Page 1


www.listabrasilusa.com

1


2

1-866-517-4467


www.listabrasilusa.com

3


4

1-866-517-4467


www.listabrasilusa.com

5


6

1-866-517-4467


FLÓRIDA 2009 Segunda Edição

Prezado Amigo, DIRETORA EXECUTIVA/EDITORA Leide Xavier DIRETOR COMERCIAL Hudson Xavier DESIGN E PROGRAMAÇÃO VISUAL Design Média Pro Leide Xavier Thalita Xavier Jorge Netto Envie correspondência para: LISTA BRASIL USA 8978 W. Sample Rd Coral Springs, FL 33065

Os artigos publicados neste catálogo, bem como publicidades, são de inteira responsabilidade de seus autores e anunciantes e não refletem a opinião dos editores deste catálogo. Todos os esforços foram feitos para que as informações contidas neste catálogo estivessem corretas. Nós, da Lista Brasil Usa, não podemos e não garantimos a atualização de dados. Erros gráficos e gramaticais são de inteira responsabilidade dos anunciantes. A Lista Brasil Usa não se responsabiliza por erros de informações das empresas constadas como gratuítas (nome e telefone); O Catálogo Hello Brazil não será trocado por erros de publicação em anúncios. Caso o erro seja nosso, entre em contato para ter o seu dinheiro de volta. É proibído a reprodução total ou parcial de qualquer informação contida neste catálogo sem a prévia autorização da Lista Brasil Usa.

Após o lançamento da nossa primeira edição da Flórida em Setembro/2008 e a grande aceitação pelos brasileiros que vivem aqui, temos o prazer de trazer até você a nossa segunda edição. Agora mais atualizada, com mais empresas cadastradas, além de mais informações. Aproveito para convida-lo a visitar, usar e se cadastrar no nosso site: www.listabrasilusa.com. Um site completo e atualizado diariamente, cheio de novidades e com mais de 30.000 visitas mensais. Esperamos que goste de mais esse trabalho, pois temos o compromisso de, juntamente com os nossa equipe de funcionários, nossos anunciantes, usuários e amigos, ajudar a fazer a história dos brasileiros na Flórida e em todos os Estados Unidos. Muito Obrigada, Leide Xavier

“... A alegria do SENHOR é a nossa força” (Neemias 8:10)

Diretora

CONHEÇA AQUI NOSSOS ÚLTIMOS LANÇAMENTOS!

1(866) 517-4467 ou visite nosso site: www.listabrasilusa.com email: info@listabrasilusa.com

Massachusetts - 8o Edição - Distribuição: Abril/2009 Flórida - 2 o. Edição - Distribuição: Maio/2009 New York / New Jersey - 2o. Edição - Em andamento


Telefones Importantes Emergências Fogo

Disque:

911

Polícia

Ambulâncias* (* Somente emergências médicas)

Informações sobre Telefones: Disque

411

Departamento de Justiça dos EUA.........................................1-800-375-8253 Federal Tax Informações.......................................................1-800-829-1040 Florida Departament of Revenue Taxpayer................................954-346-3000 Denúncias de Abusos ...........................................................1-800-342-9152 Alcóolatra Anônimos................................................................954-462-0265 Centro de Tratamento de abuso de Drogas.............................1-800-662-4357 Violência Doméstica..............................................................1-800-799-7233 Crianças Desaparecidas........................................................1-800-872-5437 Controle Nacional de Envenenamento....................................1-800-222-1222 Centro de Crise Suicida.........................................................1-800-784-2433 Centros de Emergências em Furação........................................954-797-3800 Informaç!oes sobre metrôs e ônibus..........................................305-638-6700 Polícia Rodoviária....................................................................305-470-2510

10

1-866-517-4467


GUIA PRINCIPAL

É Fácil Usar Este Catálogo Títulos e Empresas em Ordem Alfabética

CoTodos os títulos e empresas aqui listadas estão distribuidas em ordem alfabética, assim como as cidades. Cidades Dentro de cada título, as empresas estão distribuídos de acordo com a sua localidade. (Ex: Pompano Beach, Miami, Tampa, etc...). OBS: Empresas não cadastradas, poderão constar como GERAL. Atividades Principal Para facilitar a sua procura, as empresas estão classificadas por atividades principais e quando necessário, secundárias.

Ex:

COMPUTADORES AUTOMÓVEIS - VENDAS E REPAROS

Atividades Redirecionadas Caso você esteje procurando por uma atividade que possa ter outros nomes, nós redirecionamos você, de forma a encontrar o que você procura.

Ex:

CHURRASCARIAS Veja "Restaurantes/Churrascarias"

INDICE PRINCIPAL Agenda Diária........................................................................................................................112 Agenda Telefônica Pessoal....................................................................................................116 Ajuda ao Imigrante na Flórida.................................................................................................85 Anotações Gerais..................................................................................................................128 Calendário Acadêmico 2008/2009.........................................................................................111 Calendários - Anual 2008/2009............................................................................................109 Como Anunciar na Próxima Edição.......................................................................................136 Consulados Brasileiros...........................................................................................................86 CUPONS DE DESCONTOS.............................................................................................72 Emergências............................................................................................................................10 ÍNDICE DAS PÁGINAS AMARELAS...............................................................................13 Mapas da Florida .................................................................................................................133 Mapas do Brasil ...................................................................................................................132 Tabela de Conversões Pesos e Medidas, ..............................................................................135

www.listabrasilusa.com

11


12

1-866-517-4467


ÍNDICE ALFAB É T I C O A Academias............................14 Açougues..............................14 Advogados............................14 Agência de Publicidade..........18 Agências de Viagens..............18 Alfaiates (Veja Costureiras) Antenas Parabólicas.............19 Apartamentos......................20 Ar Condicionado..................20 Artes Gráficas..................................19 Assistência Legal..................20 Automóveis - Vendas e Reparos..........20 -Limpeza / Detail............25 -Socorro / Towining........26 B Bancos..................................26 Butiques................................26 C Cabeleireiros (Veja salão de Beleza) Cargas e Envios (Veja Mudanças) Carpetes...............................26 Celulares / Telefones.............26 Cestas de Café da Manhã.......28 Chaveiros.............................28 Churrascarias (Veja Restaurantes/Churrascarias)

Clínicas de Estética...............28 Clínicas Médicas...................28 Computadores.......................31 Condominios........................33 Construtoras / Reformas.......34 Contabilidade........................34 Containers (Veja Mudanças/Containers) Corretores de Imóveis (Veja Financiamentos Imob./Imobiliárias)

Costureiras............................36 Cursos de Idiomas (Vejas Escolas de Idiomas)

D Dentistas..............................37 Distribuidores........................40

www.listabrasilusa.com

E Eletrica e Eletricistas............40 Escolas de Idiomas ...............40 Escolas de Músicas................40 Estética (Veja Clínicas de Estéticas) Eventos (Veja Festas) F Festas - Artigos e Organização........40 Filmagens/Fotografos............40 Financiamentos Imobiliários.41 Fotográfos (Veja Filmagens/Fotografos) G Gráficas................................52 H Hospitais (Veja Clínicas) I Igrejas..................................46 Imigração (Veja advogados) Imobiliárias (Financiamento&Imobiliárias) Impostos (Veja Contadores) Informática ( Veja Computadores) Internet (Veja Computadores) Instrumentos Musicais..........56

N Notário Publicos (Veja Tradutores) O Óticas..................................58 P Padarias...............................59 Pet Shops............................59 Piercind e Tatuagem......... 59 Pizzarias...............................59 Produtos Brasileiros (Veja Lojas Brasileiras)

R Reboques (Veja Automóveis - Socorro/Towing)

Remessas de dinheiro..............60 Restaurantes ..........................62 Revistas (Veja Jornais e Periódicos) S Salões de Beleza.....................66 Sapatos .................................68 Seguros..................................68 Supermercados (Veja lojas brasileiras)

J Joalherias.............................48 Jornais e Periódicos..............48 T Telefones Celular (veja Celulares) Towing (Veja Automóveis-Socorro/Towing) L Lanchonetes......................50 Transportes & Vans...............71 Tradutores e Interpretes........72 Lavanderias.......................50 Turismo (Veja Agência de Viagens)

Letreiros/Signs..................50 Limosines..........................50 V Livrarias.............................50 Video Locadoras................72 Lojas Brasileiras...............51 Videos Produções..............72 Web Sites............................72 M Marmore e Granito............56 Móveis e Eletromésticos.56 Mudanças / Containers...58

13


ACADEMIAS

ACADEMIAS GYM / FITNESS FORT LAUDERDALE (Broward) Brazilian Jiu-Jitsu .......................................... 954-771-0084 Capoeira Corpo e Movimento..................… 954-567-2068

DEEFIELD BEACH (Broward) Centro Cultural e Ed.......................................954-426-4446

DORAL (Miami Dade) Brazilian Soccer Tr. Center.........................…305-865-8020 Capoeira Berimbau…...................................... 305-219-2923

MARGATE ( Broward) CARRYFULL MARKET 5385 W. Atlantic Blvd...............954-968-7191 (veja nosso anúncio em “Lojas Brasileiras” na pág.54)

TAMPA (Hillsborough) La Casa Del Churrasco...............................…813-870-1067

ADVOGADOS LAWYERS BOCA RATON (Palm Beach)

Academia de Futebol S.L. Benfica................407-844-1311

Cory Leifer.........................................................561-395-8055 John O’Brian................................................…561-392-9596 Law Offices Michael Samuel Dyer............…561-436-9699 Law Office of Charles . Mead Jr. P.A.............561-362-6677 Morano International P.A…..........................561-832-4740 Rihab T. Hamade, P.A.......................................561-367-7183 Shavitz Law Group.....................................…561-447-8888

POMPANO BEACH (Broward)

CORAL GABLES (Miami Dade)

HOLLYWOOD (Broward) Mixed Martial Arts...........................................954-316-4676

ORLANDO (Orange)

Mixed Martial Arts...........................................954-708-5417 Topazio Usa.......................................................954-805-1688

Celia Gore…......................................................305-444-8886

AÇOUGUES MEAT MARKETS

Fluentes & Berrio, LLP..................................954-752-1110

FORT MYERS (Lee) Express Market.................................................239-274-0774

DEERFIELD BEACH (Broward) LATINOS MEAT MARKET 1718 W. Hillsboro Blvd.............954-418-0503

CORAL SPRINGS (Broward) DEERFIELD BEACH (Broward) Glinn Somera & Silva….................................954-426-5553 Law Offices of Max Whitney..........................954-785-1771 Tony Mizzele, P.A............................................954-725-3778 Vincent Thomas Giovinco, D.C.....................954-379-0300

(veja nosso anúncio em “Lojas Brasileiras” ná pág. 53)

14

1-866-517-4467


ADVOGADOS

www.listabrasilusa.com

15


ADVOGADOS ORLANDO (Orange) Barry Brummer…...............................................407-849-4000 Hawkins & Associates, PLLC......................407-745-1777 Farr & Bowen....................................................407-409-8270 Gustavo Vargas.................................................407-835-1009 Km Jackson Law Firm......................................407-363-9020 Immigration Law Center.............................…407-835-1009 Law Office de Oscar Gonzales Jr..............…407-221-6465 Nova Total Hehab Center…...........................407-363-0686 Payas Payas Payas...........................................407-425-7223 Santos Law Firm P.L...................................…407-447-9090 Walter G. Santos ..............................................407-447-9090

PLANTATION (Broward) Ivan Piedrahita….............................................954-474-0111

POMPANO BEACH (Broward) ALFREDO R. JURADO P.A 1639 E. Sample Rd…................ .954-942-6449 (Veja nosso anúncio na página 14)

Anita T. Wolf.................................................…954-234-0835 Brazilian Help Center….................................954-942-4359 Gaudiosi & Whitney…..................................954-785-1300

JOHN O’BRIAN 3913 North Federal HW............954-782-9066 (Veja nosso anúncio na página aom lado)

FORT LAUDERDALE (Broward) BC Broad and Cassel.......................................954-764-7060 Craig A. Sackler................................................561-305-6879 Domingues Mc Conville, P.A...................…954-489-0009 Finizio & Finizio.........................................…954-767-6000 Law Office of Charles . Mead Jr. P.A.............954-493-7474

NOGUEIRA MORTON LAW OFFICE 4390 N. F EDERAL H WY, S TE 213....888-442-7552 (Veja nosso anúncio na página 15)

FORT MYERS (Lee) Total Help…......................................................239-936-9931

HOLLYWOOD (Broward) The Segal Law Firm..........................................954-920-9910

LAKE WORTH (Palm Beach) Vincent Thomas Giovinco, D.C.....................561-586-5326

MELISSA DA CUNHA 750 E.Sample Rd, Build3 #224...954-785-9280 (Veja nosso anúncio logo acima)

Peter Turco.........................................................954-427-4500 Scott T. Kimmel, P.A.........................................954-784-1744 Shayne Epstein.................................................954-781-1994 Trafic Ticket Defense........................................954-785-1300

TAMARAC (Broward) Robert F. Kiel....................................................954-720-4749

TAMPA (Hillsborough) Magro Law Firm...............................................813-237-8472

WEST PALM BEACH (Palm Beach) Law Office of Charles . Mead Jr. P.A.............561-366-9565

LIGHTHOUSE POINT (Broward) Advogados Wites & Kapetan.......................866-701-4878 Alvator Paralegal Services............................954-784-7656 Morano International, P.A............................ 954-784-7656

MARGATE (Broward) Muller & Associates...................................…954-972-8011

MIAMI (Miami Dade) Daisy A. Vilaruel..............................................305-372-0222 Ernesto F. Cespedes….....................................954-918-9222 Kravitz & Guerra P.A.................................….305-372-0222 Nogueira Morton P.I…...................................866-248-7780

MIAMI BEACH (Miami Dade) Coane and Associates Attorneys at Law....305-538-6800

16

1-866-517-4467


ADVOGADOS

www.listabrasilusa.com

17


AGÊNCIAS DE PUBLICIDADE AGENCIA DE PUBLICIDADES ADVERTISING AGENCIES DEERFIELD BEACH (Broward) Bright Way Productions................................954-427-4770

MIAMI (Miami Dade) ACM PRODUCTIONS ............ 305-493-1217 (Veja nosso anúncio nesta página)

ORLANDO (Orange) Beeidea Advertising........................................407-351-3976

AGENCIAS DE VIAGENS TRAVEL AGENCIES AVENTURA (Miami Dade) Magic Chartair travel Agency…...................305-999-0959

DEERFIELD BEACH (Broward) Bella Tours & Travel, Inc................................954-783-4111 Business Travel................................................954-570-7179 Minas Travel..................................................... 954-428-6605 Smartraveltour....................................................954582-9730

FORT LAUDERDALE (Broward) Brazilian Wave Tours.......................................954-561-3788 Costamar Travel................................................954-630-0060

FORT MYERS (Lee) MADE IN BRAZIL - INSURANCE & SERVICES 2301 Fowler St, Ste 3.................239-931-6079 (Veja nosso anúncio na página 70)

LITHHOUSE POINT (Broward) ALVATOUR TRAVEL E SERVICES 4624 N. Federal Hwy.................954-784-7656 (Veja nosso anúncio nesta página)

MIAMI (Miami Dade) Alaska Travel....................................................866-518-0319 Atlantic Corporate travel…...........................305-670-6550 BR Online Travel….........................................305-379-0005 Discover Brazil Tours.................................…305-382-9443 Dumonde Travel.......................................…....800-399-6186 Fredson Travel..................................................800-626-8422 Mariana Tours…...............................................305-372-1664 Transmares Tours & Travel….........................305-372-1314 Travel Business Bureau..............................…305-374-3366

ORLANDO (Orange) Chang Express..............................................…407-403-6177 Costa Brazil Tours............................................407-403-5666 Holiday Travel & Tour....................................407-277-2977 International Food Club.................................321-281-4300 Moon Travel......................................................407-354-5200 Planet Tour International...........................…407-226-9393 Star Business Travel .......................................407-354-3474 Suncoast Usa.....................................................407-354-3080

POMPANO BEACH (Broward) Air Projects Travel.........................................954-302-6809 Chang Express..................................................954-781-7130 Costa Brazil.......................................................954-317-3517 EZ Way Travel...................................................954-943-9800 Sambra Travel....................................................954-943-7944

18

1-866-517-4467


ANTENAS & TV A CABO - TELEVISÃO SMART TRAVEL TOUR 1001 E. Sample Rd Suit 10E......954-582-9730 (veja nosso anúncio nesta página)

PORT SAINT LUCIE (Saint Lucie) JV Brasil Travel & Services Corp.............…772-879-3227

TAMPA (Hillsborough) 5 Star Voyage…................................................813-864-2907 Costa Brazil Tours........................................…813-881-9755 Estrela Brasil Co…..........................................813-931-2584

WEST PALM BEACH (Palm Beach) Costamar Travel............................................…561-432-8942

ALFAIATES TAILORS Ver “Costureiras” ARTES GRAFICAS GRAPHIC DESIGN Ver ‘Gráficas“ e “Agências de Publicidades” ANTENAS & TV A CABO - TELEVISÃO SATELLITE & CABLE - TELEVISION Veja também “Canais de Televisão” POMPANO BEACH (Broward) ALL SERVICES INTERNATIONA INC 1501 SW 7th Ave......................954-933-7054 (veja nosso anúncio nesta página) Satelite Sales, Services And Installation...954-942-1232

www.listabrasilusa.com

19


APARTAMENTOS - ALUGUEL E VENDAS APARTAMENTOS - ALUGUEL E VENDAS

APARTAMENTS - RENTAL & SALES

Ver “ Condominios ” e “ Imobiliárias” AR CONDICIONADO AIR CONDITIONER NORTH LAUDERDALE (Broward) Be Kool Air Cond............................................561-929-4817

BOCA RATON (Palm Beach) Jireh Cooler........................................................954-254-5910

ASSISTENCIA LEGAL LEGAL ASSISTANCE BOCA RATON (Palm Beach) Paralegal Help Inc...........................................954-725-1202

DEERFIELD BEACH (Broward) Cleo Auto Tag, Inc - Despachante................954-427-6666

LIGHTHOUSE POINT (Broward) ALVATOUR TRAVEL - PARALEGAL SERVICES

4624 N. Federal Hwy.................954-784-7656 (Veja nosso anúncio ná pág.18)

AUTOMÓVEL - LIMPEZA CAR WASH - DETAIL DEERFIELD (Broward) Leo’s Auto Spa................................................954-691-5013

POMPANO BEACH (Broward) Bras Bright Car Wash......................................954-582-9428 National Auto Sales........................................954-297-6743

SAMPLE ROAD AUTO SPA 2501 W. Sample Road................954-974-3440 (Veja nosso anúncio logo abaixo)

Silva Services....................................................954-448-3606

AUTOMÓVEIS - PNEUS CAR TIRES DELREY BEACH (Palm Beach) TIRES4U2 1W. Linton Blv - Bay................561-272-2226 (Veja nosso anúncio na página ao lado)

FORT MYERS (Lee) SBS TIRE CARE 2454 Braman Ave Ste 18-19......239-245-3254 (Veja nosso anúncio na página 22)

20

1-866-517-4467


AUTOMテ天EIS - PNEUS

www.listabrasilusa.com

21


AUTOMÓVEIS - PNEUS

AUTOMÓVEIS- VENDAS E REPAROS CAR SALES AND AUTO REPAIR BOCA RATON (Palm Beach) JC Towing…......................................................561-756-6379 EuroBank….......................................................561-750-9999

CORAL SPRINGS (Broward) Brascredit...........................................................954-788-4564

DEERFIELD BEACH (Broward) Dixie Cars...........................................................954-725-4020 Elit-All Auto....................................................954-969-5549 Fast Stop Auto Body.......................................954-274-7092 High Preformance.............................................954-461-8882 Ipanema Alinhamentos....................................954-822-8375

KING TOYOTA (Abel Moraes) 1441 South Federal HWY..........954-426-6769 (Veja nosso anúncio nesta página)

22

1-866-517-4467


AUTOMテ天EIS - VENDAS E REPAROS

www.listabrasilusa.com

23


AUTOMÓVEIS - VENDA E REPAROS

Mocelin Auto Dealer.......................................954-420-5533 Pit Stop Auto Sales.........................................954-605-0130 Quality Build Transmissions........................954-428-5440 Sergio Auto Body.............................................954-429-0685

DELREY BEACH (Palm Beach) SCRATCH CAR AUTOMOTIVE 1 Linton Blvd Bay 19................561-278-2866 (Veja nosso anúncio nesta página)

TIRES4U2 1W. Linton Blv - Bay................561-272-2226 (Veja nosso anúncio na página 15)

FORT LAUDERDALE (Broward) Gunter Motor Company..................................561-846-0831 Phil Smith Ford of Pompano..........................954-260-8737 Us 1 Cycle..........................................................954-642-6613

FORT MYERS (Lee) BRAZIL AUTO SALES 3711 Palm Beach Blvd…...........239-690-0459 (Veja nosso anúncio na página 23)

Brazusa Auto Sales..........................................239-332-0959 Fort Myers Toyota (Guilherme Rosa)…......239-938-2800 Sam Galloway – Ford (Marcelo)...................239-274-2477

HOLLYWOOD (Broward) ABBA Auto.......................................................954-929-9919

24

1-866-517-4467


AUTOMÓVEIS - LIMPEZA E CAR WASH LAUDERHILL (Broward) Premier Motors.................................................954-934-2762

LIGHTHOUSE POINT (Broward) Sienna Motors...................................................954-784-7181

MIAMI (Miami Dade) Almi Body Shop...............................................305-634-7300 Winner Enterprise….......................................305-758-5544

MIAIMI BEACH (Miami Dade) Miami Motorcycle Salon................................305-529-2842

MARGATE (Broward) Japanese Auto ..................................................954-971-5411

OAKLAND PARK (Broward) PRIDE PARKING - VALET SERVICES 3260 NE 16Th Ave # B.............754-245-1012 (veja nosso anúncio em “MANOBRISTAS” na pág. 55)

State Auto Body...............................................954-776-6505 Surgeon Collision Center..............................954-658-5616

