Issuu on Google+



  

   



        

Kids in colour > 14

FGE Srrl - Regiionne Sann Gioovaanni, 40 - 140533 Caneelli (AT) - nr.r 3/22012 - Anno XXXIII - bimesstrale

German design special > 20

'7412'#0.'05'5

6'%*01.1);


3 (XURSH(GLWRU路VFRPPHQW 3 :KDW路VRQLQ(XURSH 3 ,QGHWDLO6W\OHZLWKSUHFLVLRQ 3 )DVKLRQSDJHV.LGVLQFRORXU 3 %UDQGSURILOH9DOHQWLQR'LVWLQFWLYHIDVKLRQ 3 6SHFLDO$QH\HRQ*HUPDQ\ 3 3URGXFWVVHFWLRQ 3 1HZVVHFWLRQ 3 9LHZIURPWKH86 3 (XURSHDQ/HQVHV 7HFKQRORJ\

M AY / J U N E 2 01 2

international eye fashion 1


/dKZÍ›^KDDEd

-

  !"#

 $!"%$  & &       '(   )  ( *+   +,&#    +, - &+ *+& '.     !    .  $+   /$0 1" 23$ ! 4 *  * 56     *  +   * $&7 *#    +     ''    '   * *& +8'&   

+'+ +'   &  '  & +#1   +, '            .' +      '# 7  &  9+& & +  +' * -&     +:  *- : :-++) *) &+ * $  #  +*-$+ ; #<*+ #   =&&&#  '*> # ' % "''                (XURSH#   <  #        #

2 20/20 Europe

M AY / J U N E 2 01 2


W H AT ’S ON IN E U ROPE

0GYUHTQO/+&1CPFUQOGGZEKVKPIEQNNGEVKQP NCWPEJGU

(:[P[JOPU[PTL Burberry presents Burberry Whipstitch collection for women, a sunglass range featured on the Spring/Summer 2012 runway with hand-stitched leather cord detail through the acetate frame and temples. Inspired by the Burberry Prorsum Spring/Summer 2012 ready-to-wear and accessories collections, the styles reflect the brand’s heritage in craftsmanship. A faceted oval front combined with a metal plaque at the temples featuring the Burberry logo. The contrasting artisanal whipstitch detail between the front and temples is inspired by the colour palette of the Burberry spring/ summer collections. The colour palette features dark tortoiseshell, amber tortoiseshell, red tortoiseshell, and green tortoiseshell. Burberry Eyewear is available from Burberry stores and selected retailers worldwide.

0[HSPHU LSLNHUJL Alberta Ferretti launches a new sunglass collection in collaboration with Cutler & Gross. The collection comprises 6 sunglass models which reflect the contemporary femininity and elegance that characterise the Alberta Ferretti world. The designs are inspired by the handmade decorations that come from the motives and linear shapes of the Ferretti ready-to-wear collection. “Cutler and Gross is a world wide leader in the luxury eyewear field thanks to its expression of tradition and quality. They will be able to translate in the best way the elegant and sensual style that has always characterised the world of Alberta Ferretti,” explains Massimo Ferretti, president of Aeffe.

4 20/20 Europe

M AY / J U N E 2 01 2


W H AT ’S ON IN E U ROPE

5H[\YHS^VYSK

Okia has launched the Flowers & Butterflies Collection, which focuses on extraordinary blends of colours: thanks to the use of artificial bright tones, this collection updates a theme from the past by introducing a totally new concept of nature. Always keeping close to its inner features - brightness, mirth, boldness and innovation – OKIA once again confirms the limitless possibilities offered by its HDA® Technology in terms of creativity and design. Thousands of shades connected to classical shapes: that is the primary concept of this new line! Vivid and unexpected colours highlight every single pattern shown on these cheerful models. Besides, the wonderful butterflies and flowers spread all around the frames feature special metallic effects produced through the revolutionary BMT technique. Finally, metallic rims and bridges bestow a delicate and fresh touch of refinement and style on the glasses, never forgetting to communicate originality. Conceived for people fond of new fashions and glamour who want to differ from the mass, this collection offers an eye-catching profile which diffuses vitality and confidence: definitely a must-have for the very next season that will make any other eyewear look ordinary. Keep young with the wonderful sketch-like design by OKIA and get hypnotized by the metallic colours combination! Try on the Flowers & Butterflies Collection, you will not be able to do without!

`LHYZVM6YNYLLU Danish eyewear brand Orgreen Optics is celebrating its 15th Anniversary in 2012. In honour of the occasion at MIDO, the company exhibited its iconic pieces from over the years, in a retrospective corner at the Orgreen stand. These included the elegant sunglasses model, Palma Lova, a celebration of the 1950s catseye shape. The model’s sly cut-out curve accentuates the eyebrow. Available in a golden version and a sultry electric blue, among other chcices.

M AY / J U N E 2 01 2

international eye fashion 5


W H AT ’S ON IN E U ROPE

4V]L[V)LSNYH]PH Henry Jullien presents Belgravia, a feminine model fitted with the French company’s new demountable screwless hinge. With its elegant lightweight design, this luxurious model is offered in yellow gold, rose gold and Palladium, and also a palette of complementary colours. Henry Jullien is one of the leading traditional eyewear producers in the Jura in France.

4HKLPU.LYTHU`767 Inspired by the European Championships, Flair has developed a new marketing campaign, which gives a clear, “Yes - to Germany as a location. With this campaign we intend to enforce and support the ophthalmic optics trade”, explains the company. The new ‘Flair - made in Germany’ decorative package includes a display/counter card, a Flair-Logo in German-flag-colours black/red/yellow and the printed certificate “commitment to Germany” as a location. This campaign includes the message “We say yes to Germany - and are proud of our country and its values”. This also reflects the values of the optician as well as of Flair. The delivery of this decorative package is available within a week, so it matches perfectly to the EC and can decorate the shop window area.

6 20/20 Europe

M AY / J U N E 2 01 2


W H AT ’S ON IN E U ROPE

=PZPVU,_WV HUK*VUMLYLUJL -VYTZ4LKPJHS (K]PZVY`7HULS Reed Exhibitions, co-owner of  International Vision Expo & Conference, has formed a Medical Advisory Panel to engage contact lens, pharmaceutical and diagnostic companies at International Vision Expo East and West. The new panel, which held its inaugural meeting during International Vision Expo East 2012 at the Javits Center in New York City on Thursday, March 22,

M AY / J U N E 2 01 2

comprises the following companies and representatives: Alcon Laboratories, Rick Weisbarth; Allergan, Dave Gibson; Bausch + Lomb, Mohinder Merchea; Coopervision, Inc., Arthur Alvut; Marco, Robert Kalapp; Topcon Medical Systems, Bob Gibson; and Vistakon, Lee Ball. “For more than two decades we’ve been recognized as the premiere fashion event. What many don’t realize is that Vision Expo also educates more optometrists than any other eye care meeting,” said Tom Loughran, vice president for Reed Exhibitions. “Over the last few years we’ve taken aggressive steps to build a comprehensive education program that offers the best products, trends and solutions for all eye care professionals.” He added, “With this panel’s support, our goal is to deliver better content and improve overall attendee and exhibitor experience at International Vision Expos.” Show management has already begun to solicit feedback from the Medical Advisory Panel on new and existing programs and plans to tap into individual members’ expertise to further develop optometric programs. Despite ongoing construction at the Javits Center, early attendance numbers and commentaries following International Vision Expo have been overwhelmingly positive. Preliminary unaudited attendance figures indicate that of the record-breaking 16,317 eye care professionals who attended the show, nearly 3,000 were ODs, a 16 percent increase from 2011. This year, show organizers introduced a new split-level floor plan, which combined pavilions and education to form a new destination on Level 1. The revised layout was part of a larger effort to better connect classroom instruction to hands-on knowledge at the exhibits.

international eye fashion 7


W H AT â&#x20AC;&#x2122;S ON IN E U ROPE

9VJR\W New British brand RockOptika has launched its latest optical styles, including trendy round shapes and strong vintage-feel menâ&#x20AC;&#x2122;s designs. Designed in Hastings in the UK and made in the Jura region of France, the spectacles and sunglasses are made from fine Italian acetate and reflect a retro-futuristic theme, where old-styling is brought up to date with clever patterns such as lace and classy patterned finishes.

Z[9L]PZP[LK Gold & Wood have ve launched model H27, a style based on the Malcolm X signature d signatur design. The mythical, retro-chic model takes on a new life as sunglasses in horn with wood. H27 is a fullrim metal panto shape with light dynamic temples. Attention is placed on the balance of volumes to give wearers a refined but light and comfortable product.

8 20/20 Europe

M AY / J U N E 2 01 2


W H AT â&#x20AC;&#x2122;S ON IN E U ROPE

*VSV\YISVJRPUNI` 4HYJ1HJVIZ The latest sunglass collection by Marc Jacobs is characterised by a strong fashion spirit which reflects the chic, and unconventional styling of the Marc Jacobs brand. Colour plays an important role, with bright hues combined to reflect trends in fashion and accessories this season. For model MJ408s pictured, choose from nude/orange, black/bright blue, pink/mint or purple/ blue to brighten up your days this summer!

T\ZPJPUZWPYLK Z[`SLZ Italian brand Vanni, produced by Nico Design, has presented a range of products in its Stratos colleection, inspired by the rhythms of Jamaican ska. The Stratos frames are form formed in acetate by stratifying different colours and thicknesses. The frames are fashioned out of strips of multicoloured acetate combined with plain plastic or single-colour patterns. Both gloss and matt finishes are featured. M AY / J U N E 2 01 2

international eye fashion 9


IN DE TA IL

:[`SL^P[O

RTGEKUKQP

*UBMZT1SBNBPSJT QBSUJDVMBSMZXFMM LOPXOGPSJUTIJHI RVBMJUZUJUBOJVN FZFXFBS/JDPMB%FM %JO UIFDPNQBOZ QSFTJEFOU TQPLF UP&VSPQF EVSJOH.JEPBCPVU HSPXUIBOEOFX BDIJFWFNFOUTJO BOECFZPOE 10 2 0 / 2 0 E u r o p e

Pramaor has introduced more acetate into the Blackfin collection. Please introduce the line and the new additions launched at Mido. For Mido 2012, we wanted to increase the Blackfin optical range, and present a new collection focusing on two materials: titanium and acetate. If you select the Blackfin brand today as a consumer, you can choose from vintage-inspired models right through to more contemporary designs, which are larger and extremely trendy. Blackfin highlights within this

new collection designs that marry comfort and design, uniting subtle thicknesses, keyhole bridges and open nose pieces with a retro feel, fronts in 2mm thick ultra-light pure titanium and temples in 0.5mm beta titanium with a strong futuristic look. For those who love softer lines, we have created some models with acetate fronts and ultra flexible beta titanium temples. The acetate front contrasts ide-

ally with the titanium but, at the same time, brings an elegance and a well balanced aesthetic to the frame which becomes even more refined with the numerous colour choices introduced. The Blackfin models feature classic shades of black, brown, red or dark violet. The originality of the contrasting tones is brought out further by using temple colours featuring opaques and beautiful satin effects. Finally, to make the M AY / J U N E 2 01 2


IN DE TA IL

Bioeyes brand and the new Nylor models we have added are typical of this. Thanks to the new IDCSâ&#x201E;˘ system (Instant and Durable Connection System) patented by Pramaor, the temples are assembled during the final stages of production withmodels extremely wearable, we have inserted adjustable nose pads on the acetate fronts made from 0.5mm thick beta titanium, with comfortable soft PVC plaques. This technical detail is for us an important innovation not only because it allows us to reinforce our position in the local and European market; it also ensures we can satisfy the Asian markets. Thanks to their incredible adaptability, the nose pads perfectly suit the Asian fitting so that the frame sits on the face perfectly. How have you extended the Bioeyes collection this season? We have worked hard developing the Bioeyes collection in the last 2 years. We have achieved amazing results in terms of quality and technical innovation. Recently, we introduced 8 new M AY / J U N E 2 01 2

Nylor models completely made of titanium and beta titanium. titanium The aim was to widen the appeal of the collection to a wider target market. The very light, harmonious and flexible frames now available offer exceptional levels of comfort. For a female target, we have also introduced models that combine an elegant and refined front in pure shiny titanium and brightly coloured temples with captivating shapes. The double form of some of the models has been designed to permit the use of progressive lenses. This is a characteristic widely used in our collection Bioeyes, where we feature unisex models in more restrained colours with minimal temple designs. Design, creative research and technical innovation are the characteristics that perfectly describe the i n t e r n a t i o n a l e y e f a s h i o n 11


IN DE TA IL

tionary technology replaces the individual parts – which in the past were soldered together – with a single, robust, resistant and aesthetically clean titanium block.

out the need for soldering, and this widens the variety of forms and colours that we can offer considerably. Finally the bridge and the pad arms are produced with a numeric system 12 20/20 Europe

from a single block of titanium with the innovative technology UNIBLOCK™: this allows us to eliminate solders and joins to increase the strength and stability of the frame. This revolu-

Please explain the qualities of the ATOM III hinge introduced into the BioEyes models. All our new models feature the ATOM III™ hinge, a third generation innovation with out screws, made completely out of titanium. ATOM III™ offers unrivalled mechanical movement, withstanding more than 50.000 movements, without wearing down. This is a sensational result: if you open and close the frame at least 10 times a day on average, this means that the frame will last around 14 years. We use a plastic material called MILATON™, which is strong, resistant to heat and absorbs shock even in very thin applications. We have the patent for this which allows us to benefit from a range of products that are made in Italy, according to the strict regulations of “neomadeinitaly™”. Pramaor has recently created a

video called 53 Steps to perfection. What is the idea behind this special production. To show our research, quality, and the continuous work we put into perfecting the styling of a brand like Blackfin which is not always easy and sometimes not even the finished product shows quite how much is done to get the end result. We wanted to translate these characteristics into pictures with a video, “53 Steps to perfection” which shows the stages required for each product in the Blackfin range, starting with the titanium itself. “53 Steps to perfection” is like a collage, a sequence of evocative images about the style and design of the Blackfin brand, which represents the heritage of the values which form our house brand. Explain the communications project of which the video is a part. The new communication programme we launched at Mido 2012 is part of a new wider marketing strategy. Our primary objective is to integrate, in a single network all the media to M AY / J U N E 2 01 2


IN DE TA IL

reinforce brand awareness and communication in the sales outlets we work with. Alongside the video “53 Steps to perfection”, we have created a new campaign in a collaboration with the photographer Giovanni De Sandre which reflects the characteristics of the brands Blackfin and Bioeyes. Concreteness and elegant minimalism are the two main elements of the new project by Anidride\design for Pramaor: the protagonists, men and women of today, express themselves with a look and eyewear that is minimal and sophisticated. The campaign was completed for the launch of the two new websites for Blackfin and Bioeyes. With regard to Pramaor’s positioning outside Italy, what are your goals and key markets at present? After having covered the Italian market with 10 direct agents, Pramaor is looking to expand further abroad. We are already distributing in Germany and 18 other countries including Portugal, France, Belgium, Netherlands, Switzerland, Spain, Serbia, Hong Kong, Singapore, Malesia Israel, M AY / J U N E 2 01 2

Taiwan, Brasil, Russia, Turkey and Canada.

same time, the company continues in its process of research and development to create collections

of excellence, suited to consumers who wish to wear spectacles that reflect their personality.

Please summarise the Pramaor philosophy for producing frames in the context of Made-in-Italy. More than Made-in-Italy, we refer to “neomadeinitaly™”. PRAMAOR created a new development model, which combines the traditional attention to quality represented by “Made in Italy”, with a new creative inspiration and production ethos. The neomadeinitaly™, based on concepts of design excellence and artisan control, defines a new product, sensitive to contaminations between art, culture, technique and technology, that is made in and promotes the search for innovative materials and eco-friendly elements, fully respecting the environment and the individual. Add any further detail about Pramaor in Europe and the company’s expansion over 2012/2013. The company is growing steadily and for the 2012-13 period we have planned expansion in the following markets: Morocco, Tunisia, USA, UK, Romania, South Korea and the Philippines. At the

www.blackfin.eu international eye fashion 13


F FASHION

20+:KP %\&ORGDJK1RUWRQ(GLWRULDO'LUHFWRU

%JKNFTGPŏU HTCOGU CTG CNYC[U EQN QWTHWNCPFCUVJGEQNQWTDNQEMKPI VTGPF EQPVKPWGU VQ UGFWEG WU KV KU PQUWTRTKUGVJCVEJKNFTGPCTGETCX KPI VJGKT UJCTG QH HGNVVKR UJCFGU KP EQQN CPF WPGZRGEVGF EQODKPC VKQPUQTUKPINGEQNQWTUVJCVECPDG RGTHGEVN[OKZGFCPFOCVEJGFYKVJ ENQVJKPIŗ6JGVTGPFKUDKIHQTQRVK ECNUCPFUWPINCUUGUCPFIKXGUEJKN FTGPCPQVJGTEJCPEGVQGPLQ[VJGKT G[GYGCTVQVJGOCZ

3LM[[VYPNO[!

62I`6NP2PKZ!VULVM[OLJOPSKYLU»Z

(NH[OH 9\Pa KL SH 7YHKH (5  

Z[`SLZ I` [OL WVW\SHY [YLUKZL[[PUN

PZ WHY[ VM [OL JVSV\YM\S YHUNL VM MYHTLZ

IYHUK 6.0 ;OL 6NP 2PKZ *VSSLJ[PVU

I` [OL :WHUPZO KLZPNULY WYVK\JLK \U

HPTZ [V VMMLY MHZOPVUMVY^HYK KLZPNUZ

KLYSPJLUJLI`67;04;OLRPK»ZMYHTLZ

[OH[HYLZ[`SPZOHMMVYKHISLHUKK\YHISL

HKVW[KL[HPSZHUKKLJVYH[PVUZ[`WPJHSVM [OLIYHUKPUJS\KPUNOLHY[ZHUKÅV^LYZ HZ ^LSS HZ M\U [VULZ HUK JSL]LY [VUHS JVTIPUH[PVUZ ^^^NY\WVW[PTJVT

^^^VNPMYHTLZJVT


PEQNQWT F FASHION

,ZWYP[,; MYVT*OHYTHU[PZ[`WP

4VKLS9PVMYVT+\[JOSHILS9LK6W[P

>PU_ *S\I >=  I` 0UV[[PJH! KL

JHS VM [OPZ SPUL ^OPJO MVJ\ZLZ VU NYLH[

JHS![OLZ[`SLZPU[OLJVSSLJ[PVUHYLM\UR`

ZPNULKMVYWS\ZJOPSKYLU[OLJVSSLJ[PVU

JVSV\YWVW\SHYZOHWLZHUKSP[[SLKL[HPSZ

HUKVYPNPUHS;OLSPULPUJS\KLZHZLYPLZVM

PZIHZLKVU[OL0[HSPHU;=ZLYPLZMLH[\Y

MVYHUL_[YHZWLJPHS[V\JO[OH[RPKZ^PSS

KHYPUN HJL[H[LZ HZ ^LSS HZ TL[HS Z[`SLZ

PUN[OLZP_>PU_MHPYPLZ*YLH[LKI`0NPUPV

LUQV`^LHYPUN

WYVK\JLK PU [OL OPNOLZ[ X\HSP[` TH[LYP

:[YHMÃ&#x201E;[OLMV\UKLYVM9HPUIV^[OL>PU_

HSZ[OH[SVVRNVVKHUKSHZ[

HYL WVZP[P]L ILH\[PM\S HUK ]P]HJPV\Z

^^^JOHYTHU[JVT

^^^YLKVW[PJHSUS

;OL VW[PJHS HUK Z\UNSHZZ JVSSLJ[PVUZ SP JLUZLK[V0UV[[PJHHYLHSS\YPUNHUKTHNP JHS ^P[O Z[YVUN JVSV\Y JVTIPUH[PVUZ HUKL_JP[PUNZOHWLZ ^^^PUV[[PJHJVT

M AY / J U N E 2 01 2

international eye fashion 15


BRAND PROFILE

&KUVKPEVKXG  

Luxury fashion leader Valentino has launched a new eyewear collection in partnership with Marchon. 20/20 EUROPE took a closer look at the first collection, launched at MIDO 2012, and spoke to designers Maria Grazia Chiuri and Pierpaolo Piccioli.

