vacation spaces that are proactively designed and built to support the holistic health and wellbeing of their residents.

Primary wellness travellers.

These travellers are primarily motivated by wellness to take a trip. Their destination is chosen specifically for its wellness offerings. An example of this type of tourist might be someone who books a retreat at a spa resort

Secondary wellness travellers.

These individuals aim to maintain wellness or engage in wellness activities during any kind of travel. An example would be someone who ensures their hotel has a fitness centre and uses it regularly during their business trips or a traveller who chooses accommodations based on the availability of healthy menu options.

Wellness Tourism and Medical Tourism, Adventure and Eco tourism.

- Wellness tourists travel to improve or maintain their health and quality of life and wellness whilst practicing holism. This is a conscious choice and is different for every traveller.

- Medical tourists travel to receive treatment for a specific diagnosed medical condition and elective surgery.

renowned for its holistic health programs, such as yoga, meditation, and nutritional workshops.

- Eco-tourism is considered to be responsible travel to natural areas that conserve the environment and sustain the wellbeing of the local people and the planet. It generally involves interpretation and education. - Adventure tourism is where travellers generally travel to partake in physical, and often physically challenging endeavours, which may include: Climbing / Hiking / Trail Running / Kayaking / Paragliding / Diving / Caving / Cycling.

Wellness Tourism Includes…

Nutrition (organic restaurants, health food stores, plant-based products)

Weight management / Detox programs / Culinary experiences / Farm-to-table dining / Nutritional workshops / Juice bars / Fitness (gyms and fitness centres) / Gym visits / Fitness classes / Stretching sessions / Pilates / Personal training

Personal growth (lifestyle retreats and wellness retreats)

Retreats / Life coaching / Stress reduction techniques / writing workshops / Art therapy / Meditation and mindfulness programs / Upliftment and lifestyle seminars.

Spiritual and Connectedness

(yoga retreats, spiritual retreats, and ashrams)

Solitude and reflection / Chanting and singing / Spiritual workshops / Pilgrimages / Global Prayer / Community service / Volunteering opportunities.

Mind-body (yoga studios and martial arts studios)

Yoga / Tai chi / Qigong / Biofeedback / Meditation / Martial arts / Breathwork / Energy Healing.

Spa and Beauty

(health-focused hotels, wellness cruises, health resorts, spas, salons and springs)

Massage therapies / Aromatherapy baths / Body treatments / Facials / Hair and nail care / Thermal and mineral springs / Hydrotherapy.

The growth and sustainability of wellness tourism and lifestyles.

Leading players in the hospitality sector are capitalising on this trend by catering to conscious consumers. They are incorporating fitness facilities into their hotels and offering amenities like in-room yoga mats. However, it's not just hotels that are adapting to the needs of wellness tourists. Airports around the world are also entering the market, providing travellers with meditation rooms, massage chairs, indoor green spaces, organic and plantbased dining options, and walking tracks.

Towards the southernmost tip of the Paradise of the Zulu Kingdom, you’ll find the Umtamvuna River which flows through Port Edward – where water sports abound! At the Pont, you can hire boatsandequipmenttogowakeboarding,water skiing,jetskiing,canoeing,stand-uppaddling,or takeasunsetrivercruise

AlsofoundalongtheiconicUmtamvunaRiveristhe Umtamvuna Nature Reserve, with magnificent hiking andmountainbikingtrailsstartingattheUmtamvuna GorgeviewingdeckthroughtotheUmtamvunaBridge. These include the more sedate 47-kilometre Green Route, the moderate 20-kilometre Blue Route, and 246-kilometre BlackRoute

You could also combine hiking with a beach experience with the 38-kilometre Beach-to-Beach Adventure Hike Start the journey at Port Edward Beach where the São João Portuguese Monument commemorates those who died in the famous shipwreck in 1552. You cross Trafalgar and Marina beaches before finishing at Ramsgate Beach – all ofwhichholdBlueFlagstatus

Port Edward is also the site of the world’s smallest desert, the Red Desert, which extends just 200m indiameter,beneathwhichmanyarchaeological treasures have been found to position it as a nationalheritagesite

And if you ’ re the type of person who needs a qualitycuppatostarttheday,thenheadonoverto Beaver Creek Coffee Estate where you can sip freshly-roasted coffee grown right on the farm. Partake in a tour of the farm to learn more about the agricultural processes behind the scenes, or grab a bike and get some exercise on the 2.5-kilometre Espresso Route, the 8.5-kilometre StoneyCreekRoute,orthechild-friendly 400-metre ChocochinoRoute.