ORLANDO (Orange) Atlantic Services Center…............................407-648-0211 Autics….............................................................407-237-8900 Auto Land Dealers...........................................407-856-2077 Auto Mechanic Gilnato Sousa......................407-953-4839 Auto Point Sales & Services….....................407-859-9901 Delaney Shell Service Center....................…407-857-1127 Extreme Auto Sales......................................…407-859-4477 Gobraz Auto repair Corp…............................407-296-2990 GS Auto Sales...............................................…407-855-7044 Liberty Cars…..................................................407-854-6886 O.A.S. Orlando Auto Services......................407-283-1011 O.B.T. Auto Sales e Services.....................….407-849-7070 Sousa Auto Mechanic.....................................407-953-4839 State Auto Body...........................................…407-855-0565 Tint-A-Lize-It…...............................................321-436-9140 Top Line Cars....................................................407-856-2077 Willy’s Mecanico............................................407-929-0375

Man Auto Services..........................................754-235-1234 MGR Auto Service...........................................954-783-9434 Minas Car ..........................................................954-785-9696 Podium Auto Sales, Inc..................................954-781-1123

POLE POSITION 3725 N. Federal HWY...............954-545-4049 (veja nosso anúncio na página 24)

POMPANO BEACH (Broward)

Premier Auto Finance......................................954-956-8000

Alex Auto Repair Inc.......................................954-545-0777 Aloha Auto Sales.............................................754-366-7273 A Unique Auto Service.................................954-781-8039

PROCAR AUTO BODY & REPAIR 1705 N. Dixie Hwy....................954-784-8500

AUTO BRAS MOTORS 4791 N. Federal HWY...............954-333-8970 Auto Brasil........................................................954-297-9915 Best Deals Auto Sales & Repair...................954-979-6923 Brascar Auto Sales...........................................954-788-0425 Bycar Autosales...............................................954-366-3490

Procycle..............................................................754-367-2453 Quality Auto Center........................................954-415-0050 Quality Built Transmissions.........................954-428-5440 Rafa Auto Repair..............................................561-506-0412 Rio Motors.........................................................954-784-6021 Sergio Auto Body.............................................954-429-0685 Silva Auto Body & Paint...............................954-448-3606 Sienna Motors...................................................954-784-1233

CRISTIANO AUTO SERVICE 831 NE 41 St Court...................954-784-6596

SUAN AUTO REPAIR & SALES, INC 1100 S.Dixie Hwy West.............954-942-3369

(Veja nosso anúncio na página 23)

(Veja nosso anuncio na página 23) Electro-Car, Inc.................................................954-782-9155 Foreign Cars of Pompano ..............................954-781-8481 Goval Auto sales Inc.......................................954-784-8010 Gui Auto Sales.................................................954-818-8319 Magic Wheels Auto Repair............................954-784-2885

www.listabrasilusa.com

(Veja nosso anúncio na página 23)

(Veja nosso anúncio ao lado)

SUAN MOTORCROSS SHOP 1100 S.Dixie Hwy West.............561-929-3312 (Veja nosso anúncio ao lado)

Top Line Auto Services..................................954-785-0279

25


AUTOMÓVEIS - VENDAS E REPAROS TopStop...............................................................954-781-0000

VAVÁ AUTO REPAIR 870 NE 41 Court.......................754-366-6279 (Veja nosso anúncio nestá página)

Zeca’s Auto Repair..........................................954-942-8003

SUNRISE (Broward) Sawgrass Ford...................................................954-851-9000

AUTOMÓVEIS - REBOQUES TOWING COCONUT CREEK (Broward) Marcelo’s Towing............................................954-709-8636 Rapid Towing....................................................954-650-8348

POMPANO BEACH (Broward) Beto’s Towing..................................................954-818-2265 K&K Towing.....................................................954-818-6502 New Town Towing...........................................954-415-6263 Thumder Towing & Recovery.........................754-235-5570

BUTIQUES BOUTIQUES BOCA RATON (Palm Beach) Fashion Market.................................................561-702-9654

DEERFIELD BEACH (Broward) Blue Beauty Fashion.......................................954-834-0312 Blueberry Boutique.........................................954-427-7760

CABBLER TWELVE SHOE REPAIR 816 SE 9th Suite B ....................954-426-1930 (Veja nosso anúncio em “SAPATOS” pág.68)

ORLY ALTERATIONS & DESIGNS 821 SE 9th St............................954-698-5198 (Veja nosso anúncio em “COSTUREIRAS”, pág. 37)

Unique Collections.........................................954-422-9608 Yes Brazil Fashion...........................................954-421-4833

MIAMI BEACH (Miami Dade) Arts by Del…....................................................305-532-8370 Brazilian Fashion.............................................503-866-8888

PORT SAINT LUCIE (Saint Lucie) Towing Service.............................................…772-209-1177

BANCOS BANKS CORAL GABLES (Miami Dade) Euro Bank…......................................................305-350-1100

LIGHTHOUSE POINT (Broward) Bank of America ...............................................954-784-2973

MIAMI (Miami Dade) Banco do Brasil S.A…....................................305-597-9166 Espirito Santo Bank of Florida….................305-539-7706 Pine Bank / Hemisphere National Bank….305-539-3400 Sofisa Bank of Florida….................................305-256-0900

POMPANO BEACH (Broward) EuroBank ..........................................................954-784-9659 Banco Wachovia ..............................................954-786-7079

ORLANDO (Orange) Andreas Acessorios........................................407-967-7806 Brazar Brasil…..................................................407-351-0303

POMPANO BEACH (Broward) BRAZILIAN DEPOT 704 SW Street...........................954-570-8292 (Veja nosso anúncio em “LOJAS BRASILEIRAS, pág.51)

Brazilian Fashion.............................................954-545-9193 Central do Brasil - Atlantic ..........................954-785-5991 Central do Brasil - Federal ............................954-785-2131 Brazil - Mart.......................................................954-782-7794 O Boticario........................................................954-933-3263 Passalera BR Brazilian Clothing..................954-946-8870

CANAIS DE TELEVISÃO TELEVISION CHANNELS

REDE RECORD INTERNACIONAL www.rederecord.com.br/internacional (veja nosso anúncio na página ao lado)

CARPETES CARPETS BOCA RATON (Palm Beach) JF Steam Cleaning…........................................561-305-2350 Spring Carpet Inc….........................................561-674-1173

CELULARES - LOJAS CELL PHONES - STORES DEERFIELD BEACH (Broward) Cellular Zone.....................................................954-426-5558 Youtel Wireless................................................954-698-0898

ORLANDO (Orange) Cellularium…....................................................407-248-2501 Metro PCS..........................................................407-248-0330

POMPANO BEACH (Broward) Dorival Usa.......................................................954-200-2200 Teletel Wireless................................................954-788-9255

26

1-866-517-4467


www.listabrasilusa.com

27


CESTAS DE CAFÉ DA MANHÃ

CESTAS DE CAFE DA MANHÃ BREAKFAST BASKETS MARGATE (Broward) Z Baskets............................................................954-978-9990

BOCA RATON Advanced Esthetics Clinic........................…561-361-9000 Boca Laser Cosmetics Surgery…..................561-477-2963 Changes Spa......................................................561-750-4400

DEERFIELD BEACH DR. MARK SCHEINBERG Ginecologia Cosmética 2345 W. Hillsboro Blv, Ste 201..561-414-3219 (Veja nosso anúncio na página ao lado)

FORT LAUDERDALE (Broward) Beauty Surprises .............................................954-873-0090 Clinica de Tratamento de Varizes..................954-561-5001

DR. NERI FRANZON, M.D 4390 N. Federal HWY # 101.....954-776-1412 (veja nosso anúncio nesta página 30)

CHAVEIROS LOCKSMITH CHAVEIRO E AMOLAGEM....954-825-5599 (veja nosso anúncio logo abaixo)

CHURRASCARIAS BRAZILIAN BBQ

Veja em “Restaurantes / Churrascarias” CLÍNICAS DE ESTÉTICAS ESTHETIC CLINIC ALTAMONTE SPRINGS Belleza Cosmetic Surgery...............................407-774-8001

POMPANO BEACH (Broward) Naturhouse........................................................954-946-7040

ORLANDO (Orange) Tweleve Roses…...............................................321-662-4383

MIAMI (Miami Dade) Dr. Timothy Alexander....................................305-756-8743 TAMARAC (Broward) Slimmer U...........................................................954-722-4861

CLÍNICAS MÉDICAS HEALTH CLINICS BOCA RATON (Palm Beach) MR Chiropractic Care......................................561-487-7655

28

1-866-517-4467


CLÍNICAS MÉDICAS

www.listabrasilusa.com

29


CLÍNICAS MÉDICAS

COCONUT CREEK (Broward) DR. MARK SCHEINBERG Obstetricia e Ginecologia...........954-970-4960 3850 Coconut Creeck Pkwy, Ste 201 (Veja nosso anúncio na página 29)

DEERFIELD BEACH (Broward) Deerfield Beach Rehab Inc.............................954-570-6046 Dr. David Maklan.............................................954-422-1865

DR. MARK SCHEINBERG Ginecologia Cosmética...............561-414-3219 2345 W. Hillsboro Blvd, Ste 201 (Veja nosso anúncio na página 29)

Dynamic Medical..............................................954-421-2005 Hillsboro Urgent Care....................................954-360-7000 Silva MEdical Center......................................954-480-8280

FORT LAUDERDALE (Broward)

POMPONO BEACH (Broward) Completae Clinica Medica de Reab..............954-941-2679 Maria Prates Correia D.O.M...........................954-785-4399 North Broward Community Health..............954-941-8866 Philippine Therap. & Relaxing Massage....954-551-5215

COMPUTADORES E INTERNETS COMPUTERS & INTERNET COCONUT CREEK (Broward) Computer Kingdom.........................................754-235-2218

FORT MYERS (Lee) Janski..................................................................239-344-0527

OFFICETECH 3777 Fowler..............................239-878-7754 (veja nosso anúncio na página seguinte)

HOLLYWOOD (Broward) C.M. Computers & Network..........................786-326-7535

Clinica de Varizes ............................................954-561-5001

MIAMI (Miami Dade)

DR. NERI FRANZON, M.D 4390 N. Federal HWY # 101.....954-776-1412

Alaska Media…................................................305-591-1444 JM Computing and Services..........................786-853-8255 Prolink ..........................................................…305-948-8830

(veja nosso anúncio nesta página) Katja Rego Johnson.........................................954-255-5715

OAKLAND PARK (Broward) Prolink...............................................................954-491-8755

FORT MYERS (Lee)

ORLANDO (Orange)

Dr. Francisco Vazquez.....................................239-694-0533

Dynamic Computer Services…....................407-468-8010 JR Electronic…................................................407-928-1797

MARGATE (Broward) Margate Rehab Center....................................954-968-7615 30

1-866-517-4467


COMPUTADORES

POMPANO BEACH (Broward) Acc Compudoares............................................954-946-8887 Great Net Int’l Trading..................................954-943-8324

In2COMPUTER INC 1066 W. Sample Rd...................954-783-8025 (veja nosso anúncio nesta página) Mr.Client............................................................561-503-1670

SUNRISE (Broward) Bassotech Technologies Worldwide...........954-578-5005

TAMPA (Hillsborough) Advance Computer Solutions…..................813-385-4020

www.listabrasilusa.com

31


COMPUTADORES

32

1-866-517-4467


CONDOMINIOS

www.listabrasilusa.com

33


CONDOMINIOS

CONDOMINIOS CONDOMINIUMS DEERFIELD BEACH (Broward) LIMETREE VILLAGE 431 SE 13th Ct..........................954-421-2150 (Veja nosso anúncio na página anterior, 33)

CONSTRUÇÃO E REFORMA CONSTRUCTION & REMODELING BOCA RATON (Palm Beach) Gutter Dynamic............................................…954-531-3618 Spring Carpet Inc (Wood Floors)….............561-674-1173 Step Up General Services...........................…561-929-9261 Coral Print Remodeling, Corp.......................954-297-1330

CAPE CORAL (Lee) Stopa Inc.............................................................239-222-4272

DELREY BEACH (Palm Beach) Novatech Flooring...........................................561-243-2842

MARGATE (Broward) JL HOME PROJECTS Kitchen and Remodeling 2716 N. State RD 7...................954-971-2994 (veja nosso anúncio logo abaixo)

POMPANO BEACH (Broward) Mouldings To go..............................................954-972-7889 Real Shining Stone..........................................954-825-1753

34

CONTABILIDADE & IMPOSTO DE RENDA ACCOUNTING & INCOME TAX ALTAMONTE SPRINGS Toro Accounting & Consulting....................407-389-0260

BOCA RATON (Palm Beach) Despachante Brasileiro...................................561-910-5400

COCONUT CREEK (Broward) Income Tax Eagle Tax........................................954-752-4553

CORAL SPRINGS (Broward) David A. Weix, CPA........................................954-340-8181

DEERFILED BEACH (Broward) Acc International CRT.....................................954-418-1464 CSG Capital Services Group.........................954-427-4770 Genesis Accounting Servives.......................954-420-0051

INCOME TAX CO...................954-603-7570 (Veja nosso anúncio ao lado) The Way Group.................................................954-4274770

FORT LAUDERDALE (Broward) E&A Tax.............................................................888-442-7252

INCOME TAX CO...................954-603-7570 FORT MYERS (Lee) MADE IN BRAZIL - INSURANCE & SERVICES 2301 Fowler St, Ste 3................239-931-6079 (Veja nosso anúncio na página 70)

Metro Business Agency.............................…239-466-8600 Transamerica Accounting & Services.........239-989-7034

1-866-517-4467


CONTABILIDADE

www.listabrasilusa.com

35


CONTABILIDADE

FORT PIERCE (Saint Lucie) Tax Place Corp..............................................…772-460-7970

LIGHTHOUSE POINT (Broward) Business Choice..............................................954-782-1829

MIAMI (Miami Dade) Carol Larson.....................................................305-519-1801

ORLANDO (Orange) Account Bookkeeping…...............................407-898-1757 Carol Larson.....................................................407-370-3686 ID Cards........................................................…407-249-2199 GS Services.......................................................407-855-7044 Ruben D. Toro Cpa......................................…407-370-6445 Tax Direct Company.........................................407-855-0660

POMPANO BEACH (Broward) BusinessChoice Tax Experts.........................954-782-1829 Despachante Brasileiro..................................954-786-7180 Escritório Jaci Carminati...............................954-942-5054 Fast Tax Refunds..............................................954-781-0421

INCOME TAX CO..................954-603-7570 (Veja nosso anúncio na página 35) Smart Tax............................................................954-782-7952 Tax House..........................................................954-782-4000 USA Tax.............................................................954-788-1818

WEST PALM BEACH (Palm Beach) QUICK TAX ACCOUNTING SERVICES 4420 Portofino Way, St 110..1-800-466-5884 (veja nosso anúncio nesta página)

COSTUREIRAS - ALTERAÇÕES TAILORS - ALTERATIONS DEERFIELD BEACH (Broward) OLRLY _ ALTERATION & DESIGN 821 SE 9th St.............................954-698-5198 (Veja nosso anúncio na página 37) Edna Alterations..............................................954-678-8558

OAKLAND PARK (Broward) Suimar Alterations & More, Inc....................954-772-7492

POMPANO BEACH (Broward) Wanda Lima Alterations.................................954-708-9022

36

1-866-517-4467


DENTISTAS

DENTISTAS DENTIST BOCA RATON (Palm Beach) Deerfield Dental Services..............................954-427-4321 Dewey Family Dentistry............................…561-582-7660

NOVA DENTAL 23041 State Rt 7.......................954-788-2388 (Veja nosso anúncio na pagina 38)

Vivian Kunstmann D.D.S.P.A…...................561-470-8006

CORAL SPRINGS (Broward) Dental Health Beauty......................................954-575-0880

DEERFIELD BEACH (BROWARD) Atlantic Coast Dentistry................................954-360-2989

FORT LAUDERDALE (Broward) Atlantic Dental Center...................................954-318-0798

FEDERAL DENTAL CARE 4390 N Federal Hwy Ste 100.....954-772-5559 (Veja nosso anúncio na página 39)

Sandra Gomez Trainer, DDS,PA...................954-958-3584

LIGHTHOUSE POINT (Broward) Dr. Kenneth E. Ross........................................954-941-2277

MIAMI (Miami Dade) Dr. Carol............................................................305-387-4274

MARGATE (Broward) All Care Dental................................................954-979-1357

OAKLAND PARK (Broward) Summit Dental Center.....................................954-561-6675

ORLANDO (Orange) Dental Excellence............................................407-351-4229 Matilde F. Castellini…...................................407-351-2245 Star Dental…....................................................407-381-3377 Universal Dental PLLC….............................407-248-0484

PLANTATION (Broward) Garcia Dental Group ......................................954-424-5868 Zagarra Orthodontics......................................954-321-5600

POMPANO BEACH (Broward) Brazilian’s Dental Center..............................954-783-9494 Dentistry Vital Dent........................................954-785-1102 Hedimo N. DeSa, DDS....................................954-783-9494

NOVA DENTAL 1501 SE 23rd Ave......................954-788-2388 (Veja nossa anúncio na página 38)

PORT SAINT LUCIE (Saint Lucie) Regency Dental................................................772-785-9515

www.listabrasilusa.com

37


DENTISTAS

38

1-866-517-4467


DENTISTAS

www.listabrasilusa.com

39


DISTRIBUIDORES - IMPORT. & EXPORT. DISTRIBUIDORES / IMP. & EXPORT DISTRIBUTORS / IMPORT & EXPORT FORT LAUDERDALE (Broward) All Brazilian Imports.......................................954-523-8134 GM Miolo USA Inc.........................................954-771-7656 ORLANDO (Orange) JCC Brazil Enterprises INC...........................407-218-9938

ELÉTRICA & ELETRÔNICAS - SERVIÇOS ELECTRICAL SERVICES COCONUT CREEK (Broward) Jõao Alves.........................................................754-367-7900

ELETRÔNICOS ELECTRONICS COCONUT CREEK (Broward) Jõao Alves.........................................................754-367-7900

MIAMI (Miami Dade) Alaska Media................................................1-877-898-9251 North Rio Electronics…................................305-381-9644 Spy-tech Int’l Inc….........................................305-377-2156

MARGATE (Broward) Magnum Appliances........................................954-978-9060

ORLANDO (Orange) Brazil Center......................................................407-363-0503 Electronics & Kipling…...............................407-363-0503 JR Electronic.................................................…407-928-1797 Yes Brasil......................................................…407-351-3684

POMPANO BEACH (Broward)

POMPANO BEACH (Broward) CCLS Pompano.................................................954-970-6464 Magestic Languages........................................754-235-6005 Wizard................................................................954-941-2442

ESCOLA DE MUSICAS MUSIC SCHOOLS HOLLYWOOD (Broward) Antonio Adolfo School of Mujsic..............786-566-1527

ESTÉTICA ESTHETIC Veja “CLINICAS DE ESTÉTICA” FESTAS E EVENTOS PARTY & EVENTS COCONUT CREEK (Broward) Happy Kids.......................................................954-839-0330 M&M Party & Events.....................................754-367-3067 Tania parties.......................................................954-480-9680

DEERFIELD BEACH (Broward) Studio One Party Corp...................................561-305-7321 Studio One Party Inc.......................................561-305-7321

FORT LAUDERDALE (Broward) Orlando’s Bakery.............................................954-263-5243

MIAMI (Miami Dade) ACM Productions….......................................305-493-1217 Arts Cultural Moviment Foundation…......305-949-4830

Ceu Tech..............................................................954-781-4350 C & S Appliances.............................................954-784-5180 Greatnet Int’l Trading.....................................954-943-7333

MARGATE (Broward)

ESCOLAS DE DANÇAS DANCE ACADEMIES MIAMI (Miami Dade)

Denise’s Catering Party ...........................….321-234-1890

From Brazil Inc….............................................305-226-1717

MIAMI BEACH (Miami Dade) Gil Santos Dance Studio............................…305-674-0709

ESCOLAS DE INGLÊS ENGLISH SCHOOLS FORT LAUDERDALE (Broward) The Language Academy..................................954-462-8373

FORT MYERS (Lee) Fort Myers Language Center.....................…239-278-3636

LIGHTHOUSE POINT (Broward) English Foward................................................954-628-2965

Steven & Sweetheart.......................................754-368-1812

ORLANDO (Orange) POMPANO BEACH (Broward) Carmen Valentine Weddings & Party...........954-941-8980 Betty’s Bar.........................................................954-784-0909 Ms. Sparkie........................................................954-934-8862

PARTY PLANET 1001 E.Sample RD....................954-942-5058 (Veja nosso anúncio na página ao lado)

FILMAGENS & FOTOGRAFOS VIDEO & PHOTOGRAPHERS POMPANO BEACH (Broward) CREATIVE PHOTO STUDIO & VIDEO 3927 N. Federal Hwy.................954-687-5102 (veja nosso anúncio na página ao lado) Mrj Photography..............................................954-354-0926

MIAMI BEACH (Miami Dade) USB Pro Language Center.........................…305-300-5054

ORLANDO (Orange) Expression Language Center....................…407-354-3880 Orlando Language School.........................…407-370-0639

40

1-866-517-4467


FINANCEIRAS & IMOBILIÁRIA

FINANCEIRAS & IMOBILIARIAS MORTGAGE & REAL ESTATE Veja também “CONDOMINIOS” BOCA RATON (Palm Beach) Teresinha Vieira (Boca Raton)........................561-445-7050

CORAL SPRINGS (Broward) Remix In Motion...............................................754-235-7588

DEERFIELD BEACH (Broward) CS Solutions (Frenado de Souza).................954-421-7456 Easy Rate Mortgage........................................561-750-1751 Fatima Abreu (NLC of Florida, Inc).............954-750-1751

LIMETREE VILLAGE 431 SE 13th Ct..........................954-421-2150 (Veja nosso anúncio em “CONDOMINIOS”, pág.33 ) Power Lending, Corp......................................954-422-8494 Trademark Financial.........................................954-725-8789

FORT LAUDERDALE (Broward) Emperial Realtors.............................................754-234-0729 Exit World Realty.............................................954-414-4400 Finn Real State..................................................954-463-2414

MIAMI (Miami Dade) Elite Global Realty..........................................305-372-5111 Metro Funding…..............................................305-279-1073

www.listabrasilusa.com

41


FINANCEIRAS & IMOBILIÁRIA OAKLAND PARK (Broward) First Alliance Realty........................................954-771-5401

ORLANDO (Orange) Premier Mortgage Solutions.....................…407-721-9224 Safe Financial Services...................................973-573-6930

PEMBROKE PINES (Broward) MJR Realty.........................................................954-517-1844

PLANTATION (Broward) Coldwell Bank.................................................954-683-6125

PARKLAND (Broward) Era 1st Choice Realty......................................954-341-3721