V

Valentino eyewear collection, produced under licence with Marchon, was nched in March. Outline the direction of the collection in terms of design, materials, colours and detail for S/S 12. The Valentino eyewear S/S12 Collection is characterized by vintage shapes, distinctive silhouettes and striking contrasts. It features iconic elements of Valentino style interpreted by Maria Grazia Chiuri and Pierpaolo Piccioli: lace, precise yet feminine lines, and studs. Lace subtly appears on transparent acetate shadow â&#x20AC;&#x201C;with a hint of colour. Metal studs and inserts accent the shape of the lens. The striking, iconic Valentino â&#x20AC;&#x153;Vâ&#x20AC;? becomes a functional element or distinctive detail. Frames are oversized, with curvy silhouettes or sharp architectural shapes. Retro themes are a key direction here. Please explain the very specific details inspired by the past. Maria Grazia Chiuri and Pierpaolo Piccioli: Our goal was to create an eyewear

16 20/20 Europe

collection with specific product characteristics and elements of the Maison. Our style in Valentino is to combine the brandâ&#x20AC;&#x2122;s classic and historic values with a more contemporary approach. We basically chose timeless, classic shapes for eyewear because we believe that Valentino is a brand that must give this type of sensation to the customer. But at the same time, we have added elements that make them extremely modern and absolutely unique. Explain any links with the Valentino apparel collections. MGC and PPP: We found technical solutions, such as making hinges that incorporated the symbol of our Maison. We were able to print a lacy motif on the lenses that provides excellent visibility and also protects against the sun. Valentino Eyewear is a high-tech product. Founded in the 1960s, the Maison Valentino has come to represent haute couture at its finest. Explain further. M AY / J U N E 2 01 2


BRAND PROFILE

The Maison Valentino is one of the most important expressions of the couture savoir fair and excellence. A “Made In Italy” label that is the most famous in the world. Maria Grazia Chiuri and Pierpaolo Piccioli, Creative Directors since October 2008, prefer a hands-on approach, writing a new language using traditional tools. Their style is to combine the brand’s classic and historic values with a more contemporary approach. They work in this company with a prestigious past, but they also live in today’s contemporary world. That’s why they don’t want to forget their background or the heritage of this Maison: their goal is to make it more contemporary, combining elements of the past, yet being fashion forward and designing products for contemporary women.

M AY / J U N E 2 01 2

Does a brand like Valentino, with such an important heritage, have new goals and new directions today. Please explain putting the licence with Marchon in context. MGC and PP: Our creativity can be applied to different lines, from haute couture, where we can experiment with unique to prêt-a-porter lines such as accessories and eyewear. We believe that the key of our style is our ability to transform everyday items into pieces that are special and reflect a world of reference. This is a very important objective from a stylistic perspective because it means bringing the world of Valentino to products that are not typical for the fashion house, but with the same level of commitment found in haute couture and couture. In a haute couture fashion house, any product must be luxurious and reveal

international eye fashion 17


BRAND PROFILE

superb craftsmanship, which is essential for it to be couture. Therefore, the craftsmanship and technology used to make these sunglasses is on the part with haute couture production: they are flawlessly made and absolutely modern objects.

Marchon has been an important element of our team because our goal was to express the stylistic vision and approach of the Maison using the technical expertise of a renowned eyewear manufacturer. Marchon has been fundamental to apply the know-how typical of the eyewear industry to our concept of lightness, elegance, luxury and modernity. Do you have any specific goals or plans for the optical/sunglasses collections in Europe. MGC and PP: Europe is an important market for Valentino and no doubt it will also be one for our eyewear business.

=PS=HGEI=CAO?KQNPAOUKB3=HAJPEJK

18 20/20 Europe

M AY / J U N E 2 01 2




 0-" &)Ä¡$"/*+1/"+!0+!/"1&)&+$

#H=EN

'(6,*1 ,1129$7256 )520 *(50$1< $1' $8675,$ ,QH\HZHDU*HUPDQ\MXVWNHHSVRQGRLQJZKDWLW GRHVEHVW²FOHDQFDUHIXOO\FUHDWHGGHVLJQZLWKDQ H[FHSWLRQDOTXDOLW\DQGÃ&#x20AC;QLVK$GGIDVKLRQDQGD JHQHURXVKHOSLQJRIVW\OHDQG\RX·YHJRWDJRRG LGHDRIKRZWKH*HUPDQGHVLJQHUVKDYHPDQDJHG WRPDNHDQDPHIRUWKHPVHOYHVDOORYHUWKHZRUOG (8523(KDVWDNHQDORRNDFURVVWKHIUDPH FROOHFWLRQVIURP*HUPDQ\DQG$XVWULDIRUWKLV URXQGXSDERXWWKHKLJKOLJKWVLQH\HZHDUIDVKLRQ IURPWKLVUHJLRQLQ

Translations page 46


0-" &)ġ$"/*+1/"+!0+!/"1&)&+$



6KDSHVJHWVOLFN 0QJCH=OOAO>U)QJAPPAO(KHHAGPEKJ

,F%HUOLQWKHVSHFLDOLVWVLQWUHQG\VFUHZOHVVVKHHW PHWDO JODVVHV ODXQFKHG DQ LPSUHVVLYH ZLGH VHOHF WLRQRIQHZVW\OHVDW0,'2LQFOXGLQJPRGHOVLQWKH XOWUDIHPLQLQH7UHV&KLFUDQJH6KDSHVKHUHDUHVHQ VXDODQGSURYRFDWLYHIURPFXUY\URXQGVWRWKHYHU\ WUHQG\PRGLÀHGFDWVH\HVDQGGHOLFDWHEXWWHUÁLHV ,QFRQWUDVWDW)ODLUDVHOHFWLRQRIOX[XULRXVULPOHVV IUDPHVERDVWLQWHUHVWLQJOHQVVKDSHVFRPELQHGZLWK HPEHOOLVKHG PRXOGHG PHWDO DUPV ZLWK HODERUDWH GWHPSOHGHWDLOVKRZLQJERWKWKHFUDIWVPDQVKLS DQGDWWHQWLRQWRGHWDLORIWKLVORQJVWDQGLQJ*HUPDQ ODEHO 1DWXUDOWDNH +RUQ DQG ZRRG DUH ZHOO UHFRJQLVHG PDWHULDOV LQ *HUPDQ\$XVWULD DQG 6ZLW]HUODQG$XVWULD·V \RXQJ DQGIDVWJURZLQJ5ROI6SHFWDFOHVKDYHWDNHQWKHQDW XUDOPDWHULDOWKHPHRQHVWHSIXUWKHUE\LQWURGXFLQJ ZRRGHQVSHFWDFOHVZLWKDVWRQHÀQLVKWKDWOHQGVD OLYHO\\HWVRIWÀQLVKWRWKHIUDPHV5ROI·V6N\ODUN WKHÀUVWKDQGPDGHPRGHOWRIHDWXUHWKHZRRGVWRQH FRQFHSWZDVDZLQQHURIWKH5HG'RWGHVLJQDZDUG IRU7KHIUDPHLVLQVSLUHGE\WKHFODVVLFFDUWKH %XLFN 6N\ODUN &RQYHUWLEOH /LNH WKH 52/) ZRRG VWRQHIUDPHVVD\VWKHFRPSDQ\WKH%XLFN6N\ODUN

*ODVVHV WUHQGV DUH H[WUHPHO\ FDSWLYDWLQJ WKLV \HDU

&RQYHUWLEOHZDVLQPDQ\UHVSHFWVDKDQGPDGHFDU

DQG ZKHQ LW FRPHV WR WKH *HUPDQ GHVLJQHUV WKLV ULQJVWUXHLQERWKWKHRSWLFDODQGVXQJODVVFROOHFWLRQV

7KHGUDZRIWLWDQLXP

)URPH[FLWLQJDQGXQXVXDOVKDSHVWRWUHQG\FRORXUV

0HWDO IUDPHV ² IURP WKRVH LQ VWDLQOHVV VWHHO WR

DQGH[SHULPHQWDOGHWDLOIUDPHGHVLJQHUVKDYHVHUYHG

WKH OX[XU\ GHVLJQV LQ WLWDQLXP DQG EHWD WLWDQLXP

XSDYDULHW\RIVWDWHPHQWPDNLQJSLHFHVDQGHYHU\GD\ VW\OHVVXLWHGWRDOOOLIHVW\OHVDQGDJHJURXSV

KDYHEHHQEHFRPLQJYHU\SRSXODUDJDLQLQWKHODVW =R=HEHEAN AN>U >U-* *#NK #NKOP OP

&RORXUIRUDOO &RORXUWUHQGVKDYHEHHQH[WUHPHO\YDULHGLQ DQGWKH*HUPDQGHVLJQHUVKDYHRIIHUHGERWKDGYHQ WXURXVDQGFODVVLFLQWKHLUFRORXUSDOHWWHV5HL]SUR SRVHGGUDPDWLFFKURPDWLFHIIHFWVRQWKHLUVXQJODVVHVIHDWXULQJJUDGDWLRQVRIEULJKW\HO ORZWKURXJKWRFDSSXFFLQRRUEULJKWRUDQJHWKURXJKWRPROH&RORXUDWWKHH[XEHUDQW 30)URVWODEHOZDVYDULHGDQGLPDJLQDWLYHZLWKEROGWRQHVIHDWXULQJSURPLQHQWO\LQWKH KRWJODVVHVUDQJHDQGWKHLU)URVW)W\SHFROOHFWLRQZKLFKPL[HVWHFKQLFDOLQQRYDWLRQDQG EULJKWFRORXUVIRUDPRGHUQORRN%HVLGHVDWOHDVWHLJKWVWDQGDUGFRORXUVDQGVHYHUDOVXU U IDFHGHVLJQVWKHFXVWRPHUFDQFKRRVHWKHLU)URVW)W\SHLQWKHLUGHVLUHGFRORXUIURPWKH ZKROH5$/FRORXUVFDOH2WKHUH[FLWLQJLQWHUSUHWDWLRQVLQFRORXUZHUHVHHQDW0,'2 LQWKH0\NLWD%HUQDUG:LOOKHOPFROOHFWLRQZKHUHPLUURUHGOHQVHVIHDWXUHGEULJKWWLQWV DQGWKH)UHXGHQKDXVOLQHZKHUHQHZVW\OHVOLNHPRGHO:ROIJDQJ3ULQFHRU7KHRZHUH SURSRVHGLQVXEGXHGEXWVRSKLVWLFDWHGFKRLFHVOLNHVODWHVPRNHRUGXDOIURQWFRORXUV VXFKDVEODFNZLWKWUDQVOXFHQWWRUWRLVH

0QNU=>U/"&7




 0-" &)ġ$"/*+1/"+!0+!/"1&)&+$

1NAO DE? KHHA?PEKJBNKI& ANHEJ

/KHB0LA?P=?HAO 4KK@OPKJA0GUH=NG

PRQWKVIRUERWKVXQJODVVHVDQGRSWLFDOV$ZHDOWKRILGHDVLQPHWDOZHUHRQGLVSOD\DW

75(1'672/22.)25

0,'2 DFURVV WKH *HUPDQ FROOHFWLRQV7KHVH LQFOXGHG WKH VSHFLDOLVWV LQ WLWDQLXP DQG LQQRYDWLYHGHVLJQ0DUNXV7ZKRSUHVHQWHG7LWDQ7IRUDFROOHFWLRQZKLFKFRP

&RORXUVEULJKWVSDVWHOVVRSKLVWLFDWHGPHWDOÀQLVKHVRUFODVVLFVOLNHJXQRUVWDLQOHVV

ELQHVSXULVPDQGRSWLFDOVWUHQJWKLQLWVGHVLJQ7LWDQ7·VSUHFLVHVW\OLQJFRPELQHGZLWK

VWHHO

UHDVRQHGFRQVWUXFWLRQLQHYHU\GHWDLODFKLHYHVIUDPHVWKDWDUHEROGEXWDOVRH[WUHPHO\

0DWHULDOVZLWKSUHPLXPPHWDOVRQWKHXSDFHWDWH DQGWKHUHWURIHHORIWKLVPDWHULDO

FRPIRUWDEOH

LVVHHLQJVRPHFRPSHWLWLRQ²EXWERWKGLUHFWLRQVDUHZDUPO\DSSUHFLDWHGE\*HUPDQ\·V OHDGLQJGHVLJQHUV 6KDSHVORWVRIPLQLPDODQGFRROVKDSHVDYDLODEOHIRUPHQZKLOHZRPHQDUHEHLQJRI I IHUHGORWVRIFKRLFHZLWKWKHPRGLÀHGFODVVLFVOLNHWKHFDWVH\HEXWWHUÁ\DQGZD\IDUHURU

1DAKBNKI#NAQ@AJD=QO

V VOLJKWO\PDVFXOLQHÁDWWRSV<RXFDQJRIRURYHUVL]HGRUVPDOOWKHVHGD\V9DULHW\LVYHU\ P PXFKDWDONLQJSRLQW

D=NI=JPABNKIPDA1NAAO DE? KHHA?PEKJBNKI&   ANHEJ

1&1+11BNKI*=NGQO1


ADVERTORIAL




 0-" &)Ä¡$"/*+1/"+!0+!/"1&)&+$

)ABPPKNECDPÄ¡)QJAPPAO0AHA?PEKJ ANHEJ

*(50$1<·6 1(:*(1(5$7,21 ,QQRYDWLRQLVDNH\SDUWRIWKHVXFFHVVRI *HUPDQ\·VQHZJHQHUDWLRQRIRSWLFDOUHWDLOHUV (XURSHVSRNHWRWZRRSWLFDOHQWUHSUHQHXUV LQWKHFRXQWU\WDNLQJVWHSVWRVKHGDQHZOLJKWRQ H\HZHDUEH\RQGWKHPDLQVWUHDP

Translations page 46

)ABPPKNECDPÄ¡()/ !=NIOP=@P


0-" &)ġ$"/*+1/"+!0+!/"1&)&+$



´,IHHOYHU\KDSS\DERXWWKHSURJUHVVRILQGHSHQGHQWUHWDLOHUVVHOOLQJVHOHFWLYHLQGHSHQGHQWODEHOVLQ*HUPDQ\µH[SODLQV $NUDP+XVVHLQLRZQHURI.ODUDERXWLTXHRSWLFDOVWRUHLQ'DUPVWDGW´0RUHDQGPRUHUHWDLOHUVUHDOLVHWKHUHLVDPDUNHW IRULQGLYLGXDOFXVWRPHUVZKRDSSUHFLDWHLQGLYLGXDOH\HZHDUDQGWKDWWKLVRIIHUVDFKDQFHIRUWKHLQGHSHQGHQWVWRÀQG VXFFHVVLQWKHEXVLQHVVZKLFKKDVEHFRPHYHU\FRPSHWLWLYHµ .ODUGLIIHUHQWLDWHVLWVHOIERWKLQLWVSKLORVRSK\DQGLWVLPDJHDQGSUHVHQWDWLRQ/RFDWHGLQDFLW\ZLWKLQKDELWDQWV GHVFULEHGDVWKHVXQQLHVWLQWKHVWDWHRI+HVVHWKHVKRSLVHYLGHQFHRIDJURZLQJWUHQGWRZDUGVEHDXWLIXOO\FUHDWHG DUFKLWHFWGHVLJQHGVKRSVZLWKDKDQGSLFNHGFROOHFWLRQRIEUDQGVWKDWFRPHIURPDOORYHUWKHZRUOG ´0\FXVWRPHUVZKRDUHZDQWLQJKLJKHQGSURGXFWVDUHUHDOO\LQWHUHVWHGLQKRZWKHIUDPHVDUHDFWXDOO\PDGHZKHUHWKH\\ DUHIURPDQGZKRLVEHKLQGWKHGHVLJQ7KH\KDYHDJUHDWDSSUHFLDWLRQRITXDOLW\ZRUNZHOOPDGHSURGXFWVZLWKDKLVWRU\\ DQGKHULWDJHDQGWKH\ZLOODVNDERXWGLIIHUHQWDUHDVIURPWKHFUHDWLYHVLGHWRVXVWDLQDELOLW\ 2XUVHUYLFHFDWHUVWRWKLV²E\VWRFNLQJWKHSURGXFWVZHRIIHUDQGNQRZLQJWKHPLQWLPDWHO\ZHFDQH[SODLQWKHZKROH VWRU\WRWKHPVKRZLQJRXUSDVVLRQDQGLQYROYHPHQWLQZKDWZHDUHGRLQJ$QGZHDOZD\VFRQFHQWUDWHRQJLYLQJSHUIHFW LQGLYLGXDODGYLFHIRUHDFKFXVWRPHUµ 7KH.ODUWHDPDUHDOVRYHU\NHHQRQSURYLGLQJWKHSHUIHFWH\HFDUHH[SHULHQFHZKHQLWFRPHVWRWHFKQLFDOPDWWHUVDQG WKH\H[SODLQWRFXVWRPHUVWKHGLIIHUHQWVWHSVWDNHQDQGKRZWKHLUIUDPHVDQGOHQVHVDUHÀQLVKHG´,QP\VKRSP\FXVWRP HUVDUHDEOHWRVHHKRZ,HGJHWKHJODVVHV0\ZRUNVKRSLVRQWKHVDPHOHYHODVWKHVKRSLWVHOIDQGLWLVRSHQWRHYHU\RQHµ 8WD*H\HUGHVLJQHUDW/XQHWWHV.ROOHNWLRQDQLFKHH\HZHDUODEHOEDVHGLQ%HUOLQDQGRZQHURI/XQHWWHV6HOHFWLRQLVLQ IXOODJUHHPHQWZKHQLWFRPHVWRRIIHULQJDEHVSRNHDQGFDUHIXOO\WDLORUHGVHUYLFHIRUWKHGLVFHUQLQJVSHFWDFOHVFXVWRPHU ´)RUPHWKH*HUPDQPDUNHWLVFKDQJLQJ:HDUHVHHLQJDPRYHDZD\IURPWKHPDLQVWUHDPWRWKHULVHRID\RXQJHULQ QRYDWLYHJHQHUDWLRQRIVRFDOOHG%RXWLTXH2SWLFLDQVZKRIRFXVRQLQGLYLGXDOKDUGHUWRÀQGIUDPHUDQJHVZLWKDORWRII SDVVLRQDQGWDVWHµ /RFDWHGLQ%HUOLQ/XQHWWHV6HOHFWLRQIRFXVHVRQWKHIDVKLRQVLGHRIWKHIUDPHVDQGKRZWKH\ORRNVW\OLVWLFDOO\7KH/X QHWWHVVWRUHVVWRFNDYDULHW\RIODEHOVIURP*H\HU·VRZQ/XQHWWHV.ROOHNWLRQWRRWKHUVPDOOFRQWHPSRUDU\EUDQGVDQGD QXPEHURIYHU\VSHFLDOYLQWDJHSLHFHVFROOHFWHGRYHUPDQ\\HDUV ´0\PLVVLRQLVWREHWKHSODFHIRUSHRSOHZKRFDQQRWÀQGZKDWWKH\DUHORRNLQJIRULQWKHW\SLFDOPDLQVWUHDPRSWL FDOVWRUHVµH[SODLQV*H\HU´:HDUHKHUHIRUSHRSOHZKRDUHORRNLQJIRULQGLYLGXDOXQLTXHVW\OHVZLWKRXWELJORJRVRU H[WUHPHO\KLJKSULFHV ,RSHQHGP\ÀUVWVWRUHEHFDXVH,FRXOGQRWÀQGWKHULJKWSDLURIJODVVHVIRUP\VHOI )RUP\FORWKLQJ,ZDVXVHGWRVKRSSLQJLQWKULIWVWRUHVKLJKHQGVHFRQGKDQGVWRUHVRULQSULYDWHODEHOERXWLTXHV%XWW ZKHQLWFDPHWRJODVVHV,KDGSUREOHPVÀQGLQJDSODFHOLNHWKLV7KLVZDVWKHVWDUWRIWKHLGHDIRUWKH/XQHWWHV6WRUHVµ /LNH.ODU/XQHWWHV6HOHFWLRQVWRUHVDUHGHVLJQHGZLWKDQDVWXWHIRFXVRQIDVKLRQDQGVW\OHSUHVHQWLQJDVHWWLQJWKDWLVIDU UHPRYHGIURPWKHW\SLFDORSWLFLDQ´2XUVW\OHVDUHDOODERXWIDVKLRQDQGÀQGLQJWKHSHUIHFWVKDSHIRUHDFKRIRXUFXVWRP HUV:HRIIHUDFRPSOHWHO\GLIIHUHQWVKRSSLQJH[SHULHQFHWKDWMXVWZRUNV7KHIDFWWKDW,DPDOVRRIIHULQJP\RZQOLQHDOVR UHDOO\KHOSV,FDQUHDFWWRWKHLPSXOVHVRIP\FXVWRPHUVEULQJLQJWKHPZKDWWKH\ZDQWDYRLGLQJPDVVSURGXFWLRQDQG PDLQVWUHDPWDVWHVZKHUH,FDQµ ./$5ZZZNODUDXJHQRSWLNGH J S /81(77(66(/(&7,21ZZZOXQHWWHVVHOHFWLRQGH ./$53KRWRJUDSK\E\)ORULDQ6FKSSHO


