Haematologica, Volume 109, Issue 4

Page 1

Journal of the Ferrata Storti Foundation VOL. 109 APRIL 2024 haematologica.org ISSN 0390 - 6078

Reasons for publishing in

Much cited Journal

Impact Factor 2022: 10.1

CiteScore 2022: 13.3

Fast review process

h

Submission ® 1st decision (submit to peer review or quick rejection): 3 days

Submission ® 2nd decision for peer-reviewed papers (accept, reject or make changes): 24 days

Low publication cost

The publisher is a non-profit Foundation that keeps the cost for authors as low as possible

Journal of the Ferrata - Storti Foundation
aematologica

Editor-in-Chief

Jacob M. Rowe (Jerusalem)

Deputy Editors

Carlo Balduini (Pavia), Jerry Radich (Seattle)

Associate Editors

Michael Deininger (Milwaukee), Shai Izraeli (Tel Aviv), Pier Mannuccio Mannucci (Milan), Jessica Okosun (London), Pavan Reddy (Ann Arbor), David C. Rees (London), Paul G. Richardson (Boston), Francesco Rodeghiero (Vicenza), Gilles Salles (New York), Kerry Savage (Vancouver), Aaron Schimmer (Toronto), Richard F. Schlenk (Heidelberg)

Statistical Consultant

Catherine Klersy (Pavia)

AI Consultant

Jean Louis Raisaro (Lausanne)

Editorial Board

Walter Ageno (Varese), Sarit Assouline (Montreal), Andrea Bacigalupo (Roma), Taman Bakchoul (Tübingen), Pablo Bartolucci (Créteil), Katherine Borden (Montreal), Marco Cattaneo (Milan), Corey Cutler (Boston), Kate Cwynarski (London), Ahmet Dogan (New York), Mary Eapen (Milwaukee), Francesca Gay (Torino), Ajay Gopal (Seattle), Alex Herrera (Duarte), Martin Kaiser (London), Marina Konopleva (Houston), Nicolaus Kröger (Hamburg), Austin Kulasekararaj (London), Shaji Kumar (Rochester), Ann LaCasce (Boston), Matthew J. Mauer (Rochester) Neha Mehta-Shah (St. Louis), Moshe Mittelman (Tel Aviv), Alison Moskowitz (New York), Yishai Ofran (Haifa), Farhad Ravandi (Houston), John W. Semple (Lund), Liran Shlush (Toronto), Sarah K. Tasian (Philadelphia), Pieter van Vlieberghe (Ghent), Ofir Wolach (Haifa), Loic Ysebaert (Toulouse)

Managing Director

Antonio Majocchi (Pavia)

Editorial Office

Lorella Ripari (Office & Peer Review Manager), Simona Giri (Production & Marketing Manager), Paola Cariati (Graphic Designer), Giulia Carlini (Graphic Designer), Debora Moscatelli (Graphic Designer), Igor Poletti (Graphic Designer), Diana Serena Ravera (Peer Review), Laura Sterza (Account Administrator), Andrew Sturgeon (Peer Review)

Assistant Editors

Luca Arcaini (Scientific Consultant), Luk Cox (Graphic Artist), Britta Dost (English Editor), Anne Freckleton (English Editor), Rosangela Invernizzi (Scientific Consultant), Marianna Rossi (Scientific Consultant), Massimo Senna (Information Technology), Rachel Stenner (English Editor)

Haematologica | 109 April 2024

Brief information on Haematologica

Haematologica (print edition, pISSN 0390-6078, eISSN 1592-8721) publishes peer-reviewed papers on all areas of experimental and clinical hematology. The journal is owned by a non-profit organization, the Ferrata Storti Foundation, and serves the scientific community following the recommendations of the World Association of Medical Editors (www. wame.org) and the International Committee of Medical Journal Editors (www.icmje.org).

Haematologica publishes Editorials, Original articles, Review articles, Perspective articles, Editorials, Guideline articles, Letters to the Editor, Case reports & Case series and Comments. Manuscripts should be prepared according to our guidelines (www.haematologica.org/information-for-authors), and the Uniform Requirements for Manuscripts Submitted to Biomedical Journals, prepared by the International Committee of Medical Journal Editors (www.icmje.org).

Manuscripts should be submitted online at http://www.haematologica.org/.

Conflict of interests. According to the International Committee of Medical Journal Editors (http://www.icmje. org/#conflicts), “Public trust in the peer review process and the credibility of published articles depend in part on how well conflict of interest is handled during writing, peer review, and editorial decision making”. The ad hoc journal’s policy is reported in detail at www.haematologica.org/content/policies.

Transfer of Copyright and Permission to Reproduce Parts of Published Papers. Authors will grant copyright of their articles to the Ferrata Storti Foundation. No formal permission will be required to reproduce parts (tables or illustrations) of published papers, provided the source is quoted appropriately and reproduction has no commercial intent. Reproductions with commercial intent will require written permission and payment of royalties.

Subscription. Detailed information about subscriptions is available at www.haematologica.org. Haematologica is an open access journal and access to the online journal is free. For subscriptions to the printed issue of the journal, please contact: Haematologica Office, via Giuseppe Belli 4, 27100 Pavia, Italy (phone +39.0382.27129, fax +39.0382.394705, E-mail: info@haematologica.org).

Rates of the printed edition for the year 2022 are as following:

Institutional: Euro 700

Personal: Euro 170

Advertisements. Contact the Advertising Manager, Haematologica Office, via Giuseppe Belli 4, 27100 Pavia, Italy (phone +39.0382.27129, fax +39.0382.394705, e-mail: marketing@haematologica.org).

Disclaimer. Whilst every effort is made by the publishers and the editorial board to see that no inaccurate or misleading data, opinion or statement appears in this journal, they wish to make it clear that the data and opinions appearing in the articles or advertisements herein are the responsibility of the contributor or advisor concerned. Accordingly, the publisher, the editorial board and their respective employees, officers and agents accept no liability whatsoever for the consequences of any inaccurate or misleading data, opinion or statement. Whilst all due care is taken to ensure that drug doses and other quantities are presented accurately, readers are advised that new methods and techniques involving drug usage, and described within this journal, should only be followed in conjunction with the drug manufacturer’s own published literature.

Direttore responsabile: Prof. Carlo Balduini; Autorizzazione del Tribunale di Pavia n. 63 del 5 marzo 1955.

Printing: Press Up, zona Via Cassia Km 36, 300 Zona Ind.le Settevene - 01036 Nepi (VT)

Haematologica | 109 April 2024
Associated with USPI, Unione Stampa Periodica Italiana. Premiato per l’alto valore culturale dal Ministero dei Beni Culturali ed Ambientali

Table of Contents

Volume 109, Issue 4: April 2024

About the Cover

Image taken from the editorial by Y. Masamoto and M. Kurokawa in this issue.

Landmark Papers in Hematology

1019 Anti-CD19 chimeric antigen receptor T-cell therapy for B-cell acute lymphoid leukemia

A.P. Rapoport

https://doi:10.3324/haematol.2024.285155

Editorials

1021 Eligibility criteria: too big, too small or just right?

E.Atallah

https://doi.org/10.3324/haematol.2023.283972

1022

More than a lonca-shot: beating the odds in relapsed/refractory diffuse large B-cell lymphoma

C.Ho and S.D. Smith

https://doi.org/10.3324/haematol.2023.284056

1025 Using machine learning to unravel the intricacy of acute myeloid leukemia

L.Guarnera and V. Visconte

https://doi.org/10.3324/haematol.2023.284085

1027 MYC overexpression: adding another piece to the puzzle of high-risk mantle cell lymphoma

A.Kumar

https://doi.org/10.3324/haematol.2023.284105

1029 First-line MAPK inhibition in pediatric histiocytosis: are we ready?

O.Abla

https://doi.org/10.3324/haematol.2023.284188

1032 A key to engineering natural killer cells to attack acute myeloid leukemia

Y.Masamoto and M. Kurokawa

https://doi.org/10.3324/haematol.2023.284272

Review Articles

1035 How we manage a high D-dimer

M.Franchini et al.

https://doi.org/10.3324/haematol.2023.283966

Articles

Acute Leukemia

1046 Use, variability, and justification of eligibility criteria for phase II and III clinical trials in acute leukemia

A.Hantel et al.

https://doi.org/10.3324/haematol.2023.283723

Haematologica | 109 April 2024 I

Acute Lymphoblastic Leukemia

1053 Association of NUDT15 gene polymorphism with adverse reaction, treatment efficacy, and dose of 6-mercaptopurine in patients with acute lymphoblastic leukemia: a systematic review and metaanalysis

S. Du et al.

https://doi.org/10.3324/haematol.2023.282761

Acute Lymphoblastic Leukemia

1069 Susceptibility of pediatric acute lymphoblastic leukemia to STAT3 inhibition depends on p53 induction L. Gasparoli et al.

https://doi.org/10.3324/haematol.2023.283613

Acute Myeloid Leukemia

1082 Extended exposure to low doses of azacytidine induces differentiation of leukemic stem cells through activation of myeloperoxidase

D.V. Jeyaraju et al.

https://doi.org/10.3324/haematol.2023.283437

Acute Myeloid Leukemia

1095 Prognostic value of European LeukemiaNet 2022 criteria and genomic clusters using machine learning in older adults with acute myeloid leukemia

S. Park et al.

https://doi.org/10.3324/haematol.2023.283606

Acute Myeloid Leukemia

1107 Immune checkpoint molecule DNAM-1/CD112 axis is a novel target for natural killer-cell therapy in acute myeloid leukemia

Y. Kaito et al.

https://doi.org/10.3324/haematol.2023.282915

Cell Therapy & Immunotherapy

1121

HLA-C*04:09N is expressed at the cell surface and triggers peptide-specific T-cell activation

C. Welters et al.

https://doi.org/10.3324/haematol.2023.283812

Hemostasis

1128 Tissue factor pathway inhibitor is associated with risk of venous thromboembolism and all-cause mortality in patients with cancer

C. Englisch et al.

https://doi.org/10.3324/haematol.2023.283581

Histiocytic Disorder

1137 Dabrafenib and trametinib in Langerhans cell histiocytosis and other histiocytic disorders

E. Cournoyer et al.

https://doi.org/10.3324/haematol.2023.283295

Non-Hodgkin Lymphoma

1149

Immunochemotherapy plus lenalidomide for high-risk mantle cell lymphoma with measurable residual disease evaluation

Z.D. Epstein-Peterson et al.

https://doi.org/10.3324/haematol.2023.282898

Non-Hodgkin Lymphoma

1163 Outcome of combined modality treatment in first-line for stage I(E) peripheral T-cell lymphoma; a nationwide population-based cohort study from the Netherlands

F.O. Meeuwes et al.

https://doi.org/10.3324/haematol.2023.283174

Non-Hodgkin Lymphoma

1171 MYC protein is a high-risk factor in mantle cell lymphoma and identifies cases beyond morphology, proliferation and TP53/p53 – a Nordic Lymphoma Group study

J.M. Rodrigues et al.

https://doi.org/10.3324/haematol.2023.283352

Haematologica | 109 April 2024 II

1184

Non-Hodgkin Lymphoma

Loncastuximab tesirine in relapsed/refractory diffuse large B-cell lymphoma: long-term efficacy and safety from the phase II LOTIS-2 study

P.F. Caimi et al.

https://doi.org/10.3324/haematol.2023.283459

Non-Hodgkin Lymphoma

1194 Polatuzumab vedotin plus bendamustine and rituximab or obinutuzumab in relapsed/refractory follicular lymphoma: a phase Ib/II study

C.R. Flowers et al.

https://doi.org/10.3324/haematol.2023.283557

Plasma Cell Disorders

1206 Ribosomal protein S3 mediates drug resistance of proteasome inhibitor: potential therapeutic application in multiple myeloma

G. Chen et al.

https://doi.org/10.3324/haematol.2023.282789

Plasma Cell Disorders

1220 Single cell analysis of the CD8+ T-cell compartment in multiple myeloma reveals disease specific changes are chiefly restricted to a CD69- subset suggesting potent cytotoxic effectors exist within the tumor bed

J. Favaloro et al.

https://doi.org/10.3324/haematol.2023.283062

Stem Cell Transplantation

1233 Targeting TFH cells is a novel approach for donor-specific antibody desensitization of allograft candidates: an in vitro and in vivo study

N. Ma et al.

https://doi.org/10.3324/haematol.2023.283698

Letters to the Editor

1247

Genome-wide assessment of genetic risk loci for childhood acute lymphoblastic leukemia in Japanese patients

M. Hangai et al.

https://doi.org/10.3324/haematol.2023.282914

1253 BH3 profiling as pharmacodynamic biomarker for the activity of BH3 mimetics

R.A. Pan et al.

https://doi.org/10.3324/haematol.2023.283060

1259

1264

1269

Subcutaneous injection of IHP-102 prevents lung vaso-occlusion in sickle cell disease mice

R.K. Dubey et al.

https://doi.org/10.3324/haematol.2023.283716

Long-term outcome after autologous BCR::ABL1-negative peripheral blood stem cell transplantation in adults with Philadelphia-positive acute lymphoblastic leukemia: a comparative study

L. Caillot et al.

https://doi.org/10.3324/haematol.2023.283742

Glofitamab monotherapy induces high complete response rates and manageable safety in Chinese patients with heavily pretreated relapsed or refractory diffuse large B-cell lymphoma

Y. Song et al.

https://doi.org/10.3324/haematol.2023.283802

1274

Low-dose azacitidine, pioglitazone and all-trans retinoic acid is safe in patients aged ≥60 years with acute myeloid leukemia refractory to standard induction chemotherapy (AMLSG 26-16/AML-ViVA): results of the safety run-in phase

D. Heudobler et al.

https://doi.org/10.3324/haematol.2023.283864

Haematologica | 109 April 2024 III

1279 Comorbidity indices for prognostic evaluation in multiple myeloma: a comprehensive evaluation of the Revised Myeloma Comorbidity Index and other comorbidity indices with pro- and retrospective applications

K.Schoeller et al.

https://doi.org/10.3324/haematol.2023.283884

1285 Catheter-related thrombosis in stem cell recipients: comparison of different types of catheter

S.Milczarek et al.

https://doi.org/10.3324/haematol.2023.283924

1289 Small myeloid subclones are present at diagnosis of multiple myeloma in patients who develop secondary myelodysplastic syndromes

G.Escure et al.

https://doi.org/10.3324/haematol.2023.284050

1293 Factor VIII genotype and the risk of developing high-responding or low-responding inhibitors in severe hemophilia A: data from the PedNet Hemophilia Cohort of 1,202 children

N.G. Andersson et al.

https://doi.org/10.3324/haematol.2023.284095

1297 CD38 expression by plasma cells in extramedullary multiple myeloma

L.Notarfranchi et al.

https://doi.org/10.3324/haematol.2023.284169

Case Reports

1301 A patient with minimal myeloma treatment who survived for 20 years

A.Djarmila Behsen et al.

https://doi.org/10.3324/haematol.2023.283563

1306 Emergence of TP53 mutation during lenalidomide therapy of myelodysplastic syndrome with del(5q) and its subsequent disappearance following salvage therapy with decitabine

N.Gangat et al.

https://doi.org/10.3324/haematol.2023.284547

Errata Corrige

1310 Erratum to: Retrospective analysis of pacritinib in patients with myelofibrosis and severe thrombocytopenia

S.Verstovsek et al.

https://doi.org/10.3324/haematol.2023.284815

1311 Erratum to: Utility of clinical comprehensive genomic characterization for diagnostic categorization in patients presenting with hypocellular bone marrow failure syndromes

P.Blombery et al.

https://doi.org/10.3324/haematol.2023.284760

Haematologica | 109 April 2024 IV

Anti-CD19 chimeric antigen receptor T-cell therapy for B-cell acute lymphoid leukemia

Aaron P. Rapoport

University of Maryland School of Medicine and Marlene and Stewart Greenebaum Cancer Center, Baltimore, MD, USA

E-mail: arapoport@umm.edu

https://doi.org/10.3324/haematol.2024.285155

©2024 Ferrata Storti Foundation

Published under a CC BY-NC license

TITLE Chimeric antigen receptor-modified T cells for acute lymphoid leukemia.

AUTHORS

JOURNAL

Grupp SA, Kalos M, Barrett D, et al.

The New England Journal of Medicine. 2013;368(16):1509-1518. doi: 10.1056/NEJMoa1215134.

Historically the long-term survival of patients with relapsed and refractory B-cell acute lymphoblastic leukemia (ALL) has been poor despite the application of allogeneic stem

cell transplants and especially after such transplants fail.1

In the landmark paper by the group led by Stephan A. Grupp, Michael Kalos and Carl H. June at the University of

Haematologica | 109 Mese 2024 1019 LANDMARK PAPER IN HEMATOLOGY A.P. Rapoport
Figure 1. Essential principles of chimeric antigen receptor T-cell therapy. CAR; chimeric antigen receptor; CRS: cytokine release syndrome; LDH: lactate dehydrogenase; CSF: cerebrospinal fluid. Figure adapted from Figures 1 and 2 in the original paper by Grupp et al.2

Pennsylvania and the Children’s Hospital of Philadelphia, two children received infusions of CD19-directed chimeric antigen receptor (CAR)-modified T cells (CTL019) for refractory pre-B-cell ALL (Figure 1).2

Both children experienced more than a 1,000-fold increase in CTL019 cells during the first 2 weeks after infusion, which comprised up to 72% and 34% of the total circulating T cells. Both children experienced high fevers starting a few days after the CTL019 infusion and lasting about 1 week; one of the children required blood pressure and ventilatory support while the other patient later developed encephalopathy. Both children had B-cell aplasia and total clearance of leukemia from their marrow by 1 month after treatment. One of the two children remained in remission for more than 12 years and recent studies suggest that anti-CD19 CAR T cells may persist, evolve into a CD4+ predominant phenotype and remain functional for 10 years or more in long-surviving leukemia patients.3

In addition to first demonstrating that patients with advanced and refractory ALL could achieve complete and durable remissions after CAR T-cell therapy, this landmark paper highlighted several principles which have become

References

1. Barrett AJ, Horowitz MM, Pollock BH, et al. Bone marrow transplants from HLA-identical siblings as compared with chemotherapy for children with acute lymphoblastic leukemia in a second remission. N Engl J Med. 1994;331(19):1253-1258.

2. Grupp SA, Kalos M, Barrett D, et al. Chimeric antigen receptor-

integral to the care of all patients with aggressive B-cell (and other hematologic) malignancies who receive CAR T-cell therapies. These include: (i) the importance of prompt recognition of life-threatening cytokine-release syndrome with features of macrophage activation due to marked elevation of interleukin-6, interferon- g and other cytokines and its successful management using the interleukin-6 receptor blocking antibody tocilizumab; (ii) potential trafficking of CAR T cells to the central nervous system and prolonged persistence leading to tumor clearance and perhaps contributing to neurological toxicity; and (iii) the risk of CAR T-cell target antigen loss (CD19) as a mechanism for treatment failure as one of the patients developed a CD19-negative relapse 2 months after treatment.

It is remarkable that so much was learned from a clinical research experience involving just two small patients. But, as Dr. Carl June and other wise clinical investigators have humbly said, “Every single patient can teach us important lessons”.

Disclosure

No conflicts of interest to disclose.

modified T cells for acute lymphoid leukemia. N Engl J Med. 2013;368(16):1509-1518.

3. Melenhorst JJ, Chen GM, Wang M, et al. Decade-long leukaemia remissions with persistence of CD4+ CAR T cells. Nature. 2022;602(7897):503-509.

Haematologica | 109 Mese 2024 1020 A.P. Rapoport LANDMARK PAPER IN HEMATOLOGY

Eligibility criteria: too big, too small

Division of Hematology & Oncology, Medical College of Wisconsin, Milwaukee, WI, USA

or just

right?

Correspondence: E. Atallah eatallah@mcw.edu

Received: September 25, 2023.

Accepted: October 2, 2023.

Early view: October 12, 2023.

https://doi.org/10.3324/haematol.2023.283972

©2024 Ferrata Storti Foundation

Published under a CC BY-NC license

In this issue of Haematologica, Hantel and colleagues1 review an important topic that is not commonly discussed: how do eligibility criteria affect the patient population enrolled and, in turn, affect the outcomes and interpretation of studies? On the one hand, eligibility criteria can be too restrictive, thereby reducing the number of eligible patients and decreasing the applicability of the findings to the general population or ‘real world’. On the other hand, eligibility criteria can be too liberal, thereby placing patients at an unnecessary risk. Finding the right balance is always a hard task. When writing a protocol, considerable thought and time should be given to the eligibility criteria. Despite that, we do not always get it right. In this study, the researchers reviewed the eligibility criteria in front-line phase II/III leukemia trials listed on clinicaltrials.gov from 2010 to 2019 and analyzed how often do we get it right. They sought to identify two concepts. The first is the consistency (concordance) between the trial eligibility criteria and known drug safety at the time of study initiation, and the second is the difference between the eligibility criteria and the drug safety-based limits.

Overall, the concordance between known toxicity and eligibility criteria was approximately 50%. So we got it right (No safety signal/No limit and Safety signal/Limit) in only half the studies. Surprisingly, approximately 30% of the studies had eligibility criteria that were too liberal (Safety signal/No limit) and approximately 10% were too restrictive (No safety signal/Limit).

Looking then at the difference between eligibility criteria and drug safety limits, we did not do any better. From 50% to 75% of studies had criteria that were more restrictive than the known drug safety limits.

Take bilirubin, for example. In 250 studies, 1.2%, 66.8%, 1.6%, and 30% of studies had no safety signal/no limit, safety signal/

References

1. Hantel A, Luskin MR, Khan I, et al. Use, variability, and justification of eligibility criteria for phase II and III clinical trials in acute leukemia. Haematologica. 2024;109(4):1046-1052.

limit, no safety signal/limit and safety signal/no limit included in the eligibility criteria, respectively. Of the studies that had a safety signal with limit, that limit was too restrictive in 75% of the studies.

So, in summary, eligibility criteria that were supposed to be included were missed 30% of the time. When they were appropriately included, they were more restrictive 50-75% of the time. This inaccuracy can lead to biases both ways: putting patients on studies and exposing them to unnecessary risk because we as researchers want to enroll more patients on studies, or excluding others that have missed the eligibility criteria by an unjustified 0.1 criteria limit. In addition, this affects the generalizability of findings to the general population, and may affect the efficacy and outcomes of these studies. The authors of the study acknowledge several weaknesses, mainly that the limits or known safety may not have been fully known at the time of protocol writing. Also, we do not know how many more patients may have been enrolled on those studies had the criteria been ‘just right’. Nevertheless, this study highlights the need for careful review of eligibility criteria and the criteria limits included in each study. This can be done by minimizing the use of eligibility criteria ‘templates’, careful review of the literature, and including only those eligibility criteria that will impact patient safety. The proper use of eligibility criteria has led several groups, including the Food and Drug Administration, to issue specific guidance for including organ dysfunction or infectious disease criteria in studies.2,3 I acknowledge that, after reading this paper, I for one will pay even more attention to the eligibility criteria of my studies and will continue to aim to get them ‘just right’.

Disclosures

No conflicts of interest to disclose.

2. Kim ES, Bruinooge SS, Roberts S, et al. Broadening eligibility criteria to make clinical trials more representative: American Society of Clinical Oncology and Friends of Cancer Research Joint Research Statement. J Clin Oncol. 2017;35(33):3737-3744.

3. Gerber DE, Singh H, Larkins E, et al. A new approach to simplifying and harmonizing cancer clinical trials-standardizing eligibility criteria. JAMA Oncol. 2022;8(9):1333-1339.

Haematologica | 109 April 2024 1021 EDITORIAL

More than a lonca-shot: beating the odds in relapsed/ refractory diffuse large B-cell lymphoma

1Division of Hematology and Oncology, Department of Internal Medicine, University of Washington and 2Fred Hutchinson Cancer Center, Seattle, WA, USA

Correspondence: S.D. Smith ssmith50@fredhutch.org

Received: September 11, 2023.

Accepted: September 26, 2023.

Early view: October 5, 2023.

https://doi.org/10.3324/haematol.2023.284056

©2024 Ferrata Storti Foundation

Published under a CC BY-NC license

Recent randomized trials have yielded major advances in management of diffuse large B-cell lymphoma (DLBCL), integrating antibody-drug conjugate (ADC) and CD19-directed chimeric antigen receptor T-cell (CAR T) therapies into modern standards of care. However, relapsed/refractory (R/R) DLBCL becomes successively less curable with each recurrence—and patient comorbidities, residual drug toxicities, logistical requirements, and disease biology become increasingly complex. While single-arm studies have yielded several accelerated drug approvals by the US Food and Drug Administration (FDA), these trials are markedly heterogenous with regard to design, eligibility criteria, duration of follow-up, and logistical requirements.1-5 In this context, selecting the therapy for R/R DLBCL with the best long-term odds of success—balancing efficacy and risk of toxicity—has emerged a formidable challenge.

Among key therapies approved for 3+ line treatment of DLBCL is loncastuximab tesirine-lpyl (lonca), an anti-CD19 antibody conjugated to a pyrrolobenzodiazepine dimer (PBD) DNA-alkylating cytotoxic payload. Lonca was granted US FDA approval in April 2021, for patients with R/R DLBCL, transformed lymphoma, and high-grade B-cell lymphoma, after two or more prior systemic therapies. This approval was based on findings from the single-arm LOTIS-2 trial, which demonstrated an overall response rate (ORR) of 48% and complete response (CR) rate of 24% with lonca administered intravenously every 3 weeks, for up to 1 year.1 A number of other PBD-based antibody-drug conjugates have been tested in hematologic malignancies but have met the fate of termination by trial sponsors, or unacceptable myelotoxicity and infection risks.6 Lonca succeeded in DLBCL where many others failed, as the LOTIS-2 trial exceeded its efficacy primary goal (targeting a 40% ORR) while demonstrating acceptable toxicity, in a highly refractory population (58% refractory to their most recent line of treatment). Nonetheless, follow-up of this study was short and toxicities were significant, including

cytopenias, photosensitivity, GGT elevation, and volume overload/pleural effusions; median number of treatment cycles was three, and 6% died of treatment-emergent adverse events. Given the stakes involved in selecting lonca for clinical use, longer-term follow-up and a higher level of detail are warranted from the LOTIS-2 study. In this issue of Haematologica , Caimi et al. present longer-term follow-up (now median 7.8 months) of the LOTIS-2 study, reporting a median overall survival of 9.6 months and a median progression-free survival (PFS) of 4.9 months.7 The study primarily focuses on subsets of patients with CR (n=36 [24.8%]) and those who achieved a long-term CR—that is, were alive in CR without disease progression for ≥1 year (n=16 [11%]) or ≥2 years (n=11 [7.6%]). This long-term report finds many ways to describe and parse the 36-patient CR subgroup, whose median follow-up is 35 months and who received a median of eight cycles of lonca treatment. Neither median PFS nor duration or response were reached, and 2-year relapse-free survival is 72.8%. Baseline characteristics of the CR subgroup, and the long-term CR, are also described in depth. However, given small sample sizes, findings (such as a higher median age, percentage female, and high-grade morphology in long-term CR) are hard to interpret. Notably, no patients with primary refractory disease achieved a CR for 2 years or more, casting doubt on any potential for lonca to cure truly chemorefractory DLBCL. In addition, the high level of detail of the CR subgroup is counterbalanced by lack of new detail on treatment exposure or toxicity with lonca, though reassuringly, neither secondary malignancy (including myelodysplasia) nor late liver toxicity (related to GGT elevations observed on therapy) were observed. These results underscore the potential for lonca to provide durable responses and extended treatment-free periods, without imparting significant long-term toxicity risk, for a select subset of patients. However, identifying pretreatment

Haematologica | 109 April 2024 1022 EDITORIAL

patient or tumor characteristics that may predict long-term benefit from lonca remains challenging. Specifically, there are no tissue-based biomarkers for predicting response to lonca. In vitro data suggests that CD19 expression, as measured by cell surface protein and RNA level, is associated with the cytotoxic activity of lonca.8 However, exploratory analyses of CD19 expression by immunohistochemistry on tumor tissue from patients in the LOTIS-2 trial did not reveal any significant correlation with clinical response to lonca.9 Other DLBCL studies (e.g., brentuximab vedotin in DLBCL) have also failed to note a clear relationship with antigen expression and clinical efficacy, and much work is needed to define biomarkers predicting response to therapy with this agent.10

Within the landscape of treatments for R/R DLBCL, and based on LOTIS-2 eligibility, lonca distinguishes itself as a valuable therapeutic option that encompasses high-risk patient populations, including those with high-grade B-cell lymphoma, refractory disease, transformed lymphoma, and those with prior anti-CD19 CAR T-cell therapy. As evidenced in this report, subgroups of these patients with high-risk R/R DLBCL will still achieve durable CR and time off therapy. However, even after reassurance that lonca can help beat long odds, selection of therapy requires nuanced consideration of patient features, toxicities, and logistics (Figure 1). This is particularly relevant in light of

two new US FDA approvals of bispecific antibodies with high efficacy (39% CR) but specific toxicity concerns including cytokine-release syndrome and a need for inpatient monitoring.4,5 The present report by Caimi and colleagues provides a high-resolution look at a small number of durable CR, but no definitive answers. Postmarketing data with lonca, and long-term reports of other agents in the 3+ line setting, are needed to help guide therapeutic choices to beat the odds in R/R DLBCL.

Disclosures

SDS reports consultancy from AstraZeneca, Karyopharm Therapeutics, Kite, Incyte, ADC Therapeutics, BeiGene, AbbVie, Coherus Biosciences (immediate family member), Epizyme, and Numab; research funding from Acerta Pharma/AstraZeneca, Ayala Pharmaceuticals (immediate family member), Bristol-Myers Squibb (immediate family member), Bayer, Denovo Biopharma, Genentech, Ignyta (immediate family member), Incyte, Merck, Portola Pharmaceuticals, BeiGene, ADC Therapeutics, Enterome, Kymera, MorphoSys/Incyte, Nanjing, Portola Pharmaceuticals/Alexion Pharmaceuticals, and Viracta Therapeutics. CH has no conflicts of interest to disclose.

Contributions

CH and SDS wrote the manuscript.

Haematologica | 109 April 2024 1023 EDITORIAL C. Ho et al.
Figure 1. Considerations in selecting among treatments for relapsed/refractory diffuse large B-cell lymphoma in the 3+ line. FDA: Food and Drug Administration; DLBCL: diffuse large B-cell lymphoma. R/R DLBCL: relapsed/refractory diffuse large B cell lymphoma.

References

1. Caimi PF, Ai W, Alderuccio JP, et al. Loncastuximab tesirine in relapsed or refractory diffuse large B-cell lymphoma (LOTIS-2): a multicentre, open-label, single-arm, phase 2 trial. Lancet Oncol. 2021;22(6):790-800.

2. Salles G, Duell J, González Barca E, et al. Tafasitamab plus lenalidomide in relapsed or refractory diffuse large B-cell lymphoma (L-MIND): a multicentre, prospective, single-arm, phase 2 study. Lancet Oncol. 2020;21(7):978-988.

3. Kalakonda N, Maerevoet M, Cavallo F, et al. Selinexor in patients with relapsed or refractory diffuse large B-cell lymphoma (SADAL): a single-arm, multinational, multicentre, open-label, phase 2 trial. Lancet Haematol. 2020;7(7):e511-e522.

4 Thieblemont C, Phillips T, Ghesquieres H, et al. Epcoritamab, a novel, subcutaneous CD3xCD20 bispecific T-cell-engaging antibody, in relapsed or refractory large B-cell lymphoma: dose expansion in a phase I/II trial. J Clin Oncol. 2023;41(12):2238-2247.

5. Dickinson MJ, Carlo-Stella C, Morschhauser F, et al. Glofitamab for relapsed or refractory diffuse large B-cell lymphoma. N Engl J Med. 2022;387(24):2220-2231.

6. Hartley JA. Antibody-drug conjugates (ADCs) delivering

pyrrolobenzodiazepine (PBD) dimers for cancer therapy. Expert Opin Biol Ther. 2021;21(7):931-943.

7 Caimi PF, Ai WZ, Alderuccio JP, et al. Loncastuximab tesirine in relapsed/refractory diffuse large B-cell lymphoma: long-term efficacy and safety from the phase 2 LOTIS-2 study. Haematologica. 2024;109(4):1184-1193.

8. Tarantelli C, Wald D, Munz N, et al. Targeting CD19-positive lymphomas with the antibody-drug conjugate (ADC) loncastuximab tesirine: preclinical evidence as single agent and as combinatorial approach. bioRxiv. 2023:2023.08.17.553668. doi:10.1101/2023.08.17.553668 [pre-print, not peer-reviewed].

9. Caimi PF, Hamadani M, Carlo-Stella C, et al. CD19 expression by IHC alone is not a predictor of response to loncastuximab tesirine: results from the LOTIS-2 Cclinical trial and quantitative systems pharmacology modeling. Blood. 2022;140(Suppl 1):S9548-9550.

10 Jacobsen ED, Sharman JP, Oki Y, et al. Brentuximab vedotin demonstrates objective responses in a phase 2 study of relapsed/refractory DLBCL with variable CD30 expression. Blood. 2015;125(9):1394-1402.

Haematologica | 109 April 2024 1024 EDITORIAL C. Ho et al.

Using machine learning to unravel the intricacy of acute myeloid leukemia

1Department of Translational Hematology & Oncology Research, Taussig Cancer Institute, Cleveland Clinic, Cleveland, OH, USA and 2Department of Biomedicine and Prevention, University of Rome Tor Vergata, Rome, Italy

Correspondence: V. Visconte visconv@ccf.org

Received: September 25, 2023.

Accepted: October 2, 2023.

Early view: October 12, 2023.

https://doi.org/10.3324/haematol.2023.284085

©2024 Ferrata Storti Foundation

Published under a CC BY license

The paper by Park et al.1 published in this issue of Haematologica proposes the application of machine learning (ML) algorithms to refine cluster signatures characterized by cytogenetic and mutational features common to patients with acute myeloid leukemia (AML). Such effort is inspired by the goal of defining similar clusters possibly informing on survival outcomes and response or refractoriness to conventional therapies (intensive chemotherapy [IC], hypomethylating agents [HMA], and HMA plus venetoclax [VEN]). The study cohort comprised 279 patients who underwent IC (n=131), HMA (n=76), and HMA/VEN (n=72) in a time span of almost four years. The focus of the study is to validate European LeukemiaNet (ELN) 2022 classification in older patients, and for this, a cohort of patients ≥60 years was analyzed. The study also expands on the investigation of ELN 2022 in patients for whom IC is not appropriate. Using unsupervised hierarchical clustering, the authors were able to merge features according to similarities, pointing out the heterogeneity of the disease with the identification of 9 genomic clusters characterized by diverse survival outcomes based on treatment. Some clusters were associated with better outcomes in one or another treatment group. For instance, cluster 4 was enriched in core-binding factor-AML (96% CBF-AML) and associated with better prognosis in the IC group, which reflected the choice of IC in older patients with CBF-AML. One of the major additions of this study to the generalized concept of using ML to measure the effects of combinatorial gene mutations was the incorporation of treatment data. However, although ML was able to distinguish cluster types associated with treatment, given the small sample size per treatment group, it is difficult to reach a definitive conclusion.

Having said that, this study complements other key results achieved through ML in the field of AML in recent years. The interconnection of several variables in large cohorts of patients has allowed researchers to explore, through ML, different patient stratifications2,3 and integrated prog-

nostic algorithms,4 to identify biomarkers,5 and support cytomorphological diagnosis.6 This huge amount of data has offered insights into different aspects of AML management, respecting the granularities of disease features, and suggesting the possibilities of adding new factors or classifiers to consider in the tailoring of treatment strategy. Thus, in the near future, one could envision a role for ML in the refinement of the disease classifications and as a useful guide to a proper integration of emerging strategies such as immunotherapies, results from clinical trials, and maintenance treatments. Furthermore, the paper by Park et al.1 offers the opportunity to reflect on the discrepancies among the studies using ML clustering in AML. In 2021, Awada et al.2 applied standard and ML-driven analysis to 6,788 AML cases and defined a genomic 4-tiered model, challenging the conventional dichotomy between de novo and secondary AML. Recently, 4 clusters were also identified in a large European cohort analyzed by Eckardt et al.7 by re-stratifying patients in comparison to ELN 2017 criteria. Ultimately, the current study identified 9 genomic clusters by incorporating treatment data. These differences can be attributed to several biases determined by unavailable / different choice of data, small sample sizes (a limitation also pointed out by Park et al.1 with regards to their study), short patient follow-up, exclusion / inclusion of clinical data, and misclassifications. Of note, the comparison among studies can be challenging and misleading, especially when using unsupervised learning approaches in which lack of prediction inputs might be applicable only to a specific context. In fact, the context-dependent interpretation of the data underpins one of the most important pitfalls and concerns of ML: the restriction of an algorithm to a single specific use. In summary, this article contributes to the literature demonstrating the utility of ML algorithms in resolving intricate molecular relationships and their impact on clinical outcomes. More importantly, the future holds the promise of

Haematologica | 109 April 2024 1025 EDITORIAL

dissecting genomic interplay guiding precision medicine. In line with several new tools being tested, large studies, standardization, validation cohorts, and uniformity of pipelines across studies could be the keys to unlock the full potential of ML.

References

1. Park S, Kim TY, Cho B-S, et al. Prognostic value of European Leukemia Net 2022 criteria and genomic clusters using machine learning in older adults with acute myeloid leukemia. Haematologica. 2024;109(4):1095-1106.

2. Awada H, Durmaz A, Gurnari C, et al. Machine learning integrates genomic signatures for subclassification beyond primary and secondary acute myeloid leukemia. Blood. 2021;138(19):1885-1895.

3. Kewan T, Durmaz A, Bahaj W, et al. Molecular patterns identify distinct subclasses of myeloid neoplasia. Nat Commun. 2023;14(1):3136.

4. Eckardt JN, Röllig C, Metzeler K, et al. Prediction of complete

Disclosures

No conflicts of interest to disclose.

Contributions

Both authors contributed equally.

remission and survival in acute myeloid leukemia using supervised machine learning. Haematologica. 2023;108(3):690-704.

5. Zhang Y, Liu D, Li F, et al. Identification of biomarkers for acute leukemia via machine learning-based stemness index. Gene. 2021;804:145903.

6. Eckardt JN, Schmittmann T, Riechert S, et al. Deep learning identifies acute promyelocytic leukemia in bone marrow smears. BMC Cancer. 2022;22(1):201.

7. Eckardt JN, Röllig C, Metzeler K, et al. Unsupervised metaclustering identifies risk clusters in acute myeloid leukemia based on clinical and genetic profiles. Commun Med (Lond). 2023;3(1):68.

Haematologica | 109 April 2024 1026 EDITORIAL L. Guarnera and V. Visconte

MYC overexpression: adding another piece to the puzzle of high-risk mantle cell lymphoma

Lymphoma Service, Division of Hematologic Malignancies, Department of Medicine, Memorial Sloan Kettering Cancer Center, New York, NY, USA

Correspondence: A. Kumar

kumara2@mskcc.org

Received: October 4, 2023.

Accepted: October 12, 2023.

Early view: October 19, 2023.

https://doi.org/10.3324/haematol.2023.284105

©2024 Ferrata Storti Foundation

Published under a CC BY-NC license

Although mantle cell lymphoma (MCL) has a common genetic hallmark t(11;14), juxtaposing IGH and CCND1 gene loci, which leads to cyclin D1 overexpression, MCL is markedly clinically and biologically heterogeneous, ranging from an indolent to highly aggressive disease. Characterizing highrisk MCL is an area of ongoing interest not only in order to refine prognostication in this disease, but also to identify subgroups of patients who may benefit from novel therapeutic approaches beyond standard chemoimmunotherapy.

The MCL International Prognostic Index (MIPI), high proliferation (estimated by Ki-67 in routine clinical practice), blastoid/pleomorphic morphology, complex cytogenetics, and TP53 aberrations are clinical and pathobiological risk factors associated with poor prognosis in MCL.1 There are ongoing efforts to identify additional factors that underlie the diversity of MCL and measures of increased genomic and epigenomic complexity as well as TP53 and C-MYC alterations have been associated with more aggressive clinical behavior and poor survival outcomes.2

In a paper published in this issue of Haematologica, Rodrigues and colleagues add to the evolving story of highrisk MCL by demonstrating that MYC protein overexpression is an independent prognostic factor associated with inferior progression-free and overall survival outcomes.3

In their retrospective analysis of 252 MCL patients (154 from the Swedish Lymphoma Register and 98 from the Nordic Lymphoma Group clinical trials MCL2 and MCL3), MYC overexpression assessed by immunohistochemistry (defined as >20% positive cells with nuclear staining using an anti-MYC antibody) was identified in 14% of samples (35/252). The MYC overexpression correlated with increased MYC mRNA expression levels by RNAscope®. Interestingly, C-MYC translocation (identified by fluorescence in situ hybridization [FISH]), C-MYC copy number gains, or C-MYC genetic mutation were rarely observed in this cohort and did not correlate with MYC protein overexpression. MYC

rearrangements and mutations have been rarely reported in previously published retrospective series and case reports, and thus have not become a routine part of the cytogenetic/ molecular evaluation of MCL cases.4-11 MYC overexpression, assessed by immunohistochemistry, in contrast, appears more prevalent based on this study and, thus, a potentially more robust prognostic marker.

In the study by Rodrigues et al., MYC overexpression correlated with inferior progression-free survival and overall survival and remained an independent prognostic factor in multivariable Cox proportional hazards models when adjusting for other high-risk features. Of interest, a subgroup of patients (n=13) with evidence of MYC overexpression and TP53 alteration (TP53 overexpression and/or mutation) had a particularly poor prognosis with an increased risk of progression (hazard ratio=16.9, 95% confidence interval: 7.438.3) and death (hazard ratio=7.8, 95% confidence interval: 4.4-14.1). TP53 aberrancy is widely recognized as one of the strongest prognostic factors in MCL and, despite optimal intensive chemoimmunotherapy, this subset of patients has markedly inferior survival outcomes compared to patients with wild-type TP53 status.12 However, molecular clustering data (incorporating whole exome sequencing and RNA-sequencing analyses) suggest that TP53 mutations can be seen in both non-nodal leukemic patients with an overall favorable prognosis (cluster 1) and also in patients with dismal survival outcomes enriched for highly proliferative and non-classical histology MCL (cluster 4), suggesting that the prognostic relevance of TP53 is context-dependent and that not all mutations are created equal.13 Interestingly, cluster 4 also had gene signatures of an active MYC pathway. Thus, as suggested in the work by Rodrigues et al., the combination of alterations in both TP53 and C-MYC may have an additive negative prognostic effect.3

C-MYC is an essential transcription factor that regulates various cellular functions, including proliferation, growth,

Haematologica | 109 April 2024 1027 EDITORIAL

and apoptosis, and has been implicated in the pathogenesis of a number of B-cell lymphomas. Although C-MYC gene rearrangements (assessed by FISH) are commonly seen in Burkitt lymphoma and high-grade B-cell lymphoma (“double-hit diffuse large B-cell lymphoma [DLBCL]”), MYC overexpression assessed by immunohistochemistry in the absence of the C-MYC gene rearrangement has been shown to be prognostically relevant in the so-called “double expressor” DLBCL.14 In MCL, the acquisition of a C-MYC translocation 8q24 has been referred by some as “double-hit” MCL and has been associated with blastic transformation and an aggressive disease course in various case reports.4-11 From the study by Rodrigues et al., we learn that MYC overexpression in MCL, without evidence of C-MYC translocation or mutation, is more common than previously recognized, prognostically relevant, and is likely driven by transcriptional dysregulation.

High-risk MCL patients, defined by TP53 mutation and other factors, remain a challenging population to treat and ongoing clinical trials are investigating integration of targeted

References

1. Jain P, Dreyling M, Seymour JF, Wang M. High-risk mantle cell lymphoma: definition, current challenges, and management. J Clin Oncol. 2020;38(36):4302-4316.

2. Nadeu F, Martin-Garcia D, Clot G, et al. Genomic and epigenomic insights into the origin, pathogenesis, and clinical behavior of mantle cell lymphoma subtypes. Blood. 2020;136(12):1419-1432.

3. Rodrigues J, Hollander P, Schmidt L. MYC protein is a high-risk factor in mantle cell lymphoma and identifies cases beyond morphology, proliferation and TP53/p53 – a Nordic Lymphoma Group study. Haematologica. 2024;109(4):1171-1183.

4 Au WY, Horsman DE, Viswanatha DS, Connors JM, Klasa RJ, Gascoyne RD. 8q24 translocations in blastic transformation of mantle cell lymphoma. Haematologica. 2000;85(11):1225-1227.

5. Felten CL, Stephenson CF, Ortiz RO, Hertzberg L. Burkitt transformation of mantle cell lymphoma. Leuk Lymphoma. 2004;45(10):2143-2147.

6. Hao S, Sanger W, Onciu M, Lai R, Schlette EJ, Medeiros LJ. Mantle cell lymphoma with 8q24 chromosomal abnormalities: a report of 5 cases with blastoid features. Mod Pathol. 2002;15(12):1266-1272.

7 Hu Z, Medeiros LJ, Chen Z, et al. Mantle cell lymphoma with MYC rearrangement: a report of 17 patients. Am J Surg Pathol. 2017;41(2):216-224.

8. Michaux L, Wlodarska I, Theate I, et al. Coexistence of BCL1/ CCND1 and CMYC aberrations in blastoid mantle cell

therapies and novel immunotherapeutics. Although it is recognized that standard chemoimmunotherapy is likely inadequate for TP53 aberrant MCL, the optimal alternative therapeutic approach remains unclear. Given the heterogeneous chemotherapies applied in the retrospective series described in the study by Rodrigues et al., this study does not provide any insights into optimal treatment pathways for the high-risk subsets with MYChigh or MYChigh with TP53 alterations, but emphasizes the need for a broader assessment of MYC expression in MCL to validate these findings and perhaps to facilitate future development of individualized therapies for high-risk MCL.

Disclosures

AK has received research support from AbbVie, Adaptive Biotechnologies, Celgene, Pharmacyclics, Loxo/Lily Pharmaceuticals, and Seattle Genetics; has received honoraria from Astra Zeneca, Kite Pharmaceuticals, Janssen, Genentech, and Loxo/Lily Pharmaceuticals; and has a consulting role with Genentech.

lymphoma: a rare finding associated with very poor outcome. Ann Hematol. 2004;83(9):578-583.

9 Reddy K, Ansari-Lari M, Dipasquale B. Blastic mantle cell lymphoma with a Burkitt translocation. Leuk Lymphoma. 2008;49(4):740-750.

10 Tirier C, Zhang Y, Plendl H, et al. Simultaneous presence of t(11;14) and a variant Burkitt’s translocation in the terminal phase of a mantle cell lymphoma. Leukemia. 1996;10(2):346-350.

11. Vaishampayan UN, Mohamed AN, Dugan MC, Bloom RE, Palutke M. Blastic mantle cell lymphoma associated with Burkitt-type translocation and hypodiploidy: short report. Br J Haematol. 2001;115(1):66-68.

12. Eskelund CW, Dahl C, Hansen JW, et al. TP53 mutations identify younger mantle cell lymphoma patients who do not benefit from intensive chemoimmunotherapy. Blood. 2017;130(17):1903-1910.

13. Yi S, Yan Y, Jin M, et al. Genomic and transcriptomic profiling reveals distinct molecular subsets associated with outcomes in mantle cell lymphoma. J Clin Invest. 2022;132(3):e153283.

14 Green TM, Young KH, Visco C, et al. Immunohistochemical double-hit score is a strong predictor of outcome in patients with diffuse large B-cell lymphoma treated with rituximab plus cyclophosphamide, doxorubicin, vincristine, and prednisone. J Clin Oncol. 2012;30(28):3460-3467.

Haematologica | 109 April 2024 1028 EDITORIAL A. Kumar

First-line MAPK inhibition in pediatric histiocytosis: are we ready?

Division of Haematology/Oncology, Hospital for Sick Children, Toronto, Ontario, Canada

Correspondence: O. Abla

oussama.abla@sickkids.ca

Received: September 29, 2023.

Accepted: November 7, 2023.

Early view: Novembet 16, 2023.

https://doi.org/10.3324/haematol.2023.284188

©2024 Ferrata Storti Foundation

Published under a CC BY-NC license

In this issue of Haematologica, Cournoyer et al. discuss their experience using first-line mitogen-activated protein kinase (MAPK) inhibitors in childhood Langerhans cell histiocytosis (LCH) and other histiocytic disorders.1

LCH, a rare myeloid neoplasm affecting mostly children, is driven by activating mutations in the MAPK pathway, mostly BRAF-V600E.2 It has heterogeneous clinical presentations ranging from limited single-system involvement to severe multisystem or neurodegenerative forms. LCH is defined by the accumulation of CD1a+/CD207+ cells in organs such as bone and skin, and the so-called risk organs (liver, spleen and hematopoietic system); patients with involvement of these organs have a higher risk of mortality.2 Multisystem LCH is treated with risk-adapted therapy, but many patients require myelosuppressive salvage regimens. MAPK inhibitors, such as dabrafenib, a BRAF inhibitor, and trametinib, a MEK inhibitor, are being used to treat refractory LCH and other histiocytic disorders, but most patients relapse after therapy discontinuation.3,4

Cournoyer et al. treated 14 young patients with relapsed/ refractory LCH (13 with proven multisystem disease, one with possible neurodegeneration and diabetes insipidus) and two with relapsed/refractory systemic Rosai-Dorfman-Destomebs disease with dabrafenib, trametinib or inhibitor combination, achieving a 94% favorable response rate; the patient with possible central nervous system (CNS)-LCH had improved neurological symptoms. Eighteen patients received inhibitors first-line, 13 with proven LCH (6 with multisystem and 7 with single-system disease), three with possible CNS-LCH (1 positive for BRAF-V600E according to droplet digital polymerase chain reaction [ddPCR]) and two with multisystem juvenile xanthogranuloma. All had sustained favorable responses with a median treatment duration of 2.5 years. The three patients with isolated possible CNS-LCH had improved or stabilized disease. Five LCH patients with single-system disease discontinued therapy and remain well, while four with multisystem LCH

who discontinued therapy relapsed and were restarted on inhibitors with rapid response.

Albeit retrospective, the report by Cournoyer et al. is important for many reasons. LCH can be almost universally cured with chemotherapy but high rates of treatment failure in patients with multisystem involvement, high toxicity of salvage therapies and long-term morbidity for all relapsed/refractory LCH patients represent major challenges. Therefore, more effective and safer treatment options are warranted. Treatment with MAPK inhibitors is promising due to its ease of administration, less toxicity, the better quality of life it provides and the possibility of it preventing reactivations.

A few studies have shown the effectiveness of MAPK inhibitors in children with relapsed/refractory LCH or neurodegenerative disease.3,4 However, the efficacy of first-line MAPK inhibitor monotherapy has been unknown, and the paper by Cournoyer et al. is the first report of such a strategy in children with LCH or juvenile xanthogranuloma. A few caveats need discussion. First, not all LCH patients are candidates for first-line inhibitor therapy, which is reasonable in clinical neurodegeneration or infants with risk organ-positive multisystem disease who are at high risk of early treatment failure. In contrast, low-risk patients with relapsed/refractory multifocal bone involvement or risk organ-negative multisystem disease routinely respond to mild chemotherapy and may not need inhibitors, unless they are resistant. This is due to the unknown optimal duration of inhibitor therapy and risk of indefinite and unnecessary treatments for mild disease. Furthermore, these inhibitors are not indicated for unifocal bone LCH, which can resolve spontaneously. Cournoyer et al. treated seven patients with single-system LCH (3 multifocal and 4 unifocal bone onvolvement) with inhibitors as first-line therapy with favorable response; however, as they state, it is unknown whether these responses were due to inhibitors or spontaneous LCH remission.

Haematologica | 109 April 2024 1029 EDITORIAL

Second, it is controversial whether patients with isolated diabetes insipidus should be treated for LCH. Indeed, in a few pediatric studies on pituitary stalk thickening, only 8-19% were diagnosed with LCH.5 It is unknown whether peripheral blood ddPCR anaysis might improve the detection rate of LCH diagnosis. Furthermore, a review from Vienna showed that only 25% of patients with LCH and radiological signs of neurodegeneration progressed to clinical neuordegeneration.6 Therefore, BRAF inhibitors are reasonable only in patients with presumed LCH, isolated diabetes insipidus and progressive radiological neurodegeneration who have

neurological symptoms and are positive by ddPCR for the BRAF-V600E mutation. Another issue is the ability of MAPK inhibitors to penetrate the CNS adequately. BRAF/MEK inhibitors are substrates of P-glycoproteins, and their efflux by the blood-brain barrier leads to limited drug levels within the CNS.7 Day101 (tovorafenib) is a type II pan-RAF inhibitor with greater CNS penetration, and less dermatological, cardiac and ocular toxicities than other MAPK inhibitors. Nevertheless, the authors showed significant improvement in their CNS-positive patients treated with MEK inhibition. Third, although MAPK inhibitors are better tolerated than

Haematologica | 109 April 2024 1030 EDITORIAL O. Abla
Figure 1. A treatment algorithm for relapsed/refractory Langerhans cell histiocytosis. LCH: Langerhans cell histiocytosis; RO: risk organ; WT: wild-type; MS: multisystem; PD: progressive disease; CR: complete remission; MTX: methotrexate; 6MP: 6-mercaptopurine.

chemotherapy, they are not harmless. However, the authors showed that inhibitors were well tolerated, and that three patients had sustained responses at smaller doses. Leukemia and cutaneous basal cell carcinoma have been seen in adults with histiocytosis following treatment with MAPK inhibitors.8 No pediatric reports of second malignancies after MAPK inhibitors exist, and the long-term toxicities of these drugs in this population is unknown. Fourth, the most important question is when to stop these inhibitors? A study of adult patients with histiocytosis whose MAPK inhibitors were discontinued after complete or partial response had been obtained, showed that 77% relapsed after treatment interruption.9 In the study by Cournoyer et al., 11 patients stopped inhibitors: 36% relapsed at a median time of 5 months and all responded after restarting inhibitors. Therefore, in some patients, such as those with relapsed/refractory, multisystem risk organ-positive disease or neurodegeneration, it may not be safe to stop inhibitors, whereas in others, with relapsed/refractory skin/ bone involvement, it might be reasonable to stop inhibitors after 2 years of remission while using ddPCR to monitor for the presence of circulating BRAF-V600E. This question should be answered in a prospective clinical trial. Additionally, targeted inhibitor therapy does not eradicate the LCH clone, whereas chemotherapy does; thus, it is possible that combining chemotherapy with inhibitors might help in MAPK inhibitor discontinuation. Evseev et al.

References

1. Cournoyer E, Ferrell J, Sharp S, et al. Dabrafenib and trametinib in Langerhans cell histiocytosis and other histiocytic disorders. Haematologica. 2024;109(4):1137-1148.

2. Khoury JD, Solary E, Abla O, et al. The 5th edition of the World Health Organization Classification of Haematolymphoid Tumours: Myeloid and Histiocytic/Dendritic Neoplasms. Leukemia. 2022;36(7):1703-1719.

3. Donadieu J, Larabi IA, Tardieu M, et al. Vemurafenib for refractory multisystem Langerhans cell histiocytosis in children: an international observational study. J Clin Oncol. 2019;37(31):2857-2865.

4 Whitlock JA, Geoerger B, Dunkel IJ, et al. Dabrafenib, alone or in combination with trametinib, in BRAF V600-mutated pediatric Langerhans cell histiocytosis. Blood Adv. 2023;7(15):3806-3815.

5. Robison NJ, Prabhu SP, Sun P, et al. Predictors of neoplastic disease in children with isolated pituitary stalk thickening. Pediatr Blood Cancer. 2013;60(10):1630-1635.

reported on nine infants who received vemurafenib and chemotherapy (cytarabine, cladribine) simultaneously as salvage therapy; eight of them showed response without toxicity. Nevertheless, this combination did not eradicate the clone as five of the eight patients relapsed soon after discontinuing vemurafenib and required vemurafenib maintenance therapy.10 The long-term safety and efficacy of such a combination will need to be validated in prospective trials. Lastly, although effective, MAPK inhibitors carry a high price tag and may not be affordable in countries with limited resources.

In summary, Cournoyer et al. have presented a promising study of patients with histiocytic disorders receiving first-line and second-line MAPK inhibitor therapy. These inhibitors are well tolerated and the rate of response to them is high, but they do not prevent relapses after their discontinuation. Prospective trials are needed to determine the long-term efficacy and safety of inhibitors as first-line therapy and optimal therapy duration in children. Validating the sensitivity of minimal disease markers (monitored by ddPCR) will help in the identification of patients in whom inhibitor discontinuation can be safe. Figure 1 shows a possible algorithm for the treatment of LCH, including the potential role of MEK inhibition.

Disclosures

OA is a consultant for Spring Works.

6. Wnorowski M, Prosch H, Prayer D, et al. Pattern and course of neurodegeneration in Langerhans cell histiocytosis. J Pediatr. 2008;153(1):127-132.

7. Sakji-Dupré L, Le Rhun E, Templier C, et al. Cerebrospinal fluid concentrations of vemurafenib in patients treated for brain metastatic BRAF-V600 mutated melanoma. Melanoma Res. 2015;25(4):302-305.

8. Cohen Aubart F, Emile JF, Carrat F, et al. Targeted therapies in 54 patients with Erdheim-Chester disease, including follow-up after interruption (the LOVE study). Blood. 2017;130(11):1377-1380.

9 Reiner AS, Durham BH, Yabe M, et al. Outcomes after interruption of targeted therapy in patients with histiocytic neoplasms. Br J Haematol. 2023;203(3):389-394.

10 Evseev D, Osipova D, Kalinina I, et al. Vemurafenib combined with cladribine and cytarabine results in durable remission of pediatric BRAF V600E-positive LCH. Blood Adv. 2023;7(18):5246-5257.

Haematologica | 109 April 2024 1031 EDITORIAL O. Abla

A key to engineering natural killer cells to attack acute myeloid leukemia

1Department of Cell Therapy and Transplantation Medicine and 2Department of Hematology and Oncology, Graduate School of Medicine, The University of Tokyo Hospital, Tokyo, Japan

Correspondence: M. Kurokawa kurokawa@m.u-tokyo.ac.jp

Received: October 23, 2023.

Accepted: October 26, 2023.

Early view: November 2, 2023.

https://doi.org/10.3324/haematol.2023.284272

©2024 Ferrata Storti Foundation

Published under a CC BY-NC license

In this issue of Hematologica, Kaito and colleagues report on a way to switch on natural killer (NK) cells so that the activity of these cells against acute myeloid leukemia (AML) is increased.1 AML is caused by the accumulation of multiple genetic abnormalities in hematopoietic stem and progenitor cells. Despite the development of novel therapies for AML, relapse remains a major problem. Immunotherapy is a promising approach to target diverse clones of AML, but the mechanisms of immune dysregulation in AML and methods to overcome them need to be elucidated. NK cells are characterized by their cytotoxic capacity against virally infected cells and cancer cells without prior activation or past exposure. Many studies have shown the fundamental role of NK cells in cancer immune surveillance. NK cells are also considered important for disease control in AML based on several observations, including that the anti-leukemic activity of NK cells is inversely correlated with disease progression,2 and NK-cell function is correlated with prognosis.

As detailed in a recent review,3 when used as cellular therapy, NK cells are generally safe because of the low risk of allogeneic reactions and cytokine release syndrome. A patient’s peripheral blood NK cells are usually infused after ex vivo expansion, but the proliferation and functional capacity of autologous cells from previously treated patients are often inadequate, limiting their therapeutic efficacy. While allogeneic NK cells harvested from healthy donors have shown clinical efficacy,4 various challenges to this strategy remain, including low persistence, lack of optimal protocols for ex vivo expansion, and risk of graft-versus-host disease mainly due to contaminating T cells. Other sources of NK cells include umbilical cord blood, induced pluripotent stem cells, and the patient-derived NK cell line NK-92, available as an off-the-shelf product. In a phase I clinical trial, NK-92 cells provided responses, without severe toxicity, in some patients.5 Since the introduction of chimeric antigen receptor (CAR)-T cells, much attention has been focused on the

cytolytic potency of chimeric-based technologies. CAR-NK cells are considered a promising option due to their favorable cytotoxicity profile and low manufacturing cost. NK-92 cells have also been modified with CAR and used in clinical trials.6 However, NK-cell therapies, including CAR-NK cells, still have problems to solve, such as loss of target antigen, a hostile tumor microenvironment, and tumor heterogeneity. One of the biggest problems is the short-term persistence of these cells in vivo and, despite many efforts, including cytokine activation and genetic modification,7 objective responses remain transient.

NK cells express a variety of activating and inhibitory receptors to recognize host cell changes such as malignant transformation or viral infection. In addition to downregulation of major histocompatibility complex class I ligands, the balance of signals from these receptors regulates the cytotoxic function of NK cells. In NK cells from AML patients, downregulation of activating receptors, such as natural cytotoxicity receptors and DNAX accessory molecule-1 (DNAM-1, CD226), and upregulation of inhibitory receptors including CD94 and TIGIT, lead to dysfunction.8 In AML cells, loss of activating ligands or increased expression of inhibitory ligands has been reported. Among them, the Nectin/ Nectin-like family plays an important role in the regulation of NK cells as well as T cells. DNAM-1 is a representative co-stimulatory receptor, while TIGIT, CD96, and PVRIG are inhibitory receptors. Several ligands, including CD155 and NECTIN2 (CD112), interact with these receptors.9 Ligands and receptors in this family have various binding affinities for each other rather than a one-to-one correspondence (Figure 1). The signaling network mediated by these complex ligand-receptor relationships regulates NK-cell activation precisely in a context-dependent manner. The ratio of CD112 to CD155 expression varies between tumors, and the CD155-TIGIT and CD112-PVRIG axes may play different roles in NK-cell regulation in different tumors. In AML, CD155 and CD112 are reportedly negative prognostic markers,10 but

Haematologica | 109 April 2024 1032 EDITORIAL

their functional significance is not yet clear. NK cells from AML patients also show high TIGIT expression as well as reduced DNAM-1 expression, associated with poor prognosis. However, it has not been clearly understood what kinds of ligand-receptor relationships are important in the pathogenesis of NK-cell abnormalities in AML in terms of therapeutic implications.

In the abovementioned study, Kaito et al. showed that

CD112 and CD155 are highly expressed in primary AML samples.1 As was reported previously,10 cases with high CD112 expression had a poor prognosis. In contrast, DNAM-1 and TIGIT were highly expressed in NK and T cells, but there was no correlation between their expression and clinical characteristics or therapeutic responses. After showing that more than 80% of NK-92 cells expressed TIGIT and 8% expressed DNAM-1, the authors generated NK-92 cells

family. The receptors are expressed on natural killer (NK) cells and T

while

ligands

present on either antigen-presenting cells or tumor cells. DNAM-1 activates NK cells via interactions with CD155 or CD112, but DNAM-1 has a higher affinity for CD155 than for CD112. The affinity between TIGIT and CD155 is significantly higher than that between DNAM-1 and CD155, so the activating receptor DNAM-1 is competed against the CD155 ligand by the inhibitory receptor TIGIT. The CD112 ligand mediates the co-stimulatory effect via DNAM-1 and the inhibitory effects via interactions with CD112R and TIGIT. CD96 is primarily bound by CD155 and acts as an inhibitory receptor, although it can act as an activating receptor in certain circumstances. In this way, ligands and receptors have various binding affinities for each other rather than a one-to-one correspondence. TIGIT also interacts with Fap2, produced by bacteria in the tumor microenvironment, to suppress NK-cell activity. Activating and inhibitory signals induced by the receptor are represented by + and -. Ligand-receptor interactions are illustrated by arrows, with arrow thickness indicating relative affinity. However, a model has recently been reported in which differences in surface expression, rather than differences in intrinsic affinity, are important. APC: antigen-presenting cell; PVRL: poliovirus receptor-related; CD: cluster of differentiation; PVR: poliovirus receptor; ITIM: immunoreceptor tyrosine-based inhibition motif; ITT: immunoglobulin tail tyrosine; Fap2: fibroblast activation protein-2; KIR2DL5A: killer cell immunoglobulin-like receptor, two Ig domains and long cytoplasmic tail 5A; TIGIT: T-cell immunoglobulin and ITIM domain; DNAM-1: DNAX accessory molecule-1; PVRIG: poliovirus receptor-related immunoglobulin domain containing; TACTILE: T cell-activated increased late expression; NK: natural killer.

Haematologica | 109 April 2024 1033 EDITORIAL
Masamoto and M. Kurokawa
Y.
Figure 1. Receptor-ligand interactions of the Nectin/Nectin-like cells, the are

transfected with DNAM-1 (NK-92 DNAM-1) or lacking TIGIT. In cytotoxicity assays, NK-92 DNAM-1 cells showed enhanced cytotoxicity against AML cells, with increased expression of degranulation markers and intracellular cytokines. In contrast, cells with knockout (KO) of TIGIT did not show these changes nor additive effects with DNAM-1 transfection. NK-92 DNAM-1 cells showed better cytotoxicity than NK-92 cells against CD155 KO AML cells. However, this enhancement was lost against CD112 KO AML cells and, interestingly, the cytotoxicity was rather less against double KO AML cells. When co-cultured with double KO AML cells, the index of activation of NK-92 DNAM-1 cells was attenuated compared to that following co-culture with wild-type AML cells, accompanied by upregulation of inhibitory receptors and signaling molecules, suggesting that the enhanced cytotoxicity of NK-92 DNAM-1 cells is ligand-dependent. These findings were replicated in primary AML blasts and in xenograft models, in which AML cells expressing CD155 and CD112 were subject to enhanced

References

1. Kaito Y, Sugimoto E, Nakamura F, et al. Immune checkpoint molecule DNAM-1/CD112 axis is a novel target for natural killercell therapy in acute myeloid leukemia. Haematologica. 2024;109(4):1107-1120.

2. Rey J, Fauriat C, Kochbati E, et al. Kinetics of cytotoxic lymphocytes reconstitution after induction chemotherapy in elderly AML patients reveals progressive recovery of normal phenotypic and functional features in NK cells. Front Immunol. 2017;8:64.

3. Myers JA, Miller JS. Exploring the NK cell platform for cancer immunotherapy. Nat Rev Clin Oncol. 2021;18(2):85-100.

4 Bachanova V, Cooley S, Defor TE, et al. Clearance of acute myeloid leukemia by haploidentical natural killer cells is improved using IL-2 diphtheria toxin fusion protein. Blood. 2014;123(25):3855-3863.

5. Boyiadzis M, Agha M, Redner RL, et al. Phase 1 clinical trial of adoptive immunotherapy using “off-the-shelf” activated natural killer cells in patients with refractory and relapsed acute

cytotoxicity by NK-92 DNAM-1 cells. While the fact that NK-92 DNAM-1 cells can be suppressed in the absence of an appropriate ligand on AML cells necessitates further analysis of the ligand-receptor relationships before clinical applications, this study demonstrates that DNAM-1 transfection in NK-92 cells enhances cytotoxic activity against AML in a CD112- and CD155-dependent manner. Further improvements are clearly needed to realize effective NK-cell therapy, including improved tumor targeting, more effective CAR design, and combination with other immunotherapies. Nevertheless, the results presented by Kaito and collleagues are important findings that may cooperate with such improvements.

Disclosures

No conflicts of interest to disclose.

Contributions

Both authors contributed equally.

myeloid leukemia. Cytotherapy. 2017;19(10):1225-1232.

6. Tang X, Yang L, Li Z, et al. First-in-man clinical trial of CAR NK-92 cells: safety test of CD33-CAR NK-92 cells in patients with relapsed and refractory acute myeloid leukemia. Am J Cancer Res. 2018;8(6):1083-1089.

7 Shimasaki N, Jain A, Campana D. NK cells for cancer immunotherapy. Nat Rev Drug Discov. 2020;19(3):200-218.

8. Valhondo I, Hassouneh F, Lopez-Sejas N, et al. Characterization of the DNAM-1, TIGIT and TACTILE axis on circulating NK, NKTlike and T cell subsets in patients with acute myeloid leukemia. Cancers (Basel). 2020;12(8):2171.

9 Wu B, Zhong C, Lang Q, et al. Poliovirus receptor (PVR)-like protein cosignaling network: new opportunities for cancer immunotherapy. J Exp Clin Cancer Res. 2021;40(1):267.

10 Stamm H, Klingler F, Grossjohann EM, et al. Immune checkpoints PVR and PVRL2 are prognostic markers in AML and their blockade represents a new therapeutic option. Oncogene. 2018;37(39):5269-5280.

Haematologica | 109 April 2024 1034 EDITORIAL
Y. Masamoto and M. Kurokawa

How we manage a high D-dimer

Massimo Franchini,1 Daniele Focosi,2 Mario Piergiulio Pezzo1 and Pier Mannuccio

1Department of Transfusion Medicine and Hematology, Carlo Poma Hospital, Mantova; 2North-Western Tuscany Blood Bank, Pisa University Hospital, Pisa and 3Fondazione IRCCS Ca’ Granda-Ospedale Maggiore Policlinico and University of Milan, Angelo Bianchi Bonomi Hemophilia and Thrombosis Center, Milan, Italy

Correspondence: P.M. Mannucci

piermannuccio.mannucci@policlinico.mi.it

Received: July 26, 2023.

Accepted: October 18, 2023.

Early view: October 26, 2023.

https://doi.org/10.3324/haematol.2023.283966

©2024 Ferrata Storti Foundation

Published under a CC BY-NC license

Abstract

D-dimer, a soluble fibrin degradation product that originates from plasmin-induced degradation of cross-linked fibrin, is an important biomarker of coagulation activation and secondary fibrinolysis that is routinely used to rule out venous thromboembolism (VTE), and to evaluate the risk of VTE recurrence, as well as the optimal duration of anticoagulant therapy. Besides VTE, D-dimer may be high due to physiologic conditions, including aging, pregnancy, and strenuous physical activity. In addition, several disorders have been associated with increased D-dimer levels, ranging from disseminated intravascular coagulation to infectious diseases and cancers. Thus, it is far from unusual for hematologists to have to deal with ambulatory individuals with increased D-dimer without signs or symptoms of thrombus formation. This narrative review is dedicated to the management of these cases by the hematologist.

Introduction

Hemostasis can be schematically represented as a constant, delicate equilibrium between anticoagulant and procoagulant strengths in order to maintain the blood in physiological conditions of fluidity. The primary function of hemostasis is the generation of a stable clot in the event of vascular injury, thereby preventing excessive blood loss.1 While the formation of a clot, composed essentially of fibrin and blood cells (i.e., erythrocytes, leukocytes, and platelets), is essential to stop bleeding, its timely removal by the fibrinolytic system is also needed to restore blood flow within the repaired blood vessel.2 Clot lysis, made by plasmin and other proteases, is accompanied by the generation of fibrin degradation products. Among the laboratory biomarkers of fibrinolysis, D-dimer is currently considered the gold standard, not only because of its high sensitivity, but also rapid results, widespread availability, and relatively low cost of the assays.3-5 Besides thromboembolic diseases, several physiological and pathological conditions (i.e., aging, pregnancy, cancer, inflammation, infection), not necessarily characterized by thrombus formation, have been associated with increased D-dimer.6

In this narrative review aimed at the hematologist, we first present a typical clinical case and describe the physiology and physiopathology of D-dimer formation. This is followed

by a summary of the main conditions associated with increased D-dimer and we propose an approach to their management, based on evidence in the literature and personal experiences. COVID-19-associated increased D-dimer levels will be not discussed here, since they have already been extensively addressed elsewhere.7-9 It is, however, undeniable that during the 3-year pandemic, an overuse of D-dimer testing was performed in many patients infected by (or recovering from) SARS-CoV-2 infection, thereby creating a generalized and often unjustified alarm among patients and medical teams.10 Accordingly, hematologists have frequently met cases of isolated increased D-dimer levels with no apparent thrombotic process, and have thus been called upon to make important decisions as to their management.

Methods

For this narrative review, we examined the medical literature for complete published studies on the management of patients with increased D-dimer. A literature search of the PubMed (through Medline) electronic database was carried out without time limits. Only studies published in English were considered. The Medical Subject Heading (MeSH) and keywords used were: “D-dimer”, “thrombosis”,

Haematologica | 109 April 2024 1035 REVIEW ARTICLE

“venous thromboembolism”, “pulmonary embolism”, “deep vein thrombosis”, “cancer”, “management”, “treatment”, “inflammation”, “disseminated intravascular coagulation”, “trauma”, “surgery”, “infection”, “sepsis”, “pregnancy”, “joint arthroplasty”, “cardiovascular disease”, “acute aortic dissection”, and “coronary artery disease”. We also screened the reference lists of the most relevant articles for further studies not captured in the initial literature search.

Clinical case

In order to show that D-dimer testing is often misused (which can lead to inappropriate diagnosis and therapies), we present here a typical case involving a 76-year old woman referred to us three years after an unprovoked deep vein thrombosis (DVT) of the popliteal vein of the left leg. All the screenings for thrombophilia or para-neoplastic syndrome were negative. After six months of antithrombotic therapy with a direct oral anticoagulant (DOAC) and negative venous ultrasonography she started a risk stratification protocol measuring D-dimer twice: first, at the time of stopping anticoagulant therapy and then one month later. Since both results were negative (below the fixed cutoff value of 500 µg/L), it was decided to stop the anticoagulation therapy. After a few months, her general practitioner, prompted by non-specific complaints of a “swollen and heavy leg”, prescribed D-dimer testing. This showed increased levels (1,350 µg/L) so that the patient was instructed to resume anticoagulation with a DOAC. During the last two years, anticoagulation has been stopped and started again several times due to the patient’s concerns about a possible hemorrhage and the fluctuation of her D-dimer levels. Finally, the general practitioner referred the case to us. Medical history and physical examination revealed that in the last five years she had been suffering from severe coxarthrosis and gonarthrosis of the left leg. Surgery had been postponed and the patient made frequent use of anti-inflammatory drugs when pain was unbearable (the cause of her fear of a possible hemorrhage if she received anticoagulants). A recent venous ultrasonography was negative. Because we observed that D-dimer levels fluctuated according to the degree of pain and inflammation, she has been instructed not to resume the anticoagulant therapy, to stop random D-dimer measurement, and to refer to an orthopedic surgeon to tackle her joint problems.

What is D-dimer?

Coagulation is the physiological process that leads to blood “solidification” through the conversion of soluble fibrinogen into insoluble fibrin through the enzymatic action of the thrombin, derived from conversion from its zymogen prothrombin. Once the coagulation mechanisms have

started, there is the secondary activation of fibrinolysis meant to prevent the uncontrolled propagation of fibrin formation and facilitate the repair of the lesion.1 However, to better understand D-dimer formation, we need to examine more deeply the molecular mechanisms underlying the physiological coagulation process. Circulating fibrinogen is made of three paired protein chains: A α , B b and g . When needed at the vascular injury site, thrombin cleaves fibrinopeptides A and B from fibrinogen to form fibrin monomers that polymerize in the frame of a non-enzymatic process. Finally, Factor XIII provides monomer stabilization through covalent binding involving the g chains, so that the insoluble fibrin net is ready to act as the main backbone of the coagulation process and related repair of the vascular lesion. Then the fibrinolytic process begins locally and converts insoluble fibrin to soluble products that can be cleared from the bloodstream by the liver. This process depends on the enzyme plasmin, derived from activation from its zymogen plasminogen that circulates in the blood and is localized inside the forming clot together with fibrinogen.1 The plasminogen to plasmin activation and its progressive action upon the fibrin net produces a number of soluble products among which there are the D-dimer fragments (Figure 1) which are present only if there is a stabilized fibrin net but are not formed with fibrinogen alone.11,12

The presence of D-dimer in the bloodstream is physiological, representing the continuous balance between coagulation and fibrinolysis. Only when D-dimer exceeds the cutoff value is it considered pathologic. Cutoff values, earlier considered fixed and universal, are now considered variable and age-dependent, perhaps reflecting the physiological changes of the homeostatic system with the increased prevalence with aging of inflammatory –coagulative – reparative processes. From the time of its formation, D-dimer begins to be detectable in blood within approximately two hours, with a half-life of approximately six hours. After surgery, D-dimer increases, peaking at about one week and then decreasing by 5-10% daily; it is detectable for at least one month.13-15

Numerous assays are commercially available for the laboratory measurement of D-dimer. Most of them rely on monoclonal antibodies and are typically enzyme-linked immunosorbent assays (ELISA). But other methods use microparticles covered with monoclonal antibodies that bind D-dimer and cause agglutination, detected and quantified by nephelometry or turbidometry. There are point of care (POC) assays that produce both qualitative and quantitative results, and provide faster results in emergency care settings. Quantitative ELISA have a high sensitivity (>95%) but a low specificity for VTE and thus are principally used for exclusion purposes. For this reason, establishing a cutoff value is very important; but these values differ greatly among the various assays used, perhaps due to the different specificity and epitope affinity of the

Haematologica | 109 April 2024 1036 REVIEW ARTICLE - High D-dimer management M. Franchini et al.

fibrin monomers by cleaving fibrinopeptides A and B.

fibrin polymers.

Factor XIII (activated by thrombin) into an insoluble cross-linked fibrin

to plasmin, which releases soluble D-dimers and other fragments,

products are cleared from the bloodstream by the liver.

different monoclonal antibodies. Thus, it is of paramount importance to use an assay method for which the cutoff value has been determined by association of the D-dimer results with the clinical and instrumental diagnostic findings of VTE.3-5 D-dimer results can be expressed in two different units: FEU (Fibrinogen Equivalent Units) that correlate the mass of the D-dimer to that of fibrinogen, or DDU (D-dimer Units) that relate to the mass of the D-dimer itself. It is important not to switch or confuse a result expressed in FEU with one expressed in DDU, because they differ by a factor of 1.75.5

Conditions associated with increased D-dimer

As mentioned above, D-dimer is used to guide the diagnos-

tic procedure of VTE, which includes DVT and pulmonary embolism. However, while patients with pulmonary embolism or DVT in the acute phase usually have high D-dimer levels, individuals with high D-dimer do not necessarily have an underlying thromboembolic disease, but they may have several other pathological and non-pathological conditions (Table 1).