POMPANO BEACH (Broward) Cornwell Brokers.............................................561-445-7050

FOTOGRAFOS PHOTOGRAPHERS Ver “FILMAGENS & FOTOGRAFIAS” GRÁFICAS PRINTING GERAL DESIGN MEDIA PRO www.minhagrafica.com...........1-800-517-2993 (Veja nosso anúncio na página seguinte)

FORT MYERS (Lee) Allegra Print Imaging (Fernando)...........…239-275-5797

ORLANDO (Orange) Hosanna Printing….......................................407-870-0010

POMPANO BEACH (Broward) ENGEAD GRAFICA BRASILEIRA 414/416 E. Sample Rd...............954-783-5161 (Veja nosso anúncio na página 44)

European Graphics Comm. Group...............954-971-6004

ENGEAD GRAFICA BRASILEIRA 414/416 E. Sample Rd...............954-941-3778 (Veja nosso anúncio nesta página)

Nova Grafica......................................................954-317-4304 Sign Depot.........................................................954-785-5100

42

1-866-517-4467


GRテ:ICAS

www.listabrasilusa.com

43


GRテ:ICAS

44

1-866-517-4467


GRテ:ICAS

www.listabrasilusa.com

45


IGREJAS

46

1-866-517-4467


IGREJAS IGREJAS CHURCHES BOCA RATON (Palm Beach) Assembleia de Deus…...................................561-302-6234 Bethel Mission International Fellowship..561-544-6911 Igreja Cristo Nossa Rocha.........................…561-447-6554

CORAL SPRINGS (Broward) Brazilian Baptist Church ...............................954-755-3540 Hebron Church.................................................954-695-5504 Igreja Batista Central ......................................954-755-3540

DEERFIELD BEACH (Broward) Assembleia de Deus Manancial....................561-305-9269 Commun. Evang. Intern. do Sul da FL.........954-421-7737 Igreja Crista Maranata.................................1-800-225-5028 Igreja da Fe no Deus Vivo .............................954-970-1000 Igreja Evangélica Avivamento da Fé...........954-461-8213 Life Point Church............................................754-367-0398 Sara Nossa Terra................................................954-695-7387

FORT LAUDERDALE (Broward) 7th Day Adventist Church - Braz. Temple..954-739-9500

FORT MYERS (Lee)

OAKLAND PARK (Broward) Brasilian Temple - Igr.Advent. de 7th Dia..954-739-9500

OCOEE (Orange) Igreja Nova Esperanca....................................407-273-4545

ORLANDO (Orange) Com. Brasileira Adventista IASD…............321-662-9595 Evangelical Christian Church..................…407-903-9754 First Baptist Church of Orlando...............…407-254-7500 Igreja Apostolica Renascer em Cristo.....…407-729-1636 Igreja Advent. 7* Dia Brasileira..................407-288-5732 Igreja Evangelica Bom Pastor...................…407-370-4747 Igreja Videira.....................................................407-248-0036 Philadelphia – Igreja Presbiteriana Bras....407-206-2137 Primeira igreja Batista Brasileira..................407-206-0163 Shalom Igreja Evangelica...........................…407-552-7728 Ministerio Seara…...........................................407-264-0110

POMPANO BEACH (Broward) Agape Church...................................................954-540-2965

ASSEMBLEIA DE DEUS 172 N. Powerline Rd...............954-984-9520

Assembleia de Deus Bethsda.........................239-217-4911

(Veja nosso anúncio na página ao lado)

ASSEMBLEIA DE DEUS 2756 McGregor Blvd................561-929-7524

Assembly of God Mission..............................954-290-0133 Brazilian Chapel - SDA .................................954-708-8849 Gilead Biblical Community Church............954-931-9868 Igreja Batista da Lagoinha.............................561-305-1212 Igreja Catolica Nossa Senhora Aparecida..954-571-8182 Igreja Internacional da Graça de Deus........954-942-6005 Igreja Universal do Reino de Deus..........1-800-317-9466 Igreja Vida Abundante....................................754-367-4011 New Life Brazilian Christian Church..........954-946-5256 Sara nossa Terra.................................................954-695-7387

(Veja nosso anúncio na página ao lado) Assembly of God Mission..............................239-245-1182 Florida Evangel Center...................................917-497-9725 Igreja Assemb.de Deus Minist. Belem........954-782-0430 Igreja Católica Sagrada Família.....................239-410-7328 Igreja do Evangelho Quadrangular.............239-200-2095 Ministerio Caminho da Graca…...................239-633-3017

FORT PIERCE (Saint Lucie) World Revival Church ...............................…561-307-9140

HOLLYWOOD (Broward)

PORT SAINT LUCIE (Saint Lucie)

ASSEMBLEIA DE DEUS 10308 US Hwy 1, Retal G4.....772-409-3645 (Veja nosso anúncio na página ao lado)

Missao Catolica Nossa Sra.Aparecida.........954-920-1070 Sheridan Hills Baptist- Minist.Brasileiro..954-961-4251

Igreja Adventista do 7* Dia......................…407-288-5732

LIGHTHOUSE POINT (Broward)

TAMPA (Hillsborough)

Assembleia de Deus Ministerio do Belem..954-782-0430

MIAMI (Miami Dade) Igreja da Salvação............................................305-592-6477 Igreja Discipulos de Cristo...........................305-718-8057 St. Catherine Catholic Church..................…954-920-1070

MIAMI BEACH (Miami Dade)

ASSEMBLEIA DE DEUS 7140 Abbott Ave - 2nd Floor....786-380-2258 (Veja nosso anúncio na página ao lado)

ASSEMBLEIA DE DEUS 7520 W. Waters Ave St10-13....813-969-4372 (Veja nosso anúncio na página ao lado) Family Community Church…........................813-890-9084 Friendly Hand Mission Center…................813-885-2323 Igreja Communidade da Familia…...............813-890-9084 Missao Batista Brasiliera em Tampa….........813-884-1517

WEST PALM BEACH (Palm Beach) Igreja Adventista Dia.................................…561-249-4645

Miami central Brazilian Seventh Day…......305-989-9779 Saint Joseph’s..............................................…305-866-6567

MARGATE (Broward) Igreja Assembleia de Deus Minist. Int........954-297-1830

MIAMI BEACH (Miami Dade) Ministerio Resgate.........................................305-944-4899

www.listabrasilusa.com

47


JOALHERIAS JOALHERIAS JEWELERS LIGHTHOUSE POINT (Broward) La Princesa Jewlery.........................................954-783-3620

POMPANO BEACH (Broward) Bijou Bijou and More.....................................954-975-5937 Joias Mil.............................................................954-783-6795 Petra’s Bijour...................................................561-305-0793 Visc Joalheria.....................................................954-943-2529

JORNAIS E PERIÓDICOS NEWSPAPERS & MAGAZINES GERAL CUPON 24 HORAS.............1-866-517-4467 (Veja nosso anúncio na página ao lado)

COCONUT CREEK (Broward) The Brazilian Paper..........................................954-782-6464

DEERFIELD BEACH (Broward) Achei USA........................................................954-570-7568 Linha aberta Gospel Magazine.....................954-360-9340 FORT LAUDERDALE (Broward) Brazilian People Magazine............................772-919-2476 Gazeta Brasilian News...................................954-938-9292 TiTiTi News......................................................954-709-5223

MIAMI (Miami Deade)

ACONTECE MAGAZINE.............305-493-1217 (Veja nosso anúncio nesta página)

Flórida Review Magazine..............................305-374-5235

48

1-866-517-4467


JORNAIS & PERIÓDICOS

www.listabrasilusa.com

49


JORNAIS & PERIÓDICOS ORLANDO (Orange) Brasileiros e Brasileiras….............................407-855-9541

POMPANO BEACH (Broward) Revista Conexão...............................................954-942-0714 So Sobre Rodas Revista..................................954-781-8151

LANCHONETES DELIS DEERFIELD BEACH (Broward)

CASA DO PASTEL 420 E. Sample Rd......................954-781-8778 (Veja nosso anúncio nesta página)

DI PIZZA RODÍZIO 3003 N. Federal Hwy.................954-942-7882 (Veja nosso anúncio em “PIZZARIAS”, pág..59)

Brazliced.............................................................954-725-5080

Padaria 2000.....................................................954-781-1594 Pamonharia Goiana..........................................954-785-2005 Pantanal..............................................................954-545-9147

BRAZILIAN DEPOT FOOD COURT 704 SW 10St.............................954-418-8656

RENASCER CAFÉ 1062 W. Sample Rd...................954-784-6674

(Veja nosso anúncio em “LOJAS BRASILEIRAS”, pág..51)

Crepes Company...............................................954-531-0981 Nosso Brasil......................................................954-428-3313 Padaria Brasil....................................................954-781-3474

FORT LAUDERDALE (Broward) Brazilian Point Cafe.........................................954-630-8840 Hot & Taste Cakes............................................954-933-9133

ORLANDO (Orange) Netto Ice Cream..................................................407-2266880

POMPANO BEACH (Broward) BRASIL ORIGINAL 3937 N. Federal Hwy.................954-785-0505 (Veja nosso anúncio em “RESTAURANTES”, pág.65.)

Brazil Point.......................................................954-366-6000

(Veja nosso anúncio em “RESTAURANTES”, pág.65)

MARGATE (BROWARD) CARRYFULL MARKET 5385 W. Atlantic Blvd...............954-968-7191 (Veja nosso anúncio em “PÁGINAS BRASILEIRAS”, pág.54)

TAMPA (Hillsborough) Moxie’s Café….................................................813-639-0111

LAVANDERIAS LAUNDRY BOCA RATON (Palm Beach) One Price Cleaners........................................(561) 477-2727

LETREIROS SIGNS BOCA RATON (Palm Beach) Signtronics....................................................…954-818-2276

HIALEAH GARDENS Brazil Signs…...................................................305-828-1441

ENGEAD GRAFICA BRASILEIRA 414/416 E. Sample Rd...............954-941-3778 (veja nosso anúncio em “GRAFICAS”, pág.44)

LIMUSINES LIMOUSINES DEERFIELD BEACH (Broward) B & B Limo Service..........................................754-264-2185

LIVRARIAS BOOK STORES POMPANO BEACH (Broward) Livraria CPAD..................................................954-941-9588

ORLANDO (Orange) Brasil Store........................................................321-234-1877

50

1-866-517-4467


LOJAS BRASILEIRAS

www.listabrasilusa.com

51


LOJAS BRASILEIRAS

AVENTURA (Miami Dade) Via Brasil…........................................................305-932-7848

BOCA RATON (Palm Beach) BOCA BRAZIL 22819 State Road 7...................561-372-0777 (Veja nosso anúncio nesta página)

BRAZIL USA 23049 State RD 441..................561-483-2618 (veja nosso anúncio na página acima)

DEERFIELD BEACH (Broward) Avenida Paulista..............................................954-574-5222 Brazil Connections..........................................954-571-7771

52

1-866-517-4467


LOJAS BRASILEIRAS

www.listabrasilusa.com

53


LOJAS BRASILEIRAS

54

1-866-517-4467


MANOBRISTAS BRAZILIAN DEPOT 704 SW 10St.............................954-420-0808 (Veja nosso anúncio na página 51)

LATINOS MEAT MARKET 1718 W. Hillsboro Blvd.............954-418-0503 (Veja nosso anúncio na página 53)

NOSSO BRASIL 71 SE 10st.................................954-428-3313 (Veja nosso anúncio na página 52)

FORT LAUDERDALE (Broward) All About Brazil..............................................954-771-3530 All Brazilian Wines.........................................954-523-8134 Brazilian Point.................................................954-630-8840

TERRA NOSSA BRAZILIAN PRODUCTS 1311 E. Commercial Blvd..........954-938-1885 ZIP COD 3334 ..................... FAX: 954-938-1886

MARGATE (Broward) CARRYFULL MARKET 5385 W. Atlantic Blvd...............954-968-7191 (Veja nosso anúncio na página ao lado)

ORLANDO (Orange) Brazar Brasil…..................................................407-351-0303 Brazil Center….................................................407-363-0503 Value Dollar..................................................…407-292-6644

POMPANO BEACH (Broward) Central do Brasil Atlantic..............................954-785-5991 Central do Brasil Federal................................954-785-2131 Pantanal Store..................................................954-784-2334 Seabra Supermarkets........................................954-783-9895

SUNRISE (Broward) Toque Brasil.......................................................954-578-1030

TAMPA (Hillsborough) Armazem Oasis..............................................…813-933-2900

FORT MYERS (Lee) Brazilian Meat Market…................................239-274-0774 Candore Express...........................................…239-931-3226 Loja do Chico...............................................…239-278-1322 Supermercado Mundo Latino Brasileiro.....239-277-1221 XPress Market...................................................239-274-0774

MIAMI (Miami Dade) Bodega............................................................…305-221-9200 Mercado Brasiliero......................................…305-670-0941 Smart Trading....................................................305-371-7750

www.listabrasilusa.com

MANOBRISTAS VALET SERVICES OAKLAND PARK (Broward) PRIDE VALET SERVICES 3260 NE 16th AVe # B..............754-245-1012 (veja noss anúncio nesta página)

55


MARMORE & GRANITO MARMORE E GRANITO MARBLE & GRANITE DEERFIELD BEACH (Broward) Planet Marble & Granite Inc..........................954-480-6044

MARGATE (Broward) JL HOME PROJECTS Kitchen and Remodeling 2716 N. State Rd 7....................954-971-2994 (Veja nosso anuncio em “CONSTRUÇÃO & REFORNA”, pág. 34)

MIAMI (Miami Dade) Brazil America Stones, Inc.............................305-593-7387

ORLANDO (Orange) Castle Flooring.............................................…407-532-8247 Earthrock Granite…........................................407-859-4377 The Granite Masters....................................…407-678-7600

POMPANO BEACH (Broward) Colli Depot........................................................954-709-7342 Planet Marble & Granite Inc..........................561-756-6352 MEDICO E CLINICO GERAL DOCTOR AND GENERAL CLINIC Ver “Clinicas de Estética” e “ Clinicas Médicas”

MÓVEIS & ELETRODOMÉSTICOS FURNITURE & APPLIANCES CORAL GABLES (Miami Dade) Artefacto......................................................…305-774-0004

DANIA BEACH (Broward)

OAKLAND PARK (Broward)

Ebano Soberon-Movies Rusticos................954-921-7453

Homeland USA Furniture...............................954-564-3334

FORT LAUDERDALE (Broward)

POMPANO BEACH (Broward)

Atrefacto.............................................................954-564-5775

AP Restoration.................................................954-288-8935

MARGATE (Broward)

C&S APPLIANCES, INC 901 E. Sampler Rd.....................954-784-5180

Urbano’s Furniture..........................................954-978-2730

56

(Veja nosso anúncio nesta página)

1-866-517-4467


MÓVEIS & ELETRODOMÉSTICOS

www.listabrasilusa.com

57


MUDANÇAS & CONTENES MUDANÇAS & CONTENES MOVING & DRY CONTAINERS FORT MYERS (Lee) BrCourier............................................................239-265-1901

ORLANDO (Orange) Expresso Brasileirinho…...............................407-352-1000 Iba Express…....................................................407-354-0340 Inter Global Mudancas…...............................407-294-1427

POMPANO BEACH (Broward) Adonai Express................................................888-268-8882 Brasil Courier................................................1-866-635-4949 Fastway Moving...............................................954-972-3797 Interact Moving Services Inc.........................954-946-8282 Nacional Moving.............................................866-970-0311 Status Baby Transporte e Mudanças............954-943-5966 Transamerica Moving Corp............................866-941-1718

OTICAS OPTICAL DEERFIELD BEACH (Broward) GUARDIAN EYECARE CENTER 1500 SE 3rd Court.....................954-428-2002 (veja nosso anúnio nesta página) Manufacturer Direct Eyerwear.......................954-570-9293 Otica Brasileira Twenty Twenty....................954-571-2022

POMPANO BEACH (Broward) OKULOS.COM IMP. & EXP. 579 E. Sample Rd......................954-786-1214 (veja nosso anúncio nesta página)

58

1-866-517-4467


PRODUTOS NATURAIS PADARIAS BAKERY BOCA RATON (Palm Beach) Casa do Pão...................................................…561-852-8390

FORT LAUDERDALE (Broward) Hot & Taste........................................................954-933-9133

FORT MYERS (Lee) Sugar Bread........................................................239-275-3285

OAKLAND PARK (Broward) Terra Nossa.........................................................954-776-6355

ORLANDO (Orange) Brazil 24 Hours................................................407-666-5001 Pao Gostoso Bakery…...................................407-535-1800 Panolli Bakery..................................................407-447-8946

PEMBROKE PINES (Broward) Brazil Tropical..................................................954-442-9398

POMPANO BEACH (Broward) Padaria & Cafe 2000........................................954-781-1594 Padaria 2000.....................................................954-781-3474 Pantanal..............................................................954-545-9147

PET SHOP BOCA RATON (Palm Beach) Happy Grooming..............................................561-470-1230

CORAL SPRINGS (Broward) Yuppy Puppy.....................................................954-753-7647

LIGHHOUSE POINT (Broward)

ORLANDO (Orange) Francesco’s Pizzaria........................................407-345-5490 HiPizza...........................................................…407-354-7900 Simply Homemade........................................…407-579-3848

Splash.................................................................954-942-9419

POMPANO BEACH (Browad)

PIERCINGS E TATUAGENS PIERCINGS & TATTOOS POMPANO BEACH (Broward)

DI PIZZA RODIZIO 3003 North Federal Hwy............954-942-7882

Wild Side Tatoo & Body Shop......................954-785-9292

PIZZARIAS PIZZERIAS BOCA RATON PICANHA BRAZIL 22797 State Rd 7 (441) ............561-488-5737

Brooklin Delli & Pizzas.................................954-941-4442

(Veja nosso anúncio nesta página) Rotelli.................................................................954-977-4466

PRODUTOS BRASILEIROS BRAZILIAN PRODUCTS Veja “LOJAS BRASILEIRAS”

(Veja nosso anúncio em “RESTAURANTES”, pág.62)

PRODUTOS NATURAIS NATURAL PRODUCTS

DEERFIELD BEACH (Broward) BRAZILIAN DEPOT - PIZZA EXPRESS 700 SW 10 Th St.......................954-418-8656

CITA CENTRO INT. TERAPIA ALTERNATIVE 3731 NW 9 Ave # 4...................954-451-2631

(Veja nosso anúncio em “LOJAS BRASILEIRAS” na pág. 51)

Pizzarella ...........................................................954-426-1515

FORT LAUDERDALE (Broward) Pizza Rustica.....................................................954-567-2992

HOLLYWOOD (Broward) Pizzarela.............................................................954-963-7171

www.listabrasilusa.com

59


REMESSAS DE DINHEIRO

60

1-866-517-4467


REMESSAS DE DINHEIRO REMESSAS DE DINHEIRO MONEY TRANSFERS DEERFIELD BEACH LATINOS MEAT MARKET INC 1718 W. Hillsboro Blvd...............954-418-050 (Veja nosso anúncio em “LOJAS BRASILEIRAS”pág.53)

FORT LAUDERDALE (Broward) TERRA NOSSA 1311 Commercial Blvd..............954-938-1885 JACKSONVILLE (Saint Lucie) Coisas do Brasil...........................................…904-880-0626

MIAMI (Miami Dade) Inter Transfers (Star Money Transfers)….1-877-565-8667

MONEY EXPRESS 100 SE 2nd St, Ste 155 ..........…305-444-9773 (Veja nosso anúncio nesta página)

NORTH BAY VILLAGE (Miami Dade) Global Remessas…..........................................305-866-0111

ORLANDO (Orange) Cash Corporation.........................................…407-352-3577 Chang Express…..............................................407-403-6177 Easy Cash Easy.........................................…1-888-577-2434 Flash............................................................…1-877-352-7404

MONEY EXPRESS 1405 S. Haiawasse Rd Ste A.......407-298-0209 (Veja nosso anúncio ao lado)

Star Money Transfers...............................…1-888-746-4630 ZPD Consulting...........................................…407-248-2501

POMPANO BEACH (Broward) Inter Transfers....................................................954-785-2529

MONEY EXPRESS 33064 W. Sample Rd.................954-785-9233

NAMUR TRANSFERS 1391 E. Sample Rd....................954-784-4660 (Veja nosso anúncio na página ao lado)

Real Transfer .....................................................954-781-1886 Vigo.....................................................................954-942-8446 Vionaldo Express.............................................954-943-9995

ST.PETERSBURG (Hillsborough) Rapid Financial Services…............................727-828-3333

(Veja nosso anúncio na página ao lado)

www.listabrasilusa.com

61


RESTAURANTES & CHURRASCARIAS BOCA RATON (Palm Beach) PICANHA BRAZIL STEAK HOUSE 22797 State Rd 7 (441)…..........561-488-5737 (Veja nosso anúncio nesta página)

COCONUT CREEK (Broward) Barriga Cheia.....................................................954-426-1115

CORAL SPRINGS (Broward) Brazil Brasil.......................................................954-575-2627

DEERFIELD BEACH (Broward) Baja Cafe.............................................................954-596-1305 Brasliced Lanchonete Brasileira...................954-725-5080 Brazil Connections..........................................954-571-7771

BRAZILIAN DEPOT 704 SW 10St.............................954-420-0808 (Veja nosso anúncio na página 51)

CAFE MINEIRO 800 S. Federal Hwy.....................954-426-1106 (Veja nosso anúncio na página ao lado) Chico Mineiro...................................................954-419-9679

LATINOS MEAT MARKET 1718 W. Hillsboro Blvd.............954-418-0503 (Veja nosso anúncio na página 53) Nosso Brasil......................................................954-428-3313 Oba Oba Restaurante.......................................954-429-8292

62

1-866-517-4467


RESTAURANTES & CHURRASCARIAS

www.listabrasilusa.com

63


RESTAURANTES & CHURRASCARIAS DELRAY BEACH Gol - Brazilian Steak House.........................561-272-6565

FORT LAUDERDALE (Broward) Brazilian Point Cafe.........................................954-630-8840 Cafe Vico Ristorante.........................................954-565-9681 Chima Steakhouse............................................954-712-0580

FORT MYERS (Lee) AMAZON GRILL BRAZILIAN STEAK HOUSE 11609 S. Cleveland Ave ............239-939-0993 (Veja nosso anúncio na página 62)

BEM BRASIL RESTAURANT 2529 Simpson St....................…239-939-5445 (Veja nosso anúncio nesta página) Supermercado Mundo Latino Brasileiro.....239-277-1221