NEW PRODUCTS

%JKNFTGPŏUG[GYGCT

1' = $JDWKD 5XL] GH OD 3UDGD $1 ' 2SWLP-    + * &   *+ -      + &   + + &   (   +     ; 3HQQ\6SDUNOH3DXO)UDQN-+  &   % 1(+  #

26 20/20 Europe

M AY / J U N E 2 01 2


NEW PRODUCTS

(\HSRSSLQJFRORXUFKRLFHVFXWHGHFRUDWLRQDQGIODWWHULQJVKDSHVIRUFKLOGUHQWKH H[FLWLQJYDULHW\RI H\HFDWFKLQJNLG·VIUDPHVDQGVXQJODVVHVWKLV\HDUPHDQVWKDW FKLOGUHQFDQHQMR\WKHIDVKLRQVLGHRI H\HZHDUMXVWOLNHWKHLUPXPVDQGGDGV

1' = %DUELH%( ,QRWWLFD :    *  - &     ?  * +  ( +  *; 'DLV\ RSWL FDO IUDPH  =RREXJ- & :  

 &     + * +(   &   '*  ' +    * +   *     +; 'RWWD  )OH\H    *   - + '  &)    '    + *    )

  +*

M AY / J U N E 2 01 2

international eye fashion 27


NEW PRODUCTS

9QOGPŏUUV[NG

1' = (PLOLR 6FRODUL    &:(    +  # 3+'+   ; /,1($ /LQ  ' $ -   *  - '  1  + ; (26   1HRVW\OH= @  : + ,'&   + *#2+)   '+'' + ; 5D\%DQ /X[RWWLFD;  '     '      #     +  **+ +   (#

28 20/20 Europe

M AY / J U N E 2 01 2


NEW PRODUCTS

:KDWHYHU\RXUFXVWRPHU·VVDUWRULDOVWDQGSRLQWWKLVVHDVRQ·V ZLGHRIIHURI IUDPHVIRUZRPHQDQGH[FLWLQJVWDWHPHQWVXQ JODVVHVZLOOEHVXUHWRFUHDWHDVWULNLQJHQVHPEOH

1' = 67'XSRQW3DULV'3'$R\DPD*URXS;+ *+ %  ) -   +5A'+ &'-&    + @ + *; (ULF-HDQ(-60&D9D6H9RLU-' +  '   ) + * +* ;3UDGD635'/X[RWWLFD  * ' #  + *  '' + -  ' :    '  ;0DULDQH;'3LHUUH(\HZHDU-- )'+ 9+ ) -

+ *#

M AY / J U N E 2 01 2

international eye fashion 29


NEW PRODUCTS

*GCFVWTPKPIVTGPFU

  (& -'  *= *XFFL**66DÃ&#x20AC;OR- ( *:  & 9+')   '  +*+    B  ; &RPPDQGDQW&ODLUH*ROGVPLWK-'+ 9+&     +*; &2E\0RGR-   + (&2 -  * 9+ *++   9 )216 *RWWL6ZLW]HUODQG      -+    , C&*#&++ 1 + + *D++E&+; &KLFDJR6XQE\6HUD SKLQ- + +2*,(\HZHDU 2 *   + +   - )+ *  + * &&'  *  1  " :     FG,# %'

'    )  + '    ++    # :    &     =?  (2(+2(2 #

30 20/20 Europe

M AY / J U N E 2 01 2


NEW PRODUCTS

:K\QRWPDNHDVWDWHPHQWWKHUHDUHSOHQW\RI JUHDWIUDPHV WKLV\HDURIIHULQJHQGOHVVRSSRUWXQLW\WRVW\OHXSIRUWKHVXPPHU

  (& -'  *= +DUULVRQ '  (-& +  *DUUHWW/HLJKW */&2; 1DWDOLD '  7KHR E\ 7LP 9DQ 6WHHQEHUJHQ /RV 6DQWRV *=  *   :(     9; /*5 IRU $3& PRGHO -     +    ) * - &     &") ')+   ."+1 +%; /LQGEHUJ7

  @'  +*+   (',  * * *& * '; %RUVDOLQR% +

     -    +    +  '   ' + #1 & *: *+-    +'  *+@ '  * #

M AY / J U N E 2 01 2

i n t e r n a t i o n a l e y e f a s h i o n 31


N EW S

h^K>/> &ƌĠĚĠƌŝĐĞĂƵƐŽůĞŝůĐƌĞĂƚĞĚŚŝƐĨŝƌƐƚĞLJĞǁĞĂƌĐŽůůĞĐƚŝŽŶŝŶϭϵϴϳ͕ŝŶWĂƌŝƐ͕ŝŶĂƐŚŽƉǁŚĞƌĞďƵĨĨĂůŽ ŚŽƌŶĂŶĚŐĞŶƵŝŶĞƚƵƌƚůĞƐŚĞůůĨƌĂŵĞƐǁĞƌĞŚĂŶĚĐƌĂĨƚĞĚ͘dŽĚĂLJ&ƌĠĚĠƌŝĐĞĂƵƐŽůĞŝůĨƌĂŵĞƐĂƌĞƐƚŝůů ĐƌĂĨƚĞĚǁŝƚŚƚŚĞŚŝŐŚĞƐƚƌĞŐĂƌĚƐĨŽƌƚŚĞƚƌĂĚŝƚŝŽŶĂůĞLJĞǁĞĂƌĐƌĂĨƚƐŵĂŶƐŚŝƉǁŚŝůĞŝŶĐŽƌƉŽƌĂƚŝŶŐ ƚŚĞůĂƚĞƐƚƚĞĐŚŶŝƋƵĞƐ͘ /ŶŽƌĚĞƌƚŽŝŶĐƌĞĂƐĞŝƚƐĚĞǀĞůŽƉŵĞŶƚ͕&ƌĠĚĠƌŝĐĞĂƵƐŽůĞŝůŝƐůŽŽŬŝŶŐĨŽƌĂŶĂŐĞŶƚĨŽƌƚŚĞďƌĂŶ ŶĚƐ &ƌĠĚĠƌŝĐ ĞĂƵƐŽůĞŝů ,ĂƵƚĞ >ƵŶĞƚƚĞƌŝĞ ĂŶĚ ^ƚƵĚŝŽ &͕ ƚŽ ĐŽǀĞƌ ƚŚĞ h<͕ &ŝŶůĂŶĚ͕ ^ǁĞĚĞŶ͕ ĂŶĚ EŽƌǁĂLJ͘ zŽƵŚĂǀĞϱƚŽϭϬLJĞĂƌƐŝŶƚŚĞĞLJĞǁĞĂƌďƵƐŝŶĞƐƐ͕ƐƉĞĂŬŶŐůŝƐŚ͕ĂŶĚǁĂŶƚƚŽƉĂƌƚŝĐŝƉĂƚĞŝŶĂŶĞǁ ĂĚǀĞŶƚƵƌĞ͘WůĞĂƐĞƐĞŶĚsĚŝƌĞĐƚƚŽ ũůŽƐŝΛďĞĂƵƐŽůĞŝůů͘Ĩƌ͘ƌ

&^,/KE^dz>͕E/D> ^Kh> &KZKZ^>/EKztZ tĞĐĂůůƚŚĞŵĂĐĐĞƐƐŽƌLJ͕ďƵƚŶŽǁƚŚĞLJ͛ƌĞďĞĐĂŵĞĂ͞ŶĞĐĞƐƐŝƚLJ͕͟ƐƵŶŐůĂƐƐĞƐĂƌĞŶŽǁƉĂƌƚŽĨĨĂƐŚͲ ŝŽŶ͘ǀĞƌLJďŽĚLJŚĂƐĂƚůĞĂƐƚĂƉĂŝƌŽĨƐƵŶŐůĂƐƐĞƐ͕ďƵƚĂůŽƚŽĨƵƐŚĂƐĂůŵŽƐƚĂĐŽůůĞĐƚŝŽŶ͘/ƚ͛ƐŶŝĐĞƚŽ ďĞĂďůĞƚŽĐŚĂŶŐĞŽƵƌŽǁŶƐƚLJůĞǁŝƚŚĂƐŝŵƉůĞŝƚĞŵ͕ƐƉŽƌƚŝǀĞ͕ĞůĞŐĂŶƚŽƌĨĂƐŚŝŽŶĚŽĞŶƐ͛ƚŵĂƚƚĞƌ͘ ŽƌƐĂůŝŶŽLJĞǁĞĂƌƌ ƉƌŽƉŽƐĞƐƚŽĂůůĨĂƐŚŝŽŶƉĂƐƐŝŽŶĂƚĞĚĂ ͚ϱϬƐƐƚLJůĞ͕ďƵƚǁŝƚŚĂŶĞǁŝŵƉƌŝŶƚŚŝŐŚ ĚĞĨŝŶŝƚŝŽŶƚĞĐŚŶŽůŽŐLJ͕ƚŚĞ ŵŝŶŝͲƉŝdžĞů͘KǀĞƌƐŝnjĞĚĂŶĚƌŽƵŶĚƐŚĂƉĞƐ͕ƌĞĂůŝnjĞĚŝŶŝŶũĞĐƚĞĚŵĂƚĞƌŝĂů͘ ŽůŽƌƐ͕ďĞƐŝĚĞƐďůĂĐŬ͕ŚĂǀĂŶĂ͕ƉĞĂƌůĞĚďƌŽǁŶĂŶĚŵĂŐĞŶƚĂ͕ƚŚĞůĞŽƉĂƌĚƉĂƚƚĞƌŶƐĞŵƉŚĂƐŝnjĞĚ ƚŚĞĨĂƐŚŝŽŶĂĚĚŝĐƚĞĚĂŶŝŵĂůƐŽƵů͘ĚŝƐƚĂŶƚůĂŶĚƐĐĂůů͕ĂŶĞǀĞƌŐƌĞĞŶƚƌĞŶĚ͕Ă ĐƵƚƚŝŶŐĞĚŐĞ͕ďƵƚ ƌŝŐŽƌŽƵƐůLJĞůĞŐĂŶƚ͘,ĞƌĞƚŚĞŽƌƐĂůŝŶŽLJĞǁĞĂƌƐƉŽƚƚĞĚƉĂƚƚĞƌŶƐ͕ƚǁŽůĞŽƉĂƌĚƐƐŽůƵƚŝŽŶ͕ǁŚŝƚĞ ŽŶďůĂĐŬĂŶĚďƌŽǁŶŽŶďůĂĐŬ͘ ŽƌƐĂůŝŶŽLJĞǁĞĂƌ͕ĂƐĂůǁĂLJƐ͕ŝƐĐŽŶƚŝŶƵŝŶŐƚŽĚĞǀĞůŽƉ ĚĞƐŝŐŶĂŶĚD/E/d>z > ƐƚLJůĞ͕ŝŶƚŽƌĚƵĐͲ ŝŶŐŝŶŶŽǀĂƚŝŽŶŝŶĂůůůĂƵŶĐŚĞĚĐŽůůĞĐƚŝŽŶƐ͕ĂƐŽƌƐĂůŝŶŽĚŝĚƚŚŝƐƚŝŵĞĂƚD/KϮϬϭϮ͘ ůůŽƌƐĂůŝŶŽƐƵŶŐůĂƐƐĞƐŚĂƐƐŵŽŬĞĚůĞŶƐĞƐ͕ǁŝƚŚhsĨŝůƚĞƌƚŽŵĂdžŝŵŝnjĞůŝŐŚƚĐŽŶƚƌĂƐƚĂŶĚƚŽŽĨĨĞƌ ŚŝŐŚĞƌĞLJĞƉƌŽƚĞĐƚŝŽŶĂŶĚƚŽƌĞƐƉĞĐƚŝŶƚĞƌŶĂƚŝŽŶĂůƋƵĂůŝƚLJƐƚĂŶĚĂƌĚƐ͘

/&EZKdt tZ 'Ƃƚƚŝ^t/dZ>EƌĞĐĞŝǀĞĚƚŚĞŝ&ƉƌŽĚƵĐƚĚĞƐŝŐŶĂǁĂƌĚϮϬϭϮĂŶĚƚŚĞƌĞĚĚŽƚĚĞƐŝŐŶĂǁĂƌĚ ϮϬϭϮĨŽƌŝƚƐ&ŽŶƐƐƵŶŐůĂƐƐĞƐ͘dŚĞŵŽĚĞůŝƐĨƌŽŵƚŚĞ^ƉŝŶΘ^ƚŽǁϯϲϬΣĐŽůůĞĐƚŝŽŶĂŶĚƐƚĂŶĚƐŽƵƚŝŶ ďŽƚŚĚĞƐŝŐŶĂŶĚĨƵŶĐƚŝŽŶĂůŝƚLJ͘ ^W/EΘ^dKt^hE'>^^^ tĞĂƌŝŶŐ Ă ƉĂŝƌ ŽĨ ƐƵŶŐůĂƐƐĞƐ ŝƐ ĂůǁĂLJƐ ĂƐƐŽĐŝĂƚĞĚ ǁŝƚŚ ƉůĞĂƐƵƌĞ͘ ůŽŶŐ ǁŝƚŚ ƚŚĞ ŶĞǁ ϯϲϬΣ ^ƉŝŶΘ^ƚŽǁ ŵĞĐŚĂŶŝƐŵ ƚŚŝƐ ƐƵŶŐůĂƐƐĞƐ ĂƌĞ ƉůĞĂƐĂŶƚ ĂŶĚ ƌĞůŝĂďůĞ ĐŽŵƉĂŶŝŽŶƐ ŝŶ ĂŶLJ ƐŝƚƵĂƚŝŽŶ͘ ^ƉŝŶΘ^ƚŽǁŵĞĂŶƐϯϲϬΣƉŽǁĞƌ͘tŝƚŚƚŚĞƌĞǀŽůǀŝŶŐĞĂƌƉŝĞĐĞƐƚŚĞƐƵŶŐůĂƐƐĞƐĐĂŶďĞĨŽůĚĞĚƵƉĨůĂƚ ƐŽƚŚĂƚƚŚĞLJĨŝƚĂŶLJǁŚĞƌĞ͘ ^>K&Yh>/dz d :ƵƐƚĂƐǁŝƚŚĂůůŐƂƚƚŝƐƵŶŐůĂƐƐĞƐ͕ƚŚĞƐĞŵŽĚĞůƐĂƌĞĞŶŐƌĂǀĞĚǁŝƚŚĂŶ͞Ƃ͕͟ĂŵĂƌŬŽĨƋƵĂůŝƚLJ͘ ZZ^ ZĞĂĚŝŶŐ ŐůĂƐƐĞƐ ŵĂĚĞ ŽĨ ŚŝŐŚͲƋƵĂůŝƚLJ ƚŝƚĂŶŝƵŵ ǁŝƚŚ Ă ĨƌĞƐŚ ĐŽůŽƌ ĂŶĚ ŐƌĞĂƚ ůŽŽŬ ʹ ƚŚĞ ŶĞǁ ZĞĂĚĞƌƐĨƌŽŵŐƂƚƚŝ^t/dZ>EŽĨĨĞƌLJŽƵŵĂŶLJĂĚǀĂŶƚĂŐĞƐ͘tŝƚŚĂŶĞƌŐŽŶŽŵŝĐďƌŝĚŐĞ͕ƚŚĞ ƌĞĂĚŝŶŐŐůĂƐƐĞƐƐŝƚĐŽŵĨŽƌƚĂďůLJŽŶƚŚĞŶŽƐĞĂŶĚĐĂŶďĞĨŽůĚĞĚƚŽŐĞƚŚĞƌĨůĂƚƚŚĂŶŬƐƚŽƚŚĞϯϲϬΣ ƌŽƚĂƚŝŶŐ^ƉŝŶΘ^ƚŽǁƚĞŵƉůĞƐ͘dŚŝƐŵĞĂŶƐƚŚĂƚƚŚĞƌĞŝƐƉůĞŶƚLJŽĨƌŽŽŵĨŽƌLJŽƵƌZĞĂĚĞƌƐ͕ĞǀĞŶŝŶ ƚŚĞƐŵĂůůĞƐƚďĂŐ͘

32 20/20 Europe

M AY / J U N E 2 01 2


N EW S

͞Dz  d,&KZ t/d,zKh͊͟ ŚƵŐĞ͕ǁŽƌůĚǁŝĚĞĨĂŶͲĨŽůůŽǁŝŶŐĂĐĐŽŵƉĂŶŝĞƐƚŚĞ^ƚĂƌtĂƌƐŚĞƌŽĞƐ͕ǁŝƚŚŬŝĚƐ͕ƚĞĞŶƐĂŶĚĞǀĞŶ ĂĚƵůƚƐĨĂƐĐŝŶĂƚĞĚďLJƚŚĞƐĂŐĂ͘ ŝƐĐŽǀĞƌ ƚŚĞ ŶĞǁ ^ƚĂƌ tĂƌƐ ĨƌĂŵĞ ĐŽůůĞĐƚŝŽŶ ĨŽƌ ŬŝĚƐ ĂŶĚ ƚĞĞŶƐ͕ ŝŶĐůƵĚŝŶŐ ŽƉƚŝĐĂů ĨƌĂŵĞƐ ĂŶĚ ƐƵŶŐůĂƐƐĞƐ͘DĂƚĐŚĞĚƚŽƚŚĞǀĂƌŝŽƵƐ^ƚĂƌtĂƌƐŚĞƌŽĞƐ͕ŽƵƌǀĞƌLJŽǁŶƐƉĞĐŝĂůĞĨĨĞĐƚŝŶƚŚĞĨŽƌŵŽĨ ĂůŝŐŚƚƐĂďĞƌŐůŽǁƐŝŶƚŚĞĚĂƌŬŽŶƚŚĞƚĞŵƉůĞƐ͊ ĚƵůƚƐƚŽŽĐĂŶŐŽŽƵƚĂŶĚĞdžƉĞƌŝĞŶĐĞĂ^ƚĂƌtĂƌƐϯĨŝůŵŝŶƉĂƌƚŝĐƵůĂƌĐŽŵĨŽƌƚďLJǁĞĂƌŝŶŐƚŚĞ ƐƉĞĐŝĂůůLJĚĞǀĞůŽƉĞĚ^ƚĂƌtĂƌƐϯĨƌĂŵĞʹƐƵŝƚĂďůĞĨŽƌĨŝƚƚŝŶŐǁŝƚŚƉƌĞƐĐƌŝƉƚŝŽŶůĞŶƐĞƐ;ĂŶĚĐĂŶ ĞǀĞŶďĞǁŽƌŶĨŽƌϯĨŝůŵĨƵŶĂƚŚŽŵĞƵƐŝŶŐƚŚĞƌĞĂůƐLJƐƚĞŵͿ͘ &ĂƐĐŝŶĂƚŝŶŐĨŝůŵĞĨĨĞĐƚƐĂŶĚĂŐƵĂƌĂŶƚĞĞĚĞLJĞĐĂƚĐŚĞƌŝŶLJŽƵƌǁŝŶĚŽǁĚŝƐƉůĂLJ͊ >/>>/ ͵'KZ'Kh^ &ZD^ &KZ >/dd> WZ/E^^^ &ƌŽŵƚŝŶLJƚŽƚƚŽƐĐŚŽŽůŐŝƌů͕ƚŚĞŶĞǁ>ŝůůĞďŝĨƌĂŵĞƐŝŶƐƚLJůŝƐŚƐŚĂƉĞƐĂŶĚƚƌĞŶĚLJĐŽůŽƵƌƐĐĂŶ͛ƚĨĂŝů ƚŽĚĞůŝŐŚƚ͘ :ƵƐƚ ůŝŬĞ Ă ŐƌŽǁŶͲƵƉ ĨƌĂŵĞ͕ ĚĞůŝĐĂƚĞ ĨůŽǁĞƌLJ ŽƌŶĂŵĞŶƚĂƚŝŽŶ ĚĞĐŽƌĂƚĞƐ ƚŚĞ ƚĞŵƉůĞƐ͕ ǁŚŝůĞ Ă ĚĞŵƵƌĞĨƌŽŶƚĨůĂƚƚĞƌƐƚŚĞĐŚŝůĚŝƐŚĨĞĂƚƵƌĞƐ͘