Venous thromboembolism

To begin, we provide a concise description of the D-dimer-based diagnostic workup of this thrombotic disorder. VTE affects nearly 10 million people every year worldwide, with an annual incidence of 1-2 cases per 1,000 population. It is the third most frequent cardiovascular disease.16,17 Although its incidence increases with age both in men and women, women have a higher risk of developing VTE at the young age of 20-40 years due to hormonal-related

Haematologica | 109 April 2024 1037 REVIEW ARTICLE - High D-dimer management M. Franchini et al.
Figure 1. Mechanism of D-dimer formation. (Top; coagulation process) Circulating human fibrinogen is made up of three pairs of polypeptide chains, designated Aα, Bb and g. Thrombin converts plasma fibrinogen to Polymerized fibrin monomers are stabilized by net. (Bottom; fibrinolytic process) Plasminogen is activated including E fragments, from Finally, these soluble

factors (i.e., pregnancy or oral contraceptive use).16,17 Owing to the substantial global burden of VTE, suspected VTE requires a timely and preferably non-invasive diagnostic tool. In this context, thanks to the high sensitivity (almost 100%) of quantitative ELISA, D-dimer measurement plays a key role in the diagnostic workup. However, due to its low specificity (high negative and low positive predictive value), the test should only be used to exclude VTE.18-20 This means that a D-dimer negative result (i.e., <500 µg/L) categorizes patients as having a low to moderate clinical pre-test probability of VTE.

Several scores have been developed in order to assess the clinical probability of VTE. The most used are the Wells and Geneva scores.21,22 In addition, a simplified and validated version of the Geneva score has been developed to widen its adoption in clinical practice.23,24 The combination of negative D-dimer ELISA and low-intermediate pre-test clinical probability excludes DVT or pulmonary embolism in approximately 30% of the cases with suspected VTE with no need for imaging (i.e., venous ultrasonography for a suspected DVT and computed tomography [CT] pulmonary angiogram for a suspected pulmonary embolism).25

Conversely, D-dimer is not recommended in patients with a high clinical probability, because a normal result does not exclude VTE, even when a highly sensitive assay is used; these cases should directly undergo imaging without D-dimer testing (Figure 2).26 Notably, as D-dimer levels increase with age, an age-adjusted (age x 10 µg/L in patients aged >50 years) rather than a fixed cutoff (< 500 µg/L) is warranted to exclude VTE in patients with low or intermediate pre-test clinical probability.27 Although impaired renal function has been suggested to affect D-dimer levels in individuals suspected of having VTE,28 its influence seems to be less important than that of age.29

D-dimer testing in combination with a clinical pre-test probability assessment (YEARS criteria or revised GENEVA score) has also been used for the exclusion of pulmonary embolism in pregnant women with the aim of avoiding unnecessary imaging.30,31 In addition, D-dimer testing provides important information not only for the diagnosis of VTE, but also for the anticoagulant management of VTE. Current evidence indicates that a positive D-dimer after completion of three months of anticoagulant therapy in patients with a first unprovoked VTE is associated with a 2-fold higher risk of VTE recurrence than a negative test.4 Thus, following the demonstration of the strong association between D-dimer and VTE recurrence,32 D-dimer testing is often included in the prediction models designed to guide decisions for stopping anticoagulant therapy.33,34 On the other hand, persistently high D-dimer after stopping a 3-month anticoagulant treatment argues in favor of therapy prolongation in cases with unprovoked VTE.35

The role of D-dimer for the diagnosis of cerebral vein thrombosis (CVT) has been the object of research in the last 20 years. A systematic review and meta-analysis by

Table 1. Pathological and non-pathological conditions associated with high D-dimer levels.

Physiological

Aging

Pregnancy

Physical exercise

Pathological

Venous thromboembolism1

Cancer1

Disseminated intravascular coagulation1

Cardiovascular diseases (atrial fibrillation, coronary artery disease, acute aortic dissection1)

HELLP syndrome

Diabetes

Hemorrhages

Infections (peri-prosthetic hip and knee infections1)/sepsis

Inflammation

Cirrhosis

Renal disease

Trauma/surgery

1Conditions for which the usefulness of D-dimer testing is supported by clinical studies. HELLP: hemolysis, elevated liver enzymes, and low platelets.

Dentali and colleagues (14 studies including 1,134 patients) found high sensitivity and specificity for D-dimer (93.9% and 89.7%, respectively) in patients with suspected CVT. 36 Another meta-analysis performed by Alons et al. (8 studies including 636 patients) showed that D-dimer had a high negative predictive value for CVT in low-risk patients (defined as those with normal neurological examination, normal standard head CT scan, and absence of such risk factors as puerperium and pregnancy) with isolated headache.37 A recent prospective study proposed a new score that, combining clinical data with normal D-dimer (i.e., < 500 µ g/L), was very effective in predicting CVT, thus reducing unnecessary neuroimaging.38 Finally, the current view is that D-dimer testing should not be recommended as a first-line diagnostic tool for the diagnosis of venous thrombosis in unusual sites (upper limbs, retinal veins, abdominal veins).39

Physiological conditions

It has previously been pointed out that the detection of increased D-dimer does not necessarily imply the presence of an underlying disease because there are a number of physiological conditions that are accompanied by abnormal values (Table 1).40 D-dimer increases with age, thus leading to a greater proportion of older patients (> 50%) with values higher than the conventional cutoff of 500 µg/L.41 The lower specificity of D-dimer for VTE in older compared to younger people implies that the former are unlikely to have negative D-dimer results even when VTE is absent, with a related high rate of unnecessary use of imaging tests.42 For

Haematologica | 109 April 2024 1038 REVIEW ARTICLE - High D-dimer management M. Franchini et al.

this reason, an age-adjusted cutoff has been validated and recommended in the diagnostic workup of VTE.43 However, in patients >80 years of age, the use of D-dimer measurement is not recommended for the exclusion of VTE, because high baseline levels lead to unacceptably high false positive results in cases with no VTE.44

Similarly, D-dimer levels increase physiologically during pregnancy and in the post-partum period.45,46 D-dimer levels are also higher in women taking oral contraceptives than in non-users, perhaps reflecting their hypercoagulable state.47

Exercise has effects on hemostasis that are dependent on the duration and intensity of the physical activity.48 D-dimer levels significantly increase following short-duration strenuous exercise,49 and exercise-induced fibrinolytic activity in healthy subjects is proportional to the amount of exercise taken.10 Changes in cardiac and hemostatic biomarkers (including D-dimer) after strenuous endurance exercise can mimic pulmonary embolism and myocardial injury in individuals who are not actually at risk.50

Disseminated intravascular coagulation

Disseminated intravascular coagulation (DIC) is a severe, often life-threatening, syndrome characterized by diffuse and persistent activation of the hemostatic system with intravascular thrombin generation, and fibrin formation and degradation.51 Early recognition of DIC is crucial to allow prompt treatment, the primary aim of which is to eliminate the underlying condition (i.e., sepsis, malignancy, trauma, obstetric diseases).48 D-dimer has become a cornerstone in the diagnosis of DIC because, thanks to its excellent negative predictive value, the use of D-dimer measurement in this context has been endorsed by all national and international guidelines.52 For example, the International Society of Thrombosis and Hemostasis (ISTH) not only validated a scoring system (including prothrombin time, platelet count, fibrinogen and D-dimer levels) for its diagnostic and prognostic value, but also recommended sequential D-dimer measurements to monitor DIC evolution, and to guide clinical and therapeutic management.53,54

Haematologica | 109 April 2024 1039 REVIEW ARTICLE - High D-dimer management M. Franchini et al.
Figure 2. Proposed algorithm for the diagnostic evaluation of venous thromboembolism. VTE: venous thromboembolism.

Cancer, inflammation, and infection

The activation of coagulation is a common finding in malignant tumors, being associated with growth and progression.55 As a consequence, up to 20% of cancer patients develop VTE, which is the second leading cause of death.56 D-dimer is over-produced in the presence of active malignancy and levels are increased in a variety of tumors.57 However, the common finding of high D-dimer in cancer even in the absence of thrombosis limits the diagnostic usefulness of this test. Nevertheless, incorporating D-dimer measurement in appropriate scoring systems including other biomarkers may help to identify cancer patients at increased risk of developing VTE who are thus candidates for primary thromboprophylaxis.58-62 In addition, although the value of screening patients with increased D-dimer for occult cancer is still a subject of debate, an occult cancer may be considered as the potential source of a substantial rise in D-dimer levels when other physiological or pathological causes have been ruled out.48 The usefulness of this approach has been highlighted in a clinical study in patients with unprovoked VTE, demonstrating that extremely high D-dimer (>4,000 µg/L) is independently associated with the likelihood of an occult cancer.63

There is a close link between fibrinogen, thrombus formation, fibrinolysis and the inflammatory process.10 Fibrinogen, an acute phase reactant, leaks out of the vasculature contributing to the inflammatory process.64 The involvement of clotting factors (i.e., FVIII and others) helps to form fibrin in the extravascular space, which functions as a scaffold for the inflammatory cells of the immune system to exert their functions.64 As a result of fibrin formation, secondary fibrinolysis occurs and this generates D-dimer, with levels paralleling the degree of inflammation.65 Several diseases are characterized by low-grade chronic inflammation and thus high D-dimer; the most common are autoimmune diseases and diabetes. Although D-dimer is considered a marker of inflammation (the so call “D-dimeritis”), high values do not necessarily imply the presence of an increased thrombotic risk10 because D-dimer increases exponentially in parallel with C-reactive protein.66

Inflammation also provides the molecular basis to explain the detection of high D-dimer during infections. The best example is sepsis, a life-threatening systemic infection-related condition associated with defects in hemostasis and, as mentioned above, with DIC.67 Marked elevations of D-dimer have been observed in sepsis, demonstrating the prognostic importance of D-dimer in relation to the severity of the patient’s condition.68,69 Besides SARS-CoV-2 infection, several viral infections (i.e., Ebola virus, influenza A virus, human immunodeficiency virus [HIV], hepatitis C virus, Coxsackievirus, herpes simplex virus and parvovirus B19) are characterized by a marked rise in plasma levels of hypercoagulability markers, such as D-dimer and thrombin-antithrombin complex.70 The endothelial dysfunction and the inflammatory state associated with infections

drive patients towards a hypercoagulable condition, that translates into an increased thromboembolic and cardiovascular risk.66 This is particularly evident in HIV-infected patients.71 In addition to chronic, low-grade inflammation (an important mechanism for their enhanced risk of cardiovascular disease), people living with HIV have increased D-dimer that correlate with VTE and mortality risks.72 The role of D-dimer in the diagnosis of peri-prosthetic infections merits special mention.73,74 A systematic review and meta-analysis based on 12 studies including a total of 1,818 patients concluded that D-dimer has sufficient diagnostic accuracy to exclude peri-prosthetic joint infection.75 In addition, the updated 2018 Musculoskeletal Infection Society criteria validated a score for the diagnosis of peri-prosthetic hip and knee infections which included D-dimer levels >860 µg/L.76

Other conditions

Several other disorders have been associated with abnormal D-dimer.77 Among cardiovascular diseases, atrial fibrillation is accompanied by high D-dimer levels, which decrease during anticoagulant treatment or after successful cardioversion.78,79 Because D-dimer is higher in atrial fibrillation patients with such additional risk factors for stroke as hypertension, diabetes or heart failure, its measurement has been proposed as a biomarker for predicting the risk of stroke.80 Notably, a recent study demonstrated the efficacy of an age-adjusted D-dimer cutoff to exclude the presence of left atrial thrombi in patients with atrial fibrillation.81 However, predictive value is less powerful than that of other biomarkers (i.e., troponin, N-terminal pro-B-type natriuretic peptide), which are preferentially incorporated into the available risk prediction models.82 Prospective studies have also evaluated the utility of D-dimer measurement to predict other cardiovascular adverse events (i.e., myocardial infarction and cardiovascular death), but with conflicting results.77 Likewise, in patients with pre-existing coronary artery disease, D-dimer is of uncertain value for the prediction of incident cardiovascular events.82 A separate mention should be made of acute aortic dissection, an extremely severe condition for which a rapid diagnosis is essential. As D-dimer levels are high in the presence of acute aortic dissection and low in its absence, a normal D-dimer helps to exclude this diagnosis.83 The diagnostic value of this measurement was recently assessed by a systematic review and meta-analysis including 16 clinical studies and 1,135 patients. This concluded that a D-dimer <500 µg/L had excellent exclusion diagnostic sensitivity (96%), thus playing a crucial role in the differential diagnosis of acute aortic dissection.84

The role of D-dimer for the diagnosis of acute intestinal ischemia has also been acknowledged in the literature.85 A systematic review and meta-analysis including 12 studies with 1,300 patients calculated a sensitivity of 94%, suggesting a potential diagnostic role for this biomarker.86

Haematologica | 109 April 2024 1040 REVIEW ARTICLE - High D-dimer management M. Franchini et al.

Beside these thrombotic or pre-thrombotic conditions, the clinical usefulness of D-dimer has also been studied in hemorrhagic conditions, including intracerebral and subarachnoid hemorrhages. A retrospective study of 1,332 consecutive cases with spontaneous intracerebral hemorrhage found that high D-dimer (>550 µg/L) was an independent predictor of poor functional outcome and mortality.87 Similar results were obtained by a retrospective study of 2,056 patients with aneurysmal subarachnoid hemorrhage.88 High D-dimer have also been reported in HELLP (hemolysis, elevated liver enzymes, low platelets) syndrome, a rare complication of pregnancy considered a variant of pre-eclampsia.48 This biomarker has, therefore, been proposed for the early identification of patients with pre-eclampsia at risk of developing a severe HELLP syndrome, although its clinical utility is questionable due to increased D-dimer during physiological pregnancy (see above). D-dimer is also increased in liver cirrhosis, and since it has been positively associated with the severity of liver dysfunction and the presence of portal vein thrombosis, it has been proposed as a predictor of adverse outcomes in these patients.89 Finally, inflammation-related increased D-dimer levels have been reported in other conditions, including pancreatitis and diabetes.5 For example, the marker has been recently proposed for cardiovascular risk stratification in patients with type 2 diabetes.90

Proposed management of ambulatory individuals with high D-dimer

While there is little doubt of the role of D-dimer in the diagnostic workup of patients affected by acute illnesses such as VTE, DIC and sepsis (Table 1), a challenge is represented by the management of ambulatory individuals characterized by the detection of high D-dimer levels but no evidence of thrombosis. This issue has received greater attention given the generalized and indiscriminate dispensation of D-dimer testing during and following the COVID-19 pandemic. When an ostensibly healthy and asymptomatic person is referred for persistently high D-dimer, they should first be reassured by explaining all the possible reasons other than disease that may underly this abnormality. On the other hand, an abnormal D-dimer should not be overlooked in otherwise asymptomatic subjects. Thus, they should have access to differential diagnostic procedures, and all possible conditions associated with increased D-dimer should be taken into consideration in the process.

Figure 3 shows a flow chart with a summary of the evaluation processes to be carried out by hematologists in ambulatory cases with increased D-dimer levels following age adjustment. This flow-chart is based mostly on our

personal experience rather than on the scarse data available in the literature. First, and most importantly, physical examination is crucial for excluding the presence of signs and/or symptoms related to VTE. It is also essential to rule out not only current symptoms, but also those that arose in the previous few days. For example, we recently observed an asymptomatic patient with increased D-dimer who reported that in the previous few days he had had some respiratory symptoms that had gradually disappeared. A precautionary CT pulmonary angiogram was performed and a pulmonary embolism was diagnosed.

In cases with clinical signs/symptoms potentially suggestive of VTE, we suggest performing a leg venous ultrasonography for the detection of occult DVT, plus, when pulmonary embolism is suspected, a CT angiogram (see the flow chart in Figure 3). If negative, the individual should then undergo blood screening to identify conditions possibly associated with increased D-dimer. Again, it is essential to check the individual’s case history and carry out a physical examination to restrict the range of blood tests to be performed. The individual should also be asked about the presence of autoimmune or rheumatic disorders, diabetes, chronic inflammatory disorders, renal disease, active or previous cancer, chronic infection, liver disease, and cardiovascular disorders. All physiological causes of high D-dimer (ongoing or recent pregnancies, strenuous physical exercise) should also be ruled out. Blood tests should, therefore, be focused on those able to confirm or diagnose an underlying disorder. In case of identification of a pathological condition, the patient should be referred to the specialist for the most appropriate care. In addition to physical examination, we suggest performing an abdominal ultrasound in order to exclude aortic dissection. If no underlying condition is identified, the individual should be reassured about their health status and a clinical follow-up set in place.

Conclusions

D-dimer testing is unequivocally a useful tool for the diagnosis of VTE. However, owing to its intrinsic poor positive predictive value, D-dimer is not specific for thromboembolic disease because increased levels are also observed in many other conditions, ranging from DIC to infections and malignant neoplasms. In other words, increased D-dimer levels may be encountered as part of an inflammatory state or cancer without being the sign of intravascular thrombus formation. Thus, while D-dimer measurement must be incorporated in multi-test algorithms for the evaluation of patients with suspected VTE, this measurement has limited clinical utility in unselected ambulatory cases and should, therefore, only be performed in specified clinical situations. However, the detection of increased D-dimer cannot be ignored and warrants a series of diagnostic procedures aimed at the proper management of these

Haematologica | 109 April 2024 1041 REVIEW ARTICLE - High D-dimer management M. Franchini et al.

cases. This means, on the one hand, the exclusion of any associated thromboembolic complication and, on the other hand, the identification or exclusion of conditions associated with increased D-dimer. When the latter remains the only abnormality, individuals should be reassured about their health status and encouraged to avoid the repeated, obsessive measurement of D-dimer.

References

1. Lippi G, Favaloro EJ. Laboratory hemostasis: from biology to the bench. Clin Chem Lab Med. 2018;56(7):1035-1045.

2. Franchini M, Mannucci PM. Primary hyperfibrinolysis: facts and fancies. Thromb Res. 2018;166:71-75.

3. Riley RS, Gilbert AR, Dalton JB, Pai S, McPherson RA. Widely used types and clinical applications of D-dimer assay. Lab Med. 2016;47(2):90-102.

4 Linkins LA , Takach Lapner S. Review of D-dimer testing: good, bad, and ugly. Int J Lab Hematol. 2017;39(Suppl 1):98-103.

5. Johnson ED, Schell JC, Rodgers GM. The D-dimer assay. Am J Hematol. 2019;94(7):833-839.

Disclosures

PMM has received honoraria from Roche, Takeda, and Werfen for lectures at educational symposia. MF, MPP and DF have no conflicts of interest to disclose.

Contributions

All the authors wrote, read and approved the manuscript.

6. Lippi G, Mullier F, Favaloro EJ. D-dimer: old dogmas, new (COVID-19) tricks. Clin Chem Lab Med. 2022;61(5):841-850.

7 Semiz S. COVID19 biomarkers: what did we learn from systematic reviews? Front Cell Infect Microbiol. 2022;12:1038908.

8. Iba T, Levy JH, Levi M, Thachil J. Coagulopathy in COVID-19. J Thromb Haemost. 2020;18(9):2103-2109.

9 Franchini M, Marano G, Cruciani M, et al. COVID-19-associated coagulopathy. Diagnosis (Berl). 2020;7(4):357-363.

10. Thachil J, Favaloro EJ, Lippi G. D-dimers-”normal” levels versus elevated levels due to a range of conditions, including

Haematologica | 109 April 2024 1042 REVIEW ARTICLE - High D-dimer management M. Franchini et al.
Figure 3. Proposed algorithm for the management of cases with increased D-dimer levels. VTE: venous thromboembolism.

“D-dimeritis”, inflammation, thromboembolism, disseminated intravascular coagulation, and COVID-19. Semin Thromb Hemost. 2022;48(6):672-679.

11. Doolittle RE. Structural aspects of the fibrinogen to fibrin conversion. Adv Protein Chem. 1973;27:1-109.

12. McKee PA, Rogers LA, Marler E, et al. The subunit polypeptides of human fibrinogen. Arch Biochem Biophys. 1966;116(1):271.

13. Mager JJ, Schutgens RE, Haas FJ, et al. The early course of D-dimer concentration following pulmonary artery embolisation, Thromb Haemost. 2001;86(6):1578-1579.

14. Chandler WL, Velan T. Plasmin generation and D-dimer formation during cardiopulmonary bypass. Blood Coagul Fibrinolysis. 2004;15(7):583-591.

15. Dindo D, Breitenstein S, Hahnloser D, et al. Kinetics of D-dimer after general surgery. Blood Coagul Fibrinolysis. 2009;20(5):347-352.

16. Khan F, Tritschler T, Kahn SR, Rodger MA. Venous thromboembolism. Lancet. 2021;398(10294):64-77.

17 Freund Y, Cohen-Aubart F, Bloom B. Acute pulmonary embolism. JAMA. 2022;328(13):1336-1345.

18. Di Nisio M, Squizzato A, Rutjes AW, Büller HR, Zwinderman AH, Bossuyt PM. Diagnostic accuracy of D-dimer test for exclusion of venous thromboembolism: a systematic review. J Thromb Haemost. 2007;5(2):296-304.

19 Konstantinides SV, Meyer G, Becattini C, et al. ESC Scientific Document Group. 2019 ESC Guidelines for the diagnosis and management of acute pulmonary embolism developed in collaboration with the European Respiratory Society (ERS). Eur Heart J. 2020;41(4):543-603.

20. Crawford F, Andras A, Welch K, Sheares K, Keeling D, Chappell FM. D-dimer test for excluding the diagnosis of pulmonary embolism. Cochrane Database Syst Rev. 2016;2016(8):CD010864.

21. Wells PS, Anderson DR, Rodger M, et al. Evaluation of D-dimer in the diagnosis of suspected deep-vein thrombosis. N Engl J Med. 2003;349(13):1227-1235.

22. Le Gal G, Righini M, Roy PM, et al. Prediction of pulmonary embolism in the emergency department: the revised Geneva score. Ann Intern Med. 2006;144(3):165-171.

23. Wells PS, Anderson DR, Rodger M, et al. Derivation of a simple clinical model to categorize patients probability of pulmonary embolism: increasing the models utility with the SimpliRED D-dimer. Thromb Haemost. 2000;83(3):416-420.

24. Klok FA, Mos IC, Nijkeuter M, et al. Simplification of the revised Geneva score for assessing clinical probability of pulmonary embolism. Arch Intern Med. 2008;168(19):2131-2136.

25. Wells PS, Anderson DR, Rodger M, et al. Excluding pulmonary embolism at the bedside without diagnostic imaging: management of patients with suspected pulmonary embolism presenting to the emergency department by using a simple clinical model and D-dimer. Ann Intern Med. 2001;135(2):98-107.

26. Duffett L, Castellucci LA, Forgie MA. Pulmonary embolism: update on management and controversies. BMJ. 2020;370:m2177.

27. Righini M, Van Es J, Den Exter PL, et al. Age-adjusted D-dimer cutoff levels to rule out pulmonary embolism: the ADJUST-PE study. JAMA. 2014;311(11):1117-1124.

28. Robert-Ebadi H, Bertoletti L, Combescure C, Le Gal G, Bounameaux H, Righini M. Effects of impaired renal function on levels and performance of D-dimer in patients with

suspected pulmonary embolism. Thromb Haemost. 2014;112(3):614-620.

29 Ten Cate V, Nagler M, Panova-Noeva M, et al. The diagnostic performance of renal function-adjusted testing in individuals suspected of having venous thromboembolism. Haematologica. 2019;104(9):e424-e427.

30 Righini M, Robert-Ebadi H, Elias A, et al. CT-PE-Pregnancy Group. Diagnosis of pulmonary embolism during pregnancy: a multicenter prospective management outcome study. Ann Intern Med. 2018;169(11):766-773.

31. van der Pol LM, Tromeur C, Bistervels IM, et al. Artemis Study Investigators. Pregnancy-adapted YEARS algorithm for diagnosis of suspected pulmonary embolism. N Engl J Med. 2019;380(12):1139-1149.

32. Legnani C, Palareti G, Cosmi B, Cini M, Tosetto A, Tripodi A. Different cut-off values of quantitative D-dimer methods to predict the risk of venous thromboembolism recurrence: a post-hoc analysis of the PROLONG study. Haematologica. 2008;93(6):900-907.

33. Rodger MA, Le Gal G, Langlois NJ, et al. REVERSE II investigators. “HERDOO2” clinical decision rule to guide duration of anticoagulation in women with unprovoked venous thromboembolism. Can I use any D-dimer? Thromb Res. 2018;169:82-86.

34 Eichinger S, Heinze G, Kyrle PA. D-dimer levels over time and the risk of recurrent venous thromboembolism: an update of the Vienna prediction model. J Am Heart Assoc. 2014;3(1):e000467.

35. Stevens SM, Woller SC, Kreuziger LB, et al. Antithrombotic therapy for VTE disease: second update of the CHEST Guideline and Expert Panel Report. Chest. 2021;160(6):e545-e608.

36. Dentali F, Squizzato A, Marchesi C, Bonzini M, Ferro JM, Ageno W. D-dimer testing in the diagnosis of cerebral vein thrombosis: a systematic review and a meta-analysis of the literature. J Thromb Haemost. 2012;10(4):582-589.

37. Alons IM, Jellema K, Wermer MJ, et al. D-dimer for the exclusion of cerebral venous thrombosis: a meta-analysis of low risk patients with isolated headache. BMC Neurol. 2015;15:118.

38. Heldner MR, Zuurbier SM, Li B, et al. Prediction of cerebral venous thrombosis with a new clinical score and D-dimer levels. Neurology. 2020;95(7):e898-e909.

39 Ordieres-Ortega L, Demelo-Rodríguez P, Galeano-Valle F, Kremers BMM, ten Cate-Hoek AJ, ten Cate H. Predictive value of D-dimer testing for the diagnosis of venous thrombosis in unusual locations: a systematic review. Thromb Res. 2020;189:5-12.

40 Favresse J, Lippi G, Roy PM, et al. D-dimer: preanalytical, analytical, postanalytical variables, and clinical applications. Crit Rev Clin Lab Sci. 2018;55(8):548-577.

41. Haase C, Joergensen M, Ellervik C, Joergensen MK, Bathum L. Age- and sex-dependent reference intervals for D-dimer: evidence for a marked increase by age. Thromb Res. 2013;132(6):676-680.

42. Schouten HJ, Geersing GJ, Koek HL, et al. Diagnostic accuracy of conventional or age adjusted D-dimer cut-off values in older patients with suspected venous thromboembolism: systematic review and meta-analysis. BMJ. 2013;346:f2492.

43. De Pooter N, Brionne-François M, Smahi M, Abecassis L, Toulon P. Age-adjusted D-dimer cut-off levels to rule out venous thromboembolism in patients with non-high pre-test probability: clinical performance and cost-effectiveness

Haematologica | 109 April 2024 1043 REVIEW ARTICLE - High D-dimer management M. Franchini et al.

analysis. J Thromb Haemost. 2021;19(5):1271-1282.

44 Olson JD. D-dimer: an overview of hemostasis and fibrinolysis, assays, and clinical applications. Adv Clin Chem. 2015;69:1-46.

45. Eichinger S. D-dimer testing in pregnancy. Pathophysiol Haemost Thromb. 2003;33(5-6):327-329.

46. Chabloz P, Reber G, Boehlen F, Hohlfeld P, de Moerloose P. TAFI antigen and D-dimer levels during normal pregnancy and at delivery. Br J Haematol. 2001;115(1):150-152.

47. Tekle E, Gelaw Y, Asrie F. Hematological profile changes among oral contraceptive users: a narrative review. J Blood Med. 2022;13:525-536.

48. Lippi G, Franchini M, Targher G, Favaloro EJ. Help me, Doctor! My D-dimer is raised. Ann Med. 2008;40(8):594-605.

49. Zadow EK, Kitic CM, Wu SSX, Fell JW, Adams MJ. Time of day and short-duration high-intensity exercise influences on coagulation and fibrinolysis. Eur J Sport Sci. 2018;18(3):367-375.

50 Sedaghat-Hamedani F, Kayvanpour E, Frankenstein L, et al. Biomarker changes after strenuous exercise can mimic pulmonary embolism and cardiac injury-a meta-analysis of 45 studies. Clin Chem. 2015;61(10):1246-1255.

51. Favaloro EJ. Laboratory testing in disseminated intravascular coagulation. Semin Thromb Hemost. 2010;36(4):458-467.

52. Wada H, Matsumoto T, Yamashita Y. Diagnosis and treatment of disseminated intravascular coagulation (DIC) according to four DIC guidelines. J Intensive Care. 2014;2(1):15.

53. Toh CH, Hoots WK. SSC on disseminated intravascular coagulation of the ISTH. The scoring system of the Scientific and Standardisation Committee on Disseminated Intravascular Coagulation of the International Society on Thrombosis and Haemostasis: a 5-year overview. J Thromb Haemost. 2007;5(3):604-606.

54. Suzuki K, Wada H, Imai H, et al. Subcommittee on Disseminated Intravascular Coagulation. A re-evaluation of the D-dimer cut-off value for making a diagnosis according to the ISTH overt-DIC diagnostic criteria: communication from the SSC of the ISTH. J Thromb Haemost. 2018;16(7):1442-1444.

55. Franchini M, Montagnana M, Targher G, Manzato F, Lippi G. Pathogenesis, clinical and laboratory aspects of thrombosis in cancer. J Thromb Thrombolysis. 2007;24(1):29-38.

56. Khorana AA, Francis CW, Culakova E, Kuderer NM, Lyman GH. Thromboembolism is a leading cause of death in cancer patients receiving outpatient chemotherapy. J Thromb Haemost. 2007;5(3):632-634.

57 Ma M, Cao R, Wang W, et al. The D-dimer level predicts the prognosis in patients with lung cancer: a systematic review and meta-analysis. J Cardiothorac Surg. 2021;16(1):243.

58. Ay C, Dunkler D, Marosi C, et al. Prediction of venous thromboembolism in cancer patients. Blood. 2010;116(24):5377-5382.

59. Pabinger I, van Es N, Heinze G, et al. A clinical prediction model for cancer-associated venous thromboembolism: a development and validation study in two independent prospective cohorts. Lancet Haematol. 2018;5(7):e289-e298.

60 Kumar V, Shaw JR, Key NS, et al. D-Dimer enhances risktargeted thromboprophylaxis in ambulatory patients with cancer. Oncologist. 2020;25(12):1075-1083.

61. Falanga A, Ay C, Di Nisio M, et al; ESMO Guidelines Committee. Venous thromboembolism in cancer patients: ESMO Clinical Practice Guideline. Ann Oncol. 2023;34(5):452-467.

62. Verzeroli C, Giaccherini C, Russo L, et al. HYPERCAN

Investigators. Utility of the Khorana and the new-Vienna CATS prediction scores in cancer patients of the HYPERCAN cohort. J Thromb Haemost. 2023;21(7):1869-1881.

63. Han D, Hartaigh B, Lee JH, et al. Impact of D-Dimer for prediction of incident occult cancer in patients with unprovoked venous thromboembolism. PLoS One. 2016;11(4):e0153514.

64 Clemmensen I, Andersen RB. The fibrinolytic system and its relation to inflammatory diseases. Semin Arthritis Rheum. 1982;11(4):390-398.

65. Shorr AF, Thomas SJ, Alkins SA, Fitzpatrick TM, Ling GS. D-dimer correlates with proinflammatory cytokine levels and outcomes in critically ill patients. Chest. 2002;121(4):1262-1268.

66. Steeghs N, Goekoop RJ, Niessen RW, Jonkers GJ, Dik H, Huisman MV. C-reactive protein and D-dimer with clinical probability score in the exclusion of pulmonary embolism. Br J Haematol. 2005;130(4):614-619.

67. Prucha M, Bellingan G, Zazula R. Sepsis biomarkers. Clin Chim Acta. 2015;440:97-103.

68. Kinasewitz GT, Yan SB, Basson B, et al. Universal changes in biomarkers of coagulation and inflammation occur in patients with severe sepsis, regardless of causative micro-organism. Crit Care. 2004;8(2):R82-90.

69 Iba T, Gando S, Murata A, et al. Predicting the severity of systemic inflammatory response syndrome (SIRS)-associated coagulopathy with hemostatic molecular markers and vascular endothelial injury markers. J Trauma. 2007;63(5):1093-1098.

70. Subramaniam S, Scharrer I. Procoagulant activity during viral infections. Front Biosci (Landmark Ed). 2018;23(6):1060-1081.

71. Vos AG, Idris NS, Barth RE, Klipstein-Grobusch K, Grobbee DE. Pro-inflammatory markers in relation to cardiovascular disease in HIV infection. A systematic review. PLoS One. 2016;11(1):e0147484.

72. Perkins MV, Joseph SB, Dittmer DP, Mackman N. Cardiovascular disease and thrombosis in HIV infection. Arterioscler Thromb Vasc Biol. 2023;43(2):175-191.

73. Wang R, Zhang H, Ding P, Jiao Q. The accuracy of D-dimer in the diagnosis of periprosthetic infections: a systematic review and meta-analysis. J Orthop Surg Res. 2022;17(1):99.

74. Cutter B, Lum ZC, Giordani M, Meehan JP. Utility of D-dimer in total joint arthroplasty. World J Orthop. 2023;14(3):90-102.

75. Balato G, De Franco C, Balboni F, et al The role of D-dimer in periprosthetic joint infection: a systematic review and metaanalysis. Diagnosis (Berl). 2021;9(1):3-10.

76. Parvizi J, Tan TL, Goswami K, et al. The 2018 definition of periprosthetic hip and knee infection: an evidence-based and validated criteria. J Arthroplasty. 2018;33(5):1309-1314.e2.

77 Weitz JI, Fredenburgh JC, Eikelboom JW. A test in context: D-dimer. J Am Coll Cardiol. 2017;70(19):2411-2420.

78. Hijazi Z, Oldgren J, Siegbahn A, Wallentin L. Application of biomarkers for risk stratification in patients with atrial fibrillation. Clin Chem. 2017;63(1):152-164.

79 Pezzo MP, Tufano A, Franchini M. Role of new potential biomarkers in the risk of thromboembolism in atrial fibrillation. J Clin Med. 2022;11(4):915.

80 Danese E, Montagnana M, Cervellin G, Lippi G. Hypercoagulability, D-dimer and atrial fibrillation: an overview of biological and clinical evidence. Ann Med. 2014;46(6):364-371.

81. Almorad A, Ohanyan A, Pintea Bentea G, et al. D-dimer blood concentrations to exclude left atrial thrombus in patients

Haematologica | 109 April 2024 1044
M. Franchini et al.
REVIEW ARTICLE - High D-dimer management

REVIEW ARTICLE - High D-dimer management

with atrial fibrillation. Heart. 2021;107(3):195-200.

82. Danesh J, Whincup P, Walker M, et al. Fibrin D-dimer and coronary heart disease: prospective study and meta-analysis. Circulation. 2001;103(19):2323-2327.

83. Cui JS, Jing ZP, Zhuang SJ, et al. D-dimer as a biomarker for acute aortic dissection: a systematic review and metaanalysis. Medicine (Baltimore). 2015;94(4):e471.

84 Yao J, Bai T, Yang B, Sun L. The diagnostic value of D-dimer in acute aortic dissection: a meta-analysis. J Cardiothorac Surg. 2021;16(1):343.

85. Derikx JP, Schellekens DH, Acosta S. Serological markers for human intestinal ischemia: a systematic review. Best Pract Res Clin Gastroenterol. 2017;31(1):69-74.

86. Sun DL, Li SM, Cen YY, et al. Accuracy of using serum D-dimer

for diagnosis of acute intestinal ischemia: a meta-analysis. Medicine (Baltimore). 2017;96(13):e6380.

87. Zhou Q, Zhang D, Chen X, et al. Plasma D-dimer predicts poor outcome and mortality after spontaneous intracerebral hemorrhage. Brain Behav. 2021;11(1):462-468.

88. Fang F, Wang P, Yao W, et al. Association between D-dimer levels and long-term mortality in patients with aneurysmal subarachnoid hemorrhage. Neurosurg Focus. 2022;52(3):E8.

89. Li Y, Qi X, Li H, et al. D-dimer level for predicting the inhospital mortality in liver cirrhosis: a retrospective study. Exp Ther Med. 2017;13(1):285-289.

90. Cheng L, Fu Q, Zhou L, et al. D-dimer as a predictor of cardiovascular outcomes in patients with diabetes mellitus. BMC Cardiovasc Disord. 2022;22(1):82.

Haematologica | 109 April 2024 1045
M. Franchini et al.

Use, variability, and justification of eligibility criteria for phase II and III clinical trials in acute leukemia

Andrew Hantel,1,2,3 Marlise R. Luskin,3 Irum Khan,4 Elizabeth Warner,2 Anand A. Patel,5 Thomas P. Walsh,1 Daniel J. DeAngelo,3 Christopher S. Lathan1,6 and Gregory A. Abel1,2,3

1Division of Population Sciences, Dana-Farber Cancer Institute, Boston, MA; 2Center for Bioethics, Harvard Medical School, Boston, MA; 3Division of Hematologic Malignancies, Dana-Farber Cancer Institute, Boston, MA; 4Division of Hematology/Oncology, Department of Medicine, Robert H. Lurie Comprehensive Cancer Center, Northwestern University, Chicago, IL; 5Section of Hematology-Oncology, Department of Medicine, The University of Chicago, Chicago, IL and 6Lowe Center for Thoracic Oncology, Dana-Farber Cancer Institute, Boston, MA, USA

Abstract

Correspondence: A. Hantel

andrew_hantel@dfci.harvard.edu

Received: June 13, 2023.

Accepted: August 4, 2023.

Early view: August 10, 2023.

https://doi.org/10.3324/haematol.2023.283723

©2024 Ferrata Storti Foundation

Published under a CC BY-NC license

Clinical trial eligibility criteria can unfairly exclude patients or unnecessarily expose them to known risks if criteria are not concordant with drug safety. There are few data evaluating the extent to which acute leukemia eligibility criteria are justified. We analyzed criteria and drug safety data for front-line phase II and/or III acute leukemia trials with start dates 1/1/2010-12/31/2019 registered on clinicaltrials.gov. Multivariable analyses assessed concordance between criteria use and safety data (presence of criteria with a safety signal, or absence of criteria without a signal), and differences between criteria and safety-based limits. Of 250 eligible trials, concordant use of ejection fraction criteria was seen in 34.8%, corrected QT level (QTc) in 22.4%, bilirubin in 68.4%, aspartate transaminase/alanine aminotransferase (AST/ALT) in 58.8%, renal function in 68.4%, human immunodeficiency virus (HIV) in 54.8%, and hepatitis B and C in 42.0% and 41.2%. HIV and hepatitis B and C criteria use was concordant with safety data (adjusted Odds Ratios 2.04 [95%CI: 1.13, 3.66], 2.64 [95%CI: 1.38, 5.04], 2.27 [95%CI: 1.20, 4.32]) but organ function criteria were not (all P>0.05); phase III trials were not more concordant. Bilirubin criteria limits were the same as safety-based limits in 16.0% of trials, AST/ALT in 18.1%, and renal function in 13.9%; in 75.7%, 51.4%, and 56.5% of trials, criteria were more restrictive, respectively, by median differences of 0.2, 0.5, and 0.5 times the upper limits of normal. We found limited drug safety justifications for acute leukemia eligibility criteria. These data define criteria use and limits that can be rationally modified to increase patient inclusion and welfare.

Introduction

Clinical research is ethical when there is fair subject selection and a favorable risk-benefit ratio.1 Recent analyses of solid tumor clinical trials found that eligibility criteria can disproportionately exclude potential participants from historically marginalized groups.2,3 Unless there is a safety-based justification for these criteria, such exclusions are discriminatory and reduce the number of eligible patients, slowing recruitment and inhibiting trial completion. For instance, eliminating exclusions for manageable medical conditions not thought to be justified by drug safety (e.g., coronary stenting, diabetes mellitus) in pancreatic cancer trials increased overall eligibility and reduced disparities for Black compared to White patients (with exclusions, ineligibility rates were 42.4% vs. 33.2%, P=0.02; without exclusions 26.8% vs. 24.8%, P>0.05).2 In this and other examples in non-small cell lung cancer,3 such modifications

enhance generalizability and arguably the scientific value necessary for ethical research.1 At the same time, criteria must be used to protect participants from unnecessary risk when safety signals are known. In late 2022, the United States (US) Food and Drug Administration (FDA) was empowered by passage of the Food and Drug Omnibus Reform Act (FDORA) to promote rational revision of criteria to reduce exclusion and enhance safety.4-6 Like unjustified criteria, unjustified variability in the limits assigned to criteria (e.g., the value that defines minimum acceptable renal function) also represents unfair exclusion or risk unless differences are drug safety-based.1 Data on the variability of eligibility criteria limits and their justification in drug safety are few. The use and variability of criteria across phase II and III trials in acute myeloid and lymphoblastic leukemia have also not been well described. Without similar data in leukemia, the blood cancer research community cannot assess where better alignment of crite-

Haematologica | 109 April 2024 1046 - Acute Leukemia ARTICLE

ria and drug-associated risks is needed, and unnecessary exclusion and risk will continue. In this context, we sought to characterize the use, variability, and drug safety-based justification of eligibility criteria, as well as the extent to which they could be rationally modified to promote inclusion and safety.

Methods

Design and objectives

This was a retrospective analysis of phase II and III acute leukemia clinical trial eligibility criteria and their basis in drug safety. Objectives were to assess concordance between trial eligibility criteria and drug safety profiles (with concordance defined as the presence of an eligibility criterion with a drug safety signal or absence of a criterion without a signal), and to determine differences between criteria-based and drug safety-based limits and their variability. We also examined whether concordance and differences improved in later phase studies. Manuscript reporting followed PRISMA guidelines, as applicable. Ethical approval for the study was provided by the Dana-Farber Cancer Institute Office for Human Research Studies as protocol 22-267.

Trial, criteria, and drug safety selection, abstraction, and coding

To assess potential changes in criteria that could be made under the aegis of a single regulatory standard, the search focused on trials registered with the US FDA. As US law FDAAA 801 requires all therapeutic clinical trials in the US to be registered on clinicaltrials.gov,7 this database was selected for review and queried on 10/6/2022. The study period (2010-2019) was defined to allow sufficient time after enactment of FDAAA 801 (circa 2008) for all new studies to be registered. The search terms and filters are described in the Online Supplementary Appendix. The results were reviewed to exclude trials that did not meet the above criteria, did not test therapies to treat acute leukemia, tested cellular therapies, only tested therapies in relapsed/ refractory disease, and/or only recruited patients outside the US. Searches, result screening, and eligibility criteria coding were independently performed by two trained team members, and consensus arbitration with a third was used to resolve discrepancies.8

An initial list of eligibility criteria was developed collaboratively by the study team based on FDA guidance.4,5 Criteria were coded into binary, categorical, or continuous variables based on FDA guidance when possible and common categories when not. The drug safety review sought to identify safety signals known at the time of study initiation that would justify the use of enrollment criteria. All anti-cancer therapies tested were compiled and reviewed to identify safety data available at the time of the study start date.

Details on criteria and drug safety identification and coding, and the lists of variables used, are shown in the Online Supplementary Methods, Online Supplementary Tables S1, S2.

Statistical analysis

Criteria use and limit differences were reported using descriptive statistics with frequencies and percentages. Criteria limit dispersion was reported as medians with interquartile ranges (IQR) and robust coefficients of variation (rCV; the IQR divided by the median).9 Univariable assessments of concordance between laboratory criteria and drug safety signals, and odds of concordance between phase III and phase II studies, were assessed using χ2 or Fisher’s exact testing with Odds Ratios and 95% Confidence Intervals. Adjusted Odds Ratios (aOR) of concordance were calculated using multivariable logistic regression models with criteria use as the dependent variable and presence of a relevant drug safety signal as the independent variable (e.g., known association with QT interval prolongation for corrected QT [QTc] criteria), adjusted for phase, year, size, and trial sponsor type(s).10,11 Improvement in alignment of criteria and safety-based limits from phase II to phase III was assessed by the absolute reduction in the median difference between criteria- and safety based-limits, with significance assessed using the two-sample Mann-Whitney U test, and the corresponding IQR difference, with significance assessed using the Brown-Forsythe equality of variances test.12 Statistical testing was performed using STATA Version 16.1 (StataCorp; College Station, TX, US). The significance level was pre-specified as alpha=0.05.

Results

The search resulted in 848 acute myeloid leukemia (AML) and 459 acute lymphocytic leukemia (ALL) trials, of which 250 (19.1%) were eligible for analysis: 190 AML (22.4%) and 60 ALL (13.1%). A flow diagram of exclusions is shown in Online Supplementary Figure S1. Most trials were phase II (203; 81.2%); 47 trials (18.8%) were phase III. Eighty (32.0%) trials were sponsored by the National Institutes of Health, 151 (60.4%) by academic investigators, and 136 (54.4%) by industry. A total of 74 (29.6%) trials had participating sites outside the US. Across all trials there were 162 unique anti-cancer therapies tested ( Online Supplementary Table S3), of which 83 (51.2%) were not FDA-approved at the study start date. Approximately half of the trials (135; 54.0%) tested at least one drug that was investigational at study start.

Variability in the use of common eligibility criteria with associated limits is shown in Table 1. Limit variability, measured as rCV, was >10% for the age demarcation of an older adult (12.5%) and for renal function (35.0%), bilirubin (22.5%), drug washout period (75.0%), and prior malignancy washout period (75.0%) limits. Violin plots of these

Haematologica | 109 April 2024 1047 ARTICLE - Eligibility criteria in acute leukemia trials A. Hantel et al.

measures’ variability are shown in Online Supplementary Figure S2. Common exclusion criteria without associated limits included diagnosis of human immunodeficiency virus (HIV) (137 trials; 54.8%), hepatitis B (105; 42.0%) and C (103; 41.2%) infection, and central nervous system (CNS) disease (117; 46.8%). Cytoreduction was specifically allowed in 122 (48.8%) trials.

Concordance between criteria with limits and relevant drug safety signals is shown in Figure 1. There was concordance between the presence of ejection fraction limits and chemotherapy associated with congestive heart failure

risk in 115 (46.0%) trials. Criteria concordance with other relevant risks was seen for QTc limits in 146 (58.4%) trials, bilirubin in 170 (68.0%) trials, aspartate transaminase/ alanine aminotransferase (AST/ALT) in 148 (59.2%) trials, and renal function in 159 (63.6%) trials. Exclusion criteria for HIV, hepatitis B, and hepatitis C were concordant with drug safety in 145 (58.0%), 135 (54.0%), and 131 (52.4%) of trials, respectively.

Unadjusted OR and aOR of concordance are shown in Table 2: HIV and hepatitis B and C criteria use was concordant with drug safety data (aOR 2.04 [95%CI: 1.13, 3.66]; 2.64

*Robust coefficient of variation = (interquartile range)/(median). ^Restricted to trials enrolling fit patients. N: number; CV: coefficient of variation; ECOG: Eastern Cooperative Oncology Group; N/A: not available; AST/ALT: aspartate transaminase/alanine aminotransferase; QTc: corrected QT; ULN: upper limit of normal; ms: milliseconds.

Haematologica | 109 April 2024 1048 ARTICLE - Eligibility criteria in acute leukemia trials A. Hantel et al.
Criterion Measure Trials with criterion Unit Median Interquartile range Robust CV* % N % Older adult age cutoff N/A 129 51.6 Years 60 60-70 12.5 ECOG Performance Status Upper limit^ 206 82.4 N/A 2 2-2 0 Renal function Upper limit 167 66.8 ULN 1.5 1.3-2.0 35.0 AST/ALT Upper limit 147 58.8 ULN 3.0 2.5-3.0 12.5 Bilirubin Upper limit 171 68.4 ULN 2.0 1.8-2.4 22.5 QTc interval Upper limit 56 22.4 ms 470 450-480 4.8 Left ventricular ejection fraction Lower limit^ 87 34.8 % 45 45-50 8.3 Prior anti-cancer therapy washout period Lower limit 128 51.2 Days 14 14-28 75.0 Half-lives 5 5-5 0 Prior malignancy washout period Lower limit 128 51.2 Months 24 12-36 75.0
Table 1. Variability in the use and limits of common eligibility criteria. Figure 1. Concordance and discordance of eligibility criteria with drug safety signals. Stacked bars show concordance (shades of blue) and discordance (shades of red) of criteria use with relevant drug safety signals. Numbers within the bars indicate the number of trials; all bars sum to N=250. LVEF: left ventricular ejection fraction; QTc: corrected QT interval; AST/ALT: aspartate transaminase/alanine aminotransferase; HIV: human immunodeficiency virus.

[95%CI: 1.38, 5.04]; 2.27 [95%CI: 1.20, 4.32]) but organ function criteria were not (all aOR P>0.05). Sponsor type was associated with eligibility criteria use in several instances. Industry sponsorship was associated with increased odds of hepatitis B and C exclusions (aOR 2.45 [95%CI: 1.13, 5.30] and 2.59 [95%CI: 1.19, 5.64]) and academic sponsorship with increased odds of bilirubin and renal function exclusions (aOR 3.14 [95%CI: 1.62, 6.07] and 2.84 [95%CI: 1.50, 5.36]). There were no significant differences in what limits were placed according to the presence or absence of a drug safety signal (all Mann-Whitney U test P>0.05) (Figure 2). Odds of concordance between criteria use and drug safety data were numerically lower for phase III studies compared to phase II studies (Online Supplementary Table S4, Online Supplementary Figure S3); odds were less concordant for bilirubin (OR 0.41 [95%CI: 0.21, 0.78]), AST/ALT (OR 0.43 [95%CI: 0.23, 0.83]), and renal function limits (OR 0.53 [95%CI: 0.28, 0.99]). We next assessed the limits that were used when there was concordance between the presence of a criterion and drug safety data. Drug safety-based and criteria-based lim-

its for bilirubin were the same in 16.0% of these trials, for AST/ALT in 18.1%, and for renal function in 13.9%; in 75.7%, 51.4%, and 56.5% of trials the criteria were more restrictive, respectively. Specific drug safety limits for left ventricular ejection fraction (LVEF) and QTc were too few for comparison. Differences in renal and hepatic function limits from eligibility criteria and drug safety data are shown in Figure 3. The median absolute differences between eligibility criteria and drug safety-based limits were 0.5 times the upper limit of normal (ULN) for renal function, 0.5 ULN for AST/ ALT, and 0.2 ULN for bilirubin; the respective IQR were 0.9, 2.5, and 1.3.

Limit differences between phase II and phase III studies are shown in Online Supplementary Figure S4. Differences in median renal function limit in phase III trials were significantly different and closer to zero (Mann Whitney U test P=0.03); bilirubin and AST/ALT limits were not significantly different in phase III. The variability of these differences was similar between phase II and III trials for renal function (IQR 0.81 and 0.50), AST/ALT (2.50 and 2.50), and bilirubin (1.30 and

*Adjustments were for trial phase, size, year of study start, leukemia subtype, and sponsor type(s). OR: odds ratio; CI: confidence interval; QTc: corrected QT; AST/ALT: aspartate transaminase/alanine aminotransferase; HIV: human immunodeficiency virus.

Haematologica | 109 April 2024 1049 ARTICLE - Eligibility criteria in acute leukemia trials A. Hantel et al.
Criterion Unadjusted Odds Ratio P OR 95% CI Adjusted Odds Ratio* P OR 95% CI Lower Upper Lower Upper Left ventricular ejection fraction 0.84 0.52 0.50 1.42 0.79 0.40 0.45 1.38 QTc interval 1.34 0.34 0.73 2.44 1.44 0.28 0.74 2.80 Bilirubin 1.65 0.52 0.36 7.55 1.79 0.49 0.34 9.37 AST/ALT 1.94 0.39 0.42 8.86 1.68 0.53 0.33 8.49 Renal function 1.07 0.87 0.46 2.52 1.30 0.58 0.52 3.28 HIV 1.80 0.04 1.03 3.12 2.04 0.02 1.13 3.66 Hepatitis B 2.17 0.01 1.21 3.90 2.64 0.003 1.38 5.04 Hepatitis C 1.90 0.03 1.06 3.40 2.27 0.01 1.20 4.32
Table 2. Unadjusted and adjusted Odds Ratios of concordance between criteria use and relevant drug safety signals. Figure 2. Criteria limits defined according to presence or absence of drug safety signals. Each box plots shows the median and interquartile range of a criterion’s limits grouped by the presence (blue) or absence (red) of a relevant drug safety signal; outlier points are shown individually. LVEF: left ventricular ejection fraction; QTc: corrected QT interval; AST/ALT: aspartate transaminase/ alanine aminotransferase.

and liberalization in order to improve representativeness and accrual, limit the implicit biases that can occur when criteria are not explicit, and improve patient safety.13 These data are consistent with solid tumor studies that demonstrate the presence of unjustified criteria and their potential impact on demographic inequities in participation.2,3 One such study used the Flatiron real-world database and found that if several enrollment criteria for non-small cell lung cancer immunotherapy trials were removed (e.g., neutrophil counts, CNS metastasis), the eligible population would be doubled and would only decrease the projected Hazard Ratio of overall survival by 0.05.3 A study in pancreatic cancer found that Black patients would have been less likely to participate owing to hepatitis and HIV status.2 The lack of justification for infectious disease exclusions in some of the trials in this analysis suggests this inequity may also be present in acute leukemia.

0.97) (all Brown-Forsythe test P>0.05).

Discussion

In this analysis assessing the use, variability, and justification of acute leukemia clinical trial eligibility criteria, there was a substantial discordance between criteria and drug safety data. The use or absence of many criteria were related to anticipated risk, but large proportions were not. There was concordance between infectious disease criteria and risk, but this was not the case for organ function criteria, and the imposed criteria limits were similarly restrictive irrespective of anticipated risk. Despite the presumption that additional safety data would become available later in drug development, criteria use in phase III studies was not more concordant. When trial criteria use was concordant with safety data, the imposed criteria limits were generally more restrictive than drug safety data and were variable in their degree of restriction. Among these studies, phase III limits were somewhat more aligned with drug safety data than phase II, but their limits were no less variable. Together, these data identify specific criteria that sponsors and investigators should assess for inclusion, removal,

To our knowledge, prior studies regarding acute leukemia enrollment criteria are aligned but distinct and do not address the question of use, variability, or justification across phase II and III studies. A trial published in 2017 enrolled patients with comorbid conditions, organ dysfunction, and poor performance status to show that a trial of low-intensity therapy was possible in this traditionally ineligible population.14 This is important in that it shows trials, rather than just post-approval real-world analyses, are possible for most patient populations. At the same time, it did not assess heterogeneity in trial criteria and when criteria are justified or unjustified. A separate study from the FDA analyzed disparities in ineligibility of screened patients on 13 trials from 2016 to 2019 (N=3192), finding that 27% were ineligible. These data also showed that Black and Hispanic patients with AML were less likely to meet study eligibility requirements due to cardiac function and/or a lack of specific mutations.15 Notably, there was significant selection bias as the analysis was restricted to those who consented to participate, meaning that data on those who were known to be ineligible, and thus not approached, were not included.

The present study adds significantly to this literature because it not only assesses criteria use but their variability and justification in drug safety. We found that there was wide variability within criteria with associated measures. Some criteria such as time since prior cancer diagnosis have limited justification, and others like bilirubin limits were not present despite known drug-related hepatotoxicity. We also saw that if a criterion was used, it was generally more restrictive than suggested by drug safety data. Criteria used were also similarly restrictive independent of if there were known drug-related risks. Taken together, these data identify criteria that should be specified and others that can be liberalized to promote a rational approach to maximizing the eligible pool of patients without compromising safety.

The systematic approach used to catalog study drug safety

Haematologica | 109 April 2024 1050 ARTICLE - Eligibility criteria in acute leukemia trials A. Hantel et al.
Figure 3. Differences between renal and hepatic function limits from eligibility criteria and based on drug safety. Each box plot shows the difference between the trial’s eligibility criteria and the most conservative drug safety profile limit. ULN: upper limit of normal; AST/ALT: aspartate transaminase/alanine aminotransferase.

profiles relative to enrollment criteria also minimizes the bias of prior studies, which did not account for the more limited knowledge of drug safety known during investigational drug development. Though much of the previously published literature focuses on criteria expansion, our study also identifies areas where known safety signals exist, but explicit criteria are missing. This can put enrollees at unnecessary risk, limit the identification of efficacious drugs, and may increase enrollment bias by leaving related eligibility decisions to individual investigators.

Applying these points to a study included in the analysis, we can see how trial eligibility may be modified in practice. This study tested the combination of nivolumab, cytarabine, and idarubicin in AML, and used exclusion criteria based on hepatic and renal lab values. The labels for the antineoplastic therapies used collectively identify hepatic and renal toxicity (among other side effects), justifying the trial’s use of exclusion criteria related to liver and kidney function. The study’s hepatic and renal criteria limits were bilirubin ≤1.5, AST/ALT ≤2.5, and creatinine ≤1.3 times the ULN, and the conservative limits from drug labels were ≤2, ≤3, ≤2.2 times the ULN, respectively. In this case, expansion of renal and hepatic criteria by 0.5, 0.5, and 1.1 times the ULN could be justified and potentially increase the eligible population while maintaining safety. A similar process, applied systematically across new trials, would align eligibility with drug safety, expanding criteria limits in some trials, contracting limits in others, and making criteria explicit instead of inexact in the rest.

Limitations of this study include the potential for bias due to safety data that were unpublished at the time of study start, which we attempted to minimize through multi-modal searches and use of trial protocols. This mirrors the investigational drug safety data and eligibility requirements that enrolling physicians use during recruitment. While we focused on drug-safety profiles from individual drugs, we could not capture safety justifications based on emerging issues related to the overall intensity of a regimen, where general eligibility restrictions for organ dysfunction or comorbidities may be used. Nonetheless, there were a number of criteria not included where safety signal(s) were identified which would not have been ameliorated. The generalizability of the analysis is limited to clinical trials conducted under FDA regulation, which was done to assess changes in criteria that could be made under a single regulatory standard. Cellular therapy trials were also excluded as the population eligible for cellular therapy treatment, even outside the research context, is much more restricted than the broader acute leukemia population. Other limitations include biases due to the necessary aggregation of unstructured data into analytic variables, which limited our ability to capture vague or inexact criteria, and required us to assume a uniform normal range of laboratory values, and the moderate sample size, which was limited by the availability of trials.

In summary, a substantial proportion of acute leukemia clinical trial enrollment criteria do not appear justified by drug safety. Both the FDA and the American Society of Clinical Oncology have recognized this issue and adopted positions requiring justification of criteria;16-18 these data identify where potentially unjustified criteria and limits exist for acute leukemia and a rational approach to meeting this goal while ensuring patient wellbeing. Judicious minimization of criteria based on drug safety profiles and standardization are key to enhancing research representativeness, efficacy, and safety.

Disclosures

AH has received personal fees (advisory boards) from AstraZeneca and AbbVie. MRL reports receiving personal fees (advisory boards) from Novartis and AbbVie. AAP has received institutional research funding from Kronos Bio, Pfizer, and Sumitumo, and personal fees from AbbVie (educational curriculum development) and Bristol Myers Squibb (advisory board). DJDeA has received research funding from Abbvie, Novartis, Blueprint, and Glycomimetrics, and personal fees from Amgen, Autolus, Blueprint, Gilead, Incyte, Jazz, Kite, Novartis, Pfizer, Servier, and Takeda (consulting). GAA has received personal fees (consulting) from Novartis. The other authors have no conflict of interests to disclose.

Contributions

AH, CSL, GAA, IK and AAP are responsible for the study concept. AH, EQ, TPW and GAA designed the methodology. AH, EW and TPW collected the data. AH, EW, TPW and GAA analyzed the data. AH, EW, TPW and GAA wrote the manuscript. MRL, IK, AAP, DJDeA, CSL and GAA critically reviewed the manuscript. All authors revised the manuscript for publication.

Acknowledgments

The authors would like to acknowledge the work of Dillon Clancy in assisting with data collection and preparing the figures.

Funding

AH is supported by grants from the National Cancer Institute of the National Institutes of Health (K08 CA273043), the American Society of Clinical Oncology (Career Development Award), the Alliance in Clinical Trials for Oncology (Special Projects Fund), and the Rieder Family Fellowship in Acute Lymphoblastic Lymphoma. IK is supported by a grant from the American Cancer Society (CSDG-21-088-01-ET). The sponsors had no role in gathering, analyzing, or interpreting the data. The content of this publication does not necessarily reflect the views or policies of the Department of Health and Human Services, nor does mention of trade names, commercial products, or organizations imply endorsement by the US government.

Haematologica | 109 April 2024 1051 ARTICLE - Eligibility criteria in acute leukemia trials A. Hantel et al.

Data-sharing statement

The data in this study are publicly available, as outlined in

References

1. Emanuel EJ, Wendler D, Grady C. What makes clinical research ethical? JAMA. 2000;283(20):2701-2711.

2. Riner AN, Girma S, Vudatha V, et al. Eligibility criteria perpetuate disparities in enrollment and participation of black patients in pancreatic cancer clinical trials. J Clin Oncol. 2022;40(20):2193-2202.

3. Liu R, Rizzo S, Whipple S, et al. Evaluating eligibility criteria of oncology trials using real-world data and AI. Nature. 2021;592(7855):629-633.

4 Duggal M, Sacks L, Vasisht KP. Eligibility criteria and clinical trials: an FDA perspective. Contemp Clin Trials. 2021;109:106515.

5. Cancer clinical trial eligibility criteria: available therapy in non-curative settings. 2022. https://www.fda.gov/media/150244/ download Accessed 18 March 2023.

6. Food and Drug Omnibus Reform Act of 2022. Washington (DC): 117th United States Congress; 2022.

7. National Library of Medicine. ClinicalTrials.gov. 2022. https:// clinicaltrials.gov Accessed 6 October 2022.

8. Flick U. The SAGE handbook of qualitative data analysis. Los Angeles (CA): Sage Publications Inc; 2014. xxiii.

9 Arachchige C, Prendergast LA, Staudte RG. Robust analogs to the coefficient of variation. J Appl Stat. 2022;49(2):268-290.

10. Altman DG. Practical statistics for medical research. 3rd ed. Chapman & Hall/CRC; 1999. xii. p. 611.

11. Fleiss JL, Levin B, Paik MC. Statistical methods for rates and proportions. Wiley series in probability and statistics. 3rd ed. J. Wiley; 2003. xxvii. p. 760.

12. Brown MB, Forsythe AB. Robust tests for the equality of

the manuscript. Datasets used in the analysis can be made available on reasonable request to the corresponding author.

variances. J Am Stat Assoc. 1974;69(346):364-367.

13. Barrett NJ, Boehmer L, Schrag J, et al. An assessment of the feasibility and utility of an ACCC-ASCO implicit bias training program to enhance racial and ethnic diversity in cancer clinical trials. JCO Oncol Pract. 2023;19(4):e570-e580.

14 Montalban-Bravo G, Huang X, Naqvi K, et al. A clinical trial for patients with acute myeloid leukemia or myelodysplastic syndromes not eligible for standard clinical trials. Leukemia. 2017;31(2):318-324.

15. Pulte D, Fernandes L, Wei G, et al. FDA analysis of ineligibility for acute myeloid leukemia clinical trials by race and ethnicity. Clin Lymphoma Myeloma Leuk. 2023;23(6):463-470.

16. Food and Drug Administration Oncology Center of Excellence: Center for Drug Evaluation and Research and Center for Biologics Evaluation and Research. Cancer clinical trial eligibility criteria: patients with organ dysfunction or prior or concurrent malignancies; guidance for industry. 2020. https://www.fda.gov/ media/123745/download Accessed 18 March 2023.

17 Food and Drug Administration Oncology Center of Excellence: Center for Drug Evaluation and Research and Center for Biologics Evaluation and Research. Cancer clinical trial eligibility criteria: patients with HIV, hepatitis B virus, or hepatitis C virus infections; guidance for industry. 2020. https://www.fda.gov/ media/121319/download Accessed 18 March 2023.

18. Kim ES, Bruinooge SS, Roberts S, et al. Broadening eligibility criteria to make clinical trials more representative: American Society of Clinical Oncology and Friends of Cancer Research Joint Research Statement. J Clin Oncol. 2017;35(33):3737-3744.

Haematologica | 109 April 2024 1052 ARTICLE - Eligibility criteria in acute leukemia trials A. Hantel et al.
Association of NUDT15 gene polymorphism with adverse reaction, treatment efficacy, and dose of 6-mercaptopurine in patients with acute lymphoblastic leukemia: a systematic

review and meta-analysis

Shan Du,1,2* Xuefei Huang,1,2* Xia He,1,2 Mian Mao,3 Min Chen,1,2 Rong Zhang,4 Huikai Shao,1,2 Ziyan Lv,1,2 Xinxia Liu1,2# and Junlan Chuan1,2#

1Department of Pharmacy, Sichuan Academy of Medical Sciences and Sichuan Provincial People’s Hospital; 2Personalized Drug Therapy Key Laboratory of Sichuan Province, School of Medicine, University of Electronic Science and Technology of China; 3Department of Pharmacy, Sichuan Cancer Hospital and 4Department of Pediatrics, Sichuan Academy of Medical Sciences and Sichuan Provincial People’s Hospital, Chengdu, China

*SD and XFH contributed equally as first authors.

#XXL and JLC contributed equally as senior authors.

Abstract

Correspondence: J. Chuan chuanjunlan@foxmail.com

X. Liu cupflysea@163.com

Received: January 18, 2023.

Accepted: September 26, 2023. Early view: October 5, 2023.

https://doi.org/10.3324/haematol.2023.282761

©2024 Ferrata Storti Foundation

Published under a CC BY-NC license

6-mercaptopurine (6-MP) serves as the backbone in the maintenance regimens of acute lymphoblastic leukemia (ALL). We aimed to evaluate the influence of NUDT15 gene polymorphism on the risk of myelosupression, hepatotoxicity and interruption of 6-MP, as well as treatment efficacy and dose of 6-MP in ALL patients. A total of 24 studies with 3,374 patients were included in this meta-analysis. We found 9-fold higher risk of 6-MP induced leukopenia (odds ratio [OR] =9.00, 95% confidence interval [CI]: 3.73-21.74) and 2.5-fold higher risk of 6-MP-induced neutropenia (OR=2.52, 95% CI: 1.72-3.69) for NUDT15 c.415C>T variant carriers in the dominant model. Moreover, we found that the dose intensity of 6-MP in ALL patients with one NUDT15 c.415C>T variant alleles (CT) was 19% less than that in wild-type patients (CC) (mean differences: 19.43%, 95% CI: -25.36 to -13.51). The tolerable dose intensity of 6-MP in NUDT15 c.415C>T homozygote variant (TT) and heterozygote variant (CT) carriers was 49% and 15% less than that in wild-type patients, respectively. The NUDT15 c.415C>T variant group (CT+TT) had seven times (OR=6.98, 95% CI: 2.83-17.22) higher risk of developing 6-MP intolerance than the CC group. However, NUDT15 c.415C>T polymorphism did not appear significantly associated with hepatotoxicity, treatment interruption or relapse incidence. We concluded that NUDT15 c.415C>T was a good predictor for 6-MP-induced myelosuppression in ALL patients. The dose intensity of 6-MP in ALL patients with NUDT15 c.415C>T variants was significantly lower than that in wild-type patients. This research provided a basis for further investigation into relations between NUDT15 gene and adverse reaction, treatment efficacy and dose intensity of 6-MP.

Introduction

Acute lymphoblastic leukemia (ALL) is a malignant and heterogeneous condition in which uncontrolled proliferation of lymphoblasts (of B- or T-cell origin) occurs in the bone marrow, peripheral blood, and/or other organs. It affects both children and adults.1,2 The overall survival (OS) of ALL has improved tremendously over the past few decades, and the 5-year OS exceeds 90% in children who receive contemporary therapy.3,4 The thio-substituted purine analogue 6-mercaptopurine (6-MP), which can inhibit ALL cell

DNA synthesis along with weekly methotrexate (MTX), is the backbone in the maintenance regimens of ALL.5,6 However, due to the narrow therapeutic index, 6-MP can bring about dose-dependent toxicities such as myelosuppression and hepatotoxicity in ALL patient. These adverse effects can result in 6-MP dose reduction or therapy interruption, and even increase the risk of life-threatening infections and relapse.7,8

It was reported that 6-MP can be converted into active metabolites 6-thioguanine nucleotides (6-TGN) via a series of enzymes. 6-TGN consist of 6-thio(d)-GMP, 6-thio(d)-GDP,

Haematologica | 109 April 2024 1053 - Acute Lymphoblastic Leukemia ARTICLE

and 6-thio(d)-GTP. 6-thio(d)-GTP are incorporated into DNA and RNA, which can cause inhibition of nucleotide and protein synthesis and lead to cytotoxicity typified by leukopenia.9-11 Meanwhile, 6-MP and its metabolites can be methylated into inactive 6-methyl mercaptopurine (6MMP) by thiopurine methyltransferase (TPMT). Therefore, TPMT activity is negatively related to 6-TGN content. Furthermore, TPMT deficiency caused by genetic variants is likely to increase the level of 6-TGN and therefore result in myelosuppression.12-14 Given the formerly observed association between TPMT polymorphisms and thiopurines-induced leukopenia, US Food and Drug Administration has suggested preemptive TPMT testing for individualizing thiopurines dose and reducing the risk of drug-related adverse events.15,16 However, compared with their Caucasians (10%) counterparts, Asians (3%) have lower frequency of TPMT variants and are more likely to be subject to 6-MP-induced leukopenia, dose intolerance, and dose reduction.17 It was observed that hematotoxicity occurred in some patients with wild-type TPMT, which indicates that some other genetic variants are probably associated with 6-MP tolerance and related adverse reactions.17-19 Recently, a series of studies reported that genotype of nucleoside diphosphate-linked moiety X-type motif 15 (NUDT15), particularly NUDT15 c.415C>T (rs116855232), had a strong association with 6-MP-induced myelosuppression and 6-MP intolerance in ALL.20-22 Indeed, NUDT15 is hypothesized to dephosphorylate the 6-MP active metabolites 6-thio(d)-GTP to 6-thio(d)-GDP, which can prevent their incorporation into DNA and decrease the 6-MP cytotoxicity.23 In other words, NUDT15 variants are supposed to result in excessive levels of 6-thio(d)-GTP and increase host toxicity. Although the association between NUDT15 c.415C>T variants and 6-MP-induced myelotoxicity is widely recognized, the pooled increased risk, by involving more newly published research, of myelosuppression in ALL patients with NUDT15 c.415C>T variants has not been reported.24-27 Moreover, the correlation between NUDT15 polymorphism and risk for hepatotoxicity, treatment interruption, dose intensity of 6-MP or relapse of ALL were not evaluated in previous meta-analysis.28-31 In order to fill this gap, we conducted a systematic review and meta-analysis aiming to assess the association between NUDT15 gene polymorphism and adverse reaction, treatment efficacy and dose of 6-MP particularly in patients with ALL.

Methods

Search strategy and selection criteria

This systematic review was conducted according to the Preferred Reporting Items for Systematic Reviews and Meta-analyses (PRISMA) Statement principles.32 The protocol for this systematic review was registered on PROSPERO (registration number: CRD42022384698). PubMed, Web

of Science, Embase, Cochrane Library, CNKI, China Biology Medicine, Wanfang and VIP databases were searched from their inception up to November 25, 2022 using the following key terms: (NUDT15 OR MTH2 protein OR Nudix Hydrolase 15 OR nucleoside diphosphate-linked moiety X-type motif 15) AND (leukaemia OR leukemia). Eligible studies were included if they met the following inclusion criteria: i) investigating the association between at least one NUDT15 gene polymorphism and adverse reactions (e.g., leukopenia, neutropenia, hepatotoxicity, treatment interruption), treatment efficacy of 6-MP or 6-MP dose (e.g., dose intensity, intolerant incidence, tolerable dose et al.); ii) patients are limited to those diagnosed with acute lymphoblastic leukemia; iii) the study type is a cohort study or case control; iv) literature language is English or Chinese. Exclusion criteria were as follows: i) review articles, editorials and comments; ii) duplicated studies; iii) case reports; iv) not an outcome of interest or not available. Two reviewers (SD, XFH) independently undertook the study selection according to prespecified inclusion and exclusion criteria, and any disagreement was resolved by discussion or by consulting a third author.

Data extraction

For each study included, two reviewers independently extracted and collected general information and outcome data in a standardized data extraction form. General information contained the first author’s name, year of publication, ethnicity, study design, age, female/male, total sample size, 6-MP initial dose, phase of treatment, the outcome of study, SNP, the genotyping method, timing of follow-up and Hardy-Weinberg equilibrium. Outcome data included any available information about leukopenia, neutropenia, hepatotoxicity, relapse, treatment interruption, dose intensity, intolerant incidence, as well as tolerable dose. In addition, we e-mailed the corresponding author for detailed information when data from a study was unextractable and any discrepancies were resolved by consensus.

Quality assessment

Two researchers independently assessed the quality of eligible studies based on the Newcastle-Ottawa Scale (NOS). The NOS contains eight items, categorized in three domains: selection, comparability, and outcome (cohort studies) or exposure (case-control studies). The quality score of each study was rated from zero to nine.33

Statistical analysis

All outcomes were pooled using Review Manager (RevMan) version 5.4. We calculated odds ratios (OR) and their 95% confidence intervals (CI) to evaluate the association of NUDT15 gene polymorphism and with the occurrence of 6-MP-induced adverse drug reactions, which include leukopenia, neutropenia, hepatotoxicity, treatment interruption along with relapse and intolerant incidence. Meanwhile,

Haematologica | 109 April 2024 1054 ARTICLE - NUDT15 affects 6-MP treatment results in ALL S. Du et al.

we also analyzed mean differences (MD) and their 95% CI which presented potential influence of NUDT15 gene polymorphism on 6-MP dose intensity and tolerable dose. Heterogeneity between studies was estimated by the χ2 test and the I2 statistic. If I2 <50%, the fixed-effects model with the Mantel-Haenszel method was employed; otherwise, the random-effects model was adopted. It is noteworthy that sensitivity analysis by sequentially excluding each study and subgroup analysis were conducted according to specific circumstances.

Results

Retrieved results

Nine hundred and seven articles were retrieved among which 530 duplicates were removed. Through reading the titles and abstracts, 256 irrelevant studies were excluded, so a total of 121 studies qualified for full text screening. After screening, we further dropped eight reviews or comments, two editorial or letters, 36 conference abstracts, two studies written in neither English nor Chinese, three other gene or other disease studies, four potential duplicates, 19 without extractable data, as well as 23 without outcome of interest. So, 24 studies were finally included. The process of literature retrieval and study screening process are illustrated in Figure 1.

Study characteristics and quality assessment

Table 1 summarizes the characteristics of the included studies. They were published between 2015 and 2022. Ten of them came from China (including Hongkong and Taiwan),25,26,34-41 three from Japan,42-44 three from Korea,45-47 three from Thailand,48-50 two from India,27,51 one from Colombia,24 Lebanon,52 and Kurdistan52 respectively, as well as one multiracial study.21 Their sample size ranged from 51 to 404. One of them was case control study37 and 23 were cohort studies. The NOS score ranged from 6 to 8.

Association between NUDT15 gene polymorphism and adverse reactions of 6-MP

Association between NUDT15 c.415C>T or NUDT15 c.52G>A polymorphism and 6-MP induced leukopenia

In total, eight studies were included to compare the occurrence of leukopenia between 256 NUDT15 c.415C>T variant (CT+TT) carriers and 820 wild-type patients (CC).26,34,35,37,40,41,44,45 Five studies used white blood cell count (WBC) <2×103/µL as the definition of leukopenia,26,35,37,40,44 Choi et al 45 defined WBC <1.5×103/µL as leukopenia and the other two studies did not define it (Online Supplementary Table S1).34,41 The result demonstrated that the CT+TT group had a nine times higher risk of leukopenia incidence than the CC group (OR=9.00, 95% CI: 3.73-21.74; P<0.00001) (Figure 2A). Sensitivity analysis with sequential omission of each study suggested that this effect was stable. The

Haematologica | 109 April 2024 1055 ARTICLE - NUDT15 affects 6-MP treatment results in ALL S. Du et al.
Figure 1. Flow chart to depict the process of study screening and selection.

Continued on following page.

Haematologica | 109 April 2024 1056 ARTICLE - NUDT15 affects 6-MP treatment results in ALL S. Du et al. Study Ethnicity Age in years* Sample size N (F/M) 6-MP initial dose (mg/m2/d) Outcome of study NUDT15 variant Genotyping method Follow-up time (range) HWE NOS score Buaboonnam 201948 Thai 5.2 (1.12-14.78) 102 (44/58) maint (50) neutr c.415C>T ASPCR 50.4 (12.3-84.0) months NA 8 Cao 202034 Chinese leuk+: 4.8±3.02; leuk-: 4.55±3.18† 173 (85/88) RI (60), cons (25), maint (50) leuk c.415> T Microarray NA YES 8 Chiengthong 201649 Thai 5.4 (1-15) 82 (NA) maint (50) neutr rel c.415C>T Pyrosequencing 8 (1-20) years YES 7 Choi 201945 Korean 5.1 (3.7-10.6) 139 (75/64) maint (50) leuk neutr TI c.415C>T Sanger sequencing 8 (1-20) years YES 7 CorreaJimenez 202124 Colombians 6 (NA) 70 (35/35) maint (50) neutr TI rel c.415C>T TaqMan SNP genotyping 6 months YES 7 Fan 202225 Chinese 6.2 (NA) 145 (64/81) maint (50) HT c.415C>T; c.52G>A Sanger sequencing *3 6 months NA 7 Khaeso 202250 Thai 5 (1-15) 169 (79/90) maint (50) neutr *2 *3, *5: TaqMan SNP genotyping; the rest: Sanger sequencing 6 months YES 8 Khera 201951 Indian Risk SNP+: 5.81 (4.0-7.63) Risk SNP-: 5.24 (4.4-6.07) 58 (48/10) maint (60) neutr c.415C>T Sanger sequencing 36 weeks YES 7 Kim 201846 Korean 4.9 (1.1-17.3) 185 (75/110) maint (50) neutr c.415C>T Fluidigm SNP genotyping 74.2 (26.6-235.7) months NA 8 Lee 202147 Korean 8.3 (1.0-16.2) 83 (27/56) maint (75) DI TD c.415C>T Sanger sequencing 9.1 (0.9-16.6) years NA 7 Li 202135 Chinese 6.3±3.5 94 (46/48) maint (50) leuk neutr c.415C>T FISH 1-18 months YES 7 Liang 201636 Chinese CC 4.6 (0.1-18) CT 5.0 (0.4-17.2) TT 4.5 (1.1-7.9) 404 (180/224) maint (60) rel TD c.415C>T Pyrosequencing 240 months NA 7 Liu 201837 Chinese 6.3 (0.67-13.4) 133 (57/76) cons (50) maint (75) leuk c.415C>T PCR-RFLP NA NA 6 Mao 202126 Chinese 5.9 (0.63-13.75) 149 (64/85) maint (50) leuk HT TD c.415C>T FISH 18 (8-47) months YES 7
Table 1. Characteristics of included studies.