This region is also the gateway to the untamed Wild Coast, whose rocky shores and green cliffs make for spectacular seaside hikes A great place to explore is the Petrified Forest which has hikes through trees deposited by the river millions of yearsago.Aguidewillalsobeabletoshowyouthe Mzamba fossils, a series of marine fossil beds exposed along the prominent reefs near the MzambaRiver

paradise An Endless

ONWARD AND UPWARD

We look back in gratitude and celebration at all those who have gone before, contributing to the past 24 editions of the Southern Explorer Magazine and Route Guide in collaboration with South Coast Tourism and Investment Enterprises.

Going forward, there will be business opportunities that will enable Small Medium and Micro Enterprises (SMME's) to flourish. Our roads will be upgraded and the expansion of Margate airport would create an aerotropolis where the city will develop around this hub creating more opportunities for hotels, restaurants, shopping facilities and a transportation infrastructure to support inbound tourism. Inbound travel and tourism is a gargantuan driving force for the economy, upskilling and uplifting communities.

Looking forward… editor Debra Robins connected with the new SCTIE Board.

Going forward, what are the key priorities of the SCTIE through 2024 and into 2026?

Destination of choice to attract investment through different sectors with tourism being one of them, in order to grow, transform and diversify the economy

To increase the number of investors and tourists to the district.

How will these priorities positively impact both local and inbound tourism and tourism infrastructure development in the region?

Creating investment opportunities will grow the demand for other activities and support tourism activities –accommodation, restaurants, and activities. Our activities are aimed at growing the overall economy of the KZN South Coast.

It is understood that tourism infrastructure development is vital to growth and sustainability of the tourism industry.

What are the primary tourism infrastructure development objectives moving forward?

Connectivity is important to the growth of the district.

With the mission of SCTIE being to attract investment in different sectors, as well as tourism. We have identified, through the new Board of Directors, catalytic projects that are vital to the Ugu district, being:

- Revitalisation of the Railway Line

- Key Roads Upgrade

- Airport Expansion

- Port and Harbour Development

- Intermodal Transport Facility

And how will these objectives improve the local economy?

The revitalisation and development of the railway track will drive passengers and freight across the district quickly and efficiently. Creating links between Ugu, the Eastern Cape and eThekweni along the coastline, and also linking Harry Gwala and Umgungundlovu, and linking them to a port, small craft harbour or airport.

The Margate Airport expansion into a Regional Airport would create an aerotropolis with facilities like an aviation school, hangars, restaurants, hotel, etc.

Port and Harbour development: to develop Port Edward fishing harbour, Hibberdene commercial port, Port Shepstone small craft harbour and beachfront mixed-use development.

These catalytic projects would create jobs and provide opportunities for local businesses to offer their services.

With the increase in demand, create more jobs and opportunities for SMMEs and tourism to flourish.

What do you believe the major challenges to be in the development of tourism and tourism infrastructure?

Because of the challenges faced during the COVID-19 pandemic, the Tourism sector was one of the hardest-hit sectors. We focus on tourism; and in addition we want to stimulate investment across all sectors in the district.

Red-tape and the different application processes and bylaws required in the local municipalities can also be difficult.

The successful establishment of a one-stop shop in January this year is one of the ways we are hoping to alleviate these challenges. We work closely with the local economic development and planning units of the Local Municipalities.

How do the additional challenges related to the lack of service delivery by municipal infrastructures, in particular roads, affect both tourism and investment?

Service delivery and the condition of municipal

infrastructure are challenges in most municipalities across the country

Our Board of Directors includes the HOD from each of the municipalities - as ex-officio members where matters are raised. We also have channels through the intergovernmental relations structures to actively lobby for support in areas identified as requiring attention.

What is the message the SCTIE board would like to share with our businesses, our community, our youth and most importantly, local and international travellers?

SCTIE is here to assist and grow the economy of the destination, which is the Ugu District, by encouraging and supporting investment across all sectors to be the destination of choice for visitors and investors.

We are committed to working with government and private sector stakeholders to offer quality products and services to all.

Michael Chiinze specialises in providing a range of unique hand crafted leather bags, rugs, belts, accessories and more.

Sebenza Village on Lot 1, National Road, Ramsgate.

Find us at: 073 190 3892 Route 5

mchiinze@gmail.com

KwaQwabe, a hidden gem in the rural area under Nkosi Gumede offers hiking trails and paint ball games in the forest, the ultimate watery, dusty and muddy thrill.

Situated at Emalangeni in a rural area, only 2km from Pennington Authentic African braai experience. A great place for “meat and eat”

Find us at:

Emalangeni, Nkombo,

KZN, 4209.

081 419 1445

Emslkhawula2@icloud.comail

Two self catering establishments near Pennington, the Ohlwini Garden Lodge at Emalangeni and Ohlwini Boutique in Sezela.

Budding Budding Brands Brands

Find us at: 064 766 7384

Ward 5, Umzumbe, Port Shepstone, 4240.

info@npsadventures.co.za.