ŬũĞůůƌĞůŽĂĚĞĚϮϬϭϮ ŵĂƐĐƵůŝŶĞ͘ĐůĂƐƐŝĐ͘ƚŽƵŐŚ͘ ƉůĂLJĞƌ͍͊ŐĞŶƚůĞŵĂŶ͍ŐŽŽĚŽƌďĂĚĐŽƉ͍ LJŽƵĐƌŽƐƐŵŽƵŶƚĂŝŶƐĂŶĚǀĂůůĞLJƐŽŶĂŵŽƚŽƌďŝŬĞ͍ LJŽƵĐĂƉLJŽƵƌƚƌŝƉŽīǁŝƚŚĂďŽƩůĞŽĨǁŚŝƐŬLJĂŶĚĂĐĂƉĮƌĞ͍ LJŽƵůŽǀĞƚŽĐŽŶƋƵĞƌƚŚĞƐĞǀĞŶƐĞĂƐŝŶLJŽƵƌŽŶĞŵĂŶďŽĂƚ͍ ĂĐƟŽŶŚĞƌŽŽƌƟŵĞůĞƐƐŐĞŶƚůĞŵĂŶ͕ďĞĞƌŽƌǁĂƚĞƌ͕ŝƚĚŽĞƐŶ͛ƚŵĂƩĞƌ͘ ƚŚĞƚǁŽƟŵĞƐĐůĂƐƐŝĐ͕ĂůƌĞĂĚLJǁŽƌŶďLJũĂƐŽŶƐƚƌĂƚŚĂŵĂŶĚďƌƵĐĞǁŝůůŝƐ͕ŵĂŬĞƐĂϮϬϭϮĐŽŵĞͲ ďĂĐŬŝŶĨŽƵƌƐƚLJůŝƐŚĐŽůŽƵƌĐŽŵďŝŶĂƟŽŶƐǁŝƚŚƚŚŝŶŶĞƌƚĞŵƉůĞĂƌŵƐŐŝǀŝŶŐĞdžƚƌĂĐŽƌŶĞƌƐĂŶĚ ĞĚŐĞƐ͘ ŵĂƐĐƵůŝŶĞ͘ĐůĂƐƐŝĐ͘ƚŽƵŐŚ͘ ǁŽŵĞŶǁŝůůŐŽǁĞĂŬĂƚƚŚĞŝƌŬŶĞĞƐ͕ƉƌŽŵŝƐĞĚ͊ ŚĂŶĚŐĞĨĞƌƟŐƚŝŶĞŝŐĞŶĞƌŚĞƌƐƚĞůůƵŶŐ͕ďĞƌůŝŶ

WZ/^ ,ĞŶƌLJ:ƵůůŝĞŶĐŽŶƟŶƵĞƐƚŽĨŽƌŐĞĂŚĞĂĚǁŝƚŚĂŶĞǁŵŽĚĞůĐŽŵďŝŶŝŶŐŵĞƚĂůĂŶĚĂĐĞƚĂƚĞ͕ĂĚĚͲ ŝŶŐƚŽƚŚĞ͞hƌďĂŶ͟ůŝŶĞƉƌĞƐĞŶƚĞĚŝŶϮϬϭϭƚŽŵĂƌŬƚŚĞϵϬƚŚĂŶŶŝǀĞƌƐĂƌLJŽĨƚŚĞďƌĂŶĚ͘ tŝƚŚŝƚƐĐŽŶƚĞŵƉŽƌĂƌLJůŝŶĞƐĂŶĚƐůĞĞŬůŽŐŽŽŶƚŚĞŚŝŶŐĞ͕ƚŚŝƐŵŽĚĞůŝƐĂŝŵĞĚĂƚďŽƚŚŵĞŶ ĂŶĚǁŽŵĞŶ͘ dŚĞ,ĞŶƌLJ:ƵůůŝĞŶĐŽůůĞĐƟŽŶĐŽŶƟŶƵĞƐƚŽƌĞŝŶĨŽƌĐĞĂŶĞŶĚƵƌŝŶŐƐƉŝƌŝƚ͗ƵŶĚĞƌƐƚĂƚĞĚĚŝƐƟŶĐͲ ƟŽŶ͕ƉƌĞŵŝƵŵĮŶŝƐŚĂŶĚ&ƌĞŶĐŚŵĂŶƵĨĂĐƚƵƌĞ͘ DŽĚĞůĂǀĂŝůĂďůĞŝŶďŽƚŚŵĞŶ͛ƐĂŶĚǁŽŵĞŶ͛ƐƐŚĂƉĞƐͲϰƐŚĂƉĞƐŝŶϰĐŽůŽƌƐ͘

M AY / J U N E 2 01 2

international eye fashion 33


VIEW FROM THE US

M

-KFU

know what they want. What they want is accessories. That has been made very clear at 20/20â&#x20AC;&#x2122;s kidsâ&#x20AC;&#x2122; oto shoots, featuring children between the ages of six and 12. They all wear the latest in footwearâ&#x20AC;&#x201D;colorful ndals, flip flops with wonderful accents and athletic shoes, some of which light up when they move. And the headwear? Itâ&#x20AC;&#x2122;s a vivid array of baseball caps on backwards, of course, big, floppy straw hats, headbands and a wide assortment of hair ornaments. One little girl was especially fond of a flexible stuffed leopard that

she wrapped around her neck faux-fur style. A seven year-old boy proudly showed me his oversized sport watch and explained excitedly what each of the buttons did. So how does this translate to eyewear? Kids love it. Our young models always want to look in mirrors to see themselves in glasses. They also make certain their parents, who are very admiring, see how they look. For this young group, putting on eyewear is a positive experience. Itâ&#x20AC;&#x2122;s another accessory. What kids also want is color. They love colorsâ&#x20AC;&#x201D;bright colorsâ&#x20AC;&#x201D;oranges, greens, purples, reds, and always blue for both boys and girls. I am pleased to report that after too much gold, pewter and brown in kidsâ&#x20AC;&#x2122; eyewear, vibrant colors and fun mixes are making a strong showing. That makes me very happy. Kids love color and so do I. Listen to the kidsâ&#x20AC;Ś and meâ&#x20AC;Ś and bring on the color. Gloria Nicola, 20/20 USA, Senior Features Editor

34 20/20 Europe

M AY / J U N E 2 01 2


*6'2+"

")1&+1"/3&"40*/ &1,) /&,1)2+"21" %+,),$6 +"4-/,!2 10+!1" %+,),$6


  



*=U'QJA

38 40 44

&+1"/3&"4 ")1EJPANREASO*=N?>EP>KH -NAOE@AJP ", /&,1)QJA=Q1A?DJKHKCU

,+1&+2&+$"!2 1&,+ 0ETPKKHOBKNUKQN?QOPKIANOANRE?APKKHGEP U'KDJJ=!QGAO ,

&++,31&,+0 +ASLNK@Q?PO=J@EJJKR=PEKJO

1

EOOQA KB ")1 LH=?AO PDA BK?QO KJ = JAS CAJAN=PEKJ KB A@CANO =P /&,1)QJA=Q 1A?DJKHKCU  H=QJ?DA@=P*&!,EJ*=N?D4A=HOKBA=PQNAOKIAKBPDAH=PAOPEJJKR=PEKJO=J@LNK@Q?PH=QJ?DAO EJ?HQ@EJC(,!(Â&#x2020;O!ECEP=H0KH=N1A?D)AJO=J@@ARAHKLIAJPO=P/A=H$H=OO &JKQN KJPEJQEJC"@Q?=PEKJOANEAO 'KDJJ=!QGAOP=HGO=>KQP?QOPKIANOANRE?AEILNKRAIAJPO#NKI QJ@ANOP=J@EJC PDA =PPNE>QPAO =J@ >AJAÅ&#x201A;PO KB PDA 1NERAT HAJO I=PANE=H PK AOP=>HEODEJC = SAH?KIEJC LN=?PE?AKBBANEJCABBA?PERAL=PEAJPBKHHKSQL PDEO=NPE?HAEOPDALANBA?PNA=@BKN=MQE?GNAIEJ@ANKJDKS PKGAALUKQNOANRE?A=?QP=>KRAPDA?KILAPEPEKJ ),!$%+,/1,+ "@EPKN


'7412'#0.'05'56'%*01.1);

+PVGTXKGY

PPDA ?QPPEJCA@CA

-

HDVHGHVFULEH\RXUQHZODXQFKHVLQWKHÃ&#x20AC;HOGRI PDFKLQHU\IRU0,'2 )RU 0,'2  ZH ODXQFKHG D QHZ FRQFHSW LQ HGJ HUVRQHLQWKH%ULRWUDQJHDQGRQHLQWKH:HFRUDQJH (PRWLRQ LV WKH QDPH RI WKH Ã&#x20AC;UVW RQH DQG ( LV WKH VHFRQG 7KH\ ERWK IHDWXUH KLJKHQG WHFKQRORJ\ IRU VLPSOLFLW\ RIXVHDQGDFFHVVLELOLW\%RWKSURGXFWVDUHDUHDOEUHDN WKURXJKIROORZLQJRQIURPRXUSUHYLRXV$FFXUDWHFK QRORJ\ZKLFKZDVÃ&#x20AC;UVWODXQFKHGLQ

#KHHKSEJC*E@K "QNKLA=J)AJOAO  1A?DJKHKCU OLKGA SEPD *=N? >EP>KH -NAOE@AJP=J@ ", /& ,1)QJA=Q 1A?DJKHKCU  =>KQP PDA H=QJ?D KB PSK JAS A@CANO "IKPEKJ >U NEKP  =J@ " >U 4" ,

:KDW DUH WKH FDSDELOLWLHV RI WKLV QHZ WHFKQRO RJ\" 7KLVLVWKHÃ&#x20AC;UVWWLPHWKHUHLVDQDWWHPSWE\DQHTXLS PHQW PDQXIDFWXUHU WR FUHDWH D QHZ  HGJHU WDUJHWLQJ FXVWRPHUV ORRNLQJ IRU D KLJKTXDOLW\ MRE DFKLHYDEOH ZLWK D YHU\ VLPSOHWRXVH PDFKLQH 7KRVH ZKR DUH ORRNLQJIRUKLJKSHUIRUPDQFHHGJLQJDQGTXDOLW\ZKLFK PDWFKHVWKHKLJKHQGSURGXFWVRIRXUFRPSHWLWRUZLOO Ã&#x20AC;QGWKLVQHZWHFKQRORJ\DPD]LQJDQGLWFRPHVDWDYHU\ DIIRUGDEOHSULFH8VXDOO\WKHVHW\SHVRIPDFKLQHVFRPH IURP ROG WHFKQRORJ\ GRZQJUDGHG IURP WKH EDVLF DJ LQJWHFKQRORJ\LQWKHPDUNHW7KHVHQHZSURGXFWVKDYH EHHQVSHFLÃ&#x20AC;FDOO\GHYHORSHGIRURXUPLGUDQJH $ VLQJOH KLJK UHVROXWLRQ VFUHHQ PDQDJHV DOO IXQFWLRQV DQG VWHSV RI Ã&#x20AC;QLVKLQJ GXH WR WKH QHZ GLJLWDO EORFNHU WHFKQRORJ\LQWHJUDWHGLQWKLVHGJHU DQLQWHJUDWHGKLJK UHVROXWLRQEORFNHU H[FOXVLYLW\RQWKHPDUNHW LVLQFOXG HGDQJOHGULOOLQJLVSURYLGHGWRLPSURYHWKHTXDOLW\RI WKHMREHYHQIRUWKLVOHYHORIPDFKLQHDQGVKDSHPRGLÃ&#x20AC; FDWLRQVDUHDYDLODEOHZLWKRXWSHULSKHU\QHHGHGVPDOOHU ZKHHOVWKDQWKHFRPSHWLWLRQHQDEOHVKDUSDQGDFFXUDWH Ã&#x20AC;QLVKLQJHYHQIRUUHODWLYHO\KLJKFXUYHV,QWKHODVW \HDUV,62VWDQGDUGVKDYHHYROYHGDQGRXUHGJHUVFRP SO\ZLWKWKHPDQGSURSRVHDWKPPSUHFLVLRQ 3OHDVHH[SODLQWKHDYDLODELOLW\DFURVV(XURSHE\ WHUULWRU\ 7KH QHZ HGJHUV DUH LQWHUQDWLRQDOO\ DYDLODEOH WKURXJK RXUVXEVLGLDULHVDQGRXUGLVWULEXWRUV2XUWHFKQLFLDQV



'WTQRGCP.GPUGUCPF6GEJPQNQI[May/June â&#x20AC;¢ 2012


+PVGTXKGY

DQGVDOHVPHQDFURVV(XURSHDUHFRPSOHWLQJWKHLUNQRZO HGJHDQGZLOOVRRQDOOEHUHDG\WRGHPRQVWUDWHWKHPDQG SURYHWRRXU(XURSHDQFXVWRPHUVWKDWZHSURSRVHVRPH HVVHQWLDOIHDWXUHVDQGSUHFLVLRQKLJKHUWKDQLQRXUSUHYL

:RXOG\RXVD\WKDWWKHSDFHRIGHYHORSPHQWDQG QHZLQQRYDWLRQVLQWKHÀHOGRIHGJLQJLVIDVWHUWKDQ HYHU"3OHDVHH[SODLQ :HKDYHODXQFKHGSURGXFWVLQPRQWKVVLQFHWKHEHJLQ

RXVPLGGOHUDQJH

QLQJRI-DQXDU\6RWKHDQVZHULVFOHDUO\´\HVµIRUXV2XU URDGPDSLVUHDG\ERWKIRUHGJHUV %ULRWDQG:HFR DQG LQVWUXPHQWV 9LVLRQL[  DQG WKH JURXS /XQHDX7HFKQRORJ\ LVUHDG\WRLQWURGXFHVRPHQHZSURGXFWVLQWRWKHPDUNHW HYHU\PRQWKV

:KDW DUH \RXU JRDOV DQG WDUJHWV LQ WKH PRQWKV DKHDGUHJDUGLQJWKHODXQFK 2IFRXUVHZHKRSHWRFRQYLQFHRXULQWHUQDWLRQDOFXVWRP HUV WKDW D QHZ DOWHUQDWLYH H[LVWV DQG WKDW WKH\ FDQ NHHS WKHTXDOLW\FRQWURORIWKHLUMREVDQGEHUHFRJQL]HGDVH[ SHUWV ZLWK %ULRW DQG:HFR  PLG UDQJH HGJHUV:H ZLOO FRQWLQXHRXUOHDGHUVKLSLQWHFKQRORJ\E\SURYLGLQJKLJK HQGWHFKQRORJ\DFFHVVLEOHIRUHDFKFDWHJRU\RIFXVWRPHU VHH QHZ:HFR (GJHU ODXQFK LQ -DQXDU\: :H ZLOO ODXQFKDQHZKLJKHQGGLDJQRVWLF9LVLRQL[LQVWUXPHQWGXU U LQJWKH6)2 6RFLHWH)UDQFDLVHG·2SKWKDOPRORJLH ZKLFK ZLOOFRPELQHXQLTXHIHDWXUHVWRJLYHGRFWRUVEHWWHUDFFHVV WRSDWLHQWH\HDQDO\VLV )RFXVLQJ RQ %5,27:(&2 ZKDW KDYH EHHQ WKH PDMRUGHYHORSPHQWVLQWKHODVWPRQWKV 6RPHQHZIHDWXUHVZHUHDGGHGLQRXU$OWDUDQJH WKHKLJK HQGRI%ULRWUDQJH  :H ORRN IRU FRQWLQXRXV LPSURYHPHQW LQ RXU HTXLSPHQW ZLWK D GDLO\ GLDORJXH ZLWK WKH PDUNHW WKURXJK RXU VDOHV DQGWHFKQLFLDQIRUFHV &RQFHUQLQJ WKH:HFR UDQJH ZH ODXQFKHG WKH QHZ VHPL LQGXVWULDOHGJHU´(GJHµDW2SWL0XQLFK,QVSLUHGE\ LQGXVWULDO UHTXLUHPHQWV WKLV HGJHU XQHTXLYRFDOO\ HYRNHV WKHUREXVWQHVVRIWKH*HUPDQEUDQG%HVLGHVDZLGHUDQJH RIIXQFWLRQDOLWLHVWKLVHGJHURIIHUVÁH[LELOLW\ZLWKHDFKSUR FHVVLQJ VWHS WKHUHE\ FRPELQLQJ VSHHG DQG TXDOLW\ DW LWV EHVW

:KDWDUHWKHFRPSDQ\·VJRDOVIRUDQGLQWKH ORQJHUWHUP :H ZLOO FRQWLQXH WR VWUHQJWKHQ WKH SHUIRUPDQFH RI RXU HTXLSPHQW ZKLOVW EHWWHU XQGHUVWDQGLQJ WKH RSWLFLDQV· QHHGV:HZDQWWREHDVTXLFNDVSRVVLEOHLQUHDFWLQJWR EULQJLQQRYDWLYHVROXWLRQVWRWKHPDUNHW:HZLOOFRQWLQXH WREXLOGXSRXU::VWUDWHJ\DQGWKHVWUHQJWKRIFRP SOHPHQWDU\ EUDQGV %ULRW:HFR IRU WKH ÀQLVKLQJ DFWLYLW\ DQG9LVLRQL[IRUWKHLQVWUXPHQWV  3OHDVHDGGDQ\IXUWKHULQIRUPDWLRQUHJDUGLQJ%5, 27·VQHZV /XQHDX7HFKQRORJ\ IROORZLQJ WKH DFTXLVLWLRQ RI %ULRW ,Q WHUQDWLRQDO:RUOGZLGHLVFRQVROLGDWLQJLWVSUHVHQFHLQWKH RSWLFDO PDUNHW ZLWK D JURZLQJ QHWZRUN RI VXEVLGLDULHV )UDQFH,WDO\*HUPDQ\3RUWXJDO6SDLQ%HQHOX[86&DQD GD DQGGLVWULEXWRUV  7KHJURXSGHYHORSVDQGVHOOVWKH EUDQGV %ULRW (GJHUV DQG ZRUNVKRS HTXLSPHQW IRU RSWL FLDQV :HFR (GJHUVIRURSWLFLDQVDQGLQGXVWULDOVROXWLRQV IRUODERUDWRULHV DQG9LVLRQL[ 5HIUDFWLRQDQGGLDJQRVWLFLQ VWUXPHQWVIRURSWLFLDQVDQGRSKWKDOPRORJLVWV 7KHJURXS LVWRGD\RQHRIWKHOHDGLQJFRPSDQ\LQWKHHTXLSPHQWÀHOG IRU2SWLFLDQV2SWRPHWULVWVDQG2SKWKDOPRORJLVW

May/June • 2012

' W T Q R G C P  . G P U G U  C P F  6 G E J P Q N Q I [




'7412'#0.'05'56'%*01.1);