Study Ethnicity Age in years* Sample size N (F/M)

6-MP initial dose (mg/m2/d) Outcome of study NUDT15 variant Genotyping method Follow-up time (range) HWE NOS score

Moradveisi 201952

Lebanese Kurdistani Lebanese (6.63±4.93); Kurdistani (6.25±3.07)

Pai 202127 Indian

cohort 1: 16.5 (2-56) cohort 2: 17 (1-63)

Lebanese: 136 (59/77); Kurdistani: 74 (31/43) maint (75) HT c.415C>T TaqMan SNP genotyping F:120 weeks M:143 weeks YES 8

cohort 1: 42 (7/35) cohort 2: 133 (45/88) maint

*Age in years was described as median (range) or mean ± standard deviation (SD) or range according to the original study. †Age at diagnosis. #Study Tanaka 2018 involved all of the patients in study Tanaka 2015 with 3 more patients, and both were included for they had different outcomes. Furthermore, as for the same outcomes from 2 studies, we only used the data with larger patient size in Tanaka 2018. 6-MP: 6-mercaptopurine; ASPCR: allele-specific polymerase chain reaction; cons: consolidation; DI: dose intensity; F: female; FISH: fluorescence in situ hybridization; d: day; HT: hepatotoxicity; HWE: Hardy–Weinberg equilibrium; init: initiation; int inc: intolerant incidence; leuk: leukopenia; M: male; maint: maintenance; NA: not available; neutr: neutropenia; NOS: Newcastle–Ottawa Scale; PCR: polymerase chain reaction; rel: relapse; RI: remission induction; TD: tolerable dose; TI: treatment interruption; SNP: single nucleotide polymorphism; CC: wild-type patients; CT: heterozygote variant carriers; TT: homozygote variant carriers.

study of Cao 202034 and Zhu 2018 41 contributed the biggest heterogeneity, probably due to involving the remission induction phase of treatment with the highest dose of 6-MP (60 mg/m/2/d) among all the studies. The subgroup analysis using the same standard of leukopenia suggested that the CT+TT group developed a 3.9 times higher risk of leukopenia than the CC group (OR=3.89, 95% CI: 2.62-5.76; P<0.00001)

with I2 decreased from 83% to 0% (Figure 2B). Moreover, 927 patients in seven studies were included to evaluate the association of NUDT15 c.415C>T gene polymorphism with leukopenia incidence in the recessive model (TT vs CT+CC) 34,35,37,40,41,44,45 and the TT group had a significantly 15.9 times higher risk of leukopenia incidence than the CT+CC group (OR= 15.88, 95% CI: 5.80-43.48; P<0.00001) (Figure

Haematologica | 109 April 2024 1057 ARTICLE - NUDT15 affects 6-MP treatment results in ALL S. Du et al.
(50) neutr TI int inc c.415C>T Sanger sequencing 18 (6-38) months NA 8 Suzuki 201642 Japanese 5.1 (1.6-15.8) 51 (28/23) maint (40) rel c.415C>T TaqMan SNP genotyping 8.3 (1.7-17.1) years YES 8 Tanaka 201543 Japanese CC 5 (1-17) CT 5 (1-17) TT 8 (3-15) 92 (45/47) maint (40) leuk HT TI rel c.415C>T TaqMan SNP genotyping 3.6 (0.4-15.5) years NA 8 Tanaka 201844# Japanese 4.9 (1-17) 95 (48/47) maint (40) leuk HT int inc c.415C>T; c.52G>A TaqMan SNP genotyping 3.6 (0.4-15.5) years c.415C>T NO; c.52G>A. YES 8 Wang 202139 Chinese 0.42 (6-16) 135 (59/76) Init (50) HT c.415C>T Sanger sequencing NA NA 7 Wang 202238 Chinese 6.2±0.5 58 (22/36) maint (50) neutr c.415C>T Sanger sequencing NA NA 6 Yang 201521 white, black, Hispanic, Asian NA 371 (NA) maint (75) DI c.415C>T Illumina Human Exome BeadChip 6 months YES 8 Zhou 201840 Chinese 5.8 (1.1-14.0) 105 (39/66) maint (50) leuk HT TI c.415C>T MassArray platform 6 months YES 8
201841 Chinese 1-15 188 (79/109) RI (60), cons
maint (50) leuk HT c.415C>T; c.52G>A NA NA NA 8
Zhu
(25),
Haematologica | 109 April 2024 1058 ARTICLE - NUDT15 affects 6-MP treatment results in ALL S. Du et al.
A B C D E
Figure 2. Forest plots for the meta-analysis of association of NUDT15 c.415C>T (rs116855232) (A-D) or c.52G>A (rs186364861) (E) with 6-MP induced leukopenia. (A) The dominant model (CT+TT vs. CC); (B) subgroup analysis in the dominant model; (C) the recessive model (TT vs. CT+CC); (D) subgroup analysis in the recessive model; (E) the dominant model (GA+AA vs. GG). CI: confidence interval.

2C). In the subgroup analysis using the same standard of leukopenia, the TT group had a 8.5 times higher risk of leukopenia incidence than the CT+CC group (OR=8.50, 95% CI: 2.38-30.32; P=0.0010) (Figure 2D).

Other than the correlation of NUDT15 c.415C>T polymorphism with leukopenia being well investigated, some studies also focused on the association of NUDT15 c.52G>A polymorphism with leukopenia in ALL patients. Two studies with 283 ALL patients in total were included to compare the events of leukopenia in NUDT15 c.52G>A variant group (GA+AA) with the wild-type group (GG).41,44 The difference between the two groups in the incidence of leukopenia was not statistically significant (OR=3.60, 95% CI: 0.79-16.38; P=0.10) (Figure 2E).

Association between NUDT15 c.415C>T polymorphism and 6-MP-induced neutropenia

We compared the events of neutropenia in NUDT15 c.415C>T variant group and wild-type group based on ten studies comprising 1,082 patients with ALL.24,27,35,38,45,46,48-51 Correa-Jimenez et al.24 did not describe the definition of neutropenia, while three studies defined neutropenia as absolute neutrophil count (ANC) <1,500/µL, ANC <1,000/µL, and ANC <750/µL,27,35,51 respectively, and the remaining six studies shared the same standard of neutropenia as ANC <500/µL (Online Supplementary Table S1).38,45,46,48-50 The variant group (CT+TT) was proven to be significantly associated with a 2.5-fold higher risk of neutropenia in comparison to the wild-type group (OR=2.52, 95% CI: 1.72-3.69; P<0.00001) (Figure 3A). The subgroup analysis that defined ANC <500/ µL as neutropenia showed that the CT+TT group had a 2.3 times higher risk of neutropenia incidence than the CC group (OR=2.28, 95% CI: 1.42-3.67; P=0.0007) (Figure 3B). In addition, five studies with 552 patients were included to investigate the role of NUDT15 c.415C>T gene polymorphism on the risk of neutropenia in the recessive model.35,38,45,46,49 No significant difference between the two groups was found (OR=2.93, 95% CI: 0.92-9.37; P=0.07) (Figure 3C). However, the sensitivity analysis suggested that after excluding Li et al. 2021,35 the homozygote variant of NUDT15 c.415C>T (TT group) had a significantly 4.8 times higher risk of neutropenia incidence compared with the CT+CC group (OR=4.84, 95% CI: 1.21-19.35; P=0.03) (Figure 3D). A potential explanation was that only one patient with TT was in Li’s analysis,35 who did not even develop neutropenia at all, so the sample was too small to be representative.

Association between NUDT15 c.415C>T or NUDT15 c.52G>A polymorphism and 6-MP-induced hepatotoxicity

A total of 1,012 patients from seven studies were included for comparing the incidence of hepatotoxicity in NUDT15 c.415C>T variant group with the wild-type group.25,26,39-41,44,52

Two of the studies shared the same standard of hepatotoxicity as alanine aminotransferase (ALT) or aspartate aminotransferase (AST) >5-fold of normal.26,41 Three studies

defined hepatotoxicity as ALT >500 U/L, ALT >700 U/L, and ALT or AST >500 U/L, respectively.25,40,44 The remaining two defined hepatotoxicity as the highest direct bilirubin values ≥1.5 mg/dL, and as either ALT, AST, alkaline phosphatase or total bilirubin above 2-fold upper limit of normal, respectively.39,52 All above-mentioned information are listed in Online Supplementary Table S1. The results revealed that NUDT15 c.415C>T variants did not increase the incidence of hepatotoxicity (OR=1.27, 95% CI: 0.84-1.91; P=0.26) and the sensitivity analysis verified the stability of the results (Figure 4A). In addition, subgroup analysis of the two studies which defined ALT or AST >5-fold of normal as hepatotoxicity, did not show that the NUDT15 c.415C>T variant group had an increased incidence of hepatotoxicity compared to the wild-type group (OR=1.06, 95% CI: 0.56-2.00; P=0.85) (Figure 4B). Moreover, no significant difference in the incidence of hepatotoxicity (OR=2.43, 95% CI: 0.95-6.20; P=0.06) (Figure 4C) was observed in the recessive model either.25,39-41,44 Three studies comprising 426 ALL patients were included to compare the events of hepatotoxicity in NUDT15 c.52 G>A variant carriers (GA+AA) versus wild-type patients (GG) and the result indicated that there was no significant difference in hepatotoxicity incidence in either (OR=1.09, 95% CI: 0.22-5.31; P=0.91) (Figure 4D).25,41,44

Association between NUDT15 c.415C>T polymorphism and 6-MP treatment interruption

Five studies with 537 ALL patients were included to compare the events of treatment interruption in the NUDT15 c.415C>T variant group (CT+TT) and the wild-type group (CC).24,27,40,43,45 The definition of treatment interruption of these included studies is listed in Online Supplementary Table S1. Specifically, treatment interruption was defined as the cessation of medicine administration caused by adverse events such as cytopenia, infections or hepatotoxicity. The result suggested that there was no significant difference in the incidence of treatment interruption between two groups (OR=1.36, 95% CI: 0.41-4.46; P=0.62) (Figure 5A). However, the sensitivity analysis did not support the result - with one study excluded,40 the NUDT15 c.415C>T variant carriers developed a 2.5-fold higher risk of treatment interruption than wild-type patients (OR=2.51, 95% CI: 1.23-5.15; P=0.01) (Online Supplementary Figure S1). Considering that patients with high-risk ALL were excluded in this study, and it defined interruption as the cessation of 6-MP resulting from infections or hepatotoxicity, this study had a lower interruption incidence than other studies. This might be a reason for its unstable results. Although there is a difference in the initial dose of 6-MP in these studies, the subgroup analysis of the four studies with the same initial dose still did not confirm a significant difference in the treatment interruption incidence between NUDT15 c.415C>T variant group and the wild-type group (OR=1.48, 95% CI: 0.23-9.32; P=0.68) (Online Supplementary Figure S2). Nor did a significant difference exist between the

Haematologica | 109 April 2024 1059 ARTICLE - NUDT15 affects 6-MP treatment results in ALL S. Du et al.

association of NUDT15 c.415C>T polymorphism with occurrence of treatment interruption in the recessive model (OR=1.47, 95% CI: 0.39-5.52; P=0.57) (Figure 5B),40,43,45 which was supported by sensitivity analysis.

Association between NUDT15 gene polymorphism and efficacy of 6-MP

In addition to the above-listed adverse events, we were also concerned about whether the efficacy of 6-MP was

Haematologica | 109 April 2024 1060 ARTICLE - NUDT15 affects 6-MP treatment results in ALL S. Du et al.
A B C D
Figure 3. Forest plots for the meta-analysis of association of NUDT15 c.415C>T (rs116855232) with 6-mercaptopurine-induced neutropenia. (A) The dominant model (CT+TT vs. CC); (B) subgroup analysis in the dominant model; (C) the recessive model (TT vs. CT+CC); (D) subgroup analysis in the recessive model. CI: confidence interval.

influenced by NUDT15 gene polymorphism. The reported outcomes related to 6-MP’s efficacy included event-free survival (EFS), overall survival (OS), relapse, and death. However, due to the limited studies and unavailable data, we could not evaluate EFS or OS using quantitative meta-analysis. Therefore our meta-analysis was limited to relapse of ALL patients after treatment with 6-MP as an efficacy outcome.

We did not find a pre-existing meta-analysis about the

influence of gene polymorphism on the relapse of ALL patients after treatment with 6-MP. In order to fill this gap, in our research, 603 patients in five studies were involved to compare the events of relapse in NUDT15 c.415C>T variant carriers with wild-type patients.24,36,42,43,49 No significant difference was found in the relapse incidence between two groups (OR=1.20, 95% CI: 0.63-2.27; P =0.58) (Figure 6A), and the sensitivity analysis supported this finding. In addition, two studies with 402 patients

Haematologica | 109 April 2024 1061 ARTICLE - NUDT15 affects 6-MP treatment results in ALL S. Du et al.
A B C D
Figure 4. Forest plots for the meta-analysis of association of NUDT15 c.415C>T (rs116855232) (A-C) or NUDT15 c.52G>A (rs186364861) (D) with 6-mercaptopurine-induced hepatotoxicity. (A) The dominant model (CT+TT vs. CC); (B) subgroup analysis in the dominant model; (C) the recessive model (TT vs. CT+CC); (D) the dominant model (GA+AA vs. GG). CI: confidence interval.

were available for comparing the incidence of relapse in NUDT15 c.415C>T recessive model, and similarly, no significant difference was observed (OR=2.29, 95% CI: 0.44-11.84; P =0.32) (Figure 6B). 36,43

Association between NUDT15 c.415C>T polymorphism and dose of 6-MP

The variants in NUDT15 that can influence 6-MP tolerance in ALL patients have been identified. Nevertheless, there

Haematologica | 109 April 2024 1062 ARTICLE - NUDT15 affects 6-MP treatment results in ALL S. Du et al.
A B
Figure 5. Forest plots for the meta-analysis of association of NUDT15 c.415C>T (rs116855232) with 6-mercaptopurine treatment interruption. (A) The dominant model (CT+TT vs. CC); (B) the recessive model (TT vs. CT+CC). CI: confidence interval.
A B
Figure 6. Forest plots for the meta-analysis of association of NUDT15 c.415C>T (rs116855232) with relapse of patients after treatment with 6-mercaptopurine. (A) The dominant model (CT+TT vs. CC); (B) the recessive model (TT vs. CT+CC). CI: confidence interval.

has been no meta-analysis concerning the influence of gene polymorphism on the dosing of 6-MP in ALL. We did a quantitative analysis of the outcome regarding dosing of 6-MP (e.g., dose intensity, tolerable dose) in ALL to make a recommendation for the individualized therapy of 6-MP in ALL in the future.

Dose intensity and intolerant incidence of 6-MP

Dose intensity refers to the ratio of the actual prescribed 6-MP dose by physician to the protocol dose, for the dose of 6-MP would be adjusted because of adverse events or not achieving the target. We assessed potential effects of gene polymorphism on the dose adjustment of 6-MP in ALL. Two articles with 1,109 patients qualified for a meta-analysis about the association between NUDT15 c.415C>T gene polymorphism and dose intensity of 6-MP in ALL,21,47 and one provided two groups of data (1 represents AALL03N1 cohort, another 1 represents St Jude cohorts).21 The dose intensity of 6-MP in ALL patients with one NUDT15 c.415C>T variant

alleles (CT) was 19% less than wild-type patients (CC) (MD: 19.43%, 95% CI: -25.36 to -13.51; P<0.00001) (Figure 7A). Only one study included the dose intensity of patients with two NUDT15 c.415C>T variant alleles (TT) (8.3±7%, N=2),21 so a quantitative meta-analysis of the model (TT vs. CC) was not feasible. Additionally, given that some studies defined 6-MP intolerance as dose intensity <50%, two studies were utilized to compare the risk of 6-MP intolerance between NUDT15 c.415C>T variant carriers and wild-type patients.27,44 We found that the NUDT15 c.415C>T variant group (CT+TT) had a seven-times higher risk of developing 6-MP intolerance compared with the wild-type group (CC) (OR=6.98, 95% CI: 2.83-17.22; P<0.0001) (Figure 7B).

Tolerable dose of 6-MP

Two studies were included in the meta-analysis to compare the tolerable dose of 6-MP in 112 NUDT15 c.415C>T variant carriers (5 homozygotes and 107 heterozygotes) with 347 wild-type patients.26,36 The initial dose of 6-MP in these

Haematologica | 109 April 2024 1063 ARTICLE - NUDT15 affects 6-MP treatment results in ALL S. Du et al.
A B C D E
Figure 7. Forest plots for the meta-analysis of association of NUDT15 c.415C>T (rs116855232) with dose intensity (A) or intolerant incidence of 6-mercaptopurine (B) or tolerable dose intensity (C-E). (A) CT versus CC; (B) CT+TT versus CC; (C) CT versus CC; (D) TT versus CC; (E) TT versus CT. CI: confidence interval.

two studies were 50 mg/m2/d and 60 mg/m2/d, respectively. We calculated the ratio of tolerable dose by initial dose as tolerable dose intensity for the purpose of avoiding the influence of the variation in initial dose between the two studies on the pooled results. The tolerable dose intensity of 6-MP in the NUDT15 c.415C>T CC, CT and TT group was 80%, 70% and 38% respectively in Mao’s research,26 while in Liang’s,36 the tolerable dose intensity of 6-MP in the NUDT15 c.415C>T CC, CT and TT group was 74%, 51%, 16% respectively. The meta-analysis suggested that the pooled tolerable dose intensity of 6-MP in the CT group was 15% less than that in the CC group (MD: -15.46%, 95% CI: -28.29 to -2.64; P=0.02) (Figure 7C). Furthermore, the tolerable dose intensity of 6-MP in the TT group was 49% less than the CC group (MD: -48.91%, 95% CI: -64.60 to -33.22; P<0.00001) (Figure 7D). Additionally, we found the tolerable dose intensity of 6-MP in the TT group was 33% less than that in the CT group (MD: -33.39%, 95% CI: -40.99 to -25.80; P<0.00001) (Figure 7E).

Discussion

6-MP is a commonly used drug for the treatment of ALL, especially in the maintenance phase.53 As known to us, the typical adverse reactions of thiopurines include myelosuppression, hepatotoxicity, hair loss and pancreatitis et al. 54 Variants in TPMT gene, as the most well-known genetic predictor for myelosuppression of thiopurine, can be responsible for merely 25% of the leukopenia cases.55 NUDT15 was identified through a genome-wide association study (GWAS) as a predictor for thiopurine intolerance in children with ALL21 and patients with IBD.22

Our systematic review suggested that NUDT15 c.415C>T polymorphism had a strong relationship with 6-MP induced leukopenia and neutropenia in ALL patients but not with 6-MP induced hepatotoxicity. No strong correlation between NUDT15 c.52G>A polymorphism and 6-MP induced leukopenia or hepatotoxicity was observed. It was demonstrated that NUDT15 c.415C>T was less likely to be a good predictor for the relapse of ALL patients who were treated with 6-MP. Moreover, it was found that the dose intensity and tolerable dose of 6-MP in ALL patients with NUDT15 c.415C>T variant were greatly reduced.

NUDT15 c.415C>T was demonstrated to be a genetic predictor for thiopurine-induced myelosuppression in a variety of diseases such as IBD,56 ALL,21 rheumatoid arthritis,57 neurological diseases,58 and autoimmune hepatitis,59 which was supported by our study as well in ALL patients through meta-analysis. In our review, NUDT15 c.415C>T variant carriers resulted in a 9-fold and 2.5-fold higher risk for leukopenia and neutropenia, respectively. In addition to NUDT15 c.415C>T, 20 variants of NUDT15 gene such as c.52G>A, c.36_37insGGAGTC et al have been reported so far. However, the correlation between NUDT15*5 and NUDT15*6 with thiopurine-related myelosuppression remain contested.50 Our study suggested that the

difference in the risk for 6-MP-associated leukopenia in NUDT15 c.52G>A variant carriers and wild-type patients was not statistically significant. The influence of NUDT15 c.52G>A gene polymorphism on 6-MP-associated leukopenia was less than NUDT15 c.415C>T in our study. This is consistent with the analysis of IBD patients,60 and substantiates NUDT15*5 being classified as uncertain function alleles in the Clinical Implementation Consortium (CPIC) Guidelines.61 Associations of other variants of the NUDT15 gene with 6-MP-induced hematotoxicity were not evaluated in the meta-analysis due to lack of enough studies (N<2).

Hepatotoxicity is another common adverse reaction which always leads to the reduction or interruption of thiopurine. Different studies have inconsistent findings regarding association of NUDT15 polymorphism with 6-MP-induced hepatotoxicity,25,26,39-41,44,52 and the majority of studies fail to find NUDT15 c.415C>T to be a predictor for hepatotoxicity of 6-MP. Some researchers explain that NUDT15 might not affect 6MMPN (6-methyl mercaptopurine nucleotide), which is known as a metabolite of thiopurine associated with hepatotoxicity.62 Other than NUDT15, TPMT*3C rs1142345,63 COMT rs4680,34 and MTHFR rs1801133 variants et al. 64 are identified as genetic predictors of thiopurine-associated hepatoxicity. Possible varying effect magnitudes of these genes in inducing hepatotoxicity leave room for future’s research. The influence of combinational drug, methotrexate (MTX), which is also hepatoxic, should be considered as a confounding factor as well. Though interruption of 6-MP is supposed to be an indication of incidence of serious adverse reaction, our meta-analysis failed to find a significant relationship between NUDT15 c.415C>T polymorphism and interruption of 6-MP. Nevertheless, the high heterogeneity between included studies and the significant greater risk for therapy interruption in NUDT15 c.415C>T variant carriers after excluding Zhou’s research40 showed that the pooled results are subject to change by adding high quality studies in future. We speculated that the cause of this situation may be exclusion of high-risk ALL individuals and different definition of “interruption” in Zhou’s research. Bhatia et al.65 once demonstrated that 6-MP non-adherence led to a high risk of relapse, and variability in TGN levels also contributed to the relapse incidence. The interruption of 6-MP should be avoided to minimize the relapse of ALL, and using NUDT15 genetic testing-guided 6-MP dosing to avoid the treatment interruption of 6-MP is worthy of research.

In addition to investigating the influence of NUDT15 polymorphism on 6-MP-associated adverse reaction, we also wonder if gene polymorphism plays a role on the efficacy of 6-MP in ALL patients. The reported efficacy outcomes of 6-MP in ALL include EFS, OS, relapse, and death.26,27,36,43,48 The rate of relapse in ALL patients appears high in developing countries,66 which relates to a poor prognosis and acts as one of major causes for death.67 Therefore, elucidating the predictor for relapse and preventing its occurrence is important. The higher level of DNA-TG, the downstream metabolite of

Haematologica | 109 April 2024 1064 ARTICLE - NUDT15 affects 6-MP treatment results in ALL S. Du et al.

MTX/6-MP combination chemotherapy, is found to be correlated with a lower relapse hazard.6,68 As a pharmacogenetic predictor for relapse of ALL, phosphoribosyl pyrophosphate synthetase 1 gene (PRPS1)67,69 and cytosolic 5’-nucleotidase II gene (NT5C2)70,71 are identified as relapse-specific mutations in recent research. In our meta-analysis, no association between NUDT15 c.415C>T polymorphism with relapse risk of ALL was observed. Nishii et al.72 found that DNA-TG was positively correlated with 6-MP dosage regardless of NUDT15 genotype. In their research, 6-MP dose was reduced in NUDT15-deficient patients to achieve a level of DNA-TG comparable to that in wild-type patients and thereby mitigate NUDT15 deficiency-mediated toxicity. Many studies have reported that patients with NUDT15 variants receive lower dose of 6-MP than those harboring wild-type NUDT15 during ALL treatment, and this was supported by our meta-analysis.21,40,43 In conclusion, the similar relapse rate in the NUDT15 group in this study was probably because the 6-MP dose during treatment was adjusted to optimize the exposure of DNA-TG in expectation of preventing 6-MP toxicity. However, this study is limited by the relatively small sample size and short follow-up period, so research with large samples and long follow-up is expected in the future to confirm the effect of NUDT15 on relapse risk. Because of the limited number of relevant studies and some unavailable data, we did not perform a meta-analysis about the association of NUDT15 polymorphism with EFS and OS in the present review. Although all of the above-mentioned studies found no significant difference for OS or EFS among NUDT15 c.415C>T genotypes,26,27,36,43,48 Tanaka et al.43 pointed out a tendency for a worse EFS rate in their study in carriers of NUDT15 c.415C>T variant allele, though explanations were not given. Therefore, further investigating this potential correlation is recommended. Death cases were reported only in two studies, and no significant difference in the incidence of death between the NUDT15 c.415C>T variant group and the wild-type group was observed (Online Supplementary Figure S3).

Pharmacogenomics studies can not only help us identify pharmacogenetic predictors for efficacy and safety of medical treatment, but also aim to provide references for individualizing therapy. NUDT15 variants carriers have a greater risk for developing leukopenia than wild-type patients, and accordingly, dosing of 6-MP based on NUDT15 genotype to avoid the severe adverse reaction and maintain the efficacy is a critical issue. Although CPIC Guidelines gave a recommendation for thiopurine dosing based on TPMT and NUDT15 genotypes, the dosing of 6-MP is not always adjusted according to the guideline in the current clinical practice.73 In addition, the efficacy and safety of 6-MP regimen adjustment also have not yet been verified in clinical use. In this article, we conducted a meta-analysis to compare the pooled dose intensity, tolerable dose of 6-MP in the clinical study of ALL patients who carry NUDT15 variants with wildtype patients, providing a reference for dose adjustment

for NUDT15 variants carriers in clinical practice. Due to the variance in the initial dose of 6-MP in the included studies, it would be preferable to use dose intensity for the dose adjustment of 6-MP, that will give a better idea on how much the dose was reduced. The tolerable dose intensity of 6-MP in ALL patients with NUDT15 c.415C>T homozygote variant (TT) and heterozygote variant (CT) was 49% and 15% less than that of wild-type patients, reminding us patients with NUDT15 c.415C>T homozygote variant (TT) should be much more carefully monitored and 6-MP dose should be greatly reduced.

Former reported meta-analyses seldomly evaluated the association of NUDT15 polymorphism with 6-MP-induced leukopenia in a specific disease,28,29,31,74 except for one which found increased risk for thiopurine-induced leukopenia in IBD patients for NUDT15 c.415C>T (OR=6.90, 95% CI: 5.2-9.1),30 and another one which conducted a subgroup analysis in different diseases and reported a significant association between NUDT15 c.415C>T and leukopenia in ALL patients with only four studies included (OR=13.13, 95% CI:3.43-50.23 for the dominant model).75 The increased risk for 6-MP-induced leukopenia in ALL patients with NUDT15 c.415C>T variants was 9-fold higher than wild-type ones according to our meta-analysis of eight studies with large sample sizes. This increases the reliability of the results in ALL patients. Furthermore, association between NUDT15 polymorphism with neutropenia, hepatotoxicity, treatment interruption, treatment efficacy and dose of 6-MP in ALL patients were also for the first time reported in our meta-analysis. However, there are some limitations in our systematic review. First of all, the majority of included studies are retrospective and the studies regarding dose intensity of 6-MP and tolerable dose of 6-MP are few. Secondly, there is a high heterogeneity between different studies concerning incidence of leukopenia and interruption. This is probably ascribed to inconsistent definition of the outcome such as leukopenia or the difference in the baseline such as the initial dose of 6-MP. Moreover, low representation of a small sample for patients with NUDT15 variants in several studies also contributes to the heterogeneity. Thus, more studies with a larger sample size are expected to further confirm the reliability of the present results. Thirdly, some outcomes were presented in different forms, further limiting the number of comparable studies. For example, a study reported 5-year EFS,48 while another one provided 3-year progression-free survival.27

In conclusion, our meta-analysis showed that NUDT15 c.415C>T was a good predictor for 6-MP-induced myelosuppression in ALL patients, and the dose intensity of 6-MP in ALL patients with NUDT15 c.415C>T variants was much less than in wild-type patients. Although NUDT15 c.415C>T variants carriers might have a higher risk of experiencing treatment interruption and relapse of ALL than wild-type patients, the correlation is not significant in this meta-analysis. Further large prospective studies, which can better evaluate

Haematologica | 109 April 2024 1065 ARTICLE - NUDT15 affects 6-MP treatment results in ALL S. Du et al.

the association between NUDT15 gene, efficacy, adverse reaction and dose of 6-MP in ALL patients, are encouraged. Additionally, the influence of confounding factors such as other genes (TPMT, inosine triphosphatase [ITPA] et al.) or the combinational drug on efficacy and adverse reactions of 6-MP requires further investigation. The economic stake of pretreatment genetic testing is an important clinical concern. So far, only a few studies have reported cost effectiveness analysis of pretreatment screening for NUDT15-defective alleles when using thiopurines in ALL or IBD patients.73,76 Further prospective studies of genotype-guided dosing of 6-MP with large sample size are needed to assess the efficacy, safety and economic benefits of pretreatment NUDT15 gene testing. It is also of great significance to compare the cost effectiveness of pretreatment NUDT15 c.415C>T testing alone or in combination with other NUDT15 risk alleles or with other genes such as TPMT and ITPA.

Conclusion

Through this systematic review, we provided the following revelations for the clinical practice. Firstly, NUDT15 c.415C>T variants are likely to increase the risk of toxicity of 6-MP in ALL patients. Secondly, the dose intensity and tolerable dose of 6-MP in NUDT15 c.415C>T variant carriers were significantly less than that in wild-type patients, so the dose adjustment of 6-MP during the treatment should be individualized among different NUDT15 genotypes. Thirdly, NUDT15 genotype did not affect the relapse of ALL based on the current research.

Disclosures

No conflicts of interest to disclose.

References

1. Al Ustwani O, Gupta N, Bakhribah H, Griffiths E, Wang E, Wetzler M. Clinical updates in adult acute lymphoblastic leukemia. Crit Rev Oncol Hematol. 2016;99:189-199.

2. Pui CH, Robison LL, Look AT. Acute lymphoblastic leukaemia. Lancet. 2008;371(9617):1030-1043.

3. Inaba H, Mullighan CG. Pediatric acute lymphoblastic leukemia. Haematologica. 2020;105(11):2524-2539.

4 Ma H, Sun H, Sun X. Survival improvement by decade of patients aged 0-14 years with acutelymphoblastic leukemia: a SEER analysis. Sci Rep. 2014;4:4227.

5. Teachey DT, Hunger SP, Loh ML. Optimizing therapy in the modern age: differences in length of maintenance therapy in acute lymphoblastic leukemia. Blood. 2021;137(2):168-177.

6. Toksvang LN, Lee SHR, Yang JJ, Schmiegelow K. Maintenance therapy for acute lymphoblastic leukemia: basic science and clinical translations. Leukemia. 2022;36(7):1749-1758.

7 Mei L, Ontiveros EP, Griffiths EA, Thompson JE, Wang ES, Wetzler M. Pharmacogenetics predictive of response and toxicity in acute lymphoblastic leukemia therapy. Blood Rev. 2015;29(4):243-249.

8. Schmiegelow K, Nielsen SN, Frandsen TL, Nersting J. Mercaptopurine/Methotrexate maintenance therapy of childhood

Contributions

SD and JLC conceived the study. SD, XFH and XH performed literature search. SD, XFH, XXL and JLC performed article selection, data extraction and analysis. SD and XFH wrote the manuscript draft. JLC, XXL, MM, MC, XH and HKS provided guidance on the methodology. SD, XFH, JLC, XXL, XH, MM, MC, RZ and ZYL edited the manuscript. SD, JLC and XXL funded the study. All authors approved final version of the article.

Acknowledgments

Dr. Tianjing Liao offered us valuable help with manuscript editing.

Funding

This study was supported by Talent Youth Fund of Sichuan Provincial People’s Hospital (2022QN22), Personalized Drug Therapy Key Laboratory of Sichuan Province (2021YB04), Research Fund for the Doctoral Program of Sichuan Academy of Medical Sciences and Sichuan Provincial People’s Hospital (2015BS04), the Science and Technology Project of Health and Family Planning Commission of Sichuan Province (19PJ269), National Natural Science Foundation of China (82101163), Department of Science and Technology of Sichuan Province of China (2021YFS0387,2021YFS0388) and Clinical Research Foundation of Sichuan Provincial People’s Hospital (2021LY23).

Data-sharing statement

All original data of our study are included in the manuscript and Online Supplementary Material. The Online Supplementary Material can be found with the online version of this article. The protocol for this systematic review was registered on PROSPERO.

acute lymphoblastic leukemia: clinical facts and fiction. J Pediatr Hematol Oncol. 2014;36(7):503-517.

9 Ebbesen MS, Nersting J, Jacobsen JH, et al. Incorporation of 6-thioguanine nucleotides into DNA during maintenance therapy of childhood acute lymphoblastic leukemia-the influence of thiopurine methyltransferase genotypes. J Clin Pharmacol. 2013;53(6):670-674.

10 Fotoohi AK, Coulthard SA, Albertioni F. Thiopurines: factors influencing toxicity and response. Biochem Pharmacol. 2010;79(9):1211-1220.

11. Kakuta Y, Kinouchi Y, Shimosegawa T. Pharmacogenetics of thiopurines for inflammatory bowel disease in East Asia: prospects for clinical application of NUDT15 genotyping. J Gastroenterol. 2018;53(2):172-180.

12. Evans WE, Hon YY, Bomgaars L, et al. Preponderance of thiopurine S-methyltransferase deficiency and heterozygosity among patients intolerant to mercaptopurine or azathioprine. J Clin Oncol. 2001;19(8):2293-2301.

13. Lennard L, Lilleyman JS, Van Loon J, Weinshilboum RM. Genetic variation in response to 6-mercaptopurine for childhood acute lymphoblastic leukaemia. Lancet. 1990;336(8709):225-229.

Haematologica | 109 April 2024 1066 ARTICLE - NUDT15 affects 6-MP treatment results in ALL S. Du et al.

14 Relling MV, Hancock ML, Rivera GK, et al. Mercaptopurine therapy intolerance and heterozygosity at the thiopurine S-methyltransferase gene locus. J Natl Cancer Inst. 1999;91(23):2001-2008.

15. Relling MV, Gardner EE, Sandborn WJ, et al. Clinical pharmacogenetics implementation consortium guidelines for thiopurine methyltransferase genotype and thiopurine dosing: 2013 update. Clin Pharmacol Ther. 2013;93(4):324-325.

16. Schmiegelow K, Forestier E, Kristinsson J, et al. Thiopurine methyltransferase activity is related to the risk of relapse of childhood acute lymphoblastic leukemia: results from the NOPHO ALL-92 study. Leukemia. 2009;23(3):557-564.

17 Collie-Duguid ES, Pritchard SC, Powrie RH, et al. The frequency and distribution of thiopurine methyltransferase alleles in Caucasian and Asian populations. Pharmacogenetics. 1999;9(1):37-42

18. Bhatia S, Landier W, Hageman L, et al. 6MP adherence in a multiracial cohort of children with acute lymphoblastic leukemia: a Children’s Oncology Group study. Blood. 2014;124(15):2345-2353.

19 Takatsu N, Matsui T, Murakami Y, et al. Adverse reactions to azathioprine cannot be predicted by thiopurine S-methyltransferase genotype in Japanese patients with inflammatory bowel disease. J Gastroenterol Hepatol. 2009;24(7):1258-1264.

20 Moriyama T, Nishii R, Perez-Andreu V, et al. NUDT15 polymorphisms alter thiopurine metabolism and hematopoietic toxicity. Nat Genet. 2016;48(4):367-373.

21. Yang JJ, Landier W, Yang W, et al. Inherited NUDT15 variant is a genetic determinant of mercaptopurine intolerance in children with acute lymphoblastic leukemia. J Clin Oncol. 2015;33(11):1235-1242.

22. Yang SK, Hong M, Baek J, et al. A common missense variant in NUDT15 confers susceptibility to thiopurine-induced leukopenia. Nature Genet. 2014;46(9):1017-1020.

23. Singh M, Bhatia P, Khera S, Trehan A. Emerging role of NUDT15 polymorphisms in 6-mercaptopurine metabolism and dose related toxicity in acute lymphoblastic leukaemia. Leuk Res. 2017;62:17-22.

24. Correa-Jimenez O, Yunis JJ, Linares-Ballesteros A, SarmientoUrbina I. Susceptibility to thiopurine toxicity by TPMT and NUDT15 variants in Colombian children with acute lymphoblastic leukemia. Colomb Med (Cali). 2021;52(3):e2074569.

25. Fan POL, Leung KT, Chan KYY, et al. ABCC4, ITPA, NUDT15, TPMT and their interaction as genetic predictors of 6-mercaptopurine intolerance in chinese patients with acute lymphoblastic leukemia. Pediatr Hematol Oncol. 2022;39(3):254-266.

26. Mao XY, Yin RX, Sun GY, et al. Effects of TPMT, NUDT15, and ITPA genetic variants on 6-mercaptopurine toxicity for pediatric patients with acute lymphoblastic leukemia in Yunnan of China. Front Pediatr. 2021;9:719803.

27. Pai AA, Mohan A, Benjamin ESB, et al. NUDT15 c.415C>T polymorphism predicts 6-MP induced early myelotoxicity in patients with acute lymphoblastic leukemia undergoing maintenance therapy. Pharmgenomics Pers Med. 2021;14:1303-1313.

28. Cargnin S, Genazzani AA, Canonico PL, Terrazzin S. Diagnostic accuracy of NUDT15 gene variants for thiopurine-induced leukopenia: a systematic review and meta-analysis. Pharmacol Res. 2018;135:102-111.

29. Khaeso K, Udayachalerm S, Komvilaisak P, et al. Meta-analysis of NUDT15 genetic polymorphism on thiopurine-induced myelosuppression in Asian populations. Front Pharmacol.

2021;12:784712.

30. van Gennep S, Konté K, Meijer B, et al. Systematic review with meta-analysis: risk factors for thiopurine-induced leukopenia in IBD. Aliment Pharmacol Ther. 2019;50(5):484-506.

31. Wang R, Liu B, Li J, et al. Association between the c.415C>T, c.52G>A, and 36_37insGGAGTC polymorphisms of NUDT 15 and thiopurine-induced leukopenia, thiopurine intolerance, and severe hair loss: an updated meta-analysis. Drug Des Devel Ther. 2019;13:2729-2744.

32. Moher D, Liberati A, Tetzlaff J, Altman DG, Group P. Preferred reporting items for systematic reviews and meta-analyses: the PRISMA statement. PLoS Med. 2009;6(7):e1000097.

33. Wells GA, Shea B, O’Connell D, et al. The Newcastle-Ottawa Scale (NOS) for assessing the quality of nonrandomized studies in meta-analyses. 2009. https://www.ohri.ca/programs/clinical_ epidemiology/oxford.asp. Accessed on Jan 15, 2023.

34. Cao M, Yin D, Qin Y, et al. Screening of novel pharmacogenetic candidates for mercaptopurine-induced toxicity in patients with acute lymphoblastic leukemia. Front Pharmacol. 2020;11:267.

35. Li H, Shen J, Ru Y, Tu C, Li Y, Ren D. Association between rs116855232 gene polymorphisms and mercaptopurine-induced adverse reactions in children with acute lymphoblastic leukemia. Chin J Pharmacoepidemiol. 2021;30(9):596-600.

36. Liang DC, Yang CP, Liu HC, et al. NUDT15 gene polymorphism related to mercaptopurine intolerance in Taiwan Chinese children with acute lymphoblastic leukemia. Pharmacogenomics J. 2016;16(6):536-539.

37. Liu JW, X. Association between polymorphism of NDUT15 gene and leucopenia induced by 6-mercaptopurine in children with acute lymphoblastic leukemia. J Clin Pediatr. 2018;36(2):113-116.

38. Wang J, Wang X, Hao G, Cheng Y, Lu H, Suo T. Relationship between NUDT15 gene polymorphism and tolerance to treatment with 6-mercaptopurinein children with acute lymphoblastic leukemia. J Leuk Lymphoma. 2022;31(5):286-289.

39 Wang X, Wang W. Association between polymorphism of NUDT15 gene and hepatotoxicity induced by 6-MP in children with acute lymphoblastic leukemia. Chin J Med Genet. 2021;38(12):1258-1261.

40. Zhou H, Li L, Yang P, et al. Optimal predictor for 6-mercaptopurine intolerance in Chinese children with acute lymphoblastic leukemia: NUDT15, TPMT, or ITPA genetic variants? BMC Cancer. 2018;18(1):516.

41. Zhu Y, Yin D, Su Y, et al. Combination of common and novel rare NUDT15 variants improves predictive sensitivity of thiopurineinduced leukopenia in children with acute lymphoblastic leukemia. Haematologica. 2018;103(7):e293-e295.

42. Suzuki H, Fukushima H, Suzuki R, et al. Genotyping NUDT15 can predict the dose reduction of 6-MP for children with acute lymphoblastic leukemia especially at a preschool age. J Hum Genet. 2016;61(9):797-801.

43. Tanaka Y, Kato M, Hasegawa D, et al. Susceptibility to 6-MP toxicity conferred by a NUDT15 variant in Japanese children with acute lymphoblastic leukaemia. Br J Haematol. 2015;171(1):109-115.

44. Tanaka Y, Nakadate H, Kondoh K, Nakamura K, Koh K, Manabe A. Interaction between NUDT15 and ABCC4 variants enhances intolerability of 6-mercaptopurine in Japanese patients with childhood acute lymphoblastic leukemia. Pharmacogenomics J. 2018;18(2):275-280.

45. Choi R, Sohn I, Kim MJ, et al. Pathway genes and metabolites in thiopurine therapy in Korean children with acute lymphoblastic leukaemia. Br J Clin Pharmacol. 2019;85(7):1585-1597.

46. Kim H, Seo H, Park Y, et al. APEX1 polymorphism and

Haematologica | 109 April 2024 1067 ARTICLE - NUDT15 affects 6-MP treatment results in ALL S. Du et al.

mercaptopurine-related early onset neutropenia in pediatric acute lymphoblastic leukemia. Cancer Res Treat. 2018;50(3):823-834.

47. Lee JM, Shim YJ, Kim DH, Jung N, Ha JS. The effect of NUDT15, TPMT, APEX1, and ITPA genetic variations on mercaptopurine treatment of pediatric acute lymphoblastic leukemia. Children (Basel). 2021;8(3):224.

48. Buaboonnam J, Sripatanatadasakul P, Treesucon A, et al. Effect of NUDT15 on incidence of neutropenia in children with acute lymphoblastic leukemia. Pediatr Int. 2019;61(8):754-758.

49. Chiengthong K, Ittiwut C, Muensri S, et al. NUDT15 c.415C>T increases risk of 6-mercaptopurine induced myelosuppression during maintenance therapy in children with acute lymphoblastic leukemia. Haematologica. 2016;101(1):e24-26.

50 Khaeso K, Komvilaisak P, Chainansamit SO, et al. NUDT15 is a key genetic factor for prediction of hematotoxicity in pediatric patients who received a standard low dosage regimen of 6-mercaptopurine. Drug Metab Pharmacokinet. 2022;43:100436.

51. Khera S, Trehan A, Bhatia P, Singh M, Bansal D, Varma N. Prevalence of TPMT, ITPA and NUDT 15 genetic polymorphisms and their relation to 6MP toxicity in north Indian children with acute lymphoblastic leukemia. Cancer Chemother Pharmacol. 2019;83(2):341-348.

52. Moradveisi B, Muwakkit S, Zamani F, Ghaderi E, Mohammadi E, Zgheib NK. ITPA, TPMT, and NUDT15 genetic polymorphisms predict 6-mercaptopurine toxicity in Middle Eastern children with acute lymphoblastic leukemia. Front Pharmacol. 2019;10:916.

53. Brown PA, Shah B, Advani A, et al. Acute lymphoblastic leukemia, Version 2.2021, NCCN clinical practice guidelines in oncology. J Natl Compr Canc Netw. 2021;19(9):1079-1109.

54 Tanaka Y, Saito Y. Importance of NUDT15 polymorphisms in thiopurine treatments. J Pers Med. 2021;11(8):778.

55. Broekman M, Coenen MJH, Wanten GJ, et al. Risk factors for thiopurine-induced myelosuppression and infections in inflammatory bowel disease patients with a normal TPMT genotype. Aliment Pharmacol Ther. 2017;46(10):953-963.

56. Kojima Y, Hirotsu Y, Omata W, et al. Influence of NUDT15 variants on hematological pictures of patients with inflammatory bowel disease treated with thiopurines. World J Gastroenterol. 2018;24(4):511-518.

57 Tsuchiya A, Aomori T, Sakamoto M, et al. Effect of genetic polymorphisms of azathioprine-metabolizing enzymes on response to rheumatoid arthritis treatment. Pharmazie. 2017;72(1):22-28.

58. Kim SY, Shin JH, Park JS, et al. NUDT15 p.R139C variant is common and strongly associated with azathioprine-induced early leukopenia and severe alopecia in Korean patients with various neurological diseases. J Neurol Sci. 2017;378:64-68.

59 Fan X, Yin D, Men R, Xu H, Yang L. NUDT15 polymorphism confer increased susceptibility to thiopurine-induced leukopenia in patients with autoimmune hepatitis and related cirrhosis. Front Pharmacol. 2019;10:346.

60 Sato T, Takagawa T, Kakuta Y, et al. NUDT15, FTO, and RUNX1 genetic variants and thiopurine intolerance among Japanese patients with inflammatory bowel diseases. Intest Res. 2017;15(3):328-337.

61. Relling MV, Schwab M, Whirl-Carrillo M, et al. Clinical

pharmacogenetics implementation consortium guideline for thiopurine dosing based on TPMT and NUDT15 genotypes: 2018 update. Clin Pharmacol Ther. 2019;105(5):1095-1105.

62. Nygaard U, Toft N, Schmiegelow K. Methylated metabolites of 6-mercaptopurine are associated with hepatotoxicity. Clin Pharmacol Ther. 2004;75(4):274-281.

63. Hao QS, Wang Z, Fang QY, et al. Effect of genetic polymorphism of TPMT and NUDT15 on the tolerance of 6-mercaptopurine therapy in adult acute lymphoblastic leukemia. Chin J Hematol. 2021;42(11):911-916.

64. Zhou Y, Wang L, Zhai XY, et al. Precision therapy of 6-mercaptopurine in Chinese children with acute lymphoblastic leukaemia. Br J Clin Pharmacol. 2020;86(8):1519-1527.

65. Bhatia S, Landier W, Hageman L, et al. Systemic exposure to thiopurines and risk of relapse in children with acute lymphoblastic leukemia: a children’s oncology group study. JAMA Oncol. 2015;1(3):287-295.

66. Li B, Brady SW, Ma X, et al. Therapy-induced mutations drive the genomic landscape of relapsed acute lymphoblastic leukemia. Blood. 2020;135(1):41-55.

67. Li B, Li H, Bai Y, et al. Negative feedback-defective PRPS1 mutants drive thiopurine resistance in relapsed childhood ALL. Nat Med. 2015;21(6):563-571.

68. Nielsen SN, Toksvang LN, Grell K, et al. No association between relapse hazard and thiopurine methyltransferase geno- or phenotypes in non-high risk acute lymphoblastic leukemia: a NOPHO ALL2008 sub-study. Cancer Chemother Pharmacol. 2021;88(2):271-279.

69 Mullighan CG. Mutant PRPS1: a new therapeutic target in relapsed acute lymphoblastic leukemia. Nat Med. 2015;21(6):553-554.

70. Dieck CL, Tzoneva G, Forouhar F, et al. Structure and mechanisms of NT5C2 mutations driving thiopurine resistance in relapsed lymphoblastic leukemia. Cancer Cell. 2018;34(1):136-147.e6.

71. Somazu S, Tanaka Y, Tamai M, et al. NUDT15 polymorphism and NT5C2 and PRPS1 mutations influence thiopurine sensitivity in acute lymphoblastic leukaemia cells. J Cell Mol Med. 2021;25(22):10521-10533.

72. Nishii R, Moriyama T, Janke LJ, et al. Preclinical evaluation of NUDT15-guided thiopurine therapy and its effects on toxicity and antileukemic efficacy. Blood. 2018;131(22):2466-2474.

73. Wei X, Zhuang J, Li N, et al. NUDT15 genetic testing-guided 6-mercaptopurine dosing in children with ALL likely to be costsaving in China. Int J Hematol. 2022;115(2):278-286.

74. Jena A, Jha DK, Kumar-M P, et al. Prevalence of polymorphisms in thiopurine metabolism and association with adverse outcomes: a South Asian region-specific systematic review and meta-analysis. Expert Rev Clin Pharmacol. 2021;14(4):491-501.

75. Liu Y, Meng Y, Wang L, Liu Z, Li J, Dong W. Associations between the NUDT15 R139C polymorphism and susceptibility to thiopurine-induced leukopenia in Asians: a meta-analysis. Onco Targets Ther. 2018;11:8309-8317.

76. Chang JY, Park SJ, Jung ES, et al. Genotype-based treatment with thiopurine reduces incidence of myelosuppression in patients with inflammatory bowel diseases. Clin Gastroenterol Hepatol. 2020;18(9):2010-2018.

Haematologica | 109 April 2024 1068 ARTICLE - NUDT15 affects 6-MP treatment results in ALL S. Du et al.

Susceptibility of pediatric acute lymphoblastic leukemia to STAT3 inhibition depends on p53 induction

Luca Gasparoli,1 Clemence Virely,1 Alexia Tsakaneli,1 Noelia Che,1 Darren Edwards,2 Jack Bartram,2 Michael Hubank,3 Deepali Pal,4 Olaf Heidenreich,5 Joost H.A. Martens,6 Jasper de Boer1 and Owen Williams1

1Cancer Section, Developmental Biology and Cancer Department, UCL Great Ormond Street Institute of Child Health, London, UK; 2Department of Pediatric Hematology, Great Ormond Street Hospital for Children, London, UK; 3Center for Molecular Pathology, The Royal Marsden, Sutton, UK; 4Department of Applied Sciences, Northumbria University, Newcastle upon Tyne, UK; 5Princess Maxima Center for Pediatric Oncology, Utrecht, the Netherlands and 6Department of Molecular Biology, Faculty of Science, Radboud Institute for Molecular Life Sciences, Radboud University, Nijmegen, the Netherlands

Abstract

Correspondence: O. Williams

owen.williams@ucl.ac.uk

Received: May 25, 2023.

Accepted: September 27, 2023.

Early view: October 5, 2023.

https://doi.org/10.3324/haematol.2023.283613

Published under a CC BY license

Advances in the clinical management of pediatric B-cell acute lymphoblastic leukemia (B-ALL) have dramatically improved outcomes for this disease. However, relapsed and high-risk disease still contribute to significant numbers of treatment failures. Development of new, broad range therapies is urgently needed for these cases. We previously reported the susceptibility of ETV6-RUNX1+ pediatric B-ALL to inhibition of signal transducer and activator of transcription 3 (STAT3) activity. In the present study, we demonstrate that pharmacological or genetic inhibition of STAT3 results in p53 induction and that CRISPR-mediated TP53 knockout substantially reverses susceptibility to STAT3 inhibition. Furthermore, we demonstrate that sensitivity to STAT3 inhibition in patient-derived xenograft (PDX) B-ALL samples is not restricted to any particular disease subtype, but rather depends on TP53 status, the only resistant samples being TP53 mutant. Induction of p53 following STAT3 inhibition is not directly dependent on MDM2 but correlates with degradation of MDM4. As such, STAT3 inhibition exhibits synergistic in vitro and in vivo anti-leukemia activity when combined with MDM2 inhibition. Taken together with the relatively low frequency of TP53 mutations in this disease, these data support the future development of combined STAT3/ MDM2 inhibition in the therapy of refractory and relapsed pediatric B-ALL.

Introduction

Pediatric leukemia accounts for up to a fifth of all cancer deaths in children. Acute lymphoblastic leukemia (ALL) comprises half of these cases, despite the success of modern chemotherapy and risk stratification. Failure of therapy in pediatric ALL is due to refractory and relapsed disease, as well as the toxicity of the chemotherapy itself.1 There is, therefore, an unmet clinical need that may be addressed by focusing on inhibition of oncogenic pathways required for leukemia maintenance across a broad range of disease subtypes. Targeting susceptibilities retained in relapsed leukemia is particularly relevant in this context.

Cancer cells often exhibit an exaggerated dependence upon normal cellular signaling pathways. Identification of such pathways deregulated in B-cell precursor ALL (B-ALL) and essential for leukemia survival is crucial for the development of novel therapies. For example, aberrant activation of STAT3 has been linked with transformation and tumor growth in multiple

tissues.2 Indeed, the importance of STAT3 in hematopoietic malignancies is well documented, particularly for subtypes of lymphoma3 and acute myeloid leukemia.4 Although STAT3 is required for the normal reconstitution activity of hematopoietic stem cells5,6 its pharmacological targeting does not appear to elicit short-term toxicity,7 providing a rationale for development of STAT3-targeting drugs.8 STAT3 is also required for normal B-cell development, deficiency resulting in reduced numbers of early B-cell progenitors.9 STAT3-deficient pro-B cells exhibit elevated levels of apoptosis, suggesting that impaired B-cell development is caused by loss of B-cell progenitor viability in the absence of STAT3.9

We previously demonstrated that STAT3 signaling plays an essential role in the most common form of pediatric leukemia, t(12;21) B-ALL. Thus, B-ALL cell lines containing the t(12;21) chromosomal translocation, which encodes the ETV6-RUNX1 fusion protein, are highly dependent on STAT3 signaling for leukemia growth, survival, clonogenicity and progression in vivo. 10 Furthermore, patient primary ETV6-RUNX1+ B-ALL cells

Haematologica | 109 April 2024 1069 - Acute Lymphoblastic Leukemia ARTICLE

were also found to be sensitive to STAT3 inhibition. Activation of STAT3 was mediated by an intracellular mechanism downstream of the ETV6-RUNX1 fusion protein, involving guanine nucleotide exchange factor induction.11 Other B-ALL subtypes, with a much poorer prognosis, were also found to be dependent upon sustained STAT3 activity.10 More recently, STAT3 dependence has also been demonstrated in poor-risk pediatric B-ALL subtypes, with high STAT3 expression being associated with inferior survival.12 Although it is likely that there are distinct mechanisms responsible for STAT3 activation in the different B-ALL subtypes, dependency renders them susceptible to pharmacological inhibition of STAT3. In this study, we used global gene expression analysis to demonstrate that STAT3 inhibition leads to induction of the p53 response in B-ALL cells. Pharmacological inhibition, small hairpin RNA (shRNA)-mediated knockdown and CRISPR/ Cas9-mediated ablation of STAT3 all result in elevated p53 protein and p53-target gene expression. B-ALL apoptosis in response to STAT3 inhibition can be reversed by deletion of TP53. In contrast to the subtype-specific STAT3 dependence we observed previously in B-ALL cell lines,10 patient-derived xenograft (PDX) B-ALL samples exhibited broad susceptibility to STAT3 inhibition across different subtypes, with resistance only apparent in two TP53 mutant samples. These data suggest that requirement for STAT3 activity may be a general characteristic of the pediatric B-ALL lineage, perhaps associated with signaling pathways operating in the cells of origin. Enhanced elimination of B-ALL cells was achieved by combining STAT3 inhibition with p53 induction through inhibition of MDM2, indicating a novel potential therapeutic opportunity. Indeed, since only a minority of pediatric B-ALL cases are associated with TP53 mutations,13 even in high-risk and relapsed disease,14-16 induction of p53 may be an attractive therapeutic approach to leukemias that are refractive to conventional therapy.

Methods

Mice

Mice were maintained in UCL GOSICH animal facilities and experiments were performed according to and approved by United Kingdom Home Office regulations and followed UCL GOSICH institutional guidelines.

B-cell acute lymphoblastic leukemia patient-derived xenograft acute lymphoblastic leukemia cells

Ethical approval was given (Research Ethics Committee reference 14/EM/0134) for use of appropriately consented material from patients with B-ALL at Great Ormond Street Hospital for Children (London, UK). Non-irradiated 6- to 12-week-old NOD-SCID-g-/- (NSG; The Jackson Laboratory, Bar Harbor, ME, USA) mice were intra-bone injected with 1-2x106 mononuclear cells (Online Supplementary Table S1). Recipient mice were sacrificed upon developing clinical signs of disease. Human

PDX ALL cells were harvested and purified from spleens using the mouse cell depletion kit (Miltenyi Biotec, Surrey, UK).

Cell culture and reagents

For co-culture experiments with Luciferase-expressing B-ALL PDX samples, 3x104/cm2 mesenchymal stem cells (MSC) were plated in 96-well tissue culture plates and 2x104 B-ALL PDX cells were added in StemSpan Serum-Free Expansion Medium II (SFEM II, STEMCELL Technologies, Cambridge, UK).17,18 Cells were treated for 5 days with indicated drugs and luminescence analyzed with the Steady-Glo Luciferase Assay System (Promega, Southampton, UK), according to manufacturer’s instruction, and detected with Infinite m200 Pro microplate reader (Tecan, Reading, UK). The following reagents and inhibitors were used, S3I-201 (Cayman Chemical, MI, USA), Napabucasin (BBI608; MedChemExpress, NJ, USA), C188-9 (MedChemExpress and Adooq Biosciences, CA, USA), Nutlin-3a (Merck Life Science, Dorset, UK) and Idasanutlin (Bio-Techne, Abingdon, UK).

In vivo transplantation

Non-irradiated NSG mice were intravenously transplanted with 2x105 luciferase-expressing B-ALL PDX cells. Recipient mice were imaged using the IVIS® Lumina Series III (PerkinElmer, Beaconsfield, UK) and randomly allocated to control or drug-treated groups, by flipping a coin. Recipient mice were treated with vehicle (7% dimtehyl sulfoxide [DMSO], 56% Labrasol, 37% polyethylene glycol 400), C188-9 (100 mg/kg), Idasanutlin (30 mg/kg) or C188-9 + Idasanutlin by 5-7 daily oral gavages. No blinding was used.

Quantitative real-time polymerase chain reaction analysis

Quantitative real-time polymerase chain recation (qRT-PCR) was performed on mRNA using TaqMan probe-based chemistry, as previously described,19 using a StepOnePlus Real-Time PCR System (Thermo Fisher Scientific). Primer/probe sets were from Applied Biosystems, Life Technologies.

Western blot and immunoprecipitation analysis

Western blot and immunoprecipitation (IP) analyses were performed as previously described10,20 (detailed in the Online Supplementary Appendix).

RNA sequencing and chromatin immunoprecipitation sequencing

RNA sequencing (RNA-seq), chromatin immunoprecipitation sequencing (ChIP-seq), ChIP-qPCR and gene set enrichment analysis (GSEA) was performed as detailed in the Online Supplementary Appendix

Statistics

Statistical significance was determined using Prism (GraphPad) software. Statistical analysis of means was performed using the one sample t test or unpaired Student’s t test, twotailed P values <0.05 being considered statistically significant.

Haematologica | 109 April 2024 1070 ARTICLE - The STAT3/p53 axis in pediatric B-ALL L. Gasparoli et al.

Variance was similar between groups. Statistical analysis of survival curves was performed using the log-rank test.

Data availability

The data generated in this study are available within the article and its Online Supplementary Appendix. The RNA-seq data generated in this study are publicly available in the Gene Expression Omnibus at GSE179333 (S3I-201) and GSE179332 (shSTAT3) and the ChIP-seq data at GSE213766. More details are provided in the Online Supplementary Appendix

Results

In order to further investigate the mechanism responsible for STAT3 dependency in ETV6-RUNX1+ B-ALL, we performed RNA-seq in REH cells to examine global gene expression changes 6 hours after pharmacological inhibition of STAT3, via the STAT3 inhibitor S3I-20121 (Figure 1A). Inhibition of STAT3 resulted in a total of 1,085 significantly upregulated and 820 downregulated genes, of which 156 and 22 were changed more than 2-fold, respectively. We performed GSEA with the MSigDB hallmark gene set collection to identify cellular pathways perturbed in this RNA-seq data in an unbiased manner. The hallmark p53 pathway (M5939) gene set was the most upregulated gene set in this analysis (Online Supplementary Figure S1A). Enrichment of high-confidence p53 target genes, assembled in a recent meta-analysis,22 confirmed that gene expression changes resulting from acute STAT3 inhibition are consistent with p53 induction (Figure 1B). Analysis of TP53 RNA sequences from the RNA-seq data confirmed that the REH cells were TP53 wild-type. Next, we performed RNA-seq in REH cells after shRNA-mediated STAT3 silencing (Figure 1A; Online Supplementary Figure S1B). The hallmark p53 pathway was once more the most upregulated gene set (Online Supplementary Figure S1A) and high-confidence p53 target genes were significantly enriched in these gene expression changes (Figure 1B). Furthermore, 240 of the 1,085 genes induced by S3I-201 were also significantly upregulated following STAT3 silencing, 45 of which were high-confidence p53 target genes.22 Taken together, these data suggest that STAT3 functions in these cells to repress p53 induction. Direct repression of TP53 by STAT3 has so far only been demonstrated in transformed fibroblast cells, where STAT3 binds to the promoter of TP53 and inhibits its transcription.23 However, we did not observe a significant change in TP53 expression in either of the RNA-seq data sets (fold change [FC] =1.01, P adj =0.96 and FC=0.99, P adj=0.83 for TP53 in the S3I-201 and shSTAT3 data sets, respectively). This indicates that p53 induction resulting from STAT3 inhibition was not due to transcriptional activation of TP53

In order to examine whether p53 induction following inhibition of STAT3 occurred at the protein level, we examined p53 protein expression after pharmacological or genetic inhibition of STAT3 (Figure 1C-E). Total p53 protein levels

increased significantly in REH cells after 6-hour exposure to S3I-201 and an independent STAT3 inhibitor, Napabucasin (BBI608) (Figure 1C).24 Moreover, this resulted in increased expression of CDKN1A (Figure 1F) and other selected p53 target genes (Online Supplementary Figure S1C). shRNA-mediated silencing of STAT3 (Online Supplementary Figure S1B) also resulted in increased total p53 protein and target gene expression (Figure 1D, G). In order to confirm these data using an independent approach, we then targeted STAT3 in REH cells by CRISPR/Cas9 knockout using two independent gRNA against the regions encoding the SH2 (g1_STAT3) and DNA-binding (g2_STAT3) domains. Tracking of insertions and deletions (Indel) by DEcomposition (TIDE) analysis in the bulk population of STAT3-/- REH cells confirmed the specific and efficient editing of the targeted regions in STAT3 (Online Supplementary Figure S2A) and consequent reduction of total STAT3 protein expression in REH cells (Figure 1E). Loss of STAT3 expression led to selective depletion of STAT3-/REH cells (Online Supplementary Figure S2B, C), in line with the anti-proliferative and apoptotic consequences of STAT3 inhibition we described previously.10 Knockout of STAT3 also resulted in a significant increase in p53 protein (Figure 1E) and target gene (Figure 1H; Online Supplementary Figure S2D) expression. Conversely, expression of a constitutively active form of STAT3 (CASTAT3) (Online Supplementary Figure S3A) we observed a small but significant decrease in p53 target gene expression (Online Supplementary Figure S3B). Protein levels of p53 are tightly regulated by the E3 ubiquitin ligase MDM2, which targets p53 for ubiquitination and subsequent degradation.25-27 In order to evaluate the role of MDM2 in controlling p53 protein levels in the context of STAT3 inhibition, we performed immunoprecipitation experiments with a specific MDM2 antibody following a short 6-hour exposure to S3I-201. We observed no changes in MDM2 association with p53 (Online Supplementary Figure S4A), an interaction important for MDM2 regulation of p53 protein expression levels.28 Furthermore, 6 hours after exposure, no changes in total MDM2 protein expression were detected following STAT3 inhibition with either S3I-201 or Napabucasin (Online Supplementary Figure S4B). In contrast, MDM2 gene expression increased significantly following STAT3 inhibition (Online Supplementary Figure S4C), most likely as a consequence of p53 induction, since MDM2 is a well-described p53 target.29,30 In summary, no changes in MDM2:p53 interaction or total MDM2 protein expression could be detected at a time point in which p53 induction was evident. Taken together, these data indicate that p53 induction following STAT3 inhibition is not directly dependent on MDM2. Ubiquitination of p53 by MDM2 has also been shown to be positively regulated by MDM4,31 suggesting an alternative mechanism through which STAT3 could influence p53 protein levels. Although the association of p53 with MDM4 was not affected by 6-hour exposure to S3I-201 (Figure 2A), S3I-201 treatment (Figure 2B) or shRNA-mediated STAT3 silencing (Figure 2C) resulted in decreased total MDM4 protein expression. Moreover, S3I-201

Haematologica | 109 April 2024 1071 ARTICLE - The STAT3/p53 axis in pediatric B-ALL L. Gasparoli et al.

Figure 1. STAT3 inhibition results in p53 induction in B-cell acute lymphoblastic leukemia cells. (A) Volcano plots of RNA-sequencing (RNA-seq) analysis showing fold gene expression changes in REH cells following treatment with S3I-201 (50 µM, 6 hours [hrs], N=3) or 5 days after small hairpin RNA (shRNA)-mediated STAT3 (sh1, N=3) silencing. Expression changes greater than 2-fold and P<0.05 are shown in red, Wald test. (B) Gene set enrichment analysis (GSEA) demonstrating enrichment of p53 target genes, as previously defined in,22 in S3I-201 and shSTAT3 induced gene expression changes. (C-E) Western blot examples (top panels) and quantification (lower panels) of p53 protein expression in REH cells (C) 6 hours after exposure to S3I-201 (50 µM) or Napabucasin (10 µM), (D) 5 days after transduction with scrambled control or shSTAT3 (sh1) shRNA or (E) 7 days after transduction with Cas9 and control or gSTAT3 gRNA. Bars and error bars are means and standard deviation (SD) of (C) N=8 and (D), (E) N=4 independent experiments. Data are normalized to (C, D) tubulin and (E) GAPDH loading control and to (C) dimethyl sulfoxide (DMSO)-treated, (D) control shRNA transduced and (E) control gRNA transduced REH cells. *P< 0.05; **P<0.01; ***P<0.001, one sample t test. (F-H) quantitative real-time polymerase chain reaction analysis of CDKN1A gene expression in REH cells (F) 6 hrs after exposure to S3I-201 (50 µM) or Napabucasin (10 µM), (G) 5 days after transduction with scrambled control or shSTAT3 shRNA or (H) 7 days after transduction with Cas9 and control or gSTAT3 gRNA. Bars and error bars are means and SD of (F) N=5, (G) N=4 and (H) N=5 independent experiments. Gene expression data are normalized to (F) DMSO-treated, (G) control shRNA transduced and (H) control gRNA transduced REH cells. *P<0.05; **P<0.01; ***P<0.001, one sample t test.

induced MDM4 loss was rescued by proteasomal inhibition (Figure 2D) suggesting that it was caused by proteasomal degradation. These data indicate that p53 induction correlates with reduced levels of MDM4 protein expression following

STAT3 inhibition.

We speculated that the observed increase in p53 protein expression would translate into increased binding to target gene loci. Indeed, immunoprecipitation experiments following

Haematologica | 109 April 2024 1072 ARTICLE - The STAT3/p53 axis in pediatric B-ALL L. Gasparoli et al.
A B C D E F G H

STAT3 inhibition by S3I-201 revealed a significant increase in the mono-methylation of lysine 372 of p53 (Figure 3A), a post-translational modification of p53 associated with increased DNA binding, resulting from the increase in total p53.32 Increased binding of target loci by p53 was confirmed by ChIP-seq (Figure 3B, C; Online Supplementary Figure S4D) and ChIP-qPCR (Figure 3D) experiments. S3I-201 exposure resulted in more than 2-fold increased binding of p53 at 400 peaks in REH cells (Figure 3B), including well-established p53 target genes CDKN1A, 33 BBC3 (PUMA)34 and ATF335 (Figure 3C, D). GSEA revealed significant enrichment of the genes that were associated with increased p53 binding in gene expression changes following S3I-201 treatment of REH cells (Figure 3E).

In order to determine the contribution of p53 induction to the response of REH cells to STAT3 inhibition, we performed CRISPR/Cas9-mediated knockout of TP53 in REH cells. Loss of p53 protein was confirmed in two independent TP53-/- clones (Figure 4A). TIDE analysis of the TP53-/- clones confirmed specific and efficient editing of the targeted region encoding the N-terminus domain of p53 (Online Supplementary Figure S5A). As expected, loss of TP53 abrogated the induction of p53 target gene expression resulting from STAT3 inhibition (Figure 4B) and significantly attenuated apoptosis induction following STAT3 inhibition with either S3I-201 or Napabucasin (Figure 4C). Similar impairment of apoptosis induction was observed following treatment of TP53-/- REH clones with the

Figure 2. p53 induction following STAT3 inhibition correlates with loss of MDM4. (A) Western blot analysis (left panel) and p53 protein expression quantification (right panel) of input and anti-MDM4 immunoprecipitates from REH cells, following 6-hour treatment with S3I-201 (50 µM). Blots were stained with anti-p53 or anti-MDM4. Data are normalized to dimethyl sulfoxide (DMSO)-treated REH cells. Bars and error bars are means and standard deviation (SD) of N=3 independent experiments. *P<0.05; NS: not significant, one sample t test. (B, C) Western blot analysis (left panels) and quantification (right panels) of MDM4 and p53 protein expression in REH cells following (B) 6-hour treatment with S3I-201 (50 µM) or (C) 5 days after transduction with scrambled control or small hairpin STA3 (shSTAT3) (sh1) shRNA. GAPDH was used as a loading control. Bars and error bars are means and SD of N=3 independent experiments. Data are normalized to GAPDH loading control and to DMSO-treated REH cells. *P<0.05; **P<0.01; NS: not significant, one sample t test. (D) Western blot analysis (left panel) and quantification (right panel) of MDM4 protein expression in REH cells following 6-hour treatment with S3I-201 (50 µM), with and without MG132 (10 µM). GAPDH was used as a loading control. Bars and error bars are means and SD of N=3 independent experiments. Data are normalized to GAPDH loading control and to DMSO-treated REH cells. *P<0.05; NS: not significant, one sample t test.

Haematologica | 109 April 2024 1073 ARTICLE - The STAT3/p53 axis in pediatric B-ALL L. Gasparoli et al.
A B C D

3. STAT3 inhibition results in increased binding of p53 to target genes. (A) Western blot example (left panel) and quantification (right panel) of input and anti-p53K372me1 immunoprecipitates from REH cells, following 6-hour treatment with dimethyl sulfoxide (DMSO) or S3I-201 (50 µM), stained with anti-p53 (DO-1). Bar and error bars are means and standard deviation (SD) of N=3 independent experiments. Data are normalized to DMSO-treated cells. **P<0.01, one sample t test. (B) Heatmap showing chromatin immunoprecipitation (ChIP) signal for the dynamic p53 peaks (>2-fold increased in S3I-201 with over 100 counts per million reads) following 6-hour exposure to DMSO or S3I-201 (50 µM). (C) Exemplar ChIP-sequencing tracks for p53 peaks at target genes in DMSO- and S3I-201-treated REH cells. High-confidence (CDKN1A, ATF3) p53 binding motifs are indicated by vertical black bars below the scale ruler. (D) ChIP quantitative polymerase chain reaction (ChIP-qPCR) validation analysis of p53 binding at CDKN1A (top panel), BBC3 (middle panel) and ATF3 (lower panel) in REH cells following 6-hour treatment with S3I-201 (50 µM). Data are shown as fold increase of enrichment over that from a gene desert region, normalized to DMSO-treated cells. Bars and error bars are means and SD of N=3 independent experiments. *P< 0.05; **P<0.01, one sample t test. (E) Gene set enrichment analysis (GSEA) demonstrating enrichment of 122 genes, with >2-fold increased p53 binding with peaks over 100 cpm reads, in gene expression changes in REH cells following treatment with S3I-201 (Figure 1A).

MDM2 inhibitor Nutlin-3a (Figure 4D). Moreover, TP53 loss also rescued inhibition of REH cell colony formation in methylcellulose following STAT3 inhibition (Online Supplementary Figure

S5B). In contrast, S3I-201-induced loss of MDM4 protein was not affected by TP53 knockout, confirming that although p53 has been shown to repress MDM4 mRNA translation31 this

Haematologica | 109 April 2024 1074 ARTICLE - The STAT3/p53 axis in pediatric B-ALL L. Gasparoli et al.
A B C D E
Figure

was not the cause of MDM4 loss following STAT3 inhibition (Online Supplementary Figure S5C).

We demonstrated previously that ETV6-RUNX1+ B-ALL cell lines

and primary patient samples are highly dependent on STAT3 signaling for leukemia growth, survival, clonogenicity and progression in vivo. 10 In order to investigate STAT3 dependence

STAT3 inhibition. (A) Western blot analysis of

by transduction of REH cells with Cas9 and control or TP53-specific gRNA,

the latter

for loss of p53 protein expression. (B) Quantitative real-time polymerase chain reaction (qRT-PCR) analysis of selected p53 target gene22 expression in TP53wt and TP53-/- REH clones following 6-hour treatment with S3I-201 (50 µM).

are normalized to gene expression in the dimethyl sulfoxide (DMSO)-treated TP53wt clone. Bars and error bars are means and standard deviation (SD) of N=4 independent experiments. *P<0.05; **P<0.01; ***P<0.001, unpaired Student’s t test between S3I-201-treated TP53wt and TP53-/- clones. (C) Induction of apoptosis (% Annexin V+ cells) in TP53wt and TP53-/- REH clones following 48 hours treatment with S3I-201 (50 µM) or Napabucasin (10 µM). Bars and error bars are means and SD of N=5 independent experiments. **P<0.01; ***P<0.001, unpaired Student’s t test between S3I-201- or Napabucasin-treated TP53wt and TP53-/- clones. (D) Induction of apoptosis (% Annexin V+ cells) in TP53wt and TP53-/REH clones following 48-hour treatment with indicated concentrations of Nutlin-3a. Bars and error bars are means and SD of N=3 independent experiments. **P<0.01; ***P<0.001, unpaired Student’s t test between Nutlin 3a-treated TP53wt and TP53-/clones.

Haematologica | 109 April 2024 1075
pediatric
L. Gasparoli et al.
ARTICLE - The STAT3/p53 axis in
B-ALL
A B C D
Figure 4. TP53 knockout desensitizes B-cell acute lymphoblastic leukemia cells to p53 protein expression in REH cells and TP53wt and TP53-/- clones, obtained clones from being selected Gene expression data

across different pediatric B-ALL subtypes, we expanded our analysis to B-ALL PDX samples, including some generated from relapsed B-ALL cases. Twelve of 14 B-ALL PDX samples exhibited sensitivity to 24-hour S3I-201 exposure (Figure 5A). Interestingly, sensitivity was apparent across a broad range of B-ALL subtypes, including ETV6-RUNX1+ but also TCF3PBX1+, hyperdiploid, KMT2A-rearranged and PAX5-rearranged samples, and samples from relapsed disease. In contrast, an ETV6-RUNX1+ and a hypodiploid B-ALL PDX sample, both from relapsed disease, exhibited resistance to STAT3 inhibition (Figure 5A). Upregulation of CDKN1A and GADD45A gene expression after 6-hour S3I-201 treatment followed the same pattern of response, changes in expression being detected in sensitive but not resistant samples (Figure 5B). Total p53 protein levels increased in all B-ALL PDX samples 6 hours after exposure to S3I-201 (Online Supplementary

Figure S6A-C). The pattern in loss of viability was the same upon exposure of the PDX samples to Nutlin-3a, with the two S3I-201-resistant samples also exhibiting resistance to MDM2 inhibition (p53 induction) (Figure 5C). Sanger sequencing of the diagnostic relapse hypodiploid B-ALL sample from which one of the resistant PDX (sample 14) was generated, revealed the presence of a missense heterozygous TP53 mutation (Online Supplementary Figure S7A). Targeted gene panel sequencing of the other resistant B-ALL PDX (sample 13), derived from relapsed ETV6-RUNX1+ disease, detected three mutations affecting TP53 (Online Supplementary Figure S7B). TP53 missense mutations in both samples affected the region encoding the DNA-binding domain of p53, Y220C and R248Q in the hypodiploid and ETV6-RUNX1+ samples, respectively. In contrast, targeted gene panel sequencing of the 12 sensitive PDX samples confirmed their wild-type

Figure 5. The sensitivity of B-cell acute lymphoblastic leukemia patient-derived xenograft cells to STAT3 inhibition correlates with TP53 status. (A) Induction of apoptosis (% Annexin V+ cells) in B-cell acute lymphoblastic leukemia patient-derived xenograft (B-ALL PDX)

24-hour treatment with S3I-201 (50 µM) in liquid culture. B-ALL PDX samples: ETV6-RUNX1+ (1-5, 12, 13), TCF3-PBX1+ (6), hyperdiploid (7), high-hyperdiploid (8), KMT2A-MLLT3+ (9), KMT2A-AFDN+ (10), PAX5-rearranged (11) and hypodiploid (14). Samples 1-10 were derived from presentation samples and samples 11-14 from relapsed samples. (B) Quantitative real-time polymerase chain reaction (qRT-PCR) analysis of CDKN1A and GADD45A gene expression in B-ALL PDX samples following 6-hour treatment with S3I-201 (50 µM). Gene expression data are normalized to dimethyl sulfoxide (DMSO)-treated cells. (C) Induction of apoptosis (% Annexin V+ cells) in B-ALL PDX samples following 24-hour treatment with Nutlin-3a (5 µM) in liquid culture.