LIHTHOUSE POINT (Broward) Gaucho Rodizio Steakhouse.........................954-784-7667

MARGATE (Broward) CARRYFULL MARKET 5385 W. Atlantic Blvd...............954-968-7191 (Veja nosso anúncio na página 54)

MIAMI (Miami Dade) Camilla’s Restaurant.......................................305-375-0992 Rios Churrascaria........................................…305-373-2777 Texas de Brasil Churrascaria......................…305-599-7729

64

1-866-517-4467


RESTAURANTES & CHURRASCARIAS MIAMI BEACH (Miami Dade) CYPO CAFÉ 7438 Collins Ave....................…305-865-3811 (Veja nosso anúncio na página ao lado) Marinheitro Restaurant...................................305-377-4442 Varanda’s Brasil...........................................…305-867-2929

ORLANDO (Orange) Arroz com Pollo…...........................................407-351-7090 Brazil 24 Hours................................................407-666-5001 Camila’s Restaurante..................................…407-354-2507 Crazy Grill…....................................................407-354-4404 Jazz & Samba Nights…...................................407-963-3745 Nelore Steak House.........................................407-345-4774 Show de Bola…................................................407-363-0883 Simply Homemade........................................…407-579-3848 Sushi Fashion..................................................407-535-1800 Vitorio’s Brazilian Restaurante…................407-352-1255

PEMBROKE PINES (Broward) BRAZIL TROPICAL GOURMET 1411 N. Palm Ave.....................954-442-9398 (Veja nosso anúncio nessa página)

POMPANO BEACH (Broward) Branca’s Steack House...................................954-785-2725

BRASIL ORIGINAL 3937 N. Federal Hwy.................954-785-0505 (Veja nosso anúncio nesta página) Caminho de Casa Restaurant..........................954-941-0906

www.listabrasilusa.com

65


RESTAURANTES & CHURRASCARIAS SALÃO DE BELEZA BEAUTY SALON BOCA RATON (Palm Beach) Hair by Emnuele...........................................…561-394-5575 Helena’s Beauty…...........................................561-487-3292 Priscilla Barboza..............................................561-305-9982 Sunlite Hair Studio.....................................…561-391-9383 Teka Brazil..........................................................561-961-4551

DEERFIELD BEACH (Broward) ANDREA’S SALON & SPA 438 W. Hillsboro Blvd…...............................954-421-1909 (Veja nosso anúncio na página ao lado) Bella Flore.....................................................…954-427-3438 Brazilian Depot Hair Salon.......................…954-421-2441 Brazilian Olga Salon..................................….954-420-0011 Latinos Spa & Beauty Salon.........................954-422-9830 Salao Brasil…...................................................954-725-8585

DI PIZZA RODIZIO 3003 North Federal Hwy............954-942-7882 (Veja nosso anúncio na página 59) Feijao com Arroz..............................................954-784-0909 Panorama Restaurante.....................................954-784-7882

FORT LAUDERDALE (Broward)

RENACER CAFE 1062 W. Sample Rd...................954-784-6674

Beauty Secret Palmira Moura…....................954-489-1033 Diego Moura Barber & Stylist..................…954-785-6400 Lucho’s Unisex Haircus............................…954-565-6930

(Veja nosso anúncio na página 65)

RESTAURANTE BRASIL 843 W. Sample Rd......................954-781-3114 (Veja nosso anúncio nesta página) Restaurante Cafe Brasil...................................954-782-5235 Tutti Fratelli…..................................................954-788-8789

RIVER TOWN SQUARE (Broward) Brazilian Grill...................................................954-421-1559

FORT MYERS (Lee) Adel’s Hair Design….....................................239-545-3683 Conalex Hair Salon......................................…239-939-0021 LA Beaute Salon & Spa…..............................239-437-3333 Planet Hair....................................................…239-939-4247

REINA’S HAIR DESIGN & SPA 1906 Boy Scout Drive...............239-936-3573 (Veja nosso anúncio na página ao lado)

TAMPA (Hillsborough)

MIAMI (Miami Dade)

Boizao Steakhouse......................................…813-286-7100 Casa Brasil Café…............................................813-881-9121

Jacques Janine Total Beauty….......................305-718-4191 Bradice Hair Salon….......................................305-554-0667

66

1-866-517-4467


SALÃO DE BELEZA

Paolo Salon.......................................................305-372-1449 Spa & Hair Group…........................................305-271-8998

MIAMI BEACH ( Miami Dade) Hair Studios 75............................................…305-865-9914 Glamour ….........................................................305-672-7142

MARGATE (Broward) Paradise Tan & Day Spa…..............................954-956-9226

ORLANDO (Orange) BC Beuty Salon................................................321-244-1700 BI’SM.............................................................…407-903-9393 Design Cuts…..................................................407-240-3087 Eva’s Beauty Image….....................................407-925-3160 Hair & Nail Salon Perfumeland…................407-248-9595 Hair Salon..........................................................321-662-4383 MM Beauty Salon........................................…407-345-9110 Sanctuary Salon & Day Spa….......................407-909-1011

www.listabrasilusa.com

POMPANO BEACH (Broward) ANDREA’S HAIR DESIGN 1054 W. Sample Rd...................954-786-3545 517 E.Sample Rd.......................954-783-8691 (Veja noso anúncio nesta página) Beauty Palace Day Spa…...............................954-545-0231 Brazilian hair & Spa.........................................954-783-7878 Brazilian Touch Hair Design….....................954-942-9818 Ipanema Salon...............................................…954-788-9922 Pompano Beach…............................................954-523-6726

SUELY SALON 540 E. Sample Rd......................954-784-0632 (Veja nosso anúncio na págia ao lado) The Hair Studio Inc.....................................…954-785-7887 Tropical Beauty.............................................…954-783-9956

67


SAPATOS Novus Insurance…..........................................954-698-6601

FORT LAUDERDALE (Broward) ALLSTATE INSURANCE - AL BERGLER 2400 W.Cypress Creek Rd, Ste 98..........954-486-0006 (Veja nosso anúncio ao lado)

FORT MYERS (Lee) MADE IN BRAZIL - INSURANCE & SERVICES 2301 Fowler St, Ste 3.................239-931-6079 (Veja nosso anúncio na página 70)

Metro Business Solutions Inc…..................239-466-8600 Mezzatesta Insurance Agency........................239-945-7844

ORLANDO (Orange) Accent Brokers….............................................407-816-5299 Allstate Insurance........................................…407-869-6838

PLANTATION (Broward) FedUsa Insurance.............................................954-475-0182

POMPANO BEACH (Broward) AGUIAR INSURANCE AGENCY 4081 North Federal Hwy, Ste 10…..............954-785-3992 (Veja nosso anúncio na página ao lado) Ed’s Insurance Agency...............................…954-782-0411 Express Insurance…........................................954-943-7900

SANTOS SEGUROS 577 East Sample Rd................…954-788-4543 SAPATOS SHOES DEERFIELD BEACH (Broward)

(Veja nosso anúncio na página 70)

Aldo Sapateiro Italiano......................................954-426-1930

CABBLER TWELVE SHOE REPAIR 816 SE 9th Ste B - Palm Plaza....954-426-1930 (Veja nosso anúncio nesta página)

SEGURADORAS INSURANCES BOCA RATON (Palm Beach) Exclusive Insurance…....................................561-488-1200

COCONUT CREEK (Broward) American Quality insurance......................…954-420-0093 Santa Fe Insurance...........................................954-354-0478 Progressive Seguros.........................................954420-0093

DEERFIELD BEACH (Broward) Ancora insurance….........................................954-420-5998 Boca Insurance Group…................................954-786-3000

68

1-866-517-4467


SEGURADORAS

www.listabrasilusa.com

69


SEGURADORAS

70

1-866-517-4467


TRANSPORTES & VANS

www.listabrasilusa.com

71


TRANSPORTES E VANS TRANSPORTES & VANS TRANSPORTS & VANS FORT MYERS (Lee) Viana’s Transportation...................................239-297-0386

ORLANDO (Orange) Alltour of America...........................................407-226-0700

PONPANO BEACH (Broward) BRAZIL SHUTTLE 591 E. Sample Rd......................561-880-7965 (veja nosso anúncio na página 71)

VIDEO LOCADORAS RENTAL MOVIES PONPANO BEACH (Broward) EXIT VIDEO 1833 E. Sample Rd....................954-783-6570 (veja nosso anúncio nesta página)

VIDEO PRODUÇÃO VIDEO PRODUCTION Ver “Agencia de Publicidades”e “Filmagens” WEBSITES ACONTECE.COM...................305-493-1217 (Veja nosso anúncio logo abaixo)

DESIGN MEDIA PRO...........1-800-517-2993

72

1-866-517-4467


Visite nosso site para mais cupons de descontos

www.listabrasilusa.com www.listabrasilusa.com

73


Visite nosso site para mais cupons de descontos

www.listabrasilusa.com 74

Anuncie:1-866-517-4467


Visite nosso site para mais cupons de descontos

www.listabrasilusa.com Anuncie: 1-866-517-4467

75


Visite nosso site para mais cupons de descontos

www.listabrasilusa.com 76

Anuncie:1-866-517-4467


Visite nosso site para mais cupons de descontos

www.listabrasilusa.com Anuncie: 1-866-517-4467

77


Visite nosso site para mais cupons de descontos

www.listabrasilusa.com 78

Anuncie: 1-866-517-4467


Visite nosso site para mais cupons de descontos

www.listabrasilusa.com Anuncie: 1-866-517-4467

79


Visite nosso site para mais cupons de descontos

www.listabrasilusa.com 80

1-866-517-4467


Visite nosso site para mais cupons de descontos

www.listabrasilusa.com www.listabrasilusa.com

81


82

1-866-517-4467


www.listabrasilusa.com

83


84

1-866-517-4467


AJUDA AO IMIGRANTE NA FLÓRIDA Florida Immigrant Coalition Um programa da “Florida Immigrant Advocacy Center” 3000 Biscayne Blvd., # 400, Miami, Florida 33137 Tel.: 305-573-1106 ext. 1160 - Fax: 305-576-6273 Email: dskovholt@fiacfla.org - www.fiacfla.org/coalition.php Minority Help A Minority Help é uma organização sem fins lucrativos, fundada em março de 2005, com o objetivo de oferecer serviços gratuitos que possam atender às necessidades mais importantes dos brasileiros vivendo nos Estados Unidos. Tel. 954-725-1202 - minorityhelp@comcast.net The Winner Women Association (Vencedoras na América) Associação de apoio a mulheres imigrantes Contato: Marcia da Silva, presidente 1845 NW 112 Ave., suíte 208 - Miami, Fl Tel. 305-298-5395 - mbsilva@bellsouth.net Centro Cultural Brasil USA-CCBU O Centro Cultural Brazil - USA da Florida é uma organização sem fins lucrativos fundada em maio de 1997, dedicada a divulgação do idioma português e da cultura brasileira. 80 SW 8th Street - Suite 2600 - Miami , FL 33130 Tel. 305-376-8864 - E-mail: ccbu@bellsouth.net - www.brazilmiamicultural.org Fundação Vamos Falar Português Organização não governamental, não partidária e sem fins lucrativos que tem como missão promover o idioma português e divulgar a cultura brasileira de modo geral, no seio da comunidade brasileira no sul da Florida. 4079 NW 79 Avenue - Miami, FL 33166 - Tel. 305-804-5957 - fax 786-3631062 E-mail: andre@vamosfalarportugues.org - http://www.vamosfalarportugues.org BATB - Brazilian Association of Tampa Bay Organização sem fins lucrativos criada com a finalidade de prestar orientação e assistência nas áreas jurídica, de saúde e de imigração, aos brasileiros residentes nas áreas de Tampa Bay e Sarasota; integrar a comunidade e realizar eventos sociais e/ou cívicos para manter as tradições brasileiras. 5712 W. Waters Ave. - suite 9 - Tampa, FL 33634 Sunflower Benevolent - USA A Sunflower Benevolent foi criada há 5 anos no Brasil e há 3 anos nos EUA com a total iniciativa de brasileiros que vivem atualmente no sul da Flórida. É uma fundação sem fins lucrativos, para apoiar famílias carentes no Brasil e no sul do Flórida. Desenvolvem cursos como: corte e costura, artesanato / reciclagem e modelagem industrial. Sua Missão: executar e manter programas de apoio à famílias carentes no Brasil e no sul da Flórida. Orientando-as nas áreas educacionais, sociais e de saúde 5440 North State Road 7 (441) - Suite 218 North Lauderdale, FL 33319 Tel. 954-485-9889 / 561-667-5128 - www.sunflowerbenevolent.org

www.listabrasilusa.com

85


CONSULADOS E EMBAIXADAS BRASILEIRAS NOS ESTADOS UNIDOS CONSULADO GERAL DO BRASIL EM BOSTON 20 Park Plaza - Suite 1420 Boston, MA 02116 Tel: 617-542-4000 Fax: 617-542-4318 E-mail: cgbos@consulatebrazil.org Juridição: Estados de Maine, Massachusetts, New Hampshire, Rhode Island, and Vermont

CONSULADO GERAL DO BRASIL EM CHICAGO 401 North Michigan Ave - Suite 3050 Chicago, IL 60611 Tel: 312-464-0244 Fax: 312-464-0299 E-mail: central@brazilconsulatechicago.org Juridição: Estados de Illinois, Indiana, Iowa, Michigan, Minnesota, Missouri, Nebraska, North Dakota, South Dakota, and Wisconsin

CONSULADO GERAL DO BRASIL EM HOUSTON 1233 West Loop South - Park Tower North Suite 1150 Houston, Texas 77027 Tel: 713-961-3063 Fax: 713-961-3070 E-mail: consbras@brazilhouston.org Homepage: www.brazilhouston.org Juridição: Estados de Arkansas, Colorado, Kansas, Louisiana, New Mexico, Oklahoma and Texas.

CONSULADO GERAL DO BRASIL EM LOS ANGELES 8484 Wilshire Blvd - Suites 711-730 Beverly Hills, CA - 90211 Tel: 323-651-2664 Fax: 323-651-1274 E-mail: comunicacoes@brazilian-consulate.org Homepage: www.brazilian-consulate.org Juridição: Estados de Arizona, Hawaii, Idaho, Montana, Nevada, Utah, Wyoming, and in the State of California the counties of: Imperial, Kern, Los Angeles, Orange, Riverside, San Bernardino, San Diego, San Luis Obispo, Santa Barbara, and Ventura.

86

CONSULADO GERAL DO BRASIL EM MIAMI 80 SW 8th Street Suite 2600 Miami, FL 33130

Tel: 305-285-6200 Fax: 305-285-6229 E-mail: consbras@brazilmiami.org Homepage: www.brazilmiami.org Juridição: Estados de Alabama, Florida, Georgia, Mississippi, North Carolina, South Carolina, and Tennessee. PuertoRico, US Virgin Islands and the Commonwealth of Bahamas.

CONSULADO GERAL DO BRASIL EM NEW YORK 1185, 6th Ave (Avenue of the Americas), 21st Floor New York, NY 10036 Tel: 917-777-7777 / 917-777-7601 Fax: 2l2-827-0225 E-mail: consulado@brazilny.org Homepage: www.brazilny.org Juridição: Estados de Connecticut, Delaware, New Jersey, New York, Pennsylvania and the Bermuda Islands.

CONSULADO GERAL DO BRASIL EM SAN FRANCISCO 300 Montgomery Street - Suite 900 San Francisco, CA 94104 Tel: 415-981-8170 Fax: 415-981-3628 E-mail: brazilsf@brazilsf.org Homepage: www.brazilsf.org Juridição: Estados de Alaska, Oregon, Washington, and in the State of California, all the counties not included in the jurisdiction of Los Angeles.

EMBAIXADA BRASILEIRA - SERVIÇO CONSULAR EM WASHINGTON, D.C. 3009 Whitehaven Street, N.W. Washington, D.C. 20008 Tel: 202-238-2837 Fax: 202-238-2818 E-mail: consular@brasilemb.org Homepage: www.brasilemb.org Juridição: Estados de Columbia, States of Kentucky, Maryland, Ohio, Virginia, and West Virginia. 1-866-517-4467


PROVIDÊNCIAS QUE O BRASILEIRO RESIDENTE NO EXTERIOR DEVE TOMAR A Secretaria da Receita Federal informa que a Declaração de Isento para as Pessoas Físicas deverá ser apresentada a partir de 1 de julho de 1998. A data limite para a entrega dependerá do último algarismo do CPF do contribuinte. Para maiores informações, consulte o seguinte endereço: www.receita.fazenda.gov.br. Comunicar imediatamente ao Consulado a ocorrência de perda, furto, extravio ou destruição do passaporte; No caso de casamento no exterior (independentemente da nacionalidade do cônjuge), providenciar o registro da certidão de casamento em Consulado brasileiro; A sentença de divórcio estrangeira, deverá ser autenticada pelo Consulado Brasileiro da jurisdição consular e posteriormente homologada no Brasil pelo Supremo Tribunal de Justiça (somente após a homologação poderá ser feito o registro do novo casamento); No caso de nascimento no exterior, sendo brasileiro o pai e/ou a mãe, providenciar o registro do nascimento em Consulado brasileiro; No caso de falecimento no exterior, declarante brasileiro ou, à falta, funcionário consular assinará o assentamento de óbito do de cujus em Consulado brasileiro; Para o nacional de sexo masculino e com idade entre 18 e 45 anos, cumprir com suas obrigações com o Serviço Militar, providenciando junto ao Consulado brasileiro seu alistamento e adiamento(s) de incorporação; Em época de eleições, cumprir com suas obrigações eleitorais junto a Consulado brasileiro. Fonte: http://www.consulatebrazil.org/Providencias.htm

wwww.listabrasilusa.com

87


DIREITOS DO CIDADÃO BRASILEIRO DETIDO NO EXTERIOR O cidadão brasileiro que seja detido nos Estados Unidos tem o direito de solicitar à autoridade norte-americana competente que informe o fato ao Consulado brasileiro mais próximo. Feita essa solicitação, a comunicação ao Consulado brasileiro deve ser necessariamente providenciada pela autoridade. Ao cidadão detido é igualmente assegurado o direito de fazer contato direto com o Consulado brasileiro. O Consulado poderá auxiliar a encontrar um advogado ou oferecer outro tipo de ajuda como, por exemplo, comunicar-se com a família do detido.

CONVENÇÃO DE VIENA SOBRE RELAÇÕES CONSULARES (Assinada pelo Brasil e pelos Estados Unidos em Viena, a 24 de abril de 1963)

Artigo 36 Comunicação com os nacionais do Estado que envia A fim de facilitar o exercício das funções consulares relativas aos nacionais do Estado que envia: a. Os funcionários consulares terão liberdade de se comunicar com os nacionais do Estado que envia e visitá-los. Os nacionais do Estado que envia terão a mesma liberdade de se comunicarem com os funcionários consulares e de visitá-los; b. Se o interessado lhes solicitar, as autoridades competentes do Estado receptor deverão, sem tardar, informar a repartição consular competente quando, em sua jurisdição, um nacional do Estado que envia for preso, encarcerado, posto em prisão preventiva ou detido de qualquer outra maneira. Qualquer comunicação endereçada à repartição consular pela pessoa detida, encarcerada ou presa preventivamente deve igualmente ser transmitida sem tardar pelas referidas autoridades. Estas deverão imediatamente informar o interessado de seus direitos nos termos do presente subparágrafo; c. Os funcionários consulares terão direito de visitar o nacional do Estado que envia, o qual estiver detido, encarcerado ou preso preventivamente, conservar e corresponder-se com ele, e providenciar sua defesa perante os tribunais. Terão igualmente o direito de visitar qualquer nacional do Estado que envia encarcerado, preso ou detido em sua jurisdição em virtude de execução de uma sentença. Todavia, os funcionários consulares deverão abster-se de intervir em favor de um nacional encarcerado, preso ou detido preventivamente, sempre que o interessado a isso se opuser expressamente. As prerrogativas a que se refere o parágrafo 1o do presente artigo serão exercidas de acordo com as leis e regulamentos do Estado receptor, devendo, contudo, entender-se que tais leis e regulamentos não poderão impedir o pleno efeito dos direitos reconhecidos pelo presente artigo.

Fonte: www.consulatebrazil.org

88

1-866-517-4467


NACIONALIDADE BRASILEIRA Dupla Nacionalide Filhos de brasileiros nascidos no exterior podem ser registrados no Consulado brasileiro para obter, posteriormente, a nacionalidade brasileira, além da nacionalidade do país de nascimento do menor. Aos brasileiros é recomendado o registro de seus filhos no Consulado, que poderá ser feito até a criança completar 12 anos de idade. Ademais de ser a prova de filiação, o ato de registro de nascimento é grátis. O registro é feito com base em certidão de nascimento ou documento equivalente, emitido por autoridade competente de qualquer cidade do país. Pode-se também registrar nascimentos ocorridos em outros países, desde que a certidão seja previamente legalizada junto ao Consulado brasileiro no país de origem do documento. Não há qualquer restrição quanto à múltipla nacionalidade de brasileiros. A nacionalidade brasileira não exclui a possibilidade de possuir, simultaneamente, a nacionalidade norteamericana. A perda de nacionalidade brasileira somente ocorrerá no caso de vontade formalmente manifestada pelo indivíduo. Em suma, ao tornar-se cidadão americano, por processo de naturalização, o cidadão brasileiro não perde automaticamente a cidadania brasileira, mas sim, passa a ter dupla cidadania: brasileira, por nascimento, e americana, por naturalização.

Perda de Nacionalidade Em conseqüência da Emenda Constitucional de revisão nº3, de 09/06/94, não são mais passíveis de perder a nacionalidade brasileira aqueles cidadãos que adquirirem outra nacionalidade em conseqüência de imposição de naturalização pela norma estrangeira, ao brasileiro residente em Estado estrangeiro, como condição para permanência em seu território ou para o exercício de direitos civis. Assim sendo, somente será instaurado processo de perda de nacionalidade quando o cidadão manifestar expressamente, por escrito, sua vontade de perder a nacionalidade brasileira. Caso contrário não ocorrerá processo de perda de nacionalidade. Os seguintes documentos são necessários para o processo de perda da nacionalidade brasileira: 1- carta dirigida à Autoridade consular; 2- original da certidão de nascimento 3- original da certidão de casamento 4- original do certificado de naturalização (que será fotocopiado e devolvido) 5- passaporte estrangeiro. A perda da nacionalidade brasileira será considerada definitiva somente após publicação no “Diário Oficial da União”.