%QPVKPWKPI'FWECVKQP

0ET1KKHOBKN6KQN QOPKIAN0ANRE?A 1KKHGEP U'KDJJ=!QGAO ,

/HDUQLQJ2EMHFWLYHV  7R XQGHUVWDQG WKH DWWULEXWHV DQG EHQHÃ&#x20AC;WV RI WKH 7ULYH[OHQVPDWHULDOLQFOXGLQJ  ([DPLQHKRZFRQVXOWDWLRQWHFKQLTXHVFRQWULEXWHWR RYHUDOOSDWLHQWVDWLVIDFWLRQ  8QGHUVWDQG WKH LPSRUWDQFH RI HVWDEOLVKLQJ D ZHO FRPLQJHQYLURQPHQWLQWKHRIÃ&#x20AC;FH  5HYLHZ HIIHFWLYH SDWLHQW IROORZXS SURFHGXUHV DQG EHQHÃ&#x20AC;WV

RXOGWKHODVWVHYHUDO\HDUVKDYHEURXJKWDERXWWKHGHDWK RISHUVRQDOFXVWRPHUVHUYLFH")URPRQOLQHRUGHULQJWRDX WRPDWHGFXVWRPHUVHUYLFHDJHQWVRQHYHU\SKRQHFDOO\RX PDNHSHRSOHDUHVRWHWKHUHGWRFHOOSKRQHVDQG,QWHUQHW FRQQHFWLRQV WKDW LW LV KDUG WR KDYH WKDW ZDUP SHUVRQDO LQWHUDFWLRQZHDOOWKULYHRQ,WVHHPVLWLVLPSRVVLEOHWRUH DOO\IHHOOLNHZHDVFXVWRPHUVDUHEHLQJFDWHUHGWR<RXDUH PRUHOLNHO\WREHWROG´:KLOH\RXUFDOOLVLPSRUWDQWWRXV



DOO RI RXU FXVWRPHU VHUYLFH UHSUHVHQWDWLYHV DUH FXUUHQWO\ ZLWKRWKHUFXVWRPHUVµ ,UHFHQWO\DVNHGIULHQGVIDPLO\DQGFROOHDJXHVWRZHLJKLQ RQ FXVWRPHU VHUYLFH LVVXHV WKH\ KDYH H[SHULHQFHG DQG KHDUGVRPHVKRFNLQJVWRULHV7KH\UDQJHGIURPZDLWLQJRQ KROGIRURYHUDQKRXUWRVSHDNWRDQDJHQWRQO\WRODWHUEH GLVFRQQHFWHGIURPWKHOLQHWRKDYLQJDFXVWRPHUVHUYLFH UHSUHVHQWDWLYH UHVSRQG WR D UHTXHVW ZLWK´:KDW GR \RX H[SHFWPHWRGRDERXWLW"µ2QHIULHQGRIPLQHGHVFULEHG DQH[SHULHQFHDWDODUJHUHWDLOHUZKHUHWKH\VSHQWPLQ XWHVZDLWLQJLQOLQHWRFKHFNRXWDQGZKHQWKH\ZHUHÃ&#x20AC;QDOO\ DWWKHFDVKLHUWKH\ZHUHXQDEOHWRSURFHVVWKHLUSD\PHQW 7KH\ZHUHVHQWWRWKHFXVWRPHUVHUYLFHGHVNZKHUHWKH\ KDG WR UHULQJ WKHLU HQWLUH SXUFKDVH 2Q WRS RI WKH WLPH GHOD\ZKLFKZDVDERXWDQRWKHUPLQXWHVWKHFXVWRPHU VHUYLFHUHSUHVHQWDWLYHWKH\ZRUNHGZLWKPXPEOHGXQGHU KHU EUHDWK ´7KLV VKRXOG·YH EHHQ WDNHQ FDUH RI DW WKHUHJLVWHUZKDWD ZDVWHRIP\WLPHµ <LNHV <RXUSDWLHQWVKDYH D YDVW QHWZRUN RI

'WTQRGCP.GPUGUCPF6GEJPQNQI[May/June â&#x20AC;¢ 2012


%QPVKPWKPI'FWECVKQP

IDPLO\ DQG IULHQGV ZKR H[SHULHQFH WKH VDPH SRRU FXV WRPHUVHUYLFHRQDGDLO\EDVLV'RQ·W\RXWKLQNWKH\ZRXOG ZHOFRPH D KDSS\ HDV\ IXQ WUDQVDFWLRQ IRU D FKDQJH"<RX EHWWHUEHOLHYHWKH\ZRXOG 7KHJHQLXVWRWKLVSURFHVVLVWKDWFXVWRPHUVHUYLFHLQJHQ HUDOLVVREDGWKDWZKHQDJRRGFXVWRPHUVHUYLFHH[SHUL HQFH LV HQFRXQWHUHG SHRSOH WDON DERXW LW7KH JRRG \RX GRIRURQHSDWLHQWFDQTXLFNO\EHFRPHDQRSSRUWXQLW\WR SURYLGHJRRGFXVWRPHUVHUYLFHWRVHYHUDOSDWLHQWV7KLVXQ ORFNVDQXQOLPLWHGSRWHQWLDOWRJURZ\RXUSUDFWLFHMXVWE\ YLUWXHRIGRLQJWKLQJVWKH´ULJKWµZD\DVIDUDV\RXUFXVWRP HUVDUHFRQFHUQHG 7+(´5,*+7µ:$< :KDWLVWKH´ULJKWµZD\WRGRWKLQJV")LUVWVKLIW\RXUSRLQW RI YLHZ WR EH´SDWLHQWFHQWULFµ DQG WKH H[SHULHQFH WKH\ KDYHZLWKLQ\RXURIÃ&#x20AC;FH%ULQJWKLVIURQWDQGFHQWHUWRWKH PLQGVRIHDFKVWDIIPHPEHU,WLVHDV\WRJHWFDXJKWXSLQ WKHPLQXWLDHRIWKHGDLO\URXWLQHWKDWRQHFRXOGHDVLO\IRU U JHWWKHSDWLHQWVLWWLQJLQIURQWRI\RXLVWKHDFWXDOOLIHEORRG RIWKHRIÃ&#x20AC;FH\RXRFFXS\

7KLQNDERXWLW:LWKRXWWKHSDWLHQWZK\ZRXOGDQ\RI\RX EHWKHUH"7KHSDWLHQWLVQRWRQO\WKHUHDVRQIRUFRPLQJWR ZRUNEXWLVDOVR\RXUDELOLW\WRSD\ELOOVRZQKRPHVDQG HQMR\\RXURZQOLYHV,W·VQRWDQHDUWKVKDNLQJQHZSLHFHRI LQIRUPDWLRQEXWLI\RXIRUJHWWKLVYDOXDEOHSLHFHRILQIRUPD WLRQWKHUHVXOWVFDQEHGHYDVWDWLQJWR\RXUSUDFWLFH+HUH·V KRZWRLPSOHPHQWH[FHOOHQWFXVWRPHUVHUYLFHZLWKLQ\RXU RIÃ&#x20AC;FH *(767$))21%2$5' +DYHGDLO\PLQXWHPHHWLQJVZLWK\RXUVWDIIDQGGLVFXVV FXVWRPHUVHUYLFH&RQVLGHUPHHWLQJEHIRUH\RXRSHQIRU WKHGD\DQGXVHWKLVWLPHWRLGHQWLI\DUHDVRIFRQFHUQWKH UHVXOWV RI IROORZXS VXUYH\V ZH ZLOO GLVFXVV WKHVH ODWHU 

DQG FHOHEUDWLRQV RI FXVWRPHU VHUYLFH VXFFHVVHV 3DW WKH VWDIIRQWKHEDFNZKHQWKH\·YHSURYLGHGH[FHOOHQWFXVWRP HU VHUYLFH DQG GRQ·W IRUJHW WR SDW \RXUVHOI RQ WKH EDFN IRUWDNLQJWKHVHVWHSVWREHWWHUWKHFXVWRPHUH[SHULHQFH ZLWKLQ\RXURIÃ&#x20AC;FH 3267,7127(6 $GGWKHIROORZLQJ3RVWLWQRWHWRFDELQHWGRRUVDQGPRQL WRUV´:LWKRXW SDWLHQWV \RX ZRXOG QRW EH KHUHµ 3RVW LW ZKHUH\RXUVWDIIZLOOYLHZLWRIWHQ1RWWREHWKUHDWHQLQJ EXW\RXUVWDIIQHHGVWRXQGHUVWDQGWKDWZHDUHDVHUYLFH GULYHQSURIHVVLRQDQGWKHSDWLHQWLVZKR\RXDUHFKDUJHG WRVHUYH7KHPRUH\RXFDQGLVFXVVWKLVYLVLRQRIVHUYLFH ZLWKVWDIIWKHPRUHHDVLO\WDUJHWHGJRDOVZLOOEHDFKLHYHG 387&2168/7$7,21,172$&7,21 <RX DQG \RXU VWDII DUH FRPPLWWHG WR PDNLQJ WKH SDWLHQW WKH IRFXV RI LPSRUWDQFH ZLWKLQ \RXU RIÃ&#x20AC;FH 1RZ ZKDW" $GGDIHZQHZWRROVWR\RXU´FXVWRPHUVHUYLFHWRROER[µ DQG SXW WKHP WR JRRG XVH )LUVW LV WKH FRQVXOWDWLRQ7KH FRQVXOWDWLRQLGHQWLÃ&#x20AC;HVZK\WKHSDWLHQWFDPHWR\RXLQWKH Ã&#x20AC;UVW SODFH :KDW VSHFLÃ&#x20AC;FDOO\ DUH WKH UHDVRQV WKH\ ZDONHG LQWKHGRRU"8VHLWWRLGHQWLI\ DQG PHHW WKHLU QHHGV7KLV LV D FRPPXQLFDWLRQ WDFWLF WKDW FUHDWHV PXWXDOO\ H[FHSWLRQDO RXWFRPHV7KH SDWLHQW7(//6 \RXZKDWWKH\ZDQWDQGWKHQ \RX*(7WKHSDWLHQWZKDWWKH\ ZDQW³WDON DERXW D ZLQZLQ VLWXDWLRQ7KHFRQVXOWDWLRQLVD ZHOOWKRXJKW RXW VHW RI TXHV WLRQV WKDW DGGUHVVHV D VHULHV RILVVXHV7KHWDEOHDERYHLVDQ H[DPSOHWKDWSURYLGHVDVHWRI TXHVWLRQVWKDWFDQEHDGRSWHG WREHVXUHWKDWWKHFRQYHUVD WLRQSURYLGHVDOOWKHGHWDLOVWR PHHWSDWLHQWH[SHFWDWLRQV %HGLOLJHQWLQDVNLQJWKHVHLP SRUWDQW TXHVWLRQV WR HYHU\ SDWLHQW(DFKFXVWRPHUVKRXOG EH DEOH WR H[SHFW WKH VDPH JUHDW VHUYLFH 8QGHUVWDQGD EO\VRPHWLPHVLWJHWVEXV\DQG\RXIHHOUXVKHGEXWWU\WR 1(9(5 DOORZ D SDWLHQW WR IHHO WKH\ KDYH LQFRQYHQLHQFHG \RXLQDQ\ZD\$IWHUDOOWKHSDWLHQWLVWKHUHDVRQ\RXFDPH WRZRUNULJKW" 2I FRXUVH \RXU SUDFWLFH ZLOO EH DEOH WR IRUPXODWH WKH TXHVWLRQV WKDW \RX VSHFLÃ&#x20AC;FDOO\ ZDQW DQ VZHUHGEXWMXVWWKHVLPSOHDVNLQJ RI WKHVH TXHVWLRQV ZLOO LPPHGL DWHO\SXWWKHSDWLHQWDWHDVHDQG JLYHWKHPDOHYHORIWUXVWDVWKHLU H\HFDUH SURIHVVLRQDO7KH DFW RI 'QOPLNAOOPDA>QPPKJARANUPEIA DVNLQJWKHVHTXHVWLRQVVKRZVWKH

May/June â&#x20AC;¢ 2012

' W T Q R G C P  . G P U G U  C P F  6 G E J P Q N Q I [




'7412'#0.'05'56'%*01.1);

%QPVKPWKPI'FWECVKQP

SDWLHQW\RXDUHOLVWHQLQJDQGFFRQFHUQHGDERXWWKHEHVWFDUH IRU WKHP:KDW FRXOG PDNH D SDWLHQW KDSSLHU WKDQ JLYLQJ WKHPH[DFWO\ZKDWWKH\ZDQW" &5($7($:(/&20,1 1 1*(19,5210(17 1H[WPDNHVXUH\RXURIÀFHLLVDVZHOFRPLQJDQGFRPIRUW L  DEOHDV\RXUSDWLHQW·VIDYRULWHSDLURIVOLSSHUV0DNH\RXURII ÀFHLQWRDSODFHSHRSOHZDQWWWRYLVLWQRWMXVWDSODFHZKHUH WKH\KDYHWRFRPHRQFHD\HDULQRUGHUWRJHWPRUHFRQ WDFWV'RQ·W\RXURXWLQHO\JRWRSODFHVZKHUH\RXIHHOZHO Q·W \RX URX  FRPHGDQGFRPIRUWDEOH":HDUHFUHDWXUHVRIKDELWZKRJR ZKHUHZHKDYHKDGJRRGH[SHULHQFHVRYHUDQGRYHU:K\ HOVHGR6WDUEXFNVORFDWLRQVZKRNQRZSHRSOH·VQDPHVDQG UHFRJQL]H ZKDW WKH\ DUH JRLQJ WR RUGHU ÁRXULVK" 3HRSOH OLNHWKDWWKH\IHHOZHOFRPHDQGWKH\EHORQJ,WLVWKDWIHHOLQJ RIEHORQJLQJWKDWNHHSVSHRSOHFRPLQJEDFN &KHFNRQRIÀFHFOHDQOLQHVV,WLVHDV\WRRYHUORRNWKHWDW WHUHG SLHFH RI FDUSHW EHFDXVH \RX VHH LW HYHU\ GD\ %XW \RXUQHZSDWLHQWKDVQHYHUVHHQLWDQGLIWKH\EHOLHYH\RX DUH WRR OD]\ WR À[ WKH WDWWHUHG SLHFH RI FDUSHW PD\EH WKH\WKLQN\RXDUHDOVRWRROD]\WRSURSHUO\ VWHULOL]H\RXULQVWUXPHQWV+DYLQJDQLPSHF FDEO\ FOHDQ RIÀFH SUHVHQWV ZHOO WR SDWLHQWV DQG LW PDNHV HYHU\RQH IHHO JRRG EHLQJ LQ WKDW VSDFH7DNH D ORRN DURXQG GR LW QRZ RUÀUVWWKLQJWRPRUURZZKHQJHWWLQJWRWKH RIÀFH DVLI\RXKDYHQHYHUVHHQLWEHIRUH2U UHFUXLW VRPHRQH ZKR KDV QHYHU VHHQ \RXU RIÀFH DQG VROLFLW WKHLU RSLQLRQ 'HWHUPLQH LI\RXUZDOOSDLQWQHHGVWREHUHIUHVKHGRU LILW·VWLPHWRUHXSKROVWHUWKHZDLWLQJURRP

%=REJC=JEILA??=>HU?HA=JKBBE?ALNAOAJPOSAHHPKL=PEAJPO=J@EPI=GAOARANUKJABAAH CKK@>AEJCEJPD=POL=?A



FKDLUV7KLVDUHDPDNHVDQLPSDFWWKHÀUVWLPSUHVVLRQRQ KRZFRPIRUWDEOHSDWLHQWVIHHO &5($7($:(/&20(:$*21 2IWHQWKHHDVLHVWZD\WRFUHDWHDZHOFRPLQJHQYLURQPHQW LVWRDSSRLQWDSHUVRQWREH\RXU´ZHOFRPLQJDJHQWµ7KLV SHUVRQDOZD\VVD\VKHOORZLWKDVPLOHDQGLVWKHÀUVWSRLQW RIFRQWDFW7KH\DUHIRFXVHGRQFUHDWLQJDVXSHULRURSWL FDOH[SHULHQFH3HRSOHGRQ·WZDQWWRIHHOOLNHVKHHSEHLQJ KHUGHGWKURXJK\RXURIÀFHWKH\ZDQWWRIHHOOLNH\RXDUH KDSS\ WR VHH WKHP DQG WKH\ KDYH JUDFHG \RX ZLWK WKHLU SUHVHQFH(QFRXUDJH\RXUSDWLHQWVWRIHHOWKLVZD\,WLVDQG VKRXOGEHDOODERXWWKHP&RQVLGHUKDYLQJDFRIIHHVWDWLRQ FRRNLHVERWWOHGZDWHUMXLFHHWF <RXU SDWLHQW·V H[SHULHQFH LV DOO DERXW WKHP WKH PRPHQW WKH\ZDONLQWKHGRRU7KH\DUHQRWFRQFHUQHGZLWKKRZ PDQ\RWKHUSDWLHQWV\RXKDYHWRVHHWKDWGD\RUWKDW\RX KDYHDVLFNFKLOGDWKRPH<RXUGXW\LVWRPDNHVXUH\RX WRR DUH FRQFHUQHG ZLWK ZKDW \RXU SDWLHQW LV H[SHULHQF LQJDWWKDWYHU\PRPHQW+DYH\RXHYHUKHDUGWKHDGDJH ´SHUFHSWLRQ LV HYHU\WKLQJµ" :HOO SDWLHQW SHUFHSWLRQ ,6 HYHU\WKLQJ

 &20081,&$7( &/($5/< &OHDUHIIHFWLYHFRPPXQLFD WLRQLVFULWLFDODWHYHU\VWHS LQWKHRIÀFH8QGHUVWDQGLQJ WKH SURFHVV RI SUHWHVWLQJ WKH H[DP UHFRPPHQGHG SURGXFWVDQGWKHÀQDOH\H ZHDU RUGHU LV NH\7KHUH LV QRWKLQJ ZRUVH WKDQ D SD WLHQWVXUSULVHGE\WKHWRWDO DPRXQW %H FOHDU LQ \RXU !AOECJ=PAOKIAKJASEPDEJUKQNKBBE?APK>APDALAN FRPPXQLFDWLRQ DW HYHU\ OKJSDKI=GAOBKHHKSQL?=HHO VWHSDQGDOVRRIWKHUHDVRQV WKH\ DUH SXUFKDVLQJ WKH LWHPV WKH\ KDYH VHOHFWHG , KLJKOLJKWFRVWKHUHEHFDXVHWRGD\·VSDWLHQWVDUHYDOXHFRQ VFLRXV<RXPLJKWFRQVLGHUXVLQJDVFULSWVLPLODUWRWKLV ´7KHIUDPH\RXFKRVHLVPDGHRIWLWDQLXPEHFDXVH\RXDS SUHFLDWHGLWVOLJKWZHLJKWDQGWHUULÀFGXUDELOLW\7KLVIUDPH FRVWV´[µ7KHQRJODUHOHQVHVZHFKRVHDUHPDGHXVLQJ89 DEVRUELQJ DQG H[FHSWLRQDOO\ LPSDFW UHVLVWDQW7ULYH[ OHQV PDWHULDOEHFDXVHRIWKHVDIHW\DQGRSWLFDOFODULW\WKH\RIIHU <RX·OO H[SHULHQFH FOHDU FULVS YLVLRQ WKDW FRPHV IURP WKH DQWLUHÁHFWLYHQRJODUHFRDWLQJ3OXVWKH\ZLOOSURWHFW\RXU H\HVIURPKDUPIXO89UD\V7KHVHOHQVHVFRVW¶\· 7KHWRWDOFRVWLV¶]·ZKLFKLQFOXGHV\RXUIUDPH\RXUDQWL UHÁHFWLYHOHQVHVXOWUDYLROHWSURWHFWLRQDQGWKH VLQJOHYL VLRQRUQROLQHSURJUHVVLYH OHQVGHVLJQ:HDQWLFLSDWH\RXU QHZH\HZHDUZLOOEHFRPSOHWHGZLWKLQWKHQH[WWR GD\VEXWZHZLOOQRWLI\\RXMXVWDVVRRQDVWKH\DUULYHµ 7KHQDVN´'R\RXKDYHDQ\TXHVWLRQVIRUPH"µ7KLVZLOODO ORZWKHSDWLHQWWRKDYHWKHODVWZRUGLQ\RXUFRQYHUVDWLRQ