Haematologica | 109 April 2024 1076 ARTICLE - The STAT3/p53 axis in pediatric B-ALL L. Gasparoli et al.
A B C
samples following

TP53 status, although one of these (sample 11) contained a heterozygous deletion (chr17p11.2-p13.3) encompassing one TP53 allele. Taken together, these data are consistent with a critical role of p53 in mediating B-ALL sensitivity to STAT3 inhibition.

Since p53 induction following STAT3 inhibition did not appear to be mediated via direct MDM2 modulation (Online Supplementary Figure S4A-C), we reasoned that it may synergize with p53 induction resulting from MDM2 inhibition. Indeed, inhibition of STAT3 by either S3I-201 or Napabucasin demonstrated synergistic anti-leukemia activity in REH cells, when combined with MDM2 inhibition by Nutlin-3a (Figure 6A, B), suggesting a rationale for combined targeting of STAT3 and MDM2 in novel B-ALL therapy.

We next used a previously developed co-culture model in which drug susceptibility of luciferase-expressing B-ALL PDX samples is evaluated after seeding onto primary Nestin-positive human MSC.18 Five luciferase-transduced B-ALL PDX samples, two of which came from relapsed disease, proliferated over a 5-day period on human MSC (Online Supplementary Figure S8A). All of these samples exhibited sensitivity to C188-936 (also known as TTI-101), a more potent STAT3 inhibitor than S3I-201, over a similar concentration range to those reported for solid cancer cells37 (Online Supplementary Figure S8B). Increased susceptibility of all five samples to STAT3 inhibition (by S3I-201, Napabucasin or C188-9) was evident on combination with MDM2 inhibition (Figure 6C). The anti-leukemia effect observed in this co-culture model was associated with cell death (Online Supplementary Figure S8C) and was not a consequence of a direct effect of the drugs on primary MSC viability (data not shown). In contrast, these drug combinations had virtually no effect on the luciferase-expressing TP53 mutant hypodiploid B-ALL PDX (sample 14) (Online Supplementary Figure S8D). Similar responses to drug combinations occurred in three additional untransduced PDX samples (Online Supplementary Figure S8E). Longitudinal bioluminescence imaging demonstrated that short-term oral administration of Idasanutlin (MDM2 inhibitor) impaired disease progression in vivo in the PAX5 rearranged (sample 11) relapsed (Figure 7) and the KMT2A-MLLT3+ (sample 9) B-ALL model (Online Supplementary Figure S9A, B), and that in the former efficacy was improved by combining MDM2 with STAT3 inhibition.

Discussion

In this study we demonstrate that pediatric pre-B ALL exhibits broad sensitivity to STAT3 inhibition. Previously, we demonstrated that ETV6-RUNX1+ B-ALL cell lines and primary patient samples were susceptible to inhibition of STAT3.10,11 However, in contrast to cell lines,10 the present study demonstrates that susceptibility of PDX samples is not restricted to specific subtypes of B-ALL but appears to be a general feature of the disease. Pharmacologic, shRNA- or CRISPR/Cas9-mediated

inhibition of STAT3 resulted in p53 induction and cell death, largely abrogated by CRISPR-Cas9-mediated TP53 knockout. Furthermore, two PDX samples exhibiting resistance to STAT3 inhibition were also resistant to MDM2 inhibition and contained missense TP53 mutations. Taken together, these data indicate that p53 induction underlies the sensitivity of B-ALL cells to STAT3 inhibition.

Combined C188-9 and Idasanutlin treatment was more effective at impairing disease progression in comparison to Idasanutlin alone in the PAX5 rearranged B-ALL PDX sample. These data validate the enhanced sensitivity of B-ALL PDX samples to combined STAT3 and MDM2 inhibition in vitro. However, enhanced drug combination efficacy was not seen in vivo for the KMT2A-MLLT3+ sample and C188-9 alone did not affect disease progression in either sample. The difference in effectiveness of Idasanutlin and C188-9 in vivo is likely to be due to their relative bioavailabilities, further improvements of which will be required for translation of STAT3 inhibition as a therapy in B-ALL.

Evidence in the literature indicates that p53 may be regulated by STAT3 through a variety of different mechanisms. Transcriptional repression of TP53 by STAT3 was demonstrated in Src transformed fibroblasts and melanoma cells,23 and in chronic lymphocytic leukemia B cells.38 More recently, leukemia inhibitory factor (LIF) was also shown to cause STAT3-dependent reduction in p53 protein expression levels in colorectal cancer cells.39 However, in this case STAT3 activation had no effect on TP53 mRNA levels but was rather shown to act via indirect transcriptional activation of MDM2 and consequent p53 protein degradation.39 Similarly, we did not observe any change in TP53 expression in B ALL cells following STAT3 inhibition, but p53 regulation was not directly dependent on MDM2 either. However, STAT3 inhibition resulted in MDM4 protein loss that was rescued by proteasomal inhibition and was not a result of p53 induction. Since MDM4 has been shown to increase ubiquitination of p53 by MDM2, as well as directly inhibiting the transactivation activity of p53,31 it is likely that STAT3 inhibition leads to elevated p53 protein levels by inducing MDM4 degradation. Further experiments are necessary to elucidate exactly how this is achieved. The broad susceptibility of pediatric B-ALL PDX samples to STAT3 inhibition suggests that a requirement for STAT3 activity may be a general characteristic of the pediatric B-ALL lineage, perhaps associated with signaling pathways operating in the cells of origin. In this context it is worth noting that both STAT3 and p53 play important roles in normal B-cell development. Thus, STAT3 was shown to be involved in the positive regulation of B-cell development, deficiency resulting in a partial pre-pro-B-cell differentiation block and increased pro-B-cell apoptosis.9 With respect to p53, regulation of its expression, transcriptionally or otherwise, plays a critical role in pre-B-cell development and selection. For example, apoptosis of pre-B cells that fail to productively rearrange their immunoglobulin heavy chain genes was shown to be mediated by p53 induction.40 In this case, induction was via

Haematologica | 109 April 2024 1077 ARTICLE - The STAT3/p53 axis in pediatric B-ALL L. Gasparoli et al.

72-hour

(A)

concentrations of either S3I-201 or Napabucasin in combination with Nutlin-3a. Data are normalized to dimethyl sulfoxide (DMSO)-treated cells. Graphs points and error bars are means and standard deviation (SD) of N=4 (S3I-201) and N=3 (Napabucasin) independent experiments. (B) 3D synergy maps and ZIP synergy scores of data shown in (A), calculated with SynergyFinder (version 2.0). (C) Luminescence of luciferase-expressing B-cell acute lymphoblastic leukemia patient-derived xenograft (B-ALL PDX) samples, grown in co-culture with human mesenchymal stem cells (MSC), 5 days after exposure to MDM2 inhibitor Nutlin-3a (5 µM) alone or in combination with STAT3 inhibitors S3I-201 (50 µM), Napabucasin (1.5 µM) and C188-9 (10 µM). Corresponding B-ALL PDX sample number from Figure 4 is indicated in brackets. Data are normalized to DMSO-treated cells. Bars and error bars are means and SD of N=3 independent experiments. *P<0.05; **P<0.01; ***P<0.001; NS: not significant, one sample t test.

transcriptional activation of TP53 by the transcription factor BACH2. Furthermore, BACH2 was shown to act as a tumor suppressor in pre-B ALL, by virtue of its regulation of TP53 expression.40 Signaling pathways regulating p53 activity also appear to control pre-B-cell homeostasis. The Wip1 phosphatase, encoded by the p53 target gene PPM1D, is involved

in the negative feedback regulation of p53 activation.41 Interestingly, deletion of the Ppm1d gene was shown to result in reduced numbers of mature B cells. This defect was found to be due to induction of p53 and apoptosis in the pre-B-cell compartment and could be reversed by deletion of Tp53 42 This suggests that the autoregulatory loop between Wip1 and

Haematologica | 109 April 2024 1078 ARTICLE - The STAT3/p53 axis in pediatric B-ALL L. Gasparoli et al.
A B C
Figure 6. STAT3 and MDM2 inhibition synergize in triggering cell death in B-cell acute lymphoblastic leukemia cells. Viability of REH cells following treatment with indicated

7. STAT3 and MDM2

B-cell acute lymphoblastic leukemia progression in vivo. (A) Bioluminescence signal (radiance = photons/s/cm2/steradian) in NSG recipient mice 5 days after injection of the luciferase-expressing PAX5 rearranged (relapse) B-cell acute lymphoblastic leukemia patient-derived xenograft (B-ALL PDX) sample and before drug treatment (left panel), and fold change in bioluminescence signal 11 days after injection, following 5 daily treatments with vehicle or the indicated drug combinations (right panel). Bars and error bars are means and standard deviation (SD) of values form each treatment group, the number of mice in each group indicated in brackets. *P< 0.05; ***P<0.001; NS: not significant, unpaired Student’s t test between indicated groups. (B) Bioluminescence imaging of NSG recipient mice before (day 5) and after (day 11) drug treatment. Bars for luminescence signal represent photons/s/cm2/steradian. (C) Survival curve for recipient mice in (A, B), treated with vehicle (black solid line), C188-9 (black dashed line), Idasanutlin (IDA, red dashed line) or C188-9 + IDA combination (red solid line). Red arrows indicate drug treatments. P=0.76 (vehicle vs. C188-9); P=0.055 (vehicle vs. IDA); P=0.0131 (vehicle vs. C188-9 + IDA); P

p53 functions to maintain normal pre-B-cell development. In contrast to the evidence for isolated STAT3 and p53 function in normal B-cell development, relatively little is known about the possible connection between STAT3 activity and repression of p53 induction in B-cell progenitors. In this context, it is interesting to note that constitutively active STAT3 was shown to promote resistance to g irradiation-induced

apoptosis in peritoneal B-1 cells.43 Interestingly, STAT3-dependent radioresistance could also be induced in normal B-2 B cells by stimulation with cytokines in the presence of BCR cross-linking.43 Although p53 induction by g irradiation was not directly examined in this study, these data suggest that a link may exist between STAT3 activity and suppression of p53 responses in normal B cells. Further studies will be required

Haematologica | 109 April 2024 1079 ARTICLE - The STAT3/p53 axis in pediatric B-ALL L. Gasparoli et al.
A B C
Figure inhibition impair =0.0494 (IDA vs. C188-9 + IDA), log-rank test.

to establish whether the STAT3/p53 pathway we describe in pre-B ALL is associated with leukemogenesis or rather is retained during transformation of pre-B cells.

TP53 mutations are more prevalent in relapsed pediatric B-ALL than primary disease.14-16 Indeed, thiopurine chemotherapy has recently been linked with the emergence of missense TP53 mutations.44 However, the overall incidence of these mutations is still relatively low in comparison to other cancers,13,45 supporting the therapeutic applicability of this approach to p53 induction in primary and relapsed pediatric B-ALL. In conclusion, we demonstrate broad susceptibility of pediatric B ALL to p53 induction following STAT3 and combined STAT3/MDM2 inhibition. p53 induction is not a result of increased TP53 transcription and is not directly dependent on MDM2, but rather is likely to result from MDM4 degradation. Consistent with this, B-ALL cells exhibited increased sensitivity to combined STAT3 and MDM2 inhibition in vitro and in vivo, indicating a novel disease susceptibility amenable to therapeutic exploitation.

Disclosures

No conflicts of interest to disclose.

Contributions

LG, CV, AT, NC and OW performed the experiments and data analysis. JB and DE provided clinical input and patient material. MH performed panel sequencing. JHAM analysed ChIP-sequencing data. DP and OH provided primary human MSC samples and methodology for ex vivo PDX co-culture. OW and JdB provided project leadership and supervised the research. LG and OW wrote the paper. All authors read, pro-

References

1. Karol SE, Pui CH. Personalized therapy in pediatric high-risk B-cell acute lymphoblastic leukemia. Ther Adv Hematol. 2020;11:2040620720927575.

2. Yu H, Lee H, Herrmann A, Buettner R, Jove R. Revisiting STAT3 signalling in cancer: new and unexpected biological functions. Nat Rev Cancer. 2014;14(11):736-746.

3. Zhu F, Wang KB, Rui L. STAT3 Activation and oncogenesis in lymphoma. Cancers (Basel). 2019;12(1):19.

4 Bar-Natan M, Nelson EA, Xiang M, Frank DA. STAT signaling in the pathogenesis and treatment of myeloid malignancies. JAKSTAT. 2012;1(2):55-64.

5. Oh IH, Eaves CJ. Overexpression of a dominant negative form of STAT3 selectively impairs hematopoietic stem cell activity. Oncogene. 2002;21(31):4778-4787.

6. Chung YJ, Park BB, Kang YJ, Kim TM, Eaves CJ, Oh IH. Unique effects of Stat3 on the early phase of hematopoietic stem cell regeneration. Blood. 2006;108(4):1208-1215.

7 Kortylewski M, Kujawski M, Wang T, et al. Inhibiting Stat3 signaling in the hematopoietic system elicits multicomponent antitumor immunity. Nat Med. 2005;11(12):1314-1321.

8. Frank DA. STAT3 as a central mediator of neoplastic cellular transformation. Cancer Lett. 2007;251(2):199-210.

vided critical comments and approved the manuscript.

Acknowledgments

The authors thank Ayad Eddaoudi, UCL GOS ICH Flow Cytometry Facility, for providing assistance with flow cytometry, all the staff of the UCL GOS ICH Western Laboratories for excellent animal husbandry, and Tony Brooks and Paola Niola, UCL Genomics, for RNA and ChIP sequencing, and Deborah Hughes, Gregorz Pietka, Reda Stankunaite and Paula Proszek at Royal Marsden Hospital Center for Molecular Pathology for help with TP53 sequencing.

Funding

This research was supported by Children with Cancer UK (14169, 17-249 to LG); Action Medical Research (GN2368 to CV); the Medical Research Council (MR/S021000/1 to CV); Children’s Cancer and Leukemia Group Little Princess Trust Project Grant program (CCLGA 2022 21 to CV); SPARKS and Great Ormond Street Hospital Children’s Charity (V4819 to AT); Action Medical Research and Life Arc (GN2820 to Noelia Che); Alternative Hair Charitable Foundation and Great Ormond Street Hospital Children’s Charity (W1073 to JdB); Great Ormond Street Hospital Children’s Charity (V1305, V2617 to OW); Olivia Hodson Cancer Fund (SR16A35 to OW); the NIHR Great Ormond Street Hospital Biomedical Research Center; and an NC3Rs fellowship (NC/ P002412/1 to DP).

Data-sharing statement

The authors will make their original data available to future researchers upon request directed to the corresponding author.

9 Chou WC, Levy DE, Lee CK. STAT3 positively regulates an early step in B-cell development. Blood. 2006;108(9):3005-3011.

10 Mangolini M, de Boer J, Walf-Vorderwulbecke V, Pieters R, den Boer ML, Williams O. STAT3 mediates oncogenic addiction to TEL-AML1 in t(12;21) acute lymphoblastic leukemia. Blood. 2013;122(4):542-549.

11. Virely C, Gasparoli L, Mangolini M, et al. ARHGEF4 regulates an essential oncogenic program in t(12;21)-associated acute lymphoblastic leukemia. Hemasphere. 2020;4(5):e467.

12. Bhansali RS, Rammohan M, Lee P, et al. DYRK1A regulates B cell acute lymphoblastic leukemia through phosphorylation of FOXO1 and STAT3. J Clin Invest. 2021;131(1):e135937.

13. Imamura J, Miyoshi I, Koeffler HP. p53 in hematologic malignancies. Blood. 1994;84(8):2412-2421.

14 Gump J, McGavran L, Wei Q, Hunger SP. Analysis of TP53 mutations in relapsed childhood acute lymphoblastic leukemia. J Pediatr Hematol Oncol. 2001;23(7):416-419.

15. Hof J, Krentz S, van Schewick C, et al. Mutations and deletions of the TP53 gene predict nonresponse to treatment and poor outcome in first relapse of childhood acute lymphoblastic leukemia. J Clin Oncol. 2011;29(23):3185-3193.

16. Krentz S, Hof J, Mendioroz A, et al. Prognostic value of genetic

Haematologica | 109 April 2024 1080 ARTICLE - The STAT3/p53 axis in pediatric B-ALL L. Gasparoli et al.

alterations in children with first bone marrow relapse of childhood B-cell precursor acute lymphoblastic leukemia. Leukemia. 2013;27(2):295-304.

17 Bomken S, Buechler L, Rehe K, et al. Lentiviral marking of patient-derived acute lymphoblastic leukaemic cells allows in vivo tracking of disease progression. Leukemia. 2013;27(3):718-721.

18. Pal D, Blair HJ, Elder A, et al. Long-term in vitro maintenance of clonal abundance and leukaemia-initiating potential in acute lymphoblastic leukaemia. Leukemia. 2016;30(8):1691-1700.

19 Walf-Vorderwulbecke V, Pearce K, Brooks T, et al. Targeting acute myeloid leukemia by drug-induced c-MYB degradation. Leukemia. 2018;32(4):882-889.

20 Clesham K, Walf-Vorderwulbecke V, Gasparoli L, et al. Identification of a c-MYB-directed therapeutic for acute myeloid leukemia. Leukemia. 2022;36(6):1541-1549.

21. Siddiquee K, Zhang S, Guida WC, et al. Selective chemical probe inhibitor of Stat3, identified through structure-based virtual screening, induces antitumor activity. Proc Natl Acad Sci U S A. 2007;104(18):7391-7396.

22. Fischer M. Census and evaluation of p53 target genes. Oncogene. 2017;36(28):3943-3956.

23. Niu G, Wright KL, Ma Y, et al. Role of Stat3 in regulating p53 expression and function. Mol Cell Biol. 2005;25(17):7432-7440.

24. Li Y, Rogoff HA, Keates S, et al. Suppression of cancer relapse and metastasis by inhibiting cancer stemness. Proc Natl Acad Sci U S A. 2015;112(6):1839-1844.

25. Haupt Y, Maya R, Kazaz A, Oren M. Mdm2 promotes the rapid degradation of p53. Nature. 1997;387(6630):296-299.

26. Kubbutat MH, Jones SN, Vousden KH. Regulation of p53 stability by Mdm2. Nature. 1997;387(6630):299-303.

27. Honda R, Tanaka H, Yasuda H. Oncoprotein MDM2 is a ubiquitin ligase E3 for tumor suppressor p53. FEBS Lett. 1997;420(1):25-27.

28. Lane DP, Hall PA. MDM2--arbiter of p53’s destruction. Trends Biochem Sci. 1997;22(10):372-374.

29. Barak Y, Juven T, Haffner R, Oren M. mdm2 expression is induced by wild type p53 activity. EMBO J. 1993;12(2):461-468.

30 Wu X, Bayle JH, Olson D, Levine AJ. The p53-mdm-2 autoregulatory feedback loop. Genes Dev. 1993;7(7A):1126-1132.

31. Haupt S, Mejia-Hernandez JO, Vijayakumaran R, Keam SP, Haupt Y. The long and the short of it: the MDM4 tail so far. J Mol Cell Biol. 2019;11(3):231-244.

32. Chuikov S, Kurash JK, Wilson JR, et al. Regulation of p53 activity through lysine methylation. Nature.

2004;432(7015):353-360.

33. el-Deiry WS, Tokino T, Velculescu VE, et al. WAF1, a potential mediator of p53 tumor suppression. Cell. 1993;75(4):817-825.

34 Nakano K, Vousden KH. PUMA, a novel proapoptotic gene, is induced by p53. Mol Cell. 2001;7(3):683-694.

35. Zhang C, Gao C, Kawauchi J, Hashimoto Y, Tsuchida N, Kitajima S. Transcriptional activation of the human stress-inducible transcriptional repressor ATF3 gene promoter by p53. Biochem Biophys Res Commun. 2002;297(5):1302-1310.

36. Redell MS, Ruiz MJ, Alonzo TA, Gerbing RB, Tweardy DJ. Stat3 signaling in acute myeloid leukemia: ligand-dependent and -independent activation and induction of apoptosis by a novel small-molecule Stat3 inhibitor. Blood. 2011;117(21):5701-5709.

37. Lewis KM, Bharadwaj U, Eckols TK, et al. Small-molecule targeting of signal transducer and activator of transcription (STAT) 3 to treat non-small cell lung cancer. Lung Cancer. 2015;90(2):182-190.

38. Sainz-Perez A, Gary-Gouy H, Gaudin F, et al. IL-24 induces apoptosis of chronic lymphocytic leukemia B cells engaged into the cell cycle through dephosphorylation of STAT3 and stabilization of p53 expression. J Immunol. 2008;181(9):6051-6060.

39 Yu H, Yue X, Zhao Y, et al. LIF negatively regulates tumoursuppressor p53 through Stat3/ID1/MDM2 in colorectal cancers. Nat Commun. 2014;5:5218.

40 Swaminathan S, Huang C, Geng H, et al. BACH2 mediates negative selection and p53-dependent tumor suppression at the pre-B cell receptor checkpoint. Nat Med. 2013;19(8):1014-1022.

41. Takekawa M, Adachi M, Nakahata A, et al. p53-inducible wip1 phosphatase mediates a negative feedback regulation of p38 MAPK-p53 signaling in response to UV radiation. EMBO J. 2000;19(23):6517-6526.

42. Yi W, Hu X, Chen Z, et al. Phosphatase Wip1 controls antigenindependent B-cell development in a p53-dependent manner. Blood. 2015;126(5):620-628.

43. Otero DC, Poli V, David M, Rickert RC. Cutting edge: inherent and acquired resistance to radiation-induced apoptosis in B cells: a pivotal role for STAT3. J Immunol. 2006;177(10):6593-6597.

44. Yang F, Brady SW, Tang C, et al. Chemotherapy and mismatch repair deficiency cooperate to fuel TP53 mutagenesis and ALL relapse. Nat Cancer. 2021;2(8):819-834.

45. Comeaux EQ, Mullighan CG. TP53 Mutations in hypodiploid acute lymphoblastic leukemia. Cold Spring Harb Perspect Med. 2017;7(3):a026286.

Haematologica | 109 April 2024 1081 ARTICLE - The STAT3/p53 axis in pediatric B-ALL L. Gasparoli et al.

Extended exposure to low doses of azacitidine induces differentiation of leukemic stem cells through activation of myeloperoxidase

Danny V. Jeyaraju,1 Maryam Alapa,1 Ann Polonskaia,1 Alberto Risueño,2 Prakash Subramanyam,3 Amit Anand,3 Kaushik Ghosh,4 Charalampos Kyriakopoulos,2 Daiane Hemerich,1 Rose Hurren,5 Xiaoming Wang,5 Marcela Gronda,5 Aarif Ahsan,1 Hsiling Chiu,1 Geethu Thomas,5 Evan F. Lind,6 Daniel L. Menezes,7 Aaron D. Schimmer,5 Patrick R. Hagner,1 Anita Gandhi1 and Anjan G. Thakurta1°

1Bristol Myers Squibb, Summit, NJ, USA; 2CITRE, Bristol Myers Squibb, Seville, Spain; 3BBRC, Bangalore, India; 4Bristol Myers Squibb, Bangalore, India; 5Princess Margaret Cancer Center, Toronto, Ontario, Canada; 6Department of Molecular Microbiology and the Knight Cancer Institute, Oregon Health & Science University, Portland, OR, USA and 7Bristol Myers Squibb, San Francisco, CA, USA

°Currrent address: Nuffield Orthopedic Center, Department of Rheumatology and Musculoskeletal Sciences, University of Oxford, Headington, UK

Abstract

Correspondence: A.G. Thakurta anjan.thakurta@ndorms.ox.ac.uk

Received: May 2, 2023.

Accepted: October 30, 2023.

Early view: November 9, 2023.

https://doi.org/10.3324/haematol.2023.283437

©2024 Ferrata Storti Foundation

Published under a CC BY-NC license

Oral azacitidine (oral-Aza) treatment results in longer median overall survival (OS) (24.7 vs. 14.8 months in placebo) in patients with acute myeloid leukemia (AML) in remission after intensive chemotherapy. The dosing schedule of oral-Aza (14 days/28-day cycle) allows for low exposure of Aza for an extended duration thereby facilitating a sustained therapeutic effect. However, the underlying mechanisms supporting the clinical impact of oral-Aza in maintenance therapy remain to be fully understood. In this preclinical work, we explore the mechanistic basis of oral-Aza/extended exposure to Aza through in vitro and in vivo modeling. In cell lines, extended exposure to Aza results in sustained DNMT1 loss, leading to durable hypomethylation, and gene expression changes. In mouse models, extended exposure to Aza, preferentially targets immature leukemic cells. In leukemic stem cell (LSC) models, the extended dose of Aza induces differentiation and depletes CD34+CD38- LSC. Mechanistically, LSC differentiation is driven in part by increased myeloperoxidase (MPO) expression. Inhibition of MPO activity either by using an MPO-specific inhibitor or blocking oxidative stress, a known mechanism of MPO, partly reverses the differentiation of LSC. Overall, our preclinical work reveals novel mechanistic insights into oral-Aza and its ability to target LSC.

Introduction

Acute myeloid leukemia (AML) is a disease of the elderly with a median age at diagnosis >68 years. Unfavorable cytogenetics and associated comorbidities are among the factors that make elderly patients unfit/ineligible for intensive chemotherapy, known as the 7+3 regimen.1-3 As a result, targeted and less intensive treatments are used as first line therapy for many of these patients. Venetoclax/ azacitidine (Ven/Aza) is one such treatment regimen that has improved outcomes in chemotherapy-ineligible newly diagnosed AML patients.4,5 The backbone of this regimen, Aza, is a hypomethylating agent that incorporates into RNA

and DNA. DNA-incorporated Aza leads to loss of DNMT1 and therefore, genome-wide hypomethylation.6 Through hypomethylation-dependent/independent effects, Aza impacts multiple cellular processes such as apoptosis, DNA damage response, tumor suppressor re-expression, immune modulation, and more.7 Given the genomic and epigenomic dysregulation and heterogeneity in AML, the broad hypomethylating effect and multitude of mechanisms impacted by Aza could be one of the keys to its clinical efficacy. Venetoclax selectively inhibits the anti-apoptotic protein, BCL-2.8 On the other hand, many AML patients eligible for intensive chemotherapy achieve complete remission with the 7+3 regimen.3 However, most of these

Haematologica | 109 April 2024 1082 - Acute Myeloid Leukemia ARTICLE

patients on chemotherapy as well as Ven/Aza therapy eventually relapse.9-11

A multicenter study identified longer relapse-free survival following first remission as one of the key parameters for better prognosis.12 Thus, better maintenance therapy is critical for AML patients. The QUAZAR AML-001 study demonstrated that maintenance therapy with oral-Aza significantly prolonged overall and relapse-free survival.13,14 Interestingly, single agent injectable-Aza did not provide a significant overall survival benefit in maintenance therapy in a similar patient population.15,16 The key translational question posed by this observation is, what specific mechanisms are associated with the oral formulation that may contribute to the observed clinical benefit in AML maintenance. In order to further explore this, we modeled injectable- and oral-Aza in our preclinical studies and explored the mechanism of action of oral-Aza. Equally important is to identify similarities between the two dosing regimens for potential future investigations of oral-Aza with agents that could combine well with injectable-Aza.

Methods

Human and mouse cell lines

AML cell lines were cultured in RPMI1640 (SKM1), Iscove’s Modified Dulbecco’s Medium (IMDM; OCI-AML2, OCI-AML20, MV411) or α-MEM (OP9, OCI-AML3, OCI-AML5) supplemented with 10% or 20% fetal bovine serum, sodium pyruvate, glutamine, and penicillin-streptomycin. OP9 cells were further supplemented with b-mercaptoethanol (b-ME) and OCI-AML20 with b-ME and granulocyte-macrophage colony-stimulating factor (GM-CSF).

Flow cytometry

For OCI-AML20, CD33, and CD45, stains were used to distinguish OP9 cells (mouse) and OCI-AML20 cells (human). OCI-AML20 were then assessed for differentiation and changes in the leukemic stem cell (LSC) population with the following markers: live/dead stain, CD34 and CD38. Flow cytometry was performed in a BD LSRFortessaTM X-20.

Myeloperoxidase inhibition

OCI-AML20 cells were treated with Aza (conventional or extended dose) alone or in combination with 10 µM myeloperoxidase (MPO)-IN-28 (dosed on days 1 and 4). Flow analysis was done on day 7.

Cytokine array

OCI-AML20 cells were seeded at 0.5x106 cells/mL and treated with Aza, conventional or extended dosing. Supernatant from the cells was collected on days 3, 5, and 7. Cytokine array was performed using Proteome Profiler Human XL Cytokine Array Kit (biotechne, ARY022B), according to the manufacturer’s recommendation except that membranes

were incubated with IRDye 800CW Streptavidin (Licor, 92632230) to allow fluorescent detection of the cytokines. Membranes were imaged with Odyssey CLx (Licor).

Primary acute myeloid leukemia cell culture and CD34+ cells enrichment

Frozen primary patient samples (mutations in BCOR, BCORL1, CDKN2A, IKZF1, NOTCH1 RUNX1, SF3B1, STAG2, TET2, TP53) were quickly thawed and followed by CD34+ cells isolation (Stemcell Technologies, 17856) according to the manufacturer’s protocol. Flow cytometry was used to verify enrichment of the CD34+ population before treatment initiation. Cells were resuspended to a concentration of 0.5x106 cells/mL in X-VIVO 10 medium (Lonza, 04-380Q) supplemented with 20% BIT 9500 serum substitute (STEMCELL Technologies, 09500) and cytokines: interleukin-6 (IL-6) (10 ng/mL; PeproTech, 200-06), IL-3 (10 ng/mL; PeproTech, 200-03), stem cell factor (50 ng/mL; Peprotech, 300-07), FLT3-ligand (50 ng/mL; PeproTech, 300-19), granulocyte colony-stimulating factor (10 ng/mL; PeproTech, 300-23), and TPO (25 ng/mL; PeproTech, 300-18). The cells were dosed with Aza (extended or conventional) and flow analysis was performed on day 7 day with live/dead stain, CD34, and CD38 antibodies.

In vivo studies

For in vivo intrafemoral engraftment studies, we modeled injectable-Aza and oral-Aza doses with 3 mg/kg once daily for 5 days (QDx5) and 1 mg/kg QDx15, respectively (intraperitonially in both cases, modified from Vu et al.)13 Twelve-week female immunodeficient NOD.CB17-Prkdcscid/J (NOD-SCID)17 mice used for the transplantation of primary AML cells were obtained from the Ontario Cancer Institute (Toronto, Ontario, Canada). All animal studies were performed in accordance with the Ontario Cancer Institute Animal Use Protocol (AUP): # 1251.33 (NOD-SCID).

For the syngenic mouse model: C1498 (ATCC® TIB-49™) murine acute leukemia cells (American Tissue Culture Collection) expressing firefly luciferase and GFP (designated C1498-Luc3-GFP) were developed at Charles River Laboratories. Mice were injected with 1x106 C1498-Luc3GFP tumor cells via the tail vein. Animals were randomized into treatment groups based on body weight on day 1 post-injection. All drug treatments were initiated on day 5 and were administered QD. Vehicle (phosphate-buffered saline [PBS]) and Aza were administered intraperitoneally.

For the chimeric AML model: FLT3-internal tandem duplication (ITD), TET2, and LysM-cre mice were bred to generate a heterologous genotype of FLT3-ITD-/+TET2-/+LysM-cre-/+ . Bone marrow chimeras were generated by irradiating mice in an X-ray irradiator at a lethal dose of 9 Gy. Bone marrow from FLT3-ITD-/+TET2-/+LysM-cre-/+ (CD45.2) was adoptively transferred via intravenous injection into 8-week-old CD45.1 congenic disparate recipient mice. Mice were monitored for chimerism after week 8 post-adoptive transfer. Aza was administered intraperitonially.

Haematologica | 109 April 2024 1083 ARTICLE - Extended-dose Aza targets leukemic stem cells D.V. Jeyaraju et al.

Results

Extended-dose Aza leads to durable hypomethylation and sustained gene expression independent of the integrated stress response pathway

While both injectable- and oral-Aza have the same active ingredient, their clinical dose and schedules are different, and they do not have similar bioavailability, pharmacokinetic (PK) or pharmacodynamic (PD) profiles.18,19 In a phase I study, compared with non-responders, patients who achieved clinical response with oral-Aza had greater hypomethylation as measured by global demethylation scores.19 This indicated that the dosing schedule might impact the hypomethylative effect of Aza. In order to test this hypothesis, we modeled injectable- and oralAza based on a recent study by Vu and colleagues.20 They modeled the clinical exposures of injectable- and oral-Aza using a “high exposure, limited duration” (HE-LD) regimen mimicking injectable-Aza and a “low exposure, extended duration” (LE-ED) mimicking oral-Aza hereafter referred to as conventional and extended dose respectively.

In order to understand the mechanistic basis of greater hypomethylation by oral-Aza, we treated three different AML cell lines with the in vitro modeling of the conventional- versus extended-dosing regimens. In these Aza-treated samples, genome-wide methylation was measured by whole-genome bisulfite sequencing and gene expression changes by RNA sequencing (RNA-seq) (Figure 1A) on days 3 and 5. While day 3, showed greater genome-wide hypomethylation in the conventional dose in two of the three cell lines (Figure 1B-D, upper panels), by the end of treatment (day 5), the extended-dose Aza regimen demonstrated durable hypomethylation in all three cell lines relative to the conventional Aza (P<0.001) (Figure 1B-D, lower panels, based on b score greater than 0.7; Online Supplementary Figure S1A; Online Supplementary Table S1). This suggested progressive hypomethylation in the extended dose but not in the conventional dose. Similarly, gene expression changes were greater/progressive in the extended dose at the end of treatment (day 5) (Figure 1E). Intrigued by the sustained effects of the low-dose Aza, we explored the status of DNMT1, which is degraded through entrapment by Aza thereby facilitating hypomethylation.6 Biochemical analysis revealed loss of DNMT1 (90% reduction) at early time points (Figure 1F). On day 7, DNMT1 levels recovered to nearly 90% with the conventional dose (Figure 1F) but not in the extended dose. Thus, the extended dose, albeit at lower exposures of Aza, facilitates prolonged loss of DNMT1 and thereby durable hypomethylation. Of note, while up to day 10, DNMT1 levels continue to be low in extended Aza treatment, there is about 20-50% cell death at these time points raising the possibility that at time points beyond day 7, cell death could contribute to loss of DNMT1 (data not shown).

In order to further understand the sustained hypometh -

ylation of the extended-dose Aza, we analyzed the PD basis in an in vivo study measuring [14C] Aza incorporation in peripheral blood mononucelar cells (PBMC) after intraperitoneal administration to male C57BL/6 mice. These mice were treated with the two dosing regimens to mimic the conventional dose (3 mg/kg, QDx5) and extended dose (1 mg/kg, QDx15) regimens of Aza ( Online Supplementary Figure S1B ) with both regimens receiving the same cumulative dose of Aza. Results showed that the relative incorporation of Aza into DNA was greater in the extended dose based on relative area under the curve (AUC) (Figure 1G). Thus, the continued exposure of Aza resulted in a sustained therapeutic effect through greater nucleic acid incorporation thereby explaining the prolonged loss of DNMT1.

RNA incorporation of Aza is a potential mechanism through which, integrated stress response (ISR), one of the known mechanisms of action of Aza, 21 is activated. In a recent study, this has been postulated as a mechanistic basis for synergy with venetoclax. 22 In order to investigate if the extended dose also activates ISR, we treated MV4-11, SKM-1, and AML-193 cell lines with 0.2 µ M or 1 µ M Aza in short-term (24 hours) experiments (Figure 1H). As expected, 1 µ M Aza, mimicking conventional Aza, resulted in increased levels of eIF2 α phosphorylation as well as ATF4, the core and effector of ISR, respectively. 23 With the 0.2 µ M dose, we observed slightly lower levels of phospho-eIF2 α and ATF4. In addition, treatment with ISRIB, 24 a known inhibitor of ISR, reversed ATF4 expression without impacting DNMT1 loss. In order to investigate if ISR could be activated at later stages of the extended dose, we performed a time-course experiment over a period of 7 days (Figure 1I). While the extended dose was able to induce ATF4 expression, it did not result in activation of C/EBP Homologous Protein (CHOP), a downstream effector of ATF4 that leads to cell death 25 which was observed in the 1 µ M dose at 24 hours. These results indicate that while both the conventional and extended dosing trigger a stress response, the extended dose is not robust enough to mediate cell death through the ISR pathway.

Taken together, the above-stated observations indicate that while conventional-Aza works through activation of stress response and hypomethylation mediated changes, the extended dosing of oral-Aza results in sustained gene expression driven temporal effects that could be a key differentiating factor between injectable- and oral-Aza.

Extended dosing of Aza preferentially targets bone marrow blasts than conventional-Aza

In order to further investigate the therapeutic impact of the above-observed differences, we investigated the effect of the two dosing regimens in an in vivo syngeneic and patient-derived xenograft (PDX) model of AML. C1498-Luc3-GFP cells were injected into the tail vein of

Haematologica | 109 April 2024 1084 ARTICLE - Extended-dose Aza targets leukemic stem cells D.V. Jeyaraju et al.
Haematologica | 109 April 2024 1085 ARTICLE - Extended-dose Aza targets leukemic stem cells D.V. Jeyaraju et al. Continued
A B C D E F G H I
on following page.

Figure 1. Extended-dose Aza leads to a more sustained hypomethylation and gene expression. (A) Schematic of experimental design of (B) OCI-AML2, (C) MV-4-11, and (D) SKM-1 cell lines DNA methylation profiles as measured by whole-genome bisulfite sequencing (WGBS) in response to the 2 dosing regimens. Compared to day 3, in day 5 extended dose results in a progressing/ sustained hypomethylation. (E) Barplots indicating the total number of significantly differentially expressed genes in all 3 cell lines at the 2 time points (day 3 and day 5). Three replicates per cell line, per time point, per gene was used to generate the barplots using the R limma package. Note the increase in the number of genes in extended dose but not in conventional dose azacitidine (Aza) at the later time point (“down” indicates downregulated and “up” indicates upregulated). (F) DNMT1 levels were measured by protein simple western blotting at the indicated times in SKM-1 cell line. (G) Area under the curve (AUC) barplots representing the amount of Aza incorporation in peripheral blood mononucear cells (PBMC) using the conventional or extended dose of Aza. AUC data was generated from 3 animals and 5 time points for each dosing regimen (H) Biochemical analysis was performed in MV-4-11, SKM-1, and AML-193 cells treated with low (0.2 µM) or high (1 µM) dose of Aza for 24 hours. Protein lysates were prepared and assessed for treatment-mediated activation of ISR and loss of DNMT1. AML-193 experiment was duplicated (right panel) to assess the effect of ISRIB, an ISR inhibitor, in ablating Aza-induced ISR activation. Tubulin or glyceraldehyde-3-phosphate dehydrogenase (GAPDH) was used as a loading control. (I) AML-193 cells were treated with Aza in conventional or extended regimen and protein lysates were prepared from days 1-7 and assessed for DNMT1 expression and ISR activation markers. EIF2α was used as a loading control. RNA-seq: RNA sequencing.

syngeneic mice which were then treated with the two dosing regimens of Aza. Ventral bioluminescence imaging (BLI) of luciferase-expressing tumor cells demonstrated that both regimens of Aza significantly decreased tumor burden at 15, 18 and 21-days post-injection ( Online Supplementary Figure S2A ). At day 25 post-injection, flow cytometry analysis demonstrated that both dosing regimens significantly decreased the percentage of GFP + C1498 tumor cells in peripheral blood ( Online Supplementary Figure S2B ). Both Aza regimens similarly increased survival of tumor-bearing mice, compared to vehicle controls (Figure 2A) suggesting that both regimens are equally effective in reducing disease burden.

In order to further validate these in vivo observations, we used an IDH1R132H PDX AML model, CTG-2227.26 Cells were injected into the tail vein of sublethally irradiated, immunocompromised mice (NOG-EXL) and the animals were treated with the two dosing regimens. Tumor burden was assessed by measuring spleen weight at the end of the study. Similar to the syngenic model, both dosing regimens caused significant and comparable decreases in spleen weight compared to vehicle-treated animals (Figure 2B). Taken together, the syngeneic and PDX models indicate that despite the difference in dosing schedule, both the Aza dosing regimens are equally effective against bulk AML cells and contribute to lowering disease burden.

Given that oral-Aza is effective in maintenance therapy where leukemic stem/progenitor cells are one of the drivers of relapse, we tested the two dosing regimens in a chimeric AML model. Bone marrow from FLT3 -ITD; TET2 ; LysM-cre compound heterozygous mice on a CD 45.2 background was adoptively transferred to CD45.1 wild-type (WT) recipient mice. Again, the extended-Aza dosing was as effective as the conventional dosing at resolving splenomegaly (Figure 2C), a strong indicator of AML progression; However, the extended-Aza dosing significantly decreased blasts in the bone marrow, whereas conventional dosing did not (Figure 2D). These data suggest that the extended dosing regimen more effectively controls bone marrow disease in this model.

Extended-dose Aza induces differentiation/elimination of leukemic stem cells

LSC are primitive hematopoietic cells related to the origin and relapse in AML.27,28 In order to investigate the impact of the oral-Aza/extended dosing on the LSC compartment, we utilized an in vitro LSC model, OCI-AML20.29 Extended-Aza dosing resulted in depletion of LSC (CD34+/CD38- or CD38 low) and concomitant enrichment of CD34+/CD38+ cells at day 7 (Figure 3A, representative flow plot; Online Supplementary Figure S3A, replicate data). While the conventional-Aza dosing also resulted in depletion of CD34+CD38cells, the extended-Aza dosing had greater depletion of LSC in response to the extended-dose Aza. Notably, no overt cell death/apoptosis observed in these cells (Online Supplementary Figure S3B). In order to further validate the differentiation phenotype, we treated a CD34+ cell-enriched primary AML sample (TP53- and TET2-mutated) with both dosing regimens and identified differentiation of CD34+ cells to CD34- cells (Figure 3B; Online Supplementary Figure S3C). In order to further substantiate these observations, we performed single cell RNA-seq in OCI-AML20 cells at different time points (3, 5, and 7 days). Data were analyzed using a previously described classifier to identify leukemic myeloid cell lineages.30 Compared to untreated cells, the extended dosing resulted in an increase of granulocyte-monocyte progenitor (GMP) and myeloid cells indicating induction of differentiation in immature cells. While the conventional dosing also resulted in similar change in cell type composition, the extended-dosing regimen was associated with significantly greater differentiation compared with the conventional regimen (Figure 3C).

In order to test the effects of oral-Aza like dosing on leukemic progenitors in vivo, we leveraged a mouse xenograft model (NOD/SCID). Following injection of AML patient-derived PBMC into the right femur, the mice were treated with Aza regimens mimicking the injectable/conventional dose (3 mg/kg x5 days) or the oral/extended dose (1 mg/ kg x15/21 days) (Figure 4A). At day 42, animals were sacrificed, and primary engraftment was measured in the left femur/distal site. Both conventional and extended dosing

Haematologica | 109 April 2024 1086 ARTICLE - Extended-dose Aza targets leukemic stem cells D.V. Jeyaraju et al.

Figure 2. Extended dosing of Aza preferentially targets bone marrow blasts. (A) Survival of B6 albino mice injected with C1498Luc3-GFP+ cells and treated with vehicle, conventional-azacitidine (Aza) (5 mg/kg once daily for 4 days [QDx4]) or extended-Aza (1 mg/kg QDx20); N=10 per group. Representative bioluminescence imaging (right panel) of mice are shown (N=1 representative mouse/group). Blue to red color represents low to high intensity of bioluminescence. (B) Mean spleen weights measured at the end of the study for the patient-derived xenograft (PDX) acute myeloid leukemia (AML) mice treated with vehicle, conventional-Aza (5 mg/kg QDx5) or extended-Aza dosing (1 mg/kg QDx25) are shown as group mean ± standard deviation (N=5 to 7/group). Red dotted line indicates normal C57BL/6J mouse spleen weight. **P≤ 0.01. (C) Median spleen weights from GEM model of AML harboring FLT3-ITD and TET2 loss (N=17-19/group) (normal spleen weight of wild-type mice is 72 milligrams). *P≤0.05; **P≤0.01, ***P≤ 0.001 for Aza relative to vehicle/isotype control using non-parametric one-way ANOVA. (D) Flow cytometry was performed on cells collected at the end of week 4 and cell percentages are presented as group medians (N=12/group). ***P≤0.001 for Aza relative to vehicle/isotype control. P values were calculated using non-parametric one-way ANOVA. NS: not significant.

reduced engraftment by about 10-fold relative to the control treatment (Figure 4B).

In order to further validate the differentiation phenotype observed with the extended dose, we analyzed the human PBMC that remained at the site of injection (right femur) in the primary engraftment experiment. Similar to the engraftment, the degree of differentiation induction on progenitors was similar in both regimens. Most of the cells in the sample tested were arrested in the GMP-like phase and both regimens of Aza induced the differentiation

of >50% of these cells into a common myeloid progenitor (CMP) or megakaryocyte-erythrocyte progenitor (MEP) like phenotype (Figure 4C-E). There was also reduction of CD33+CD123+ stem/progenitor cells at the site of injection (Figure 4F). Notably, there was no overt loss of weight in the animals (Figure 4G).

Taken together, our data based on an in vitro LSC model suggest that the efficacy of oral-Aza in AML maintenance is in part linked to the ability of the extended dosing schedule to target LSC. In addition, the in vivo model demonstrates

Haematologica | 109 April 2024 1087 ARTICLE - Extended-dose Aza targets leukemic stem cells D.V. Jeyaraju et al.
B A C D

Aza

leukemic stem cells. (A) OCI-AML20 cells were cultured on OP9 feeder layer and the cells were treated with dimethyl sulfoxide (DMSO) or azacitidine (Aza) (extended or conventional dosing). At day 7, all cells were collected and subjected to flow cytometry. After discriminating live/dead cells and singlets, human cells (to differentiate from mouse OP9 cells) were identified by CD33+/CD45+ staining. Within that population the profile of CD34/ CD38 was identified. (B) CD34+-enriched primary acute myeloid leukemia (AML) sample was treated with both dosing regimens. Flow cytometry was performed on day 7 to identify CD34 and CD38 population (C) Samples from the above-described experiment were collected and subjected to single-cell RNA sequencing (scRNA-seq) as described in the methods. Violin plots indicating the treatment-specific distribution and the Wilcoxon P value of the GSVA enrichment on Van Galen signatures at days 3, 5, and 7. GMP: granulocyte-monocyte progenitors.

Haematologica | 109 April 2024 1088 ARTICLE - Extended-dose Aza targets leukemic stem cells D.V. Jeyaraju et al.
A B C
Figure 3. Extended dosing of induces greater differentiation of

that oral-Aza induces differentiation of LSC and leukemic progenitor cells.

Extended-dose Aza induces differentiation through increased myeloperoxidase activity

In order to understand the molecular determinants of the greater degree of differentiation occurring in the LSC compartment in the extended dose, we sorted CD34+CD38- cells from OCI-AML20 cells (Figure 5A) and treated them with the two Aza dosing regimens and performed bulk RNAseq at day 5. As expected, pathway analysis (GO process) revealed that the most significantly upregulated pathway was cellular differentiation in the CD34+CD38- cells upon 5 days of extended dosing but not in the conventional dosing (Figure 5B).

In order to investigate drivers of the upregulated cell differentiation pathway, we analyzed secreted factors from cell culture supernatants of OCI-AML20 cells treated with both the Aza-dosing regimens in a feeder layer-free culture using the Proteome Profiler™ antibody array. Among the differentially secreted factors, MPO, a hallmark enzyme of the myeloid lineage was the secreted factor that was also the most upregulated by gene expression analysis in LSC that were treated with the extended-dose Aza (Online Supplementary Figure S4A). In addition, western blot analysis confirmed that MPO is upregulated in OCI-AML20 cells as well as in CD34+ cells from a primary sample (TP53- and TET2-mutated) in response to the extended dose (Figure 5C). Given MPO’s association to myeloid differentiation, we hypothesized that upregulation of MPO could be implicated in extended Aza-induced LSC differentiation. In order to test this hypothesis, we used an inhibitor of MPO, MPO-IN-2831 and treated OCI-AML20 cells with MPO-IN-28 and the both the Aza doses. Inhibition of MPO countered the differentiation induction by extended-dose Aza (Figure 5D; Online Supplementary Figure S4B) by more than 20% reduction in the non-LSC population (CD34+CD38+ or CD34-). Being a peroxidase, MPO has been shown to induce reactive oxygen species (ROS) generation in myeloid cells,32 a potential mechanism that has been shown to induce differentiation of LSC.33,34 In order to investigate if MPO-induced ROS could facilitate differentiation in LSC, OCI-AML20 cells were concurrently treated with N-acetylcysteine (NAC) and the two Aza dosing regimens. ROS scavenging with NAC, blocked differentiation of LSC with the extended dose but not with the conventional dose further validating our hypothesis (Figure 5E; Online Supplementary Figure S4C). Taken together, our results suggest that extended dose Aza induces differentiation of LSC through upregulation of MPO and ROS.

Discussion

In AML maintenance therapy, the primary goal is to elim-

inate residual leukemic cells in the bone marrow thereby eliminating minimal residual disease (MRD) and reducing the risk of relapse. However, rare therapy-resistant cells that reside within the MRD, also known as LSC, can drive clonal leukemic repopulation resulting in relapse.28,35 Thus, understanding the biology of these LSC and identifying therapeutic agents that effectively target LSC during induction or maintenance therapy would be important in reducing rates of relapse in AML. While oral-Aza is effective in AML maintenance therapy, the mechanistic basis was not clear. Our preclinical work, for the first time demonstrates oralAza’s ability to target LSC.

Even though both injectable- and oral-Aza have the same active ingredient, the dosing schedule results in varying PK and PD profiles as well as therapeutic effects. Based on the preclinical data presented here, oral-Aza acts primarily through sustained hypomethylation-mediated gene expression changes and injectable-Aza acts through stress response as well as hypomethylation (not as sustained as oral-Aza). Consistent with our observations, a study with low-risk MDS patients reported sustained hypomethylation imparted by oral-Aza over the entire treatment cycle (up to 21 days). In addition, patients administered with oral-Aza and with resultant reduction in DNA methylation had better hematologic response.36 Similarly, sustained hypomethylation with oral-Aza were observed in another independent study.19

Given the biochemical differences observed (Figure 1) between the two dosing regimens, our in vivo studies yielded interesting similarities and differences (Figure 2) highlighting the functional impact of the two dosing regimens based on differentiation state of the cell. Both oral- and injectable-Aza were equally efficacious in targeting bulk AML cells in the syngeneic and the PDX model, both of which used bulk AML cells. However, when we looked at less differentiated bone marrow blast cells in the FLT3-ITD; TET2 model, the extended dose was effective in targeting this less differentiated population. When we applied this finding to an in vitro LSC model (OCI-AML20), we observed similar results and demonstrated that oral-Aza is more effective in eliminating immature myeloid cells and inducing differentiation of leukemic stem cells through upregulation of MPO. MPO, being a ROS generator, in turn likely acts through ROS to induce differentiation of LSC. Inhibition of MPO activity as well as ROS scavenging both rescue/block oral-Aza-mediated differentiation of LSC. Thus, a key understanding from our work is that the impact of oral-Aza is cell type specific.

Aza in combination with other agents has been shown to target LSC and induce differentiation.37,38 However, the specific Aza-associated mechanism was not clear. A key understanding from our work is the differential effect of oral-Aza on LSC versus non-LSC. In the in vitro model (OCIAML20) enriched in LSC, the extended dose was more effective than the conventional dose. In order to recapitulate

Haematologica | 109 April 2024 1089 ARTICLE - Extended-dose Aza targets leukemic stem cells D.V. Jeyaraju et al.
Haematologica | 109 April 2024 1090 ARTICLE - Extended-dose Aza targets leukemic stem cells D.V. Jeyaraju et al.
A B C D E F G
Continued on following page.

Figure 4. Extended-dose Aza is equally effective as conventional dosing in targeting acute myeloid leukemia cells and stem/ progenitor cells in vivo. (A) Schematic of experiment. Primary acute myeloid leukemia (AML) cells were injected into the right femurs of sub-lethally irradiated NOD/SCID mice. Twenty days after injection, mice (10 animals per group) were treated with vehicle or 2 different doses of azacitidine (Aza) mimicking conventional/injectable dosing (3 mg/kg 5 doses for 5 consecutive days) or extended dosing (1 mg/kg 15 doses over 21 days [5/7 days per week]). At the end of treatment (42 days from day of injection), flow cytometry was performed in both right and left femurs to measure engraftment. (B) Plots indicate the percentage of human cells that engrafted in the left femur (distal site). The red bar indicates the median values, and each data point indicates a mouse. In order to measure the ability of Aza to target the persistence of leukemic cells at the site injection, human cells in the right femur (site of injection) were assessed with the indicated surface markers to identify (C) granulocyte-monocyte progenitors (GMP), (D) common myeloid progenitors (CMP) and (E) megakaryocyte-erythrocyte progenitors (MEP) (F) CD123 (IL-3 receptor α chain), a marker for AML stem and progenitor cells, was also reduced at the site of injection demonstrating equivalent efficacy for the conventional dosing and the extended dosing of Aza. (G) Animal body weight was monitored during treatment as a proxy for animal health. The dotted line indicates 90% (10% change). Data represent median ± standard deviation. *P<0.05 and **P<0.01 by unpaired t test.

the in vitro findings, we performed engraftment studies of primary AML samples using bulk mononuclear cells which predominantly includes progenitors and blasts. The two dosing regimens performed similarly in reducing disease burden. Notably, conventional Aza is administered for 7 days in the clinic while our animal models received Aza only for 5 days based on our modeling. While we attempted to perform secondary engraftment, a measure of the capacity of re-initiation of leukemia by LSC when serially transplanted into mice, we did not achieve any engraftment in the conventional or extended-dose regimens even at the site of injection in the secondary mice likely because of the robust effect of both dosing regimens in the primary engraftment (data not shown). Thus, we could not leverage

our transplant models to interrogate effects on LSC in vivo. Multiple studies have demonstrated that LSC rely on oxidative phosphorylation, a process that could generate more ROS and result in loss of stemness.33,39,40 However, LSC have developed unique mechanisms to maintain stemness by countering increased ROS such as increased antioxidant enzymes, increased levels of mitophagy and others.41-44 Thus, when oxidative stress/damage/signaling increases, stem cells tend to differentiate.45,46,33 MPO is a hallmark enzyme of the myeloid lineage and patients with high MPO have been shown to have superior overall survival47 and has been shown to be expressed at high levels in cells committed to granulomonocytic differentiation and activation of MPO facilitates oxidative damage.48 In

Haematologica | 109 April 2024 1091 ARTICLE - Extended-dose Aza targets leukemic stem cells D.V. Jeyaraju et al.
Continued
on following page.
A B C

Figure 5. Extended-dose Aza upregulates myeloperoxidase expression to induce leukemic stem cell differentiation, which can be partly rescued by myeloperoxidase inhibition or reactive oxygen species scavenging. (A) OCI-AML20 cells were sorted to retrieve the CD34+38- population. (B) Sorted cells were treated with azacitidine (Aza) (extended or conventional dose) and bulk RNA sequencing was performed at day 5 followed by pathway enrichment analysis (gene ontology [GO] process) to assess Aza-induced pathways. (C) OCI-AML20 cells were treated with Aza (conventional or extended regimen) and myeloperoxidase (MPO) expression was assessed by capillary electrophoresis on day 7, glyceraldehyde-3-phosphate dehydrogenase (GAPDH) was used as a loading control. (D) Representative flow data from 1 experiment with OCI-AML20 cells were treated with extended or conventional regimen of Aza with or without 10 µM MPO-IN-28 or (E) N-acetylcysteine (NAC) on days 2 and 4 and flow cytometry assessment was conducted on day 7 using live/dead, CD45, CD34 and CD38 staining. DMSO: dimethyl sulfoxide.

addition, MPO has been shown to be increased in response to Aza in a few cases through promoter demethylation by DNMT-inhibitors.49,50 Our work uniquely demonstrates MPO upregulation in the LSC compartment upon Aza treatment which induce differentiation through oxidative stress as evidenced by a block in differentiation through ROS scavenging. A limitation of our study is that the cell lines and the LSC model that we have used are not truly representative of de novo AML and do not carry the common molecular mutations observed in elderly AML patients. To this end we attempted to replicate our key findings in commercially available multiple primary AML samples. However, we were successful in culturing CD34+ cells from only one primary sample (TET2- and TP53-mutated and not the commonly observed DNMT3A/NPM1/FLT3-ITD mutation) for 7 days and replicated our key findings.

Overall, we have highlighted mechanistic insights of oralAza that make it an effective maintenance therapy. Aza is known to have additional mechanisms of action beyond the ones described here including immune modulation, viral mimicry, and others. While we have primarily focused on tumor intrinsic mechanisms as part of this work, our data warrant exploring other mechanisms where Aza is implicated and identify further unique properties of oral-Aza.

Disclosures

DVJ, MA, AP, AR, PS, AA, KG, CK, DH, DLM, PRH and AG are current employees of Bristol Myers Squibb and received equity compensation. ADS has received research funding from Takeda Pharmaceuticals, BMS and Medivir AB, and consulting fees/honorarium from Takeda, Novartis, Jazz, and Otsuka Pharmaceuticals; and is named on a patent application for

Haematologica | 109 April 2024 1092 ARTICLE - Extended-dose Aza targets leukemic stem cells D.V. Jeyaraju et al.
D E

the use of DNT cells to treat AML. AGT and AA are former employees of BMS and received equity compensation. EFL received research funding from Celgene/BMS.

Contributions

DVJ, MA, AP, AR, PS, CK, DH, RH, XW, MG, AA, GT and HC designed and performed the research, analyzed data,

References

1. Appelbaum FR, Gundacker H, Head DR, et al. Age and acute myeloid leukemia. Blood. 2006;107(9):3481-3485.

2. Siegel RL, Miller KD, Jemal A. Cancer statistics, 2020. CA Cancer J Clin. 2020;70(1):7-30.

3. Pollyea DA, Bixby D, Perl A, et al. NCCN guidelines insights: acute myeloid leukemia, Version 2.2021. J Natl Compr Canc Netw. 2021;19(1):16-27.

4 DiNardo CD, Wang J, Pratz KW. Azacitidine and venetoclax in AML. Reply. N Engl J Med. 2020;383(21):2088-2089.

5. Mustafa Ali MK, Corley EM, Alharthy H, et al. Outcomes of newly diagnosed acute myeloid leukemia patients treated with hypomethylating agents with or without venetoclax: a Propensity Score-Adjusted Cohort Study. Front Oncol. 2022;12:858202.

6. Patel K, Dickson J, Din S, et al. Targeting of 5-aza-2’deoxycytidine residues by chromatin-associated DNMT1 induces proteasomal degradation of the free enzyme. Nucleic Acids Res. 2010;38(13):4313-4324.

7 Issa JP, Kantarjian H. Azacitidine. Nat Rev Drug Discov. 2005 May:Suppl:S6-7.

8. Souers AJ, Leverson JD, Boghaert ER, et al. ABT-199, a potent and selective BCL-2 inhibitor, achieves antitumor activity while sparing platelets. Nat Med. 2013;19(2):202-208.

9 Dohner H, Weisdorf DJ, Bloomfield CD. Acute myeloid leukemia. N Engl J Med. 2015;373(12):1136-1152.

10. Lowenberg B, Ossenkoppele GJ, van Putten W, et al. High-dose daunorubicin in older patients with acute myeloid leukemia. N Engl J Med. 2009;361(13):1235-1248.

11. Reville PK, Kadia TM. Maintenance therapy in AML. Front Oncol. 2020;10:619085.

12. Breems DA, Van Putten WL, Huijgens PC, et al. Prognostic index for adult patients with acute myeloid leukemia in first relapse. J Clin Oncol. 2005;23(9):1969-1978.

13. Wei AH, Dohner H, Pocock C, et al. Oral azacitidine maintenance therapy for acute myeloid leukemia in first remission. N Engl J Med. 2020;383(26):2526-2537.

14 Roboz GJ, Montesinos P, Selleslag D, et al. Design of the randomized, phase III, QUAZAR AML Maintenance trial of CC486 (oral azacitidine) maintenance therapy in acute myeloid leukemia. Future Oncol. 2016;12(3):293-302.

15. Burnett A, Russell N, Freeman S, et al. A comparison of limited consolidation chemotherapy therapy or not, and demethylation maintenance or not in older patients with Aml and high risk Mds: long term results of the Uk Ncri Aml16 Trial. EHA Library. 2015;103225:S513.

16. Huls G, Chitu DA, Havelange V, et al. Azacitidine maintenance after intensive chemotherapy improves DFS in older AML patients. Blood. 2019;133(13):1457-1464.

17 Nicolini FE, Cashman JD, Hogge DE, et al. NOD/SCID mice engineered to express human IL-3, GM-CSF and Steel factor

and wrote the paper. AA, EFL, KG, DLM, ADS, PRH, AG and AGT designed the research, analyzed data and wrote the paper.

Data-sharing statement

Original data are available upon request to the first and corresponding authors.

constitutively mobilize engrafted human progenitors and compromise human stem cell regeneration. Leukemia. 2004;18(2):341-347.

18. Garcia-Manero G, Gore SD, Cogle C, et al. Phase I study of oral azacitidine in myelodysplastic syndromes, chronic myelomonocytic leukemia, and acute myeloid leukemia. J Clin Oncol. 2011;29(18):2521-2527.

19 Laille E, Shi T, Garcia-Manero G, et al. Pharmacokinetics and pharmacodynamics with extended dosing of CC-486 in patients with hematologic malignancies. PLoS One. 2015;10(8):e0135520.

20 Vu T, Straube J, Porter AH, et al. Hematopoietic stem and progenitor cell-restricted Cdx2 expression induces transformation to myelodysplasia and acute leukemia. Nat Commun. 2020;11(1):3021.

21. Lee TT, Karon MR. Inhibition of protein synthesis in 5-azacytidine-treated HeLa cells. Biochem Pharmacol. 1976;25(15):1737-1742.

22. Jin S, Cojocari D, Purkal JJ, et al. 5-Azacitidine induces NOXA to prime AML cells for venetoclax-mediated apoptosis. Clin Cancer Res. 2020;26(13):3371-3383.

23. Costa-Mattioli M, Walter P. The integrated stress response: from mechanism to disease. Science. 2020;368(6489):eaat5314.

24. Sidrauski C, Tsai JC, Kampmann M, et al. Pharmacological dimerization and activation of the exchange factor eIF2B antagonizes the integrated stress response. Elife. 2015;4:e07314.

25. Zinszner H, Kuroda M, Wang X, et al. CHOP is implicated in programmed cell death in response to impaired function of the endoplasmic reticulum. Genes Dev. 1998;12(7):982-995.

26. Gruber E, So J, Lewis AC, et al. Inhibition of mutant IDH1 promotes cycling of acute myeloid leukemia stem cells. Cell Rep. 2022;40(7):111182.

27. Bonnet D, Dick JE. Human acute myeloid leukemia is organized as a hierarchy that originates from a primitive hematopoietic cell. Nat Med. 1997;3(7):730-737.

28. Shlush LI, Mitchell A, Heisler L, et al. Tracing the origins of relapse in acute myeloid leukaemia to stem cells. Nature. 2017;547(7661):104-108.

29 Luciani GM, Xie L, Dilworth D, et al. Characterization of inv(3) cell line OCI-AML-20 with stroma-dependent CD34 expression. Exp Hematol. 2019;69:27-36.

30 van Galen P, Hovestadt V, Wadsworth Ii MH, et al. Single-cell RNA-Seq reveals AML hierarchies relevant to disease progression and immunity. Cell. 2019;176(6):1265-1281.

31. Soubhye J, Chikh Alard I, Aldib I, et al. Discovery of novel potent reversible and irreversible myeloperoxidase inhibitors using virtual screening procedure. J Med Chem. 2017;60(15):6563-6586.

32. Nakazato T, Sagawa M, Yamato K, et al. Myeloperoxidase is a key regulator of oxidative stress mediated apoptosis in myeloid

Haematologica | 109 April 2024 1093 ARTICLE - Extended-dose Aza targets leukemic stem cells D.V. Jeyaraju et al.

leukemic cells. Clin Cancer Res. 2007;13(18 Pt 1):5436-5445.

33. Lagadinou ED, Sach A, Callahan K, et al. BCL-2 inhibition targets oxidative phosphorylation and selectively eradicates quiescent human leukemia stem cells. Cell Stem Cell. 2013;12(3):329-341.

34 Owusu-Ansah E, Banerjee U. Reactive oxygen species prime Drosophila haematopoietic progenitors for differentiation. Nature. 2009;461(7263):537-541.

35. Ng SW, Mitchell A, Kennedy JA, et al. A 17-gene stemness score for rapid determination of risk in acute leukaemia. Nature. 2016;540(7633):433-437.

36. Garcia-Manero G, Gore SD, Kambhampati S, et al. Efficacy and safety of extended dosing schedules of CC-486 (oral azacitidine) in patients with lower-risk myelodysplastic syndromes. Leukemia. 2016;30(4):889-896.

37. MacBeth KJ, Chopra VS, Tang L, et al. Combination of azacitidine and enasidenib enhances leukemic cell differentiation and cooperatively hypomethylates DNA. Exp Hematol. 2021;98:47-52.

38. Pollyea DA, Stevens BM, Jones CL, et al. Venetoclax with azacitidine disrupts energy metabolism and targets leukemia stem cells in patients with acute myeloid leukemia. Nat Med. 2018;24(12):1859-1866.

39 Sriskanthadevan S, Jeyaraju DV, Chung TE, et al. AML cells have low spare reserve capacity in their respiratory chain that renders them susceptible to oxidative metabolic stress. Blood. 2015;125(13):2120-2130.

40 Culp-Hill R, D’Alessandro A, Pietras EM. Extinguishing the embers: targeting AML metabolism. Trends Mol Med. 2021;27(4):332-344.

41. Pei S, Minhajuddin M, Adane B, et al. AMPK/FIS1-mediated mitophagy is required for self-renewal of human AML stem cells. Cell Stem Cell. 2018;23(1):86-100.

42. Tothova Z, Gilliland DG. FoxO transcription factors and stem cell homeostasis: insights from the hematopoietic system. Cell Stem Cell. 2007;1(2):140-152.

43. Aloum L, Brimson CA, Zhyvoloup A, et al. Coenzyme A and protein CoAlation levels are regulated in response to oxidative stress and during morphogenesis in Dictyostelium discoideum. Biochem Biophys Res Commun. 2019;511(2):294-299.

44. Folkerts H, Hilgendorf S, Wierenga ATJ, et al. Inhibition of autophagy as a treatment strategy for p53 wild-type acute myeloid leukemia. Cell Death Dis. 2017;8(7):e2927.

45. Diehn M, Cho RW, Lobo NA, et al. Association of reactive oxygen species levels and radioresistance in cancer stem cells. Nature. 2009;458(7239):780-783.

46. Kim YS, Kang MJ, Cho YM. Low production of reactive oxygen species and high DNA repair: mechanism of radioresistance of prostate cancer stem cells. Anticancer Res. 2013;33(10):4469-4474.

47. Matsuo T, Kuriyama K, Miyazaki Y, et al. The percentage of myeloperoxidase-positive blast cells is a strong independent prognostic factor in acute myeloid leukemia, even in the patients with normal karyotype. Leukemia. 2003;17(8):1538-1543.

48. Yu G, Liang Y, Zheng S, et al. Inhibition of myeloperoxidase by N-Acetyl lysyltyrosylcysteine amide reduces oxidative stressmediated inflammation, neuronal damage, and neural stem cell injury in a murine model of stroke. J Pharmacol Exp Ther. 2018;364(2):311-322.

49 Aumer T, Gremmelmaier CB, Runtsch LS, et al. Comprehensive comparison between azacytidine and decitabine treatment in an acute myeloid leukemia cell line. Clin Epigenetics. 2022;14(1):113.

50 Leung KK, Nguyen A, Shi T, et al. Multiomics of azacitidinetreated AML cells reveals variable and convergent targets that remodel the cell-surface proteome. Proc Natl Acad Sci U S A. 2019;116(2):695-700.

Haematologica | 109 April 2024 1094 ARTICLE - Extended-dose Aza targets leukemic stem cells D.V. Jeyaraju et al.

Prognostic value of European LeukemiaNet 2022 criteria and genomic clusters using machine learning in older adults with acute myeloid leukemia

Correspondence: B.S. Cho cbscho@catholic.ac.kr

1Department of Hematology, Catholic Hematology Hospital, Seoul St. Mary’s Hospital, College of Medicine, The Catholic University of Korea, Seoul, South Korea; 2Leukemia Research Institute, College of Medicine, The Catholic University of Korea, Seoul, South Korea; 3Division of Hematology/Oncology, Department of Medicine, Vanderbilt University Medical Center, Nashville, TN, USA; 4Department of Laboratory Medicine, College of Medicine, The Catholic University of Korea, Seoul, South Korea; 5Department of Chemical Engineering, Hongik University, Seoul, South Korea; 6ImpriMedKorea Inc., Seoul, South Korea and 7Vanderbilt University, Nashville, TN, USA

*SP and TYK contributed equally as first authors.

Abstract

Received: May 25, 2023.

Accepted: September 6, 2023. Early view: September 14, 2023.

https://doi.org/10.3324/haematol.2023.283606

©2024 Ferrata Storti Foundation

Published under a CC BY-NC license

This study aimed to validate the new European Leukemia Net (ELN) 2022 criteria for genetic risk stratification in older adults with acute myeloid leukemia (AML) and to determine the most likely set of clusters of similar cytogenetic and mutation properties correlated with survival outcomes in three treatment groups: intensive chemotherapy (IC), hypomethylating agents (HMA) alone, and HMA plus venetoclax (HMA/VEN). The study included 279 patients (aged ≥60 years) who received IC (N=131), HMA (N=76), and HMA/VEN (N=72) between July 2017 and October 2021. No significant differences were observed in survival among the groups according to ELN 2022 risk stratification. Unsupervised hierarchical clustering analysis identified nine genomic clusters (C1-9) with varying survival outcomes depending on treatment type. For example, C4 (predominant for core binding factor-AML) displayed a favorable prognosis in the IC group, but not in the HMA or HMA/VEN groups. The HMA/VEN group had better outcomes than the HMA group in many clusters (C1, 2, 3, and 5); however, the addition of VEN to HMA or IC did not improve the survival outcomes compared with those of HMA alone in C7 and C9 (predominant for -5, del(5q), -7, -17/abn(17p), complex karyotypes, and mutated TP53). The study highlights the limitations of ELN genetic risk stratification in older adults with AML. It emphasizes the need for a more comprehensive approach that considers co-occurring somatic mutations to guide treatment selection in older adults with AML.

Introduction

Acute myeloid leukemia (AML) is a heterogeneous group of diseases with variable prognoses,1-3 resulting primarily from the complexity of the clonal architectures due to various chromosomal abnormalities, genetic mutations, or epigenetic changes.1-4 In addition to this biological heterogeneity, age is an important prognostic indicator.5,6 For instance, older adults with AML have been considered a distinct entity representing a vulnerable population characterized by inferior response and lower tolerance to conventional chemotherapy.6,7 Therefore, treating older adults with AML is challenging. Classically, medical fitness is regarded as the major factor in determining candidacy for intensive chemotherapy (IC). Older adults with AML can receive IC if they meet the assessment criteria be-

cause IC is considered the best choice for obtaining a higher chance of remission and longer survival.7-10 However, with the introduction of novel agents in recent years,11 less intensive therapeutics, such as a combination of venetoclax (VEN) and hypomethylating agents (HMA),12-14 have been used more frequently than IC, not only in patients with poor-risk cytogenetics, but also for those with NPM1 and/or IDH mutations known to benefit from VEN-based regimens.15,16 Consequently, fitness cannot be the sole basis for treatment decisions, and clinicians have to consider best-fit treatment options on an individualized basis according to the patient’s disease-specific features, including cytogenetics and the mutational profile.17 As more information about AML genomic landscapes becomes available, the prognostication system for AML has continued to evolve. Until recently, the European LeukemiaNet (ELN)

Haematologica | 109 April 2024 1095 - Acute Myeloid Leukemia ARTICLE
Silvia Park,1,2,3* Tong Yoon Kim,1,2* Byung-Sik Cho,1,2 Daehun Kwag,1,2 Jong-Mi Lee,4 Myungshin Kim,4 Yonggoo Kim,4 Jamin Koo,5,6 Anjali Raman3,7 Tae Kon Kim,3,7 and Hee-Je Kim1,2

2017 genetic risk stratification2 (now up-dated to the 2022 version3) was regarded as the gold standard for AML prognostication, and proved to be effective in predicting outcomes in independent validation cohorts of AML patients aged <65 years.18,19 Although it is broadly accepted that the ELN risk model fits well and can serve as a basis for guiding treatment strategies in young patients with AML, the same risk strata are not as informative for older patients.20,21 Therefore, the newly up-dated ELN 2022 guideline should be validated using multiple cohorts, and if outcomes are not predictable, there is an urgent need for appropriate tools to guide physicians in precisely tailoring a treatment strategy for this patient population.

Machine learning (ML) methods are effective for analyzing vast amounts of data and identifying complex relationships between variables. These advantages can promote better understanding of individual heterogeneities within a given disease. They can also delineate diagnostic and prognostic subgroups more precisely, and these can be used to develop individualized therapeutic strategies.22-24 Some studies have classified the genomic landscapes of patients with AML using the unsupervised ML method and attempted to categorize survival outcomes of each cluster.22,25-27 However, these studies focused on relatively young patients with AML. Given the need to validate the ELN 2022 classification in older patients with AML, and the scarcity of genomic classification data for this population, we aimed to investigate the effectiveness of ELN 2022 in this population and attempted to identify distinct genomic subtypes of older patients with AML via unsupervised clustering. In addition, we compared the patient outcomes of three treatment modalities, namely, IC, HMA alone, and HMA plus VEN, within the identified genomic subtypes and evaluated the potential impact of genomic clustering by ML on the care of elderly patients.

Methods

Patient selection

The patient selection criteria were: a) older ≥ 60 years patients with AML newly diagnosed at Seoul St. Mary’s Hospital between July 2017 and October 2021; b) having available information on chromosome and gene mutations at diagnosis; and c) having received either IC, HMA alone, or HMA plus VEN (HMA/VEN) as their first-line treatment. Patient consent was not required because of the retrospective nature of the study. Patients who received only the best supportive care were not included in this study, which was approved by the Institutional Review Board and Ethics Committee of the Catholic Medical Center in South Korea (KC21RISI0572).

Molecular and cytogenetic studies

Bone marrow karyotyping was performed on G-banded metaphase chromosomes using conventional techniques. The karyotypes were interpreted using the International Standing

Committee on Human Cytogenomic Nomenclature (ISCN) 2016.28 For molecular analysis, next-generation sequencing was performed using a customized myeloid panel (SM panel), as described in our previous report.29 The SM panel contains 67 genes that are frequently mutated in patients with AML. (See the Online Supplementary Appendix for details.)

For the detection of the FMS-like tyrosine kinase 3-internal tandem duplication (FLT3-ITD) mutation, polymerase chain reaction (PCR) for fragment analysis was performed using a previously published modified protocol, as detailed in the Online Supplementary Appendix. 30

Definition of outcomes and statistical analyses

The baseline clinical and molecular characteristics of the older patients with AML were compared using the χ2 test or Fisher exact test for categorical variables and a two-sample t test or Mann-Whitney U test for continuous variables. The P value was corrected using the Bonferroni method when multiple tests were indicated. Overall survival (OS) was defined as the time from the initiation of treatment to death from any cause. OS was estimated using the Kaplan-Meier method, and the groups were compared using the log-rank test. The Cox proportional hazards model was used for the univariate and multivariate analyses of OS. Variables with P<0.10 by univariate analysis were considered for entry into the multivariate analysis.

Unsupervised clustering and stratification

Unsupervised techniques were evaluated in our cohort and internally validated without testing external data. The abnormalities in karyotypes and genetic mutations that were used for risk stratification in ELN 2022 and additional mutations found in >3% of all patients in our cohort were used for the analysis. Detailed genomic variables are described in Online Supplementary Table S1. The number of clusters was determined using the parameter NbClust,31 which explored a range of 3-12 clusters. The optimal number of clusters was chosen based on a voting process involving several measures, including the maximum value of the index, the maximum difference between the hierarchy levels of the index, and the minimum value of second differences between levels of the index. This process is further explained in detail in Online Supplementary Table S2 and Online Supplementary Figure S1

The Ward1 algorithm with Euclidean distances were used for hierarchical agglomerative clustering and compared with k-means, clustering with partitioning around medoids (PAM), self-organizing maps (SOM), and the Gaussian mixture model (GMM). (See the Online Supplementary Appendix for details.) For internal validation, the clustering algorithms were compared by the clValid package.32 The correlation network map demonstrated the weight if the correlation coefficient was >0.02. The analysis was performed using R software for statistical computing (v.0.2; R Foundation for Statistical Computing, Vienna, Austria).

Haematologica | 109 April 2024 1096 ARTICLE - Genomic clustering in older adults with AML S. Park et al.

Results

Patient characteristics and their comparison between the treatment groups

A total of 279 patients who met the inclusion criteria were selected; median age at diagnosis was 68 years (range 6084 years). As first-line treatment, 131 patients received IC (47.0%), 76 patients received HMA alone (27.2%), and 72 patients received HMA/VEN (25.8%). Median age of patients who received IC, HMA alone, and HMA/VEN was 64, 75, and 70 years, respectively (Table 1). Median age of patients in the HMA group was significantly higher than that of patients in the other groups. Most patients had de novo AML (N=238, 85.3%). There were more patients with secondary AML in the HMA/VEN group (30.6%) than in the other groups (IC: 9.2%;

HMA: 9.2%). Among the genetic mutations at AML diagnosis, the distribution of FLT3-ITD and PTPN11 mutations differed significantly among the three groups. The frequency of mutated FLT3-ITD was the lowest in patients receiving HMA/ VEN (IC: 16%; HMA: 19.7%; HMA/VEN: 2.8%; P=0.018), whereas the PTPN11 mutation was observed the least in the IC group (IC: 2.3%; HMA: 13.2%; HMA/VEN: 8.3%; P=0.03).