Reaquisição de Nacionalidade O brasileiro que houver perdido a nacionalidade brasileira em virtude do disposto no artigo 12, II, da Constituição Federal de 1988, poderá solicitar sua reaquisição, mesmo que esteja residindo no exterior, por meio da apresentação ao Consulado dos seguintes documentos: 1. requerimento de revogação do decreto de sua perda de nacionalidade brasileira, dirigido ao Cônsul-Geral; 2. requerimento de revogação do decreto de sua perda de nacionalidade brasileira, dirigido ao Ministro da Justiça; 3. original da certidão de nascimento do requerente, cuja cópia deverá ser autenticada pelo Consulado (custo: US$ 5.00); e, 4.original da carteira de identidade ou passaporte brasileiro, se disponível. O processamento do requerimento de reaquisição da nacionalidade brasileira é gratuito. Fonte: www.consulatebrazil.org

wwww.listabrasilusa.com

89


As informações que você encontrará das páginas 91 à 108 é parte do “Guia para Novos Imigrantes”, produzido pelo U.S. Departamente of Homeland Security. Para ver o guia completo, por favor visitar o site: www.uscis.gov

90

1-866-517-4467


6HXV'LUHLWRVH5HVSRQVDELOLGDGHVFRPR 5HVLGHQWH3HUPDQHQWH  &RPRUHVLGHQWHSHUPDQHQWHYRFrGHYHUiUHVSHLWDUHVHUOHDODRV(VWDGRV8QLGRVEHPFRPR REHGHFHUjVOHLVGRSDtV6HUUHVLGHQWHSHUPDQHQWHWDPEpPVLJQLÀFDWHUQRYRVGLUHLWRVH UHVSRQVDELOLGDGHV

6HUUHVLGHQWHSHUPDQHQWHpXP´SULYLOpJLRµQmRXP´GLUHLWRµ2JRYHUQRGRV(8$SRGHUHYRJDU RVHXVWDWXVGHUHVLGHQWHSHUPDQHQWHVREGHWHUPLQDGDVFRQGLo}HVeQHFHVViULRPDQWHURVHXVWDWXV GHUHVLGHQWHSHUPDQHQWHVHYRFrTXLVHUYLYHUHWUDEDOKDUQRV(VWDGRV8QLGRVHWRUQDUVHFLGDGmR GRV(8$DOJXPGLD1HVWDVHomRYRFrDSUHQGHUiRTXHVLJQLÀFDVHUUHVLGHQWHSHUPDQHQWHHFRPR PDQWHURVWDWXVGHUHVLGHQWHSHUPDQHQWH

U.S. Department of Homeland Security, U.S. Citizenship and Immigration Services, Office of Citizenship, Welcome to the United States: A Guide for New Immigrants,Washington, DC, 2007, Part’s Revised Edition.

wwww.listabrasilusa.com

91


6HXV'LUHLWRVH5HVSRQVDELOLGDGHV  2TXHÀ]HUDJRUDTXHVHWRUQRXUHVLGHQWHSHUPDQHQWHWHUiUHSHUFXVVmRQRIXWXURTXDQGRYRFrTXLVHU WRUQDUVHFLGDGmRGRV(8$2SURFHVVRGHWRUQDUVHFLGDGmRGRV(8$pGHQRPLQDGR´QDWXUDOL]DomRµ &RPRUHVLGHQWHSHUPDQHQWHYRFrWHPGLUHLWRD ‡9LYHUHWUDEDOKDUSHUPDQHQWHPHQWHHPTXDOTXHUOXJDUGRV(8$ ‡5HTXHUHUFLGDGDQLDDPHULFDQDDSyVWHUFXPSULGRWRGRVRVUHTXLVLWRV ‡6ROLFLWDUYLVWRVSDUDTXHRHVSRVRHVSRVDHÀOKRVQmRFDVDGRVSRVVDPYLYHUQRV(8$ ‡2EWHUEHQHItFLRVGD3UHYLGrQFLD6RFLDO5HQGD6XSOHPHQWDUGD3UHYLGrQFLDHEHQHItFLRVGR0HGLFDUH VHWLYHUGLUHLWR ‡7HUSURSULHGDGHVQRV(8$ ‡6ROLFLWDUFDUWHLUDGHPRWRULVWDHPVHXHVWDGRRXWHUULWyULR ‡6DLUHUHJUHVVDUDRV(8$VREGHWHUPLQDGDVFRQGLo}HV ‡)UHTHQWDUHVFRODVHXQLYHUVLGDGHVS~EOLFDV ‡,QJUHVVDUHPGHWHUPLQDGRVVHWRUHVGDV)RUoDV$UPDGDVGRV(8$ ‡&RPSUDUHSRVVXLUDUPDVGHIRJRGHVGHTXHQmRKDMDUHVWULo}HVORFDLVRXHVWDGXDLVTXHRLPSHoDP &RPRUHVLGHQWHSHUPDQHQWHpVXDUHVSRQVDELOLGDGH ‡2EHGHFHUDWRGDVDVOHLVIHGHUDLVHVWDGXDLVHORFDLV ‡3DJDULPSRVWRGHUHQGDIHGHUDOHVWDGXDOHORFDO ‡,QVFUHYHUVHQRRVHOHFWLYHVHUYLFH GDV)RUoDV$UPDGDVGRV(8$ VHIRUGRVH[RPDVFXOLQRHWLYHULGDGH HQWUHHDQRV9HMDDSiJLQDSDUDREWHUGHWDOKHV ‡0DQWHUVHXVWDWXVLPLJUDWyULR ‡3RUWDUVXDFRPSURYDomRGHVWDWXVGHUHVLGHQWHSHUPDQHQWHWRGRRWHPSR ‡&RPXQLFDUVHXQRYRHQGHUHoRFDGDYH]TXHPXGDUVHSHOD,QWHUQHWRXSRUFDUWDSDUDR'+6 'HSDUWPHQWRI+RPHODQG6HFXULW\ QRSUD]RGHGLDVDFRQWDUGDGDWDGDPXGDQoD$VLQWUXo}HV HVWmRQDSiJLQD 2VUHVLGHQWHVSHUPDQHQWHVUHFHEHPXP&DUWmRGH5HVLGHQWH3HUPDQHQWH )RUPXOiULR, FRPRSURYDGHVHXVWDWXVGHUHVLGHQWHOHJDOGRV(8$ $OJXPDVSHVVRDVFKDPDPHVVHGRFXPHQWRGH´*UHHQ&DUGµ&DVRYRFr VHMDXPUHVLGHQWHSHUPDQHQWHFRPDQRVRXPDLVpQHFHVViULRSRUWDU FRPSURYDomRGHVHXVWDWXVLPLJUDWyULRHVHOKHIRUVROLFLWDGRPRVWUiOD DRRÀFLDOGHLPLJUDomR2VHXFDUWmRpYiOLGRSRUDQRVHSUHFLVDVHU UHQRYDGRDQWHVGHYHQFHU9RFrGHYHDSUHVHQWDUR)RUPXOiULR,SDUD VXEVWLWXLURXUHQRYDUVHX&DUWmRGH5HVLGHQWH3HUPDQHQWHeSRVVtYHOREWHU HVVHIRUPXOiULRQRKWWSZZZXVFLVJRYRXOLJDQGRSDUD'LVTXH)RUPXOiULRV86&,63DUDGDUHQWUDGD DR)RUPXOiULR,pQHFHVViULRSDJDUXPDWD[D

U.S. Department of Homeland Security, U.S. Citizenship and Immigration Services, Office of Citizenship, Welcome to the United States: A Guide for New Immigrants,Washington, __DC, 2007, Part’s Revised Edition.

92

1-866-517-4467


2&DUWmRGH5HVLGHQWH3HUPDQHQWHPRVWUDTXHYRFrSRGHYLYHUHWUDEDOKDUQRV(VWDGRV8QLGRV9RFr WDPEpPSRGHXVDURVHX&DUWmRGH5HVLGHQWH3HUPDQHQWHSDUDLQJUHVVDUDRV(VWDGRV8QLGRV&DVR SHUPDQHoDIRUDGRV(8$SRUPDLVGHPHVHVYRFrSUHFLVDUiDSUHVHQWDUGRFXPHQWDomRDGLFLRQDOSDUD UHWRUQDUDRV(VWDGRV8QLGRVFRPRUHVLGHQWHSHUPDQHQWH9HMDDSiJLQDSDUDREWHUPDLRUHVLQIRUPDo}HV VREUHRVGRFXPHQWRVQHFHVViULRVSDUDUHWRUQDUDRV(8$VHSHUPDQHFHUIRUDGRSDtVSRUPDLVGHPHVHV

287526'2&80(1726,03257$17(6 0DQWHQKDRVGRFXPHQWRVLPSRUWDQWHVTXHWLYHUWUD]LGRGHVHXSDtVGHRULJHPHP XPOXJDUVHJXUR7DLVGRFXPHQWRVLQFOXHPRSDVVDSRUWHDFHUWLGmRGHQDVFLPHQWR DFHUWLGmRGHFDVDPHQWRDFHUWLGmRGHGLYyUFLRGLSORPDVTXHGHPRQVWUHPTXH FRQFOXLXRHQVLQRPpGLRRXVXSHULRUEHPFRPRFHUWLÀFDGRVTXHGHPRQVWUHPTXH SRVVXLFDSDFLWDomRRXIRUPDomRHVSHFLDO

&RPR0DQWHUR6WDWXVGH5HVLGHQWH3HUPDQHQWH  eSUHFLVRFXPSULUFHUWRVUHTXLVLWRVSDUDPDQWHUVHXVWDWXVGHUHVLGHQWHSHUPDQHQWHeERPOHPEUDUTXH HVWHVUHTXLVLWRVVmRLPSRUWDQWHVVHYRFrSODQHMDUHTXHUHUDFLGDGDQLDDPHULFDQD ‡1mRVDLUGRV(VWDGRV8QLGRVSRUORQJRVSHUtRGRVGHWHPSRQHPVHPXGDUSDUDRXWURSDtV SHUPDQHQWHPHQWH ‡3DJDULPSRVWRGHUHQGDIHGHUDOHVWDGXDOHVHIRURFDVRORFDO ‡5HJLVWUDUVHMXQWRDR6HOHFWLYH6HUYLFHVHIRUGRVH[RPDVFXOLQRFRPLGDGHHQWUHHDQRV ‡)RUQHFHUVHXQRYRHQGHUHoRDR'+6 0DQWHQKDVHX6WDWXV,PLJUDWyULR 5HVLGHQWHVSHUPDQHQWHVTXHVDHPGRV(VWDGRV8QLGRVSRUORQJRVSHUtRGRVGHWHPSRRXTXHQmR FRQVLJDPGHPRQVWUDUVXDLQWHQomRGHYLYHUSHUPDQHQWHPHQWHQRV(8$SRGHPSHUGHUVHXVWDWXV GHUHVLGHQWHSHUPDQHQWH0XLWRVLPLJUDQWHVDFKDPTXHSRGHPYLYHUQRH[WHULRUGHVGHTXHUHWRUQHP DRV(8$SHORPHQRVXPDYH]SRUDQR,VVRQmRpFRUUHWR6HYRFrDFUHGLWDTXHÀFDUiIRUDGRV(8$ SRUPDLVGHPHVHVGHYHHQWUDUFRPXPSHGLGRGHDXWRUL]DomRGHUHWRUQRDQWHVGHVDLUGRSDtV 8VHR)RUPXOiULR,$SSOLFDWLRQIRUD7UDYHO'RFXPHQW SHGLGRGHGRFXPHQWRGHYLDJHP  9RFrSRGHREWHUHVWHIRUPXOiULRQRVLWHKWWSZZZXVFLVJRYRXDWUDYpVGR'LVTXH)RUPXOiULRV 86&,62)RUPXOiULR,H[LJHRSDJDPHQWRGHXPDWD[D $DXWRUL]DomRGHUHWRUQRWHPYDOLGDGHGHDWpGRLVDQRVeSHUPLWLGRPRVWUDUDDXWRUL]DomRGHUHWRUQR QRSRQWRGHHQWUDGDHPYH]GRYLVWRRX&DUWmRGH5HVLGHQWH3HUPDQHQWH$DXWRUL]DomRGHUHWRUQR QmROKHJDUDQWHDHQWUDGDQRV(VWDGRV8QLGRVTXDQGRGHVHXUHJUHVVRPDVDMXGDDSURYDUTXHYRFrHVWi UHWRUQDQGRGHXPDYLVLWDWHPSRUiULDDRH[WHULRU3DUDPDLRUHVLQIRUPDo}HVYLVLWHRVLWHKWWSZZZ VWDWHJRYRXSURFXUHR'HSDUWPHQWRI6WDWH&RQVXODU2IÀFH 6HUYLoR&RQVXODUGR'HSDUWDPHQWRGH(VWDGR  QRH[WHULRU

U.S. Department of Homeland Security, U.S. Citizenship and Immigration Services, Office of Citizenship, Welcome to the United States: A Guide for New Immigrants,Washington, __ DC, 2007, Part’s Revised Edition.

wwww.listabrasilusa.com

93


'HFODUHGH,PSRVWRGH5HQGD &RPRUHVLGHQWHSHUPDQHQWHpSUHFLVR DSUHVHQWDUGHFODUDo}HVGHLPSRVWRGHUHQGD MXQWRDR,QWHUQDO5HYHQXH6HUYLFH ,56  5HFHLWD)HGHUDO HRGHSDUWDPHQWRWULEXWiULR HVWDGXDOORFDORXGHVXDFLGDGHVHQHFHVViULR &DVRQmRDSUHVHQWHGHFODUDomRGHLPSRVWRGH UHQGDQRSHUtRGRHPTXHYLYHUIRUDGRV(8$ SRUTXDOTXHUSHUtRGRGHWHPSRRXVHGLVVHU TXHp´QmRUHVLGHQWHµHPVXDGHFODUDomRGH LPSRVWRGHUHQGDRJRYHUQRGRV(8$SRGH GHWHUPLQDUTXHYRFrDEULXPmRGHVHXVWDWXVGHUHVLGHQWHSHUPDQHQWH 5HJLVWUHVHMXQWRDR6HOHFWLYH6HUYLFH 6HYRFrpKRPHPHWHPHQWUHHDQRVGHLGDGHpREULJDGRDVHUHJLVWUDUMXQWRDR6HOHFWLYH6HUYLFH DJrQFLDIHGHUDOTXHHIHWXDUHFUXWDPHQWRVGHHPHUJrQFLD $RVHUHJLVWUDUYRFrGHFODUDDRJRYHUQR TXHHVWiGLVSRQtYHOSDUDVHUYLUQDV)RUoDV$UPDGDVGRV(8$$WXDOPHQWHRV(VWDGRV8QLGRVQmRWrP DOLVWDPHQWRPLOLWDUREULJDWyULR,VVRVLJQLÀFDTXHUHVLGHQWHVSHUPDQHQWHVHFLGDGmRVQmRVmRREULJDGRV DVHUYLUQDV)RUoDV$UPDGDVH[FHWRVHDVVLPGHVHMDUHP 2UHJLVWURSRGHVHUIHLWRHPTXDOTXHUDJrQFLDGRVFRUUHLRV GRV(8$RXSHODLQWHUQHW3DUDVHUHJLVWUDUQR6HOHFWLYH6HUYLFH SHODLQWHUQHWYLVLWHRVLWHGR6HOHFWLYH6HUYLFHKWWSZZZVVVJRY 3DUDIDODUFRPXPDSHVVRDGR6HOHFWLYH6HUYLFHOLJXH (VWDOLJDomRQmRpJUDWXLWD 3RGHVHWDPEpPREWHULQIRUPDo}HVVREUHLVVRQRVLWHGR86&,6KWWSZZZXVFLVJRY &RPXQLTXHVHX1RYR(QGHUHoRDR'+6 7RGDYH]TXHPXGDUGHHQGHUHoRpQHFHVViULRLQIRUPiORDR'+69RFrSUHFLVDDSUHVHQWDUR)RUPXOiULR $5$OLHQ·V&KDQJHRI$GGUHVV&DUG FDUWmRGHPXGDQoDGHHQGHUHoRGHHVWUDQJHLURV eQHFHVViULR DSUHVHQWDUHVVHIRUPXOiULRQRSUD]RGHGLDVDSyVDPXGDQoD1mRpQHFHVViULRSDJDUWD[DSDUD DSUHVHQWDUHVVHIRUPXOiULR9RFrSRGHFRPXQLFDUDPXGDQoDGHHQGHUHoRRQOLQHYLDXPIRUPXOiULR $5HOHWU{QLFRSHORKWWSZZZXVFLVJRY0HVPRSDUDDPDLRULDGRVFDVRVSHQGHQWHVDPXGDQoDGH HQGHUHoRSRGHVHUFRPXQLFDGDSHOD,QWHUQHW 3DUDPDLRUHVLQIRUPDo}HVOLJXHSDUDR86&,6SHORWHOHIRQHRXDFHVVHKWWSZZZXVFLVJRY

&DVR6HMD5HVLGHQWH&RQGLFLRQDO 9RFrSRGHHVWDUQRV(8$FRPRUHVLGHQWHFRQGLFLRQDO &5 (VVHpRFDVRGHSHVVRDVTXHHVWDYDPFDVDGDV KiPHQRVGHGRLVDQRVFRPXPFLGDGmRDPHULFDQRRXUHVLGHQWHGRV(8$QRGLDGDFRQFHVVmRGRVWDWXV GHUHVLGHQWHSHUPDQHQWH6HYRFrWHPÀOKRVHOHVWDPEpPSRGHPVHU&5V&HUWRVLQYHVWLGRUHVLPLJUDQWHV WDPEpPVmRUHVLGHQWHVFRQGLFLRQDLV

U.S. Department of Homeland Security, U.S. Citizenship and Immigration Services, Office of Citizenship, Welcome to the United States: A Guide for New Immigrants,Washington, DC, 2007, Part’s Revised Edition.

__

94

1-866-517-4467


8P&5WHPRVPHVPRVGLUHLWRVHUHVSRQVDELOLGDGHVGHXPUHVLGHQWHSHUPDQHQWH5HVLGHQWHVFRQGLFLRQDLV WHPGRLVDQRVSDUDDSUHVHQWDUR)RUPXOiULR,3HWLWLRQWR5HPRYHWKH&RQGLWLRQVRQ5HVLGHQFH SHWLomRSDUDDUHWLUDGDGDVFRQGLo}HV RXR)RUPXOiULR,3HWLWLRQE\(QWUHSUHQHXUWR5HPRYH &RQGLWLRQV SHWLomRGRHPSUHHQGHGRUSDUDDUHWLUDGDGDVFRQGLo}HV DSDUWLUGDGDWDHPTXHUHFHEHUDP VHXVWDWXVGHUHVLGHQWHSHUPDQHQWHFRQGLFLRQDO2ÀQDOGHVWHSUD]RJHUDOPHQWHFRLQFLGHFRPDGDWDGH YHQFLPHQWRGHVHX&DUWmRGH5HVLGHQWH3HUPDQHQWH'rHQWUDGDQHVWHVIRUPXOiULRVGXUDQWHRVGLDV TXHDQWHFHGHPDGDWDGRVHJXQGRDQLYHUViULRGHUHFHELPHQWRGRVWDWXVGHUHVLGHQWHFRQGLFLRQDO 6HQmRRÀ]HUYRFrSRGHSHUGHUVHXVWDWXVGHLPLJUDomR (QWUHFRPD3HWLomRGR)RUPXOiULR,-XQWDPHQWHFRP6HX&{QMXJH 6HYRFrpUHVLGHQWHFRQGLFLRQDOHVXDLPLJUDomRGHYHVHDFDVDPHQWRFRPFLGDGmRRXUHVLGHQWH SHUPDQHQWHYRFrHVHXF{QMXJHGHYHPDSUHVHQWDUR)RUPXOiULR,MXQWRVSDUDSRGHUHPUHWLUDU DVFRQGLo}HVGHVHXVWDWXVGHUHVLGHQWHSHUPDQHQWH (PFHUWRVFDVRVQmRpQHFHVViULRDSUHVHQWDUR)RUPXOiULR,MXQWRFRPVHXF{QMXJH6HYRFrQmRPDLV HVWLYHUFDVDGRRXVHWLYHUVRIULGRDEXVRSRUSDUWHGHVHXF{QMXJHSRGHDSUHVHQWDUR)RUPXOiULR, VR]LQKR1HVWHVFDVRVRIRUPXOiULR,SRGHVHUHQYLDGRDTXDOTXHUPRPHQWRDSyVDFRQFHVVmR GDUHVLGrQFLDFRQGLFLRQDO

&202$35(6(17$526)2508/É5,26,(,'286&,6 4XHP5HVLGHQWHVFRQGLFLRQDLV 3RUTXr2VWDWXVGHUHVLGHQWHFRQGLFLRQDOYHQFHGRLVDQRVDSyVDGDWDHPTXHYRFr VHWRUQRX&5 4XDQGR2VUHVLGHQWHVFRQGLFLRQDLVTXHDSUHVHQWDUHPDSHWLomRFRPRF{QMXJHGHYHP DSUHVHQWDUR)RUPXOiULR,2VLQYHVWLGRUHVLPLJUDQWHVGHYHPDSUHVHQWDUR)RUPXOiULR ,(VVHVGRLVIRUPXOiULRVSUHFLVDPVHUDSUHVHQWDGRVQRSUD]RGHGLDVDQWHVGRVWDWXV GHUHVLGHQWHFRQGLFLRQDOYHQFHU$GDWDGHYHQFLPHQWRpQRUPDOPHQWHDPHVPDGRVHX &DUWmRGH5HVLGHQWH3HUPDQHQWH 2QGHREWHURIRUPXOiULR9RFrSRGHOLJDUSDUD'LVTXH)RUPXOiULRV86&,6QRQ~PHUR 3RGHWDPEpPREWHURIRUPXOiULRQRVLWHKWWSZZZXVFLVJRY 3DUDRQGHHQYLDURIRUPXOiULR(QYLHSDUDR86&,66HUYLFH&HQWHU &HQWURGH6HUYLoRVGR 86&,6 2HQGHUHoRGRV6HUYLFH&HQWHUVHQFRQWUDVHQDVLQVWUXo}HVGRIRUPXOiULR 4XDQWRFXVWDeQHFHVViULRSDJDUXPDWD[DSDUDDSUHVHQWDUR)RUPXOiULR,RXR )RUPXOiULR,(VVDVWD[DVSRGHPPXGDUSRUWDQWRYHULÀTXHMXQWRDR86&,6RVYDORUHV DWXDLVDQWHVGHHQYLDURIRUPXOiULR 6HYRFrDSUHVHQWDUR)RUPXOiULR,RXR)RUPXOiULR,GHQWURGRSUD]RR86&,6 QRUPDOPHQWHHQYLDUiXPDQRWLÀFDomRHVWHQGHQGRRVHXVWDWXVGH&5SRUDWpPHVHV 'XUDQWHHVVHWHPSRR86&,6DYDOLDUiDVXDVROLFLWDomR

',&$*XDUGHFySLDVGHWRGRVRVIRUPXOiULRVTXHHQYLDUDR86&,6HDRXWUDVUHSDUWLo}HVGR

JRYHUQR4XDQGRHQYLDUGRFXPHQWRVQmRHQYLHRVRULJLQDLVHQYLHFySLDV­VYH]HVRV IRUPXOiULRVVHSHUGHP0DQWHUFySLDVSRGHDMXGDUDHYLWDUSUREOHPDV

U.S. Department of Homeland Security, U.S. Citizenship and Immigration Services, Office of Citizenship, Welcome to the United States: A Guide for New Immigrants,Washington, DC, 2007, Part’s Revised Edition.