Enjoy the beautiful, peaceful surroundings with spectacular views, abundant bird and wild life of the Umdoni Park Forest

South Coast

Your charismatic tour operator specialising in cultural and captivating tours in and around Harding, Umuziwabantu

Find us at:

1 WillowdeneAve,Turner Street, Harding, 4680.

Find us at: 065952 5379

theforesthousebnb@gmail.com

Harding, Umuziwabantu, KZN, 4680.

073 224 2750

malusiq1@gmail.com

Find us at: 073 542 8615 / 0744752837

Nelson Mandela Road, Sezela, Umzinto, 4215.

ohlwinilodges@gmail.com

Enjoy a 5km hike through the indigenous forest, along the Izotsha River to the 80m waterfall, with designated picnic and braai areas in full view of the waterfall.

Find us at: 083 349 2164

Madakane, Off N2 Murchison, KwaNdwalane, Port Shepstone.

pholapark1madakane@gmail.com

Local tour operator specialising in cultural, rural and township outdoor activities such as hiking, camping and authentic experiences in KZN South Coast

GamalakheTownship, South Coast KZN, 4249.

073 092 9818

mbongenimthembu900501@gmail.com Find us at:

Successful South Coast KZN S

UNLOCK THE TASTE OF PARADISE WITH MAZZ

Indulge in the Original Mauritian Mazavaroo, straight from the sunny shores of the South African KZN South Coast. Crafted with love and passion, our red or green relish and sauce serve as the perfect condiment for any dish.

Made from home-grown chillies, handpicked with care, and blended with our fiercely guarded recipe, MAZZ is undeniably addictive. 100% pure natural ingredients. No colourants, food additives and no thickeners. It’s pure wholesome and authentic.

Loved and cherished worldwide, MAZZ is shipped to every corner of the globe- including Mauritius! From grilled meats to sandwiches, pizzas to pasta, MAZZ adds a burst of flavour that tantalizes your taste buds and leaves you craving more.

Discover adventure and family fun

at Lake Eland Game Reserve

Nestled in the heart of the stunning KwaZulu-Natal province of South Africa lies a hidden gem that promises unforgettable adventures and cherishedfamilymoments:LakeEland GameReserve.Stretchingacross2500 hectares, this pristine reserve offers a perfect blend of wildlife encounters, adrenaline-pumping activities, and serene natural beauty, making it an ideal destination for adventurers and familiesalike.

One of the most enticing aspects of LakeElandGameReserveisitsdiverse array of wildlife. Visitors have the opportunity to spot a wide variety of animals in their natural habitat, including majestic giraffes, graceful zebras, elusive antelopes, and even the occasional sighting of the reserve'snamesake,theelusiveeland. Embark on a thrilling game drive or opt for a guided bushwalk to get up close and personal with these magnificent creatures while learning abouttheimportanceofconservation effortsinpreservingtheirhabitats.

For those seeking an adrenaline rush, Lake Eland Game Reserve offers an array of heart-pounding activities guaranteed to get your blood pumping. Daredevils can take on the iconicLakeElandZipLine,whichspans an impressive 4.5 kilometers and offers breathtaking views of the reserve's lush landscape as you soar throughtheairatexhilaratingspeeds. Alternatively, test your bravery on the suspension bridge, which hangs 80 meters above the Oribi Gorge, providing an adrenaline-fueled experienceunlikeanyother.

Families will find no shortage of funfilled adventures to enjoy together at Lake Eland Game Reserve. Spend the

day picnicking alongside the tranquil shores of Lake Eland, where children can paddle in the shallows or try their handatfishingwhileparentsrelaxand soak in the serene surroundings

Younger visitors will delight in the reserve's playground facilities, which feature a mini zipline, swings and climbing frames, as well as an adventure zippy Put guaranteed to keep them entertained for hours on end.

Nature enthusiasts will revel in the opportunity to explore the reserve's extensive network of hiking trails, which wind their way through forests and across rolling hillsides. Keep your eyes peeled for a myriad of bird species that call the reserve home, including the vibrant Knysna turaco and the majestic African fish eagle, makingitabirdwatcher'sparadise.

After a day of adventure, unwind and recharge at one of Lake Eland Game R e s e r v e ' s c o m f o r t a b l e accommodation options. Choose fromcozyself-cateringchaletsnestled amidst the trees, or opt for a rustic camping experience under the starlit African sky. Wake up to the sounds of natureandthepromiseofanotherday filledwithexplorationandexcitement.

Whether you're seeking an adrenaline-fueled adventure or a peaceful retreat into nature, Lake ElandGameReserveofferssomething for everyone With its incredible scenery, diverse wildlife and endless array of activities, it's no wonder that familiesreturnyearafteryeartocreate cherished memories that will last a lifetime.Sowhywait?Planyourvisitto Lake Eland Game Reserve today and embark on the ultimate African adventure.