Survival outcomes after each treatment in older patients with acute myeloid leukemia according to European Leukemia Net 2022 criteria risk stratification

The clinical outcomes of each treatment are shown in Figure 1. After a median follow-up of 26.3 months, the median OS in the IC, HMA, and HMA/VEN groups was 20 months (95% CI: 14.9-32.5), 8.8 months (95% CI: 6.0-11.3), and 10 months

Karyotype abnormality, N (%) Complex -5 or del(5q);-7;-17/abn(17p)

Mutation, N (%)

IC: intensive chemotherapy; HMA: hypomethylating agent; HMA/VEN: HMA plus venetoclax; N: number; RUNX1-RUNX1T1: t(8;21)(q22;q22) rearrangement; CBFB-MYH11: inv(16)(p13.1q22) or t(16;16)(p13.1;q22) rearrangement; VAF: variant allele frequency.

Haematologica | 109 April 2024 1097 ARTICLE - Genomic clustering in older adults with AML S. Park et al.
Variables IC N=131 HMA N=76 HMA/VEN N=72 IC vs. HMA HMA vs. HMA/VEN HMA/VEN vs. IC P P P P Age at diagnosis in years, median (range) 64.0 (62.0-67.0) 75.0 (71.0-77.0) 70.0 (66.5-74.0) <0.001 <0.001 <0.001 <0.001 Sex, female, N (%) 54 (41.2) 25 (32.9) 40 (55.6) 0.298 0.009 0.019 0.057 Disease type, N (%) De novo Secondary 119 (90.8) 12 (9.2) 69 (90.8) 7 (9.2) 50 (69.4) 22 (30.6) >0.999 0.002 <0.001 <0.001
Monosomal RUNX1-RUNX1T1 CBFB-MYH11 8 (6.1) 6 (4.6) 5 (3.8) 10 (7.6) 6 (4.6) 9 (11.8) 4 (5.3) 5 (6.6) 4 (5.3) 1 (1.3) 6 (8.3) 10 (13.9) 10 (13.9) 3 (4.2) 4 (5.6) 0.236 >0.999 0.577 0.713 0.393 0.664 0.131 0.23 >0.999 0.331 0.757 0.037 0.019 0.506 >0.999 >0.999 0.111 0.084 >0.999 >0.999
NPM1 NPM1mut without FLT3-ITD DNMT3A TET2 FLT3-ITD FLT3-TKD IDH1 IDH2 RUNX1 ASXL1 NRAS PTPN11 SRSF2 BCOR TP53 TP53 (VAF ≥10%) U2AF1 Non-bZIP CEBPA bZIP in-frame CEBPA JAK2 SETBP1 31 (23.7) 14 (10.7) 23 (17.6) 20 (15.3) 21 (16.0) 4 (3.1) 8 (6.1) 23 (17.6) 12 (9.2) 11 (8.4) 5 (3.8) 3 (2.3) 9 (6.9) 5 (3.8) 4 (3.1) 3 (2.3) 3 (2.3) 4 (3.1) 3 (2.3) 5 (3.8) 2 (1.5) 20 (26.3) 10 (13.2) 18 (23.7) 20 (26.3) 15 (19.7) 6 (7.9) 7 (9.2) 6 (7.9) 12 (15.8) 12 (15.8) 8 (10.5) 10 (13.2) 5 (6.6) 7 (9.2) 7 (9.2) 7 (9.2) 7 (9.2) 4 (5.3) 3 (3.9) 1 (1.3) 5 (6.6) 10 (13.9) 8 (11.1) 19 (26.4) 16 (22.2) 2 (2.8) 2 (2.8) 3 (4.2) 5 (6.9) 8 (11.1) 6 (8.3) 7 (9.7) 6 (8.3) 5 (6.9) 5 (6.9) 5 (6.9) 1 (1.4) 4 (5.6) 3 (4.2) 0 (0.0) 4 (5.6) 2 (2.8) 0.795 0.757 0.376 0.079 0.626 0.219 0.581 0.085 0.226 0.161 0.105 0.005 >0.999 0.196 0.114 0.057 0.057 0.674 0.798 0.546 0.124 0.094 0.897 0.849 0.698 0.003 0.311 0.371 >0.999 0.554 0.256 >0.999 0.497 >0.999 0.839 0.839 0.082 0.593 >0.999 0.263 0.331 0.483 0.14 >0.999 0.192 0.294 0.009 >0.999 0.795 0.059 0.841 >0.999 0.163 0.1 >0.999 0.518 0.351 >0.999 0.413 0.989 0.493 0.826 0.932 0.447 >0.999 0.885 0.417 0.018 0.579 >0.999 0.105 >0.999 0.585 0.366 0.03 >0.999 0.831 0.486 0.063 0.261 >0.999 0.756 >0.999 0.408
Table 1. Baseline demographic and clinical characteristics of the study cohort (N=279).

(95% CI: 6.3-27.0), respectively (P<0.01). We applied the ELN 2022 risk stratification to the three treatment groups. For patients in the IC group, the median OS was estimated to be 44.1, 23.2, and 13.9 months according to the risk groups of favorable (FAV), intermediate (INT), and adverse (ADV) risk by ELN 2022, respectively. Moreover, long-term survival rate has a distinct trend that was not significantly different between the risk groups (P=0.069). As observed in the IC group, there was no significant difference in OS according to the ELN 2022 risk in the HMA (P=0.926) or HMA/VEN (P=0.498) groups. These data suggest that ELN 2022 genetic risk stratification does not impact survival outcome with respect to treatment modalities in older patients with AML.

Genetic factors that are associated with worse overall survival in older patients with acute myeloid leukemia by the treatment groups

To determine which ELN 2022 genetic risk stratification factors are associated the most with OS in each treatment group, we conducted univariate and multivariate analyses of these factors (Table 2). Mutated genes that were found in >3% of the patients and the cut-off age of 75 years were included in this analysis. Among the patients in the IC group, monosomal karyotype, mutated TP53 with at least 10% variant allele frequency (VAF), U2AF1, and SETBP1 result in inferior OS according to the multivariate analysis. In the HMA group, CBFB-MYH11 fusion, mutated SRSF2, and non-biZIP CEBPA were independently associated with worse OS. In the HMA/VEN group, no variables significantly impacted OS in the multivariate analysis. These data suggest that certain genetic mutations are associated with OS in distinct treatment groups of older patients with AML.

Unsupervised clustering with respect to molecular aberrations

Hierarchical clustering with respect to the molecular and cytogenetic analysis results indicates that older patients

with AML can be classified into one of the nine clusters (Figure 2A). The dominant cytogenetic features of each cluster were as follows. Cluster 1 (C1): no dominant genomic alterations; C2: non-bZIP CEBPA and FLT3-ITD mutations; C3: mutated ASXL1 and RUNX1; C4: RUNX1-RUNX1T1 or CBFB-MYH11 fusion; C5: BCOR and IDH2 mutations; C6: mutated NPM1 with FLT3-ITD wild type, IDH1, NRAS, PTPN11, bZIP in-frame CEBPA, and JAK2; C7: abnormal karyotype (-5 or del(5q); -7;-17/abn(17p)); C8: mutated SRSF2 and TET2; and C9: complex karyotype and TP53 mutation at a VAF of at least 10%.

To determine which molecular aberrations are associated with each other in a paired fashion, we mapped their correlation network (Figure 2B). In this data analysis, the following pairs of molecular aberrations were highly correlated: monosomal karyotype and either -5, del(5q), -7 or -17/abn(17p), RUNX1-RUNX1T1 and KIT mutations, and complex karyotype and TP53 mutations with at least 10% VAF. The node with the most concomitant mutation or genetic events (also referred to as the highest betweenness centrality) was mutated SETBP1, followed by NRAS mutation. In contrast, the betweenness centrality was lowest in CBFB-MYH11 fusion, followed by the bZIP in-frame CEBPA mutation, complex karyotype, and SRSF2 mutations. Detailed proportions of the cytogenetic abnormalities and genetic mutations in each cluster are described in Figure 3. (See also Online Supplementary Table S1.) There were some overlaps across the clusters that may be due to the inherent limitations of the clustering method employed and the modest sample size, or they could reflect the characteristics of AML, where mutational overlapping across clusters is unavoidable. In addition, we also compared different cluster methods and found that the hierarchical agglomerative clustering used in this study showed the best score in connectivity and stability (average proportion of non-overlap and the average distance between means) (Online Supplementary Table S3). According to the Meila

Haematologica | 109 April 2024 1098 ARTICLE - Genomic clustering in older adults with AML S. Park et al.
A B C
Figure 1. Prognostic significance of the European LeukemiaNet 2022 risk classification in predicting the overall survival of older patients with acute myeloid leukemia. Survival curves of patients who received (A) intensive chemotherapy, (B) hypomethylating agent, and (C) hypomethylating agent plus venetoclax.

IC: intensive chemotherapy; HMA: hypomethylating agent; HMA/VEN: HMA plus venetoclax; HR: Hazard Ratio; CI: Confidence Interval; RUNX1RUNX1T1: t(8;21)(q22;q22) rearrangement; CBFB-MYH11: inv(16)(p13.1q22) or t(16;16)(p13.1;q22) rearrangement; VAF: variant allele frequency.

Haematologica | 109 April 2024 1099 ARTICLE - Genomic clustering in older adults with AML S. Park et al. Variable IC HMA HMA/VEN Univariate Multivariate Univariate Multivariate Univariate HR (95% CI) P HR (95% CI) P HR (95% CI) P HR (95% CI) P HR (95% CI) P Age >75 years 4.32 (1.04-18.0) 0.044 3.35 (0.58-19.4) 0.177 1.16 (0.73-1.85) 0.533 -1.79 (0.94-3.41) 0.078 Complex 2.18 (1.00-4.77) 0.05 1.02 (0.38-2.73) 0.966 1.3 (0.64-2.63) 0.463 -1.08 (0.39-3.03) 0.878 -5 or del(5q)-7;-17/ abn(17p) 1.56 (0.57-4.26) 0.389 -0.8 (0.29-2.22) 0.674 -1.58 (0.73-3.41) 0.241 Monosomal 7.24 (2.79-18.8) <0.001 8.21 (2.85-23.7) <0.001 0.7 (0.28-1.74) 0.437 -1.57 (0.73-3.37) 0.248 RUNX1-RUNX1T1 0.82 (0.33-2.03) 0.667 -0.93 (0.34-2.56) 0.887 -0.94 (0.23-3.88) 0.929 CBFB-MYH11 0.6 (0.19-1.90) 0.383 -37 (3.35-408) 0.003 47.2 (4.23-526) 0.002 0.81 (0.19-3.39) 0.774 NPM1mut without FLT3-ITD DNMT3A 1.03 (0.50-2.13) 0.94 -0.81 (0.38-1.70) 0.575 -1.48 (0.62-3.50) 0.375 TET2 1.37 (0.77-2.43) 0.29 -1.16 (0.69-1.97) 0.579 -1.39 (0.71-2.70) 0.335 FLT3-ITD 1.1 (0.62-1.95) 0.754 -1.44 (0.81-2.55) 0.214 -1 (0.14-7.26) 0.997 FLT3-TKD 2.45 (0.89-6.72) 0.082 2.11 (0.61-7.35) 0.239 0.55 (0.22-1.37) 0.202 -1.79 (0.43-7.49) 0.425 IDH1 0.85 (0.34-2.10) 0.722 -1.2 (0.55-2.63) 0.649 -1.91 (0.59-6.19) 0.28 IDH2 0.7 (0.39-1.25) 0.231 -0.94 (0.38-2.35) 0.901 -0.47 (0.11-1.99) 0.305 RUNX1 0.68 (0.30-1.56) 0.364 -0.69 (0.36-1.32) 0.262 -0.89 (0.35-2.28) 0.804 ASXL1 0.7 (0.30-1.61) 0.397 -0.85 (0.44-1.61) 0.608 -0.79 (0.28-2.24) 0.658 NRAS 1.33 (0.42-4.21) 0.63 -0.56 (0.25-1.24) 0.155 -1.15 (0.45, 2.98) 0.768 PTPN11 1.24 (0.31-5.07) 0.761 -1.23 (0.63-2.40) 0.547 -1.63 (0.64-4.15) 0.308 SRSF2 1.1 (0.48-2.52) 0.83 -2.36 (0.93-5.98) 0.07 2.65 (1.04-6.75) 0.041 1.82 (0.71-4.65) 0.209 BCOR 0.7 (0.22-2.22) 0.547 -0.71 (0.32-1.56) 0.395 -0.72 (0.17-3.00) 0.656 TP53 (VAF ≥10%) 7.1 (2.18-23.2) 0.001 7.1 (2.18-23.2) 0.004 1.2 (0.55-2.63) 0.647 -1.02 (0.14-7.42) 0.985 KIT 0.62 (0.23-1.69) 0.347 -1.89 (0.59-6.06) 0.286 -1.2 (0.29-4.98) 0.802 U2AF1 6.7 (2.07-21.7) 0.002 6.7 (2.07-21.7) <0.001 1.49 (0.68-3.27) 0.318 -0.33 (0.05-2.39) 0.272 Non-bZIP CEBPA 0 (0.00-Inf) 0.995 -3.54 (1.25-10.0) 0.018 4.03 (1.41-11.5) 0.009 0.7 (0.16-3.05) 0.634 bZIP in-frame CEBPA 0 (0.00-Inf) 0.996 -1.46 (0.46-4.69) 0.521 - - -JAK2 1.38 (0.56-3.42) 0.485 -0.67 (0.09-4.86) 0.693 -1.1 (0.34-3.56) 0.87 SETBP1 3.57 (0.87-14.6) 0.078 4.19 (1.01-17.4) 0.048 0.88 (0.35-2.20) 0.784 -2.35 (0.56-9.90) 0.246
Table 2. Univariate and multivariate analysis for survival outcomes related to genetic alteration.

variance information, clusters from PAM and SOM were the most similar, and hierarchical agglomerative clustering and GMM were the most different.

Genomic clustering by hierarchical agglomerative clustering and survival outcomes

To determine whether clusters formed with respect to molecular aberrations are associated with survival outcomes in older patients with AML, we compared and analyzed the survival of patients in clusters classified by molecular and cytogenetic aberrations. The median OS of all patients was 12.8 months, and those of C1, C3, C4, and C5 were >13 months. C7 showed the worst OS (median 6.7 months) among the clusters (Online Supplementary Table S4). The OS of each cluster according to

the treatment type (Online Supplementary Figure S2) showed that survival could be significantly different across clusters when subject to the same treatment. Linking the clusters with survival outcomes of each treatment arm (Figure 4A, B, C, Online Supplementary Figure S3) enabled stratification (favorable, intermediate, and adverse) with significant differences in OS. Among the 131 patients in the IC group, the survival of C3 and C4 was superior to those of C2, C7, and C9 (Hazard Ratio [HR]: 2.79; 95% CI: 1.30-5.99; P=0.009). In contrast, C1, C3, and C7 achieved better survival (HR: 2.97; 95% CI: 1.28-6.88; P=0.011) than C2 and C4 when treated with HMA. In the HMA/VEN group, C1, C3, and C5 showed favorable survival outcomes, whereas C6 and C8 showed poorer outcomes (HR: 3.97; 95% CI: 1.60-9.84; P=0.001).

Haematologica | 109 April 2024 1100 ARTICLE - Genomic clustering in older adults with AML S. Park et al.
B
Figure 2. Classification of hierarchical clustering in older patients with acute myeloid leukemia. (A) Dendrogram showing patients classified into nine distinct subgroups based on the frequently assembled mutations and chromosomal abnormalities. (B) Nodes in the network map represent genomic alterations found in dominant individual clusters. The edges, arranged in relation to each gene, represent the correlations between different genes. Colors of the nodes represent the nine clusters, which include the dominant genes.
A

Stratification of the clusters differed depending on the treatment type, and survival outcomes of each cluster were substantially different according to different treatment arms (Figure 4D-F). Among C4, C6, and C8, IC showed better outcomes than HMA/VEN did (7 vs. 23.6 months; P=0.009). The HMA/VEN arm showed better outcomes than HMA only (HMA vs. HMA/VEN: 9.2 vs. 31.4 months; P=0.002) among C1, C2, C3, and C5. C7 and C9 showed no differences in OS among the HMA, HMA/VEN, and IC groups (8.6 vs. 9.5 vs. 9.4 months; P=0.904).

Discussion

With the recent release of the up-dated version of the ELN risk stratification, several groups have reported real-world prognostic validation results that proved that ELN 2022 performs well in stratifying patients with AML into prognostically different favorable, intermediate, and adverse risk groups.33,34

However, these results were derived only from patients who received IC; consequently, information on the prognostic utility of ELN 2022 in older patients who may or may not be candidates for IC is lacking. In this study, we applied ELN 2022 to verify its prognostic predictability among patients with AML ≥ 60 years of age. We observed that it could not distinguish survival prognosis in these aged populations regardless of the treatments they received. The poor predictive ability of ELN 2022 was particularly noticeable in the patients receiving lower-intensity treatment compared with that of the IC group. Our results are consistent with previous findings that demonstrated the limited value of ELN 2017 in predicting prognosis in older adults with AML.20,21 This highlights the need for a distinct prognostic system from that used for young patients with AML to guide therapeutic approaches in this older population.

Given the lack of prognostic models derived from disease features in older adults with AML, we examined the feasibility of prognostication based on clustering with respect

Haematologica | 109 April 2024 1101 ARTICLE - Genomic clustering in older adults with AML S. Park et al.
Figure 3. Heatmap of individual genomic lesions. Rows represent individual genomic lesions; columns represent patients included in the study. Vertical lines are used to indicate the presence of a specified driver mutation in each patient.
Haematologica | 109 April 2024 1102 ARTICLE - Genomic clustering in older adults with AML S. Park et al.
A B C D E F
Figure 4. Association of overall survival and hierarchical clustering in older patients with acute myeloid leukemia. Risk stratification of individual genomic cluster according to the three treatment arms: (A) intensive chemotherapy (IC), (B) hypomethylating agent (HMA), and (C) hypomethylating agent plus venetoclax (HMA/VEN). Clusters showing better survival (D) in the HMA/VEN arm than in the HMA treatment arm and (E) in the IC treatment arm than in the HMA/VEN treatment arm. (F) Clusters showing similar survival between the three treatment arms. OS: overall survival.

to abnormalities in karyotypes and genetic mutations. Prior to our study, several scoring systems had been proposed to assist in determining which treatment may be beneficial to older adults with AML in terms of OS, early mortality, or comprehensive geriatric quality of life.6-8,35,36 However, these were limited in that the development of such decision models was usually conducted regardless of the treatment type, with the result that they were unable to provide information regarding outcomes according to different treatment types. In addition, previous risk stratification was mainly focused on survival outcomes of exclusive genetic alterations that did not overlap.26,27 As various genes were verified and characterized as affecting each other, subgrouping was needed to promote better interpretation.37 Analyzing the interaction of each gene with several genes was possible via conventional statistical methods; however, because more genes were added, calculating the effect of the gene was impossible without applying an ML method. In particular, the ML method could validate whether these classifications were well-divided. In this study, we conducted an unsupervised hierarchical clustering analysis and classified older adults with AML into nine clusters with different genetic profiles at baseline. Although clustering is not straightforward because of the presence and complexity of co-occurring somatic mutations, each cluster has its own molecular signature based on predominantly mutated genes or karyotype abnormalities. Intriguingly, we observed that each genomic cluster was mapped to different prognostic positions by the changes in treatment modalities; a genomic cluster that showed favorable survival outcomes after IC would not necessarily show favorable outcomes after HMA or HMA/VEN, but could instead be the one that shows a poor prognosis.

In this context, one of the noticeable clusters was C4, in which core-binding factor-AML (CBF-AML) fusion dominance was observed. Among the AML subtypes, CBF-AML is a genetically distinct group of AML associated with chromosomal changes in t(8;21) and inv(16)(p13q22) or t(16;16)(p13;q22). It has several clinically distinctive characteristics compared with other forms of AML, such that it often begins in young adults. Patients aged >60 years with CBF-AML make up only about 5-15% of all adult CBF-AML.38-41 It often presents a good prognosis given its favorable response to cytarabine-based IC. Moreover, it is generally accepted that older adults with CBF-AML should be offered IC if they are considered fit. Accordingly, patients with CBF-AML in our study were primarily offered IC unless deemed ineligible to receive such therapy. However, apart from data concerning IC, there are few data regarding the management of older adults with CBF-AML. Furthermore, phase III studies evaluating the effectiveness of lower-intensity treatments, such as HMA or HMA+VEN, in older adults with AML excluded CBF-AML for study inclusion.13,42,43 In this study, we observed that C4, which mostly consisted of patients with CBF-AML (25/26, 96.2%), had a good prognosis in the IC group but not in the HMA or HMA/ VEN groups. Moreover, the addition of VEN to HMA did not

provide additional survival benefits compared with HMA alone for C4 patients. Our findings are in line with the results of a previous study in which the possibility of VEN resistance in CBF-AML was considered given the unpredictably poor event-free survival or OS in relapsed or refractory CBF-AML patients receiving the VEN-combined intensive regimen.44 However, this conflicts with the findings of another study showing remarkable activity of HMA+VEN in favorable-risk AML, including cases of CBF-AML (10/46, 22%).45 Given the limited data on the activity of HMA or HMA+VEN in patients with CBF alterations, further research with a larger cohort is needed.

Acute myeloid leukemia with higher-risk cytogenetics and mutated TP53 have a dismal prognosis following conventional IC, making these patients candidates for innovative therapies that have the potential to improve prognosis. Our findings also showed that IC has no survival benefit over HMA or HMA+VEN in patients belonging to C7 and C9, where unfavorable cytogenetics, such as -5, del(5q), -7, -17/abn(17p), or complex karyotypes with mutated TP53 were predominant. The median OS was similar between the IC, HMA, and HMAVEN groups (9.4 vs. 8.6 vs. 9.5 months; P=0.904). Moreover, VEN combined with HMA did not improve the survival outcome compared with HMA alone, consistent with the results from the subgroup analysis of the phase III VIALE-A study.13 Similarly, in a phase II study of 10-day decitabine plus VEN,14 the median OS for adverse-risk cytogenetics was reported to be 8.0 months, whereas the median estimates were not reached for newly diagnosed de novo AML. In addition, multivariable analysis in this phase II study indicated that TP53 mutation is associated with inferior survival and higher risk of relapse. Taken together, these data suggest an urgent need for novel therapeutic approaches targeting this group of patients. Based on the evidence that enhanced immune infiltrations are frequently observed in TP53-mutated AML, promising preliminary data with novel immune-based agents such as magrolimab,46 flotetuzumab,47 sabatolimab, and eprenetapopt48 have been reported. In particular, given that TP53 mutation is frequently accompanied by a complex karyotype (as shown in C9), the results of ongoing clinical trials for TP53-mutated AML are awaited with the hope of improving survival.49

With regard to treatment selection for older adults with AML, the current guideline50 recommends azacitidine plus VEN as a preferred category 1 regimen for the majority of elderly patients unless they are suitable for IC. However, we have found that some clusters treated with HMA/VEN did not show any remarkable survival advantage over HMA alone. In addition, in real-world practice, we have observed a more prominent cytopenia or morphologic leukemia-free state with an uncertain response when using the VEN combination compared to HMA alone. This potentially leads to significant morbidity or mortality, highlighting the need for speedy identification of patients who are less likely to respond to the VEN combination. To date, however, beyond current risk factors such as genomics, we cannot be sure of the best way to identify the

Haematologica | 109 April 2024 1103 ARTICLE - Genomic clustering in older adults with AML S. Park et al.

best-fit population for specific treatments, including HMA/ VEN. In this way, exploring a model that can reliably predict overall benefit through a summation of potential benefit and toxicity, which could perhaps be complemented with a physical function measure51 or an ex vivo drug sensitivity test,52 would be helpful for older adults with AML who usually consider HMA/VEN as their first choice.

The current study has several limitations. First, its retrospective nature and the relatively modest sample size in each treatment group, sometimes with a very small number of patients receiving specific treatments, make it challenging to draw definitive conclusions. Second, the lack of an independent validation cohort restricts the generalizability of our findings, and further validation of the clustering groups using external data or prospective cohorts is needed. Third, other possible factors affecting survival outcomes, such as fitness at diagnosis, quality of treatment response, and type of post-remission treatment, were not taken into account in the survival model. Fourth, we could not assess the impact of CPX-351, FLT3, or IDH inhibitors on survival outcomes because these agents were not available when the patients included in the study were treated. Fifth, the unsupervised clustering approach employed may have inherent weaknesses as it does not incorporate the physicians’ clinical standpoints. For instance, C6 encompasses diverse genetic subgroups that are clustered together, where the co-assignment of various genetic mutations in the same cluster does not necessarily imply a strong relationship between them. Instead, it appears to reflect a tendency for C6 to possess less distinct genetic characteristics compared to the other clusters within the fixed cluster size (N=9) that was determined by the voting process involving multiple indices. Nevertheless, to the best of our knowledge, this is the first study to validate the new ELN 2022 risk stratification in older adults with AML. Furthermore, this is the first attempt to correlate genomic subtypes of AML revealed by unsupervised ML clustering with treatment-dependent prognostic prediction, which was confined to the setting of older adults with AML. This provides new insights into how therapeutic benefits vary by and depend on an individual genetic signature, which may aid clinicians in determining suitable treatments for older adults with AML. In conclusion, we demonstrate the limits of the new ELN 2022 for predicting outcomes in older adults with AML, highlighting

References

1. Papaemmanuil E, Gerstung M, Bullinger L, et al. Genomic classification and prognosis in acute myeloid leukemia. N Engl J Med. 2016;374(23):2209-2221.

2. Dohner H, Estey E, Grimwade D, et al. Diagnosis and management of AML in adults: 2017 ELN recommendations from an international expert panel. Blood. 2017;129(4):424-447.

the need for a different prognostic approach in this population. We also show that ML might be used to categorize genetic variables that influence prognosis depending on the type of treatment. When large-scale data analysis is possible, ML technology can allow genomic data to be classified more accurately based on how well different treatments work. This may improve our understanding of the unique clonal architecture of each patient, and enable a heterogeneous group of older adults with AML to receive the most precise and individualized treatment.

Disclosures

No conflicts of interest to disclose.

Contributions

TYK and SP collected and analyzed the data, and wrote the manuscript. DK, JML, MSK and YK provided patients and materials, and reviewed the manuscript. JK provided the materials and reviewed the manuscript. AR, TKK and HJK reviewed the manuscript and analyzed the data. BSC designed the study, provided patients and materials, analyzed the data, and supervised the writing of the manuscript. All authors read and agreed to the final version of the manuscript for publication.

Acknowledgments

We thank all patients and their families for their participation in the trial.

Funding

This research was supported by the Research Fund of Seoul St. Mary’s Hospital associated with The Catholic University of Korea and by a grant from Catholic Institute of Cell Therapy in 2023; by a grant from the National Research Foundation of Korea funded by the South Korean government (MSIT; 2022R1A2C2004517) and a grant of the Korea Health Technology R&D Project through the Korea Health Industry Development Institute (KHIDI), funded by the Ministry of Health and Welfare, Republic of Korea (HI22C1314).

Data-sharing statement

The data presented in this study are available on request from the corresponding author. The data are not publicly available for privacy and ethical reasons.

3. Dohner H, Wei AH, Appelbaum FR, et al. Diagnosis and management of AML in adults: 2022 recommendations from an international expert panel on behalf of the ELN. Blood. 2022;140(12):1345-1377.

4 Park JH, Kang MG, Kim HR, et al. Changing the frequency and spectra of chromosomal aberrations in Korean patients with acute leukemia in a tertiary care hospital. Blood Res. 2020;55(4):225-245.

5. Appelbaum FR, Gundacker H, Head DR, et al. Age and acute myeloid leukemia. Blood. 2006;107(9):3481-3485.

6. Min GJ, Cho BS, Park SS, et al. Geriatric assessment predicts nonfatal toxicities and survival for intensively treated older

Haematologica | 109 April 2024 1104 ARTICLE - Genomic clustering in older adults with AML S. Park et al.

adults with AML. Blood. 2022;139(11):1646-1658.

7 Palmieri R, Paterno G, De Bellis E, et al. Therapeutic choice in older patients with acute myeloid leukemia: a matter of fitness. Cancers (Basel). 2020;12(1):120.

8. Ferrara F, Barosi G, Venditti A, et al. Consensus-based definition of unfitness to intensive and non-intensive chemotherapy in acute myeloid leukemia: a project of SIE, SIES and GITMO group on a new tool for therapy decision making. Leukemia. 2013;27(5):997-999.

9 Cortes JE, Mehta P. Determination of fitness and therapeutic options in older patients with acute myeloid leukemia. Am J Hematol. 2021;96(4):493-507.

10 Juliusson G. Older patients with acute myeloid leukemia benefit from intensive chemotherapy: an update from the Swedish Acute Leukemia Registry. Clin Lymphoma Myeloma Leuk. 2011;11(Suppl 1):S54-59.

11. Park S, Cho BS, Kim HJ. New agents in acute myeloid leukemia (AML). Blood Res. 2020;55(S1):S14-S18.

12. Cherry EM, Abbott D, Amaya M, et al. Venetoclax and azacitidine compared with induction chemotherapy for newly diagnosed patients with acute myeloid leukemia. Blood Adv. 2021;5(24):5565-5573.

13. DiNardo CD, Jonas BA, Pullarkat V, et al. Azacitidine and venetoclax in previously untreated acute myeloid leukemia. N Engl J Med. 2020;383(7):617-629.

14 DiNardo CD, Maiti A, Rausch CR, et al. 10-day decitabine with venetoclax for newly diagnosed intensive chemotherapy ineligible, and relapsed or refractory acute myeloid leukaemia: a single-centre, phase 2 trial. Lancet Haematol. 2020;7(10):e724-e736.

15. Pollyea DA, DiNardo CD, Arellano ML, et al. Impact of venetoclax and azacitidine in treatment-naive patients with acute myeloid leukemia and IDH1/2 mutations. Clin Cancer Res. 2022;28(13):2753-2761.

16. Lachowiez CA, Loghavi S, Kadia TM, et al. Outcomes of older patients with NPM1-mutated AML: current treatments and the promise of venetoclax-based regimens. Blood Adv. 2020;4(7):1311-1320.

17 de Leeuw DC, Ossenkoppele GJ, Janssen J. Older patients with acute myeloid leukemia deserve individualized treatment. Curr Oncol Rep. 2022;24(11):1387-1400.

18. Boddu PC, Kadia TM, Garcia-Manero G, et al. Validation of the 2017 European LeukemiaNet classification for acute myeloid leukemia with NPM1 and FLT3-internal tandem duplication genotypes. Cancer. 2019;125(7):1091-1100.

19. Harada Y, Nagata Y, Kihara R, et al. Prognostic analysis according to the 2017 ELN risk stratification by genetics in adult acute myeloid leukemia patients treated in the Japan Adult Leukemia Study Group (JALSG) AML201 study. Leuk Res. 2018;66:20-27.

20 Pogosova-Agadjanyan EL, Moseley A, Othus M, et al. AML risk stratification models utilizing ELN-2017 guidelines and additional prognostic factors: a SWOG report. Biomark Res. 2020;8:29.

21. Itzykson R, Fournier E, Berthon C, et al. Genetic identification of patients with AML older than 60 years achieving long-term survival with intensive chemotherapy. Blood. 2021;138(7):507-519.

22. Awada H, Durmaz A, Gurnari C, et al. Machine learning integrates genomic signatures for subclassification beyond primary and secondary acute myeloid leukemia. Blood. 2021;138(19):1885-1895.

23. Eckardt JN, Bornhauser M, Wendt K, Middeke JM. Application of machine learning in the management of acute myeloid

leukemia: current practice and future prospects. Blood Adv. 2020;4(23):6077-6085.

24. Lee SI, Celik S, Logsdon BA, et al. A machine learning approach to integrate big data for precision medicine in acute myeloid leukemia. Nat Commun. 2018;9(1):42.

25. Metzeler KH, Herold T, Rothenberg-Thurley M, et al. Spectrum and prognostic relevance of driver gene mutations in acute myeloid leukemia. Blood. 2016;128(5):686-698.

26. Hua X, Hyland Paula L, Huang J, et al. MEGSA: a powerful and flexible framework for analyzing mutual exclusivity of tumor mutations. Am J Human Genet. 2016;98(3):442-455.

27. Shen W, Tokdar ST, Ghosal S. Adaptive Bayesian multivariate density estimation with Dirichlet mixtures. Biometrika. 2013;100:623-640.

28. International Standing Committee on Human Cytogenomic Nomenclature. ISCN: an international system for human cytogenomic nomenclature (2016). Basel: Karger; 2016.

29. Lee J-M, Kim Y-J, Park S-S, Han E, Kim M, Kim Y. Simultaneous monitoring of mutation and chimerism using next-generation sequencing in myelodysplastic syndrome. J Clin Med. 2019;8(12):2077.

30 Kim Y, Lee GD, Park J, et al. Quantitative fragment analysis of FLT3-ITD efficiently identifying poor prognostic group with high mutant allele burden or long ITD length. Blood Cancer J. 2015;5(8):e336.

31. Charrad M, Ghazzali N, Boiteau V, Niknafs A. NbClust: an R package for determining the relevant number of clusters in a data set. J Stat Softw. 2014;61:1-36.

32. Brock G, Pihur V, Datta S, Datta S. clValid: an R package for cluster validation. J Stat Softw. 2008;25:1-22.

33. Lo MY, Tsai C-H, Kuo Y-Y, et al. Prognostic relevance of adult acute myeloid leukemia patients according to the 2022 European LeukemiaNet risk stratification. Blood. 2022;140(Suppl 1):130-131.

34 Song G-Y, Kim T, Ahn S-Y, et al. Prognostic predictability of 2022 European LeukemiaNet (ELN) risk stratification in the real world. Blood. 2022;140(Suppl 1):1018-1019.

35. Deschler B, Ihorst G, Platzbecker U, et al. Parameters detected by geriatric and quality of life assessment in 195 older patients with myelodysplastic syndromes and acute myeloid leukemia are highly predictive for outcome. Haematologica. 2013;98(2):208-216.

36. Walter RB, Othus M, Borthakur G, et al. Prediction of early death after induction therapy for newly diagnosed acute myeloid leukemia with pretreatment risk scores: a novel paradigm for treatment assignment. J Clin Oncol. 2011;29(33):4417-4423.

37. van der Werf I, Wojtuszkiewicz A, Meggendorfer M, et al. Splicing factor gene mutations in acute myeloid leukemia offer additive value if incorporated in current risk classification. Blood Adv. 2021;5(17):3254-3265.

38. Appelbaum FR, Kopecky KJ, Tallman MS, et al. The clinical spectrum of adult acute myeloid leukaemia associated with core binding factor translocations. Br J Haematol. 2006;135(2):165-173.

39 Park S, Choi H, Kim HJ, et al. Genome-wide genotype-based risk model for survival in core binding factor acute myeloid leukemia patients. Ann Hematol. 2018;97(6):955-965.

40 Marcucci G, Mrozek K, Ruppert AS, et al. Prognostic factors and outcome of core binding factor acute myeloid leukemia patients with t(8;21) differ from those of patients with inv(16): a Cancer and Leukemia Group B study. J Clin Oncol. 2005;23(24):5705-5717.

41. Borthakur G, Kantarjian H. Core binding factor acute

Haematologica | 109 April 2024 1105 ARTICLE - Genomic clustering in older adults with AML S. Park et al.

myelogenous leukemia-2021 treatment algorithm. Blood Cancer J. 2021;11(6):114.

42. Dombret H, Seymour JF, Butrym A, et al. International phase 3 study of azacitidine vs conventional care regimens in older patients with newly diagnosed AML with >30% blasts. Blood. 2015;126(3):291-299.

43. Kantarjian HM, Thomas XG, Dmoszynska A, et al. Multicenter, randomized, open-label, phase III trial of decitabine versus patient choice, with physician advice, of either supportive care or low-dose cytarabine for the treatment of older patients with newly diagnosed acute myeloid leukemia. J Clin Oncol. 2012;30(21):2670-2677.

44 DiNardo CD, Lachowiez CA, Takahashi K, et al. Venetoclax combined with FLAG-IDA induction and consolidation in newly diagnosed and relapsed or refractory acute myeloid leukemia. J Clin Oncol. 2021;39(25):2768-2778.

45. Arslan S, Zhang J, Dhakal P, et al. Outcomes of therapy with venetoclax combined with a hypomethylating agent in favorable-risk acute myeloid leukemia. Am J Hematol. 2021;96(3):E59-E63.

46. Sallman D, Asch A, Kambhampati S, et al. AML-196: The first-inclass anti-CD47 antibody magrolimab in combination with azacitidine is well tolerated and effective in AML patients: phase 1b results. Clin Lymphoma Myeloma Leuk.

2021;21(Suppl 1):S290.

47. Uy GL, Aldoss I, Foster MC, et al. Flotetuzumab as salvage immunotherapy for refractory acute myeloid leukemia. Blood. 2021;137(6):751-762.

48. Cluzeau T, Sebert M, Rahmé R, et al. Eprenetapopt plus azacitidine in TP53-mutated myelodysplastic syndromes and acute myeloid leukemia: a phase II study by the Groupe Francophone des Myélodysplasies (GFM). J Clin Oncol. 2021;39(14):1575-1583.

49 Vadakekolathu J, Lai C, Reeder S, et al. TP53 abnormalities correlate with immune infiltration and associate with response to flotetuzumab immunotherapy in AML. Blood Adv. 2020;4(20):5011-5024.

50 Pollyea DA, Altman JK, Assi R, et al. Acute Myeloid Leukemia, Version 3.2023, NCCN Clinical Practice Guidelines in Oncology. J Natl Compr Canc Netw. 2023;21(5):503-513.

51. Kwag D, Bang SY, Lee JH, et al. The prognostic value of physical function in older adults with acute myeloid leukemia treated with low intensity treatment. Blood. 2022;140(Suppl 1):1020-1021.

52. Kuusanmäki H, Kytölä S, Vänttinen I, et al. Ex vivo venetoclax sensitivity testing predicts treatment response in acute myeloid leukemia. Haematologica. 2023;108(7):1768-1781.

Haematologica | 109 April 2024 1106 ARTICLE - Genomic clustering in older adults with AML S. Park et al.

Immune checkpoint molecule DNAM-1/CD112 axis is a novel target for natural killer-cell therapy in acute myeloid leukemia

Yuta Kaito,1 Emi Sugimoto,2 Fumi Nakamura,3 Yutaka Tsukune,4 Makoto Sasaki,4 Shunsuke Yui,5 Hiroki Yamaguchi,5 Susumu Goyama,6 Yasuhito Nannya,1 Kinuko Mitani,3 Hideto Tamura7 and Yoichi Imai3

1Division of Hematopoietic Disease Control, Institute of Medical Science, The University of Tokyo, Tokyo; 2Division of Cellular Therapy, Institute of Medical Science, The University of Tokyo, Tokyo; 3Department of Hematology and Oncology, Dokkyo Medical University, Tochigi; 4Department of Hematology, Juntendo University School of Medicine, Tokyo; 5Department of Hematology, Nippon Medical School, Tokyo; 6Division of Molecular Oncology, Graduate School of Frontier Sciences, The University of Tokyo, Tokyo and 7Division of Diabetes, Endocrinology and Hematology, Department of Internal Medicine, Dokkyo Medical University Saitama Medical Center, Saitama, Japan.

Abstract

Correspondence: Y. Imai imaiyo-tky@umin.ac.jp

Received: February 8, 2023.

Accepted: September 8, 2023.

Early view: September 21, 2023.

https://doi.org/10.3324/haematol.2023.282915

©2024 Ferrata Storti Foundation

Published under a CC BY-NC license

Acute myeloid leukemia (AML) is a hematologic malignancy that frequently relapses, even if remission can be achieved with intensive chemotherapy. One known relapse mechanism is the escape of leukemic cells from immune surveillance. Currently, there is no effective immunotherapy for AML because of the lack of specific antigens. Here, we aimed to elucidate the association between CD155 and CD112 in AML cell lines and primary AML samples and determine the therapeutic response. Briefly, we generated NK-92 cell lines (NK-92) with modified DNAX-associated molecule 1 (DNAM-1) and T-cell immunoglobulin and ITIM domain (TIGIT), which are receptors of CD155 and CD112, respectively. Analysis of 200 cases of AML indicated that the survival of patients with high expression of CD112 was shorter than that of patients with low expression. NK-92 DNAM-1 exhibited enhanced cytotoxic activity against AML cell lines and primary cells derived from patients with AML. DNAM-1 induction in NK-92 cells enhanced the expression of cytotoxicity-related genes, thus overcoming the inhibitory activity of TIGIT. Between CD155 and CD112, CD112 is an especially important target for natural killer (NK)-cell therapy of AML. Using a xenograft model, we confirmed the enhanced antitumor effect of NK-92 DNAM-1 compared with that of NK-92 alone. We also discovered that CD112 (Nectin-2), an immune checkpoint molecule belonging to the Nectin/Nectin-like family, functions as a novel target of immunotherapy. In conclusion, modification of the DNAM-1/CD112 axis in NK cells may be an effective novel immunotherapy for AML. Furthermore, our findings suggest that the levels of expression of these molecules are potential prognostic markers in AML.

Introduction

Acute myeloid leukemia (AML) is a hematologic malignancy in which hematopoietic stem/progenitor cells accumulate multiple genetic abnormalities associated with differentiation and proliferation, resulting in the autonomous and uncontrolled progression of the disease.1,2 Recently, molecular targeted agents such as venetoclax3 and gilteritinib4 have been approved for use as AML treatment. However, AML relapse remains a major concern and is associated with a poor prognosis.5 Escape of tumor cells from the immune system has piqued interest as an important mechanism of relapse in hematologic malignancies. Previous studies have documented enhanced

expression of inhibitory receptors such as programmed death-1 in T cells derived from patients with AML.6,7 To circumvent escape from the immune system, immune checkpoint inhibitors have been tested for AML treatment, but they have not been effective.8,9 Moreover, the development of chimeric antigen receptor T-cell therapy for AML has stalled because of the lack of specific targetable antigens.10

We focused on natural killer (NK) cells, a type of innate lymphocyte capable of directly killing target cells without antigen presentation.11 The cytotoxic function of NK cells is regulated by the balance of signals from activating and inhibitory receptors.12

NK-cell therapy for AML includes autologous and allogeneic

Haematologica | 109 April 2024 1107 - Acute Myeloid Leukemia ARTICLE

NK cells. Autologous NK cells are less likely to cause graftversus-host disease, but they do not exhibit substantial therapeutic efficacy because of their own reduced cytotoxicity.13,14 Difficulties with in vitro expansion and activation, and lack of in vivo persistence of allogeneic NK cells contribute to insufficient clinical efficacy.15

The NK-92 cell line (NK-92), which is derived from a patient with non-Hodgkin lymphoma, has been employed in off-theshelf therapy,16,17 as it has just one receptor of the inhibitory killer cell immunoglobulin-like receptor (KIR) family members,18 expresses many activating receptors,19 and is more cytotoxic than primary NK cells. A clinical trial using NK-92 for relapsed/refractory AML was conducted, but the results were not promising.20

Recently, the pathway between immune cell receptors, including DNAX-associated molecule 1 (DNAM-1, CD226), T-cell immunoglobulin and ITIM domain (TIGIT), PVR-related Ig domain (PVRIG, CD112R), T-cell activation, increased late expression (TACTILE, CD96), and their ligands, the Nectin/Nectin-like family molecules CD155 (poliovirus receptor), CD111 (Nectin-1), CD112 (Nectin-2), and CD113 (Nectin-3), have attracted attention as a novel class of immune checkpoint molecules. The major receptors in this pathway are thought to be DNAM-1 (an activating receptor) and TIGIT (an inhibitory receptor).21,22 CD155 and CD112 belong to the immunoglobulin superfamily of adhesion glycoproteins23 and their expression is upregulated in a variety of malignancies, although their association with prognosis varies by the type of malignancy.24-26 There are reports of decreased DNAM-1 expression in NK cells and increased TIGIT expression in exhausted T cells derived from AML.27-30 TIGIT antibodies have been shown to be useful in the treatment of solid tumors and are being tested in clinical trials, but have not been shown to be useful in AML.31,32 In this study, we analyzed the expression of CD155 and CD112 in AML cell lines and primary AML samples to elucidate their association with therapeutic responses. We found that CD112 may be associated with a poor prognosis. Furthermore, we established a DNAM-1-introduced NK-92 assuming that CD112 targeted therapy may be more promising than previous immunotherapies for patients with a poor prognosis.

Methods

Analysis using a clinical database

The Cancer Genome Atlas (TCGA) program (https://www. cancer.gov/about-nci/organization/ccg/research/structural-genomics/tcga) was used to analyze data in the cBioPortal for Cancer Genomics (version 5.1.2) (https://www.cbioportal. org/).33 mRNA expression in TCGA dataset was assigned to the group with a threshold Z-score >1.0. Kaplan-Meier overall survival curves were analyzed using the log-rank test.

Cytotoxicity assay

Leukemia cell lines (primary AML cells) were stained with

carboxyfluorescein succinimidyl ester (CellStain-CFSE; Dojindo, Kumamoto, Japan). Tumor cells (target cells) and NK-92/modified NK-92 (effector cells) were co-cultured for 4 h at effector-to-target cell ratios of 1, 5, and 10. Four hours later, the cells were collected and stained with Cellstain-propidium iodide (PI) solution (Dojindo). The percentage of PI-positive leukemia cell lines cultured alone or co-cultured with leukemia cell lines was estimated using flow cytometry. Cytotoxicity of NK-92 and modified-NK-92 was calculated as the percentage of PI-positive co-cultured leukemia cell lines minus that of leukemia cell lines cultured alone.

Primary cells

Primary cells were stained with the antibodies listed in Online Supplementary Table S1. The cells were analyzed and isolated using BD FACS Aria II SORP (BD Biosciences). FlowJo software (version 10.8.0, FlowJo LLC, Ashland, OR, USA) was used to analyze the results. This study was reviewed and approved by the Ethics Review Committee of the Institute of Medical Science, University of Tokyo (2020-16-0623).

Leukemia xenograft models

Female (6- to 8-week-old) NOD.Cg-Prkdcscid Il2rgtm1Wjl/ SzJ (NSG) mice were irradiated with 200 cGy on day -1. Luciferase-introduced MOLM-13 and phosphate-buffered saline (PBS) (FUJIFILM Wako, Japan)/NK-92/NK-92 DNAM-1 cells were injected through the tail vein on day 0. PBS/NK-92/ NK-92 DNAM-1 cells were injected through the tail vein on days 1 and 2. D-luciferin (FUJIFILM Wako Pure Chemicals, Osaka, Japan) was administered intraperitoneally at a dose of 100 µL (150 µg) to each animal twice a week and evaluated using the Spectrum In Vivo Imaging System (IVIS, PerkinElmer, Waltham MA, USA). Living Image Software (version 4.7.4, PerkinElmer) was used to quantify the luminescence. Details on these protocols are included in the Online Supplementary Methods. Additional information on the methods is provided in the Online Supplementary Data

Results

High CD112 expression is associated with a poor prognosis in patients with acute myeloid leukemia

To confirm the association between Nectin/Nectin-like family molecule expression and prognosis in AML patients, we analyzed data from patients with AML using cBioPortal. We analyzed the AML cohort of TCGA program and found no significant difference in survival rate between the groups with high or low CD155 ( P=0.972). However, the CD112 high-expression group had a significantly worse prognosis than the low-expression group (P=0.014) (Figure 1A). Analysis of TCGA clinical data showed an increased frequency of patients with adverse-risk cytogenetics according to the European LeukemiaNet (ELN) risk classification in the

Haematologica | 109 April 2024 1108 ARTICLE - Immune checkpoint modified NK-92 therapy for AML Y. Kaito et al.
Haematologica | 109 April 2024 1109 ARTICLE - Immune checkpoint modified NK-92 therapy for AML Y. Kaito et al.
A B C D
Continued on following page.

Figure 1. Relationship between CD155 and CD112 expression and prognosis in patients with acute myeloid leukemia. (A) The cBioPortal was used to analyze the association between CD155 and CD112 expression and prognosis in a cohort of patients with acute myeloid leukemia (AML) from The Cancer Genome Atlas (TCGA). A log-rank test was used. The red line indicates the high expression group and the blue line represents the low expression group. (B, C) Left: relationship between CD155/CD112 expression and European LeukemiaNet risk classification in a cohort of patients with AML derived from TCGA. The difference in the distribution of patients with each cytogenetic risk between the high and low expression groups was estimated using the χ2 test. Right: relationship between CD155/CD112 expression and genetic mutation in a cohort of patients with AML derived from TCGA. Red indicates the high expression group and blue indicates the low expression group. (D) Expression of CD155 and CD112 in AML cell lines (MOLM-13 and MV-4-11) was analyzed using flow cytometry. Gray histograms indicate the isotype control, red indicates CD155 and blue indicates CD112 expression. MFI: median fluorescence intensity.

CD112 high-expression group compared with that in the low-expression group (P<0.001). In a multivariate analysis, CD112 was not identified as an independent prognostic factor for overall survival. We could not find any consistent correlation between CD155 expression and ELN risk classification (P=0.005) (Online Supplementary Figure S1A). Regarding somatic mutations, the CD112 high-expression group had a significantly lower frequency of FLT3 mutations and significantly higher frequency of NRAS mutations than the low-expression group. Although the difference was not statistically significant, TP53 mutations were also frequently found in the CD112 high-expression group. Other clinical data did not differ significantly between CD155 or CD112 high- and low-expression groups (Figure 1B, C, Online Supplementary Figure S1A, B).

Leukemia cell lines express CD155/CD112 on the cell surface

The expression of CD155 and CD112 in AML cell lines (MOLM-13, MV-4-11, THP-1, KG-1, NB-4, Kasumi-1, TF-1) and a blastic phase of a chronic myeloid leukemia cell line (K562) was analyzed using flow cytometry. Both CD155 and CD112 were expressed in both types of cell line, and more than 90% of the cells expressed these molecules, except for CD112 in NB-4 (Figure 1D, Online Supplementary Figure S2).

CD155 and CD112 are expressed in primary acute myeloid leukemia blasts and their expression is not associated with the initial treatment response

To analyze the expression of Nectin/Nectin-like family molecules and their receptors in leukemia cells from patients with AML, we analyzed the expression of CD155 and CD112 in primary AML blasts from patients with de novo AML using flow cytometry (Online Supplementary Figure S3). The patients’ characteristics are shown in Online Supplementary Table S2. As for primary AML blasts in peripheral blood, 63.0% (17/27 cases) had more than 20% positivity for both CD155 and CD112 expression (Figure 2A).

Next, we analyzed the relationship between the expression of CD155/CD112 in AML blasts and their response to therapy. We divided patients into two groups: those who achieved a complete response with standard induction therapy and those who did not and compared the expression of CD155/CD112 in AML blasts in the two groups. The expression of CD155 and CD112 in primary AML blasts did

not differ significantly between the groups. Although the median CD155 and CD112 values were higher in the group that did not achieve a complete response than in the group that did, the difference in distribution was not statistically significant (Online Supplementary Figure S4).

Thus, AML blasts express CD155 and CD112. Although the mRNA expression of CD112 in AML blasts is related to overall survival, CD155 and CD112 expression in AML blasts was not associated with the achievement of complete response to induction therapy.

No association between DNAM-1 or TIGIT expression on natural killer cells and initial treatment response in patients with acute myeloid leukemia

We analyzed the expression of DNAM-1 and TIGIT in primary NK and T cells from patients with de novo AML using flow cytometry (Online Supplementary Figure S3). More than 90% of NK cells in the peripheral blood and bone marrow were positive for DNAM-1 and TIGIT. No correlation was observed between DNAM-1 and TIGIT expression (Figure 2B). All T cells in peripheral blood and bone marrow were positive for DNAM-1 and TIGIT. There was a significant positive correlation between DNAM-1 and TIGIT expression in peripheral blood T cells (Online Supplementary Figure S5A).

Next, we analyzed the relationship between the expression of DNAM-1 and TIGIT in NK cells and response to therapy. We divided the patients into two groups and compared the expression of DNAM-1/TIGIT in NK cells from the two groups. DNAM-1 and TIGIT expression in NK cells did not differ significantly between the groups. Regarding peripheral blood, the group that did not achieve a complete response had a lower median DNAM-1 and higher median TIGIT expression than the group that did have a complete response (Online Supplementary Figure S5B). In T cells, DNAM-1 and TIGIT expression did not differ significantly between the groups (Online Supplementary Figure S5C). No correlation was found between the clinical test data and expression of Nectin/Nectin-like family molecules or their receptors (Online Supplementary Figure S6).

The expression of receptors for Nectin/Nectin-like family molecules in NK-92 was analyzed using flow cytometry. TIGIT and TACTILE were expressed in more than 80% of the cells, whereas DNAM-1 was expressed in only approximately 8% of the cells, and PVRIG was almost not expressed (Figure 2C).

Haematologica | 109 April 2024 1110 ARTICLE - Immune checkpoint modified NK-92 therapy for AML Y. Kaito et al.

Figure 2. CD155 and CD112 expression on acute myeloid leukemia cells and receptor expression on natural killer cells from patients with acute myeloid leukemia and on NK-92 cells. (A) Results of flow cytometry analysis of the percentage of CD155/CD112-positive leukemic cells in peripheral blood samples from patients with acute myeloid leukemia (AML) are shown in box and whisker plots. (B) Left: flow cytometric analysis of the percentage of DNAM-1/TIGIT-positive natural killer (NK) cells in peripheral blood and bone marrow fluid samples from patients with AML is shown in box and whisker plots. Right: scatter plots of the percentages of DNAM-1 and TIGIT. Bars indicate regression lines. Linear regression analysis was used to analyze correlations. (C) Expression of receptors for Nectin/Nectin-like family molecules in a NK-cell line (NK-92) was analyzed using flow cytometry. r: correlation coefficient; PB: peripheral blood; BM: bone marrow; MFI: median fluorescence intensity.

Nectin/Nectin-like family molecule receptor-modified NK-92 showed enhanced cytotoxicity against leukemia cell lines

To analyze the relationship between the receptors of Nectin/ Nectin-like family molecules and NK-92 activity, we generated a receptor-modified NK-92. DNAM-1 complementary DNA was transfected into the cells using lentiviral particles and analyzed using flow cytometry after 1 week. Lentiviral vectors with DsRed as a marker were generated and transfected into NK-92 to create control cells. (Online Supplementary Figure S7A, B). The cells that were strongly positive for DNAM-1 were sorted and expanded for another week, and DNAM-1 expression was analyzed using flow cytometry. DNAM-1induced NK-92 (NK-92 DNAM-1 DsRed) with a significantly higher mean fluorescence intensity and a positivity rate of more than 90% were obtained (Figure 3A). Electroporation was used to introduce sgRNA for knockout (KO) of TIGIT and Cas9 protein into NK-92 and analyzed using flow cy-

tometry after 1 week (Online Supplementary Figure S7C, D). TIGIT-negative cells were sorted and their expression was analyzed using flow cytometry after 1 week. TIGIT-negative NK-92 (NK-92 TIGIT KO) with a significantly lower mean fluorescence intensity and a positivity rate of less than 1% were obtained (Online Supplementary Figure S8).

To analyze the function of DNAM-1-induced and TIGIT KO NK-92, we conducted MTT and cytotoxicity assays. Analysis of cell proliferation at 24 and 48 h indicated no significant changes in either NK-92 DNAM-1 or NK-92 TIGIT KO, compared with that in NK-92 (Online Supplementary Figure S9). Next, we conducted a cytotoxicity assay targeting leukemia cell lines (MOLM-13, MV-4-11, KG-1) and measured the percentage of death (PI positivity) of leukemia cells (CFSE positive) after 4 h of co-culture with NK-92 DsRed or NK-92 DNAM-1 DsRed (Online Supplementary Figure S10A). Both cell lines showed significantly enhanced NK-92 DNAM-1 DsRed cytotoxicity compared to NK-92 DsRed (Figure 3B,

Haematologica | 109 April 2024 1111 ARTICLE - Immune checkpoint modified NK-92 therapy for AML Y. Kaito et al.
A B C

Online Supplementary Figure S10B). Similar effects were confirmed in NK-92 and NK-92 TIGIT KO (Online Supplementary Figure S10C).

Strong expression of DNAM-1 induces NK-92 activation and cytokine production

To evaluate DNAM-1-induced NK-cell activation, the expression of the degranulation marker (CD107a) and intracellular

cytokines (tumor necrosis factor-α [TNFα] and interferon-g [IFNg]) of NK cells co-cultured with leukemia cell lines was analyzed using flow cytometry (Online Supplementary Figure S11A). Both in the absence of target cells and when co-cultured with leukemia cell lines, the expression of CD107a, TNFα, and IFNg was significantly upregulated in NK-92 DNAM-1 DsRed, compared with that in NK-92 DsRed (Figure 3C, Online Supplementary Figure S11B). In contrast,

Figure 3. Generation and functional analysis of NK-92 with modified receptors for Nectin/Nectin-like family molecules. (A) DNAM-1 expression in NK-92 DsRed and NK-92 DNAM-1 DsRed. Gray histograms represent the isotype control, while the red histograms represent DNAM-1 expression. (B) Cytotoxicity of NK-92 DsRed and NK-92 DNAM-1 DsRed against leukemia cell lines (MOLM-13, MV-4-11) was analyzed and compared using cytotoxicity assays. Red lines indicate NK-92 DNAM-1 DsRed and blue lines indicate NK-92 DsRed. (C) CD107a expression in NK-92 DsRed/NK-92 DNAM-1 DsRed was analyzed using flow cytometry when NK-92 DsRed and NK-92 DNAM-1 DsRed and leukemia cell lines were co-cultured. Tumor necrosis factor-α and interferon- g expression in NK-92 DsRed and NK-92 DNAM-1 DsRed was analyzed using intracellular flow cytometry. Comparisons between the groups were performed using a two-tailed Student t test. The mean ± standard error are shown. **P<0.01, ***P<0.001, ****P<0.0001, E: effector; T: target; MFI: median fluorescence intensity.

Haematologica | 109 April 2024 1112 ARTICLE - Immune checkpoint modified NK-92 therapy for AML Y. Kaito et al.
A B C

in the absence of target cells, the expression of CD107a, TNFα, and IFNg was not significantly altered in NK-92 TIGIT KO compared with that in NK-92. When NK-92 TIGIT KO or NK-92 were co-cultured with target cells, increases in TNFα or IFNg expression were observed in some cell lines; however, CD107a expression did not change significantly (Online Supplementary Figure S11C).

Upregulation of cytotoxicity-related genes in NK-92 by DNAM-1 induction

RNA sequencing was performed to analyze the genes with changes in expression due to DNAM-1 induction or TIGIT KO. We identified genes that showed significant expression changes (|log2 (fold change)| ≥1 and P<0.05) after DNAM-1 induction. The expression of 128 genes, including those related to heat shock protein (HSP), interleukin and KIR, was upregulated. The expression of 110 genes containing those related to T-cell function was downregulated (Figure 4A, B). Based on previous reports,34,35 we analyzed activating and inhibitory receptor-related genes. The expression of CD244, FCGR3B, HAVCR2, and others was significantly altered, but less than 2-fold (Figure 4C).

Gene set enrichment analysis showed that pathways such as Regulation of NK cell mediated immunity, Positive regulation of cell killing, and Positive regulation of cytokine production involved in immune response were significantly upregulated in the Gene Ontology Biological Process gene set (Figure 4D, Online Supplementary Figure S12). None of the downregulated genes, such as those related to amino acid transport, was associated with cell killing or antitumor effects.

In contrast, among the genes that showed more than 2-fold and significant changes of expression by KO of TIGIT, 135 genes were upregulated and 316 genes were downregulated (Online Supplementary Figure S13A). Several inhibitory receptor-related genes (HAVCR2, IL1RN, KLRD1, and TGFBR1) were significantly downregulated (Online Supplementary Figure S13B). The gene set enrichment analysis showed upregulation of genes related to ribosome biogenesis, mRNA processing, and telomere maintenance in the Gene Ontology Biological Process gene set (Online Supplementary Figure S13C, D).

Thus, strong DNAM-1 expression upregulates the expression of cytotoxicity-related genes in NK-92; however, TIGIT KO did not induce upregulation of cytotoxicity-related genes in NK-92.

NK-92 DNAM-1 does not show any additive effect of the cytotoxicity caused by TIGIT KO.

From previous analyses, the activation of NK-92 was more evident under DNAM-1 induction than under TIGIT KO. To evaluate whether there is an additive effect of TIGIT KO on NK-92 activation by DNAM-1 induction, we generated NK92 transfected with DNAM-1 and TIGIT KO (NK-92 DNAM-1 TIGIT KO) (Figure 5A).

Cytotoxicity assays targeting leukemia cell lines were per-

formed using NK-92 DNAM-1, NK-92 TIGIT KO, and NK-92 DNAM-1 TIGIT KO. NK-92 DNAM-1 showed significantly increased cytotoxicity, compared to NK-92 TIGIT KO, but not when compared to K562 (Figure 5B, Online Supplementary Figure S14A). In K562, the cytotoxicity of NK-92 TIGIT KO was very strong, even at an effector-to-target ratio of 1:1, and there was no significant difference in cytotoxicity between NK-92 DNAM-1 and NK-92 TIGIT KO. Furthermore, no significant difference was observed between NK-92 DNAM-1 and NK-92 DNAM-1 TIGIT KO.

Next, using flow cytometry, we analyzed the expression of CD107a, TNFα, and IFNg in NK-92 co-cultured or not with leukemia cell lines. In NK-92 DNAM-1 or NK-92 DNAM-1 TIGIT KO, CD107a, TNFα, and IFNg expression was significantly upregulated compared with that in NK-92 TIGIT, with or without co-culture with target cells. However, no significant difference was observed between NK-92 DNAM-1 and NK-92 DNAM-1 TIGIT KO (Figure 5C, Online Supplementary Figure S14B).

Enhancement of cytotoxicity by DNAM-1 induction is ligand-dependent

To analyze whether the enhancement of cytotoxicity by DNAM-1 induction was dependent on CD155 and CD112, we generated CD155 and/or CD112 KO cells in some leukemia cell lines (Online Supplementary Figure S15A-C).

Cytotoxicity assays were performed using NK-92 DNAM-1; the cytotoxicity of NK-92 DNAM-1 was compared between wild-type and CD155 KO, CD112 KO, or double KO cell lines. When targeting MOLM-13, single KO of CD155 or CD112 did not reduce cytotoxicity of NK-92 DNAM-1, but double KO significantly reduced its cytotoxicity compared to the wildtype. When targeting MV-4-11, CD155 KO did not reduce cytotoxicity, but CD112 KO as well as double KO significantly reduced cytotoxicity. When targeting KG-1, both CD155 KO and CD112 KO reduced cytotoxicity, with CD112 KO tending to reduce it more, and double KO reducing the cytotoxicity yet further (Figure 6A).

Next, the expression of CD107a, TNFα, and IFNg was analyzed using flow cytometry when NK-92 DNAM-1 was co-cultured with the leukemia cell lines. The expression was significantly lower when co-cultured with double KO cells, compared with that in wild-type cells. In CD155 or CD112 single KO cells, changes in CD107a and cytokine expression differed between the cell lines (Figure 6B).

These results suggest that the enhancement of cytotoxicity by DNAM-1 induction depends on pathways mediated by CD155 and CD112, and that the dependence on CD155 or CD112 differs between each cell line.

NK-92 DNAM-1 exerts cytotoxicity against primary acute myeloid leukemia blasts

Using flow cytometry, we next compared the cytotoxicity of NK-92 and NK-92 DNAM-1 against leukemia cells derived from patients with AML.

Cytotoxicity against primary AML blasts with at least 40%

Haematologica | 109 April 2024 1113 ARTICLE - Immune checkpoint modified NK-92 therapy for AML Y. Kaito et al.

B

Figure 4. NK-92 DNAM-1 DsRed showed increased expression of cytotoxicity-related genes. (A) Volcano plot of genes with variable expression based on RNA-sequencing. Log2 (fold change [FC]) is plotted on the X axis and -log10 (P value) on the Y axis. Gray points indicate |log2 (FC)| ≤1 and P≥0.05, red points indicate log2 (FC) ≥1 and P<0.05, and blue points indicate log2 (FC) ≤ -1 and P<0.05. (B) Heatmap of upregulated and downregulated genes. (C) Heatmap of natural killer (NK) cell activating receptor-related genes and NK cell inhibitory receptor-related genes. (D) Representative data from a gene set enrichment analysis of a Gene Ontology Biological Process gene set. NES: normalized enrichment score, q: false discovery rate.

Haematologica | 109 April 2024 1114 ARTICLE - Immune checkpoint modified NK-92 therapy for AML Y. Kaito et al.
C D
A

Figure 5. DNAM-1 transduction and TIGIT knockout do not appear to have an additive effect. (A) A NK-92 DNAM-1 TIGIT knockout (KO) cell line was generated and its expression was analyzed using flow cytometry. (B) Cytotoxicity of NK-92 DNAM-1, NK-92 TIGIT KO, and NK-92 DNAM-1 TIGIT KO against leukemia cell lines (MOLM-13 and MV-4-11) was analyzed and compared using cytotoxicity assays. Red lines indicate NK-92 DNAM-1, blue lines indicate NK-92 TIGIT KO, and green lines indicate NK-92 DNAM-1 TIGIT KO. (C) CD107a expression of NK-92 DNAM-1, NK-92 TIGIT KO, and NK-92 DNAM-1 TIGIT KO in co-culture with leukemia cell lines was analyzed using flow cytometry. Tumor necrosis factor-α and interferon-g expression in NK-92 DNAM-1, NK-92 TIGIT KO, and NK-92 DNAM-1 TIGIT KO was analyzed using intracellular flow cytometry. The mean ± standard error are shown. A two-tailed Student t test was used to compare two groups, and one-way analysis of variance was used for comparisons among three groups. Multiple comparisons were made using the Tukey test. ns: no statistically significant difference, **P<0.01, ***P<0.001, ****P<0.0001. TNF-α: tumor necrosis factor-α; IFN-g: interferon-g

Haematologica | 109 April 2024 1115 ARTICLE - Immune checkpoint modified NK-92 therapy for AML Y. Kaito et al.
A B C

Figure 6. Enhancement of cytotoxicity by DNAM-1 is dependent on Nectin/Nectin-like family molecules. (A) Cytotoxicity of NK-92 DNAM-1 against MOLM-13, MV-4-11, KG-1 and CD155 and/or CD112 knockout (KO) cells was analyzed and compared using cytotoxicity assays. (B) CD107a expression of NK-92 DNAM-1 cells co-cultured with MOLM-13, MV-4-11, KG-1 and CD155 and/or CD112 KO cells was analyzed using flow cytometry. Tumor necrosis factor-α and interferon-g expression of NK-92 DNAM-1 cells was analyzed using intracellular flow cytometry. The mean ± standard error are shown. A two-tailed Student t test was used to compare the two groups. (C) Cytotoxicity of NK-92 and NK-92 DNAM-1 against primary acute myeloid leukemia (AML) blasts that expressed at least 40% positivity for CD155 and CD112 and 70% for either (positive group) was compared with that against primary AML blasts with less CD155 and CD112 positivity (negative group). Each point connected by a line represents a sample from the same patient. The mean ± standard error are shown. The Wilcoxon signed-rank test was used for comparison between the two groups. ns: no statistically significant difference, *P<0.05, **P<0.01, ***P<0.001, ****P<0.0001. WT: wild-type; TNF-α: tumor necrosis factor-α; IFN-g: interferon-g; E:T: effector-to-target cell ratio.

Haematologica | 109 April 2024 1116 ARTICLE - Immune checkpoint modified NK-92 therapy for AML Y. Kaito et al.
A B C

and 70% positivity for CD155 and CD112, respectively (positive group), was compared with that against primary AML blasts with less CD155 and CD112 positivity (negative group). In the positive group, the cytotoxicity of NK-92 DNAM-1 was significantly enhanced compared to that of NK-92 at an effector-to-target cell ratio of 10. No significant difference was observed in the negative control group at any effector-to-target cell ratio (Figure 6C).

Thus, the cytotoxicity of NK-92 DNAM-1 was enhanced compared with that of NK-92 in primary AML blasts with strong expression of CD155 and CD112.

DNAM-1 induced NK-92 displays stronger anti-acute myeloid leukemia effects than NK-92 in a xenograft model

To evaluate the cytotoxicity of NK-92 DNAM-1 in vivo, we generated a xenograft mouse model. NSG mice were irradiated on day -1. Luciferase-introduced MOLM-13 (1×105 cells/100 µL) were injected via the tail vein with 100 µL of PBS, NK-92 (5×106 cells/100 µL), or NK-92 DNAM-1 (5×106 cells/100 µL) on day 0. Then, 200 µL of PBS, NK-92 (5×106 cells), or NK-92 DNAM-1 (5×106 cells) were injected via the tail vein on days 1 and 2. Proliferation of leukemic cells was evaluated using IVIS once or twice a week (Figure 7A).

Representative IVIS images from days 5 and 8 are shown for the three groups: vehicle (PBS), NK-92, and NK-92 DNAM-1. The NK-92 DNAM-1 group showed suppressed AML progression, with this effect being more pronounced than in the PBS or NK-92 groups (Figure 7B).

Regarding average radiance, the NK-92 DNAM-1 group showed significantly suppressed AML progression compared to the vehicle and NK-92 groups on day 15 (Figure 7C). A significant survival benefit was observed (Figure 7D). There was no significant difference in body weight between the three groups (Figure 7E).

Discussion

This is the first study to analyze the association between the Nectin/Nectin-like family molecules expressed in AML cells and their receptors on NK cells and to demonstrate the utility of treatment with receptor-modified NK cells. The development of immunotherapy for AML has lagged behind that for other hematologic malignancies because of the lack of appropriate therapeutic targets. We, therefore, sought promising targets, which are especially specific to AML patients with a poor prognosis.

NK cells from patients with AML have a suppressive phenotype as shown by the increased expression of TIGIT36 and decreased expression of DNAM-1,37 and that prognosis is poor for patients with such impaired immune cells.36,38 With regard to CD155 and CD112, there have been reports that leukemia cells escape NK-cell attack by decreasing CD155/ CD112 expression,39 and that the expression of multiple NK-

cell receptor ligands, including MICA, ULBP, CD155, and CD112, is associated with prognosis in patients with AML.40 However, there have been no reports on the association of CD155 or CD112 alone with prognosis in patients with AML or on NKcell therapy targeting them.

Here, we found that high expression of CD112 is a poor prognostic marker in AML, which is at least partially explained by a higher frequency of cases with high-risk cytogenetics and trends to a higher frequency of TP53 mutations. In addition, the group with high CD112 expression had fewer FLT3-mutated cases and these cases do not benefit from the practically available treatment of FLT3 inhibition. Thus, adaptive immunotherapy that stimulates NK cells through activation of the DNAM-1-CD112 axis by exploiting the high expression of CD112 could be a sophisticated strategy to take advantage of the feature of this group of AML patients with a poor prognosis. DNAM-1 and TIGIT, the receptors focused on in this study, share some ligands and transmit opposing signals to NK cells.22

Previous reports indicated that TIGIT inhibits DNAM-1 directly,41 suggesting that high TIGIT expression may be associated with low DNAM-1 expression, but no such correlation was observed, at least in the samples in this study. By accumulating more cases, it may be possible to analyze whether the expression of DNAM-1 or TIGIT and the correlation between them are related to the remission rate or the subsequent relapse rate. In the analysis of the antitumor effects of DNAM-1 induction and TIGIT KO, we focused on the DNAM-1 pathway because the effect of DNAM-1 induction was stronger than that of TIGIT KO. Induction of DNAM-1 in NK-92 resulted in increased expression of HSP-related genes, such as HSPA1A and HSPA1B. HSP contributes to increased immune cell cytotoxicity,42,43 which may induce the production of pro-inflammatory cytokines such as IL-1 and IL-6, thereby increasing NK-cell activity. In contrast, as negative feedback to the activation by DNAM-1 induction, increased expression of some inhibitory KIR-related genes was observed. Inhibition of these receptors, rather than TIGIT, may be more effective when combined with NK-92 DNAM-1 cell therapy. No genes and pathways that were downregulated were found to be associated with the suppression of NK-cell function, supporting the usefulness of DNAM-1 induction. The enhanced cytotoxicity induced by DNAM-1 was dependent on binding to CD155 or CD112. The dependence on CD155 and CD112 was cell line-dependent. In some cell lines, CD112 KO reduced the cytotoxicity of NK-92 DNAM-1, suggesting the importance of the DNAM-1/CD112 axis. It is important to analyze the association between known AML risk factors and CD112 to better select patients who will benefit from treatment with NK-92 DNAM-1. CD112 expression may be a marker for predicting the therapeutic response to DNAM-1-induced NK-cell therapy. In vivo, DNAM-1-induced NK-92 was able to inhibit AML growth compared to the vehicle, but administration of NK-92 DNAM-1 after AML progression did not have any suppressive effect (data not shown). In clinical settings, it

Haematologica | 109 April 2024 1117 ARTICLE - Immune checkpoint modified NK-92 therapy for AML Y. Kaito et al.

the In Vivo

days 5 and 8. (C) One-way

of variance (ANOVA) was used to compare the three groups. Multiple comparisons were made using the Tukey test. (D) Survival curves of the three groups. A log-rank test was used. Multiple comparisons were performed with the Holm test. (E) Mouse weight curves for the three groups. A one-way ANOVA test was used. Multiple comparisons were made using the Tukey test. The mean ± standard error are shown. ns: no statistically significant difference, *P<0.05, **P<0.01

Haematologica | 109 April 2024 1118 ARTICLE - Immune checkpoint modified NK-92 therapy for AML Y. Kaito et al. A B C
D
E
Figure 7. NK-92 DNAM-1 inhibits acute myeloid leukemia progression in vivo. (A) Schematic diagram of the xenograft mouse model experimental protocol. (B) Representative images from Imaging System on analysis

is realistic to use NK-92 DNAM-1 cell therapy to eliminate minimal residual disease and for maintenance therapy after remission, but not as induction therapy. Enhancement of directivity to the tumor is important for enhancing the efficacy of NK-cell therapy. As a method to increase directivity against tumors, the generation of chimeric antigen receptor-NK cells, a combination of antibodies with antibody-dependent cellular cytotoxicity, and a combination of immunostimulatory drugs is encouraged.44,45 The combination of these drugs may increase the sensitivity of AML cells to NK-92 DNAM-1.46,47 In this study, we showed that the Nectin/Nectin-like family molecule CD112 was expressed in AML blasts and that it may be associated with prognosis and therapeutic response. NK-cell therapy that targets these cells may be effective in suppressing AML progression. We propose that the necessary steps before proceeding to a first-in-human study of NK-92 DNAM-1 must include genetic modifications, such as enabling the autocrine secretion of cytokines that activate NK-92 and maintain their proliferation, and introducing suicide genes that prevent tumorigenesis, as well as experiments with patient-derived xenograft models. Moreover, efficacy and safety analyses, including effects on normal hematopoiesis, are needed. Clinically, NK-92 DNAM-1 cell therapy may contribute to the eradication of minimal residual disease as a maintenance therapy after hematopoietic stem cell transplantation and chemotherapy.

Disclosures

YN received research funding from Daiichi Sankyo and an honorarium from Fuji Pharma. YN is a consultant for Novartis and Otsuka Pharmaceutical. KM has received research

References

1. Arber DA, Orazi A, Hasserjian R, et al. The 2016 revision to the World Health Organization classification of myeloid neoplasms and acute leukemia. Blood. 2016;127(20):2391-2405.

2. Papaemmanuil E, Gerstung M, Bullinger L, et al. Genomic classification and prognosis in acute myeloid leukemia. N Engl J Med. 2016;374(23):2209-2221.

3. DiNardo CD, Jonas BA, Pullarkat V, et al. Azacitidine and venetoclax in previously untreated acute myeloid leukemia. N Engl J Med. 2020;383(7):617-629.

4 Perl AE, Martinelli G, Cortes JE, et al. Gilteritinib or chemotherapy for relapsed or refractory FLT3-mutated AML. N Engl J Med. 2019;381(18):1728-1740.

5. Jongen-Lavrencic M, Grob T, Hanekamp D, et al. Molecular minimal residual disease in acute myeloid leukemia. N Engl J Med. 2018;378(13):1189-1199.

6. Knaus HA, Berglund S, Hackl H, et al. Signatures of CD8+ T cell dysfunction in AML patients and their reversibility with response to chemotherapy. JCI Insight. 2018;3(21):e120974.

7 Williams P, Basu S, Garcia-Manero G, et al. The distribution of T-cell subsets and the expression of immune checkpoint receptors and ligands in patients with newly diagnosed and

funding from Nippon Shinyaku, Takeda Pharmaceutical, Kyowa Kirin, Chugai Pharmaceutical, Sumitomo Dainippon Pharma, and Daiichi Sankyo. KM is a consultant for Novartis Pharma, Kyowa Kirin, and Bristol-Myers Squibb. YI received research funding from JSPS KAKENHI (grant number 20K08726), Takeda Pharma, and Bristol Myers Squibb. YI has received honoraria from Bristol Myers Squibb, Takeda Pharma, Janssen Pharmaceutical, and Sanofi. The remaining authors have no conflicts of interest to disclose.

Contributions

YK and YI performed the research, analyzed and interpreted the data, and wrote the manuscript. YI designed the study and edited the manuscript. ES, SG, YN, and HT analyzed and interpreted the data and revised the manuscript. FN, YT, MS, SY, HY, and KM provided the samples from AML patients for this study. YI supervised the project. YK and YI confirmed the authenticity of all the raw data. All the authors have read and approved the final manuscript.

Acknowledgments

The authors thank all patients who participated in this study.

Funding

This study was funded by the Japan Society for the Promotion of Science, Kagaku Kenkyu hi (grant n. 20K08726).

Data-sharing statement

The data generated in the current study are available from the corresponding author on reasonable request. RNA sequencing data were deposited in the DNA Data Bank of Japan (accession number DRA 015488).

relapsed acute myeloid leukemia. Cancer. 2019;125(9):1470-1481.