__

wwww.listabrasilusa.com

95


&RPR(QFRQWUDU$VVLVWrQFLD-XUtGLFD 6HSUHFLVDUGHDMXGDFRPXPSUREOHPDGHLPLJUDomRYRFrSRGHXWLOL]DURVVHUYLoRVGHXPDGYRJDGRGH LPLJUDomRFRPSHWHQWHHOLFHQFLDGR&RQWDWHDDVVRFLDomRGHDGYRJDGRVORFDOVHSUHFLVDUGHDMXGDSDUD HQFRQWUDUXPDGYRJDGRTXDOLÀFDGR &HUWRVHVWDGRVFHUWLÀFDPHVSHFLDOLVWDVHPOHJLVODomRLPLJUDWyULD(VVHVDGYRJDGRVSDVVDUDPHPH[DPHV SDUDSURYDUTXHSRVVXHPFRQKHFLPHQWRVHVSHFLDLVVREUHDVOHLVGHLPLJUDomR2VVHJXLQWHVHVWDGRV IRUQHFHPOLVWDVGHHVSHFLDOLVWDVFHUWLÀFDGRVHPVHXVVLWHVGHDVVRFLDo}HVHVWDGXDLV&DOLIyUQLD)OyULGD &DUROLQDGR1RUWHH7H[DV1RHQWDQWRDUHVSRQVDELOLGDGHGDGHFLVmRGHFRQWUDWDURXQmRXPDGYRJDGR pVXD2'+6QmRHQGRVVDRXUHFRPHQGDQHQKXPDGYRJDGRHVSHFtÀFR 6HSUHFLVDUGHDVVLVWrQFLDMXUtGLFDSDUDUHVROYHUXPSUREOHPDGHLPLJUDomRPDVQmRWLYHUGLQKHLUR VXÀFLHQWHSDUDFRQWUDWDUXPDGYRJDGRH[LVWHPRSo}HVGHDVVLVWrQFLDJUDWXLWDRXGHEDL[RFXVWR 9RFrSRGHSHGLUDMXGDQRVVHJXLQWHVORFDLV ‡8PDRUJDQL]DomRUHFRQKHFLGD([LVWHPRUJDQL]Do}HVTXHVmRUHFRQKHFLGDVSHOR%,$%RDUG RI,PPLJUDWLRQ$SSHDOV FRQVHOKRGHDSHODomRGHLPLJUDomR 3DUDTXHXPDRUJDQL]DomRVHMD ´UHFRQKHFLGDµHODSUHFLVDWHUEDVWDQWHFRQKHFLPHQWRHH[SHULrQFLDSDUDSUHVWDUVHUYLoRVDLPLJUDQWHV HVRPHQWHSRGHFREUDURXDFHLWDUSHTXHQRVKRQRUiULRVSHORVVHUYLoRV3DUDREWHUXPDOLVWD GHVVDVRUJDQL]Do}HVUHFRQKHFLGDVSHOR%,$YLVLWHRVLWH KWWSZZZXVGRMJRYHRLUVWDWVSXEUHFRJQLWLRQDFFUHGLWDWLRQURVWHUSGI ‡8PUHSUHVHQWDQWHFUHGHQFLDGR6mRSHVVRDVOLJDGDVjV´RUJDQL]Do}HVUHFRQKHFLGDVµGR%,$ (VVHVUHSUHVHQWDQWHVVRPHQWHSRGHPFREUDURXDFHLWDUSHTXHQRVKRQRUiULRVSRUVHXVVHUYLoRV 3DUDREWHUXPDOLVWDGHUHSUHVHQWDQWHVFUHGHQFLDGRVSHOR%,$YLVLWHRVLWH KWWSZZZXVGRMJRYHRLUVWDWVSXEDFFUHGLWHGUHSURVWHUSGI ‡8PUHSUHVHQWDQWHTXDOLÀFDGR6mRSHVVRDVTXHSUHVWDPVHUYLoRVJUDWXLWRV(VVDVSHVVRDVSUHFLVDP FRQKHFHUDVOHLVGHLPLJUDomRHDVUHJUDVSURFHVVXDLV(QWUHRVH[HPSORVGHUHSUHVHQWDQWHVTXDOLÀFDGRV LQFOXHPHVWXGDQWHVHIRUPDGRVHP'LUHLWRHSHVVRDVGHERQVYDORUHVPRUDLVTXHSRVVXDPUHODomR SHVVRDORXSURÀVVLRQDOFRPYRFr SDUHQWHYL]LQKRPHPEURGRFOHURFROHJDGHWUDEDOKRDPLJR  ‡3UHVWDGRUHVGH6HUYLoRV-XUtGLFRV*UDWXLWRV22IÀFHRIWKH&KLHI,PPLJUDWLRQ-XGJH HVFULWyULRGR MXL]GHLPLJUDomR SRVVXLXPDOLVWDGHSURYHGRUHVGHVHUYLoRVMXUtGLFRVJUDWXLWRVUHFRQKHFLGRVSDUD SHVVRDVTXHVHHQFRQWUDPHPSURFHVVRLPLJUDWyULR DFHVVHRVLWHKWWSZZZXVGRMJRYHRLUSURERQR VWDWHVKWP 7UDWDVHGHXPDOLVWDGHDGYRJDGRVHRUJDQL]Do}HVTXHSRGHPUHSUHVHQWDULPLJUDQWHVHP SURFHGLPHQWRVMXUtGLFRVSHUDQWHRV7ULEXQDLVGH,PLJUDomR2VDGYRJDGRVHRUJDQL]Do}HVGHVVDOLVWD FRQFRUGDPHPDMXGDURVLPLJUDQWHVSURERQR JUDWXLWDPHQWH VRPHQWHSDUDSURFHGLPHQWRVLPLJUDWyULRV SRUWDQWRDOJXQVGHOHVSRGHPQmRVHUFDSD]HVGHDMXGiORHPDVVXQWRVQmRUHODFLRQDGRVFRPWULEXQDORX MXt]R RXVHMDSHWLo}HVQDWXUDOL]Do}HVHWF  ‡3URJUDPDPROBONO$OLVWDGHRUJDQL]Do}HVTXHSUHVWDPVHUYLoRVSURERQR JUDWXLWRV HRVUHSUHVHQWDQWHV GHVVDVRUJDQL]Do}HVSRGHPVHUHQFRQWUDGRVQRVHVFULWyULRVORFDLVGR86&,6

U.S. Department of Homeland Security, U.S. Citizenship and Immigration Services, Office of Citizenship, Welcome to the United States: A Guide for New Immigrants,Washington, DC, 2007, Part’s Revised Edition.

__

96

1-866-517-4467


6(92&È)259Ì7,0$'($%862'20e67,&2 6HYRFrIRUYtWLPDGHDEXVRGRPpVWLFRpSRVVtYHOREWHUDMXGDDWUDYpVGD&HQWUDO1DFLRQDO GH$WHQGLPHQWRj9LROrQFLD'RPpVWLFDWHOHIRQHVH SDUDGHÀFLHQWHVDXGLWLYRV $MXGDGLVSRQtYHOHPHVSDQKROHRXWURVLGLRPDV $/HLGH9LROrQFLD&RQWUDD0XOKHUSHUPLWHTXHHVSRVDVHÀOKRVGHFLGDGmRVDPHULFDQRVH UHVLGHQWHVSHUPDQHQWHVTXHVRIUDPDEXVRGRPpVWLFRIDoDPXPD´DXWRSHWLomRµRXDSUHVHQWHP SHWLomRSUySULDSDUDVHWRUQDUHPUHVLGHQWHVSHUPDQHQWHV9LVLWHRVLWHKWWSZZZXVFLVJRY RXOLJXHSDUDD1DWLRQDO'RPHVWLF9LROHQFH+RWOLQH FHQWUDOQDFLRQDOGHDWHQGLPHQWRjYLROrQFLD GRPpVWLFD SDUDPDLRUHVLQIRUPDo}HV

&XLGDGRFRP)UDXGHVGH&RQVXOWRUHVGH,PLJUDomR 0XLWRVSUDWLFDQWHVGDiUHDGHLPLJUDomRVmRTXDOLÀFDGRVHKRQHVWRVHSRGHPSUHVWDUERQVVHUYLoRVD LPLJUDQWHV(QWUHWDQWRH[LVWHPDOJXPDVSHVVRDVTXHWLUDPYDQWDJHPGHLPLJUDQWHV $QWHVGHGHFLGLUREWHUDMXGDFRPDVVXQWRVGHLPLJUDomRHDQWHVGHSDJDUTXDOTXHUYDORUYRFrGHYH SHVTXLVDUSDUDTXHSRVVDWRPDUDGHFLVmRFHUWDVREUHRWLSRGHDMXGDMXUtGLFDTXHSUHFLVD3URWHMDVHSDUD QmRVHWRUQDUYtWLPDGHIUDXGHGHLPLJUDomR $TXLHVWmRDOJXPDVFRQVLGHUDo}HVSDUDDMXGiOR ‡1HQKXPDRUJDQL]DomRRXSHVVRDItVLFDTXHRIHUHoDDMXGDFRPTXHVW}HVGHLPLJUDomRSRVVXLOLJDomR HVSHFLDOFRPR86&,6)DoDSHUJXQWDVDSHVVRDVTXHID]HPSURPHVVDVTXHVmRPXLWRERDVSDUDVHU YHUGDGHRXTXHDOHJDPSRVVXLUUHODFLRQDPHQWRHVSHFLDOFRPR86&,61mRFRQÀHHPSHVVRDVTXH JDUDQWDPUHVXOWDGRVRXSURFHVVDPHQWRUiSLGR&DVRQmRWHQKDGLUHLWRDQHQKXPEHQHItFLRGHLPLJUDomR XWLOL]DURVVHUYLoRVGHGHWHUPLQDGRDGYRJDGRRXFRQVXOWRUQmRPXGDUiHVVHIDWR ‡$OJXQVFRQVXOWRUHVDJrQFLDVGHYLDJHPHVFULWyULRVLPRELOLiULRVHSHVVRDVGHQRPLQDGDV´QRWiULRV S~EOLFRVµRIHUHFHPVHUYLoRVGHLPLJUDomR1mRGHL[HGHSHUJXQWDUVREUHVXDVTXDOLÀFDo}HVHSHoD SDUDYHUDVFySLDVGDFDUWDGHFUHGHQFLDPHQWRMXQWRDR%,$RXFHUWLÀFDGRGDDVVRFLDomRGHDGYRJDGRV $OJXPDVSHVVRDVTXHGL]HPVHUTXDOLÀFDGDVSDUDRIHUHFHUVHUYLoRVMXUtGLFRVQmRRVmR(VVDVSHVVRDV SRGHPFRPHWHUHUURVTXHSRGHPFDXVDUSUREOHPDVVpULRVSDUDYRFr ‡6HXWLOL]DURVVHUYLoRVGHXPDGYRJDGRRXFRQVXOWRUGHLPLJUDomRH[LMDXPFRQWUDWRSRUHVFULWR2 FRQWUDWRGHYHUVHUHPLQJOrVHHPVXDSUySULDOtQJXDFDVRRLQJOrVQmRVHMDDVXDOtQJXDQDWLYD2 FRQWUDWRGHYHUHODFLRQDUWRGRVRVVHUYLoRVTXHOKHVHUmRSUHVWDGRVHRSUHoR3HoDUHIHUrQFLDVDQWHVGH DVVLQDURFRQWUDWR ‡(YLWHSDJDUSHORVVHUYLoRVHPGLQKHLUR2EWHQKDVHPSUHXPUHFLERGRSDJDPHQWRHIHWXDGR)LTXHFRP WRGRVRVVHXVGRFXPHQWRVRULJLQDLV ‡1XQFDDVVLQHXPIRUPXOiULRRXSHWLomRHPEUDQFR&HUWLÀTXHVHGHTXHHQWHQGHRTXHHVWiDVVLQDQGR 6HIRUOHVDGRSRUXPFRQVXOWRUGHLPLJUDomRSURFXUHDMXGD/LJXHSDUDRSURFXUDGRUORFDORXGRHVWDGR RGHSDUWDPHQWRGHDVVXQWRVUHODFLRQDGRVFRPRFRQVXPLGRURXRGHSDUWDPHQWRGHSROtFLDORFDO

U.S. Department of Homeland Security, U.S. Citizenship and Immigration Services, Office of Citizenship, Welcome to the United States: A Guide for New Immigrants,Washington, DC, 2007, Part’s Revised Edition.

__

wwww.listabrasilusa.com

97


&RQVHTrQFLDVGH&RQGXWD&ULPLQRVDSDUDRV5HVLGHQWHV3HUPDQHQWHV 2V(VWDGRV8QLGRVVmRXPDVRFLHGDGHVHJXLGRUDGHOHLV5HVLGHQWHVSHUPDQHQWHVGRV(VWDGRV8QLGRVWrP TXHREHGHFHUDWRGDVDVOHLVGRSDtV6HIRUXPUHVLGHQWHSHUPDQHQWHHHQYROYHUVHRXIRUFRQGHQDGR GHXPFULPHQRV(8$YRFrSRGHUiWHUVpULRVSUREOHPDV9RFrSRGHUiVHUH[SXOVRGRSDtVSRGHUiVHU SURLELGRGHUHWRUQDUVHVDLUHHPGHWHUPLQDGDVFLUFXQVWkQFLDVSHUGHUVHXGLUHLWRGHREWHUFLGDGDQLDGRV (8$(QWUHRVH[HPSORVGHFULPHVTXHSRGHPDIHWDUVHXVWDWXVGHUHVLGHQWHSHUPDQHQWHHQFRQWUDPVHRV VHJXLQWHV ‡&ULPHVGHÀQLGRVFRPR´FULPHVTXDOLÀFDGRVµLQFOXLQGRFULPHVYLROHQWRVFRPSHQDGHXPDQRGHSULVmR ‡+RPLFtGLR ‡$WLYLGDGHVWHUURULVWDV ‡(VWXSUR ‡$EXVRVH[XDOGHFULDQoDV ‡7UiÀFRLOHJDOGHGURJDVDUPDVRXSHVVRDV ‡&ULPHGH´GHJHQHUDomRPRUDOµTXHHPJHUDOpFULPHFRPRLQWXLWRGHURXEDURXIUDXGDUFULPHHPTXH KiDPHDoDRXUHDOL]DomRGHOHVmRItVLFDFULPHRQGHOHVmRItVLFDJUDYHpSURYRFDGDSRUFRPSRUWDPHQWR WHPHUiULRRXFULPHGHFRQGXWDVH[XDOLPSUySULD +DYHUiWDPEpPFRQVHTrQFLDVVpULDVSDUDRUHVLGHQWHSHUPDQHQWHTXH ‡0HQWLUSDUDREWHUEHQHItFLRVGHLPLJUDomRSDUDVLSUySULRRXRXWUDSHVVRD ‡)L]HUSDVVDUVHSRUFLGDGmRDPHULFDQR ‡9RWDUHPHOHLomRIHGHUDORXHOHLo}HVORFDLVDEHUWDVDSHQDVDFLGDGmRVDPHULFDQRV ‡)RUFRQVLGHUDGRDOFRyODWUD²SHVVRDVTXHDEXVDPGHEHELGDVDOFRyOLFDVRXGHGURJDVLOHJDLV ‡6HMDFDVDGRFRPPDLVGHXPDSHVVRDDRPHVPRWHPSR ‡1mRVXVWHQWDUVXDIDPtOLDRXQmRSDJDUSHQVmRDOLPHQWtFLDDÀOKRVRXF{QMXJHFRQIRUPHRUGHQDGR ‡)RUSUHVRSRUDJUHGLURXDVVHGLDUPHPEURGDIDPtOLDLQFOXLQGRDYLRODomRGHXPDRUGHPGHSURWHomR (VWHVDWRVVmRFKDPDGRVGHYLROrQFLDGRPpVWLFD ‡0HQWLUSDUDREWHUEHQHItFLRVS~EOLFRV ‡1mRDSUHVHQWDUGHFODUDomRGHLPSRVWRGHUHQGDTXDQGRH[LJLGR ‡,QWHQFLRQDOPHQWHQmRVHUHJLVWUDUMXQWRDR6HOHFWLYH6HUYLFHVHIRUGRVH[RPDVFXOLQRFRPLGDGH HQWUHDDQRV ‡$MXGDUDOJXpPTXHQmRVHMDFLGDGmRDPHULFDQRRXQDWXUDOL]DGRDHQWUDULOHJDOPHQWHQRV(VWDGRV8QLGRV PHVPRTXHHVWDSHVVRDVHMDSDUHQWHSUy[LPRHDLQGDTXHYRFrQmRHVWHMDVHQGRSDJRSDUDID]rOR 6HFRPHWHURXIRUFRQGHQDGRSRUXPFULPHYRFrGHYHFRQVXOWDUXP DGYRJDGRGHLPLJUDomRUHQRPDGRRXRUJDQL]DomRFRPXQLWiULDTXHSUHVWD VHUYLoRVMXUtGLFRVDLPLJUDQWHVDQWHVGHHQWUDUFRPSHWLomRSDUDRXWUR EHQHItFLRGHLPLJUDomR9HMDDSiJLQDSDUDREWHULQIRUPDo}HVVREUH FRPRHQFRQWUDUDVVLVWrQFLDMXUtGLFD

U.S. Department of Homeland Security, U.S. Citizenship and Immigration Services, Office of Citizenship, Welcome to the United States: A Guide for New Immigrants,Washington, DC, 2007, Part’s Revised Edition.

__ 98

1-866-517-4467


&RPRVH7RUQDU&LGDGmRGRV(8$

 7RUQDUVHFLGDGmRGRV(8$GiDRUHVLGHQWHSHUPDQHQWHQRYRVGLUHLWRVHSULYLOpJLRV$FLGDGDQLD WDPEpPWUD]QRYDVUHVSRQVDELOLGDGHV(VWDVHomRDSUHVHQWDDOJXPDVFRQVLGHUDo}HVSDUDTXHPSHQVD HPVHWRUQDUXPFLGDGmRGRV(8$HGHVFUHYHRTXHpQHFHVViULRID]HUSDUDVHWRUQDUFLGDGmRGRV (8$

U.S. Department of Homeland Security, U.S. Citizenship and Immigration Services, Office of Citizenship, Welcome to the United States: A Guide for New Immigrants,Washington, DC, 2007, Part’s Revised Edition.

wwww.listabrasilusa.com

99


3DUDVHWRUQDUFLGDGmRpSUHFLVRHVWDUGLVSRVWRDMXUDUOHDOGDGHDRV(VWDGRV8QLGRVeQHFHVViULRDEULUPmR GHVXDÀGHOLGDGHSDUDFRPTXDOTXHURXWURSDtVeSUHFLVRFRQFRUGDUHPDSRLDUHGHIHQGHUD&RQVWLWXLomR GRV(8$$RVHWRUQDUFLGDGmRDSHVVRDDFHLWDWRGDVDVUHVSRQVDELOLGDGHVGHVHUDPHULFDQR(PWURFD DGTXLUHFHUWRVGLUHLWRVHSULYLOpJLRVGHFLGDGmR

3RU4XHVH7RUQDU&LGDGmRGRV(8$" 2VUHVLGHQWHVSHUPDQHQWHVSRVVXHPDPDLRULDGRV GLUHLWRVGRVFLGDGmRVGRV(8$0DVKiPXLWDV UD]}HVLPSRUWDQWHVSDUDFRQVLGHUDUDFLGDGDQLD DPHULFDQD$TXLHVWmRDOJXPDVERDVUD]}HV ‡'HPRQVWUDUVHXSDWULRWLVPR7RUQDUVHFLGDGmR pXPDIRUPDGHGHPRQVWUDUVHXFRPSURPLVVR FRPRVHXQRYRSDtV ‡9RWDU3DUDYRWDUHPHOHLo}HVIHGHUDLVRHOHLWRU WHPTXHVHUFLGDGmR$PDLRULDGRVHVWDGRV QDPDLRUSDUWHGDVHOHLo}HVWDPEpPUHVWULQJH RGLUHLWRGRYRWRDFLGDGmRVDPHULFDQRV ‡3DUWLFLSDUGHM~ULV6yFLGDGmRVDPHULFDQRV SRGHPSDUWLFLSDUGHM~ULVQRQtYHOIHGHUDO $PDLRULDGRVHVWDGRVWDPEpPUHVWULQJHHVVD SDUWLFLSDomRDFLGDGmRVDPHULFDQRV3DUWLFLSDU GHM~ULVpXPDUHVSRQVDELOLGDGHLPSRUWDQWH GRVFLGDGmRVDPHULFDQRV ‡9LDMDUFRPSDVVDSRUWHDPHULFDQR2SDVVDSRUWH DPHULFDQRSRVVLELOLWDDREWHQomRGHDVVLVWrQFLD GRJRYHUQRGRV(8$QRH[WHULRUVHQHFHVViULR ‡7UD]HUPHPEURVGDIDPtOLDSDUDRV(8$2VFLGDGmRVGRV(8$QRUPDOPHQWHWrPSULRULGDGHSDUDWUD]HU PHPEURVGDIDPtOLDSDUDYLYHUSHUPDQHQWHPHQWHQRSDtV ‡2EWHUFLGDGDQLDSDUDÀOKRVQDVFLGRVQRH[WHULRU1DPDLRULDGRVFDVRVXPDFULDQoDQDVFLGDQR H[WHULRUGHSDLVTXHVmRFLGDGmRVDPHULFDQRVpDXWRPDWLFDPHQWHFLGDGmGRV(8$ ‡7HUGLUHLWRDHPSUHJRVIHGHUDLV'HWHUPLQDGRVHPSUHJRVHPyUJmRS~EOLFRVH[LJHPFLGDGDQLD DPHULFDQD ‡(OHJHUVHSDUDFDUJRVS~EOLFRV6yFLGDGmRVSRGHPFRQFRUUHUSDUDFDUJRVIHGHUDLV 6HQDGRH&kPDUD GRV5HSUHVHQWDQWHV HSDUDDPDLRUSDUWHGRVFDUJRVS~EOLFRVHVWDGXDLVHORFDLV ‡0DQWHUDUHVLGrQFLD2GLUHLWRGRFLGDGmRGRV(8$GHSHUPDQHFHUQRV(VWDGRV8QLGRVQmRSRGH VHUUHWLUDGR ‡7HUGLUHLWRDEROVDVGHHVWXGRHVXEVtGLRVIHGHUDLV0XLWRVVXEVtGLRVGHDMXGDÀQDQFHLUDLQFOXLQGR EROVDVGHHVWXGRHVXEVtGLRVHVSHFLDLVGDGRVSHORJRYHUQRSDUDGHWHUPLQDGRVÀQVHVWmRGLVSRQtYHLV DSHQDVSDUDFLGDGmRVGRV(8$ ‡2EWHUEHQHItFLRVS~EOLFRV$OJXQVEHQHItFLRVGRJRYHUQRHVWmRGLVSRQtYHLVDSHQDVSDUDFLGDGmRV GRV(8$