'WTQRGCP.GPUGUCPF6GEJPQNQI[May/June • 2012


%QPVKPWKPI'FWECVKQP

8VLQJDVFULSWUHLQIRUFHVWKHUHDVRQVWKH\KDYHFKRVHQWKH LWHPVWKH\GLGDVZHOODVFRPPXQLFDWLQJWKHFRVWVWRWKHSD WLHQWVVRLWFDQEHDGGUHVVHGSULRUWRWKHFKHFNRXWSURFHVV )2//2:83 7KH SDWLHQW KDV EHHQ LQ WR WKH RIÀFH KDV SXUFKDVHG DQG UHFHLYHG WKHLU QHZ H\HZHDU RU FRQWDFWV ³QRZ ZKDW" 7KHQH[WVWHSLVWRIROORZXSZLWKWKHSDWLHQW<RXZDQWWR NQRZKRZWKH\DUHDQGKRZ\RXGLG<RXPLJKWDVN´'LG ZHSURYLGH\RXZLWKVHUYLFHWKDWH[FHHGHG\RXUH[SHFWD WLRQV"$UH\RXVDWLVÀHGZLWK\RXUQHZH\HZHDU RUFRQ WDFWV ":HUH\RXVDWLVÀHGZLWKWKHTXDOLW\RI\RXUH[DP",V WKHUHDQ\WKLQJZHFRXOGGRGLIIHUHQWO\WREHWWHUVHUYH\RX" :HVWULYHWRSURYLGHH[FHOOHQWFXVWRPHUVHUYLFHDQGZH ZRXOG ORYH WR KHDU \RXU IHHGEDFN DERXW WKH H[SHULHQFH \RXKDGZKLOHYLVLWLQJRXURIÀFHµ 'HVLJQDWH VRPHRQH ZLWKLQ \RXU RIÀFH WR EH WKH SHUVRQ ZKRPDNHVIROORZXSFDOOV1HYHUXQGHUHVWLPDWHWKHYDOXH RIWKHIHHOLQJWKDWZLOOEHIHOWE\WKHSDWLHQWZKRNQRZV\RX FDUHDERXWKRZWKH\DUHGRLQJ'R\RXWKLQNSHRSOHIHHO WKH\DUHFDUHGDERXWLQWKHLUHYHU\GD\OLIH"1RWJHQHUDOO\ $WOHDVWQRWE\PRVWRIWKHSODFHVZLWKZKLFKWKH\GREXVL QHVV%\VKRZLQJ\RXFDUHLWHQGHDUV\RXUSDWLHQWVWR\RX DQG\RXUSUDFWLFH %(&20($352%/(062/9(5 'XULQJIROORZXSEHSUHSDUHGWRKHDUVRPHSHRSOHKDYH LVVXHVZLWKWKHLUH\HZHDURUFRQWDFWVRUVRPHSDUWRIWKHLU FDOO RU YLVLW7KH IROORZXS KHOSV WR LGHQWLI\ WKHVH LVVXHV VRWKH\PD\EHFRUUHFWHG&RQVLGHUVD\LQJ´+RZDUH\RX JHWWLQJDORQJZLWK\RXUQHZH\HZHDU RUQHZFRQWDFWV "µ 7KHQ SURYLGH WKH SDWLHQW ZLWK WKH RSSRUWXQLW\ WR YRLFH DQ\FRQFHUQVWKH\PD\KDYH<RXUDQVZHUVKRXOGDOZD\VEH ´3OHDVHFRPHLQWRWKHRIÀFHDVVRRQDVLWLVFRQYHQLHQW ZHZDQWWRPDNHVXUH\RXDUHFRPSOHWHO\VDWLVÀHGDQGZH ZDQWWRGRRXUEHVWWRUHPHG\WKHVLWXDWLRQµ 7KLVFRQYHUVDWLRQVKRZVWKHFXVWRPHUWKH\ZLOOQRWEHOHIW DORQH WR ÁRXQGHU ZLWK ZKDWHYHU LVVXH WKH\ PD\ KDYH ,W VKRZV\RXKDYHFRQFHUQIRUKRZWKH\DUHGRLQJDQGLI\RX DUHDEOHWRUHVROYHWKHLVVXHTXLFNO\7KLVRIWHQLPSUHVVHV WKHFXVWRPHUHYHQPRUHWKDQLIWKHUHKDGEHHQQRSURE OHPDWDOO 27+(5352%/(062/9,1*7$&7,&6 6ROYHSUREOHPVWKHLQVWDQWDSUREOHPLVHQFRXQWHUHG)RU LQVWDQFH´,XQGHUVWDQGWKHUHLVDQLVVXHZLWK\RXUJODVVHV RUFRQWDFWV :KDWLVWKHSUREOHP"+RZZRXOG\RXOLNHWR VHHWKLVLVVXHUHVROYHG"µ 7KLV JLYHV WKH SDWLHQW VRPH RZQHUVKLS LQ WKH RXWFRPH 2IWHQWLPHV\RXZLOOEHVXUSULVHGWKHSDWLHQW·VSURSRVHG UHVROXWLRQLVPXFKOHVVLQWUXVLYHWKDQZKDW\RXPLJKWKDYH FRQVLGHUHG$IWHUDOOLWLVDORWHDVLHUWRPHHWWKHSDWLHQW·V H[SHFWDWLRQV ZKHQ \RX NQRZ ZKDW WKH\ H[SHFW RI \RX :K\ ZDVWH WLPH DVVXPLQJ \RX NQRZ ZKDW \RXU SDWLHQW ZDQWVZK\QRWMXVWDVNWKHTXHVWLRQDQGWKHQVSHQG\RXU WLPHFRUUHFWLQJWKHLVVXHLQDPDQQHUWKDWZLOOVDWLVI\WKHP DQG\RX"

&2817(5815($/,67,&(;3(&7$7,216 6RPHWLPHV\RXZLOOHQFRXQWHUDSDWLHQWZKRUHTXHVWVWKH LVVXH EH VROYHG E\ PHDVXUHV WKDW FDQQRW EH PHW 'RQ·W RYHUSURPLVH LQ WKHVH VLWXDWLRQV %H UHDOLVWLF DQG KRQHVW DQG WHOO WKH SDWLHQW \RX FDQQRW PHHW WKHLU UHTXHVW EXW JLYHWKHPDQDOWHUQDWLYHWKDW\RXFDQDFFRPPRGDWH3HR SOHKDWHWRKHDU\RX´FDQ·WµGRVRPHWKLQJ'RQ·WGZHOORQ ZKDW\RXFDQ·WGRSUHVHQWWRWKHPZKDW\RX´FDQµGR2I FRXUVH WKH QH[W NH\ WR WKLV LV WR IROORZ WKURXJK DQG GR ZKDW\RXVDLG\RXZRXOG ,I\RXWKLQNDERXWLWGRQ·W\RXWXUQWRSHRSOHLQ\RXUOLIH RYHUDQGRYHUZKRKDYHSURYHQWREH´SUREOHPVROYHUVµ" :KHQ\RXKDYHDQLVVXH\RXJRZKHUHYHU\RXFDQJHWLW UHVROYHGPRVWTXLFNO\DQGHIÀFLHQWO\ /HW\RXURIÀFHEHWKDWSODFHIRUSDWLHQWV/HWWKHPFRPH WR\RXEHFDXVHWKH\WUXVW\RXZLOOWDNHFDUHRIDQ\SURE OHPVWKH\PD\KDYHZLWKWKHLURSWLFDOQHHGV7UXVWLVDYDOX DEOHWKLQJLWHQVXUHV\RXDUHFUHDWLQJDSDWLHQWIRUOLIHZKR ZLOOEHDUHIHUUDOVRXUFHIRU\RXDQGIRUWKHJRRGRI\RXU SUDFWLFH'RQ·WORRNDWSUREOHPVDVLQFRQYHQLHQFHORRNDW SUREOHPVDVRSSRUWXQLWLHVWREHFRPHWKDWWUXVWHG´SURE OHPVROYHUµ ,1&21&/86,21³67$5772'$< 6KLIW WKH IRFXV WR WKH LPSRUWDQFH RI SDWLHQW VDWLVIDFWLRQ 7KH RXWFRPHV FDQ EH WUHPHQGRXV 3DWLHQWV \RX KDYH ZRUNHGVRKDUGWRSOHDVHZLOOQRWZDQWWRNHHSWKHH[SHUL HQFHWKH\KDGDVHFUHWWKH\ZLOOEHH[FLWHGWRVSUHDGWKH ZRUGWRIULHQGVDQGIDPLO\7KDWJURZVSDWLHQWQXPEHUVDQG UHYHQXH 'RQ·W IRUJHW WR SXW \RXUVHOI LQ \RXU SDWLHQW·V VKRHV DQG WU\ WR FRQYH\ \RX ZLOO EH WKHLU WUXVWHG SUREOHP VROYHU IRUDVORQJDVWKH\FKRRVHWRVHHN\RXUSURIHVVLRQDOKHOS 5HPHPEHUWKDWWKH\GR&+226(WRFRPHWR\RXWKH\ FRXOGMXVWDVHDVLO\FKRRVHWRJRVRPHZKHUHHOVH 4XDOLW\FXVWRPHUVHUYLFHLVQRWDQXQDWWDLQDEOHJRDODQGLW GRHVQRWKDYHWREH DORVWDUW<RXUSUDF WLFH FDQ SURYLGH TXDOLW\ FXVWRPHU VHUYLFHLWMXVWWDNHV VRPH SODQQLQJ SD WLHQFH FOHDU FRP PXQLFDWLRQ DQG D IHZ QHZ WRROV LQ WKH FXVWRPHU VHUY LFHWRRONLW

-=PEAJPOUKQD=RASKNGA@OKD=N@ PKLHA=OASEHHJKPS=JPPKGAALPDA ATLANEAJ?ADAUD=@=OA?NAP PDAU SEHH>AAT?EPA@PKOLNA=@PDASKN@ PKBNEAJ@O=J@B=IEHU

May/June • 2012

' W T Q R G C P  . G P U G U  C P F  6 G E J P Q N Q I [




'7412'#0.'05'56'%*01.1);

+PPQXCVKQPU

)AJOAOPA?DJKHKCU 1. '2),+51

,QWHUFDVW (XURSH WKH 3DUPDEDVHG PDQXIDFWXUHU RI WKH SDWHQWHG KLJK SHUIRUPDQFH 1;7ŠOHQVHVDQG-XOERDVXQJODVVHVEUDQGDQGVSHFLDOLVWLQVRODUSURWHFWLRQIRUH[WUHPH HQYLURQPHQWVFRQWLQXHWRVWUHQJWKHQWKHLUVXFFHVVIXOSDUWQHUVKLSDQGFROODERUDWLRQLQWHUPV RISURGXFWGHYHORSPHQW 7KHQHZZLQWHUJRJJOHVFROOHFWLRQE\-XOERRIIHUVDZLGHFKRLFHRIOHQVHVWKDWSURYLGH WKHYHU\EHVWLQSHUIRUPDQFHWKDQNVWRWKHXVHRI1;7Š9DULDŒSODWIRUPFXUUHQWO\ZLGHO\ UHFRJQL]HGDVWKHEHVWSKRWRFKURPLFWHFKQRORJ\LQWKHPDUNHWIRUVRODUÀOWUDWLRQ$V-XOER DIÀUPV¶WKHGLIIHUHQFHLVLQWKHOHQV·1;7ŠOHQVHVSURYLGHH[WUHPHLPSDFWWHPSHUDWXUHDQG FKHPLFDOUHVLVWDQFHWRJHWKHUZLWKVXSHULRURSWLFDOSHUIRUPDQFHFRPSDUHGWRWKHH[LVWLQJ WHFKQRORJLHV7KDWLVZK\WKH\KDYHEHHQFKRVHQDVWKHSHUIHFWVROXWLRQIRU-XOERJRJJOHV DOZD\VDLPLQJDWSURWHFWLQJVQRZORYHUVZLWKKLJKTXDOLW\SURGXFWVDQGYLVXDOFRPIRUW /LJKW²VHQVLWLYHWUHDWPHQWWKURXJKRXWWKHZKROHERG\RIWKHOHQVDQGQRWMXVWRQWKHVXUIDFH SURYLGHVXQULYDOOHGYLHZLQJFRPIRUWLQDOOVLWXDWLRQVVD\VWKHFRPSDQ\

ZZZQ[WYLVLRQFRP

2. %,6%KU=HAJOCQE@A

+R\D LV VXSSRUWLQJ WKH ULVH LQ L3DG XVH ZLWKLQ LQGHSHQGHQW SUDFWLFHV LQ WKH 8. ZLWK WKH ODXQFKRILWVQHZOHQVFDWDORJXHDYDLODEOHLQWKLVTXLFNHDV\WRUHIHUHQFHIRUPDW 3URPRWLQJLWVXVHUIULHQGO\GLVSHQVLQJDQGPDQDJHPHQWL3DG$SSVWKHQHZFDWDORJXHIURP +R\DLVDOVRDYDLODEOHDVDJORVV\SULQWHGKDUGFRS\SUHVHQWHGLQDQDWWUDFWLYHIROGHU ´:HKDYHPDGHWKHQHZ+R\D/HQV&DWDORJXHDVDFFHVVLEOHDVSRVVLEOHIRUHYHU\W\SHRI SUDFWLFH²ZKHWKHUWKH\DUHWHFKQRORJ\OHGRUSUHIHUWUDGLWLRQDOSUHVHQWDWLRQV7KHIRUPDW PDNHVLWHDVLHUWKDQHYHUWRORFDWHWKHODWHVWLQLQQRYDWLYHSURGXFWVIURP+R\DµVDLG6WHYH 5REHUW)%'2+R\D/HQV8.3URGXFW0DQDJHU ([WHQGLQJ WKH DZDUGZLQQLQJ IUHHIRUP OHQV SRUWIROLR WKH OHQV FDWDORJXH LV D TXLFN HDV\ UHIHUHQFHZLWKIUHHIRUPDQGFRQYHQWLRQDOOHQVGHVLJQVOLVWHGVHSDUDWHO\ ´+R\D·V QHZ UHIHUHQFH KDV EHHQ GHYHORSHG DIWHU FRQVXOWDWLRQ ZLWK FXVWRPHUV WR HQVXUH WKDWZHKDYHWKHPRVWXVHUIULHQGO\IRUPDWIRUVRXUFLQJLQIRUPDWLRQ7KHFHQWUDWLRQFKDUWLV SDUWLFXODUO\HDV\WRQDYLJDWHµDGGHG6WHYH

ZZZKR\DFRXN

3. --$&J@QOPNEAO-AJP=HEPA1NE>E@HAJOAO

33*,QGXVWULHV 1<6(33* DQG'$,2SWLFDO,QGXVWULHVSUHVHQWHGWKHODXQFKRI3HQWDOLWHŠ 7ULEULGŒOHQVHVLQ,WDO\DWWKH0,'2,QWHUQDWLRQDO2SWLFV([KLELWLRQ ´7ULEULGPDWHULDOUHSUHVHQWVWKHQH[WHYROXWLRQRIOHQVPDWHULDOWHFKQRORJ\µVDLG&KULVWLQH &DPVX]RX33*,QGXVWULHVJHQHUDOPDQDJHURSWLFDOPDWHULDOV´%\FRPELQLQJPRUHEHQHÀWV IRU WKH ZHDUHU7ULEULG PDWHULDO EXLOGV RQ 33*·V FRPPLWPHQW WR GHYHORS XQFRPSURPLVLQJ RSWLFDOPDWHULDOV1RZSDWLHQWVZLWKKLJKHUSUHVFULSWLRQVFDQKDYHOHQVHVWKDWDUHPRUHWKDQ MXVWWKLQDQGRIIHUFOHDUYLVLRQOLJKWQHVVLPSDFWUHVLVWDQFHDQG89SURWHFWLRQ:HDUHH[FLWHG WRFROODERUDWHZLWK'$,2SWLFDORQWKHODXQFKRIWKHLUQHZ3HQWDOLWH7ULEULGOHQVHVµ 7KHODXQFKRIWKLVQHZSURGXFWH[SDQGVWKHUDQJHRIKLJKSHUIRUPDQFHRSKWKDOPLFOHQVHV PDQXIDFWXUHG E\ '$, 2SWLFDO7KH 3HQWDOLWH OHQV SURGXFW IDPLO\ QRZ IHDWXUHV 3HQWDOLWH 7ULEULG OHQVHV IRU SDWLHQWV ZLWK KLJKHU SUHVFULSWLRQV DQG 3HQWDOLWH 7ULYH[ 5  OHQVHV IRU WKH PDMRULW\ RI SDWLHQWV ZLWK ORZ WR PRGHUDWH SUHVFULSWLRQV %RWK SURGXFWV SURYLGH WKH EHVWEDODQFHRISHUIRUPDQFHOHQVFKDUDFWHULVWLFVDQGUHLQIRUFH'$,·VFRPPLWPHQWWRWKH WHFKQLFDOGHYHORSPHQWRILQQRYDWLYHSURGXFWVDQGVROXWLRQVIRUWKHLUFXVWRPHUV ´2XU H[FOXVLYH 3HQWDOLWH 7ULEULG OHQVHV XVH D FXWWLQJHGJH WHFKQRORJ\ WKDW FRPELQHV FKDUDFWHULVWLFVRI3HQWDOLWH7ULYH[PDWHULDOZLWKKLJKLQGH[OHQVFKHPLVWULHVµVDLG5REHUWR 'H*HQQDUR&(2'$,2SWLFDO,QGXVWULHV´2XUFXVWRPHUVZLOOEHVDWLVÀHGE\WKHEHQHÀWV RIIHUHGE\WKLVQHZSURGXFW²OLJKWQHVVWUDQVSDUHQF\VWUHQJWKKDUGQHVVDQGVXEWOHW\1HZ 3HQWDOLWH7ULEULGOHQVHVUHSUHVHQWWKHLGHDOVROXWLRQIRUDOOOLIHVW\OHVDQGWKH\FDQEHHDVLO\ XVHGE\FKLOGUHQDQGHOGHUO\SHRSOH:HDUHH[FLWHGWREHRQHRIWKHÀUVWODERUDWRULHVLQ,WDO\ WRRIIHU7ULEULGPDWHULDOWRRXUFXVWRPHUVµ 6LPLODUWR7ULYH[PDWHULDO7ULEULGOHQVHVRIIHUH[FHSWLRQDOSHUIRUPDQFHVSHFLÀFDOO\WDUJHWLQJ SDWLHQWVZLWKKLJKHUSUHVFULSWLRQV 'WR' WKURXJKWKHXQLTXHFRPELQDWLRQ RIFOHDUYLVLRQOLJKWZHLJKWFRPIRUWWKLQQHVVLPSDFWUHVLVWDQFHDQG89SURWHFWLRQ

ZZZSSJWULEULGFRP 

'WTQRGCP.GPUGUCPF6GEJPQNQI[May/June • 2012


+PPQXCVKQPU

4. (,!(!ECEP=H0KH=N1A?)AJO

6LJQHW$UPRUOLWH KDV DQQRXQFHG WKH ODXQFK RI WKH .2'$. 'LJLWDO 6RODU7HF /HQV:LWK WKHXVHRISLRQHHULQJGLJLWDOWHFKQRORJ\DVSHFLDOLVWDQGEDVHZUDSDURXQGSUHVFULSWLRQ S SXULW\ S \ WKURXJKRXW J DFFRUGLQJ J WR WKH FRPSDQ\ S \ OHQV KDV EHHQ FUHDWHG ZKLFK RIIHUV RSWLFDO :UDSDURXQGOHQVHVUHTXLUHVSHFLDOLVWPDQXIDFWXULQJWRLQFRUSRUDWHDKLJKEDVHFXUYHLQWR D SUHVFULSWLRQ OHQV &RQYHQWLRQDO OHQVHV ZLWKLQ ZUDSDURXQG IUDPHV FDQ FDXVH SUREOHPV VXFK DV SRZHU GHYLDWLRQ RSWLFDO DEHUUDWLRQV LQGXFHG GHFHQWUDWLRQ DQG SULVPDWLF HIIHFWV RQPRYHPHQWDZD\IURPWKHRSWLFDOFHQWUH7KH.2'$.'LJLWDO6RODU7HF/HQVKDVEHHQ VSHFLÀFDOO\ GHVLJQHG WR RIIHU DFFXUDWH YLVXDO DFXLW\ SDQRUDPLF ÀHOG RI YLVLRQ  89 SURWHFWLRQ DQG VLPSOH GLVSHQVLQJ ,GHDO IRU VSRUW DQG VXQJODVV IUDPHV .2'$. 'LJLWDO 6RODU7HF/HQVHVDUHDYDLODEOHLQVLQJOHYLVLRQDQGSURJUHVVLYHOHQVRSWLRQVDQGDUHLQFOXVLYH RIKDUGFRDWWLQWDQG89SURWHFWLRQ:LWKDZLGHUDQJHFKRLFHRIPDWHULDOVIURP WRLQFOXGLQJ3RODULVHG'ULYHZHDUDQG7UDQVLWLRQV;75$FWLYHOHQVHVWKLVQHZDQG EDVHGLJLWDOIUHHIRUPZUDSDURXQGOHQVLVDOVREDFNHGE\DGD\SURJUHVVLYHQRQWROHUDQFH JXDUDQWHHSURYLGLQJ\RXDQG\RXUSDWLHQWVZLWKSHDFHRIPLQG

ZZZNRGDNOHQVFRP

5.