8. Bashey A, Medina B, Corringham S, et al. CTLA4 blockade with ipilimumab to treat relapse of malignancy after allogeneic hematopoietic cell transplantation. Blood. 2009;113(7):1581-1588.

9 Daver N, Garcia-Manero G, Basu S, et al. Efficacy, safety, and biomarkers of response to azacitidine and nivolumab in relapsed/refractory acute myeloid leukemia: a nonrandomized, open-label, phase II study. Cancer Discov. 2019;9(3):370-383.

10. Huang R, Li X, He Y, et al. Recent advances in CAR-T cell engineering. J Hematol Oncol. 2020;13(1):86.

11. Abel AM, Yang C, Thakar MS, Malarkannan S. Natural killer cells: development, maturation, and clinical utilization. Front Immunol. 2018;9:1869.

12. Waldhauer I, Steinle A. NK cells and cancer immunosurveillance. Oncogene. 2008;27(45):5932-5943.

13. Veluchamy JP, Kok N, van der Vliet HJ, Verheul HMW, de Gruijl TD, Spanholtz J. The rise of allogeneic natural killer cells as a platform for cancer immunotherapy: recent innovations and future developments. Front Immunol. 2017;8:631.

14 Parkhurst MR, Riley JP, Dudley ME, Rosenberg SA. Adoptive transfer of autologous natural killer cells leads to high levels of

Haematologica | 109 April 2024 1119 ARTICLE - Immune checkpoint modified NK-92 therapy for AML Y. Kaito et al.

circulating natural killer cells but does not mediate tumor regression. Clin Cancer Res. 2011;17(19):6287-6297.

15. Franks SE, Wolfson B, Hodge JW. Natural born killers: NK cells in cancer therapy. Cancers (Basel). 2020;12(8):2131.

16. Romanski A, Uherek C, Bug G, et al. CD19-CAR engineered NK-92 cells are sufficient to overcome NK cell resistance in B-cell malignancies. J Cell Mol Med. 2016;20(7):1287-1294.

17 Tam YK, Miyagawa B, Ho VC, Klingemann HG. Immunotherapy of malignant melanoma in a SCID mouse model using the highly cytotoxic natural killer cell line NK-92. J Hematother. 1999;8(3):281-290.

18. Zhang J, Zheng H, Diao Y. Natural killer cells and current applications of chimeric antigen receptor-modified NK-92 cells in tumor immunotherapy. Int J Mol Sci. 2019;20(2):317.

19. Maki G, Klingemann HG, Martinson JA, Tam YK. Factors regulating the cytotoxic activity of the human natural killer cell line, NK-92. J Hematother Stem Cell Res. 2001;10(3):369-383.

20. Boyiadzis M, Agha M, Redner RL, et al. Phase 1 clinical trial of adoptive immunotherapy using “off-the-shelf” activated natural killer cells in patients with refractory and relapsed acute myeloid leukemia. Cytotherapy. 2017;19(10):1225-1232.

21. Blake SJ, Dougall WC, Miles JJ, Teng MW, Smyth MJ. Molecular pathways: targeting CD96 and TIGIT for cancer immunotherapy. Clin Cancer Res. 2016;22(21):5183-5188.

22. Sanchez-Correa B, Valhondo I, Hassouneh F, et al. DNAM-1 and the TIGIT/PVRIG/TACTILE axis: novel immune checkpoints for natural killer cell-based cancer immunotherapy. Cancers (Basel). 2019;11(6):877.

23. Mendelsohn CL, Wimmer E, Racaniello VR. Cellular receptor for poliovirus: molecular cloning, nucleotide sequence, and expression of a new member of the immunoglobulin superfamily. Cell. 1989;56(5):855-865.

24. Stamm H, Klingler F, Grossjohann EM, et al. Immune checkpoints PVR and PVRL2 are prognostic markers in AML and their blockade represents a new therapeutic option. Oncogene. 2018;37(39):5269-5280.

25. Qu P, Huang X, Zhou X, et al. Loss of CD155 expression predicts poor prognosis in hepatocellular carcinoma. Histopathology. 2015;66(5):706-714.

26. Huang X, Qu P, Chen Y, et al. Low expression of CD112 is associated with poor overall survival in patients with hepatocellular carcinoma. Hum Pathol. 2014;45(9):1944-1950.

27. Sanchez-Correa B, Gayoso I, Bergua JM, et al. Decreased expression of DNAM-1 on NK cells from acute myeloid leukemia patients. Immunol Cell Biol. 2012;90(1):109-115.

28. Guillerey C, Harjunpää H, Carrié N, et al. TIGIT immune checkpoint blockade restores CD8(+) T-cell immunity against multiple myeloma. Blood. 2018;132(16):1689-1694.

29 Kong Y, Zhu L, Schell TD, et al. T-cell immunoglobulin and ITIM domain (TIGIT) associates with CD8+ T-cell exhaustion and poor clinical outcome in AML patients. Clin Cancer Res. 2016;22(12):3057-3066.

30. Josefsson SE, Huse K, Kolstad A, et al. T cells expressing checkpoint receptor TIGIT are enriched in follicular lymphoma tumors and characterized by reversible suppression of T-cell receptor signaling. Clin Cancer Res. 2018;24(4):870-881.

31. Mettu NB, Ulahannan SV, Bendell JC, et al. A phase 1a/b openlabel, dose-escalation study of etigilimab alone or in

combination with nivolumab in patients with locally advanced or metastatic solid tumors. Clin Cancer Res. 2022;28(5):882-892.

32. Cho BC, Abreu DR, Hussein M, et al. Tiragolumab plus atezolizumab versus placebo plus atezolizumab as a first-line treatment for PD-L1-selected non-small-cell lung cancer (CITYSCAPE): primary and follow-up analyses of a randomised, double-blind, phase 2 study. Lancet Oncol. 2022;23(6):781-792.

33. Ley TJ, Miller C, Ding L, et al. Genomic and epigenomic landscapes of adult de novo acute myeloid leukemia. N Engl J Med. 2013;368(22):2059-2074.

34 Martinet L, Ferrari De Andrade L, Guillerey C, et al. DNAM-1 expression marks an alternative program of NK cell maturation. Cell Rep. 2015;11(1):85-97.

35. Landolina N, Mariotti FR, Ingegnere T, et al. IL-1R8 silencing improves the anti-tumor function of freshly isolated human NK cells. J Immunother Cancer. 2022;10(3):e003858.

36. Liu G, Zhang Q, Yang J, et al. Increased TIGIT expressing NK cells with dysfunctional phenotype in AML patients correlated with poor prognosis. Cancer Immunol Immunother. 2022;71(2):277-287.

37. Valhondo I, Hassouneh F, Lopez-Sejas N, et al. Characterization of the DNAM-1, TIGIT and TACTILE axis on circulating NK, NKTlike and T cell subsets in patients with acute myeloid leukemia. Cancers (Basel). 2020;12(8):2171.

38. Chretien AS, Devillier R, Granjeaud S, et al. High-dimensional mass cytometry analysis of NK cell alterations in AML identifies a subgroup with adverse clinical outcome. Proc Natl Acad Sci U S A. 2021;118(22):e2020459118.

39 Kearney CJ, Ramsbottom KM, Voskoboinik I, Darcy PK, Oliaro J. Loss of DNAM-1 ligand expression by acute myeloid leukemia cells renders them resistant to NK cell killing. Oncoimmunology. 2016;5(8):e1196308.

40 Mastaglio S, Wong E, Perera T, et al. Natural killer receptor ligand expression on acute myeloid leukemia impacts survival and relapse after chemotherapy. Blood Adv. 2018;2(4):335-346.

41. Ge Z, Peppelenbosch MP, Sprengers D, Kwekkeboom J. TIGIT, the next step towards successful combination immune checkpoint therapy in cancer. Front Immunol. 2021;12:699895.

42. Multhoff G, Mizzen L, Winchester CC, et al. Heat shock protein 70 (Hsp70) stimulates proliferation and cytolytic activity of natural killer cells. Exp Hematol. 1999;27(11):1627-1636.

43. Figueiredo C, Wittmann M, Wang D, et al. Heat shock protein 70 (HSP70) induces cytotoxicity of T-helper cells. Blood. 2009;113(13):3008-3016.

44 Farber M, Chen Y, Arnold L, et al. Targeting CD38 in acute myeloid leukemia interferes with leukemia trafficking and induces phagocytosis. Sci Rep. 2021;11(1):22062.

45. Le Roy A, Prébet T, Castellano R, et al. Immunomodulatory drugs exert anti-leukemia effects in acute myeloid leukemia by direct and immunostimulatory activities. Front Immunol. 2018;9:977.

46. Chen B, Lee JB, Kang H, Minden MD, Zhang L. Targeting chemotherapy-resistant leukemia by combining DNT cellular therapy with conventional chemotherapy. J Exp Clin Cancer Res. 2018;37(1):88.

47. Cany J, Roeven MWH, Hoogstad-van Evert JS, et al. Decitabine enhances targeting of AML cells by CD34(+) progenitor-derived NK cells in NOD/SCID/IL2Rg(null) mice. Blood. 2018;131(2):202-214.

Haematologica | 109 April 2024 1120 ARTICLE - Immune checkpoint modified NK-92 therapy for AML Y. Kaito et al.

HLA-C*04:09N is expressed at the cell surface and triggers peptide-specific T-cell activation

Carlotta Welters,1 Marthe-Lina Welters,1 Serena Stadler,2 Lars Bullinger,1,2 Julian Strobel,3 Holger Hackstein,3 Arunraj Dhamodaran,4 Thomas Blankenstein5 and Leo Hansmann1,2,6

1Department of Hematology, Oncology, and Tumor Immunology, Charité –Universitätsmedizin Berlin (CVK), Berlin, Germany; 2German Cancer Consortium (DKTK), Partner Site Berlin, Berlin, Germany; 3Department of Transfusion Medicine and Hemostaseology, Friedrich-Alexander-University Erlangen-Nuremberg, Erlangen, Germany; 4T-knife Therapeutics Inc., San Francisco, CA, USA; 5Molecular Immunology and Gene Therapy, Max-Delbrück-Center for Molecular Medicine (MDC), Berlin, Germany and 6Department of Internal Medicine III, University Hospital Regensburg, Regensburg, Germany

Abstract

Correspondence: L. Hansmann leo.hansmann@ukr.de

Received: June 23, 2023.

Accepted: September 18, 2023.

Early view: September 28, 2023.

https://doi.org/10.3324/haematol.2023.283812

©2024 Ferrata Storti Foundation

Published under a CC BY-NC license

The null allele HLA-C *04:09N differs from HLA-C *04:01 in a frameshift mutation within its cytoplasmic domain, resulting in translation of 32 additional amino acids that are assumed to prevent cell surface expression. However, we recently identified a multiple myeloma-reactive T-cell receptor (TCR) that appeared to recognize antigen presented on HLA-C *04:09N and encouraged us to ask whether HLA-C *04:09N, albeit not easily detectable at the cell surface, can present antigen sufficient for T-cell activation. We generated two HLA-class I-deficient cell lines, re-expressed HLAC *04:09N, detected HLA expression by flow cytometry, and tested for T-cell activation using a cytomegalovirus peptide-specific HLA-C *04:01-restricted TCR. In both cell lines, HLA-C *04:09N expression was detectable at the cell surface and could be enhanced by IFN- g exposure. Recombinant HLA-C * 04:09N expression was sufficient for T-cell activation in vitro , which could be blocked by an HLA-class I-specific antibody, suggesting HLA-TCR interaction at the cell surface. Peripheral blood mononuclear cells isolated from an individual who physiologically expressed HLA-C*04:09N triggered peptide-specific T-cell activation, confirming our results with cells with natural HLA expression levels. In conclusion, we present peptide-specific HLA-C *04:09N-restricted T-cell activation and suggest consideration of this allele in the appropriate clinical context, such as allogeneic stem cell transplantation, or in the setting of cellular therapy.

Introduction

HLA-C*04:09N (C*04:09N) is one of 344 currently reported null alleles at the HLA-C locus (https://hla.alleles.org). Accounting for frequencies between 0.00002 and 0.0189 in cohorts that include more than 1,000 individuals,1,2 C*04:09N is considered one of the most frequent null alleles.3,4 C*04:09N differs from HLA-C*04:01 (C*04:01) in a point deletion within exon seven, which results in a frameshift and extension of the reading frame 97 base pairs beyond the canonical stop codon, translating into a protein 32 amino acids longer than C*04:01.5-7 The additional 32 amino acids do not inhibit intracellular protein expression but were suggested to prevent cell surface expression.5,7 Consequently, C*04:09N expression has been reported to be detectable by intracellular staining but not at the cell surface using the pan HLA-class I-specific antibody, clone W6/32, which resulted in its designation as a null allele.5 The extracellular parts

of C*04:09N and C*04:01 are identical, suggesting potential presentation of identical peptide repertoires.

We recently identified a multiple myeloma-reactive T-cell receptor (TCR) that appeared to recognize antigen presented on C*04:09N,8 calling its status as a null allele into question. Current evidence that defines C*04:09N as a null allele relies on flow cytometry-based detection of HLA-cell surface expression using one HLA-class I-specific antibody clone (W6/32) and lacks functional proof of the biological irrelevance of this allele.

Our observations in multiple myeloma encouraged us to study whether C*04:09N, albeit not detectable at the cell surface in previous studies, can present antigen in a form that enables peptide-specific T-cell activation. We asked experimentally whether C*04:09N expression: i) is detectable at the cell surface with current technologies; ii) can be modulated by the cytokine milieu; and iii) is sufficient for peptide presentation and specific T-cell activation.

Haematologica | 109 April 2024 1121 - Cell Therapy & Immunotherapy ARTICLE

Methods

Primary cells

The study was approved by the local institutional review board (protocol EA2/096/15 to LH). All participants provided written informed consent, and all research was conducted in accordance with the Declaration of Helsinki.

Cell lines and culture conditions

HEK293T (RRID: CVCL_0063) and U2OS (RRID: CVCL_0042) were cultivated in DMEM with 10% fetal bovine serum (FBS), 10,000 U/mL penicillin, and 10 mg/mL streptomycin (all Thermo Fisher Scientific) at 37°C and 5% CO2. If indicated, 1,000 U/mL IFN-g (PeproTech) were added for 24 hours (h) prior to analysis or co-culture experiments.

T-cell receptor expression on human peripheral blood lymphocytes

Recombinant TCR expression in human lymphocytes was performed as previously described.8-10 Detailed information on the QYD peptide-specific TCR has been reported previously.11

HLA knockout using CRISPR-Cas9

HLA-A, HLA-B, and HLA-C knockout of U2OS was performed as previously described8 and confirmed by flow cytometry.

Recombinant HLA expression

Coding sequences of C*04:09N and C*04:01 (accession numbers HLA01451, HLA00420) were downloaded from IPDIMGT/HLA (https://www.ebi.ac.uk/ipd/imgt/hla/), synthesized (GeneArt, Life Technologies), and cloned into the pHSE3’ vector under control of an H-2Kb promoter, as previously described.12 Cell lines were transfected with FuGENE® HD (Promega). For stable expression, cells were selected with 3 mg/mL G418 (Cayman Chem), and single cell clones were generated by limiting dilution.

Minigene expression

The amino acid sequence of cytomegalovirus (CMV)-derived pp65 was downloaded (https://www.ncbi.nlm.nih.gov, Gene ID: 3077579) and two 38 amino acid long sequences containing QYDPVAALF (QYD, underlined: MGQQIFLEVQAIRETVELRQYDPVAALFFFDIDLLLQRG) and KDVALRHVV (KDV, underlined: MTSAFVFPTKDVALRHVVCAHELVCSMENTRATKMQVIG) were reverse translated using EMBOSS.13 Minigene constructs were synthesized (Integrated DNA Technologies Inc.), cloned into pcDNA6/V5-His A, and transfected with FuGENE® HD (Promega) 36 h before co-culture experiments.

Flow cytometry

Reagents for determination of HLA expression or T-cell activation upon co-incubation are listed in the Online Supplementary Appendix. For intracellular staining, we used the Cytofix/Cytoperm Fixation/Permeabilization Kit (BD Biosciences). All reagents were used according to the man-

ufacturer’s instructions.

Magnetic-activated cell separation

For enrichment of CD8+ T cells before co-culture experiments, we used MojoSort™ Human CD8 Nanobeads (Biolegend) for magnetic-activated cell separation (MACS) with minor modifications: CD8 Nanobeads were diluted 1:5 and cells were separated on MS columns (Miltenyi). Enriched populations were on average 71.7% CD8+, as determined by flow cytometry.

Co-cultures

Co-culture experiments of TCR-transduced T cells with HEK293T or U2OS were performed in 250 µL medium (RPMI-1640 supplemented with 10% FBS, 10,000 U/mL penicillin, and 10 mg/mL streptomycin) in 48-well plates for 18 h; co-cultures with PBMC were performed in 150 µL medium in 96-well plates for 24 h at 37°C and 5% CO2. Indicated peptides (Genscript) were added at 5 µM final concentration 1 h before co-culture. For HLA-blocking, Ultra-LEAF Purified Anti-Human HLA-class I (clone W6/32, BioLegend, RRID: AB_2561492) or Ultra-LEAF Purified Mouse IgG2a κ isotype control (clone MOPC-173, BioLegend, RRID: AB_11148947) were added at 50 µg/mL final concentration 1 h before co-culture. Activation of T cells was detected using the Human IFN-g ELISA Set BD OptEIA (BD Biosciences, RRID: AB_2869029), the human granzyme B DuoSet ELISA kit (R&D Systems), and by flow cytometry.

HLA typing of the sample MM160

HLA-typing was performed using Holotype HLA24/7 (Omixon; Budapest, Hungary) in combination with MiSeq (Illumina; San Diego, CA, USA) according to the manufacturer’s instructions. Sequencing data were analyzed using Twin software v.3.1.1 (Omixon) and IMGT/HLA-Database v.3.32. HLA-C*04:09N was confirmed by sequence-specific primer (SSP) PCR (Olerup SSP® HLA-C*04:09N, Olerup SSP AB; Stockholm, Sweden) according to the manufacturer’s instructions.

Statistical analysis

Statistics were calculated using R, v.4.0.3.14 (See figure legends for the tests applied.)

Results

HLA-C*04:09N is expressed at the cell surface

We transfected HEK293T that lack HLA-A, HLA-B and HLA-C expression (HEKHLA-KO)8 with pHSE3’ expression plasmids that encoded C*04:09N or C*04:01 as a positive control. HLA expression was determined by flow cytometry after intracellular or cell surface staining with antibodies specific for HLA-BC (clone B1.23.2) or pan HLA-class I (clone W6/32) (Online Supplementary Table S1). As expected, C*04:09N was detectable by intracellular staining (Figure 1A). How-

Haematologica | 109 April 2024 1122 ARTICLE - T-cell activation in the context of HLA-C*04:09N C. Welters et al.

ever, we also detected C*04:09N cell surface expression after staining with the HLA-BC-specific antibody (Figure 1A, top). In line with previous observations,5,7 only residual C*04:09N cell surface expression could be observed with the pan HLA-class I antibody (Figure 1A, bottom). C*04:01 expression was detectable by intracellular and cell surface staining (Figure 1A).

Recombinant HLA expression can vary in the context of different cell types and due to transfection efficiency. To confirm our findings, we generated an osteosarcoma cell line deficient in HLA-A, HLA-B and HLA-C (U2OSHLA-KO), of which we established a single cell clone-derived cell line that stably expressed C*04:09N as the only HLA-ABC allele

(U2OS04:09N). In line with our results from transient HLA expression in HEKHLA-KO, surface expression of C*04:09N was weak but detectable with the HLA-BC-specific, but not with the pan HLA-class I-specific antibody (Figure 1B). Microenvironmental influences including, but not limited to the cytokine milieu, can modulate HLA expression. As an example, we determined HLA-cell surface expression of U2OS04:09N after exposure to IFN-g in vitro. While C*04:09N cell surface expression was detectable on an average of 21.4% of U2OS04:09N, expression increased to an average of 81.8% after IFN-g treatment. (See Figure 1C for a representative example). On average, HLA-cell surface expression on U2OS04:09N, determined as allophycocyanin (APC) mean

*04:09N cell surface expression by flow cytometry. (A) HEKHLA-KO were transfected with plasmids encoding C*04:09N (HEK04:09N) or C*04:01 (HEK04:01) and stained with HLA-BC (clone B1.23.2, top) or pan HLA-class I (clone W6/32, bottom) antibody for flow cytometry. The plots show one representative example out of 3 independent experiments. (B) Flow cytometry detection of cell surface C*04:09N expression on U2OS04:09N with HLA-BC (top) or pan HLA-class I antibody (bottom). (C) Effects of in vitro IFN-g exposure on C*04:09N cell surface expression on U2OS04:09N. If indicated, cells were incubated with 1,000 U/mL IFN-g for 24 hours (h) prior to analysis. The flow cytometry plot is representative for 3 independent experiments. (D) HLA cell surface expression of U2OS04:09N after 24-h IFN-g exposure determined as mean fluorescence intensity (MFI) in 3 independent experiments with 3 replicates per experiment. Data points indicate 9 individual replicates. WT: wild type.

Haematologica | 109 April 2024 1123 ARTICLE - T-cell activation in the context of HLA-C*04:09N C. Welters et al.
A B C D
Figure 1. Detection of HLA-C

fluorescence intensity (MFI), increased 1.9-fold upon IFN-g exposure (Figure 1D). IFN-g exposure did not substantially affect cell surface staining of C*04:09N with the pan HLAclass I-specific antibody (Online Supplementary Figure S1). Taken together, C*04:09N expression was detectable at the cell surface of two different cell lines and increased upon IFN-g exposure in vitro

T cells can be activated by peptides presented on HLAC*04:09N

Identical extracellular domains, including the peptide binding grooves, of C*04:09N and C*04:01 suggest binding of a similar peptide repertoire. To determine potential T-cell activation by peptides presented on C*04:09N, we expressed a C*04:01-restricted TCR specific for the CMV-derived epitope QYDPVAALF (QYD),11 which is presented on C*04:01, in human peripheral blood T cells (TQYD) (Online Supplementary Figure S2). (See Table 1 for HLA-class I alleles of the donor used for TCR expression). IFN-g and granzyme B secretion were measured to detect T-cell activation. For antigen presentation, HEKHLA-KO were co-transfected with expression plasmids encoding C*04:09N and a minigene encoding the target epitope (QYD) or a negative control epitope (KDVALRHVV, called KDV). Only HEKHLA-KO co-transfected with C*04:09N and the target epitope QYD activated TQYD, confirming activation of a C*04:01-restricted TCR by a peptide presented on C*04:09N (Figure 2A). Non-TCR-transduced T cells could not be activated by HEK04:09N confirming TCR-dependent T-cell activation (Online Supplementary Figure S3). T-cell activation was blocked by pan HLA-class I-specific antibody, which suggested that C*04:09N-T-cell interaction occurred at the cell surface (Figure 2B).

To confirm our results in a different cell line, U2OSHLA-KO and U2OS04:09N were transfected with the QYD or KDV minigenes and co-cultured with TQYD. Only U2OS04:09N expressing the QYD minigene activated TQYD (Figure 2C). In line with our results from HEK293T, non- transduced T cells were not activated

Patient/Donor

T-cell donor

MM160

HLA-class I alleles

A*03:01:01; A*34:02:01

B*07:02:01; B*14:01:01

C*07:02:01; C*08:02:01

A*02:01:01G; A*23:01:01

B*44:03:01G; B*51:01:01G

C*04:09N; C*15:02:01

by U2OS04:09N (Online Supplementary Figure S4). TQYD activation by U2OS04:09N could be blocked by the pan HLA-class I antibody (Figure 2D).

Our data functionally confirmed: i) C*04:09N-dependent; and ii) target epitope-specific T-cell activation.

Peripheral blood mononuclear cells of an HLA-C*04:09N+ donor can present QYD and trigger specific T-cell activation

We obtained peripheral blood mononuclear cells (PBMC) of one multiple myeloma patient (MM160) who physiologically expressed C*04:09N (Table 1) and had been part of a previous study of our group.8 PBMC of MM160 were rested or incubated with IFN-g for 24 h, washed, loaded with QYD or the negative control peptide KDV, and incubated with TQYD CD137 expression on TCR-transduced CD8+ T cells (see Online Supplementary Table S2 for antibody panel and Online Supplementary Figure S5 for gating strategy) and granzyme B in cell culture supernatants were measured to detect T-cell activation. TQYD were activated by PBMC of patient MM160 in a QYD-specific manner, and activation could be enhanced by pre-incubation of PBMC with IFN-g (Figure 3A). Accordingly, increased frequencies of dead cells among target peptide-loaded PBMC after co-culture suggested peptide-specific killing in the context of C*04:09N (Figure 3A,

T cells for recombinant T-cell receptor expression were isolated from leftover materials of an allogeneic stem cell graft (T-cell donor). Continued on following page.

Haematologica | 109 April 2024 1124 ARTICLE - T-cell activation in the context of HLA-C*04:09N C. Welters et al.
Table 1. HLA-class I alleles of the T-cell donor for T-cell receptor expression and multiple myeloma patient MM160.
A B

*04:09N. (A) TQYD were cultured with HEKHLA-KO which were (co-)transfected with a plasmid encoding C*04:09N and a minigene encoding QYD or KDV. (B) TQYD were incubated with HEKHLA-KO co-transfected with a plasmid encoding C*04:09N and the QYD-minigene in presence of a blocking antibody against pan HLAclass I (clone W6/32) or isotype control (clone MOPC 173). (C) TQYD were incubated with U2OSHLA-KO or U2OS04:09N transfected with the QYD- or KDV-minigene. (D) TQYD were incubated with U2OS04:09N transfected with the QYD-minigene in the presence of a blocking antibody against pan HLA-class I (clone W6/32) or isotype control (clone MOPC 173). Bar charts indicate mean ± standard error of mean. In all charts, IFN-g and granzyme B in cell culture supernatants were measured by ELISA. Data are representative of 3 independent experiments with 3 technical replicates per experiment. Statistical significance was determined by paired Student t test and corrected for multiple testing by Bonferroni correction. ***P<0.001.

B). Non-TCR-transduced T cells were not activated by QYD loaded onto PBMC of MM160, although granzyme B showed higher background after pre-incubation with IFN-g (Figure 3B). To exclude the possibility that QYD could potentially be presented by any of the HLA-alleles of MM160 other than C*04:09N, we expressed all HLA-alleles of MM160 one at a time (Table 1) in HEKHLA-KO, each in combination with the QYD minigene, and tested for activation of TQYD. Only C*04:09N in combination with the QYD minigene activated TQYD (Figure 3C). T cells that were used for TCR transduction did not express either C*04:01 or C*04:09N (Table 1); to experimentally exclude antigen presentation by T cells used for TCR transduction, we demonstrated that incubation of non-transduced T cells and TQYD in presence of QYD peptide did not result in T-cell activation (Figure 3D).

In summary, PBMC of a C*04:09N+ individual can present peptide and trigger T-cell activation in a C*04:09N-restricted manner.

Discussion

C*04:09N, first described in 2002,5,7 is considered a null allele due to previously non-detectable cell surface expression, and we are not aware of any functional confirmation that C*04:09N could not trigger peptide-specific T-cell activation. Moreover, we recently identified a multiple myeloma-reactive TCR that appeared to recognize antigen in the context of C*04:09N.8 This encouraged us to experimentally address whether C*04:09N expression: i) can be detected at the cell

surface with current technologies; and ii) can trigger peptide-specific T-cell activation in a functional assay.

Accurate detection of C*04:09N cell surface expression requires specific antibodies, which are commercially available against pan HLA-class I (clone W6/32), HLA-BC (clone B1.23.2), and HLA-C (clone DT9). Currently, there is no commercially available antibody specifically against C*04:01, or even C*04:09N. Therefore, we generated two cell lines (HEK293T and U2OS), in which we deleted all endogenous HLA-A, HLA-B, and HLA-C alleles by CRISPR Cas9. In these cell lines, we expressed single HLA-C alleles of choice, which could subsequently be detected by any of the above-mentioned antibodies (pan HLA class I, HLA-BC, or HLA-C). We chose HEK293T and U2OS because they are widely available and easy to transfect with high efficiency by standard methodologies. The HLA-C-specific antibody (DT9) delivers only weak staining for flow cytometry compared to the HLA-BC or pan HLA-class I-specific antibodies; furthermore, DT9 can also recognize HLA E,15 and was, therefore, not used in this study.

Recombinant cell surface expression of C*04:09N was weak and only reliably detectable with the HLA-BC-specific antibody (B1.23.2) confirming results of previous studies that only used the pan HLA-class I-specific antibody (W6/32) for C*04:09N detection.5,7 A possible explanation, among many others, for the observed differences in sensitivity between the B1.23.2 and W6/32 antibodies could be that W6/32 detects HLA in complex with b2-microglobulin, whereas B1.23.2 recognizes an epitope expressed on both b2-microglobulin-associated and free HLA-class I heavy chains.16,17

Haematologica | 109 April 2024 1125 ARTICLE - T-cell activation in the context of HLA-C*04:09N C. Welters et al.
C D
Figure 2. Specific T-cell activation by a peptide presented on HLA-C

3. QYD peptide-specific T-cell activation in an HLA-C*04:09N+ individual. (A) TQYD were labeled with cell trace violet and cultured with peripheral blood mononuclear cells (PBMC) of an HLA-C*04:09N+ individual loaded with 5 µM QYD- or KDV-peptide; PBMC were incubated with 1,000 U/mL IFN-g for 24 hours (h) before co-culture if indicated. To detect T-cell activation, CD137 expression on TCR-transduced CD8+ T cells was determined by flow cytometry and granzyme B secretion in cell culture supernatants was measured by ELISA. Dead PBMC were determined as zombie NIR+ among all cell trace violet negative cells. (B) Non-TCR-transduced T cells labeled with cell trace violet and incubated with PBMC of the same donor (see panel A) loaded with 5 µM QYD- or KDV-peptide; PBMC were incubated with 1,000 U/mL IFN-g for 24 h before co-culture if indicated. To detect T-cell activation, CD137 expression on CD8+ T cells was determined by flow cytometry and granzyme B secretion in cell culture supernatants was measured by ELISA. Dead PBMC were determined as zombie NIR+ among all cell trace violet negative cells. (C) TQYD were cultured with HEKHLA-KO that recombinantly expressed all HLA alleles of MM160 (one at a time) and the QYD-minigene. IFN-g and granzyme B in cell-culture supernatants were measured by ELISA. Bar charts indicate mean ± standard error of mean. Data are representative of 3 experiments. (D) To confirm that QYD could not be presented by the T cells used for T-cell receptor (TCR) transduction, TQYD were co-cultured with non-TCR-transduced T cells loaded with 5 µM QYD- or KDV-peptide.

C*04:09N surface expression was enhanced by IFN-g exposure. IFN-g is known to regulate gene expression beyond HLA-class I genes.18-20 In vitro application of IFN-g resulted in substantially increased C*04:09N expression and stronger specific T-cell activation. Based on these observations, we assume relevant effects of the cytokine milieu and tissue-associated modulation of C*04:09N expression in vivo. Independently of whether C*04:09N cell surface expression was detectable by flow cytometry, we asked experimentally whether C*04:09N expression was functionally relevant and could mediate peptide-specific T-cell activation. We demonstrated in two unrelated cell lines that transient or stable C*04:09N expression was sufficient for peptide presentation and specific T-cell activation. Inhibition of T-cell activation by addition of pan HLA-class I antibody to the cell culture indicated that TCR-peptide-HLA interaction occurred at the cell surface. Our results were confirmed with PBMC of a C*04:09N+ individual. Our data prove functionally

that C*04:09N expression, albeit challenging to detect by flow cytometry, is biologically relevant for HLA-restricted T-cell activation.

Our study was entirely carried out in vitro; therefore, we cannot draw conclusions on in vivo situations. However, strong modulation of C*04:09N expression by the cytokine milieu (IFN-g), and isolation of a clonally expanded C*04:09-restricted T-cell clone from bone marrow of a multiple myeloma patient8 strongly suggest immunological relevance of this allele in vivo.

We assume our findings to have implications in the fields of hematopoietic stem cell and solid organ transplantation; however, although C*04:09N is considered one of the most abundant null alleles, its overall frequency is relatively low and varies within several orders of magnitude between different populations.2 Comprehensive analyses of larger cohorts along with C*04:09N peptidome data, especially in comparison with C*04:01, are required to determine impli-

Haematologica | 109 April 2024 1126 ARTICLE - T-cell activation in the context of HLA-C*04:09N C. Welters et al.
A B C D
Figure

cations for allogeneic transplantation and specific disease associations, as well as in the context of other settings, such as cellular therapy.

Disclosures

LB has sat on advisory committees for Abbvie, Amgen, Astellas, Bristol-Myers Squibb, Celgene, Daiichi Sankyo, Gilead, Hexal, Janssen, Jazz Pharmaceuticals, Menarini, Novartis, Pfizer, Sanofi, and Seattle Genetics, and has received research support from Bayer and Jazz Pharmaceuticals. LH has sat on advisory committees for Sanofi, and has received travel support from Amgen. All other authors have no conflicts of interest to disclose.

Contributions

CW and LH conceived the project. CW, MLW, SS, JS, HH, AD, TB and LH designed experiments. AD and TB provided

References

1. Bors A, Inotai D, Andrikovics H, et al. Low occurrence of the HLA-C*04:09N allele in a large Hungarian cohort. Tissue Antigens. 2015;86(1):32-35.

2. Gonzalez-Galarza FF, McCabe A, Santos E, et al. Allele frequency net database (AFND) 2020 update: gold-standard data classification, open access genotype data and new query tools. Nucleic Acids Res. 2020;48(D1):D783-D788.

3. Pinto C, Smith AG, Larsen CE, et al. HLA-Cw*0409N is associated with HLA-A*2301 and HLA-B*4403-carrying haplotypes. Hum Immunol. 2004;65(2):181-187.

4. Bauer M, Kempenich J, Wadsworth K, Malmberg C, Beduhn B, Dehn J. Frequencies and haplotype associations of nonexpressed HLA alleles in ethnically diverse populations on the National Marrow Donor Program’s Be The Match Registry. Hum Immunol. 2020;81(10-11):580-587.

5. Balas A, Santos S, Aviles MJ, et al. Elongation of the cytoplasmic domain, due to a point deletion at exon 7, results in an HLA-C null allele, Cw*0409 N. Tissue Antigens. 2002;59(2):95-100.

6. Lind C, Ferriola D, Mackiewicz K, Papazoglou A, Sasson A, Monos D. Filling the gaps - the generation of full genomic sequences for 15 common and well-documented HLA class I alleles using next-generation sequencing technology. Hum Immunol. 2013;74(3):325-329.

7 Wang ZC, Smith AG, Yunis EJ, et al. Molecular characterization of the HLA-Cw*0409N allele. Hum Immunol. 2002;63(4):295-300.

8. Welters C, Lammoglia Cobo MF, Stein CA, et al. Immune phenotypes and target antigens of clonally expanded bone marrow T cells in treatment-naive multiple myeloma. Cancer Immunol Res. 2022;10(11):1407-1419.

9 Engels B, Cam H, Schuler T, et al. Retroviral vectors for highlevel transgene expression in T lymphocytes. Hum Gene Ther. 2003;14(12):1155-1168.

10 Lammoglia Cobo MF, Welters C, Rosenberger L, et al. Rapid single-cell identification of Epstein-Barr virus-specific T-cell receptors for cellular therapy. Cytotherapy. 2022;24(8):818-826.

critical material. CW, MLW and SS performed experiments. CW, MLW, SS, LB, JS, HH, AD, TB and LH analyzed data. CW and LH wrote the manuscript with input from all authors. LH co-ordinated and supervised the project.

Acknowledgments

We thank Matthias Truss for flow cytometry support, and Klaus Dornmair for providing expression vectors.

Funding

This work was supported by Deutsche Krebshilfe e.V. (70113355; to LH), Berliner Krebsgesellschaft e.V. (HAFF202013 MM; to LH), the German Cancer Consortium (DKTK; to LH), and the European Union (ERC Advanced Grant Neo-T, 882963; toTB).

Data-sharing statement

All data are publicly available along with this manuscript.

11. Dhamodaran A. Generation and characterization of ABab.I transgenic mice: a novel tool for the isolation of human T cell receptors selected on a distinct human HLA class I haplotype for adoptive T cell therapy of cancer [Dissertation]. Refubium - Freie Universität Berlin Repository. https://refubium.fu-berlin. de/handle/fub188/32213 Accessed June 2023.

12. Siewert K, Malotka J, Kawakami N, Wekerle H, Hohlfeld R, Dornmair K. Unbiased identification of target antigens of CD8+ T cells with combinatorial libraries coding for short peptides. Nat Med. 2012;18(5):824-828.

13. Rice P, Longden I, Bleasby A. EMBOSS: the European Molecular Biology Open Software Suite. Trends Genet. 2000;16(6):276-277.

14 R Core Team. R: a language and environment for statistical computing. Vienna, Austria: R Foundation for Statistical Computing; 2020.

15. Tremante E, Lo Monaco E, Ingegnere T, Sampaoli C, Fraioli R, Giacomini P. Monoclonal antibodies to HLA-E bind epitopes carried by unfolded beta2 m-free heavy chains. Eur J Immunol. 2015;45(8):2356-2364.

16. Rebai N, Malissen B. Structural and genetic analyses of HLA class I molecules using monoclonal xenoantibodies. Tissue Antigens. 1983;22(2):107-117.

17 Shields MJ, Ribaudo RK. Mapping of the monoclonal antibody W6/32: sensitivity to the amino terminus of beta2microglobulin. Tissue Antigens. 1998;51(5):567-570.

18. Basham TY, Bourgeade MF, Creasey AA, Merigan TC. Interferon increases HLA synthesis in melanoma cells: interferon-resistant and -sensitive cell lines. Proc Natl Acad Sci U S A. 1982;79(10):3265-3269.

19. Campbell IL, Bizilj K, Colman PG, Tuch BE, Harrison LC. Interferon-gamma induces the expression of HLA-A,B,C but not HLA-DR on human pancreatic beta-cells. J Clin Endocrinol Metab. 1986;62(6):1101-1109.

20 Friedman RL, Manly SP, McMahon M, Kerr IM, Stark GR. Transcriptional and posttranscriptional regulation of interferoninduced gene expression in human cells. Cell. 1984;38(3):745-755.

Haematologica | 109 April 2024 1127 ARTICLE - T-cell activation in the context of HLA-C*04:09N C. Welters et al.
Tissue factor pathway inhibitor is associated with risk of venous thromboembolism and all-cause mortality in patients with cancer

1Clinical Division of Hematology and Hemostaseology, Department of Medicine I, Medical University of Vienna, Vienna, Austria; 2Division of Oncology, Department of Internal Medicine, Medical University of Graz, Graz, Austria; 3Division of Hematology, Department of Medicine, UNC Blood Research Center, University of North Carolina at Chapel Hill, Chapel Hill, NC, USA and 4Division of Oncology, Department of Medicine I, Medical University of Vienna, Vienna, Austria

Abstract

Correspondence: C. Ay cihan.ay@meduniwien.ac.at

Received: May 23, 2023.

Accepted: October 3, 2023.

Early view: October 12, 2023.

https://doi.org/10.3324/haematol.2023.283581

©2024 Ferrata Storti Foundation

Published under a CC BY-NC license

Venous thromboembolism (VTE) is a common complication in patients with cancer. Data on the role of natural inhibitors of coagulation for occurrence of cancer-associated VTE are limited, thus, we investigated the association of tissue factor pathway inhibitor (TFPI) with risk of VTE and all-cause mortality in patients with cancer. Total TFPI antigen levels were measured with a commercially available enzyme-linked immunosorbant assay in patients included in the Vienna Cancer and Thrombosis Study, a prospective observational cohort study with the primary outcome VTE. Competing risk analysis and Cox regression analysis were performed to explore the association of TFPI levels with VTE and all-cause mortality. TFPI was analyzed in 898 patients (median age 62 years; interquartile range [IQR], 53-68; 407 (45%) women). Sixty-seven patients developed VTE and 387 died (24-month cumulative risk 7.5% and 42.1%, respectively). Patients had median TFPI levels at study inclusion of 56.4 ng/mL (IQR, 45.7-70.0), with highest levels in tumor types known to have a high risk of VTE (gastroesophageal, pancreatic and brain cancer: 62.0 ng/mL; IQR, 52.0-75.0). In multivariable analysis adjusting for age, sex, cancer type and stage, TFPI levels were associated with VTE risk (subdistribution hazard ratio per doubling =1.63, 95% confidence interval [CI]: 1.03-2.57). When patients with high and intermediate/low VTE risk were analyzed separately, the association remained independently associated in the high risk group only (subdistribution hazard ratio =2.63, 95% CI: 1.40-4.94). TFPI levels were independently associated with all-cause mortality (hazard ratio =2.36, 95% CI: 1.85-3.00). In cancer patients increased TFPI levels are associated with VTE risk, specifically in patients with high-risk tumor types, and with all-cause mortality.

Introduction

Venous thromboembolism (VTE) is a common complication in patients with cancer. The risk for VTE in this patient population is about 7-9-fold higher compared to the general population.1-3 VTE is not only a major cause of morbidity but also a negative prognostic factor in patients with cancer.4-7 The mechanisms of cancer-associated thrombosis are not completely understood. However, several hemostatic biomarkers have been found to predict risk of VTE in patients with cancer, for instance, procoagulant factors, such as tissue factor (TF), neutrophil extracellular traps (NETS), and podoplanin, have been implicated in the development of cancer-associated thrombosis.8-11 In contrast, the association of natural inhibitors of hemostasis with cancer-associated thrombosis is currently unclear.

Tissue factor pathway inhibitor (TFPI) is a natural anticoagulant that inhibits complexes of tissue factor (TF) and factor VIIa via its Kunitz-1 domain and factor Xa via its Kunitz-2 domain. The majority (about 80%) of TFPI is bound to the endothelium, with the remaining 20% circulating freely (about 2%) or bound to low-density lipoproteins.12 Furthermore, humans have a heparin-releasable and a platelet pool of TFPI.13

Conflicting results on the association of TFPI with VTE risk have been reported in the general population. Several case-control studies found an association between low levels of TFPI and risk of VTE.14-17 However, these results were not replicated in a longitudinal study.15 Therefore, it is unclear, if low TFPI levels in the case-control studies were the cause or the consequence of a VTE event. Further, it has been speculated that TFPI levels may be increased due

Haematologica | 109 April 2024 1128 - Hemostasis ARTICLE

to binding to TF+ extracellular vesicles (EV).18,19 It is known that TF is expressed by cancer cells of various types and is thought to play a significant role in tumor growth and metastasis formation.20,21 Thus, high TF levels are associated with poor overall survival in patients with various tumor types.5,20,22

In comparison to the non-cancer population, higher plasma TFPI levels were reported in patients with cancer and especially in those with metastatic disease.23,24 It has been suggested that TFPI also plays a role in cancer progression in different tumor types.25 Low expression of TFPI on tumor cells was found to be associated with cancer progression and poor overall survival.26-28 However, the association of TFPI with risk of developing VTE and prognosis of the disease has not been studied in a broad population of patients with cancer. Therefore, we measured TFPI levels in a prospective cohort study of patients with cancer for prediction of VTE and risk of all-cause mortality.

Methods

Study population

This analysis was performed within the framework of the Vienna Cancer and Thrombosis Study (CATS). The study is a single-center, prospective observational cohort study including patients with newly diagnosed or recurrent cancer after full or partial remission. The study has been approved by the local ethics committee (EC no.: 126/2003, ethik-kom@ meduniwien.ac.at) and was performed according to the Declaration of Helsinki and its later amendments. Detailed information about the study, its inclusion and exclusion criteria and the study procedures has been published in previous publications29,30 and can be found in the Online Supplementary Appendix

Laboratory analysis

Blood was drawn at study inclusion and collected in Vacutainer citrate tubes (Vacuette; Greiner-Bio One) by sterile venipuncture. Blood preparation is explained in the Online Supplementary Appendix

Total TFPI antigen levels were measured with a commercial assay in citrate plasma samples according to the manufacturer´s instructions (Imubind total TFPI ELISA kit; American Diagnostica Inc., Stamford, CT, USA). EV-TF activity was measured according to standardized protocols for a chromogenic endpoint assay as reported in detail previously.22,23 D-dimer levels were measured by a quantitative latex assay (STA-LIAtest D-DI; Diagnostica-Stago, Asnieres, France) on an STA-R analyzer (Diagnostica-Stago).32 sP-selectin levels were measured using a human sP-selectin Immunoassay (R&D Systems; Minneapolis, MN) following the manufacturer’s instructions as described previously.30 Fibrinogen was determined according to Clauss (STA Fibrinogen; Diagnostica Stago, Asnieres, France; normal

range: 180-390 mg/dL).33 C-reactive protein (CRP) serum levels were determined by an immuno-nephelometric assay (Olympus Diagnostics; Southall, UK) on an AU 2700 chemistry analyzer.34

Statistical analysis

Statistical analyses were performed with STATA 17 (Stata Corp., Houston, TX, USA), SPSS 28.0 (IBM SPSS Statistics; Chicago, IL, USA) and R (Version 4.1.0; R Core Team). Standard summary statistics were used to report patient baseline characteristics (absolute frequencies, percentages, median, interquartile range [IQR, indicating the 25 th to 75 th percentile of the distribution of metric variables]). Medians between two groups were compared with a Mann-Whitney U test. Correlations were analyzed with a Spearman correlation coefficient. As death was considered as a competing event during follow-up time, VTE outcomes were studied in a competing risk framework. 35 In order to compare the cumulative VTE incidence between groups, a proportional sub-hazard regression model according to Fine and Gray was conducted. The association of TFPI levels with all-cause mortality was assessed in Cox regression analysis. A multivariable model including age, sex, cancer type and stage (stage 4 vs . stage 1, 2, 3) was conducted as well. For cancer type adjustment patients were stratified according to tumor type VTE risk category. Patients with pancreatic, gastroesophageal and brain tumors were considered to be at very high risk, those with breast and prostate cancer at low risk and all others to be at intermediate risk. 36 Furthermore, a model adjusting for EV-TF activity, D-dimer or sP-selectin levels was used for competing-risk and Cox regression analysis.

For a subgroup analysis patients were divided according to the baseline VTE risk according to the tumor type into high, intermediate, and low risk. 36 A ROC curve analysis with AUC computing was performed for the different VTE multivariable models to obtain the AUC values.

Results

Patient characteristics

TFPI was analyzed in 898 patients with available samples. The median age was 62 years (IQR, 53-68) and 407 (45%) patients were female. Patients were followed for a median follow-up of 22 months (IQR, 7-25). Overall, 67 patients (7.5%) were diagnosed with VTE (6-, 12-, and 24-month cumulative risk: 5.5%, 6.7%, 7.5%) and 387 patients (43.1%) died (6-, 12-, and 24-month cumulative risk: 15.1%, 27%, 42.1%) (Table 1). In detail, 27 patients were diagnosed with PE only, 31 with a DVT only, four with both PE and DVT, one with DVT and portal vein thrombosis, one with portal vein thrombosis, one with sinus vein thrombosis and two with catheter-related thrombosis as index event.

Haematologica | 109 April 2024 1129 ARTICLE - TFPI and VTE in patients with cancer C. Englisch et al.

Distribution of tissue factor pathway inhibitor levels

Patients had median TFPI levels of 56.4 ng/mL (IQR, 45.770.0). The distribution of TFPI levels did not significantly differ between cancer types (Figure 1). Patients with metastatic disease had higher levels compared to those with non-metastatic disease (median 61.0 ng/mL; IQR, 50.074.0 vs. 50.4 ng/mL, IQR, 42.0-62.0; P<0.001). TFPI levels showed a weak positive correlation with CRP, fibrinogen, D-dimer, sP-selectin, and platelet counts, but not with EV-TF activity (Table 2).

Association between tissue factor pathway inhibitor levels and venous thromboembolism

Baseline levels of TFPI were associated with risk of VTE (subdistribution hazard ratio [SHR] per doubling of TFPI levels: 1.92, 95% confidence interval [CI]: 1.33-2.79). This association remained significant in multivariable analysis adjusting for age, sex, cancer type and stage (adjusted subdistribution hazard ratio [SHR] per doubling =1.62, 95% CI: 1.03-2.57). When comparing the 1-year and 2-year cumulative incidence of patients with TFPI levels above the 75th percentile (>70 ng/mL) to those with levels equal to or below the 75th percentile (≤70 ng/mL) a significant difference was observed (9.7% vs. 5.8%; 10.7% vs. 6.6%; P=0.04 for 12-month cumulative incidence; Figure 2). In a separate analysis adjusting for EV-TF activity, D-dimer, or sP-selectin levels, the association remained significant (EV-TF activity adjusted SHR per doubling of TFPI =2.00, 95% CI: 1.25-3.21; D-dimer

adjusted SHR per doubling of TFPI =1.92, 95% CI: 1.29-2.85; sP-selectin adjusted SHR per doubling of TFPI =1.60, 95% CI: 1.08-2.38). When D-dimer (adjusted SHR per doubling of TFPI =1.62, 95% CI: 0.99-2.63) or sP-selectin (adjusted SHR per doubling of TFPI =1.42, 95% CI: 0.87-2.23) levels were added to the clinical covariates model the association was weakened significantly (Table 3).

In a smaller subgroup (n=291) EV-TF activity was available and the addition of this biomarker to the clinical multivariate model did not lead to a significant weakening of the association (adjusted SHR per doubling of TFPI =2.12, 95% CI: 1.20-3.43; Table 3).

In a subgroup analysis we stratified according to tumor type based VTE risk categories in high risk (brain, pancreas, gastroesophageal) and low/intermediate risk.36 Patients with high VTE risk tumor types had the highest TFPI levels (62.0, IQR, 52.0-75.0). In the high-risk group we found an association between TFPI and risk of VTE (sex, age, and stage adjusted SHR per doubling of TFPI =2.63, 95% CI: 1.40-4.94), also after adding D-dimer to the clinical covariable model (adjusted SHR per doubling of TFPI =2.49, 95% CI: 1.34-4.62). This association was not observed when analyzing patients with low/intermediate-risk tumor types (sex and age adjusted SHR per doubling of TFPI =1.34, 95% CI: 0.68-2.63).

Association between tissue factor pathway inhibitor levels and all-cause mortality

The baseline level of TFPI was associated with risk of all-

IQR: interquartile range; VTE: venous thromboembolism; TFPI: tissue factor pathway inhibitor; EV-TF: extracellular vesicle-associated tissue factor; CRP: C-reactive protein.

Haematologica | 109 April 2024 1130 ARTICLE - TFPI and VTE in patients with cancer C. Englisch et al.
Characteristics Available data N Median (IQR) or N (%) Age in years 898 62 (53-68) Female 898 407 (45) VTE 898 67 (7.5) Died 898 387 (43) Metastatic disease (solid tumor patients) 663 370 (56) Non-classifiable into metastatic vs. notmetastatic (brain, hematological) 235 235 (26) High-risk tumor type (brain, pancreas, gastroesophageal) 898 202 (22.5) Intermediate-risk tumor type (all others) 898 439 (48.9) Low-risk tumor type (breast, prostate) 898 257 (28.6) TFPI levels, ng/mL 898 56.4 (45-70) EV-TF activity, pg/mL 291 0.05 (0.01-0.10) D-dimer, µg/mL 893 0.71 (0.35-1.38) CRP, mg/dL 840 0.55 (0.17-1.87) sP-selectin, ng/mL 898 43.5 (34-54.1) Fibrinogen, mg/dL 894 394 (323-474.25)
Table 1. Details on cohort characteristics at study inclusion.

cause mortality (hazard ratio [HR] =2.70, 95% CI: 2.21-3.03). In multivariable analysis (adjusting for age, sex, cancer type and stage), the association was weakened in magnitude but remained statistically significant (adjusted HR per doubling of TFPI =2.36, 95% CI: 1. 85-3.00). The 1-year and 2-year cumulative risk of all-cause mortality in patients with TFPI levels above the 75th percentile (>70 ng/ mL) and those equal to or below the 75th percentile (≤70 ng/mL) was significantly higher (47.2% vs. 21.7%; 54.4% vs. 34.7%; P<0.001 for 12-month cumulative incidence; Figure

3). Further, upon adding D-dimer or sP-selectin levels to the clinical multivariable analysis (including sex, age, stage and cancer type) the association was weakened but remained significant (D-dimer adjusted HR per doubling of TFPI =1.56, 95% CI: 1.21-2.01; sP-selectin adjusted HR per doubling of TFPI =2.15, 95% CI: 1.67-2.76, respectively). In the subgroup with EV-TF activity levels available, the addition of this biomarker to the clinical multivariable model led to a weakened but significant association (EV-TF activity adjusted HR per doubling of TFPI =2.08, 95% CI: 1.42-3.04).

Haematologica | 109 April 2024 1131 ARTICLE - TFPI and VTE in patients with cancer C. Englisch et al.
Figure 1. Tissue factor pathway inhibitor total antigen levels according to different cancer types and venous thromboembolism risk categories. (A) Cancer types. (B) Venous thromboembolism risk (VTE) categories. Category brain includes only primary brain tumors: glioma, medulloblastoma, meningioma. Category other includes esophageal, sarcoma, testis, hepatocellular, thymus, genitourinary, thyroidal, mesothelioma. High risk includes patients with brain, pancreatic and gastroesophageal cancer, low risk breast and prostate cancer and intermediate risk all others. Bold line represents median; upper and lower hinge represent third and first quartile, respectively; points indicate outliers. TFPI: tissue factor pathway inhibitor; IQR: interquartile range.

Discussion

In the present prospective cohort study of patients with cancer, we found an association between TFPI levels and cancer-associated VTE and all-cause mortality. In a subgroup analysis, we identified the association between TFPI levels and risk of VTE to be refined to the population of patients with tumor types at a high risk of VTE, but not in the intermediate/low-risk population.

It is counter intuitive that higher levels of an anticoagulant are associated with cancer-associated thrombosis. However, this may be, in part, due to a change in distribution of TFPI from the endothelium into the circulation during cancer progression. Indeed, we found higher levels of circulating TFPI in patients with metastatic disease compared to patients with non-metastatic disease. This is consistent with two other studies.23,24 Patients with metastatic disease have a higher risk of VTE compared with patients with non-metastatic disease.7,37 Similar findings, i.e., an association between higher levels and adverse outcomes, were reported in the setting of arterial thrombosis and atherosclerosis studies.38

The association remained beyond clinical co-variates such as age, sex, cancer stage, and type. However, upon adding D-dimer to this clinical co-variable analysis, an established predictive biomarker for VTE in patients with cancer,32 the association between total TFPI levels and VTE did not remain statistically significant. A similar observation has been reported in a previous study of patients with acute deep vein thrombosis (DVT).39 It has been suggested that the close interrelation between TFPI and D-dimer could be due to release of fibrin-bound TFPI and D-dimer from a fibrin clot, which could explain why TFPI is higher in patients with VTE.39 However, in our study TFPI levels were not measured during an acute VTE event. Therefore, the

prediction of future VTE events with higher levels cannot be completely explained by this hypothesis. D-dimer levels are elevated in patients with cancer even in the absence of a thrombotic event and indicate a general systemic hypercoagulable state. Higher D-dimer levels have been associated with poor survival and higher risk of all-cause mortality beyond its association with increased risk of VTE in patients with cancer.6,32,40 One possible explanation for our observation could be that TFPI levels measured in our study are reflecting fibrin-bound TFPI that is co-released with D-dimer after activation of hemostasis and fibrinolysis, also in the absence of overt thrombotic manifestations. Interestingly, TFPI levels in our study correlated positively with D-dimer levels, albeit only weakly.

When adding sP-selectin to the clinical covariables, the association between TFPI levels and VTE was significantly weakened. sP-selectin was previously shown to be associated with an increased risk for cancer-associated VTE.30 Thus, some of the circulating TFPI levels might be derived from activated platelets in patients with cancer.41,42 This

CRP: C-reactive protein; EV-TF: extracellular vesicle-associated tissue factor.

Figure 2. Cumulative venous thromboembolism incidence of patients (N=898) with tissue factor pathway inhibitor levels ≤75th (N=680) (≤70 ng/mL) versus >75th percentile (N=218) (>70 ng/mL). Patients were divided according to their tissue factor pathway inhibitor (TFPI) level and the group with levels equal to or under 70 ng/mL (≤75th percentile) was compared to the group with levels over 70 ng/mL (>75th percentile) within a Fine and Gray subdistribution hazard model, P=0.04.

Haematologica | 109 April 2024 1132 ARTICLE - TFPI and VTE in patients with cancer C. Englisch et al.
r 95% CI P CRP 0.20 0.13-0.27 <0.001 Fibrinogen 0.15 0.08-0.22 <0.001 D-dimer 0.25 0.19-0.31 <0.001 EV-TF activity 0.09 -0.03-0.21 0.13 sP-selectin 0.23 0.17-0.30 <0.001 Platelet counts 0.26 0.01-0.14 0.03
Table 2. Correlation between tissue factor pathway inhibitor levels and markers of hemostasis and inflammation. Statistical analysis was performed with a Spearman correlation coefficient.

hypothesis is supported by the fact that we observed a positive correlation between TFPI and sP-selectin levels. The endothelium is another potential source of the increased levels of circulating sP-selectin and TFPI.

Interestingly, the results differed when stratifying the association of TFPI levels with risk of VTE according to tumor site risk categories (i.e., high VTE risk vs. intermediate/low VTE risk tumor type groups). An independent association in the high-risk subgroup was seen, whereas this was not the case in the intermediate/low-risk group. This subgroup also had the highest TFPI levels. One explanation for this finding could be that patients with pancreatic cancer were allocated in the high-risk group. It is known that TF plays a role in VTE development in this tumor type.5,20,43 Thus, it could be speculated that its inhibitor, TPFI, might be of

importance in pancreatic cancer patients as well. Based on the known systemic hypercoagulability and subclinical hemostatic activation in patients with cancer, our study provides a suitable framework to evaluate the interrelation of TFPI in the context of other biomarkers of hemostasis and inflammation. We found a positive and weak correlation between TFPI and CRP, fibrinogen, and sP-selectin. While some studies have reported positive correlations with various coagulation factors and hemostatic biomarkers (including e.g., FVIII and D-dimer), this was not replicated by others.15,23,39,44 A weak positive correlation between TF and TFPI was described previously.45 However, it is important to note that this study used a commercial enzyme-linked immunosorbant assay to measure TF antigen levels that was shown to not reliably detect TF antigen in plasma.46 We did

Model

Haematologica | 109 April 2024 1133 ARTICLE - TFPI and VTE in patients with cancer C. Englisch et al.
SHR (95% CI) P AUC (95% CI) Model 1, N=872 TFPI (per double) Age Sex Cancer stage Cancer type 1.62 (81.03-2.579 0.99 (0.98-1.0) 1.18 (0.71-1.96) 1.34 (0.79-2.26) 2.12 (1.50-2.98) 0.04 0.59 0.53 0.28 <0.001 71.5 (64.6-78.4) Model 2, N=291 TFPI (per double) EV-TF activity 2.00 (1.25-3.21) 0.66 (0.16-2.74) 0.004 0.56 68.5 (59.9-77.1) Model 3, N=893 TFPI (per double) D-dimer 1.92 (1.29-2.85) 1.01 (0.97-1.04) 0.001 0.67 62.1 (55.6-68.6) Model 4, N=898 TFPI (per double) sP-selectin 1.60 (1.08-2.38) 1.01 (1.00-1.02) 0.019 0.014 66.6 (59.6-73.6) Model 5, N=291 TFPI (per double) Age Sex Cancer type Cancer stage EV-TF activity 2.12 (1.20-3.73) 0.98 (0.96-1.00) 1.46 (0.74-2.88) 1.15 (0.57-2.29) 1.35 (0.91-2.00) 0.64 (0.14-2.83) 0.009 0.09 0.25 0.7 0.14 0.55 68.5 (59.9-77.1)
6, N=867 TFPI (per double) Age Sex Cancer type Cancer stage D-dimer 1.62 (0.99-2.63) 0.99 (0.98-1.01) 1.17 (0.70-1.97) 1.34 (0.79-2.27) 2.11 (1.50-2.98) 1.00 (0.96-1.04) 0.051 0.60 0.54 0.28 0.21 0.93 71.5 (64.7-78.4)
Table 3. Association between tissue factor pathway inhibitor antigen levels and venous thromboembolism risk in different multivariable models.
Model
7, N=872
(per double) Age Sex Cancer type Cancer stage sP-selectin 1.42 (0.90-2.23) 0.99 (0.98-1.01) 1.190 (0.71-2.00) 1.33 (0.79-2.25) 2.11 (1.50-2.96) 1.01 (1.00-1.02) 0.14 0.64 0.51 0.28 <0.001 0.061 72.3 (65.3-79.2)
TFPI
SHR: subdistribution hazard ratio; CI: confidence interval; AUC: area under the curve; TFPI: tissue factor pathway inhibitor; EV-TF: extracellular vesicle-associated tissue factor.

not find an association between TFPI and EV-TF activity. However, our power for this analysis was low as EV-TF was not measured in all patients, leaving us with 34 VTE events in this subgroup. Overall, our results may indicate that TFPI is a marker of disease severity and this could explain the opposing results reported previously due to different time points of measurements and patient populations.

TFPI was reported to play a role in the cancer environment as well.25 High levels were described to have a favorable effect and absence of TFPI may propagate cancer progression in experimental studies.26-28,45 Important to note is that previously no correlation between tumor TFPI and plasma TFPI levels could be established.45 This could explain why divergent results are reported, namely that high plasma TFPI levels were associated with poor overall survival in our cohort of cancer patients.

With respect to the association between TFPI and risk of mortality, we only observed a slightly weakened association when adding D-dimer, EV-TF activity or sP-selectin levels to the clinical co-variable model in multivariate analysis. The association of TFPI and mortality risk might be explained by increased plasma levels of TFPI mediated through pathways involving activation of the hemostatic system, endothelium and/or inflammation, which in return might be involved in cancer-promoting mechanisms or adverse clinical outcomes. Interestingly, we previously found an association between higher levels of antithrombin, another natural anticoagulant, and all-cause mortality in patients with cancer, specifically in those with brain tumors.47

Elevated EV-TF activity levels were reported to be associated with increased VTE risk and in specific cancer types with poor overall survival.5,20,48 Interestingly, in our cohort,

Figure 3.

(N=898)

tissue factor pathway inhibitor levels ≤75th (N=680) (≤70 ng/mL) versus >75th percentile (N=218) (>70 ng/mL). Patients were divided according to their tissue factor pathway inhibitor level and the group with levels equal to or under 70 ng/mL (≤75th percentile) was compared to the group with levels over 70 ng/mL (>75th percentile) within a Kaplan-Meier analysis and with a log-rank test, P<0.001.

TFPI levels were higher in patients with metastatic disease, similarly to higher TF levels that were previously reported.20 Our observation that adding EV-TF activity to the multivariate analysis did not influence the association of TFPI and VTE risk, could indicate that TFPI might have a better predictive capacity than TF in a heterogeneous cohort of cancer patients. Important to note is that this was only a subgroup analysis as EV-TF activity was available in a small group of patients. Furthermore, these patients were mostly the ones with a high VTE risk tumor type, of which especially patients with pancreatic tumors are known to have elevated EV-TF activity.22 Thus, TFPI could act as a surrogate marker, as the physiological response to elevated TF levels could be an increase in TFPI levels to maintain the hemostatic balance as proposed previously.49 In addition, EV captured from plasma using an anti-TF antibody were shown to contain TFPI.18 Further, it was reported that TF activity of EV isolated from plasma is increased in the presence of an anti-TFPI antibody, thus, this data suggests that TFPI is bound to TF+ EV.19

TF is a biomarker that was found to have predictive and prognostic capacity in patients with cancer, most pronounced in patients with pancreatic cancer.5 However, most of the methods purported to measure TF in plasma are not reliable or are highly variable and, therefore, cannot be used in the clinic.50 Thus, TFPI might be more reliable and reproducible to measure in the clinical setting. Generally, hemostatic biomarkers that have a predictive or prognostic potential are of interest in oncological research. Various markers have shown to have this potential and might aid in personalized clinical decision making in oncology.6 The study had some limitations. Firstly, there is no stan-

Haematologica | 109 April 2024 1134 ARTICLE - TFPI and VTE in patients with cancer C. Englisch et al.
Overall survival of patients with

dardized TFPI measurement. However, we decided to measure total TFPI antigen levels with a widely used commercial enzyme-linked immunsorbant assay in plasma samples. Second, EV-TF activity levels were not available in all patients and there was some missing data. Third, we could not investigate endothelial activation due to the lack of an adequate marker. Furthermore, prophylactic heparin injections were not an exclusion criterion in our study, and heparins were shown to lead to a transient but short increase of TFPI plasma levels. However, only a very small proportion (<5%) of patients received prophylactic heparin injections 12-24 hours before blood sampling. Lastly, our analysis was exploratory in nature. We used a predefined cutoff (75th percentile of TFPI levels of the whole cohort) for elevated levels and thus, in the future validation and further investigations of the causality of our findings are needed.

To conclude, TFPI levels are associated with risk of VTE and all-cause mortality in a prospective cohort of patients with cancer. TFPI levels might represent a surrogate marker for hemostatic activation and thus should be further investigated in independent studies.

References

1. Mulder FI, Horváth-Puhó E, van Es N, et al. Venous thromboembolism in cancer patients: a population-based cohort study. Blood. 2021;137(14):1959-1969.

2. Grilz E, Posch F, Nopp S, et al. Relative risk of arterial and venous thromboembolism in persons with cancer vs. persons without cancer-a nationwide analysis. Eur Heart J. 2021;42(23):2299-2307.

3. Khorana AA, Mackman N, Falanga A, et al. Cancer-associated venous thromboembolism. Nat Rev Dis Primers. 2022;8(1):11.

4 Moik F, Posch F, Grilz E, et al. Haemostatic biomarkers for prognosis and prediction of therapy response in patients with metastatic colorectal cancer. Thromb Res. 2020;187:9-17.

5. Moik F, Prager G, Thaler J, et al. Hemostatic biomarkers and venous thromboembolism are associated with mortality and response to chemotherapy in patients with pancreatic cancer. Arterioscler Thromb Vasc Biol. 2021;41(11):2837-2847.

6. Moik F, Ay C. Hemostasis and cancer: impact of haemostatic biomarkers for the prediction of clinical outcomes in patients with cancer. J Thromb Haemost. 2022;20(12):2733-2745.

7 Chew HK, Wun T, Harvey D, Zhou H, White RH. Incidence of venous thromboembolism and its effect on survival among patients with common cancers. Arch Intern Med. 2006;166(4):458-464.

8. Ay C, Pabinger I, Cohen AT. Cancer-associated venous thromboembolism: burden, mechanisms, and management. Thromb Haemost. 2017;117(2):219-230.

9 Hisada Y, Grover SP, Maqsood A, et al. Neutrophils and neutrophil extracellular traps enhance venous thrombosis in mice bearing human pancreatic tumors. Haematologica. 2020;105(1):218-225.

10. Hisada Y, Ay C, Auriemma AC, Cooley BC, Mackman N. Human pancreatic tumors grown in mice release tissue factor-positive

Disclosures

MP has received honoraria for lectures, consultation or advisory board participation from the following companies: Bayer, Bristol-Myers Squibb, Novartis, Gerson Lehrman Group (GLG), CMC Contrast, GlaxoSmithKline, Mundipharma, Roche, BMJ Journals, MedMedia, Astra Zeneca, AbbVie, Lilly, Medahead, Daiichi Sankyo, Sanofi, Merck Sharp & Dome, Tocagen, Adastra, Gan & Lee Pharmaceuticals and Servier.

Contributions

CE and CA developed the concept of the study. SK and JT performed measurements. CE and FM performed data analysis. NM and IP supervised the project. MP, IP and CP recruited patients. All authors drafted and revised the manuscript.

Acknowledgments

We would like to thank Dr. Daniel Kraemmer for his statistical advice.

Data-sharing statement

The data presented in this study are available on request from the corresponding author.

microvesicles that increase venous clot size. J Thromb Haemost. 2017;15(11):2208-2217.

11. Riedl J, Preusser M, Nazari PM, et al. Podoplanin expression in primary brain tumors induces platelet aggregation and increases risk of venous thromboembolism. Blood. 2017;129(13):1831-1839.

12. Kasthuri RS, Glover SL, Boles J, Mackman N. Tissue factor and tissue factor pathway inhibitor as key regulators of global hemostasis: measurement of their levels in coagulation assays. Semin Thromb Hemost. 2010;36(7):764-771.

13. Lindahl AK, Sandset PM, Abildgaard U. The present status of tissue factor pathway inhibitor. Blood Coagul Fibrinolysis. 1992;3(4):439-449.

14 Dahm A, Van Hylckama Vlieg A, Bendz B, et al. Low levels of tissue factor pathway inhibitor (TFPI) increase the risk of venous thrombosis. Blood. 2003;101(11):4387-4392.

15. Zakai NA, Lutsey PL, Folsom AR, Heckbert SR, Cushman M. Total tissue factor pathway inhibitor and venous thrombosis. The longitudinal investigation of thromboembolism etiology. Thromb Haemost. 2010;104(2):207-212.

16. Amini-Nekoo A, Futers TS, Moia M, et al. Analysis of the tissue factor pathway inhibitor gene and antigen levels in relation to venous thrombosis. Br J Haematol. 2001;113(2):537-543.

17 Ariëns RA, Alberio G, Moia M, Mannucci PM. Low levels of heparin-releasable tissue factor pathway inhibitor in young patients with thrombosis. Thromb Haemost. 1999;81(2):203-207.

18. Franco C, Lacroix R, Vallier L, et al. A new hybrid immunocapture bioassay with improved reproducibility to measure tissue factor-dependent procoagulant activity of microvesicles from body fluids. Thromb Res. 2020;196:414-424.

19. Sachetto ATA, Mackman N. Tissue factor and COVID-19: an update. Curr Drug Targets. 2022;23(17):1573-1577.

Haematologica | 109 April 2024 1135 ARTICLE - TFPI and VTE in patients with cancer C. Englisch et al.

20 Hisada Y, Mackman N. Tissue factor and cancer: regulation, tumor growth, and metastasis. Semin Thromb Hemost. 2019;45(4):385-395.

21. Lawaetz M, Christensen A, Juhl K, et al. Potential of uPAR, αvb6 integrin, and tissue factor as targets for molecular imaging of oral squamous cell carcinoma: evaluation of Nine targets in primary tumors and metastases by Immunohistochemistry. Int J Mol Sci. 2023;24(4):3853.

22. Thaler J, Ay C, Mackman N, et al. Microparticle-associated tissue factor activity, venous thromboembolism and mortality in pancreatic, gastric, colorectal and brain cancer patients. J Thromb Haemost. 2012;10(7):1363-1370.

23. Iversen N, Lindahl AK, Abildgaard U. Elevated TFPI in malignant disease: relation to cancer type and hypercoagulation. Br J Haematol. 1998;102(4):889-895.

24. Lindahl AK, Sandset PM, Abildgaard U, Andersson TR, Harbitz TB. High plasma levels of extrinsic pathway inhibitor and low levels of other coagulation inhibitors in advanced cancer. Acta Chir Scand. 1989;155(8):389-393.

25. Sierko E, Wojtukiewicz MZ, Kisiel W. The role of tissue factor pathway inhibitor-2 in cancer biology. Semin Thromb Hemost. 2007;33(7):653-659.

26. Amirkhosravi A, Meyer T, Chang JY, et al. Tissue factor pathway inhibitor reduces experimental lung metastasis of B16 melanoma. Thromb Haemost. 2002;87(6):930-936.

27. Stavik B, Skretting G, Aasheim HC, et al. Downregulation of TFPI in breast cancer cells induces tyrosine phosphorylation signaling and increases metastatic growth by stimulating cell motility. BMC Cancer. 2011;11:357.

28. Williams L, Tucker TA, Koenig K, et al. Tissue factor pathway inhibitor attenuates the progression of malignant pleural mesothelioma in nude mice. Am J Respir Cell Mol Biol. 2012;46(2):173-179.

29. Ay C, Jungbauer LV, Sailer T, et al. High concentrations of soluble P-selectin are associated with risk of venous thromboembolism and the P-selectin Thr715 variant. Clin Chem. 2007;53(7):1235-1243.

30 Ay C, Simanek R, Vormittag R, et al. High plasma levels of soluble P-selectin are predictive of venous thromboembolism in cancer patients: results from the Vienna Cancer and Thrombosis Study (CATS). Blood. 2008;112(7):2703-2708.

31. Hisada Y, Mackman N. Measurement of tissue factor activity in extracellular vesicles from human plasma samples. Res Pract Thromb Haemost. 2019;3(1):44-48.

32. Ay C, Vormittag R, Dunkler D, et al. D-dimer and prothrombin fragment 1 + 2 predict venous thromboembolism in patients with cancer: results from the Vienna Cancer and Thrombosis Study. J Clin Oncol. 2009;27(25):4124-4129.

33. Tiedje V, Dunkler D, Ay C, et al. The role of fibrinogen plasma levels, the -455G>A fibrinogen and the factor XIII A subunit (FXIII-A) Val34Leu polymorphism in cancer-associated venous thrombosis. Thromb Haemost. 2011;106(5):908-913.

34 Kanz R, Vukovich T, Vormittag R, et al. Thrombosis risk and survival in cancer patients with elevated C-reactive protein. J Thromb Haemost. 2011;9(1):57-63.

35. Ay C, Posch F, Kaider A, Zielinski C, Pabinger I. Estimating risk of venous thromboembolism in patients with cancer in the

presence of competing mortality. J Thromb Haemost. 2015;13(3):390-397.

36. Pabinger I, van Es N, Heinze G, et al. A clinical prediction model for cancer-associated venous thromboembolism: a development and validation study in two independent prospective cohorts. Lancet Haematol. 2018;5(7):e289-e298.

37. Dickmann B, Ahlbrecht J, Ay C, et al. Regional lymph node metastases are a strong risk factor for venous thromboembolism: results from the Vienna Cancer and Thrombosis Study. Haematologica. 2013;98(8):1309-1314.

38. Winckers K, ten Cate H, Hackeng TM. The role of tissue factor pathway inhibitor in atherosclerosis and arterial thrombosis. Blood Rev. 2013;27(3):119-132.

39 Sidelmann JJ, Bladbjerg EM, Gram J, Münster AM, Jespersen J. Tissue factor pathway inhibitor relates to fibrin degradation in patients with acute deep venous thrombosis. Blood Coagul Fibrinolysis. 2008;19(5):405-409.

40. Posch F, Riedl J, Reitter EM, et al. Dynamic assessment of venous thromboembolism risk in patients with cancer by longitudinal D-Dimer analysis: a prospective study. J Thromb Haemost. 2020;18(6):1348-1356.

41. Riedl J, Kaider A, Marosi C, et al. Decreased platelet reactivity in patients with cancer is associated with high risk of venous thromboembolism and poor prognosis. Thromb Haemost. 2017;117(1):90-98.

42. Riedl J, Pabinger I, Ay C. Platelets in cancer and thrombosis. Hamostaseologie. 2014;34(1):54-62.

43. Hisada Y, Mackman N. Cancer cell-derived tissue factor-positive extracellular vesicles: biomarkers of thrombosis and survival. Curr Opin Hematol. 2019;26(5):349-356.

44 Yamanaka S, Miyake R, Yamada Y, et al. Tissue factor pathway inhibitor 2: a novel biomarker for predicting asymptomatic venous thromboembolism in patients with epithelial ovarian cancer. Gynecol Obstet Invest. 2022;87(2):133-140.

45. Tinholt M, Vollan HK, Sahlberg KK, et al. Tumor expression, plasma levels and genetic polymorphisms of the coagulation inhibitor TFPI are associated with clinicopathological parameters and survival in breast cancer, in contrast to the coagulation initiator TF. Breast Cancer Res. 2015;17(1):44.

46. Lee RD, Barcel DA, Williams JC, et al. Pre-analytical and analytical variables affecting the measurement of plasmaderived microparticle tissue factor activity. Thromb Res. 2012;129(1):80-85.

47. Englisch C, Königsbrügge O, Nopp S, et al. Antithrombin activity and assocciation with risk of thrombosis and mortality in patients with cancer. Int J Mol Sci. 2022;23(24):15770.

48. van Es N, Hisada Y, Di Nisio M, et al. Extracellular vesicles exposing tissue factor for the prediction of venous thromboembolism in patients with cancer: a prospective cohort study. Thromb Res. 2018;166:54-59.

49 Mann KG, Orfeo T, Butenas S, Undas A, Brummel-Ziedins K. Blood coagulation dynamics in haemostasis. Hamostaseologie. 2009;29(1):7-16.

50 Mackman N, Sachetto ATA, Hisada Y. Measurement of tissue factor-positive extracellular vesicles in plasma: strengths and weaknesses of current methods. Curr Opin Hematol. 2022;29(5):266-274.

Haematologica | 109 April 2024 1136 ARTICLE - TFPI and VTE in patients with cancer C. Englisch et al.

Dabrafenib and trametinib in Langerhans cell histiocytosis and other histiocytic disorders

Eily Cournoyer,1* Justin Ferrell,1* Susan Sharp,2 Anish Ray,3 Michael Jordan,4 Christopher Dandoy,4 Michael Grimley,4 Somak Roy,5 Robert Lorsbach,5 Arnold C. Merrow,2 Adam Nelson,4 Allison Bartlett,4 Jennifer Picarsic5 and Ashish Kumar4

1Cincinnati Children’s Hospital Medical Center Pediatric Residency Training Program, Cincinnati, OH; 2University of Cincinnati College of Medicine, Division of Radiology, Cincinnati Children’s Hospital Medical Center, Cincinnati, OH; 3Division of Hematology and Oncology, Cook Children’s Hospital, Fort Worth, TX; 4University of Cincinnati College of Medicine, Division of Bone Marrow Transplant and Immune Deficiency, Cincinnati Children’s Hospital Medical Center, Cincinnati, OH and 5University of Cincinnati College of Medicine, Division of Pathology, Cincinnati Children’s Hospital Medical Center, Cincinnati, OH, USA

*EC and JF contributed equally as first authors.