U.S. Department of Homeland Security, U.S. Citizenship and Immigration Services, Office of Citizenship, Welcome __DC, 2007, Part’s Revised Edition. to the United States: A Guide for New Immigrants,Washington,

100

1-866-517-4467


1DWXUDOL]DomR&RPR7RUQDUVH&LGDGmR 2SURFHVVRGHVHWRUQDUFLGDGmRGRV(8$pFKDPDGRGH´QDWXUDOL]DomRµeSRVVtYHOHQWUDUFRPRSHGLGR GHQDWXUDOL]DomRXPDYH]TXHWHQKDDWHQGLGRjVVHJXLQWHVH[LJrQFLDV 7HUPRUDGRQRV(8$SRUSHORPHQRVFLQFRDQRVFRPRUHVLGHQWHSHUPDQHQWH RXWUrVDQRVVHFDVDGRH YLYHQGRFRPFLGDGmRDPHULFDQR  7HUHVWDGRSUHVHQWHQRV(8$GXUDQWHSHORPHQRVPHVHVQRV~OWLPRVFLQFRDQRV RXPHVHVQRV ~OWLPRVWUrVDQRVVHFDVDGRHYLYHQGRFRPFLGDGmRDPHULFDQR  7HUPRUDGRQRHVWDGRRXGLVWULWR86&,6SHORPHQRVWUrVPHVHVDQWHVGHHQWUDUFRPRSHGLGR $VUHJUDVSRGHPVHUGLIHUHQWHVVH ‡9RFrRXXPGHVHXVSDLVF{QMXJHRXÀOKRVIDOHFLGRVWLYHUVHUYLGRQDV)RUoDV$UPDGDVGRV(8$ ‡9RFrQDVFHXQRV(8$ ‡9RFrREWHYHDUHVLGrQFLDSHUPDQHQWHDWUDYpVGDOHLGHDQLVWLDGH ‡9RFrpUHIXJLDGRRXREWHYHDVLORSROtWLFR ‡6HXF{QMXJHIRUFLGDGmRHHVWLYHUUHJXODUPHQWHHPSRVWRQRH[WHULRU ‡9RFrSHUGHXDFLGDGDQLDGHYLGRDXPFDVDPHQWRFRPF{QMXJHQmRFLGDGmRHPOHLYLJHQWHDQWHULRU ‡)RUIXQFLRQiULRGHGHWHUPLQDGRVWLSRVGHHPSUHVDVRXRUJDQL]Do}HVVHPÀQVOXFUDWLYRV 3DUDPDLRUHVLQIRUPDo}HVFRQVXOWHRJXLD$*XLGHWR1DWXUDOL]DWLRQRXFRQVXOWHXPDGYRJDGRGHLPLJUDomRRX RXWURSURÀVVLRQDOTXDOLÀFDGR

&2022%7(5,1)250$d¯(662%5(1$785$/,=$d®2 3HVVRDVFRPLGDGHLJXDORXVXSHULRUDDQRVTXHTXHLUDPVHWRUQDU FLGDGmRVGHYHPREWHUR)RUPXOiULR0$*XLGHWR1DWXUDOL]DWLRQ *XLDSDUD 1DWXUDOL]DomR (VVHJXLDWHPLQIRUPDo}HVLPSRUWDQWHVVREUHDVH[LJrQFLDVSDUD DQDWXUDOL]DomR'HVFUHYHWDPEpPRVIRUPXOiULRVQHFHVViULRVSDUDGDUHQWUDGD DRSURFHVVRGHQDWXUDOL]DomR 2)RUPXOiULR01DWXUDOL]DWLRQ(OLJLELOLW\:RUNVKHHW 3ODQLOKDGH'LUHLWR GH1DWXUDOL]DomR ORFDOL]DGRQRÀQDOGR$*XLGHWR1DWXUDOL]DWLRQOKHDMXGDD YHULÀFDUVHYRFrWHPGLUHLWRDQDWXUDOL]DomR8WLOL]HR)RUPXOiULR1SDUD GDUHQWUDGDQRSHGLGRGHQDWXUDOL]DomR+iXPDWD[DSDUDGDUHQWUDGDQR )RUPXOiULR1 3DUDREWHURV)RUPXOiULRV00H1OLJXHSDUDD'LVTXH )RUPXOiULRV86&,6QRQ~PHURRXDFHVVHRVLWH KWWSZZZXVFLVJRY

U.S. Department of Homeland Security, U.S. Citizenship and Immigration Services, Office of Citizenship, Welcome __ DC, 2007, Part’s Revised Edition. to the United States: A Guide for New Immigrants,Washington,

wwww.listabrasilusa.com

101


([LJrQFLDVSDUDD1DWXUDOL]DomR $VH[LJrQFLDVJHUDLVSDUDDQDWXUDOL]DomRVmRDVVHJXLQWHV 9LYHUQRV(8$FRPRUHVLGHQWHSHUPDQHQWHSRUXPSHUtRGRGHWHPSRHVSHFtÀFR 5HVLGrQFLD&RQWtQXD  (VWDUSUHVHQWHQRV(8$SRUSHUtRGRVHVSHFtÀFRVGHWHPSR 3UHVHQoD)tVLFD  3HUPDQHFHUHPVHXHVWDGRRXGLVWULWR86&,6GXUDQWHSHUtRGRVGHWHUPLQDGRVGHWHPSR  3HUtRGRGH7HPSRHP'LVWULWR86&,6RX(VWDGR$PHULFDQR  &RQGX]LUVHGHIRUPDOHJDOHDFHLWiYHO %RP&DUiWHU0RUDO  6DEHULQJOrVHWHUFRQKHFLPHQWRGDKLVWyULDHGRJRYHUQRGRV(8$ ,QJOrVH&LYLVPR  (QWHQGHUHDFHLWDURVSULQFtSLRVGD&RQVWLWXLomRGRV(8$ 'HGLFDomRj&RQVWLWXLomR 

0$187(1d®2'(5(6,'È1&,$&217Ì18$&2025(6,'(17(3(50$1(17( 6HYRFrVDLUGRV(8$SRU

6HXVWDWXVFRPR UHVLGHQWHp

3DUDPDQWHUVHXVWDWXVp SUHFLVR

0DLVGHVHLVPHVHV

3RVVLYHOPHQWH LQYDOLGDGD

3URYDUTXHFRQWLQXRXDYLYHU HWUDEDOKDUQRV(8$HRX WHPOLJDomRFRPRV(8$SRU H[HPSORSDJRXLPSRVWRV  HQTXDQWRHVWDYDIRUD

0DLVGHXPDQR

,QYDOLGDGD

1DPDLRULDGRVFDVRVYRFr WHPTXHUHLQLFLDURSURFHVVR GHUHVLGrQFLDFRQWtQXD 6ROLFLWHDXWRUL]DomRGH UHWRUQRDQWHVGHVDLUVH SUHWHQGHUUHJUHVVDUDRV(8$ FRPRUHVLGHQWHSHUPDQHQWH

5HVLGrQFLD&RQWtQXD ´5HVLGrQFLDFRQWtQXDµVLJQLÀFDTXHDSHVVRDSUHFLVDYLYHUQRV(8$FRPRUHVLGHQWHSHUPDQHQWHSRUXP FHUWRSHUtRGRGHWHPSR$PDLRULDGDVSHVVRDVSUHFLVDVHUUHVLGHQWHSHUPDQHQWHFRPUHVLGrQFLDFRQWtQXD GHFLQFRDQRV RXWUrVDQRVVHFDVDGRFRPFLGDGmRDPHULFDQR DQWHVGHFRPHoDUVHXSURFHVVRGH QDWXUDOL]DomR3DUDUHIXJLDGRVLVVRVLJQLÀFDFLQFRDQRVGDGDWDGDFKHJDGDQRV(8$TXHJHUDOPHQWH pDGDWDGDREWHQomRGRVWDWXVGHUHVLGHQWHSHUPDQHQWH3DUDSHVVRDVTXHREWLYHUDPVWDWXVGHDVLODGR QRV(8$HVVHSHUtRGRGHWHPSRFRPHoDXPDQRDQWHVGHREWHURVWDWXVGHUHVLGHQWHSHUPDQHQWH $GDWDLPSUHVVDQRVHX&DUWmRGH5HVLGHQWH3HUPDQHQWHpDGDWDHPTXHFRPHoDRSHUtRGRGHFLQFRDQRV 6HYRFrVDLUGRV(VWDGRV8QLGRVSRUXPSHUtRGRORQJRJHUDOPHQWHVHLVPHVHVRXPDLVFRUUHRULVFR GH´LQWHUURPSHUµVXDUHVLGrQFLDFRQWtQXD

U.S. Department of Homeland Security, U.S. Citizenship and Immigration Services, Office of Citizenship, Welcome to the United States: A Guide for New Immigrants,Washington, __DC, 2007, Part’s Revised Edition.

102

1-866-517-4467


&20235(6(59$568$5(6,'È1&,$3$5$),16'(1$785$/,=$d®2 ,6(1d¯(63$5$$86È1&,$6'(80$12 6HWUDEDOKDUSDUDRJRYHUQRGRV(8$XPDLQVWLWXLomRGHSHVTXLVDUHQRPDGDDPHULFDQDRX GHWHUPLQDGDVHPSUHVDVDPHULFDQDVRXVHÀ]HUSDUWHGRFOHURHHVWLYHUWUDEDOKDQGRQRH[WHULRU YRFrSRGHSUHVHUYDUDVLWXDomRGHUHVLGrQFLDFRQWtQXDVH 7LYHUHVWDGRÀVLFDPHQWHSUHVHQWHHPRUDQGRQRV(8$VHPVDLUSRUSHORPHQRVXPDQRDSyV VHWRUQDUUHVLGHQWHSHUPDQHQWH 6XEPHWHUR)RUPXOiULR1$SSOLFDWLRQWR3UHVHUYH5HVLGHQFHIRU1DWXUDOL]DWLRQ3XUSRVHV VROLFLWDomRGHSUHVHUYDomRGHUHVLGrQFLDSDUDÀQVGHQDWXUDOL]DomR DQWHVVHDXVHQWDUGRV (8$SRUPDLVGHXPDQReQHFHVViULRSDJDUXPDWD[DSDUDDSUHVHQWDUR)RUPXOiULR1 3DUDPDLRUHVLQIRUPDo}HVOLJXHSDUDR'LVTXH)RUPXOiULRV86&,6HSHoD R)RUPXOiULR1$SSOLFDWLRQWR3UHVHUYH5HVLGHQFHIRU1DWXUDOL]DWLRQ3XUSRVHV VROLFLWDomR GHSUHVHUYDomRGHUHVLGrQFLDSDUDÀQVGHQDWXUDOL]DomR (VVHIRUPXOiULRSRGHWDPEpPVHU REWLGRQRVLWHGR86&,6HPKWWSZZZXVFLVJRY

$RVDLUGRV(VWDGRV8QLGRVSRUXPDQRRXPDLVYRFrSRGHUiUHWRUQDUVHWLYHUXPDDXWRUL]DomRGH UHWRUQR6ROLFLWHDDQWHVGHVDLUGRV(VWDGRV8QLGRV9HMDLQIRUPDo}HVQDSiJLQDVREUHFRPRVROLFLWDU DDXWRUL]DomRGHUHWRUQR1DPDLRULDGRVFDVRVRWHPSRTXHYRFrSDVVRXQRV(VWDGRV8QLGRVDQWHVGH VDLUGRSDtVQmRFRQWDUiFRPRWHPSRGHUHVLGrQFLDFRQWtQXD,VWRVLJQLÀFDTXHVXDUHVLGrQFLDFRQWtQXD FRPHoDDFRQWDUDSDUWLUGHVHXUHWRUQRDRV(VWDGRV8QLGRVHDLQGDTXHYRFrSRGHUiWHUTXHHVSHUDUSRU XPSHUtRGRGHDWpTXDWURDQRVHXPGLDDQWHVGHUHTXHUHUVXDQDWXUDOL]DomR ',&$2)RUPXOiULR, DXWRUL]DomRGHUHWRUQR HR)RUPXOiULR1$SSOLFDWLRQWR

3UHVHUYH5HVLGHQFHIRU1DWXUDOL]DWLRQ3XUSRVHV VROLFLWDomRGHSUHVHUYDomRGHUHVLGrQFLDSDUD ÀQVGHQDWXUDOL]DomR QmRVmRDPHVPDFRLVD$RUHWRUQDUDRV(VWDGRV8QLGRVDSyVXPD DXVrQFLDWHPSRUiULDYRFrSRGHPRVWUDUDDXWRUL]DomRGHUHWRUQRHPYH]GR&DUWmRGH5HVLGrQFLD 3HUPDQHQWH VHYRFrÀFRXIRUDPHQRVGHPHVHV RXHPYH]GRYLVWR VHYRFrÀFRXIRUDPDLVGHPHVHV 

(;&(d¯(63$5$0,/,7$5(6 6HIRUPLOLWDUGDDWLYDRXWLYHUVLGRUHFHQWHPHQWHGLVSHQVDGRGDV)RUoDV$UPDGDVGRV(8$ DVH[LJrQFLDVGHUHVLGrQFLDFRQWtQXDHSUHVHQoDItVLFDSRGHPQmRVHDSOLFDUQRVHXFDVR 3DUDPDLRUHVLQIRUPDo}HVFRQVXOWHRIROKHWR01DWXUDOL]DWLRQ,QIRUPDWLRQIRU0LOLWDU\ 3HUVRQQHO LQIRUPDo}HVVREUHQDWXUDOL]DomRSDUDPLOLWDUHV 7RGDEDVHPLOLWDUGHYHWHUXPD SHVVRDGHFRQWDWRSDUDOLGDUFRPDVXDVROLFLWDomRGHQDWXUDOL]DomRHFHUWLÀFDUR)RUPXOiULR 15HTXHVWIRU&HUWLÀFDWLRQRI0LOLWDU\RU1DYDO6HUYLFH VROLFLWDomRGHFHUWLÀFDomRGHVHUYLoR PLOLWDURXQDYDO eQHFHVViULRDSUHVHQWDUR)RUPXOiULR1MXQWDPHQWHFRPVHXVIRUPXOiULRV GHVROLFLWDomR3DUDREWHURVIRUPXOiULRVTXHSUHFLVDOLJXHSDUDR86&,6Q~PHURJUDWXLWRGR 0LOLWDU\+HOS/LQH&,60,/  3DUDPDLRUHVLQIRUPDo}HVYLVLWH KWWSZZZXVFLVJRYPLOLWDU\RXOLJXHSDUDR6HUYLoRGH$WHQGLPHQWRDR&RQVXPLGRU 

6DLEDTXHDXVrQFLDVGRV(8$HQTXDQWRRVHXSURFHVVRGHQDWXUDOL]DomRHVWLYHUHPDQGDPHQWRSRGHP FDXVDUSUREOHPDVTXDQWRDRVHXGLUHLWRjQDWXUDOL]DomRSULQFLSDOPHQWHVHDFHLWDUHPSUHJRQRH[WHULRU U.S. Department of Homeland Security, U.S. Citizenship and Immigration Services, Office of Citizenship, Welcome __ to the United States: A Guide for New Immigrants,Washington, DC, 2007, Part’s Revised Edition.

wwww.listabrasilusa.com

103


3UHVHQoD)tVLFDQRV(VWDGRV8QLGRV ´3UHVHQoDItVLFDµVLJQLÀFDTXHDSHVVRDHVWHYHGHIDWRSUHVHQWHQRV(VWDGRV8QLGRV6HYRFrpUHVLGHQWH SHUPDQHQWHFRPSHORPHQRVDQRVGHLGDGHpREULJDGRDWHUHVWDGRÀVLFDPHQWHSUHVHQWHQRV(VWDGRV 8QLGRVSRUXPSHUtRGRGHSHORPHQRVPHVHVGXUDQWHRV~OWLPRVFLQFRDQRV RXPHVHVGXUDQWH RV~OWLPRVWUrVDQRVVHFDVDGRFRPFLGDGmRDPHULFDQR DQWHVGHUHTXHUHUQDWXUDOL]DomR

´35(6(1d$)Ì6,&$µ 3

4XDOpDGLIHUHQoDHQWUH´SUHVHQoDItVLFDµH´UHVLGrQFLDFRQWtQXDµ"

5

´ 3UHVHQoDItVLFDµpRWRWDOGHGLDVTXHÀFRXQRV(VWDGRV8QLGRVHQmRLQFOXLRWHPSR SDVVDGRIRUDGRV(8$7RGRVRVGLDVTXHYRFrSDVVDUIRUDGRV(8$VHUiGHVFRQWDGR GHVXD´SUHVHQoDItVLFDµWRWDO6HÀFDUIRUDGRV(8$SRUSHUtRGRVGHWHPSRORQJRVRX VHÀ]HUPXLWDVYLDJHQVFXUWDVSDUDIRUDGRV(8$YRFrSRGHUiQmRDWHQGHUjH[LJrQFLD GH´SUHVHQoDItVLFDµ3DUDFRQWDURVHXWHPSRGH´SUHVHQoDItVLFDµEDVWDVRPDUWRGR RWHPSRTXHHVWHYHQRV(VWDGRV8QLGRVHHQWmRVXEWUDLUWRGDVDVYLDJHQVTXHUHDOL]RX SDUDIRUDGRV(VWDGRV8QLGRV,VVRLQFOXLYLDJHQVFXUWDVDR&DQDGiHDR0p[LFR 3RUH[HPSORVHIRUDR0p[LFRSRUXPÀPGHVHPDQDGHYHLQFOXLUHVVDYLDJHP TXDQGRFRQWDURVGLDVTXHSDVVRXIRUDGRSDtV



´ 5HVLGrQFLDFRQWtQXDµpRWHPSRWRWDOTXHYRFrPRURXFRPRUHVLGHQWHSHUPDQHQWH QRV(VWDGRV8QLGRVDQWHVGHVROLFLWDUDQDWXUDOL]DomR6HSDVVDUPXLWRWHPSRIRUDGRV (VWDGRV8QLGRVGXUDQWHXPD~QLFDYLDJHPSRGHTXHEUDUDVXDVLWXDomRGH´UHVLGrQFLD FRQWtQXDµ

7HPSRFRPR5HVLGHQWHGH(VWDGRRX'LVWULWR86&,6 $PDLRUSDUWHGDVSHVVRDVWHPTXHYLYHUQRHVWDGRRXGLVWULWR86&,6RQGHVROLFLWDUDPVXDQDWXUDOL]DomRSRU XPSHUtRGRGHSHORPHQRVWUrVPHVHV(VWXGDQWHVSRGHPUHTXHUHUVXDQDWXUDOL]DomRQRORFDOGDLQVWLWXLomR TXHIUHTHQWDPRXQRORFDORQGHYLYHVXDIDPtOLD VHIRUHPGHSHQGHQWHVGRVSDLVÀQDQFHLUDPHQWH  %RP&DUiWHU0RUDO 3DUDWHUGLUHLWRDQDWXUDOL]DomRpSUHFLVRVHUXPDSHVVRDGHERPFDUiWHUPRUDO6HXPDSHVVRDFRPHWHU FHUWRVFULPHVGXUDQWHRVFLQFRDQRVDQWHULRUHVDRSHGLGRGHQDWXUDOL]DomRRXVHPHQWLUGXUDQWH DHQWUHYLVWDGHQDWXUDOL]DomRHVVDSHVVRDQmRpFRQVLGHUDGDFRPR´GHERPFDUiWHUPRUDOµ

&203257$0(172648(32'(0'(021675$5)$/7$'(&$5É7(5025$/ ‡'LULJLUErEDGRRXHVWDUErEDGRDPDLRUSDUWHGRWHPSR ‡-RJRLOHJDO ‡3URVWLWXLomR ‡0HQWLUSDUDFRQVHJXLUEHQHItFLRVLPLJUDWyULRV ‡1mRSDJDUSHQVmRLQIDQWLORUGHQDGDMXGLFLDOPHQWH ‡&RPHWHUDWRVWHUURULVWDV ‡3HUVHJXLUDOJXpPHPIXQomRGHUDoDUHOLJLmRSDtVGHRULJHPRSLQLmRSROtWLFD RXJUXSRVRFLDO

U.S. Department of Homeland Security, U.S. Citizenship and Immigration Services, Office of Citizenship, Welcome __ DC, 2007, Part’s Revised Edition. to the United States: A Guide for New Immigrants,Washington,