,,-"/3&0&,+

&RRSHU9LVLRQDOHDGLQJJOREDOFRQWDFWOHQVPDQXIDFWXUHUZDVUHFRJQLVHGE\5(%5$1'·V (LJKWK$QQXDO*OREDO$ZDUGVZLWKD´%HVWRIµDZDUGIRUH[FHOOHQFHLQEUDQGUHSRVLWLRQLQJ *OREDO VWUDWHJLF EUDQGLQJ ÀUP 6LHJHO*DOH FROODERUDWHG ZLWK WKH FRPSDQ\ RQ LWV QHZ EUDQG VWUDWHJ\ DQG YLVXDO LGHQWLW\7KH 5(%5$1'  LV WKH ÀUVW DQG KLJKHVW ZRUOGZLGH UHFRJQLWLRQ RI LWV NLQG &RRSHU9LVLRQ·V UHYLWDOLVHG EUDQG FOHDUO\ GHÀQHV ZKDW PDNHV WKH FRPSDQ\XQLTXHDQGYDOXDEOH7KHEUDQGSODWIRUPIHDWXUHVDVWULNLQJYLVXDOLGHQWLW\EDVHG RQ ZDWHUFRORXUV SURYLGLQJ DQ XQH[SHFWHG GHSDUWXUH IURP WKH LQGXVWU\·V VWDQGDUG EUDQG FRQFHSW7KHQHZGHVLJQDIUHVKDQGRULJLQDOWDNHRQWKHFRQFHSWRIPRLVWXUHDQGFRORXU FHOHEUDWHVWKHUHIUHVKLQJSHUVSHFWLYHFRQWDFWOHQVZHDUHUVHQMR\ZLWK&RRSHU9LVLRQOHQVHV ´2XUQHZEUDQGUHÁHFWVWKHJHQXLQHFRQQHFWLRQWKDW&RRSHU9LVLRQPDNHVZLWKFXVWRPHUV DQGZHDUHUVDQGRXUFUHDWLYHDSSURDFKWRVROYLQJYLVLRQFRUUHFWLRQQHHGVµUHPDUNHG5RE +HDOH\8.0DUNHWLQJ0DQDJHUDW&RRSHU9LVLRQ´:HDUHSURXGWREHUHFRJQLVHGZLWKWKLV SUHVWLJLRXVDZDUGIURP5(%5$1'0RUHLPSRUWDQWO\ZH·UHHQHUJLVHGE\WKHUHVXOWVRI WKHUHEUDQGLQJZKLFKRXUHPSOR\HHVWKURXJKRXWWKHZRUOGKDYHHDJHUO\HPEUDFHGDQGRXU FXVWRPHUVKDYHUHFRJQLVHGDVDUHIUHVKLQJO\GLIIHUHQWDSSURDFKWRWKHH\HFDUHPDUNHWµ

ZZZFRRSHUYLVLRQFRP

6.

/)7"&003&0&,+02+)"+0"07AEOO>U0EIKJ DEI

&DUO=HLVV9LVLRQ6XQOHQVWKHGLYLVLRQGHGLFDWHGWRWKHGHYHORSPHQWDQGSURGXFWLRQRIQRQ SUHVFULSWLRQVXQOHQVHV²WRJHWKHUZLWK+RQJ.RQJGHVLJQHU6LPRQ&KLPZDVVHOHFWHGE\ JUDQGHVLJQ(WLFR,QWHUQDWLRQDO$ZDUGLQLWVWK\HDURIDFWLYLW\7KLVGHVLJQSUL]HDZDUGVFRP SDQLHVZLWKHWKLFVWDQGDUGVUHVHDUFKLQJQHZVROXWLRQV&DUO=HLVV9LVLRQ6XQOHQV·VSURMHFW VHOHFWHGIRUWKHQRPLQDWLRQLVWKHVXQJODVV=(,66E\6LPRQ&KLPDOLPLWHGFROOHFWLRQWR FHOHEUDWH\HDUVRISUHFLVLRQOHQVHVE\&DUO=HLVV7KHSURGXFWFUHDWHGZLWKWKH5HF\FOH 3DSHU)UDPHVWHFKQLTXHLVDQRULJLQDOFROODERUDWLRQEHWZHHQFXOWXUHV &KLQD,WDO\DQG *HUPDQ\ FRPELQLQJ=(,66WUDGLWLRQVIRURSWLFVZLWKFUDIWVPDQVKLS 7KHDZDUGFHUHPRQ\ZLOOWDNHSODFHRQ1RYHPEHUQGLQ0LODQ,WDO\

ZZZVXQOHQV]HLVVFRP

7. /")$)00

5HDO*ODVVTXDOLW\EUDQGFUHDWHGWRSURPRWHWKHXVHRIPLQHUDOJODVVIRUSUHVFULSWLRQJODV VHVDQGVXQJODVVHVEULQJVWRJHWKHUOHDGLQJFRPSDQLHVWKDWRSHUDWHLQWKHOHQVJODVVVXSSO\ FKDLQ %DUEHULQL 6SD %DUEHULQL *PE+ &RUQLQJ (VVLORU /7/ 3ROR 5RGHQVWRFN DQG =HLVV 7RGD\WZRQHZPDMRUIRUFHVKDYHMRLQHGWKH5HDO*ODVVOLVWRIQDPHV/HPDDQG6KDPLU 2SWLFDO,QGXVWU\/WG/HPDIRXQGHGLQ3DUPDLQLVDOHDGLQJPDQXIDFWXUHURIRYHQVIRU FKHPLFDOWHPSHULQJERWKIRURSWLFDOOHQVODERUDWRULHVDVZHOODVIRUVXQJODVVHVSURGXFHUV &KHPLFDOWHPSHULQJLVDQLQGLVSHQVDEOHWUHDWPHQWIRUPDNLQJWKHJODVVOHQVVDIHE\LPSURYLQJ LWVUHVLVWDQFH6KDPLU2SWLFDO,QGXVWU\/WGLVRQHRIWKHZRUOG·VWRSPDQXIDFWXUHUVRIKLJK TXDOLW\SURJUHVVLYHDQGVLQJOHYLVLRQOHQVHVDQGPRXOGV)RXQGHGLQ6KDPLUKDVRYHU WKHFRXUVHRIIRXUGHFDGHVPDGHDQDPHIRULWVHOIZRUOGZLGHIRULQQRYDWLRQFXWWLQJHGJH WHFKQRORJ\ DQG VWULQJHQW TXDOLW\ DVVXUDQFH SUDFWLFHV  FRPSDQLHV KDYH QRZ HPEUDFHG WKH5HDO*ODVVSURMHFWSKLORVRSK\DQGDUHDOOFRPPLWWHGWRDURXVLQJLQWHUHVWDQGSURPRWLQJ DZDUHQHVVRIWKHEHQHÀWVDQGTXDOLWLHVRIPLQHUDOJODVV7KHXVHRIPLQHUDOJODVVWKDQNV DERYHDOOWRUHFHQWWHFKQLFDOLQQRYDWLRQVLVPRUHDQGPRUHLQGHPDQGDPRQJRSHUDWRUVDQG FRQVXPHUVZKRVHHNDKLJKTXDOLW\DQGSUHVWLJLRXVSURGXFWFDSDEOHRIJLYLQJDGGHGYDOXHWR VXQJODVVHVDQGSUHVFULSWLRQJODVVHV

ZZZUHDOJODVVRUJ

May/June • 2012

' W T Q R G C P  . G P U G U  C P F  6 G E J P Q N Q I [




deutsch wurden neue Stilrichtungen sowie das Modell Wolfgang, Prince oder Theo vorgestellt. Diese Modelle präsentierten sich als dezent aber elegant in Farben wie blaugrau, rauchfarben oder mit doppelten Frontfarben sowie schwarz mit durchscheinendem braun.

Sonderteil – Deutschland Trends Einleitung Designerfinder aus Deutschland und Österreich Was Brillen angeht, tun die Deutschen das, was sie am besten können – einwandfreie und gewissenhafte Designs mit einer bemerkenswerten Qualität und Anfertigung. Man addiere Fashion mit einer Portion Style und man erhält eine Idee davon, wie es deutsche Designer geschafft haben sich auf der ganzen Welt einen Namen zu machen. Für einen Überblick im Bereich Brillenmode 2012 hat 20/20 EUROPE einen Blick auf die Kollektionen von Brillengestelle aus Deutschland und Österreich geworfen. Die Brillentrends aus diesem Jahr sind sehr beeindruckend und was deutsche Designer anbelangt gilt dies sowohl für optische Brillen als auch für Sonnenbrillen. Von aufregenden und ungewöhnlichen Formen hin zu trendigen Farben und experimentierfreundlichen Details. Die Brillendesigner präsentierten eine Vielzahl an stark akzentuierten Teilen und alltagstauglichen Styles die sich an jeden Lebensstil und jede Altersgruppe anpassen. Farben für Jedermann Die Farbentrends im Jahre 2012 waren sehr vielseitig und deutsche Designer boten in ihren Farbpaletten beides an, abenteuerliche aber auch klassische Farben. Reiz stellten dramatische Farbeffekte bei ihren Sonnenbrillen vor, diese waren gekennzeichnet durch Farbabstufungen von hellgelb bis cappuccino oder hellorange bis graubraun. Die Farben des ausgelassenen PM Frost Labels sind abwechslungsreich und ideenreich mit kräftigen Tönen wodurch hauptsachlich die Hot Glasses Reihe gekennzeichnet ist. Ihre Frost F-Type Kollektion hingegen, kombiniert technische Neuheiten mit hellen Farben für einen modernen Look. Ebenfalls, bietet das PM Frost Label seinen Kunden mindesten acht Standardfarben und mehrere Oberflächen Designs an, so dass, die Klienten ihr Frost F-Type in ihrer gewünschten Farbe aussuchen können. Weitere aufregende Farbinterpretationen wurden auf der MIDO gesehen. In der Mykita/Bernard Willhelm Kollektion findet man verspiegelte Brillengläser die mit hellen Farbtönen kombiniert sind und bei der Freudenhaus Kollektion 46 20/20 Europe

wohingegen es für Frauen eine große Auswahl an umgewandelten Klassikern gibt sowie die Katzenaugen- oder Schmetterlingsbrille, oder auch das Wayfarer Modell sowie die leicht männliche Pilotenbrille. Zur Zeit sind sowohl Übergrößen als auch kleinere Brillen top aktuell! Vielfalt ist immer ein wichtiges Thema.

Raffinierte Formen Ic! Berlin, der Fachmann für trendige schraubenlose Metallblechbrillen, führte auf der MIDO eine beeindruckende und umfangreiche Auswahl an neuen Stilen vor. Diese Auswahl an neuen Modellen beinhaltet auch eine sehr feminine Tres Chic Kollektion die sinnliche und provokante Formen aufweist, von kurvigen Rundung hin bis zu sehr trendigen abgewandelten Katzenaugen und dezenten Schmetterlingen. Im Gegensatz dazu, präsentierte Flair eine Auswahl an luxuriösen randlosen Brillengestellen, die interessante Brillengläser vorweisen, sowie Kombinationen aus verziert geformten Metallgestellen mit einem ausgearbeiteten 3-d Brillenbügel. Hier erkennt man das handwerkliche Geschick und die Zuwendung zum Detail dieses deutschen Labels, dass schon seit einigen Jahren besteht. Naturgetreu Hörner und Hölzer sind sehr geschätzte Materialien in Deutschland, Österreich und in der Schweiz. Österreichs junge und schnellwachsende Rolf Spectacles sind sogar einen Schritt weiter gegangen, was natürliche Materialien angeht, und haben Brillen aus Holz mit einer Steinoberflache, dass dem Brillengestell einen lebhaften aber doch matten Abschluss geben soll, entwickelt. Rolf’s Skylark 41, das erste handgemachte Modell aus der Woodstone Kollektion, gewann den Red Dot Design Preis 2012. Der Oldtimer, Buick Skylark Convertible, gab die Inspiration für das Brillengestell. Genau wie die ROLF Woodstone Brillen, erwähnt das Unternehmen, war auch der Buick Skylark Convertible in vielerlei Hinsicht ein von Hand gemachtes Auto. Interesse an Titan Metallrahmen, von Edelstahl bis hin zu den luxuriösen Titandesigns und BetaTitandesigns, sind in den letzten Monaten wieder sehr populär geworden sowohl für Sonnenbrillen als auch für optische Brillen. Auf der MIDO konnte man unter den deutschen Kollektionen eine Fülle an Ideen für Metall entdecken. Einer von den Fachleuten für Titan und innovative Designs ist Markus T., der die Kollektion Titan T2 für 2012 vorstellte. Eine Kollektion, die Reinheit und optische Stärke in sich trägt. Titan T2’s klares Design kombiniert mit einer durchdachten Struktur lässt Brillen entstehen die gewagt aber äußerst bequem sind. NEUE TRENDS Farben: helle- und Pastelltöne, hochwertige Metallfarben oder Klassiker sowie Stahl oder Edelstahl Materialien: Edelmetalle sind im Moment sehr modern, Acetat (das Material gibt einen Retrolook) hat jedoch durch andere Materialien Konkurrenz bekommen – allerdings schätzen führende deutsche Designer beide Stilrichtungen sehr Formen: für Männer gibt es eine Menge an minimalistischen und coolen Formen

Deutscher Sonderteil Deutschlands Neue Generation Innovation ist das Schlüsselkonzept für den Erfolg der neuen Generation deutscher Optiker. 20/20 Europe sprach mit zwei deutschen Unternehmern der Optikbranche, die Aufschluss über die neue Brillenmode geben, die über die Massen hinausgeht. „Ich bin sehr erfreut über den Fortschritt freier Einzelhändler die ausgewählte unabhängige Labels in Deutschland verkaufen“, erklärt Akram Husseini, Besitzer von Klar, Optikerladen in Darmstadt. „Immer mehr Einzelhändler erkennen, dass es einen Markt gibt in dem individuelle Kunden individuelle Brillenmode sehr begrüßen. Dieser Markt gibt den freien Händlern die Möglichkeit erfolgreich in diesem Business zu werden, der nun auch sehr konkurrenzfähig geworden ist.“ Klar unterscheidet sich von den anderen durch seine Philosophie, sein Image und seine Aufmachung. Gelegen in einer Stadt mit 150, 000 Einwohnern, die als die sonnigste Stadt Hessens bezeichnet wird, ist Klar ein Beweis dafür, dass es einen steigenden Trend in Richtung schöngestalteter und stylischer Optikerläden gibt, die zudem auch ausgewählte Designerware aus aller Welt anbieten. „Meine Kunden, die Luxusartikel möchten, sind sehr daran interessiert wie Brillengestelle produziert werden, wo sie produziert werden und wer hinter dem Design steht. Meine Klienten schätzen qualifizierte Arbeit und gut verarbeitete Produkte die eine Gesichte und Herkunft haben. Ebenfalls sind meine Kunden sowohl an der Kreativität des Designs als auch an der Tragfähigkeit des Brillengestells interessiert. Da wir unsere Produkte sehr gut kennen können wir unseren Kunden die ganze Produktionsdurchführung eines Brillengestells beschreiben und somit zei-

gen wir Ihnen unsere Leidenschaft und Engagement für unseren Beruf. Außerdem konzentrieren wir uns immer darauf jedem Kunden eine perfekte und individuelle Beratung bieten zu können.“ Das Klar Team ist auch sehr darauf erpicht seinen Kunden das perfekte Augenpflegeerlebnis auch technisch zu bieten wenn es darum geht ihnen die verschiedenen Schritte bis zum fertigen Brillengestell und seinen Linsen zu erklären. „In meinem Laden haben die Kunden die Möglichkeit dabei zuzuschauen wie ich die Linsen und das Gestell zusammensetze, da sich meine Werkstatt auf derselben Ebene befindet wie der Laden, so dass sie für jeden offen steht.“ Uta Geyer, Inhaberin von Lunettes Selection und Designerin bei Lunettes Kollektion, einem spezialisierten Brillenlabel aus Berlin kann nur zustimmen wenn es darum geht, dass es das Hauptziel sei maßgeschneiderte Designs zu entwickeln um den Bedürfnissen der Kunden vollstens nachzugehen. „Meiner Meinung nach hat sich der deutsche Markt verändert. Wir sehen eine Distanzierung vom Mainstream hin zu einer jungen und innovativen Generation, den sogenannten Boutique Optiker, die mit Leidenschaft und Geschmack individuelle Gestelle anbieten möchten die es nicht so einfach überall zu finden gibt.“ Ansässig in Berlin, legt Lunettes Selection den Focus auf den modischen und stilistischen Aspekt der Brillengestelle. Die Lunettes Stores führen eine große Auswahl an Modelabels von Geyers eigener Lunettes Kollektion hin bis zu kleineren aktuellen Marken. Ebenfalls findet man in den Lunettes Stores auch außergewöhnliche vintage Stücke, die über viele Jahre hinweg gesammelt wurden. „Meine Mission ist es den Menschen zu helfen, die nach etwas suchen, was sie in einem „Mainstream“ Optikerladen nicht finden können“, erklärt Geyer. „Wir sind dazu da um die Bedürfnisse derer zu erfüllen, die nach etwas individuellem und einzigartigem suchen und nicht nach einer teuren Markenbrille. Ich öffnete meinen ersten Laden weil ich keine passende Brille für mich finden konnte. Um Kleidung zu kaufen ging ich immer in Gebrauchtwarenläden, erstklassigen Secondhandläden oder in privaten Labelboutiquen, aber als es darum ging eine Brille zu kaufen, hatte ich immer Probleme einen passenden Optiker zu finden. Dies legte somit die Grundidee für die Gründung der Lunettes Stores.“ Genau wie Klar, sind die Lunettes Selection Stores raffiniert stylisch eingerichtet und präsentieren somit einen Kontrast zum klassischen Optiker. „In unseren Läden geht es um Fashion und darum das perfekte Model für unsere Kunden zu finden. Wir bieten ein vollkommen andersartiges Shoppingerlebnis das funktioniert. Die Tatsache, dass ich auch meine eigene Kollektion anbiete hilft sehr, da ich auf die Impulse meiner Kunden reagieren kann und ihnen somit das anbieten kann was sie wünschen. Dabei versuche ich immer dem Geschmack von Massenprodukten zu umgehen.“ KLAR, www.klar-augenoptik.de LUNETTES SELECTION, www.lunettes-selection.de (KLAR Fotos: Florian Schüppel) M AY / J U N E 2 01 2


20/2 20 20

  

  