Abstract

Correspondence: A. Kumar

Ashish.kumar@cchmc.org

Received: April 6, 2023.

Accepted: September 4, 2023.

Early view: September 21, 2023.

https://doi.org/10.3324/haematol.2023.283295

©2024 Ferrata Storti Foundation

Published under a CC BY-NC license

The standard treatment for Langerhans cell histiocytosis (LCH) is chemotherapy, although the failure rates are high. Since MAP-kinase activating mutations are found in most cases, BRAF- and MEK-inhibitors have been used successfully to treat patients with refractory or relapsed disease. However, data on long-term responses in children are limited and there are no data on the use of these inhibitors as first-line therapy. We treated 34 patients (26 with LCH, 2 with juvenile xanthogranuloma, 2 with Rosai-Dorfman disease, and 4 with presumed single site-central nervous system histiocytosis) with dabrafenib and/or trametinib, either as first line or after relapse or failure of chemotherapy. Sixteen patients, aged 1.3-21 years, had disease that was recurrent or refractory to chemotherapy, nine of whom had multisystem LCH with risk-organ involvement. With a median treatment duration of 4.3 years, 15 (94%) patients have sustained favorable responses. Eighteen patients, aged 0.2-45 years, received an inhibitor as first-line treatment. All of these have had sustained favorable responses, with a median treatment duration of 2.5 years. Three patients with presumed isolated central nervous system/pituitary stalk histiocytosis had stabilization or improvement of their disease. Overall, inhibitors were well tolerated. Five patients with single-system LCH discontinued therapy and remain off therapy without recurrence. In contrast, all four patients with multisystem disease who discontinued therapy had to restart treatment. Our data suggest that children suffering from histiocytoses can be treated safely and effectively with dabrafenib or trametinib. Additional studies are, however, needed to determine the long-term safety and optimal duration of therapy.

Introduction

Histiocytic diseases are rare neoplastic disorders resulting from the aberrant accumulation of cells of the monocyte lineage, namely macrophages or dendritic cells.1 The most common and well-studied histiocytic disease is Langerhans cell histiocytosis (LCH), a condition characterized by accumulation of clonal CD1a+ and CD207+ cells.2 LCH affects approximately one in 200,000 children and is most common in children 1 to 3 years old, but can present at any age.3 Clinical manifestations of LCH are highly variable, ranging from isolated, self-limiting lesions to multi-organ disease that is associated with significant morbidity and mortality. Traditionally, the first-line treatment for LCH has been vinblastine and systemic steroids, based on the

last international randomized controlled study nearly a decade ago (called LCH-III).4 Patients with multisystem (MS) LCH with involvement of liver, spleen, or bone marrow i.e. with so-called risk-organ involvement (RO+), have a variable course, with only about 60% achieving a status of not having active disease after 1 year on standard LCH-III therapy. In MS-LCH without risk organ involvement (MS RO–), the relapse/reactivation rate after 1 year of standard therapy with vinblastine and prednisone is still about 37%.4 Second-line agents have included cytarabine and/ or cladribine, or clofarabine for recurrent disease or for disease that failed to respond to standard of care.5 These chemotherapy treatments carry a high risk of morbidity, require central access for the duration of treatment, and are not always effective in MS RO+ and central nervous

Haematologica | 109 April 2024 1137 - Histiocytic Disorder ARTICLE

system (CNS) disease.6 These regimens are associated with severe hematologic toxicities, often requiring transfusion support, as well as delayed immune reconstitution and grade IV neutropenia, with associated blood stream infections. These toxicities are a high price to pay given the persistent risk of disease reactivation both during and after therapy.5

The ontology of LCH lesions has been linked to bone marrow-derived myeloid dendritic precursor cells. Activating mutations in the mitogen-activated protein kinase (MAPK) pathway play a central role in the pathogenesis of LCH.7-13 Approximately 50-60% of LCH lesions harbor a recurrent activating mutation in the BRAF gene, specifically BRAF-V600E.14,15 Furthermore, even in cases without the BRAF-V600E mutation, there is ubiquitous activation of downstream phosphorylated kinases, phospho-MEK and phospho-ERK. This suggests that activation of the BRAF-MEK-ERK axis is universal in this disease, regardless of BRAF-V600E mutational status.16 Given these findings, there has been growing interest in BRAF-MEK-ERK pathway inhibitors for the treatment of histiocytic diseases. Several studies have shown that BRAF and MEK inhibitors hold promise as salvage therapy for the treatment of high-risk LCH, particularly for patients with multisystem disease or those with risk organ involvement.17-24 The utility and feasibility of these treatments as first-line therapies have yet to be elucidated.

Herein, we describe our experience using dabrafenib, a BRAF inhibitor, and trametinib, a MEK inhibitor, to treat LCH and other histiocytic disorders. We initially treated several children whose disease was refractory to conventional treatments or who had relapsed after therapy. Based on the observed responses and safety profiles in these patients, we offered targeted, first-line inhibitor therapy to newly diagnosed patients. All patients were treated off-label as described in detail under the methods section.

Methods

Background rationale for treating patients with inhibitors

Several children were referred to us for refractory or relapsed LCH. With consistent positive results of dabrafenib and trametinib in these patients, we proposed a clinical trial of inhibitors in the first-line setting to several companies.17,25 However, none was able to support a trial. We therefore offered newly diagnosed patients the choice of treatment with conventional chemotherapy or an inhibitor. The justifications of this approach were the demonstrable efficacy of inhibitors in patients with refractory disease, and our goals of treatment, namely restoration of health and prevention of disease recurrence. The benefits and risks of conventional and targeted therapies were discussed in detail with the patient/parent, including the

unknown potential for cure and unknown duration of optimal therapy for the latter. Patients and families were informed in detail about the off-label use of the agents and all were given the option of treatment with conventional chemotherapies. Patients receiving inhibitors were monitored for adverse effects with regular complete blood counts, blood chemistry panels, and echocardiograms.

The Institutional Review Board of Cincinnati Children’s Hospital Medical Center certified this retrospective study as exempt from oversight and from requiring informed consent.

The diagnosis was confirmed via histopathology, when tissue samples were attainable (n=28), by expert pediatric pathologists (RL and JP). LCH was classified as single system or multisystem, and being with or without involvement of risk organs (liver, bone marrow, spleen). Mutations were identified by VE1-immunohistochemistry (BRAF-V600E) or next-generation sequencing. Patients with diabetes insipidus and accompanying imaging findings of isolated pituitary stalk infiltration/thickening and/or loss of a posterior pituitary bright spot were classified as having isolated pituitary lesions. Other CNS manifestations (abnormal T2 signal in cerebellar nuclei or white matter, pontine lesions, cerebellar atrophy) were classified as isolated CNS LCH or neurodegenerative LCH. In cases of isolated pituitary or CNS disease, the presumed diagnosis was based on location and radiological characteristics.

Outcome measures

Clinical status and radiological changes were used to assess response to therapy following the Histiocyte Society guidelines. Overall responses were classified as no active disease, active disease that was better since starting therapy, active disease that was progressing, or active disease that was stable. For patients with irreversible diabetes insipidus the response was recorded separately from overall disease response. For example, in patients with MS-LCH and diabetes insipidus, complete resolution of non-pituitary disease was recorded as no active disease with diabetes insipidus. Similarly, for patients with irreversible sclerosing cholangitis present at the time of initiating inhibitor treatment, the overall disease response was separated from the liver disease (e.g., no active disease with sclerosing cholangitis).

The imaging modalities used to assess response to treatment included positron emission tomography - computerized tomography scan (PET/CT), magnetic resonance imaging, CT scan, and ultrasound. For PET scans, the initial maximum standardized uptake value (SUVmax) was compared to the SUVmax of the same lesion on the first follow-up PET/CT for patients who had a PET/CT scan on record at the time of starting the inhibitor and at follow-up within 1 year of starting the medication. PET findings were considered to indicate progressive disease, stable disease, improved disease, or complete resolution

Haematologica | 109 April 2024 1138 ARTICLE - Targeted therapies in LCH E. Cournoyer et al.

based on interval changes in SUVmax values, as well as the number of lesions. There was not an absolute SUV value that was used as a negative cutoff. When looking at the response of LCH lesions to treatment, lesions were compared to the local background. For example, we would determine whether a skeletal lesion continued to have uptake greater than the adjacent uninvolved bone or whether a liver lesion still had uptake above that of the uninvolved liver. This classification was then used in conjunction with clinical status to determine the overall response.

BRAF-V600E mutation detection by droplet digital polymerase chain reaction

When feasible, patients with a known BRAF-V600E mutation had their peripheral blood analyzed for the presence of circulating mutant cells by real-time polymerase chain reaction (RT-PCR) or by droplet digital polymerase chain reaction (ddPCR) (using DNA derived from peripheral blood mononuclear cells, available at our institution as HistioTrak). The platform for HistioTrak is a standard ddPCR system (BioRad, Inc) that is optimized to maximize signal-to-noise ratio at mutation levels that are below a variant allele frequency of 0.01%. Fractional abundance or a variant allele frequency <0.001% is considered a negative result. The term “significant or not significant” is not used for clinical reporting of HistioTrak results.

Results

This study was a single-center, retrospective chart review of 34 patients with histiocytic disease who were treated with dabrafenib and/or trametinib. The patients’ characteristics and outcomes are tabulated in Tables 1 and 2. Thirty-four patients (12 females, 22 males) aged 0.2 to 45 years old were treated with targeted inhibitor therapy. Sixteen patients had received systemic treatment for their histiocytosis prior to initiation of the inhibitor and 18 received the inhibitor without prior treatment (see details under Methods). The median age of the patients at diagnosis was 2.3 years and the median age at the start of inhibitor therapy was 1.9 years. The patients’ characteristics, average time on inhibitor treatment, risk organ involvement, mutation, site(s) of disease, inhibitor used, histiocytic disease classification, response at last follow-up, and adverse effects are detailed in Table 1 for those with relapsed/refractory disease and in Table 2 for those treated with a targeted inhibitor as first-line therapy.

Patients receiving inhibitors who were refractory to prior treatment

Details of the 16 patients who received the targeted inhibitor after undergoing earlier histiocytic disease-specific therapy can be viewed in Table 1. Thirteen patients had

biopsy-confirmed LCH; nine patients had MS RO+ disease and four patients had multisystem disease without involvement of risk organs (MS RO–). Of these, one had MS RO+ LCH with CNS involvement and one had MS RO– LCH with pituitary stalk involvement. One patient had isolated CNS involvement (central diabetes insipidus, progressive ataxia and cognitive dysfunction) that could not be biopsied because of the location of disease, however the imaging findings were highly characteristic of LCH (loss of posterior pituitary bright spot, abnormal T2 signal in white matter and cerebellum, and progressive cerebellar volume loss). Two patients had systemic Rosai-Dorfman disease (patient #15: lymph node and CNS disease; patient #16: skin, bone and lymph node disease). Of the 14 patients with tissue samples available for analysis, 13 had mutations in BRAF-MEK-ERK pathway genes (BRAF-V600E, n=12; MAP2K1, n=1). In this cohort, the median age of initiation of inhibitor treatment was 2.4 years (range, 1.3-31). Seven patients received dabrafenib, seven received trametinib, and two patients received both drugs simultaneously. The rationale for the combination therapy for patient #14 was the unknown mutation and the lack of data on the impact of inhibitors in CNS LCH at the time of initiation of treatment, while for patient #15 dabrafenib was added to help to reduce the acneiform rash with trametinib.26 The median length of time that this group has been treated with the inhibitor is 4.3 years (range, 0.3-7.3 years). As shown in Figure 1, in this group, six patients with LCH no longer have active disease, six do not have active disease but have residual organ damage (4 with diabetes insipidus, 1 with sclerosing cholangitis, and 1 with both diabetes insipidus and sclerosing cholangitis). Of the two patients with Rosai-Dorfman disease, one has stable disease, while the other suffered progressive disease. The patient with isolated CNS disease (patient #14) had improvement of neurological symptoms and function.

Patients receiving inhibitor as first-line therapy

Eighteen patients were treated with targeted inhibitors as first-line therapy (Table 2). Thirteen patients had biopsy-confirmed LCH; seven patients had single-system disease, three patients had MS RO– disease (1 with CNS involvement), and three patients had MS RO+ disease. Four patients with single-system LCH had solitary bone lesions and received treatment due to location (CNS risk) and/or rapid growth of the lesion or persistence of pain. There were two patients with isolated CNS or pituitary stalk lesion(s) that could not be biopsied due to the location of the disease, however their imaging findings were highly characteristic of LCH (abnormal T2 signal in white matter and deep cerebellar nuclei). One patient with isolated CNS disease (#32) was found to have circulating BRAF-V600E+ cells via peripheral blood ddPCR, suggesting LCH as the likely diagnosis (Figure 2). Two patients had progressive systemic juvenile xanthogranuloma. In this cohort, four

Haematologica | 109 April 2024 1139 ARTICLE - Targeted therapies in LCH E. Cournoyer et al.

Table 1. Trametinib and/or dabrafenib treatment for relapsed or refractory disease. Disease classifications, mutations, and response to trametinib and/or dabrafenib in patients who received prior therapy for their histiocytic disorder.

PB

1

2

3

4

5

RO+ BM, bone, skin BRAF V600E

(i) VBL, CS

(ii) EPEG, CS, CTX (iii)

(i) VBL, CS (ii) ARA-C (iii)

(i)

(i)

6

(i)

16

Pt #: patient number; yrs: years; Dx: diagnosis; ITx: inhibitor treatment; FU: follow-up; recur.: recurrence; PB: peripheral blood; RT-PCR: real-time polymerase chain reaction; ddPCR: droplet digital polymerase chain reaction; LCH: Langerhans cell histiocytosis; MS: multisystem; RO+/–: risk organ positive/negative; BM: bone marrow; VBL: vinblastine; CS: corticosteroid; EPEG: etoposide; CTX: cyclophosphamide; CAFdA: clofarabine; DAB: dabrafenib; NAD: no active disease; Y: yes; wks: weeks; LN: lymph node; MTX: methotrexate; MP: mercaptopurine; ARA-C: cytarabine; NAD + DI: no active disease with residual diabetes insipidus; mths: months; NA: not applicable; BM: bone marrow; N: no; ND: not done; CNS: central nervous system; TRA: trametinib; PS: pituitary stalk; DR: dose reduction; ADB: active disease, better; LCH-ND: neurodegenerative LCH; RDD: Rosai-Dorfman disease; ADS: active disease, stable; ADP: active disease, progressing.

Haematologica | 109 April 2024 1140 ARTICLE - Targeted therapies in LCH E. Cournoyer et al.
Pt # Age in yrs/ Sex Dx Disease classification Site Genetic mutation Prior therapy Age at ITx start in yrs Inhibitor ITx, yrs Response at FU Trial off ITx, Y/N Time to recur. off-therapy Adverse
effects
BRAFV600E RT-PCR ddPCR Histiotrak
LCH MS,
0.3/F
1.9 DAB 6.3 NAD Y 3 wks None + +
CAFdA
0.8/F LCH MS, RO+ BRAF V600E
MTX, MP, ARA-C 1.3 DAB 5.7 NAD + DI Y 10 mths None
+
(i)
-
0.8/M LCH BM, bone, skin BRAF V600E
1.9 DAB 7.3 NAD Y 5 mths None - +
CAFdA
0.1/M LCH MS, RO+ BRAF V600E
VBL, CS (ii) CAFdA 1.3 DAB 5.0 NAD + sclerosing cholangitis N NA None - Low +
(i)
0.8/M LCH BM, bone, skin, LN BRAF V600E
VBL, CS (ii) CAFdA (iii) ARA-C, CAFdA 1.4 DAB 6.3 NAD N NA None + ND
0.4/M LCH MS, RO+ BRAF V600E
VBL, CS
CAFdA (iii) CS, vemurafenib, VBL 2.9 DAB 3.6 NAD N NA None + + 7 1.0/M LCH Skin, bone, LN, liver, spleen BRAF V600E VBL, CS 1.7 TRA 4.4 NAD + DI N NA None + +
1.0/M LCH MS, RO+ BRAF V600E
VBL, CS (ii) ARA-C, CS 3.8 TRA 2.1 NAD + DI + cholangitis N NA None ND +
0.5/M LCH Skin, LN, bone, spleen, liver BRAF V600E (i) VBL, CS (ii) CAFdA 1.3 DAB 4.2 NAD N NA None + ND
0.7/M LCH MS, RO+ BRAF V600E
(ii)
8
(i)
9
10
VBL, CS
ARA-C (iii) CAFdA 7.3 TRA 4.4 NAD + DI N NA None - Low + 11 1.2/M LCH Skin, bone, liver, spleen, BM BRAF V600E (i) VBL, CS, MP 1.8 TRA 1.8 NAD N NA Rash (DR) - ND 12 2.8/M LCH MS, RO+ MAP2K1 Q56P (i) ARA-C (ii) hydroxyurea, MTX 5.8 TRA 2.5 NAD + DI N NA Loose stools NA NA
13.6/M LCH Skin, bone, liver, spleen, BM, LN BRAF V600E ARA-C 15.42 TRA 2.1 ADB N NA None - -
17.4/M LCHND Isolated CNS NA
ARA-C cytarabine (ii) CAFdA (iii) MTX, rituximab 20.8 DAB, TRA 6.3 Improved neurological symptom, function N NA None - Low + 15 11.8/F RDD MS, RO+ Unknown CS 11.9 TRA, DAB 2.8 ADS N NA Rash (TRA) ND ND
(ii)
13
14
(i)
20.0/F RDD Skin, liver, PS Unknown (i) VBL, CS (ii) MTX (iii) CAFdA (iii) sirolimus, CS (iv) ARA-C 31.0 TRA 0.3 ADP N 23 mths Rash (DR) NA NA

**Identified by droplet digital polymerase chain reaction (ddPCR) because no tissue was available due to isolated central nervous system involvement. ***Restarted 18 months after a trial off therapy when noted to be ddPCR-positive in peripheral blood. Pt #: patient number; yrs: years; Dx: diagnosis; ITx: inhibitor treatment; Y: yes; N: no; recur.: recurrence; PB: peripheral blood; RT-PCR: real-time polymerase chain reaction; ddPCR: droplet digital polymerase chain reaction; F: female; LCH: Langerhans cell histiocytosis; MS: multisystem; RO+/–: risk organ positive/negative; LN: lymph node; DAB: dabrafenib; TRA: trametinib; PP: parental preference; NAD: no active disease; BM: bone marrow; NA: not applicable; GI: gastrointestinal; CNS: central nervous system; DI: diabetes insipidus; SS: single system; ND: not done; PS: pituitary stalk; DR: dose reduction; JXG: juvenile xanthogranuloma; NAD + DI: no active disease with residual diabetes insipidus.

Haematologica | 109 April 2024 1141 ARTICLE - Targeted therapies in LCH E. Cournoyer et al.
Pt # Age in yrs/ Sex Dx Disease classification Site Genetic mutation Age ITx start in yrs Inhibitor ITx, yrs Response at follow-up Trial off ITx, Y/N Time to recur. off therapy Adverse effects PB BRAF-V600E RT-PCR ddPCR Histiotrak 17 0.6/F LCH MS, RO+ Skin, spleen, liver, LN BRAF V600E 1.1 DAB, TRA (PP) 5.0 NAD Y 18 mths*** None - + 18 1.7/F LCH MS, RO+ Bone, spleen, lungs, LN, BM BRAF V600E 1.7 TRA 1.7 NAD N NA None + + 19 0.17/M LCH MS, RO+ skin, BM, liver, GI tract BRAF V600E 0.2 TRA 1.8 NAD N NA None + + 20 0.3/M LCH MS, ROskin, bone BRAF V600E 0.7 DAB 4.4 NAD N NA None + Low + 21 0.7/M LCH MS, ROskin, bone BRAF V600E 0.7 TRA 2.9 NAD N NA None + ND 22 36.0/F LCH MS, ROCNS, soft tissue, CNS BRAF N486_ P490 deletion 45.0 TRA 6.5 NAD, resolution of DI, improved cognition N NA None NA + 23 3.8/F LCH SS, unifocal bone BRAF V600E 3.9 TRA, DAB 2.1 NAD Y N Hair loss with TRA - + 24 8.7/F LCH SS, unifocal bone BRAF V600E 8.8 DAB 2.0 NAD Y N Nausea - + 25 3.0/F LCH SS, unifocal bone BRAF L485_ P490>F 3.1 TRA 1.1 NAD Y N None NA ND 26 9.3/F LCH SS, multifocal bone BRAF V600E 9.4 TRA 0.3 NAD Y N Rash, hair loss, grey hair (stopped) - Low + 27 13.6/M LCH SS, multifocal bone BRAF V600E 13.7 DAB 4.0 NAD Y N None - ND 28 12.3/M LCH SS, multifocal bone BRAF V600E 12.4 TRA 1.8 NAD Y 4 mths Rash, abdominal pain (DR) - NA 29 12.1/M LCH SS, multifocal bone Unknown 12.7 TRA 0.3 NAD Y N None -30 15.8/M LCH PS NA 15.9 TRA 3.2 Decrease size + DI N NA Rash - Low + 31 10.5/F LCH Isolated CNS PS, cerebellar changes NA 10.6 TRA 3.4 Stable size of PS lesion +DI (DR) - - - ND 32 4.3/M LCH Isolated CNS PS, cerebellar changes **BRAF V600E 4.3 TRA 3.4 Decrease in size of PS lesion + DI N NA None - NA 33 0.3/M JXG Skin, liver, spleen, BM TFG-RET fusion 0.3 TRA 1.3 NAD N NA None NA NA 34 6.6/M JXG Skin, CNS GAB2-BRAF fusion 6.7 TRA 3.9 NAD + DI N NA None NA NA
Table 2. Trametinib and/or dabrafenib as first-line therapy. Disease classifications, mutations, and response to trametinib and/ or dabrafenib in patients who did not receive prior therapy for their histiocytic disorder.

Langerhans cell histiocytosis when he developed sudden onset diabetes insipidus (upper panel). The arrow points to thickened infundibulum. He was treated with trametinib and repeat MRI 6 weeks later (lower panel) showed normal thickness of the enhanced infundibulum (red arrow). NAD: no active

infundibular infiltration (arrow). Extensive evaluation was negative for histiocytosis or a germ cell tumor. A biopsy of the pituitary stalk was deemed unsafe. (B) Follow-up MRI a few months later showed worsening of pituitary stalk thickening (arrow). Treatment was initiated with trametinib. (C) Repeat MRI 3 months after initiation of trametinib showed resolution of the pituitary stalk infiltration (arrow). (D) HistioTrak on peripheral blood mononuclear

Haematologica | 109 April 2024 1142 ARTICLE - Targeted therapies in LCH E. Cournoyer et al.
A B
Figure 1. Response to inhibitor therapy in patients with relapsed/refractory disease. (A) Graphical summary of all responses achieved in patients with refractory/recurrent disease. Response categories are represented by the segments of the doughnut plot. (B) Post-contrast brain magnetic resonance imaging (MRI) of a 7-year-old boy with a history of recurrent disease; DI: diabetes insipidus; ADS: active disease, stable; RDD: Rosai Dorfman disease; CNS: central nervous system; ADB: active disease, better.
A B C D
Figure 2. Isolated pituitary stalk disease diagnosed by HistioTrak. (A) Post-contrast brain magnetic resonance imaging (MRI) of a 4-year-old boy with sudden onset central diabetes insipidus, showing DNA revealed the presence of the BRAF-V600E mutation (positive droplets circled).

patients received dabrafenib, 13 received trametinib, and one patient (#23) was initially treated with trametinib but then switched to dabrafenib due to side effects. Of the 13 patients with tissue samples available for analysis, 12 had mutations in BRAF-MEK-ERK pathway genes (BRAF-V600E, n=9; GAB2-BRAF fusion, n=1; BRAF indel, n=2). One patient with juvenile xanthogranuloma had a TFG-RET fusion that was identified after the patient had experienced a dramatic response to treatment with trametinib. In this group, the median age of treatment initiation was 5.5 years (range, 0.2-45) and the median treatment duration was 2.5 years (range, 0.3-6.4). As depicted in Figure 3, 12 patients with LCH currently do not have active disease, and one patient with MS RO– LCH which included CNS disease now does not have active disease, with resolution of diabetes insipidus and improved clinical neurocognition. Of the two patients with systemic juvenile xanthogranuloma (patient

#33 with skin, liver, spleen, and bone marrow disease and patient #34 with CNS and skin disease), neither has active disease, although one still has diabetes insipidus. Three patients had isolated CNS or pituitary stalk disease, two of whom are currently improved, while one has stable disease.

Overall, no patients in either group experienced progression or worsening of disease on therapy, including notably patients with MS RO+ disease. When available, there was a universal decrease in PET scan activity upon treatment with trametinib and/or dabrafenib ( Online Supplementary Figure S1). Eleven patients (4 with MS RO+ LCH and 7 with single-system LCH) were trialed off inhibitor therapy with four experiencing relapses of disease ranging from 3 weeks to 1 year after discontinuation with a median time of 5 months. Three of the nine relapsed/refractory MS RO+ patients had a pause in treatment. All three had

histiocytosis

Langerhans

and juvenile xanthogranuloma,

extensive disease including fluorodeoxyglucose (FDG)-avid lesions of the calvarium, chest wall, vertebrae, pelvis, and lower extremities, as well as splenomegaly and profound lymphadenopathy involving the neck, chest,

and

for BRAF-V600E. Repeat imaging (right

following 8 weeks of therapy with trametinib, with marked interval decrease in size and FDG avidity of bony lesions, decrease in splenomegaly and marked improvement in lymphadenopathy throughout. (C) PET (upper and middle rows) and computed tomography (bottom row) of a 12-year-old male at diagnosis (left frames in each row) of multifocal bone LCH demonstrating a large bony lesion involving the L1 vertebral body, with a SUVmax value of 15. Repeat imaging (right frames) performed following 6 weeks of therapy with trametinib

vertebral lesion. NAD: no active disease; CNS: central nervous

Haematologica | 109 April 2024 1143 ARTICLE - Targeted therapies in LCH E. Cournoyer et al.
A B C
Figure 3. Response to inhibitor as first-line therapy. (A) Graphical summary of all responses achieved in patients treated with an inhibitor as first-line therapy. Response categories are represented by the segments of the doughnut plot. (B) Positron emission tomography (PET) of a 20-month-old female at diagnosis (left panel) with mixed with features of cell histiocytosis demonstrating abdomen pelvis. Biopsy was positive panel) shows minimal FDG uptake and marked improvement of the system; DI: diabetes insipidus.

disease recurrence, at 3 weeks, 5 months and 10 months after suspension of the inhibitor, and all achieved a status of no active disease after the inhibitor was resumed. The remaining six patients with RO+ disease were not trialed off therapy and remain without active disease. One patient with single-system multifocal bone disease (no prior chemotherapy) suffered recurrence upon stopping therapy after 1 year and similarly experienced resolution of disease when the inhibitor was resumed. Only one patient receiving an inhibitor as first-line therapy with MS RO+ LCH (patient #17) was taken off therapy in accordance with parental preference and with the knowledge that peripheral blood and bone marrow PCR (real time) were both negative for the BRAF-V600E mutation. This patient remains without active disease; however, therapy was resumed 18 months later once it was discovered that peripheral blood HistioTrak (ddPCR for BRAF-V600E) was positive. Six patients with single-system disease did not experience recurrence following cessation of therapy (4 patients with single-system, unifocal bone disease who were treated because the location of the lesion created a risk to the CNS or due to a rapidly growing lesion or persistent symptoms and 2 patients with single-system, multifocal bone disease). These patients were treated for a median time of 1.8 years (range, 0.3 months to 4 years) and the median time off therapy was 11 months (range, 4 months to 3.2 years).

Dosing and side effects

Patients treated with trametinib were prescribed an oral starting dose of 0.025 mg/kg daily. For young children, the 0.5 mg tablet was dissolved in 5 mL of clear liquid and the appropriate dose calculated for each patient. For patients treated with dabrafenib, the starting dosage was an oral formulation of 3-5 mg/kg daily in two divided doses. The contents of the 50 mg capsule were dissolved in 5 mL of clear liquid and the dose calculated for each child based on weight. Each dose was prepared fresh. Attributable side effects for each inhibitor are listed in Tables 1 and 2. Most of the listed side effects were considered minor. The most common reported side effect was skin rash with trametinib in six of 20 patients. The only reported side effect of dabrafenib was nausea in one of 11 patients. Four out of 20 patients on trametinib required dose adjustment due to side effects of skin rash or abdominal pain, which resolved upon dose reduction. Only one patient stopped trametinib due to side effects. Patient #23 had hair-thinning and was transitioned from trametinib to dabrafenib as per parental preference. No patients on dabrafenib needed dose adjustment.

Peripheral blood BRAF-V600E analysis in selected patients

For patients with BRAF-V600E-associated disease, peripheral blood monitoring was performed either by real-time

Patients’ demographics

N (%)

12 (35)

34 (100)

Male Female Total 22 (65)

Inhibitor treatment

Dabrafenib

Trametinib

Both

Disease classification

Langerhans cell histiocytosis

Single system disease

Multisystem, ROMultisystem, RO+ Isolated CNS or PS

Total

Rosai Dorfman disease

Juvenile xanthogranuloma

Mutation

Langerhans cell histiocytosis

BRAF V600E

BRAF L485

BRAF N486

MAP2K1 Q56P

Unable to biopsy*

Unknown**

Juvenile xanthogranuloma

GAB2-BRAF

TFG-RET fusion

Rosai Dorfman disease

Unknown**

Unknown***

11 (32)

20 (59)

3 (9)

7 (20.5)

7 (20.5)

12 (35)

4 (12)

30 (88)

2 (6)

2 (6)

23 (68) 1 (3) 1 (3) 1 (3) 3 (8) 1 (3)

1 (3) 1 (3)

1 (3) 1 (3)

*Unable to biopsy due to location (e.g., central nervous system, pituitary stalk). **Next-generation sequencing not approved by insurance for patients #15 and #29 (VE1 negative by immunohistochemistry). ***No mutations identifiable by next-generation sequencing (patient #16). RO+/–: risk organ positive/negative; CNS: central nervous system; PS: pituitary stalk.

PCR or more recently by ddPCR. The results of the most recent testing are shown in Tables 1 and 2. In most patients with MS RO+ LCH, circulating BRAF-V600E+ cells were detectable even after their disease had become inactive. Notably, in several patients we did not detect circulating BRAF-V600E by real-time PCR, but did see low level detection by ddPCR, highlighting the importance of using methodologies with greater sensitivity to detect the presence of residual disease cells.

Discussion

In 2017, we reported dramatic sustained clinical responses in patients with refractory MS LCH treated with inhibitors targeting the BRAF-MEK pathway.25 Although limited by the number of pediatric patients included, several other studies have also shown sustained clinical responses to the

Haematologica | 109 April 2024 1144 ARTICLE - Targeted therapies in LCH E. Cournoyer et al.
Table 3. Summary of the patients’ demographics, inhibitor treatment, disease classification, and mutation status.

targeted BRAF inhibitors dabrafenib and/or vemurafenib in histiocytosis, most notably in refractory disease.17-19 Moreover, a large pediatric international observational study recently documented that vemurafenib was effective at controlling refractory LCH with the BRAFV-600E mutation, albeit not curing the disease as shown by reactivation after stopping therapy.20 A recently published prospective phase I/II study evaluated single-agent dabrafenib or the combination of dabrafenib and trametinib in pediatric patients with recurrent/refractory LCH. Clinical efficacy and manageable toxicity were seen in both treatment groups, with most responses ongoing at the end of the study.24 Outside of pediatrics, these inhibitors have also shown efficacy in adults with histiocytic disorders.27-29 The efficacy of targeted inhibitors as a first-line monotherapy is largely unknown, as most patients in these studies had been previously treated with conventional therapies and either did not respond or relapsed. Given the dramatic, consistent, and sustained responses seen in patients with refractory high-risk disease, we aimed to treat patients newly diagnosed with histiocytic disorders with inhibitors as first-line therapy to achieve rapid and durable disease control. Ideally, such novel treatments should be administered as part of a prospective clinical trial. Unfortunately, none of the manufacturers of the available BRAF or MEK inhibitors was able to support such a trial. With overall treatment failure rates of approximately 40% with chemotherapy compared to the almost 100% response rate with the targeted inhibitors, we chose to treat patients with the latter Food and Drug Administration-approved drugs off-label, with the goal of restoring the patient’s health and preventing disease recurrence. The secondary benefits were the ease of administration while also sparing patients the potential side effects, toxicity and morbidity of traditional chemotherapeutic agents.

In our study, most of the patients had LCH and, consistent with the existing literature, the majority harbored the BRAF -V600E or another BRAF-MEK-ERK pathway activating mutation. All the patients with LCH or juvenile xanthogranuloma, regardless of the mutation, showed a favorable response to dabrafenib or trametinib, ranging from stabilization of disease (CNS disease, sclerosing cholangitis of liver) to complete clinical and radiographic resolution. The responses were comparable in patients treated with either dabrafenib or trametinib. Trametinib and dabrafenib each led to sustained clinical responses in patients with all classifications of disease, either as first-line therapy or in recurrent/refractory disease (Figures 1 and 3). Dabrafenib is effective only in the case of BRAF-V600E, while trametinib, being a MEK inhibitor, has a wider application. Once we had observed responses to trametinib in patients whose disease was driven by other mutations in BRAF or in MAP2K1, we treated all subsequent patients with trametinib, regardless of the driver mutation. One reasonable approach is to use a BRAF inhibitor

in patients with BRAF-V600E-associated disease, and a MEK inhibitor in all the others. Our data suggest that a MEK inhibitor may be useful in all patients, regardless of the driver mutation. None of the patients in our cohorts had disease associated with RAF-independent mutations in MAP2K1 (Class III), which are known to be resistant to allosteric MEK inhibitors such as trametinib.30 Given their tolerability and efficacy in patients with either BRAF or MAPK21 mutations, MEK inhibitors such as trametinib may be utilized initially in all patients while awaiting identification of the mutation.

It is well known that patients with MS RO+ LCH are at considerable risk of disease progression despite conventional chemotherapy.4 In concordance with previous studies, we saw sustained dramatic clinical and radiological responses, even in MS RO+ patients who were refractory to chemotherapy.18,19,21 Moreover, three patients with MS RO+ LCH treated with the inhibitor as first-line therapy did not have active disease at follow-up, a status that has been sustained, making these inhibitors a potential novel therapeutic option for pediatric patients with highrisk disease. The range of disease response to therapy was largely based on classification of the disease, with the known irreversible effects such as diabetes insipidus or sclerosing cholangitis/liver cirrhosis persisting despite therapy (e.g., patients #4 and #8). The goals of treatment in these situations are to preserve organ function and prevent further progression.31 Unfortunately, by the time these two patients were referred to us for inhibitor therapy, both had already developed extensive fibrosis in the liver, which was irreversible. In patients treated with inhibitors as first-line therapy, we hope to decrease or prevent the development of these permanent consequences. In fact, no patients in our study (in either cohort) developed diabetes insipidus, cirrhosis, or neurodegenerative LCH while on targeted therapy. Although CNS penetration of MEK inhibitors varies, these drugs remain a mainstay of brain tumor therapy for low-grade gliomas, neurofibromatosis type I and metastatic melanoma. 32 We report significant improvements for the patients in our cohort with CNS disease treated with MEK inhibition, including those with isolated CNS disease, in accordance with what was described by McClain et al. in their 2018 report on CNS LCH.33 The only patient whose disease did not respond to a targeted inhibitor was patient #16, who had recurrent/ refractory Rosai-Dorfman disease for 12 years that did not respond to numerous treatments and who did not have an identifiable mutation on multiple biopsies. Trametinib was tried due to persistent, severe knee pain in an area of perceived active disease. However, symptoms persisted, and trametinib was stopped when the disease progressed. The adverse effects of trametinib and dabrafenib in our study were generally mild and well tolerated with only one patient experiencing side effects significant enough to stop therapy (patient #26). It is also notable that re-

Haematologica | 109 April 2024 1145 ARTICLE - Targeted therapies in LCH E. Cournoyer et al.

sponses were sustained at smaller doses, as seen in patients #11, #30, and #28. The discontinuation rate of the inhibitors used in our study was less than the 11.5-15.7% reported in melanoma treatment.34 Although an increase in the risk of skin cancers has been attributed to BRAF and MEK inhibitors in the adult population, none of our patients developed skin cancer during their treatment.35 As the average duration of treatment in our study was just over 3 years and 3 months, the longer-term tolerability remains to be elucidated.

One of the great medical challenges in treating patients with BRAF and MEK inhibitors has been the question of when to stop therapy. In our study, all patients with single-system solitary bone lesions and two of three patients with single-system multifocal bone disease experienced sustained remissions after treatment was discontinued. It is known that some patients with single-system solitary bone lesions may experience resolution of disease without treatment. As such, these lesions are not always treated and are instead monitored over time. However, in cases in which the lesion involves the cranial bones outside the calvarium, treatment is recommended due to the risk of progression to the CNS. We, therefore, cannot state with certainty whether the responses seen in this cohort were due to therapy or to spontaneous remission. The rapid resolution of symptoms and the accompanying radiographic improvement are consistent with a treatment effect. One patient with single-system multifocal bone disease (patient #28) in whom therapy was stopped at 1 year had a recurrent bone lesion shortly after discontinuation of trametinib. Resumption of treatment resulted in a rapid response that has been sustained. Additionally, all MS-LCH patients who stopped therapy experienced recurrence of disease, but regained a status of no active disease once inhibitor treatment was reinitiated. These data support others’ conclusions that 1 year of inhibitor treatment is potentially insufficient outside of solitary bone lesions. Furthermore, in MS-LCH, inhibitors likely do not eradicate disease cells but rather induce clinical (silent) remission.19,20 We detected very low levels of circulating mutant cells in the blood of many MS-LCH patients, even upon attaining complete clinical remission on inhibitor therapy. This phenomenon is thought to be due to the presence of presumed long-lived, but scantily represented, mutant bone marrow progenitor cells that serve as a reservoir of disease.10,13,17 However, given the clinical and radiological remissions, the inhibitor therapy does effectively inhibit (render static) the mutant cell(s) from causing systemic and tissue-specific inflammatory damage to end-organs, and thus likely prevents permanent, irreversible consequences in some children (i.e., diabetes insipidus, neurodegeneration, liver cirrhosis secondary to sclerosing cholangitis) as well as quickly ameliorating the hyper-inflammatory hemophagocytic lymphohistiocytosis-like cytokine storm in MS RO+ infants which carries a

high risk of mortality.36

A highly sensitive minimal residual disease marker is needed to guide physicians on the duration of therapy based on the molecular detection of occult disease. Unfortunately, testing the blood for the circulating mutant BRAF-V600E cells by RT-PCR has not proven to monitor molecular remission accurately, as clinical relapses have been noted after cessation of therapy despite negative RT-PCR results.17 In fact, when these same samples were re-tested by ddPCR on circulating mononuclear cells (not cell-free DNA), a low level of mutational burden was found. We have now developed this assay as a clinical test, called HistioTrak, to serve as a high-sensitivity biomarker for minimal residual disease. As predicted, the majority of patients with MS LCH had detectable circulating BRAF-V600+ cells by HistioTrak, even years after inhibitor therapy. Remarkably, HistioTrak helped us to diagnose the etiology of isolated diabetes insipidus in a patient whose magnetic resonance imaging showed pituitary stalk infiltration (Figure 2). Although the diabetes insipidus persists, the pituitary stalk infiltration resolved rapidly with trametinib therapy and the child remains otherwise asymptomatic, with no clinical evidence of neurological dysfunction. However, his peripheral blood HistioTrak remains positive in spite of treatment with trametinib for 2 years. Incorporation of molecular assays such as HistioTrak will help to improve the diagnosis, treatment, and monitoring of patients with histiocytic diseases, reducing the risk of long-term complications such as neurodegenerative disease.

Despite the successful clinical remissions reached with targeted therapies in histiocytic disorders, our study is limited by being a retrospective review, not a prospective clinical trial. As such, it is difficult to deduce the efficacy of these therapies directly. We also recognize the inability of these agents to cure MS RO+ LCH. Additionally, since these drugs are relatively new, the long-term safety of treatment, including its impact on fertility, is unknown. The utility of inhibitors in patients with isolated diabetes insipidus is also unknown, so treating these patients with inhibitors is not universally accepted. However, despite these limitations, our experience suggests that targeted therapies are safe and appear more efficacious in controlling disease than conventional chemotherapy, as shown by the consistent responses in both refractory and newly diagnosed disease. Prospective studies are needed in order to demonstrate efficacy rigorously. Given the rarity of this disease, it is our hope that these aggregate results will lead to prospective clinical trials that will help to answer the question of efficacy. In addition, we believe that the inability to completely eradicate mutant cells and achieve cure (defined as absence of disease without therapy) should not be the reason to discard or not utilize these life-preserving targeted therapies. There are tantalizing reports of disease eradication being attained by combining targeted therapy with chemotherapy.37 The utility and safety of such combination approaches will need to be evaluated in larger groups of patients, probably

Haematologica | 109 April 2024 1146 ARTICLE - Targeted therapies in LCH E. Cournoyer et al.

once a targeted therapy is approved and readily available for use in children.

In summary, patients with histiocytic disorders can be treated safely and effectively with targeted BRAF inhibitors such as dabrafenib (for those with BRAF-V600E mutant disease) or a MEK inhibitor such as trametinib (in disease caused by any BRAF mutation and most MAP2K1 mutations). Although our data suggest that it may be possible to discontinue inhibitor therapy in single-system disease, future prospective studies are needed to determine when and if patients with multisystem disease can safely discontinue therapy. The development of highly sensitive molecular testing for minimal residual disease may help clinicians make this decision and should be incorporated into future studies. The availability of an efficacious, well-tolerated treatment for patients with high-risk disease offers a breakthrough therapeutic choice for a potentially fatal condition. Likewise, it also provides a new therapeutic possibility for patients with neurodegenerative disease for whom no effective therapy is currently available. Prospective studies are warranted to further determine the long-term efficacy and tolerability of inhibitors as first-line therapy as well as the duration of treatment.

References

1. Hogstad B, Berres ML, Chakraborty R, et al. RAF/MEK/ extracellular signal-related kinase pathway suppresses dendritic cell migration and traps dendritic cells in Langerhans cell histiocytosis lesions. J Exp Med. 2018;215(1):319-336.

2. Baiocchi RA . Driving toward targeted therapy for LCH. Blood. 2014;124(10):1546-1548.

3. Tran G, Huynh TN, Paller AS. Langerhans cell histiocytosis: a neoplastic disorder driven by Ras-ERK pathway mutations. J Am Acad Dermatol. 2018;78(3):579-590.

4 Gadner H, Minkov M, Grois N, et al. Therapy prolongation improves outcome in multisystem Langerhans cell histiocytosis. Blood. 2013;121(25):5006-5014.

5. Simko SJ, Tran HD, Jones J, et al. Clofarabine salvage therapy in refractory multifocal histiocytic disorders, including Langerhans cell histiocytosis, juvenile xanthogranuloma and Rosai-Dorfman disease. Pediatr Blood Cancer. 2014;61(3):479-487.

6. Donadieu J, Bernard F, van Noesel M, et al. Cladribine and cytarabine in refractory multisystem Langerhans cell histiocytosis: results of an international phase 2 study. Blood. 2015;126(12):1415-1423.

7 Allen CE, Merad M, McClain KL. Langerhans-cell histiocytosis. N Engl J Med. 2018;379(9):856-868.

8. Berres ML, Merad M, Allen CE. Progress in understanding the pathogenesis of Langerhans cell histiocytosis: back to histiocytosis X? Br J Haematol. 2015;169(1):3-13.

9. Durham BH, Lopez Rodrigo E, Picarsic J, et al. Activating mutations in CSF1R and additional receptor tyrosine kinases in histiocytic neoplasms. Nat Med. 2019;25(12):1839-1842.

10. Durham BH, Roos-Weil D, Baillou C, et al. Functional evidence for derivation of systemic histiocytic neoplasms from hematopoietic stem/progenitor cells. Blood. 2017;130(2):176-180.

11. Lim KPH, Milne P, Poidinger M, et al. Circulating CD1c+

Disclosures

AK is a consultant for SOBI, Springworks Therapeutics, and OPNA. MJ is a consultant for SOBI. AR has served on an advisory board for SOBI. The other authors have no conflicts of interest to disclose.

Contributions

EC collected and analyzed data and authored the manuscript. JF collected and analyzed data and authored the manuscript. SS and ACM reviewed radiological findings, edited the manuscript and provided the radiological figures. JP analyzed pathology specimens and edited the manuscript. RL analyzed pathology specimens. MJ, MG, AB, and AN provided clinical data. SR performed the ddPCR (HistioTrak) analysis. AK provided clinical data, supervised the entire study, and edited the manuscript.

Funding

The study was supported by Liam’s Lighthouse Foundation.

Data-sharing statement

Additional raw data are available upon request to the corresponding author.

myeloid dendritic cells are potential precursors to LCH lesion CD1a+CD207+ cells. Blood Adv. 2020;4(1):87-99.

12. Milne P, Bigley V, Bacon CM, et al. Hematopoietic origin of Langerhans cell histiocytosis and Erdheim-Chester disease in adults. Blood. 2017;130(2):167-175.

13. Xiao Y, van Halteren AGS, Lei X, et al. Bone marrow-derived myeloid progenitors as driver mutation carriers in high- and low-risk Langerhans cell histiocytosis. Blood. 2020;136(19):2188-2199.

14 Badalian-Very G, Vergilio JA, Degar BA, et al. Recurrent BRAF mutations in Langerhans cell histiocytosis. Blood. 2010;116(11):1919-1923.

15. Chakraborty R, Hampton OA, Shen X, et al. Mutually exclusive recurrent somatic mutations in MAP2K1 and BRAF support a central role for ERK activation in LCH pathogenesis. Blood. 2014;124(19):3007-3015.

16. Brown NA, Furtado LV, Betz BL, et al. High prevalence of somatic MAP2K1 mutations in BRAF V600E-negative Langerhans cell histiocytosis. Blood. 2014;124(10):1655-1658.

17 Lee LH, Krupski C, Clark J, et al. High-risk LCH in infants is serially transplantable in a xenograft model but responds durably to targeted therapy. Blood Adv. 2020;4(4):717-727.

18. Haroche J, Cohen-Aubart F, Emile JF, et al. Dramatic efficacy of vemurafenib in both multisystemic and refractory ErdheimChester disease and Langerhans cell histiocytosis harboring the BRAF V600E mutation. Blood. 2013;121(9):1495-1500.

19. Eckstein OS, Zinn D, Fein Levy C, et al. Clinical outcomes and molecular responses in children with Langerhans cell histiocytosis treated with MAPK pathway inhibitors. Blood. 2018;132(Suppl 1):3684.

20 Donadieu J, Larabi IA, Tardieu M, et al. Vemurafenib for refractory multisystem Langerhans cell histiocytosis in children: an international observational study. J Clin Oncol.

Haematologica | 109 April 2024 1147 ARTICLE - Targeted therapies in LCH E. Cournoyer et al.

2019;37(31):2857-2865.

21. Diamond EL, Durham BH, Ulaner GA, et al. Efficacy of MEK inhibition in patients with histiocytic neoplasms. Nature. 2019;567(7749):521-524.

22. Evseev D, Kalinina I, Raykina E, et al. Vemurafenib provides a rapid and robust clinical response in pediatric Langerhans cell histiocytosis with the BRAF V600E mutation but does not eliminate low-level minimal residual disease per ddPCR using cell-free circulating DNA. Int J Hematol. 2021;114(6):725-734.

23. Yang Y, Wang D, Cui L, et al. Effectiveness and safety of dabrafenib in the treatment of 20 Chinese children with BRAFV600E-mutated Langerhans cell histiocytosis. Cancer Res Treat. 2021;53(1):261-269.

24. Whitlock JA, Geoerger B, Dunkel IJ, et al. Dabrafenib, alone or in combination with trametinib, in BRAF V600-mutated pediatric Langerhans cell histiocytosis. Blood Adv. 2023;7(15):3806-3815.

25. Lee LH, Gasilina A, Roychoudhury J, et al. Real-time genomic profiling of histiocytoses identifies early-kinase domain BRAF alterations while improving treatment outcomes. JCI Insight. 2017;2(3):e89473.

26. Flaherty KT, Infante JR, Daud A, et al. Combined BRAF and MEK inhibition in melanoma with BRAF V600 mutations. N Engl J Med. 2012;367(18):1694-1703.

27. Diamond EL, Subbiah V, Lockhart AC, et al. Vemurafenib for BRAF V600-mutant Erdheim-Chester disease and Langerhans cell histiocytosis: analysis of data from the histologyindependent, phase 2, open-label VE-BASKET study. JAMA Oncol. 2018;4(3):384-388.

28. Hazim AZ, Ruan GJ, Ravindran A, et al. Efficacy of BRAFinhibitor therapy in BRAF(V600E) -mutated adult Langerhans

cell histiocytosis. Oncologist. 2020;25(12):1001-1004.

29 Abeykoon JP, Rech KL, Young JR, et al. Outcomes after treatment with cobimetinib in patients with Rosai-Dorfman disease based on KRAS and MEK alteration status. JAMA Oncol. 2022;8(12):1816-1820.

30 Gao Y, Chang MT, McKay D, et al. Allele-specific mechanisms of activation of MEK1 mutants determine their properties. Cancer Discov. 2018;8(5):648-661.

31. Braier J, Ciocca M, Latella A, et al. Cholestasis, sclerosing cholangitis, and liver transplantation in Langerhans cell histiocytosis. Med Pediatr Oncol. 2002;38(3):178-182.

32. Schreck KC, Grossman SA, Pratilas CA. BRAF mutations and the utility of RAF and MEK inhibitors in primary brain tumors. Cancers (Basel). 2019;11(9):1262.

33. McClain KL, Picarsic J, Chakraborty R, et al. CNS Langerhans cell histiocytosis: common hematopoietic origin for LCHassociated neurodegeneration and mass lesions. Cancer. 2018;124(12):2607-2620.

34 Heinzerling L, Eigentler TK, Fluck M, et al. Tolerability of BRAF/MEK inhibitor combinations: adverse event evaluation and management. ESMO Open. 2019;4(3):e000491.

35. Gencler B, Gonul M. Cutaneous side effects of BRAF inhibitors in advanced melanoma: review of the literature. Dermatol Res Pract. 2016;2016:5361569.

36. Chellapandian D, Hines MR, Zhang R, et al. A multicenter study of patients with multisystem Langerhans cell histiocytosis who develop secondary hemophagocytic lymphohistiocytosis. Cancer. 2019;125(6):963-971.

37. Eder SK, Schwentner R, Ben Soussia P, et al. Vemurafenib acts as a molecular on-off switch governing systemic inflammation in Langerhans cell histiocytosis. Blood Adv. 2022;6(3):970-975.

Haematologica | 109 April 2024 1148 ARTICLE - Targeted therapies in LCH E. Cournoyer et al.

Immunochemotherapy plus lenalidomide for high-risk mantle cell lymphoma with measurable residual disease evaluation

Zachary D. Epstein-Peterson,1 Esther Drill,2 Umut Aypar,3 Connie Lee Batlevi,1 Philip Caron,1 Ahmet Dogan,3 Pamela Drullinsky,1 John Gerecitano,1° Paul A. Hamlin,1 Caleb Ho,3° Allison Jacob,4 Ashlee Joseph,1 Leana Laraque,1 Matthew J. Matasar,1 Alison J. Moskowitz,1 Craig H. Moskowitz,1° Chelsea Mullins,4° Colette Owens,1 Gilles Salles,1 Heiko Schöder,5 David J. Straus,1 Anas Younes,1° Andrew D. Zelenetz1 and Anita Kumar1

1Lymphoma Service, Division of Hematologic Malignancies, Department of Medicine, Memorial Sloan Kettering Cancer Center, New York, NY; 2Department of Biostatistics and Epidemiology, Memorial Sloan Kettering Cancer Center, New York, NY; 3Department of Pathology, Memorial Sloan Kettering Cancer Center, New York, NY; 4Adaptive Biotechnologies, Seattle, WA and 5Department of Radiology, Memorial Sloan Kettering Cancer Center, New York, NY, USA

°Current address JG: The Janssen Pharmaceutical Companies of Johnson & Johnson, Raritan, NJ, USA

°Current address CH: Loxo Oncology, Inc., Stamford, CT, USA

°Current address CM: Notch Therapeutics, Seattle, WA, USA

°Current address CHM: Department of Medicine, Division of Hematology, Sylvester Comprehensive Cancer Center, University of Miami Miller School of Medicine, Miami, FL, USA

°Current address AY: AstraZeneca Pharmaceuticals, LP, Wilmington, DE, USA

Abstract

Correspondence: A. Kumar

kumara2@mskcc.org

Received: February 7, 2023.

Accepted: August 21, 2023.

Early view: August 31, 2023.

https://doi.org/10.3324/haematol.2023.282898

©2024 Ferrata Storti Foundation

Published under a CC BY-NC license

Chemoimmunotherapy followed by consolidative high-dose therapy with autologous stem cell rescue was a standard upfront treatment for fit patients with mantle cell lymphoma (MCL) in first remission; however, treatment paradigms are evolving in the era of novel therapies. Lenalidomide is an immunomodulatory agent with known efficacy in treating MCL. We conducted a single-center, investigator-initiated, phase II study of immunochemotherapy incorporating lenalidomide, without autologous stem cell transplant consolidation, enriching for patients with high-risk MCL (clinicaltrials gov. Identifier: NCT02633137). Patients received four cycles of lenalidomide-R-CHOP, two cycles of R-HiDAC, and six cycles of R-lenalidomide. The primary endpoint was rate of 3-year progression-free survival. We measured measurable residual disease (MRD) using a next-generation sequencing-based assay after each phase of treatment and at 6 months following end-oftreatment. We enrolled 49 patients of which 47 were response evaluable. By intent-to-treat, rates of overall and complete response were equivalent at 88% (43/49), one patient with stable disease, and two patients had disease progression during study; 3-year progression-free survival was 63% (primary endpoint not met) and differed by TP53 status (78% wild-type vs 38% ALT; P=0.043). MRD status was prognostic and predicted long-term outcomes following R-HiDAC and at 6 months following end-of-treatment. In a high-dose therapy-sparing, intensive approach, we achieved favorable outcomes in TP53wild-type MCL, including high-risk cases. We confirmed that sequential MRD assessment is a powerful prognostic tool in patients with MCL.

Introduction

An established standard of care for younger, fit patients with mantle cell lymphoma (MCL) has been frontline immunochemotherapy (IC) followed by consolidative high-dose

therapy with autologous stem cell rescue (HDT/ASCR) and rituximab maintenance. However, the use of upfront HDT/ ASCR in MCL was established in an era when rituximab and cytarabine were not routinely applied and there were limited treatment options for relapsed or refractory (R/R)

Haematologica | 109 April 2024 1149 - Non-Hodgkin Lymphoma ARTICLE

disease. Thus, it has been questioned whether HDT/ASCR should remain incorporated into frontline MCL therapy given the lack of clear overall survival (OS) benefit for this approach,1-3 the rapidly evolving treatment landscape in MCL, and the substantial toxicity and intensive healthcare utilization associated with HDT/ASCR.4 Furthermore, the outcomes among patients with high-risk MCL (e.g., TP53 alteration high proliferation index, blastoid histology) treated with IC followed by HDT/ASCR are poor.5,6 A number of novel therapies have shown promising efficacy for the treatment of MCL (thoroughly reviewed in 7), including bortezomib, lenalidomide (len), Bruton tyrosine kinase inhibitors (BTKi), and venetoclax. Several studies have incorporated these novel agents into established IC regimens to evaluate if they can improve outcomes and potentially facilitate the safe omission of HDT/ASCR consolidation.

Len, an immunomodulatory agent with pleotropic anti-tumor effects, has established efficacy in newly diagnosed8 and R/R MCL.9 We designed a sequential frontline treatment approach for untreated MCL incorporating len to IC (rituximab, cyclophosphamide, doxorubicin, vincristine, and prednisone [R-CHOP] followed by rituximab + high-dose cytarabine [R-HiDAC]) followed by R-len maintenance. We examined whether HDT/ASCR can be spared using this intensive induction treatment regimen in combination with len followed by R-len maintenance in a cohort of patients with MCL enriched for high-risk features (blastoid or pleomorphic histology, Ki67 ≥30%).

In addition to establishing the safety and efficacy of this treatment approach, we sought to investigate measurable residual disease (MRD) testing to augment response assessment and disease monitoring. The presence of MRD has been shown to offer prognostic information in MCL. However, comprehensive, prospective data in uniformly treated cohorts using contemporary, sensitive testing methodologies assays was lacking. MRD testing results do not currently guide treatment selection, intensification, or de-escalation for patients with MCL in clinical practice and

further data are required before it can be incorporated into routine treatment decisions. We concurrently assessed the utility of sequential next-generation sequencing (NGS) for MRD detection using the clonoSEQ® Assay (Adaptive Biotechnologies, Seattle, WA) in the context of our prospective clinical study.

Methods

Patient enrollment

Eligible patients were age ≥18 years with untreated stage II-IV MCL. Eligibility required radiographically measurable disease, absent active infection, absent central nervous system involvement by MCL, and adequate performance status, blood counts, and organ function. Full eligibility requirements are detailed in the Online Supplementary Appendix. We aimed to enroll 2/3 high-risk patients, defined as Ki67 ≥30% or blastoid/pleomorphic histology. Eligibility for HDT/ASCR was not an enrolment criterion; subjects being considered for enrolment who intended to pursue HDT/ASCR were not permitted to enroll given the design of our study. This study was approved by our institutional review board (#15-196) and all trial conduct was in accordance with the Declaration of Helsinki with informed written consent. Our trial was registered with the National Clinical Trials Network ( clinicaltrials gov. Identifier: NCT02633137).

Assessment of genomic alterations

In 43 instances, we performed molecular profiling on baseline tumor samples using a hybrid-capture, NGS panel interrogating >400 genes with the ability to detect mutations and copy number alterations.10

Treatment

Initial treatment consisted of four cycles of R-CHOP (lenR-CHOP; Figure 1) followed by two cycles of R-HiDAC. At

Haematologica | 109 April 2024 1150 ARTICLE - Immunochemotherapy plus lenalidomide for MCL Z.D. Epstein-Peterson et al.
Figure 1. Study schema. MRD: measurable residual disease; PET: positron-emission tomography; len: lenalidomide; R-CHOP: rituximab, cyclophosphamide, doxorubicin, vincristine, and prednisone; R-HiDAC: rituximab + highdose cytarabine; mo: months.

interim evaluation with 16 patients, the 3,000 mg/m2 dose of cytarabine was removed due to excess hematologic toxicity. Thereafter, patients received 6 months of rituximab-lenalidomide (R-len). We administered standard thromboprophylaxis concurrent with len, growth factor support for len-R-CHOP and R-HiDAC, varicella prophylaxis throughout treatment, and Pneumocystis jirovecii prophylaxis during len-R-CHOP and R-HiDAC.

18FDG positron emission tomography/computed tomography (PET/CT) was performed after each phase of treatment. MRD testing occurred at these same time points and additionally at 6 months following end-of-treatment (EoT, the conclusion of R-len). We assessed radiographic response using the 5-point scale (5PS)11 and classified responses using the Lugano Classification.12 We used CTCAE version 4.0 to grade adverse events.

Measurable residual disease testing

The methodology for peripheral blood-based NGS MRD assay has been described previously.13 Briefly, clonoSEQ® uses multiplex polymerase chain recation (PCR) and NGS to identify and track MCL-associated immunoglobulin receptor gene rearrangements (IgH, IgK, and IgL) with a lower detection limit of 1x10-6. All MRD analyses were performed centrally (Adaptive Biotechnologies, Seattle, WA); any detectable tumor-associated clonal rearrangement was labeled ‘detectable MRD’ (dMRD) and the absence of detectable rearrangement, ‘uMRD’.

Statistical analysis

The primary efficacy endpoint was 3-year progression-free survival (PFS) measured from study enrollment, with desirable cutoff 75% and undesirable 60%. The trial was powered at 80% with 47 patients. By protocol, patients who enrolled but did not complete the len-R-CHOP phase were removed and replaced. We report intent-to-treat outcomes including all 49 patients enrolled. Secondary objectives included PFS and OS, each measured from start of treatment. PFS was measured until progression or last follow-up and OS until death or last follow-up. Patients lost to follow-up or withdrawn from study are also counted as events. We conducted a landmark survival analysis to investigate the association between progression status at 24 months post-diagnosis (POD24) and OS and performed this only on those patients who were alive/not lost to follow-up at that time point. We conducted survival analyses using the Kaplan-Meier method. We evaluated prognostic variables using Cox proportional hazards. ED conducted biostatistical analyses using R (Version 4.0) and all authors had access to clinical data.

Results

Patient characteristics

We enrolled 49 total patients (Table 1) from January 2016 until

*Percentages refer to evaluated patients. **One patient did not have Ki67 assessment at baseline; additionally, 1 patient’s MCL displaying aggressive pathologic features not reaching the threshold for formally labeling as blastic morphology had Ki67 (<10%) only assessed from bone marrow sampling at baseline was classified as high-risk per protocol given these features at diagnosis and that subsequent biopsy specimens showed an elevated (≥30%) Ki67 concurrent with the same aggressive features. †Patients with evaluation via multiple methodologies are listed in each category. IQR: interquartile range; MIPI_b: biologic Mantle Cell Lymphoma International Prognostic Index; LDH: lactate dehydrogenase; GI: gastrointestinal; NGS: next-generation sequencing; WT: wild-type; ALT: altered; SNP: single nucleotide polymorphism.

Haematologica | 109 April 2024 1151 ARTICLE - Immunochemotherapy plus lenalidomide for MCL Z.D. Epstein-Peterson et al.
Characteristic N=49* Median age in years (IQR) 63 (57-68) Sex: male, N (%) 35 (71) Stage, N (%) II III IV 4 (8.2) 4 (8.2) 41 (84) MIPI_b risk, N (%) High Intermediate Low 29 (59) 18 (37) 2 (4.1) High-risk per protocol,** N (%) Unknown 31 (65) 1 Ki67 ≥30%, N (%) Unknown 30 (62) 1 Blastoid, N (%) 4 (8.2) Elevated LDH, N (%) 16 (33) Bone marrow involvement, N (%) Unknown 36 (75) 1 GI tract involvement, N (%) Unknown 6 (14) 5 TP53 mutation, N (%) Unknown 10 (23) 6 TP53 deletion, N (%) Unknown 12 (27) 5 TP53 alteration, N (%) Wild-type Deletion Mutation Mutation and deletion or loss of heterozygosity Unknown 27 (63) 6 (14) 2 (4.7) 8 (19) 6 Protocol risk/TP53 alteration, N (%) Low risk/TP53 WT Low risk/TP53 ALT High risk/TP53 WT High risk/TP53 ALT Unknown 11 (26) 4 (9.5) 15 (36) 12 (29) 7 Method for TP53 deletion assessment,† N (%) NGS-based sequencing assay Fluorescence in situ hybridization Karyotype SNP array 39 (80) 30 (61) 8 (16) 4 (8.2)
Table 1. Patient characteristics at enrollment.

June 2018. Per protocol, efficacy-evaluable patients completed len-R-CHOP treatment. Two patients did not complete len-R-CHOP, one for progressive disease and one for toxicity. One patient withdrew from the study in remission following R-HiDAC to pursue HDT/ASCR. The median age among all patients was 63 years (range, 30-79) and 22 (45%) were

≥65 years old at enrollment. Thirty-one (65%) patients were high-risk by protocol including four patients with blastoid histology. Forty-one patients (84%) had tumor TP53 mutation and deletion status assessed prior to treatment; of these, 14 were TP53 altered (mutation and/or gene loss) (34%): three harbored mutated TP53, five harbored one copy of TP53, and

2.

TP53 and progression of disease within 24 months status.

(A) Progression-free survival (PFS) in evaluable patients (N=47).

(B) Overall survival (OS) in evaluable patients (N=47). (C) PFS by TP53 status (wild-type [WT] vs. deletion alone vs. mutation (MUT) alone vs. mutated/deleted, N=41). (D) OS by TP53 status (WT vs. deletion (DEL) alone vs. MUT alone vs. mutated/deleted, N=41). (E) PFS by TP53 status (WT/retained vs. altered, N=41). (F) OS by TP53 status (WT/retained vs. altered, N=41). (G) OS by progression of disease within 24 months (POD24) status. LOH: loss of heterozygosity.

Haematologica | 109 April 2024 1152 ARTICLE - Immunochemotherapy plus lenalidomide for MCL Z.D. Epstein-Peterson et al.
Figure Survival analyses among all patients and according to
A C E G B D F

six harbored both. High-risk patients were enriched for MCL harboring TP53 alterations (Online Supplementary Table S1).

Efficacy outcomes

By intent-to-treat (N=49), as of March 2023, the median follow-up among survivors was 63 months (range, 11-84). At EoT (N=47 patients), the overall response rate was 88% (Online Supplementary Figure S1), all complete responses (CR). Examining the three patients with stable disease or progressive disease on treatment, two had tumor TP53 status assessed and both harbored deletion and mutation. Among 43 patients with CR at EoT, 32 have since relapsed at a median of 40 months (95% confidence interval [CI]: 33-49) from enrollment. The median PFS among all patients was 49 months (95% CI: 38-59; Figure 2A) and the median OS was not reached [NR]; Figure 2B); the rates of 3-year PFS and OS were 63% (95% CI: 50-78) and 85% (95% CI: 76-96), respectively. PFS and OS differed according to TP53 status (Figures 2C-F): 3-year PFS, wild-type [WT] 78% (95% CI: 64-95) versus altered 38% (95% CI: 20-71; logrank P=0.04); 3-year OS WT 96% (95% CI: 89-100) versus

altered 69% (95% CI: 49-96) as well as MIPI-b14 and study risk category (PFS, not OS; Table 2). Median OS differed numerically by CR status (CR vs. <CR) post-len-R-CHOP (22 months vs. NR) but this did not meet the threshold for statistical significance (Online Supplementary Table S5). At relapse/disease progression, all response-evaluable patients but three (with localized MCL amenable to radiation) received BTKi-based therapy (8 single-agent, 18 combination therapy), of which 19 (76% of response-assessed) had disease response. Nine patients had TP53 mutation at relapse and received BTKi, of whom seven (78%) experienced disease response. The median survival among relapsing/ progressing patients was 32 months (95% CI: 19-NR) from time of relapse/progression and 16 patients are deceased, including two patients deceased due to SARS-CoV2 infection coincident with responding MCL. Progression during study/within 1 year of EoT and relapse within 2 years of EoT were each associated with inferior OS (Table 3), as was POD24 (Table 3; Figure 2G). The seven patients who progressed within 2 years of diagnosis had a median OS of 17 months (95% CI: 7-NR) after the 2-year time point

1N;

confidence interval; MIPI_b: biologic Mantle Cell Lymphoma International Prognostic Index;

deletion; LOH: loss of heterozygocity;

not reached.

Haematologica | 109 April 2024 1153 ARTICLE - Immunochemotherapy plus lenalidomide for MCL Z.D. Epstein-Peterson et al.
Characteristic Counts PFS OS Overall1 PFS events1 OS events1 Median PFS in months (95% CI) P2 Median OS in months (95% CI) P2 Overall 49 32 16 Ki67 <30% >=30% 18 30 9 23 5 11 60 (46-NR) 38 (25-54) 0.034 NR NR (60-NR) 0.5 MIPI_b risk Low/intermediate High 20 29 9 23 3 13 57 (49-NR) 30 (24-56) 0.008 NR NR (50-NR) 0.032 High risk per protocol No Yes 17 31 8 24 4 12 60 (46-NR) 38 (24-54) 0.015 NR NR (60-NR) 0.3 TP53 alteration WT DEL MUT MUT & DEL/LOH 27 6 2 8 16 3 2 7 5 2 1 7 51 (49-NR) 54 (42-NR) 26 (24-NR) 14 (11-NR) 0.002 NR NR (42-NR) 56 (42-NR) 35 (21-NR) <0.001 TP53 WT vs. one-hit vs. biallelic WT MUT or DEL MUT & DEL/LOH 27 8 8 16 5 7 5 3 7 51 (49-NR) 48 (29-NR) 14 (11-NR) 0.004 NR NR (42-NR) 35 (21-NR) <0.001 TP53 WT vs. altered WT ALT 27 16 16 12 5 10 51 (49-NR) 24 (16-NR) 0.043 NR 51 (31-NR) <0.001 Protocol risk/TP53 alteration Low risk/TP53 WT Low risk/TP53 ALT High risk/TP53 WT High risk/TP53 ALT 11 4 15 12 5 2 11 10 2 2 3 8 60 (49-NR) 52 (18-NR) 49 (31-NR) 21 (12-NR) 0.018 NR 52 (25-NR) NR (64-NR) 51 (31-NR) 0.011 Overall 49 (38-59) NR (64-NR)
Table 2. Progression-free survival and overall survival estimates by risk factors.
2Log-rank
PFS:
OS:
CI:
WT:
MUT:
DEL:
NR:
test.
progression-free survival;
overall survival;
wild-type; ALT: altered;
mutation;

versus an unreached median for the 38 non-progressing patients (P<0.001).

Toxicity outcomes

Treatment-related toxicities of interest are displayed in Table 4. At interim evaluation following 16 total patients, the 3,000 mg/m2 cytarabine dose was removed due to a pattern of excessive hematologic toxicity of grades 3/4 anemia and thrombocytopenia with one or both of these occurring in seven of ten patients who received 3,000 mg/m2. Cycle 2 of cytarabine was dose-reduced or omitted in all but two such patients and no major bleeding events occurred during this period. For cycle 2 cytarabine dosing, one patient received 500 mg/m2, two 750 mg/m2, 13 1,000 mg/m2, 24 2,000 mg/ m2, and two 3,000 mg/m2.

No treatment-related deaths occurred; one patient withdrew during len-R-CHOP due to tumor lysis syndrome. The most common grade ≥3 toxicities were hematologic, most commonly neutropenia (37% of patients undergoing lenR-CHOP, 70% of patients undergoing R-HiDAC, and 42% of patients receiving R-len). The rates of febrile neutropenia were 14%, 21%, and 7% and grade ≥3 thrombocytopenia 22%, 83%, and 9% (one grade 1 bleeding event occurred) in the three treatment phases, respectively.

Treatment-related adverse events frequently led to dose reductions or delays (Table 4): 41% of patients receiving lenR-CHOP, 36% R-HiDAC, and 53% R-len. For the 20 patients requiring dose reduction/delay during len-R-CHOP, reasons included neutropenic fever (N=7), cytopenia (N=7), infection (N=3), rash (N=2), or other causes (N=2); see protocol in the Online Supplementary Appendix for lenalidomide and cytarabine dose reduction guidelines (R-CHOP dosing was not altered).

Rare grade ≥3 infections occurred, including four instances of pneumonia, one skin/soft tissue, and one sepsis. Non-hematologic grade ≥3 toxicities are detailed in the Online Supplementary Table S4; we did not observe malignancies ascribed to treatment. Notably frequent grade ≤2 toxicities across phases of treatment included fatigue (e.g., 35% during len-R-CHOP), peripheral sensory neuropathy (29% during len-R-CHOP), and rash (20% during both len-R-CHOP and R-len).

Measurable residual disease outcomes

Among 46 patients with an available pretreatment tumor sample, clonal rearrangement characterization was successful in 89% of patients; all baseline (pretreatment) blood samples were dMRD. An MRD result at the level of 1x10-5 sensitivity (1E-5) sensitivity was available at all four post-baseline time points in 28 patients (Figure 3A). At 1E-5, 32% (12/37) of patients remained dMRD following lenR-CHOP, of which 11 converted to uMRD following R-HiDAC thus 3% (1/37) were dMRD following both len-R-CHOP and R-HiDAC consolidation. PFS did not differ by MRD status at 1E-5 following len-R-CHOP and only one patient remained dMRD following R-HiDAC at 1E-5. At the level of 1x10 -6 sensitivity (1E-6; Figure 3B; Online Supplementary Table S2), MRD status did predict median PFS following both len-R-CHOP (39 months [95% CI, 21-46] for dMRD vs. 54 months [95% CI, 28-NR] for uMRD; P=0.03) and R-HiDAC (19 months [95% CI, 11-NR] for dMRD vs. 45 months [95% CI, 27-NR] for uMRD; P=0.005).

Among 37 patients with MRD results at 1E-5 at EoT, four were dMRD, two of which were simultaneous (within 2 weeks of testing) with relapse; the remaining two patients dMRD had median PFS of 5 (95% CI, 4-NR) months versus

Haematologica | 109 April 2024 1154 ARTICLE - Immunochemotherapy plus lenalidomide for MCL Z.D. Epstein-Peterson et al.
Overall1 OS events1 36-month OS
CI)
OS
EoT in months (95% CI) P2 <CR at EoT or progression/relapse within 1 year of EoT No Yes 36 8 6 5 90 (80-100) 38 (15-92) 53 (53-NR) 26 (19-NR) <0.001 Progression/relapse within 2 years of EoT No Yes 29 15 3 8 96 (88-100) 53 (33-86) NR (53-NR) 49 (28-NR) <0.001 24-month OS from 2 years post-diagnosis, % (95% CI) Median OS from 2 years post-diagnosis in months (95% CI) POD24 No Yes 37 7 7 4 91 (82-100) 43 (18-100) 85 (41-NR) 17 (7.0-NR) <0.001 1N; 2log-rank test. CR: complete response; EoT: end of treatment; OS: overall survival; CI: confidence interval; POD24: progression of disease within 24 months; NR: not reached.
Table 3. Overall survival by progression status after end of treatment (among 49 patients, 4 came off study before end of treatment and 1 was lost to follow-up within 1 year of end of treatment).
Characteristic
from EoT in months, % (95%
Median
from

General/metabolism

Musculoskeletal/connective

Nervous system

Peripheral

*Data are presented as N patient (%) except for totaled toxicities which are at the toxicity instance (not patient) level. †Toxicities related to a phase of treatment affecting the next phase are ascribed to the preceding therapy; e.g., a patient with grade 3 anemia due to cycle 4 of len-R-CHOP causing delay in cycle 1 of R-HiDAC, this would be attributed to len-R-CHOP. ‡37 patients received only <3,000 mg/m2, seven patients received 1 cycle of 3,000 mg/m2 followed by 2,000 mg/m2 for cycle 2, 2 patients received both cycles at 3,000 mg/m2, and 1 patient received only 1 cycle total at 3,000 mg/m2; toxicities are listed under 3,000 g/m2 if a patient received at least 1 dose at this level. §Instances of febrile neutropenia with an identified infectious source/agent are noted under both Infection and Febrile neutropenia categories. #Instances of dose reduction or delay due to multiple causes are listed under each category. Len-R-CHOP: lenalidomide plus rituximab, cyclophosphamide, doxorubicin, vincristine, and prednisone; R-HiDAC: rituximab plus high-dose cytarabine; R-len: rituximab plus lenalidomide.

Haematologica | 109 April 2024 1155 ARTICLE - Immunochemotherapy plus lenalidomide for MCL Z.D. Epstein-Peterson et al.
Timing† Toxicity Len-R-CHOP N=49 R-HiDAC‡ R-len N=45 All doses N=47 <3,000 mg/m2 N=37 3,000 mg/m2 N=10
grades 3/4, N (%) Anemia Thrombocytopenia Neutropenia Febrile neutropenia 10 (20) 11 (22) 18 (37) 7 (14) 24 (51) 39 (83) 33 (70) 10 (21) 19 (51) 30 (81) 25 (68) 8 (22) 3 (30) 8 (80) 7 (70) 2 (20) 0 4 (9) 19 (42) 3 (7) Infection,§ grades 3/4, N (%) Any Pneumonia Skin/soft tissue Sepsis Metapneumovirus 1 (2) 1-1 (2)-1 (2) 1 (3)-1 (3) 0-5 (11) 3 1 1Toxicity resulting in dose adjustment or delay,# N (%) Any toxicity
to febrile neutropenia
to cytopenia(s) Due to infection Due to rash Due to other causes 20 (41) 7 7 3 2 2 17 (36) 7 12 23 7 (19) 5 5 12 10 (100) 2 7 11 23 (53) 2 29 5 3 4 Common toxicities, any grade, N (%)
Constipation Dysgeusia Nausea Diarrhea Mucositis
Table 4. Significant (occurring in ≥5% of patients or resulting in treatment dose adjustment or delay) treatment-related adverse events.*
Hematologic,
Due
Due
Gastrointestinal
Fatigue Anorexia
Myalgia Edema
tissue Arthralgia
sensory neuropathy Memory impairment Respiratory Dyspnea Hoarseness Nasal congestion Skin/subcutaneous tissue Rash Alopecia Dry skin Pruritus 16 (33) 7 (14) 6 (12) 6 (12) 5 (10) 17 (35) 3 (6) 6 (12) 6 (12) 5 (10) 14 (29)5 (10) 3 (6) 3 (6) 10 (20) 5 (10) 4 (8) 3 (6)1 (2)2 (4) 1 (2) 8 (17)2 (4) 2 (4) 6 (13)2 (4)1 (2)2 (4)-------------------1 (2) 2 (4) 1 (2) 6 (13) 4 (9) 7 (16)1 (2) 1 (2) 1 (2) 8 (18) 3 (7) 1 (2) 1 (2) 9 (20)4
-
(9)
Haematologica | 109 April 2024 1156 ARTICLE - Immunochemotherapy plus lenalidomide for MCL Z.D. Epstein-Peterson et al. A B Continued
on following page.

38 (95% CI, 33-NR) months for the 32 patients non-relapsed with uMRD (P<0.001). All six patients whose MCL was uMRD at 1E-6 at EoT and converted to dMRD at 6 months post-EoT eventually experienced disease relapse. MCL MRD status at 1E-6 at 6-months post-EOT was predictive of PFS (Figure 3C; Online Supplementary Table S2; Online Supplementary Figure S2): among the 29 patients with 1E-6 MRD results (12 dMRD, 17 uMRD), median PFS was 42 months (95% CI, 34-NR) for uMRD versus 11 months (95% CI, 0-NR) for dMRD (P<0.001).