104

1-866-517-4467


6HYRFrFRPHWHUGHWHUPLQDGRVFULPHVQXQFDSRGHUiVHWRUQDUFLGDGmRDPHULFDQRHSURYDYHOPHQWHVHUi UHPRYLGRGRSDtV(VVHVFULPHVVmRFKDPDGRVGH´EDUUHLUDVµSDUDQDWXUDOL]DomR([HPSORVGHEDUUHLUDV SHUPDQHQWHVSDUDQDWXUDOL]DomRVmRRVFULPHVFKDPDGRV´TXDOLÀFDGRVµ VHFRPHWLGRVDSDUWLUGHGH QRYHPEURGH TXHLQFOXHPKRPLFtGLRHVWUXSRDEXVRVH[XDOGHFULDQoDVDJUHVVmRYLROHQWDWUDLomR HWUiÀFRLOHJDOGHGURJDVDUPDVRXSHVVRDV2XWURVH[HPSORVGHLPLJUDQWHVSHUPDQHQWHPHQWHEDUUDGRV GDFLGDGDQLDDPHULFDQDVmRRVLVHQWRVRXGLVSHQVDGRVGHVHUYLUQDV)RUoDV$UPDGDVGRV(8$SRUVHUHP LPLJUDQWHVHRVLPLJUDQWHVGHVHUWRUHVGDV)RUoDV$UPDGDVGRV(8$ eSRVVtYHOTXHVXDFLGDGDQLDVHMDQHJDGDFDVRYRFrVHFRPSRUWHGHRXWUDVPDQHLUDVTXHGHPRQVWUHPIDOWD GHERPFDUiWHUPRUDO ([LVWHPRXWURVFULPHVTXHFRQVWLWXHPEDUUHLUDVWHPSRUiULDVSDUDQDWXUDOL]DomR$EDUUHLUDWHPSRUiULD JHUDOPHQWHLPSHGHDFLGDGDQLDSRUXPSHUtRGRGHDWpFLQFRDQRVDSyVDRFRUUrQFLDGRFULPH([HPSORV ‡4XDOTXHUFULPHFRQWUDXPDSHVVRDFRPDLQWHQomRGHIHULU ‡4XDOTXHUFULPHFRQWUDSURSULHGDGHRXRJRYHUQRTXHHQYROYDIUDXGH ‡'RLVRXPDLVFULPHVFRPSHQDVFRPELQDGDVGHFLQFRDQRVRXPDLV ‡9LRODomRGDVOHLVVREUHVXEVWkQFLDVFRQWURODGDV SRUH[HPSORXVRRXYHQGDGHGURJDVLOHJDLV  ‡3HUPDQrQFLDHPFDGHLDRXSULVmRSRUGLDVRXPDLVGXUDQWHRV~OWLPRVFLQFRDQRV 5HODWHTXDOTXHUFULPHTXHWHQKDFRPHWLGRDRVROLFLWDUQDWXUDOL]DomR,VVRLQFOXLFULPHVTXHMiIRUDP UHWLUDGRVGHVHXKLVWyULFRRXFULPHVFRPHWLGRVDQWHVGDLGDGHGHDQRV6HYRFrQmRFRPXQLFDUHVVHV FULPHVDR86&,6VHXSHGLGRGHFLGDGDQLDSRGHUiVHUQHJDGRHYRFrDLQGDFRUUHRULVFRGHVHUSURFHVVDGR ,QJOrVH&LYLVPR (PJHUDOpSUHFLVRGHPRQVWUDUTXHVDEHOHUHVFUHYHUHIDODULQJOrVEiVLFReWDPEpPQHFHVViULRWHU FRQKHFLPHQWREiVLFRGDKLVWyULDHGRJRYHUQRGRV(8$ WDPEpPFRQKHFLGRSRUFLYLVPR eREULJDWyULR SDVVDUQRWHVWHGHLQJOrVHQRWHVWHGHFLYLVPRSDUDSURYDUVHXFRQKHFLPHQWR 9iULDVHVFRODVHRUJDQL]Do}HVFRPXQLWiULDVDMXGDPRVFDQGLGDWRVDVHSUHSDUDUHPSDUDRWHVWHGHFLGDGDQLD 2JXLD$*XLGHWR1DWXUDOL]DWLRQIRUQHFHH[HPSORVGHSHUJXQWDVTXHFDHPQRWHVWH2HVFULWyULRGHFLGDGDQLD 2IÀFHRI&LWL]HQVKLS GR86&,6RIHUHFHSURGXWRVTXHDMXGDPDHVWXGDUSDUDRWHVWHFRPRRVFDUW}HV &LYLF)ODVK&DUGVHDSXEOLFDomR/HDUQ$ERXWWKH8QLWHG6WDWHV4XLFN&LYLFV/HVVRQV$FHVVHHVVHPDWHULDOJUDWXLWRHP KWWSZZZXVFLVJRY 'HGLFDomRj&RQVWLWXLomR eSUHFLVRHVWDUGLVSRVWRDDSRLDUHGHIHQGHURV(VWDGRV8QLGRVHVXD&RQVWLWXLomR2FDQGLGDWRjFLGDGDQLD GHFODUDVXD´GHGLFDomRµRXOHDOGDGHDRV(VWDGRV8QLGRVHj&RQVWLWXLomRGRV(8$DRID]HUR-XUDPHQWR GH)LGHOLGDGH9RFrWRUQDVHFLGDGmRGRV(8$TXDQGRID]R-XUDPHQWRGH)LGHOLGDGH

U.S. Department of Homeland Security, U.S. Citizenship and Immigration Services, Office of Citizenship, Welcome to the United States: A Guide for New Immigrants,Washington, __ DC, 2007, Part’s Revised Edition.

wwww.listabrasilusa.com

105


(;&(d¯(6­6(;,*È1&,$648$172$2,1*/È6(&,9,602 2VWHVWHVVmRGLIHUHQWHVSDUDDOJXPDVSHVVRDVTXHVROLFLWDPDQDWXUDOL]DomRHPIXQomR GHVXDLGDGHHGRWHPSRTXHHVWmRYLYHQGRQRV(8$ 6HWLYHU

7LYHUYLYLGRFRPR UHVLGHQWHSHUPDQHQWH QRV(8$SRU

1mRpSUHFLVR ID]HU

DQRVGH LGDGHRXPDLV

DQRV

7HVWHGHLQJOrV

7HVWHGHFLYLVPR HPVXDOtQJXD

DQRVGH LGDGHRXPDLV

DQRV

7HVWHGHLQJOrV

7HVWHGHFLYLVPR HPVXDOtQJXD

DQRVGH LGDGHRXPDLV

DQRV

7HVWHGHLQJOrV

7HVWHVLPSOLÀFDGR GHFLYLVPR HPVXDOtQJXD

eSUHFLVR ID]HU

6HYRFrIRULVHQWRGRWHVWHGHLQJOrVWHUiTXHWUD]HUVHXSUySULRWUDGXWRUSDUDRWHVWHGHFLYLVPR 6HIRUSRUWDGRUGHGHÀFLrQFLDTXHRLPSRVVLELOLWHGHFRPSDUHFHUjHQWUHYLVWDKiSURYLGrQFLDV DVHUHPWRPDGDV3DUDPDLRUHVLQIRUPDo}HVOLJXHSDUDR'LVTXH)RUPXOiULRV86&,6 HVROLFLWHR)RUPXOiULR1RXREWHQKDXPDFySLDQRVLWHGR86&,6 KWWSZZZXVFLVJRY

$VSHVVRDVTXHVmRFRPSURYDGDPHQWHSRUWDGRUDVGHGHÀFLrQFLDItVLFDRXGHGHVHQYROYLPHQWRTXH DVWRUQHLQFDSD]HVGHFRPSUHHQGHURVLJQLÀFDGRGRMXUDPHQWRQmRSUHFLVDUmRID]HUR-XUDPHQWRGH )LGHOLGDGH 6HVHXSURFHVVRGHQDWXUDOL]DomRDLQGDHVWLYHUSHQGHQWHHYRFrPXGDUGHHQGHUHoRpQHFHVViULRIRUQHFHU DR86&,6RVHXQRYRHQGHUHoR9RFrSRGHOLJDUSDUDRQ~PHURSDUDLQIRUPDUR VHXQRYRHQGHUHoReWDPEpPQHFHVViULRDSUHVHQWDUR)RUPXOiULR$5MXQWRDR'+69RFrSRGH FRPXQLFDUDPXGDQoDGHHQGHUHoRRQOLQHXVDQGRR)RUPXOiULR(OHWU{QLFR$5GLVSRQtYHOHP KWWSZZZXVFLVJRY$VLQVWUXo}HVHVWmRQDSiJLQD &HULP{QLDVGH1DWXUDOL]DomR 6HR86&,6DSURYDUVXDVROLFLWDomRGHQDWXUDOL]DomRYRFrSUHFLVDFRPSDUHFHUDXPDFHULP{QLDHID]HUR -XUDPHQWRGH)LGHOLGDGH286&,6HQYLDUiR)RUPXOiULR11RWLFHRI1DWXUDOL]DWLRQ2DWK&HUHPRQ\ QRWLÀFDomRGHFHULP{QLDGHMXUDPHQWRGHÀGHOLGDGH TXHFRQWpPLQIRUPDo}HVVREUHDGDWDHKRUiULR GHVXDFHULP{QLD9RFrSUHFLVDSUHHQFKHURIRUPXOiULRHOHYiORjFHULP{QLD 6HYRFrQmRSXGHULUjFHULP{QLDGHWHUPLQDGDpSRVVtYHOUHPDUFDUDGDWDGDFHULP{QLD3DUDUHPDUFDU pQHFHVViULRHQYLDUR)RUPXOiULR1DRHVFULWyULRORFDOGR86&,6MXQWDPHQWHFRPXPDFDUWD H[SOLFDQGRSRUTXHYRFrQmRSRGHFRPSDUHFHUjFHULP{QLD 6HX&DUWmRGH5HVLGHQWH3HUPDQHQWHGHYHVHUGHYROYLGRDR86&,6TXDQGRFKHJDUjFHULP{QLDGH -XUDPHQWR9RFrQmRSUHFLVDUiPDLVGRFDUWmRSRUTXHQDFHULP{QLDUHFHEHUiR&HUWLÀFDGRGH 1DWXUDOL]DomR 6ypFLGDGmRTXHPMiIH]R-XUDPHQWRGH)LGHOLGDGH1DKRUDGRMXUDPHQWRXPRÀFLDOOrRWH[WR GHYDJDUSDUWHSRUSDUWHHSHGHSDUDYRFrUHSHWLUDVSDODYUDV8PDYH]MXUDPHQWDGRYRFrUHFHEHUiVHX U.S. Department of Homeland Security, U.S. Citizenship and Immigration Services, Office of Citizenship, Welcome to the United States: A Guide for New Immigrants,Washington, DC, 2007, Part’s Revised Edition.

__

106

1-866-517-4467


&HUWLÀFDGRGH1DWXUDOL]DomR(VVHFHUWLÀFDGRSURYDTXHYRFrpFLGDGmRDPHULFDQR$QWHVGR-XUDPHQWR GH)LGHOLGDGHQDFHULP{QLDIRUPDOGHQDWXUDOL]DomRYRFrQmRpFLGDGmR $FHULP{QLDGH-XUDPHQWRGH)LGHOLGDGHpXPHYHQWRS~EOLFR0XLWDVFRPXQLGDGHVUHDOL]DPFHULP{QLDV HVSHFLDLVQR'LDGD,QGHSHQGrQFLDHPGHMXOKR9HULÀTXHVHVXDFRPXQLGDGHUHDOL]DFHULP{QLDV HVSHFLDLVGHFLGDGDQLDQRGLDGHMXOKRHFRPRYRFrSRGHSDUWLFLSDU0XLWDVSHVVRDVWUD]HPDIDPtOLD SDUDFRPHPRUDUDSyVDFHULP{QLD

26(67$'2681,'26'(+2-(

7ASHINGTON -ONTANA /REGON

)DAHO 7YOMING

.ORTH $AKOTA

#OLORADO +ANSAS

!RIZONA

7ISCONSIN

)NDIANA

)OWA

.EW -EXICO

.EW 9ORK

0ENNSYLVANIA /HIO

)LLINOIS

5TAH #ALIFORNIA

-ISSOURI +ENTUCKY

/KLAHOMA !RKANSAS

4ENNESSEE

!LABAMA

'EORGIA

6IRGINIA

.EW(AMPSHIRE -ASSACHUSETTS 2HODE)SLAND #ONNECTICUT .EW*ERSEY $ELAWARE -ARYLAND 7ASHINGTON $# 7EST6IRGINIA

.ORTH #AROLINA

3OUTH#AROLINA

4EXAS

&LORIDA

!LASKA

,OUISIANA (AWAII

-AINE

-ICHIGAN

3OUTH $AKOTA

.EBRASKA

.EVADA

6ERMONT

-INNESOTA

-ISSISSIPPI

2V(VWDGRV8QLGRV WDPEpPLQFOXHPRV WHUULWyULRVGH*XDP 6DPRD$PHULFDQDDV ,OKDV9LUJHQV$PHULFDQDV HRV(VWDGRV/LYUHV $VVRFLDGRVGH3RUWR5LFR HGDV,OKDV0DULDQDVGR 1RUWHTXHQmRDSDUHFHP QHVWHPDSD

U.S. Department of Homeland Security, U.S. Citizenship and _ Immigration Services, Office of Citizenship, Welcome _ to the United States: A Guide for New Immigrants,Washington, DC, 2007, Part’s Revised Edition.

wwww.listabrasilusa.com

107


2&DPLQKR(VWi7UDoDGR (VSHUDPRVTXHHVWHJXLDVHMD~WLOSDUDYRFr(OH IRLUHGLJLGRSDUDDX[LOLDUUHVLGHQWHVDFRPHoDUHP VXDVYLGDVQRV(VWDGRV8QLGRVHHQWHQGHUHPVHXV GLUHLWRVHUHVSRQVDELOLGDGHVFRPRUHVLGHQWHV SHUPDQHQWHV2JXLDH[SOLFDDVPDQHLUDV SHODVTXDLVYRFrSRGHSDUWLFLSDUGDYLGDGDVXD FRPXQLGDGH&RQWpPWDPEpPFRLVDVTXHYRFr WHUiTXHDSUHQGHUVHTXLVHUVHWRUQDUFLGDGmR DPHULFDQRQDWXUDOL]DGR2VLWHGR86&,6IRUQHFH RXWURVPDWHULDLVTXHDMXGDUmRYRFrDDSUHQGHU PDLV KWWSZZZXVFLVJRY  $JRUDTXHYRFrFKHJRXWHUiRSRUWXQLGDGHGH VHQWLURSRWHQFLDOGDYLGDQRV(VWDGRV8QLGRV %RDVYLQGDVDYRFrFRPRUHVLGHQWHSHUPDQHQWH HDTXLGHL[DPRVQRVVRVYRWRVGHSURVSHULGDGHH IHOLFLGDGHHPQRVVRSDtV

__

U.S. Department of Homeland Security, U.S. Citizenship and Immigration Services, Office of Citizenship, Welcome to the United States: A Guide for New Immigrants,Washington, DC, 2007, Part’s Revised Edition.

108

1-866-517-4467


2009 M

T

JANUARY W

T

F

S

S

1

2

3

4

N

O T E S

M

T

APRIL

W

T

F

S

S

1

2

3

4

5

5

6

7

8

9

10

11

6

7

8

9

10

11

12

12

13

14

15

16

17

18

13

14

15

16

17

18

19

19

20

21

22

23

24

25

20

21

22

23

24

25

26

26

27

28

29

30

31

27

28

29

30

M

T

M

T

W

FEBRUARY W

T

F

S

S

MAY T

1

F

S

S

1

2

3

2

3

4

5

6

7

8

4

5

6

7

8

9

10

9

10

11

12

13

14

15

11

12

13

14

15

16

17

16

17

18

19

20

21

22

18

19

20

21

22

23

24

23

24

25

26

27

28

25

26

27

28

29

30

31

M

T

S

M

T

W

T

F

S

S

1

1

2

3

4

5

6

7

MARCH W

T

F

S

JUNE

2

3

4

5

6

7

8

8

9

10

11

12

13

14

9

10

11

12

13

14

15

15

16

17

18

19

20

21

16

17

18

19

20

21

22

22

23

24

25

26

27

28

23

24

25

26

27

28

29

29

30

30

31

S

2009 M

T

JULY

W

T

F

S

S

1

2

3

4

5

N

O T E S

M

T

OCTOBER W

T

F

S

1

2

3

4

6

7

8

9

10

11

12

5

6

7

8

9

10

11

13

14

15

16

17

18

19

12

13

14

15

16

17

18

20

21

22

23

24

25

26

19

20

21

22

23

24

25

27

28

29

30

31

26

27

28

29

30

31

M

T

M

T

W

T

F

S

AUGUST W

T

F

S

S

1

2

NOVEMBER

S 1

3

4

5

6

7

8

9

2

3

4

5

6

7

8

10

11

12

13

14

15

16

9

10

11

12

13

14

15

17

18

19

20

21

22

23

16

17

18

19

20

21

22

24

25

26

27

28

29

30

23

24

25

26

27

28

29

31

M

30

SEPTEMBER T

W

T

F

S

S

1

2

3

4

5

6

7

8

9

10

11

12

13

14

15

16

17

18

19

21

22

23

24

25

26

28

29

30

wwww.listabrasilusa.com

M

DECEMBER

T

W

T

F

S

1

2

3

4

5

S 6

7

8

9

10

11

12

13

20

14

15

16

17

18

19

20

27

21

22

23

24

25

26

27

28

29

30

31

109


110 96

1-866-517-4467 Anuncie:1-866-517-4467

M

6 13 20 27

S

5 12 19 26

5 12 19 26

6 13 20 27

5 12 19 26

4 11 18 25

M

S

M

5 12 19 26

4 11 18 25

S

M

S

JULY W 1 8 15 22 29

R 2 9 16 23 30

OCTOBER W R 1 6 7 8 13 14 15 20 21 22 27 28 29

T

7 14 21 28

T

T

APRIL W R 1 2 7 8 9 14 15 16 21 22 23 28 29 30

JANUARY W R 1 6 7 8 13 14 15 20 21 22 27 28 29

T

F 2 9 16 23 30

F 3 10 17 24 31

F 3 10 17 24

F 2 9 16 23 30

S 3 10 17 24 31

S 4 11 18 25

S 4 11 18 25

S 3 10 17 24 31

S 1 8 15 22 29

2 9 16 23 30

S

3 10 17 24 31

S

S 1 8 15 22

M 2 9 16 23 30

3 10 17 24 31

M

4 11 18 25

M

M 2 9 16 23

7 14 21 28

R

5 12 19 26

6 13 20 27

AUGUST W R

6 13 20 27

MAY W

FEBRUARY W R 4 5 11 12 18 19 25 26

NOVEMBER T W R 3 4 5 10 11 12 17 18 19 24 25 26

4 11 18 25

T

5 12 19 26

T

T 3 10 17 24

F 6 13 20 27

7 14 21 28

F

F 1 8 15 22 29

F 6 13 20 27

2009

S 7 14 21 28

S 1 8 15 22 29

S 2 9 16 23 30

S 7 14 21 28

6 13 20 27

S

6 13 20 27

S

7 14 21 28

S

S 1 8 15 22 29

7 14 21 28

M

7 14 21 28

M

M 1 8 15 22 29

M 2 9 16 23 30 JUNE W 3 10 17 24

MARCH W 4 11 18 25

R 4 11 18 25

R 5 12 19 26

DECEMBER T W R 1 2 3 8 9 10 15 16 17 22 23 24 29 30 31

SEPTEMBER T W R 1 2 3 8 9 10 15 16 17 22 23 24 29 30

T 2 9 16 23 30

T 3 10 17 24 31

F 4 11 18 25

F 4 11 18 25

F 5 12 19 26

F 6 13 20 27

S 5 12 19 26

S 5 12 19 26

S 6 13 20 27

S 7 14 21 28

JANUARY th 19 ʹ MLK Day FEBRUARY nd 2 ʹ Groundhog Day th 14 ʹ sĂůĞŶƚŝŶĞ͛ƐĂLJ th 16 ʹ WƌĞƐŝĚĞŶƚ͛ƐĂLJ th 25 ʹ Ash Wednesday MARCH th 8 ʹ Daylights Savings Begins th 17 ʹ ^ƚ͘WĂƚƌŝĐŬ͛ƐĂLJ th 20 ʹ Spring Begins APRIL st 1 ʹ Ɖƌŝů&ŽŽů͛ƐĂLJ th 12 ʹ Easter MAY th 5 ʹ Cinco de Mayo th 10 ʹ DŽƚŚĞƌ͛ƐĂLJ th 25 ʹ Memorial Day JUNE th 14 ʹ Flag Day st 21 ʹ &ĂƚŚĞƌ͛ƐĂLJ st 21 ʹ Summer Begins JULY th 4 ʹ Independence Day SEPTEMBER th 7 ʹ Labor Day nd 22 ʹ Autumn Begins OCTOBER th 12 ʹ Columbus Day st 31 ʹ Halloween NOVEMBER st 1 ʹ Daylight Savings Ends th 11 ʹ sĞƚĞƌĂŶ͛ƐĂLJ th 26 ʹ Thanksgiving DECEMBER st 21 ʹ Winter Begins th 25 - Christmas

2009


CALENDĂ RIO ACADEMICO

2008 & 2010

wwww.listabrasilusa.com Anuncie: 1-866-517-4467

111 97


Hrs

Hrs

Hrs

112

1-866-517-4467


Hrs

Hrs

Hrs

www.listabrasilusa.com

113


Hrs

Hrs

Hrs

114

1-866-517-4467


Hrs

Hrs

Hrs

www.listabrasilusa.com

115


116

Anuncie: 1-866-517-4467


A B C D

Anuncie: 1-866-517-4467

117


118


E F G H

119


120

Anuncie: 866-517-4467


I J K L

Anuncie:866-517-4467

121


122

Anuncie:866-517-4467


M N O P

Anuncie:866-517-4467

123


124

Anuncie:866-517-4467


Q R S T

Anuncie:866-517-4467

125


126

Anuncie:866-517-4467


U V W X Z

Anuncie:866-517-4467

127


Anotações

128

Anuncie:866-517-4467


Anotações

Anuncie:866-517-4467

129


Anotações

130

Anuncie:866-517-4467


Anotações

Anuncie:866-517-4467

131


Saudades do Brasil? Visite nosso site: www.listabrasilusa.com 132

1-866-517-4467


www.listabrasilusa.com

133


134

1-866-517-4467


ANOTAÇÕES

www.listabrasilusa.com

Visite-nos online : www.hellobrazil.net

135


136

www.listabrasilusa.com


Lista Brasil Usa da Flórida 2009  

Págians amarelas brasileiras da Florida, edição 2009

Read more
Read more
Similar to
Popular now
Just for you