'WTQRGCP%QTTGURQPFGPEG1HHKEG ()'UTNĹ&#x152;(CDKCPQ)TWRRQ'FKVQTKCNG4GI5CP)KQXCPPK%CPGNNK #6 +VCN[ 6GN  (CZ  GOCKNGWTQRG"HIGFKVQTGKV 'FKVQTKCNFKTGEVKQPD[$Q[F0QTVQP#UUQEKCVGU 'FKVQT%NQFCIJ0QTVQP6GN  Q GOCKNEPQTVQP"HIGFKVQTGKV 2WDNKUJKPIFKTGEVQT&KTGVVQTGTGURQPUCDKNG (GTFKPCPFQ(CDKCPQ 'FKVQTKCNEQTTGURQPFGPVU 2CWN$CTHQQV,QCP)TCF[-GTUVKP8QUUJCPU.QTPC*CNN6COUKP-KPIUYGNN &GUKIPRTQFWEVKQPD[()'UTN(CDKCPQ)TWRRQ'FKVQTKCNG 1RGTCVKQPU/CPCIGT0KEQNG6QIPK 2TQFWEVKQP/CPCIGT2KGTRCQNC'TCNFK +OCIGEQPUWNVKPIHQTHCUJKQPUJQQVU)KWNKCPC$GPCVVK6CTIKQPK 6TCPUNCVKQPUD[ /CT[4WDKEM 'PINKUJ 2WDNKUJGT4GFC\KQPG ()'UTNĹ&#x152;(CDKCPQ)TWRRQ'FKVQTKCNG4GI5CP)KQXCPPK%CPGNNK #V +VCN[ (QTUWDUETKRVKQPEKTEWNCVKQPGPSWKTKGUEQPVCEVVJG%KTEWNCVKQP&GRCTVOGPV 6GN  (CZ  GOCKNGWTQRG"HIGFKVQTGKV +PVGTPCVKQPCNUCNGU (TCPEG+VCN[7PKVGF-KPIFQO5RCKP#WUVTKC)GTOCP[&GPOCTM$GPGNWZ 5YKV\GTNCPF5ECPFKPCXKC.KGEJVGPUVGKP%\GEJ4GRWDNKE2QNCPFCPF'CUV'WTQRG 5CNGU&KTGEVQT/CVKNFG5QOGVVK6GN  (CZ   OCVKNFG"UVWFKQ\CPCUKKV 5CNGU&KTGEVQT75#Ĺ&#x152;&GPPKU/WTRJ[6GN  (CZ  &/WTRJ["LQDUQPEQO 5CNGU&KTGEVQT+UTCGNĹ&#x152;#UC6CNDCT6GN  (CZ  VCNDCT"VCNDCTEQKN 5CNGU&KTGEVQT#UKC GZEN,CRCP-QTGC Ĺ&#x152;/CT[0I6GN  (CZ   HWVWTCOMVI"PGVXKICVQTEQO 5CNGU&KTGEVQT-QTGCĹ&#x152;;QWPI5GQJ%JKPP6GN  (CZ  LGUOGFKC"WPKVGNEQMT 5CNGU&KTGEVQT,CRCP5JQ*CTKJCTC6GN  (CZ  UJQ"[WMCTKOGFKCEQO

1.$ )1 . $+       *(XURSH +  '+  '  -&+'(# 1.$ )1 . $+         (XURSH#

6XEFULSWLRQV

      H '+ $  +HG    #%' ?  % +  *+!##   +@ *  +  +1   2 '    +' &  '   :+#++     B

$    +   # %' '   '    +#    :  B   *+ *       -   $   +  # Print and reproduction: FGE srl - Fabiano Gruppo Editoriale - Canelli (AT), Italy No part of this publication may be reproduced, stored in a retrieval system, or transmitted in any form, without the prior permission of the Publisher. Aucune partie de cette publication ne peut ĂŞtre reproduite, enregistrĂŠe par un dipositif de restitution de l'information, ou transmise sous une forme quelconque sans lâ&#x20AC;&#x2122;autorisation prĂŠalable de l'editeur. Die Vervielfältigung, Speicherung in einem Informationswidergewinnungssystem oder die Vermittlung jeglicher Teile dieser VerĂśffentlichung in welcher Form auch immer ist ohne die Genehmigung des Herausgebers untersagt. Ă&#x2C6; vietata la riproduzione, memorizzazione in un sistema che ne permetta il recupero o qualsiasi forma di trasmissione parziale o totale di questa pubblicazione senza la precedente autorizzazione dellâ&#x20AC;&#x2122;editore. Queda prohibida la reproducciĂłn total o parcial de la presente publicaciĂłn, asĂ­ como su almacenamiento en un sistema de consulta de datos y su transmisiĂłn en cualquier forma que sea, sin previa autorizacĂ­on del editor.

48 20/20 Europe

M AY / J U N E 2 01 2


+:  2    & +# & '('+' '  -   %   $ +  ' = # + <*+ # @DM5FE6JIJ56  ' #'    :+ ++ &  '   +

@:    $!"%$#

:  +-$!"%$ : + '   +@ '$  '   - ' ++    D + '  E#$   *     +   +#0 :  ( +    

  -  %       +  +   '           +'*  +    '     *'* *  +  #

   ++2  +   

!

A

1  +

1

5GJ

: 

/

5I

 * . 5J

  



65

1 

1

55

  



5I

 * 

.

AG

? *

'

?

5

.'



6F

@' *



5G

 :( 

L

6

? * 

?!

5GF

. 

."

5

 



5G

 : 

 

5JA

+

 G6

3*L*

3L

JG

&K +

K

A

  M + $

56

  

7

5GI

3 *

3

5A

&



6I

&+



6A

& > +

3

6

 

3"

5JG

  +



5G6

% +

% 

6J

2 +

 

5

> "  

K

6

 +

" 

5G5

% * 

%

5G

2 (

2"

F

'(

L

6G

 



5F

"' 

"

6

!( 

!

5J

$ 

$2

5I

%

J

"  1+ 

"!

I

! +L *+'

!L

66

 

$GYHUWLVHUOLVWLQJV ?+

5

 N? 

1+ ?  

5

:(

.

5

 +

3 

55

M AY / J U N E 2 01 2

5-55 55 :6

+ %   (  ' /  $@ 0

5 F : - 6I 5A

international eye fashion 49


'LUHFWRU\OLVWLQJV

$5($65/

2 5#GGF#I#GA

1@5G5#A5#G#

,WDO\

1@5#G##J6

1$ *

2 M5F65A6A6

(/&(

&+$ 



2 6I5IAIF

1@M5F65A6A6G

)UDQFH

2 6JI6II

1@6I5#I#A#

FJ<FJ# 

2 #M555J6665

1@6JI6IFI

&&&# #

&&&#FJ# 

1@M555J666II

&&&# )  '# 

1/ $ + +

 +< # '

'$ .'

2 55AGJGJ

&&&# # '

2 6FJG6IJ

1@55AGJGJG

1@6FJG6IF

&&&# #

&&&# #+

3$ % *

'.$ '(

2 5GFIFJF

2 6GIJ666

1@5GFAAF

1@6GIJ66G

:  '< # 

(32665/

&&&# #+(

6$ 

,WDO\

( $ $ 

2 6AJAA

%5$1'62,

2 M5FJFGFI6

2 56F5565

1@6AJIAFGF

,WDO\

1@M5FJFJJ

1@56F5GJGJA

&&&# #

2 M5F65J655FF

< ' # '

&&&# #

8.$  +

1@M5F65J6FG

&&&# ' # '

)$ 1 

2 666G6656G6

<+) # 

2 55J

1@666G665666

&&&#+) # 

1@55IIIAJG

&&&# # # (

 = <$ #1 &&&# # ),1$  2 5GJF56JJ 1@5GJF56JJ65 (66,/25,17(51$7,21$/

&&&# #

)/$,5

,QVWUXPHQWV'HSDUWPHQW

,$   

*HUPDQ\

&$5/=(,669,6,21681/(16

&&&#*  *):  # '

2 5FG5GIF

2 M6FGJ6

,WDO\

$$   .'

1@5FG5GIFA

1@M6FGJ6J

2 5F55JG5

2 65##5AAJ#G

&&&# # 

  <  #+

1@5F55JGJFG

1@65##5AAJ#FG

,5/$  + +

&&&#  #+

&&&#  #> # '

%$ ? *

'###/#

2 5G5#A#JG#G5

50 20/20 Europe

M AY / J U N E 2 01 2


)5('(5,&%($862/(,/

$!2") ,-1&(016)""2

2 M5GJ5IG

)5$1&(

2 M65AIA5FFGI

1@M5GJ5IGA

2 556IIJF

' #* :<  ( #

'O#'< '#

1@556IIIIA

%51?3"

*5."$$$)%22$##

 <   #

72$$%2

2 M55JFJJ

&&&#   #

2 MFI5IG55FI

1@M555IA5

1@MFI5I6A6

'#:    <   #*

'< # '#

+3!."7)%2"L

*g77, 6:,7=(5/$1'*0%+

%51 ?$ .!

2 M5A56FAAJ

6:,7=(5/$1'

),,-"6"4"/

<   # '

2 666IJA6I

2 M5)6J6JG

+.-"

1@666IJA6

1@M56JJFJ

%2L3

 <* # 

O <> #

2 MFAAGJGG

&&&#* # 

&< 6-/20

1@MFAAGJ66

 $C# 2

 (<  (' # '

2 M5GIG5AII

+.-"

1@M5GIG5GIAGI

."?%2 "

   <# '

2 MFAAGJAA6G

(7$.7%2

1@MFAAGJAA6J

+(15<-8//,(1

."?%2 #

''+#<'* # '

)UDQFH

2 M)IIGI

.:7L!02

2 555J65GJJJ

1@MIIGIFG

3%2#

1@555J665GJJG

,1277,&$

''+#<'* # '

2 MFAGJAJ

   , B 

$/  ?$!"%2L

(7$.7%2)?"L%2

1@MFAG6JG

2 M5GGAFJG5

2 M66FJI

&> <# '

   (> <# '

' # +<(  #

/9 2/

,&%(5/,1%5,//(1*0%+

$/ ?$.%2L

(67$2

$2"$1%2$2"7

*HUPDQ\

'*  ( < # 

"L$%2L!

2 M5IAI5JA5A

2 M6F56III)IA

'= .$"

2 M5II55IAG

1@M5IAI5I55

1@M5II55IAA

(<  (# :

1@M6F56III)

!$22$"$ .!$$!"

' < ) #+

2 M5A566A

'(  (<'(  (#

5/ $?

&&&# ) #+

1@M5A5565J

),11 

."?%2

+  <  ) * #

?? ?1 7

2 MFAFFFG

M AY / J U N E 2 01 2

i n t e r n a t i o n a l e y e f a s h i o n 51


1@MFAFFFG

1@M6JA5

2 M66GF6GF

 >< ' +  # '

''+#<'* # '

& # ( < ' # '#

' #'< #(

*%!L

5/ $?

3%"2!.

=$!231"

".07%2 !%% $ 2

23"$7$

2"%2

$$13%27 2

2 M66FGAIJJ

2 MFA6FFJ

2 M5GJ6AA

2 MIJAAF5I

+: +< +*&# '

1@MFA6FFJ

1@M5GJ6AI

' <O # #>

$'17$$

 +<## 

+    < # 

(%

."?7$$

/$5 ?7

3%"2!. )?$ "$ +

7C.32%"2# #

2 MFAII55I5G

 3$3?23"!L$2

2 M6655IIA

2 M56FI55FAG

''+#<'* # '

2 MJ6IIG6G

1@M6655F5

1@M56FI556F5

65%$"?)."%2

MJ6IIG6G

 <*' # '

<++ *# 

2 M5J5G5JJ

PP  <# '

586"!

6<57"

1@M5J5G5JJ

0 2

. $"$73L/ +

$"2".#

( <   + :  #

 '  ' +

2 MI6FGA6I5A

 <''# '

2 M5GA6JF)5

1@MI6FGG56F

712!

1@M5GA6JFA

* P (:<' #

%2 //$2$2

 # <    # '

.6$!"?

2 MAII55AF

0' /)%2)

."?%2 # 2

1@MAII556F

2 M5I5GAJFJ

2 MFAAAGAGG

/< #

1@M5I5JF6F

1@MFAAAGJI

712!

> < ' #'+

& +#' +<'* # '

? !$%2 2"?!2

0$"

.6$!"?

2 MAI66JG

 $2"?!2

2!22".$2#

1@MAAIAG5

2 M6IAG

2 MFAAIJF

< )   # '

MFII6

1@MFAA6A6I

752!"L$7

(#' <  #'

   <  * # '

%2%2L#/$2# 2#2

1"07)"$?"

.6$!"?

2 MFG6G

2 M6II5

 ) %2 2".$2#

1@MFG5J6

1@M6II5I

2 MFAAAJJ

 '< '+# '#

 < #

1@MFAAFI5

8$(%###%2$!"$ 

,163(&6/WG

3/% 

 '< O'    # '#

2"!$2

2 M66DEGII

%2%#3#!###

6. /L

2 MFI6AIFI5J

 <   # '

2 M6JJAGAG

% ###

MFI6AIJ5F

&&&#   # '

52 20/20 Europe

M AY / J U N E 2 01 2


,17(5&$67(8523(6S$ ,WDO\ 2 5FGAIGGG 1@5FGAIFA

<@):  # ' &&&#@):  # '

/81($87(&+12/2*<23(5$7,216

1@5GJGAF

)UDQFH

<' # '

2 M555FJF5

&&&#' # '

1@M555GF6  <   # ' &&&#:   @# ' &&&# # ' &&&#& )  '+# ' 0$==8&&+(//,63$ ,WDO\ 2 M5F55JA 1@M5F55JA5

,17(51$7,21$/9,6,21(;3286$

<'>>  J6F# 

&&&#:  @ &# '

&&&#'>>  J6F# 

,9.2*0%. 0,'26UO8QLSHUVRQDOH

*HUPDQ\

,WDO\

2 M6FAGAFGA 1@M6FAGAFGAFF

< :(#+ &&&# :(#+

2 5F5AI5AI5

021'277,&$

1@5F5655

8QLWHG.LQJGRP

&&&#' +# 

2 =66GFAIIF 1@=66GFAIIIF

&&&#  )&# '

 <'+ # '

&&&#' )&# '

&&&#'+ # '

/*565/ ,WDO\ 2 M5FA6565JIF 1@M5FAJ5AGGG5

 < *) * # ' &&&# *) * # '

M AY / J U N E 2 01 2

0$5&+21(8523(

02'2(<(:($5

1/+ + +?/

,WDO\

2 =5I6FI66F

2 M5F65FFJFJA

1@=5IGGA

1@M5F65FJ5FJ

)5+ 1 

$  <'+# '

2 =556GA6F6

&&&#'+# '

1@=556GA55G

7KH1HWKHUODQGV 2 5GJGG

international eye fashion 53


2*,(<(:($5

1@56F56J5

2 G6)GAI)GIF

8.-$ 

@ <*   '# '

1@G6)III)AGGG

:     2

&&&#*   '# '

$   

2 666GGJAJA

    B 

2 65AFFI5

1@666GGJ6

1@65AFFI5FA

&&&#: # # (

86$ 2 IA5GF6F5

&=6.$/  

1@IA5G5I5F55

2 66I55

<* '# '

1@66I5FF

&&&#* '# '

&&&#+#(

32/$5,6(<(:($5

'.'  >

6ZHGHQ

3$19(1,&(65/

2 6F6A5A5AJ

2 M6AFIGGA

,WDO\

1@6F6A5A5AGGI

1@M6AFI56

2 M5F6G6GF

&&&#  >)  (#+

<   &#

1@M5F6G6FF

(J\SW6XGDQ/LE\D

&&&#   &# '

&&&# ( +# '

$ )   

< : # '

2 56I6

,WDO\ 2 5F6JIGAF *HUPDQ\ 2 6F#J6#FFI#6 1@=6F#J6#FFI#66 ,VUDHO 2 FI#5#FA#FFI 1@=FI#5#FA#FFA

1@56I5

1HZ=HDODQG

,:

321&(76$5/

2 5FFI6

)UDQFH

3,1237,.65/

1@5FFI65

2 M556I6IIJFJ

,WDO\

&&&#:  # '

1@M56I6IIGJII

2 M5F65FIJJ55

3// &

< )  # 

1@M5F65FIJIGG

2 6JIIJIIG6G

&&&#  Q#

<'> &# 

1@6JIIJIIG6

&&&#'> &# 

3- ' 

2 A6#F#G5#F 1@=A6#F#G5#F5A 6ZLW]HUODQG 2 6I5GGF 1@6I5JI6 7KH1HWKHUODQGV 2 56F55FFFA6 1@56F556GJ

2 5GFJIG 1@5GFJIGF &&&#' # # (-+

237,06$ 6SDLQ

   2  *

33*2SWLFDO0DWHULDOV

2 56FJAFI5

86$

3,;(/237,&6,1&#

1@56FII66

2 I65GGFG

8QLWHG6WDWHV

&&&#     *#

&&&# 5F # '

2 56F56JF5F5

54 20/20 Europe

M AY / J U N E 2 01 2


&&&# * :@# '

$ "+ (R 

,"+ (  

1@5F6JI6G

$   

2 65GFF

2 5F56

&&&# # '

 1Q+  1

1@65GFFG

1@5F56

 < # '

2 556AFJJ5J

% "+ (? @#/#

1 "+ (*

1@556AFJJA5

2 55JJGG

2 6I5II

  < *# '

1@55JJGGA

1@6I5III

%8/  ''  +

1/ "+ (+ +

2 5GFFJAF5

2 5GG6666

6$),/2

1@5GFFJAF5

1@5GG6I56

,WDO\

&+"+ ( & >.

3  '   +

2 5F6FAFJG

2 6J5666

2 5G665AG6

1@M5F6FAFJG5A

1@6J56I6

1@5G66JI

&&&#* # '

&= "+ ("###

3%   ##

2 6JA56AG

2 5G6III

1@6JA56A

1@5G6F6G5

'"+ (.'3

3/ "+ (% ( #>###

2 6FJFI

2 6J5A6

6,/023DULV

35$0$25

1@6FJFIAF

1@6J5AJ5GJ

)UDQFH

,WDO\

'."+ ('(

6 "+ (: *?

2 M55656AIA

2 M5F65IAAG5

2 6GJAA55

2 6AJJJ

1@M55656AIA

1@M5F65II55G

1@6GJAA5JJ

1@6AJGGFA5

 '< '#

''  < '# '

( +  +  %

8."+ (D!LE +

&&&# '  # '

&&&# '# '

2 56F5A6IJ

2 666I65GGGG

1@56F5A6A6FG

1@666I6G5G6F

)"+ (1 ##"# #



2 555666 

1@55565J6

=,//,(\HZHDU

),11  ((7

)UDQFH

2 5GJ66JGIGIJ

2 M556IF6

52'(1672&.

1@5GJFIA5A5

1@M556IFFFF

*HUPDQ\

*5!  

6$),/(1665/

&<> #

2 6FJFII6G

2 55IFIIJA

,WDO\

&&&#> #

1@6FJFII6F

1@55IFIJG

2 5F6JI5FF

M AY / J U N E 2 01 2

international eye fashion 55


20/20

europe

EUROPEAN LENSES +

TECHNOLOGY

international eye fashion

TRY YOUR ONLINE SUBSCRIPTION NOW

IT’S FREE!

DOWNLOAD THE MARCH ISSUE FOR PC AND iPAD FROM www.2020europemagazine.com FGE S.r.l. - Fabiano Gruppo Editoriale - Reg. S. Giovanni 40 - 14053 Canelli (AT) - Italy Ph. +39 0141 827802 - Fax +39 0141 827830 - e-mail: 2020europe@fgeditore.it - www.2020europemagazine.com 2020032012

YES! I wish to subscribe to 20/20 europe (5 issues a year): 1 year printed version † 100 € for Europe † 250 € for all other countries

1 year † 100 € web online + iPad

I SHALL PAY: † By bank transfer to: FGE S.r.l. - IT57 Q060 8547 3000 0000 030 016 BIC CASRIT22 Cassa di Risparmio di Asti - Filiale di Canelli † By non-transferable bank cheque enclosed payable to FGE S.r.l. † By credit card

expiry date

CVV

PLEASE, PRINT CLEARLY (OR ATTACH BUSINESS CARD)

Card owner

Date of birth

Family name

First name

Companyy

VAT N° (strictly needed for Europe))

Address City

Country

Zip Code

e-mail Ph. Please specify:

Fax

† Optician

† Company

Signature

† Other



20/20 Europe - May/June