Examining concordance between PET/CT results and MRD status at 1E-5 (Online Supplementary Table S3), there were 111 coincident testing instances, of which most (86%) were concordant: six as PET+/dMRD and 89 as PET-/uMRD. Sixteen coincident tests showed discordant results: five PET+/uMRD (all 5PS =4; 3 after len-R-CHOP and 2 after R-HiDAC) and 11 PET-/dMRD. In all three instances of PET+/uMRD discordance following len-R-CHOP, the patients’ subsequent PET eventually was rated as 5PS ≤3. One patient with PET+/uMRD discordance following R-HiDAC converted to PET- followed R-len maintenance whereas the other patient remained PET+ and had conversion to dMRD. Both patients whose disease was PET-/dMRD at EoT have experienced disease relapse.

Tumor genomic and cytogenetic alterations

Forty-five patients underwent NGS-based targeted exome sequencing (Figure 4) and 20 patients therein underwent analysis of paired tumor sequencing at relapse/progression. As shown in Figure 4A, besides TP53 (N=8, 22%), commonly mutated genes at baseline included ATM (53%) and KMT2D (24%). A subset of 11 patients also had expanded cytogenetic testing at baseline (karyotype, N=7; SNP array, N=3; both, N=1) of whom two had complex karyotype (≥3 unrelated cytogenetic abnormalities beyond t(11;14)). Six of 20 patients with

paired sequencing at time of disease relapse/progression demonstrated emerging CDKN2A and CDKN2B homozygous deletions compared to baseline (McNemar test for paired data, P=0.13). No gene besides TP53 was prognostic when altered at baseline (hazard ratio [HR] for PFS =5.91; 95% CI: 2.35-14.84; HR for OS =7.87; 95% CI: 2.21-28.02).

Discussion

We performed a single-center, investigator-initiated, phase II study examining a frontline intensive IC-based treatment regimen for MCL with the addition of len and omitting consolidative HDT/ASCR. Although the primary study endpoint of 3-year PFS was not met, this was primarily driven by the poor outcomes observed among patients with TP53-altered MCL, further establishing that TP53-altered MCL is associated with poor outcomes when treated with IC and len does not overcome this negative prognostic impact.5 However, among patients with WT TP53, outcomes were more favorable, even among patients whose MCL harbored adverse disease features (elevated Ki67 and/or blastoid/pleomorphic histology). We further demonstrated the prognostic importance of MRD status in MCL within our approach, especially at the level of 1E-6 sensitivity, which can be achieved using the NGSbased MRD assay.

The frequency and severity of toxicities observed with our treatment regimen generally aligned with those expected based on prior studies investigating len-R-CHOP15 and R-len.16 The addition of lenalidomide did impact R-CHOP dosing, as 41% of patients required dose reduction (in len) or delay during len-R-CHOP, primarily due to cytopenias (7 instances) and neutropenic fever (6 instances). This frequency is

Haematologica | 109 April 2024 1157 ARTICLE - Immunochemotherapy plus lenalidomide for MCL Z.D. Epstein-Peterson et al.
C D
Figure 3. Measurable residual disease analyses. (A) Measurable residual disease (MRD) swimmer plot at 1x10-5 sensitivity. (B) MRD swimmer plot at 1x10-6 sensitivity. (C) Progression-free survival (PFS) by MRD status at 1x10-5 at 6 months post-end of treatment (EoT). (D) PFS by MRD status at 1x10-6 at 6 months post-EoT; DEL: deletion, MUT: mutation; LOH: loss of hetrozygosity; dMRD: detectable MRD; uMRD: absence of detectable MRD.

higher than that observed (9%15) in treating diffuse large B-cell lymphoma with len-R-CHOP, which could be due to the higher incidence of bone marrow involvement in MCL predisposing to hematologic toxicity. At interim analysis of 16 patients, we observed excessive hematologic toxicity, primarily grades 3/4 thrombocytopenia without bleeding, with 3,000 mg/m2 of cytarabine. Therefore, this dose level was removed for the remainder of our study. Numerous dose regimens of cytarabine have been utilized in treating MCL, notably: R-BAC - 500-800 mg/m2 for 3 days, R-DHAX - 2,000 mg/m2 every 12 hours for two doses, hyper-CVAD (age-based) - 1,000-3,000 mg/m2 every 12 hours for 2 days, and Nordic (age-based) - 2,000-3,000 mg/m2 every 12 hours for 2 days.

In our study, many patients’ MCL responded to cytarabine radiographically and based on conversion from dMRD to uMRD with cytarabine dosing of <3,000 mg/m2, suggesting that efficacy may be maintained with dose attenuation for advanced age or comorbidity.

The role for consolidative HDT/ASCR in first remission in MCL has been questioned given several retrospective and real-world studies in the modern era which have not demonstrated an OS benefit with this approach.1,3,17 An updated analysis from the European Mantle Cell Lymphoma Network phase 3 clinical trial that established the role of HDT/ASCR show no statistically significant difference in PFS and OS in the rituximab-treated patient subset (N=68) between HDT/

in cohort in at least 4 instances (N=45 patients). Source of TP53 deletion status includes all possible testing modalities, including targeted sequencing and other cytogenetic studies (karyotype, single nucleotide polymorphism array, fluorescence in situ hybridization). (B) Tile plot displaying genomic alterations at progression evaluating the top 6 genes altered in relapsed samples (N=20 patients). LOH:loss of heterozygosity; Mut: mutations.

ASCR and interferon-α maintenance in first remission.3 The rate of referral for HDT/ASCR in real-world datasets of patients in the United States is as low as 17%, suggesting incomplete uptake of this practice.18,19 Although supportive care measures for patients undergoing HDT/ASCR have improved and the incidence of major toxicities or death with its use in contemporary practice is lower,20 it still carries potential for substantial toxicity (especially in older patients in whom MCL is common), deep and lasting immunosuppression with potential infectious sequelae, high cost, and intensive exposure to healthcare facilities, much of which are especially undesirable during the ongoing COVID-19 pandemic. Other notable studies have incorporated novel agents to frontline therapy with IC without HDT/ASCR consolidation.21-24 Results from the WINDOW-1 study were published,22 reporting outcomes from 131 patients treated with ibrutinib-rituximab followed by R-hyper-CVAD/methotrexate-cytarabine: among 97 PET/CT-evaluable patients, the overall response rate was 71% and complete response rate 69% to ibrutinib-rituximab alone; 3-year PFS was 79% (95% CI: 70-85), indicative of high clinical activity for this regimen. The Nordic MCL4 study24 investigated len added to upfront bendamustine-rituximab in a non-transplant-eligible patient population (N=50) and demonstrated a median PFS of 42 months; importantly, patients whose MCL harbored altered TP53 (N=12) had inferior survival outcomes in this

Haematologica | 109 April 2024 1158 ARTICLE - Immunochemotherapy plus lenalidomide for MCL Z.D. Epstein-Peterson et al.
A B
Figure 4. Genomic analyses. (A) Tile plot for baseline genomic alterations including all genes altered

study. Finally, abstract results have been reported for the Triangle study,23 which randomized 870 patients to IC plus HDT/ASCR (‘arm A’) versus IC plus HDT/ASCR plus ibrutinib (‘arm A+I’) versus IC plus ibrutinib omitting HDT/ASCR (‘arm I’). Similar to the WINDOW-1 study, only 15% of patients in Triangle were high-risk by MIPI. Although the 3-year PFS estimates from these studies (especially WINDOW-1 and Triangle) are higher than the 3-year PFS reported in the current study, our study included both younger and older patients and enriched for high-risk patients (59% with MIPI-b high risk and 23% with mutated TP53), thus limiting cross-trial comparison of outcomes. Collectively, these studies and our results show that frontline targeted therapies can build upon IC regimens and spare patients the toxicities associated with HDT/ASCR without a clear decrement in PFS.

Maintenance therapy has a clear role post-HDT/ASCR in prolonging remission duration based on results from the LYSA Group’s randomized study demonstrating prolongation in PFS and OS with 3 years of rituximab maintenance.25 Data from the Randomized European MCL Elderly Trial26 reinforced the benefit to rituximab maintenance for older patients following R-CHOP. Multiple other groups have investigated the role for len-based maintenance with27 or without8 HDT/ ASCR. The MCL R2 Elderly trial8 reported improved PFS but not OS comparing R-len to rituximab alone as maintenance following induction (without HDT/ASCR) at the cost of increased toxicity; thus, along with waited results from the ongoing ECOG-ACRIN E1411 trial,28 the optimal composition of maintenance therapy remains an unanswered question that warrants further inquiry. In our study, the re-emergence of detectable MRD and subsequent relapses that we observed in the 6 months following EoT suggest that a longer duration of maintenance beyond 6 months may have been beneficial to sustain remissions in this high-risk patient population. However, such considerations would have to balance potential benefits with toxicity and further immunosuppression from R-len.

We evaluated MRD status at multiple points and our data comprise one of the largest experiences in MCL using the NGS clonoSEQ platform; most prior studies used ASO PCR. Overall, we have shown that MRD status carried prognostic importance in our sequential treatment regimen, especially at later time points such as 6 months following EoT, and that 1E6 is more strongly predictive of outcomes than 1E5 sensitivity. A key finding from our study is the different implications for MRD results at the level of 1E-5 versus 1E-6 sensitivity levels: a majority of patients’ disease was uMRD at 1E-5 following R-HiDAC and MRD status at this sensitivity level and time point did not carry prognostic significance. However, MRD status at 1E-6 at this same time point did discriminate long-term PFS (median 22 months dMRD vs. 54 months uMRD). This supports the use an of NGS MRD assay which is a highly sensitive assay and can achieve a sensitivity level of 1x10-6. An additional key finding is that persistent or

recurrent dMRD late in study treatment predicted long-term PFS: at 6 months following EoT, median PFS was 13 months for dMRD versus 39 uMRD at the level of 1E-6 sensitivity. This prompts consideration as to whether additional maintenance could have been beneficial in patients with dMRD. Furthermore, this finding of a later MRD time point carrying prognostic importance is concordant with results from a large, prospective effort using a PCR-based assay.29 Therein, the authors showed that MRD status at 6 months post-HDT/ ASCR was a particularly useful measure for predicting longterm outcome. MRD-based study designs based on these results could continue maintenance for patients with dMRD and/or terminate maintenance for patients with uMRD. We substantiated existing literature correlating abnormalities in TP53 and poor outcomes with IC-treated patients in MCL (this relationship was not firmly established at time of study conception). Our data correlating upfront sequencing results with clinical outcomes is one of the largest and most comprehensive in uniformly treated patients with MCL. We did not identify additional gene signatures predictive of outcomes. Through serial sequencing in 20 patients at baseline and relapse, we demonstrated stability in TP53 alterations (Figure 4B) and identified in CDKN2A and CDKN2B loss at time of relapse, similar to enrichment previously published findings.30 The 3-year PFS rate among patients with TP53-altered MCL approximates data from the Nordic MCL2 study in which patients underwent HDT/ASCR, recognizing the limitations of cross-trial comparisons and differences between these cohorts.5 The addition of len did not appear to abrogate this negative effect. There are ongoing studies without chemotherapy that are investigating the use of targeted therapies, such as BTKi with or without venetoclax, as upfront treatment of TP53-altered MCL (clinicaltrials gov. Identifier: NCT03824483, NCT03112174) and we await results from these studies to inform management for high-risk MCL patients.

Our study carries limitations. First, our study was devised and implemented prior to the extensive body of literature demonstrating the adverse prognostic effect of TP53 abnormalities in MCL. Second, although there are clear patterns among our data from clinical and MRD perspectives, we caution firm conclusions given the relatively small numbers of patients treated at a single center that ultimately warrant confirmation in a multicenter effort.

We designed a non-HDT/ASCR-based frontline treatment approach for MCL and achieved generally favorable clinical outcomes in patients with WT TP53 MCL with expected toxicity for cytarabine-containing induction regimens in treating MCL. Our clinical outcomes roughly align with those from other upfront HDT/ASCR-sparing approaches with novel agents, when accounting for our enriching for patients with high-risk MCL, and further substantiate the validity of this therapeutic approach. Additionally, we have redemonstrated the predictive power of MRD evaluation in defining disease trajectories longitudinally in patients with MCL and highlight

Haematologica | 109 April 2024 1159 ARTICLE - Immunochemotherapy plus lenalidomide for MCL Z.D. Epstein-Peterson et al.

the 1E-6 sensitivity level as particularly useful. Although we are not further developing this treatment regimen, similar future approaches could consider developing a strategy with a longer maintenance treatment phase given the pattern of relapses that we observed post-maintenance. Based on the first formal evaluation in the Triangle study incorporating upfront BTKi, it is unclear whether or not upfront len + chemoimmunotherapy approaches will be further developed. Noteworthy ongoing upfront studies include venetoclax-lenalidomide-rituximab31 and acalabrutinib-lenalidomide-rituximab32 from which we await further results. Given len’s immunomodulatory mechanism of action and the advent of chimeric antiden receptor T cell33 and bi-specific antibodies34 in treating MCL, there may be rational synergistic combinations that can be pursued wherein len augments the efficacy of these immune-based therapies.

Disclosures

ZDE-P discloses education content review for Elsevier. CLB discloses grants/contracts from Epizyme, Autolus, Roche and Vincerx; consulting/advisory boards for BMS, Seattle Genetics, Kite, Karyopharm, TG Therapeutics, ADC Therapeutics, Abbvie and Genentech; stock/options of Dava Oncology; honoraria from TouchIME, Medscape and Moderna. PC discloses stock/options of Bristol-Myers Squibb, Johnson and Johnson, Novartis, Pfizer, Teva and Glaxo Smith Kline. AD discloses grants/contracts from Roche and Takeda; consulting for Incyte and EUSA. JG discloses employment at Janssen Pharmaceuticals. PAH discloses grants/contracts from Molecular Templates, Alexion/Portola and Janssen; consulting for Calithera Pharmaceuticals, AstraZeneca, Juno Therapeutics, Sandoz, Karyopharm and Celgene; data safety monitoring/advisory board of Molecular Templates. CH discloses honoraria from Invivoscribe, Inc. and Maryland Society of Pathologists; support for meetings/travel from Loxo Oncology at Lilly; advisory board membership at Blueprint Medicines; stock options of Eli Lilly and Company; employment at Loxo Oncology at Lilly. AJa discloses employment at Adaptive Biotechnologies. MJM discloses grants/contracts from Astra Zeneca, Bayer, Genentech, IGM Biosciences, Janssen, Pharmacyclics, Roche and Seattle Genetics; consulting/advisory role at ADC Therapeutics, Astra Zeneca, Bayer, Daiichi Sankyo, Epizyme, F. Hoffmann-La Roche Ltd, Genentech Inc., IMV Therapeutics, Juno Therapeutics, Karyopharm, Merck, MEI Pharma, Rocket Medical, Seattle Genetics, TG Therapeutics and Teva; honoraria from ADC Therapeutics, Bayer, Daiichi Sankyo, Epizyme, IMV Therapeutics, Janssen, MEI Pharma, Pharmacyclics, Genentech, Roche and Seattle Genetics; expert testimony for Bayer; stock/options of Merck. AJM discloses honoraria from Seagen, L.P./Purdue, Affimed, Imbrium Therapeutics, Takeda, Seattle Gentics, Janpix Ltd. and Merck; data safety monitoring/advisory board of Lymphoma Hub and Gilead Science Inc. CM discloses stock/options and employment at Adaptive

Biotechnologies. GS discloses consulting for Abbvie, Beigene, BMS/Celgene, Epizyme, Genentech/Roche, Genmab, Incyte, Janssen, Kite/Gilead, Loxo, Milteniy, Molecular Partners, Morphosys, Nordic Nanovector, Novartis, Rapt, Takeda and Debiopharm/Velosbio/Ipsen; honoraria from Abbvie, Bayer, Incyte, Kite/Gilead, Morphosys, Novartis and Regeneron; stock/options of Owkin. DJS disloses grants/contracts and honoraria from Takeda and Seagen. AY discloses employment at AstraZeneca. ADZ discloses grants/contracts from MEI Pharma, Genentech/Roche and Beigene; consulting for Genentech Roche, Beigene, MEI Pharma, AstraZeneca, Abbvie, MorphoSys, Novartis, Adaptive Biotech, Janssen, Gilead, Kite, BMS, Celgene and Juno; honoraria from MEI Pharma, Kyowa Kirin, NCCN, ASCO Post, Curio Science, Kite Pharm and DAVA Oncology; support for meetings/travel from Dava Oncology, NCCN, ER Congressi and UNMC; data safety monitoring/ advisory board of Genentech, Roche, Abbvie, AstraZeneca, Kite, Celgene and Juno; leadership/fiduciary role at NCCN and Lymphoma Research Foundation; DMC membership at BMS, Celgene and Juno. AK discloses research support from Celgene; grants/contracts from Genentech/Abbvie, Pharmacyclics, Adaptive Biotechnologies and Seattle Genetics; honoraria from Astra Zeneca, Kite Pharmaceuticals and Janssen; stock from Bridge Bio. All other authors have no conflicts of interest to disclose.

Contributions

AK and AZ designed the study. ZDE-P wrote the manuscript. ED conducted biostatistical analyses. UA and CH assisted with genomic and cytogenetic analyses. CLB, PC, PD, JG, PAH, MJM, AJM, CHM, CO, DJS, AY, ADZ, and AK enrolled patients, oversaw treatments, and graded toxicities. LL and AJ assisted with data collection and oversight. AD and CH provided pathology input. APJ and CM performed and provided input on MRD analyses. GS provided critical input on the manuscript. HS interpreted PET/CT scans. All authors read and approved the final manuscript for submission.

Acknowledgments

We acknowledge the patients and caregivers for participating in our study. We also acknowledge the study staff, medicine steering committee, and protocol development staff at MSKCC for implementation assistance. Formatting assistance at MSK was provided by Hannah Rice.

Funding

This work was supported by the institutional P30 grant (P30CA008748) and the American Association for Cancer Research, the Lymphoma Research Foundation, and the AIDS Malignancy Consortium (to ZDE-P).

Data-sharing statement

The data generated in this study are available upon request from the corresponding author.

Haematologica | 109 April 2024 1160 ARTICLE - Immunochemotherapy plus lenalidomide for MCL Z.D. Epstein-Peterson et al.

References

1. Gerson JN, Handorf E, Villa D, et al. Survival outcomes of younger patients with mantle cell lymphoma treated in the rituximab era. J Clin Oncol. 2019;37(6):471.

2. Karmali R, Switchenko JM, Goyal S, et al. Multi-center analysis of practice patterns and outcomes of younger and older patients with mantle cell lymphoma in the rituximab era. Am J Hematol. 2021;96(11):1374-1384.

3. Zoellner A-K, Unterhalt M, Stilgenbauer S, et al. Long-term survival of patients with mantle cell lymphoma after autologous haematopoietic stem-cell transplantation in first remission: a post-hoc analysis of an open-label, multicentre, randomised, phase 3 trial. Lancet Haematol. 2021;8(9):e648-e657.

4 Shah GL, Mohammadi I, Purdum AG, Wong AC, Schroeder A, Kilgore KM. Cost and healthcare utilization in relapsed/ refractory diffuse large B-cell lymphoma: a real-world analysis of medicare beneficiaries receiving chimeric antigen receptor T-cell vs. autologous and allogeneic hematopoietic cell transplants. Transplant Cell Ther. 2021;27(3):S302.

5. Eskelund CW, Dahl C, Hansen JW, et al. TP53 mutations identify younger mantle cell lymphoma patients who do not benefit from intensive chemoimmunotherapy. Blood. 2017;130(17):1903-1910.

6. Geisler CH, Kolstad A, Laurell A, et al. Long-term progressionfree survival of mantle cell lymphoma after intensive front-line immunochemotherapy with in vivo–purged stem cell rescue: a nonrandomized phase 2 multicenter study by the Nordic Lymphoma Group. Blood. 2008;112(7):2687-2693.

7 Jain P, Dreyling M, Seymour JF, Wang M. High-risk mantle cell lymphoma: definition, current challenges, and management. J Clin Oncol. 2020;38(36):4302-4316.

8. Ribrag V, Safar V, Kluin-Nelemans H, et al. Rituximablenalidomide (R2) maintenance is superior to rituximab maintenance after first line immunochemotherapy in mantle cell lymphoma: results of the MCL R2 Elderly Clinical Trial. Blood. 2021;138(Suppl 1):379.

9 Trněný M, Lamy T, Walewski J, et al. Lenalidomide versus investigator’s choice in relapsed or refractory mantle cell lymphoma (MCL-002; SPRINT): a phase 2, randomised, multicentre trial. Lancet Oncol. 2016;17(3):319-331.

10 Cheng DT, Mitchell TN, Zehir A, et al. Memorial Sloan KetteringIntegrated Mutation Profiling of Actionable Cancer Targets (MSK-IMPACT): a hybridization capture-based next-generation sequencing clinical assay for solid tumor molecular oncology. J Mol Diagn. 2015;17(3):251-264.

11. Barrington SF, Mikhaeel NG, Kostakoglu L, et al. Role of imaging in the staging and response assessment of lymphoma: consensus of the International Conference on Malignant Lymphomas Imaging Working Group. J Clin Oncol. 2014;32(27):3048.

12. Cheson BD, Pfistner B, Juweid ME, Gascoyne RD, Specht L, Horning SJ, Coiffier B, Fisher RI, Hagenbeek A, Zucca E. Revised response criteria for malignant lymphoma. J Clin Oncol. 2007;25(5):579-586.

13. Ching T, Duncan ME, Newman-Eerkes T, et al. Analytical evaluation of the clonoSEQ Assay for establishing measurable (minimal) residual disease in acute lymphoblastic leukemia, chronic lymphocytic leukemia, and multiple myeloma. BMC Cancer. 2020;20(1):1-15.

14 Hoster E, Klapper W, Hermine O, et al. Confirmation of the mantle-cell lymphoma International Prognostic Index in randomized trials of the European Mantle-Cell Lymphoma

Network. J Clin Oncol. 2014;32(13):1338-1346.

15. Nowakowski GS, LaPlant B, Macon WR, et al. Lenalidomide combined with R-CHOP overcomes negative prognostic impact of non–germinal center B-cell phenotype in newly diagnosed diffuse large B-cell lymphoma: a phase II study. J Clin Oncol. 2015;33(3):251-257.

16. Ruan J, Martin P, Shah B, et al. Lenalidomide plus rituximab as initial treatment for mantle-cell lymphoma. N Egnl J Med. 2015;373(19):1835-1844.

17 Dreyling M, Lenz G, Hoster E, et al. Early consolidation by myeloablative radiochemotherapy followed by autologous stem cell transplantation in first remission significantly prolongs progression-free survival in mantle-cell lymphoma: results of a prospective randomized trial of the European MCL Network. Blood. 2005;105(7):2677-2684.

18. Kumar A, Martin P, Wang M, et al. Real-world treatment patterns and outcomes of 3,455 previously untreated mantle cell lymphoma patients in US routine clinical practice. Hematol Oncol. 2021;39(Suppl 2):18-22.

19 Sawalha Y, Radivoyevitch T, Tullio K, et al. The role of upfront autologous hematopoietic cell transplantation in the treatment of mantle cell lymphoma, a population based study using the National Cancer Data Base (NCDB). Blood. 2017;130(Suppl 1):2009.

20 Liu H-W, Seftel MD, Rubinger M, et al. Total body irradiation compared with BEAM: Long-term outcomes of peripheral blood autologous stem cell transplantation for non-Hodgkin’s lymphoma. Int J Radiat Oncol Biol Phys. 2010;78(2):513-520.

21. Chang JE, Li H, Smith MR, et al. Phase 2 study of VcR-CVAD with maintenance rituximab for untreated mantle cell lymphoma: an Eastern Cooperative Oncology Group study (E1405). Blood. 2014;123(11):1665-1673.

22. Wang ML, Jain P, Zhao S, et al. Ibrutinib–rituximab followed by R-HCVAD as frontline treatment for young patients (≤ 65 years) with mantle cell lymphoma (WINDOW-1): a single-arm, phase 2 trial. Lancet Oncol. 2022;23(3):406-415.

23. Dreyling M, Doorduijn JK, Gine E, et al. Efficacy and safety of ibrutinib combined with standard first-line treatment or as substitute for autologous stem cell transplantation in younger patients with mantle cell lymphoma: results from the randomized Triangle Rrial By the European MCL Network. Blood. 2022;140(Suppl 1):1-3.

24. Eskelund CW, Albertsson-Lindblad A, Kolstad A, et al. Lenalidomide plus bendamustine-rituximab does not overcome the adverse impact of TP53 mutations in mantle cell lymphoma. Haematologica. 2018;103(11):e541.

25. Le Gouill S, Thieblemont C, Oberic L, et al. Rituximab after autologous stem-cell transplantation in mantle-cell lymphoma. N Engl J Med. 2017;377(13):1250-1260.

26. Kluin-Nelemans HC, Hoster E, Hermine O, et al. Treatment of older patients with mantle cell lymphoma (MCL): long-term follow-up of the randomized European MCL elderly trial. J Clin Oncol. 2020;38(3):248-256.

27. Ladetto M, Cortelazzo S, Ferrero S, et al. Lenalidomide maintenance after autologous haematopoietic stem-cell transplantation in mantle cell lymphoma: results of a Fondazione Italiana Linfomi (FIL) multicentre, randomised, phase 3 trial. Lancet Haematol. 2021;8(1):e34-e44.

28. Smith MR, Jegede O, Martin P, et al. ECOG-ACRIN E1411 randomized phase 2 trial of bendamustine-rituximab (BR)based induction followed by rituximab (R) ± lenalidomide (L)

Haematologica | 109 April 2024 1161 ARTICLE - Immunochemotherapy plus lenalidomide for MCL Z.D. Epstein-Peterson et al.

consolidation for mantle cell lymphoma: effect of adding bortezomib to front-line BR induction on PFS. J Clin Oncol. 2021;39(Suppl 15):7503.

29 Ferrero S, Grimaldi D, Genuardi E, et al. Punctual and kinetic MRD analysis from the Fondazione Italiana Linfomi MCL0208 phase 3 trial in mantle cell lymphoma. Blood. 2022;140(12):1378-1389.

30 Delfau-Larue M-H, Klapper W, Berger F, et al. High-dose cytarabine does not overcome the adverse prognostic value of CDKN2A and TP53 deletions in mantle cell lymphoma. Blood. 2015;126(5):604-611.

31. Phillips TJ, Danilov AV, Bond D, et al. The combination of venetoclax, lenalidomide and rituximab in patients with newly diagnosed mantle cell lymphoma induces high response rates and MRD undetectability. J Clin Oncol. 2021;39(Suppl 15):7505.

32. Ruan J, Leonard JP, Chen GZ, et al. Phase 2 trial of acalabrutinib-lenalidomide-rituximab (ALR) with real-time monitoring of MRD in patients with treatment-naïve mantle cell lymphoma. Blood. 2022;140(Suppl 1):175-177.

33. Wang M, Siddiqi T, Gordon L, et al. Lisocabtagene maraleucel (liso-cel) in r/r MCL: primary analysis results from the MCL cohort of the single-arm, multicenter, Seamless Design Transcend NHL study. Hematol Oncol. 2023;41(S2):875-877.

34. Phillips T, Dickinson M, Morschhauser F, et al. Glofitamab step-up dosing induces high response rates in patients (pts) with relapsed or refractory (R/R) mantle cell lymphoma (MCL), most of whom had failed prior bruton’s tyrosine kinase inhibitor (BTKi) therapy. Blood. 2021;138(Suppl 1):130.

Haematologica | 109 April 2024 1162 ARTICLE - Immunochemotherapy plus lenalidomide for MCL Z.D. Epstein-Peterson et al.

Outcome of combined modality treatment in first-line for stage I(E) peripheral T-cell lymphoma; a nationwide population-based cohort study from the Netherlands

Frederik O. Meeuwes,1,2 Mirian Brink,3 Wouter Plattel,2 Marjolein W.M. van der Poel,4 Marie José Kersten,5 Mariëlle Wondergem,5 Lara Böhmer,6 F.J. Sherida H. Woei-A-Jin,7 Otto Visser,8 Rimke Oostvogels,9 Patty M. Jansen,10 Karen J. Neelis,11 Anne P.G. Crijns,12 Laurien A. Daniëls,13 Tjeerd J.F. Snijders,14 Joost S.P. Vermaat,15 Gerwin A. Huls2 and Marcel Nijland2

1Department of Hematology, Treant Hospital, Emmen, the Netherlands; 2Department of Hematology, University Medical Center Groningen, Groningen, the Netherlands; 3Department of Research and Development, Netherlands Comprehensive Cancer Organisation (IKNL), Utrecht, the Netherlands; 4Department of Hematology, GROW School for Oncology and Developmental Biology, Maastricht University Medical Center, Maastricht, the Netherlands; 5Department of Hematology, Amsterdam University Medical Centers, Cancer Center Amsterdam, Amsterdam, the Netherlands; 6Department of Hematology, Haga Hospital, The Hague, the Netherlands; 7Department of General Medical Oncology, University Hospitals Leuven, Leuven, Belgium; 8Department of Hematology, Isala Hospital, Zwolle, the Netherlands; 9Department of Hematology, University Medical Center Utrecht, Utrecht, the Netherlands; 10Department of Pathology, Leiden University Medical Center, Leiden, the Netherlands; 11Department of Radiotherapy, Leiden University Medical Center, Leiden, the Netherlands; 12Department of Radiotherapy, University Medical Center Groningen, Groningen, the Netherlands; 13Department of Radiotherapy, Amsterdam University Medical Centers, Cancer Center Amsterdam, Amsterdam, the Netherlands; 14Department of Hematology, Medisch Spectrum Twente, Enschede, the Netherlands and 15Department of Hematology, Leiden University Medical Center, Leiden, the Netherlands

Abstract

Correspondence: M. Nijland m.nijland@umcg.nl

Received: March 26, 2023.

Accepted: September 27, 2023.

Early view: October 5, 2023.

https://doi.org/10.3324/haematol.2023.283174

©2024 Ferrata Storti Foundation

Published under a CC BY-NC license

Peripheral T-cell lymphomas (PTCL) comprise a heterogeneous group of mature T-cell neoplasms with an unfavorable prognosis; presentation with stage I(E) disease is uncommon. In clinical practice, an abbreviated chemotherapy treatment regimen combined with radiotherapy (combined modality treatment [CMT]) is commonly used, although evidence from clinical trials is lacking. The aim of this nationwide population-based cohort study is to describe first-line treatment and outcome of patients with stage I(E) PTCL. All newly diagnosed patients ≥18 years with stage I(E) anaplastic large cell lymphoma (ALCL), angioimmunoblastic T-cell lymphoma (AITL) and peripheral T-cell lymphoma NOS (PTCL not otherise specified [NOS]) in 1989-2020 were identified in the Netherlands Cancer Registry. Patients were categorized according to treatment regimen, i.e., chemotherapy (CT), radiotherapy (RT), CMT, other therapy and no treatment. The primary endpoint was overall survival (OS). Patients with stage I(E) ALCL, AITL and PTCL NOS (n=576) were most commonly treated with CMT (28%) or CT (29%), 2% underwent SCT. RT only was given in 18%, and 8% received other therapy and 16% no treatment. Overall, the 5-year OS was 59%. According to subtype, 5-year OS was superior for ALCL as compared to PTCL NOS and AITL (68% vs. 55% and 52%, respectively; P=0.03). For patients treated with CMT, 5-year OS was significantly higher (72%) as compared to patients treated with either CT or RT alone (55% and 55%, respectively; P<0.01). In multivariable analysis, age per year increment (hazard ratio [HR] =1.06, 95% confidence interval [CI]: 1.05-1.07), male sex (HR=1.53, 95% CI: 1.23-1.90), and CT, or no treatment (HR=1.64, 95% CI: 1.21-2.21, and HR=1.55, 95% CI: 1.10-2.17, respectively) were associated with a higher risk of mortality. For stage I(E) ALCL, AITL and PTCL NOS, 5-year OS is 59%, comparing favorably to historical outcome in advanced-stage disease. Superior outcome estimates were observed in patients treated with CMT.

Haematologica | 109 April 2024 1163 - Non-Hodgkin Lymphoma ARTICLE

Introduction

Peripheral T-cell lymphomas (PTCL) are mature lymphoproliferative diseases that form a heterogenous group of >20 distinct subtypes. PTCL account for approximately 10% of newly diagnosed lymphomas worldwide. The most prevalent subtypes in Europe and North America are anaplastic large cell lymphoma (ALCL), angioimmunoblastic T-cell lymphoma (AITL) and peripheral T-cell lymphoma not otherwise specified (PTCL NOS), which together account for approximately 80-86% of all PTCL diagnoses.1,2 The prognosis of patients with PTCL is generally poor, with a median 5-year overall survival (OS) of 28-43%, where ALCL anaplastic lymphoma kinase (ALK)+ is a positive exception with a 5-year OS of 72-78%.3-8

The majority of PTCL patients present with advanced-stage disease. These patients are generally treated with six cycles of cyclophosphamide, doxorubicin, vincristine and prednisone - either with or without etoposide (CHO(E)P). More recently brentuximab vedotin + CHP was shown to be superior to CHOP in ALCL, but a direct comparison with CHOEP is lacking.9 In young and fit patients, current data largely support the use of consolidative autologous stem cell transplant (SCT).3,7,8,10-14

A minority of patients present with limited-stage disease whereby the incidence strongly depends on subtype. 3-5

A recent population-based study conducted in Denmark and Sweden indicated that the outcome in patients with limited-stage disease is superior to to those with extensive disease.15 Clinical trials on the optimal treatment of patients with limited stage are lacking. Derived from its use in aggressive B-cell lymphoma, an abbreviated treatment regimen with three cycles of CHO(E)P combined with radiotherapy (combined modality treatment [CMT]) has been adapted in daily practice of stage I(E) PTCL, but only sporadically in stage II.8,16-18

Clinical trials addressing the efficacy of different first-line treatment modalities in stage I(E) PTCL have, to the best of our knowledge, not been performed. Our nationwide population-based cohort study aims to describe the various first-line treatment regimens and the outcome of patients with stage I(E) PTCL in the Netherlands.

Methods

Registry and study population

The nationwide population-based Netherlands Cancer Registry (NCR) is maintained and hosted by the Netherlands Comprehensive Cancer Organization (IKNL) and has nationwide coverage of at least 95% of all malignancies since 1989.19 The NCR relies on comprehensive case notification through the Nationwide Histopathology and Cytopathology Data Network and the Nationwide Registry of Hospital Discharges (i.e., inpatient and outpatient discharges). In-

formation on dates of birth and diagnosis, sex, topography and morphology, hospital type of diagnosis, and first-line therapy is routinely recorded by trained registrars of the NCR through retrospective medical records review. Information on last known vital status for all patients (i.e., alive, dead, or emigration) is obtained through annual linkage with the Nationwide Population Registries Network that holds vital statistics on all residents of the Netherlands.

All patients ≥18 years with stage I(E) PTCL diagnosed between 1989-2020 were identified in the NCR, using the International Coding system of Disease - Oncology (ICD-O) of the World Health Organization (WHO), morphology codes 9702-9705, 9714 and 9715. Stage I(E) was defined according to the Ann Arbor staging system, determined by physician assessment, in which IE is defined as extranodal localization of the lymphoma.

The PTCL subgroups analyzed included ALCL, AITL and PTCL NOS. Enteropathy associated T-cell lymphoma (EATL), extranodal natural killer-T-cell lymphoma nasal type (ENKTCL), and anaplastic large cell lymphoma, seroma associated - also known as breast-implant associated anaplastic large cell lymphoma (BIA-ALCL) - and several other, rare PTCL subtypes were excluded from analyses as treatment regimens of these disease entities are different from ALCL, AITL and PTCL NOS. Moreover, patients with a defined primary cutaneous T-cell lymphoma, including the primary cutaneous T-cell lymphomas subcutaneous panniculitis-like T-cell lymphoma (ICD-O 9708), mycosis fungoides (ICD-O 9700), primary cutaneous ALCL (ICD-O 9718), primary cutaneous g/δ T-cell lymphoma (ICD-O 9726), CD4+ small/medium T-cell lymphoproliferative disorder (ICD-O 9709) and CD8+ aggressive epidermotropic cytotoxic T-cell lymphomas (ICD-O 2513) were disregarded for this study. Furthermore, PTCL patients with primary involvement of the central nervous system have been excluded. ALK+ and ALK- ALCL were registered as distinct entities in the NCR as of 2008, according to WHO classification of 2008 (4th edition). Patients were categorized according to treatment modality, i.e., chemotherapy (CT; +/- SCT), radiotherapy (RT), CMT, other therapy and no treatment. Anatomical localization of first clinical presentation according to treatment modality is presented in Online Supplementary Figure S1. Information on the exact therapeutic regimen and number of cycles was registered in the NCR for patients diagnosed as of January 1, 2014. Furthermore, patients were categorized in two calendar periods, i.e., 1989-1999, and 2000-2020. The ‘cutoff’ year was based on the implementation of CMT for patients with PTCL in the Netherlands adapted from the pivotal study of Miller et al. in large B-cell lymphoma published in 1998.18

According to the Central Committee on Research involving Human Subjects (CCMO), this type of observational study does not require approval from an ethics committee in the Netherlands. The Privacy Review Board of the NCR approved the use of anonymous data for this study.

Haematologica | 109 April 2024 1164 ARTICLE - Combined modality treatment for stage I(E) peripheral T-cell lymphoma F.O. Meeuwes et al.

Statistical analysis

Descriptive statistics were used to present patient characteristics across the six treatment modalities. In addition, for 58 patients treated with CT and diagnosed in 20142020, type of chemotherapy, number of cycles and best response, determined by physician assessment using the Lugano classification, were evaluated. The primary endpoint was OS, defined as the time between PTCL diagnosis and all-cause-death with survival follow-up through February 1, 2022 (patients alive were censored on this date). With a median follow-up time of 70 months post-diagnosis, all survival analyses were restricted to 5 years of follow-up. The Kaplan-Meier method served to estimate OS, and the log-rank test to examine differences in survival distributions. OS was calculated for the two calendar periods, three subtypes of PTCL (AITL, PTCL NOS and ALCL) and for the five treatment strategies (CT, CMT, RT, other therapy and no treatment). For ALK+ and ALK- ALCL have been classified as distinct entities as of 2008, OS was calculated for 77 patients with ALK+ ALCL and ALK- ALCL diagnosed as of 2008. Moreover, 2-year progression-free survival (PFS) of patients treated with CT and diagnosed in 2014-2020 was calculated. PFS was defined as the time between diagnosis and tumor progression or all-cause-death, whichever occurred first.

Finally, the impact of age, sex, subtype, period of diagnosis, Ann Arbor stage (meaning stage I vs. stage IE or extranodal vs. nodal disease) and treatment on risk of mortality was evaluated using uni- and multivariable Cox proportional hazard regression analysis. For the latter, co-variates were introduced in the regression models with a backward selection method, and the final model was accomplished when the P value for the covariates was below 0.05. The results from the Cox regression analyses produce hazard ratios (HR) with associated 95% confidence intervals (CI). The proportional hazard assumption was tested based on

the Schoenfeld residuals. Overall, a P value below 0.05 was considered statistically significant. All analyses were performed using STATA/SE 17.1 (StataCorp LP, College Station, Texas, USA).

Results

Patient characteristics

From 1989 to 2020, among the 4,795 patients with PTCL, 851 (18%) patients were diagnosed with stage I(E) disease. Of the stage I(E) patients, 343 were diagnosed with PTCL-NOS (40%), 205 with ALCL (24%), 28 with AITL (3%), and 275 with other subtypes of PTCL (32%; Figure 1). Patients with PTCL NOS, ALCL and AITL were included, leaving 576 patients with stage I(E) disease for further analyses. Over time, the share of patients with PTCL NOS decreased from 74% to 46%, whilst more patients were diagnosed with ALCL in the latter time period (24% vs. 47%); the percentage of AITL patients remained relatively stable (2% vs. 7%). The majority of the 576 patients were diagnosed between 2000 and 2020 (n=320, 56%), although the incidence of stage I(E) disease among patients with PTCL NOS, ALCL, or AITL decreased over time when compared to patients with stage II-IV (Online Supplementary Figure S2). Overall, the median age was 61 years with a male preponderance (58%). Median age varied between 55 and 67 years for patients treated with CMT versus patients treated with RT only or without therapy. Most patients treated with CMT had ALCL, whereas most patients treated with RT only were diagnosed with PTCL NOS (Table 1). Regarding ALCL, 77 patients were diagnosed after 2007 of whom 29 were ALK+, 47 were ALK- and for one patient the ALK status was unknown.

Treatment

In total, 331 patients (57%) were treated with CT (Table 1),

Haematologica | 109 April 2024 1165 ARTICLE - Combined modality treatment for stage I(E) peripheral T-cell lymphoma F.O. Meeuwes et al.
Figure 1. Incidence of stage I(E) peripheral T-cell lymphoma in 1989-2020 in the Netherlands, according to all subtypes.

of whom 157 (47%) received CT only, 163 (49%) received CMT and 11 patients (3%) received consolidative SCT. RT was used in 102 patients (18%), 48 patients (8%) were treated otherwise, i.e., by means of surgical resection or with steroids and 95 patients did not receive any treatment at all (16%). From 2000 onwards, more patients were treated with CMT (39% vs. 131%) and less with RT (36% vs. 6%),

as compared to patients diagnosed before 2000 (P<0.01; Figure 2).

Of the 58 patients with stage I(E) disease diagnosed in 2014-2020 that were treated with CT, 39 received CHOP, 17 received CHOEP, one patient received CEOP and one patient brentuximab vedotin. Of the 56 patients with CHO(E)P, 31 patients received CT in combination with RT. The majority

AITL, PTCL NOS). ALCL: anaplastic large cell lymphoma; AITL: angioimmunoblastic T-cell lymphoma; PTCL: peripheral T-cell lymphoma; NOS: not otherwise

CT: chemotherapy; CMT: combined-modality therapy; RT: radiotherapy; ALK: anaplastic lymphoma kinase; NOS: not otherwise specified; N: number; ALCL: anaplastic large cell lymphoma; AITL: angioimmunoblastic T-cell lymphoma; PTCL: peripheral T-cell lymphoma.

Haematologica | 109 April 2024 1166
ARTICLE - Combined modality treatment for stage I(E) peripheral T-cell lymphoma F.O. Meeuwes et al.
Characteristics CT N=168 CMT N=163 RT N=102 Other treatment N=48 No treatment N=95 N % N % N % N % N % Male sex 101 60 92 56 58 57 26 54 55 58 Period of diagnosis 1989-1999 2000-2020 74 94 44 56 42 121 26 74 74 28 73 27 28 20 58 42 38 57 40 60 Age in years at diagnosis Median age (range) 58 (18-86) 55 (19-87) 67 (19-91) 64 (18-93) 67 (31-99) ≤60 >60 90 78 54 46 97 66 60 40 32 70 31 69 20 28 42 58 41 54 43 57 ALCL subtype ALK+ ALKALK NOS 77 12 17 48 45 16 22 62 84 18 18 48 52 21 21 57 19 0 2 17 19 0 11 89 6 0 2 4 13 0 33 67 19 1 9 9 20 5 47 47 PTCL NOS 81 48 73 45 79 77 40 83 70 74 AITL 10 6 6 4 4 4 2 4 6 6 Localization Nodal Extranodal 132 35 79 21 121 42 74 26 57 45 56 44 29 19 60 40 61 34 64 36
Figure 2. Treatment modalities according to period of diagnosis for patients with a stage I(E) peripheral T-cell lymphoma (ALCL, specified. Table 1. Baseline characteristics of patients with stage I(E) ALCL, PTCL NOS and AITL diagnosed in 1989-2020 in the Netherlands, according to first-line treatment modality.

(29/31, 94%) of patients treated with CMT received 2-4 cycles of CHO(E)P. Of the 25 patients with CHO(E)P (of whom 5 with SCT), 76% (n=19) received ≥6 cycles.

Outcome

Overall, the 5-year OS of stage I(E) PTCL was 59%. The 5-year OS estimates for ALCL, PTCL NOS and AITL were 68% (median OS 88 months), 55% (median OS 67 months) and 52% (median OS 44 months), respectively (P=0.03; Figure 3A). For patients with ALCL ALK+, 5-year OS was 80% as compared to 68% for patients with ALCL ALK- (Online Supplementary Figure S3; P=0.28). For patients with ALCL, PTCL NOS and AITL, 5-year OS was significantly higher when treated with CMT (72%) as compared to either chemotherapy or radiotherapy alone (55% 5-year OS for both; P<0.01; Figure 3B). There was no significant difference in the 5-year OS for stage I(E) PTCL over time, e.g., 56% in 1989-1999 and 62% in 2000-2020 (P=0.15).

For the whole cohort, uni- and multivariable analyses were performed (Online Supplementary Table S1). In multivariable analyses, age had a negative impact on outcome (per year increment, HR=1.06, 95% CI: 1.05-1.07) as well as male sex (HR=1.54, 95% CI: 1.24-1.91). Treatment with CT or no treatment were associated with a higher risk of mortality compared to CMT (HR=1.64, 95% CI: 1.211-2.21, and HR=1.55, 95% CI: 1.10-2.17, respectively; Figure 4; Online Supplementary Table S1).

Response and 2-year PFS were calculated for the 55 patients treated in 2014-2019. In this subpopulation, 50 patients received CT and five patients RT only. Of the patients with CT, 17 (34%) received CT only, 29 (58%) with RT (CMT), and four (8%) with SCT. Regarding best response, three patients with CT only had refractory disease, one patient early progression. Refractory disease or early progression was not

observed in patients treated with CMT or RT. Two-year PFS was 67% for patients with CT, and 79% for patients with CMT (Online Supplementary Figure S4; P=0.33).

Discussion

In this nationwide population-based study, we show that 18% of patients with PTCL present with stage I(E) disease. Although the outcome of stage I(E) patients with ALCL, AITL and PTCL-NOS compares favorably to historical outcomes in patients with stage II-IV, the 5-year OS of 59% remains unsatisfactory.

The reported incidence of patients with PTCL presenting with limited-stage PTCL (stage I and II) varies between 23% and 48%.3,6,20,21 The incidence of stage I(E) disease is reported to be 9.5-11%.15,22 The incidence of stage I(E) PTCL in this cohort as compared to advanced-stage disease varies per subtype, i.e., patients with AITL rarely have limited-stage disease, which is in line with previous studies.23,24 There has been a remarkable shift in diagnoses between the two time periods from predominantly PTCL NOS to a more or less equal divide between PTCL NOS and ALCL. This might be due to better understanding of the disease and therefore more accurate diagnostic classifications like immunohistochemical stainings for better discrimination between the different PTCL subtypes or reflect the actual higher percentage of patients with ALCL presenting with limited-stage disease. Furthermore, the increased use of positron-emission tomography for the staging of aggressive lymphoma helps to more accurately distinguish those patients that truly have stage I(E) disease from those that have low volume advanced-stage disease that might be missed when using the less accurate method of computed

Haematologica | 109 April 2024 1167 ARTICLE - Combined modality treatment for stage I(E) peripheral T-cell lymphoma F.O. Meeuwes et al.
A B
Figure 3. Overall survival among patients with stage I(E) peripheral T-cell lymphoma. (A) Overall survival is presented according to subtype and (B) overall survival is presented according to treatment modality. ALCL: anaplastic large cell lymphoma; AITL: angioimmunoblastic T-cell lymphoma; PTCL: peripheral T-cell lymphoma; NOS: not otherwise specified; CMT: combined-modality therapy; CT: chemotherapy; RT: radiotherapy.

tomography-scanning.

Optimal treatment of patients with limited-stage PTCL remains unknown. Patients with stage II disease can present with quite a variable disease burden and in the Netherlands are generally treated with full course chemotherapy.18 In parallel with the implementation of CMT in patients with limited-stage aggressive B-cell lymphoma, there was an increase in the administration of CMT for stage I(E) PTCL patients, i.e., from 15% to 40% in the most recent time period. While SCT has been widely adopted in patients with advanced-stage PTCL, it was only offered in 2% of stage I(E) patients.

The favorable 5-year OS of patients with stage I(E) PTCL in the current study, as compared to advanced-stage disease previously reported by our group, confirms the results of the Nordic Lymphoma Epidemiology Group that reported on patients with limited-stage (I-II) AITL, ALCL and PTCL NOS (n=239) and found a similar 5-year OS (58%, including stage II patients) compared to 28% for patients with advanced-stage disease in the same time period.8,15 It is unclear whether there was a difference in outcome between stage I and II patients. One might expect a better outcome in our cohort since it only reports on patients with stage I disease, however the Nordic Lymphoma Epidemiology Group only included patients that were treated with at least one cycle of CHOP-like therapy whereas we included all patients with stage I(E) disease. In the Netherlands, CMT is preserved for stage I PTCL patients, whereas in other countries CMT is also offered to patients with stage II disease. In our study, outcome among patients with stage I(E) disease who received CMT was similar as compared to outcomes reported in two retrospective registry studies among patients with limited-stage PTCL comparing CMT with CT.16,17 In these studies, the effect of CMT versus CT on outcome was not reported separately for stage I and stage

Figure 4. Forest plot of multivariable analysis for overall survival among patients with stage I(E) peripheral T-cell lymphoma. HR: hazard ratio; CI: confidence interval; CMT: combined modality therapy; CT: chemotherapy; RT: radiotherapy.

II disease. Therefore, it cannot be ruled out that only in case of stage I disease and not stage II disease, CMT is associated with an improved survival as compared to CT.

Finally, since outcomes are improved in limited-stage aggressive B-cell lymphomas when treated with CMT, we anticipated that, once the use of CMT as a treatment strategy increased, this might lead to improved OS in PTCL patients. While the use of CMT is on the rise, the majority of patients are still treated differently and, therefore the impact of the increase in the use of CMT is not sufficient to have a statistically significant impact on outcome for the whole cohort. In recent years, many new drugs - alemtuzumab, brentuximab vedotin, romidepsin, amongst others - were studied in the first-line treatment of PTCL and most of them failed to show an improvement in outcome.9,25,26 Brentuximab vedotin (BV) was the only positive exception. In the ECHELON-2 study, BV-CHP was superior over CHOP.9 The study population mainly consisted of ALCL patients; only a small number of patients had AITL or PTCL NOS. In a subgroup analysis, in both limited-stage and advanced-stage disease the risk of mortality for patients treated with BV-CHP versus CHOP was similar. Recently, no benefit in ORR, PFS or OS was observed in a randomized clinical trial comparing CHOP to CHOP with romidepsin (Ro-CHOP) in PTCL. Separate results for stage I disease patients (3.8%) were not available in that study.26 In a phase II study, the impact of oral azaciditine added to CHOP was studied as first-line treatment option among 21 patients with PTCL, showing an ORR of 85%. However, only two patients had limited-stage disease.27 Despite the favorable outcome of limited-stage PTCL as compared to advanced-stage disease, these patients should not be overlooked when conducting clinical trials.

The main strength of our study includes the use of a nationwide population-based cancer registry with comprehensive

Haematologica | 109 April 2024 1168 ARTICLE - Combined modality treatment for stage I(E) peripheral T-cell lymphoma F.O. Meeuwes et al.

data available on first-line treatment in a homogeneous patient population. Limitations of our study include selection bias, as we do not know the motivation of the treating physician to choose a certain treatment modality, lack of information on comorbidities, potential misclassification of subtypes of PTCL, and the lack of information on the dose of radiotherapy. Furthermore, detailed information on tumor, treatment characteristics as well as response and progression-free survival were available from 2014 onward. Despite these limitations, cancer registries remain the standard for cancer surveillance activities and for population-based analysis of treatment outcomes and with little data being available on this subject, let alone prospective studies, these data are highly valuable.

Conclusion

For stage I(E) ALCL, AITL and PTCL NOS, 5-year OS is 59%. This compares favorably to the reported outcomes in advanced-stage disease. Superior outcome estimates were observed in patients treated with CMT.

References

1. Swerdlow SH, Campo E, Harris NL, et al. WHO Classification of Tumours of Haematopoietic and Lymphoid Tissues. Lyon: International Agency for Research on Cancer. 2017.

2. Stewart BW, Wild CP. World Cancer Report 2014. Lyon, France: International Agency for Research on Cancer IARC Press. 2014;482-491.

3. Ellin F, Landström J, Jerkeman M, Relander T. Real-world data on prognostic factors and treatment in peripheral T-cell lymphomas: a study from the Swedish Lymphoma Registry. Blood. 2014;124(10):1570-1577.

4 Vose J, Armitage J, Weisenburger D. International peripheral T-cell and natural killer/T-cell lymphoma study: pathology findings and clinical outcomes. J Clin Oncol. 2008;26(25):4124-4130.

5. Foss FM, Horwitz SM, Civallero M, et al. Incidence and outcomes of rare T cell lymphomas from the T Cell Project: hepatosplenic, enteropathy associated and peripheral gamma delta T cell lymphomas. Am J Hematol. 2020; 95(2):151-155.

6. Petrich AM, Helenowski IB, Bryan LJ, Rozell SA, Galamaga R, Nabhan C. Factors predicting survival in peripheral T-cell lymphoma in the USA: a population-based analysis of 8802 patients in the modern era. Br J Haematol. 2014;168(5):708.

7 Cederleuf H, Hjort Jakobsen L, Ellin F, et al. Outcome of peripheral T-cell lymphoma in first complete remission: a Danish-Swedish population-based study. Leuk Lymphoma. 2017;58(12):2815.

8. Brink M, Meeuwes FO, Van der Poel MWM, et al. Impact of etoposide and ASCT on survival among patients aged <65 years with stage II to IV PTCL: a population-based cohort study. Blood. 2022;140(9):1009-1019.

9. Horwitz S, O’Connor OA, Pro B, et al. Brentuximab vedotin with chemotherapy for CD30-positive peripheral T-cell lymphoma (ECHELON-2): a global, double-blind, randomised phase 3 trial. Lancet. 2019;393(10168):229-240.

10 Pfreundschuh M, Trümper L, Kloess M, et al. Two-weekly or

Disclosures

No conflicts of interest to disclose.

Contributions

MN and MB designed the study. MB collected the data. MB, MN and FM analyzed the data. FM, MB and MN wrote the paper. All authors revised the manuscript and accepted its final version.

Acknowledgements

The authors would like to thank the registrars of the Netherlands Cancer Registry (NCR) for their dedicated data collection. The nationwide population-based NCR is maintained and hosted by the Netherlands Comprehensive Cancer Organization (IKNL).

Data-sharing statement

No data sharing other than in the form of this manuscript is possible due to laws and regulations.

3-weekly CHOP chemotherapy with or without etoposide for the treatment of elderly patients with aggressive lymphomas: results of the NHL-B2 trial of the DSHNHL. Blood. 2004;104(3):634-641.

11. Schmitz N, Trümper L, Ziepert M, et al. Treatment and prognosis of mature T-cell and NK-cell lymphoma: an analysis of patients with T-cell lymphoma treated in studies of the German High-Grade Non-Hodgkin Lymphoma Study Group. Blood. 2010;116(18):3418-3425.

12. Reimer P, Rüdiger T, Geissinger E, et al. Autologous stem-cell transplantation as first-line therapy in peripheral T-cell lymphomas: results of a prospective multicenter study. J Clin Oncol. 2009;27(1):106-113.

13. Park SI, Horwitz SM, Foss FM, et al. The role of autologous stem cell transplantation in patients with nodal peripheral T-cell lymphomas in first complete remission: report from COMPLETE, a prospective, multicenter cohort study. Cancer. 2019;125(9):1507-1517.

14. Fossard G, Broussais F, Coelho I, et al. Role of up-front autologous stem-cell transplantation in peripheral T-cell lymphoma for patients in response after induction: an analysis of patients from LYSA centers. Ann Oncol. 2018;29(3):715-723.

15. Ludvigsen Al-Mashhadi A, Cederleuf H, Kuhr Jensen R, et al. Outcome of limited-stage peripheral T-cell lymphoma after CHOP(-like) therapy: a population based study of 239 patients from the Nordic lymphoma epidemiology group. Am J Hematol. 2023;98(3):388-397.

16. Chen Z, Huang H, Li X, et al. Chemotherapy plus radiotherapy versus chemotherapy alone for patients with peripheral T-cell lymphoma, not otherwise specified. Front Oncol. 2021;11:607145.

17. Rodríguez-López JL, Patel AK, Balasubramani GK, Glaser SM, Beriwal S, Vargo JA. Treatment selection and survival outcomes in early-stage peripheral T-cell lymphomas: does anaplastic lymphoma kinase mutation impact the benefit of consolidative radiotherapy? Leuk Lymphoma. 2021;62(3):538-548.

Haematologica | 109 April 2024 1169 ARTICLE - Combined modality treatment for stage I(E) peripheral T-cell lymphoma F.O. Meeuwes et al.

18. Miller TP, Dahlberg S, Cassady JR, et al. Chemotherapy alone compared with chemotherapy plus radiotherapy for localized intermediate- and high-grade non-Hodgkin’s lymphoma. N Engl J Med. 1998;339(1):21-26.

19 Schouten LJ, Höppener P, van den Brandt PA, Knottnerus JA, Jager JJ. Completeness of cancer registration in Limburg, The Netherlands. Int J Epidemiol. 1993;22(3):369-376.

20 Rodriguez-Pinilla SM, Domingo-Domenech E, Climent F, et al. Clinical and pathological characteristics of peripheral T-cell lymphomas in a Spanish population: a retrospective study. Br J Haematol 2021;192(1):82-99.

21. Savage KJ, Chhanabhai M, Gascoyne RD, Connors JM. Characterization of peripheral T-cell lymphomas in a single North American institution by the WHO classification. Ann Oncol. 2004;15(10):1467-1475.

22. Carson KR, Horwitz SM, Pinter-Brown LC, et al. A prospective cohort study of patients with peripheral T-cell lymphoma in the United States. Cancer. 2017;123(7):1174.

23. Kameoka Y, Takahashi N, Itou S, et al. Analysis of clinical

characteristics and prognostic factors for angioimmunoblastic T-cell lymphoma. Int J Hematol. 2015;101(6):536-542.

24. De Leval L, Parrens M, Le Bras F, et al. Angioimmunoblastic T-cell lymphoma is the most common T-cell lymphoma in two distinct French information data sets. Haematologica. 2015;100(9):e361-364.

25. Wulf GG, Altmann B, Ziepert M, et al. Alemtuzumab plus CHOP versus CHOP in elderly patients with peripheral T-cell lymphoma: the DSHNHL2006-1B/ACT-2 trial. Leukemia. 2021;35(1):143-155.

26. Bachy E, Camus V, Thieblemont C, et al. Romidepsin plus CHOP versus CHOP in patients with previously untreated peripheral T-cell lymphoma: results of the Ro-CHOP phase III study (conducted by LYSA). J Clin Oncol. 2021;40(3):242-251.

27. Ruan J, Moskowitz AJ, Metha-Shah N, et al. High rates of remission with the initial treatment of oral azacitidine plus CHOP for peripheral T-cell lymphoma (PTCL): clinical outcomes and biomarker analysis of a multi-center phase II study. Blood. 2021;138(Suppl 1):138.

Haematologica | 109 April 2024 1170 ARTICLE - Combined modality treatment for stage I(E) peripheral T-cell lymphoma F.O. Meeuwes et al.

MYC protein is a high-risk factor in mantle cell lymphoma and identifies cases beyond morphology, proliferation and TP53/p53 – a Nordic Lymphoma Group study

Joana M. Rodrigues,1 Peter Hollander,2 Lina Schmidt,1 Eirinaios Gkika,1 Masoud Razmara,3 Darshan Kumar,4 Christian Geisler,5 Kirsten Grønbæk,5-7 Christian W. Eskelund,5,6 Riikka Räty,8 Arne Kolstad,9 Christer Sundström,10 Ingrid Glimelius,10 Anna Porwit,11 Mats Jerkeman11 and Sara Ek1

1Department of Immunotechnology, Lund University, Lund, Sweden; 2Cancer Immunotherapy, Department of Immunology, Genetics and Pathology, Uppsala University, Uppsala, Sweden; 3Department of Clinical Pathology, Akademiska University Hospital, Uppsala, Sweden; 4Aiforia Technologies Plc, Helsinki, Finland; 5Department of Hematology, Rigshospitalet, Copenhagen, Denmark; 6Biotech Research and Innovation Center (BRIC), University of Copenhagen, Copenhagen, Denmark; 7Department of Clinical Medicine, Faculty of Health Science, University of Copenhagen, Copenhagen, Denmark; 8Department of Hematology, Helsinki University Hospital, Helsinki, Finland; 9Department of Oncology, Innlandet Hospital Trust, Division Gjøvik-Lillehammer, Gjøvik, Norway; 10Department of Immunology, Genetics and Pathology, Cancer Precision Medicine, Uppsala University, Uppsala, Sweden and 11Division of Oncology, Department of Clinical Sciences, Lund University, Lund, Sweden

Abstract

Correspondence: S. Ek sara.ek@immun.lth.se

Received: April 14, 2023.

Accepted: August 21, 2023.

Early view: August 31, 2023.

https://doi.org/10.3324/haematol.2023.283352

©2024 Ferrata Storti Foundation

Published under a CC BY-NC license

The transcription factor MYC is a well-described oncogene with an important role in lymphomagenesis, but its significance for clinical outcome in mantle cell lymphoma (MCL) remains to be determined. We performed an investigation of the expression of MYC protein in a cohort of 251 MCL patients complemented by analyses of structural aberrations and mRNA, in a sub-cohort of patients. Fourteen percent (n=35) of patients showed high MYC protein expression with >20% positive cells (MYChigh), among whom only one translocation was identified, and 86% (n=216) of patients showed low MYC protein expression. Low copy number gains of MYC were detected in ten patients, but with no correlation to MYC protein levels. However, MYC mRNA levels correlated significantly to MYC protein levels with a R2 value of 0.76. Patients with a MYChigh tumor had both an independent inferior overall survival and an inferior progression-free survival (hazard ratio [HR]=2.03, 95% confidence interval [95% CI]: 1.2-3.4 and HR=2.2, 95% CI: 1.04-4.6, respectively) when adjusted for additional high-risk features. Patients with MYChigh tumors also tended to have additional high-risk features and to be older at diagnosis. A subgroup of 13 patients had concomitant MYChigh expression and TP53/p53 alterations and a substantially increased risk of progression (HR=16.9, 95% CI: 7.4-38.3) and death (HR=7.8, 95% CI: 4.4-14.1) with an average overall survival of only 0.9 years. In summary, we found that at diagnosis a subset of MCL patients (14%) overexpressed MYC protein, and had a poor prognosis but that MYC rearrangements were rare. Tumors with concurrent MYC overexpression and TP53/p53 alterations pinpointed MCL patients with a dismal prognosis with a median overall survival of less than 3 years. We propose that MYC needs to be assessed beyond the current high-risk factors in MCL in order to identify cases in need of alternative treatment.

Introduction

MYC is a pleiotropic transcription factor that regulates 10-15% of the genome and can simultaneously affect protein-coding genes and non-coding RNA products.1,2 It is involved in a plethora of essential cellular mechanisms, such as cell growth, metabolism and protein synthesis, cell adhesion, apoptosis, cell cycle, and angiogenesis.1-3 MYC is an important factor in B-cell proliferation known

to be involved in lymphomagenesis,3 and its deregulation is frequently associated with worse outcome.2-4 Translocations involving MYC and immunoglobulin genes are described in other B-cell lymphomas, particularly Burkitt and double-hit lymphomas, and are associated with aggressive behavior of the malignancy.2 Overexpression of MYC without genetic rearrangements also has a negative impact on outcome in B-cell lymphomas in general.5 In mantle cell lymphoma (MCL), mutations of MYC have been shown to

Haematologica | 109 April 2024 1171 - Non-Hodgkin Lymphoma ARTICLE

occur in around 20% of cases,6 and MYC-regulated pathways are often affected by genetic alterations in subsets of disease.7 Cytogenetic investigations of MYC were recently recommended as part of clinical routine but are not yet clinically implemented in most hospitals.8 The frequency of translocations involving MYC is reportedly low9-11 and most reports have been case studies describing translocations that juxtapose MYC and CCND1 12-15 In general, consensus on the degree of MYC deregulation in MCL is lacking. Here, we aim to describe the frequency of protein expression, mRNA, translocations, and amplifications of MYC in primary MCL and relate the findings to clinicopathological parameters and outcome.

MCL is a disease with a heterogeneous clinical behavior characterized by the chromosomal t(11;14)(q13;q32) that juxtaposes CCND1 to immunoglobulin genes, leading to constitutive cyclin D1 overexpression.16 An established prognostic tool, the MCL International Prognostic Index (MIPI), integrates information on age, performance status, lactate dehydrogenase levels and white blood cell count and stratifies patients into high, intermediate and low risk.17 Additional biological risk factors include TP53 mutations and/ or p53 overexpression, high proliferation, and non-classic morphology.16 Despite recent improvements in treatment,18 MCL patients often have a poor prognosis and frequently relapse.19 Thus, identification and improved understanding of alterations in MCL lymphomagenesis, beyond the already established risk factors, are critical in order to be able to individualize therapeutic decision-making.

To date, a limited number of studies have focused on MYC in MCL. In 2017, Hu et al. showed that MYC rearrangements were present in less than 1.0% of MCL cases at diagnosis, with these cases having a median overall survival (OS) of 31.3 months.20 When compared with other subtypes of lymphoma, MCL tumors seem to have a lower frequency of structural alterations involving MYC. 21 Nonetheless, in an evaluation of 88 patients, Wang et al. described 27 with tumors with MYC rearrangements and 21 with extra copies of MYC. Both subgroups of patients showed a lower OS when compared to cases with no MYC aberrations.22 However, the study by Wang et al., and other investigations reporting MYC translocations, were selected cohorts enriched for structural alterations involving MYC 9,20,23 An extensive study evaluating 1,214 lymphomas, including 138 cases of MCL, did not find any MYC rearrangements in MCL cases and only 2% had MYC protein overexpression >26%.11 Overall, MYC aberrations in MCL have been associated with a worse prognosis,10,23,24 non-classic morphology20,21,23,24 and, reportedly, enrichment for p53 overexpression among MYC-overexpressing tumors,24-26 but their additive role in MCL prognosis and clinical characteristics has not been determined. A study in diffuse large B-cell lymphoma showed that tumors with dual MYC/TP53 alterations had distinct clinicopathological characteristics with worse survival compared to wild-type cases.27

In the current study, we investigated the frequency of each molecular layer of MYC deregulation in primary diagnostic samples from a cohort of MCL patients and identified its association with both clinical and molecular high-risk factors.

Methods

Patients’ material

Two hundred and fifty-two MCL patients were included in this study, and 154 patients were part of a population-based cohort that comprised patients registered in the Swedish Lymphoma Register (SLR) and diagnosed in Uppsala and Southern Sweden between 2000-2017. The additional 98 samples were derived from patients enrolled in the Nordic Lymphoma Group clinical trials MCL2 and MCL3 (N-MCL2/3) (Online Supplementary Figure S1). The N-MCL2 trial was registered with ISRCTN.com ID ISRCTN87866680; the N-MCL3 trial was registered with ClinicalTrials.gov ID NCT00514475. Further details are provided in the Online Supplementary Materials and Methods

This study was approved by the Ethical Regional Committee in Lund (Dnr 2011/593) for part of the SLR cohort (BLISS) and by the Ethical Regional Committee in Uppsala for the N-MCL2/3 samples (Dnr 2009/428) and for part of the SLR cohort (U-CAN) (Dnr 2014/233).

Immunohistochemistry

The patients’ tissue microarrays were stained with anti-MYC antibody (clone Y69 1:50, Abcam; Cambridge, UK), as used in the clinical setting and in previous publications.10,24 Tissue samples were considered to overexpress MYC when the percentage of cells with a dark brown nucleus was ≥20%, in agreement with published data.24 Details about the immunohistochemistry investigaions are provided in the Online Supplementary Materials and Methods.

Fluorescent in-situ hybridization

Fluorescent in-situ hybridization (FISH) was performed on 4 µm tissue sections using split-signal DNA probes for MYC with Vysis MYC Break Apart FISH Probe (Abbott Laboratories; Green Oaks, IL, USA) according to instructions from the manufacturer. An Olympus BX-51 microscope (Prior Lumen200 light source) and GenASIs Capture and Analysis Platform software (Applied Spectral Imaging; Carlsbad, CA, USA) were used to capture digital images of tumor areas. Cases without representative tumor material or with no representative signals were excluded. Positive FISH results on tissue microarrays were validated by evaluating whole-tissue sections.

mRNA in situ hybridization

MYC mRNA was evaluated in 85 fresh-frozen, paraffin-embedded samples from the SLR cohort with the RNAscope® assay (Advanced Cell Diagnostics; Newark, CA, USA) following the manufacturer’s instructions. The H-score was calculated

Haematologica | 109 April 2024 1172 ARTICLE - MYC is a high-risk factor in mantle cell lymphoma J.M. Rodrigues et al.

for each sample, and was defined as the dynamic range of MYC expression based on the quantification of the probe signal on a cell-by-cell level. The workflow is described in detail in the Online Supplementary Materials and Methods.

Multiplexed immunofluorescence staining

Tissue microarray slides were stained with anti-CD20 (11.9 µg/mL, clone IGEL/773, Novus Biologicals, Littleton, CO, USA), anti-CD3 (2 µg/mL, clone UM500048CF, OriGene; Rockville, MD, USA) conjugated with AlexaFluor 532 antibody labeling kit (Thermo Fisher Scientific, Waltham, MA, USA), anti-CD163 (1.25 µg/mL, clone EPR14643-36, Abcam; Cambridge, UK) conjugated with AlexaFluor 647 antibody labeling kit (Thermo Fisher Scientific), and Syto13 (500 nM, Nanostring, Seattle, WA, USA).

A software for deep learning artificial intelligence, Aiforia Create Version 5.3 (Aiforia Technologies Plc, Helsinki, Finland), was used for image analyses as further described in the Online Supplementary Materials and Methods

Statistical analysis

A χ2 test, t test or Wilcoxon signed-rank test was used to

evaluate differences between groups. The Pearson correlation coefficient was applied to test correlations between continuous variables. The outcome variables considered in the study were OS and PFS. Maximally selected rank statistics (Max Rank) in R28 was used to determine a cutoff for MYC. Differences were considered statistically significant when the P value was <0.05. A detailed description of the statistical analysis is provided in the Online Supplementary Materials and Methods.

Results

Patients’ clinicopathological characteristics

A total of 252 patients were included in this study (Table 1), with 98 patients belonging to the N-MCL2/3 clinical trials and 154 patients being part of the SLR cohort. Male patients were predominant (75%) and the median age at diagnosis was 63 years. Patients were evenly distributed among the different MIPI risk groups, but this information was only available for 196 of the 252 patients. Thirty-one percent (76/242) of the patients had highly proliferative tumors

p53

TP53/p53, N (%)

Percentages might not add up to 100 due to rounding. *Missing information for only one of the variables studied. **Progression-free survival information was only available for 198 patients. N: number; MIPI: Mantle Cell Lymphoma Prognostic Index; WBC: white blood cell; LDH: lactate dehydrogenase; ULN: upper limit of normal; ECOG: Eastern Cooperative Oncology Group; N-MCL2/3: Nordic-Mantle Cell Lymphoma 2/3 clinical trials; R-CHOP: rituximab, cyclophosphamide, doxorubicin, vincristine, prednisone; OS: overall survival; PFS: progression-free survival.

Haematologica | 109 April 2024 1173 ARTICLE - MYC is a high-risk factor in mantle cell lymphoma J.M. Rodrigues et al.
Characteristic Full set Patients, N (%) 252 (100) Sex, N (%) Male Female 188 (75) 64 (25) Age at diagnosis, N (%) ≤65 years >65 years 137 (55) 115 (45) MIPI risk group, N (%) Low risk Medium risk High risk Missing 76 (39) 62 (31) 59 (30) 56 WBC x109/L, median (range) 7.8 (2.6-520) LDH >ULN, median (range) 2.2 (0.5-13) ECOG performance status, N (%) 0 1 2-4 Missing 125 (63) 62 (31) 13 (7) 52 Morphology, N (%) Classic Blastoid/pleomorphic Missing 204 (84) 38 (16) 10 Ki67 index, N (%) <30 ≥30 Missing 166 (69) 76 (31) 10 MYC expression, N (%) <20% ≥20% Missing 216 (86) 35 (14) 1
Table 1. Clinicopathological characteristics of the patients included in this study.
Characteristic Full set TP53, N (%) Wildtype Mutated Missing 95 (80) 24 (20) 133
expression,
<30% ≥30% Missing 211 (88) 29 (12) 12
N (%)
Wildtype/<30%
Mutated/≥30% expression Missing* 207 (86) 35 (14) 10
N-MCL2/3
R-CHOP Rituximab-bendamustine Chlorambucil Others Missing 134 (72) 3 (2) 39 (21) 5 (3) 6 (3) 65 OS in years, median 6.2 PFS in years, median, 4.8**
expression
Treatment, N (%)
protocols

(Ki67 >30%) and 16% (38/242) had non-classic morphology. A subgroup of patients had tumors with high expression of p53 (12%, 29/240) and/or TP53 mutations (20%, 24/119). Thus, 35/242 cases had either high p53 protein expression or a TP53 mutation. The discrepancy in frequency between the p53 and TP53 evaluation is mostly due to the lower number of samples sequenced, restricted by the availability of high-quality material. Overall, patients had a median OS of 6.2 years and a median PFS of 4.8 years. Of note, OS information was available for all patients included, whereas PFS was calculated based on 200 patients. The patients’ clinicopathological characteristics, divided by cohort, can be found in Online Supplementary Table S1

MYC overexpression

Based on previous studies in which MYC expression was assessed in a cohort of 65 cases of MCL,24 a cutoff of 20% was used to define patients with MYC protein overexpression (MYChigh). Immunohistochemistry was used to determine MYC protein expression. The mean expression was 13.1% (range, 0.14-82.9%) and the median expression was 8.7%. Max Rank statistics showed that OS outcome differences were maximized when groups were dichotomized with a cutoff at 21.4%, supporting the applicability of the 20% cutoff used to define MYC overexpression.24

Using the 20% cutoff, MYC was overexpressed in 14% of all tumor samples studied (35/252) (Table 1). Online Supplementary Figure S2 shows representative immunohistochemistry staining for MYC.

MYC mRNA and immunohistochemistry results are concordant

To evaluate MYC mRNA expression levels, we performed RNAscope®; representative images of the staining are shown in Online Supplementary Figure S3. An H-score for MYC

mRNA expression was calculated, which showed a strong correlation (Pearson) to the frequency of positive cells detected by immunohistochemistry (Online Supplementary Figures S4 and S5) with a R2 value of 0.76 (P<0.001), in the same range as previously reported for MCL.10 Information about the cohort used for RNAscope® can be found in Online Supplementary Table S2

MYChigh is associated with poor outcome

Outcome in patients with MYChigh tumors was inferior compared to that of patients with MYClow tumors (Figure 1). Patients with MYChigh MCL had a median OS of 2.2 years and PFS of 1.8 years, whereas patients with MYClow tumors had a median OS of 7.3 years and PFS of 5.2 years. In concordance, patients with MYChigh tumors also had a significantly higher risk of death (hazard ratio [HR]=2.34, 95% confidence interval [955 CI]: 1.55-3.57) and disease progression (HR=1.73, 95% CI: 1.05-2.86) compared to patients with MYClow tumors. The frequency of MYC-positive cells was also significantly associated with poor outcome as a continuous variable, for both OS and PFS. However, per increased percentage of MYC-positive cells, the risk of death or progression only increased by 3% and 4%, respectively (Table 2). Likewise, for MYC mRNA (as a continuous value), a higher H-score was associated with inferior survival and shorter progression-free survival, albeit with a low hazard ratio per H-score unit increase (Table 2). MYC protein measurements violated the proportional hazards assumption, showing a greater impact on short-term survival (Online Supplementary Figure S6). Of the cases classified as MYChigh, 57% died and 62% progressed within the first 3 years (Figure 1). In a follow-up of 3 years, the proportional hazards assumption for PFS was not violated and a negative impact on survival could be observed (Online Supplementary Table S3). Similar trends were seen when evaluating the effect of MYChigh and MYC frequency

Haematologica | 109 April 2024 1174 ARTICLE - MYC is a high-risk factor in mantle cell lymphoma J.M. Rodrigues et al.
A B
Figure 1. Patients with tumors with MYChigh protein overexpression have a worse outcome than patients with MYClow tumors. (A, B) Prognostic impact of MYC protein expression on overall survival (A) and progression-free survival (B). Samples (N=252) were categorized based on total percentage of MYC-expressing cells, with a cutoff of 20%. Kaplan-Meier estimates were calculated and are shown. Log-rank statistics were used to evaluate the statistical significance. PFS: progression-free survival.

as a continuous value on outcome for the different cohorts separately (Online Supplementary Figure S7, Online Supplementary Table S4 ). However, in the SLR cohort, MYChigh was not statistically prognostic for PFS, probably because of the heterogenous treatment protocols used in this population-based cohort. In the N-MCL2/3 cohort, only six patients were classified as MYChigh and the group reached statistical significance as predictor for PFS, but not OS (Online Supplementary Table S4).

To understand if there were consistent differences among MYChigh cases depending on whether they had an OS shorter or longer than 3 years, we compared the main clinicopathological parameters of these two groups of patients (Online Supplementary Table S5). The patients with an OS less than 3 years had additional high-risk factors, being in a high-risk MIPI group and the majority also with high proliferation and/ or TP53/p53 aberrations. Surprisingly, the male/female ratio showed a major difference, with only one out of nine female MYChigh patients surviving for more than 3 years.

MYChigh tumors remained associated with OS (HR=2.03, 95% CI: 1.22-3.40) and PFS (HR=2.20, 95% CI: 1.04-4.64) when adjusting for gender, age and established high-risk factors (Table 3). MYChigh was not significant when adjusting for MIPI group (Table 3). Of note, evaluation of MYC protein expression on prognosis in MCL remained significant only when considering patients with MIPI information (Online Supplementary Table S6). MYC as a continuous variable was not independent of high-risk factors (data not shown).

MYChigh is associated with high-risk factors

Patients with MYChigh tumors were enriched in other high-risk factors such as age, Ki-67 proliferation index, non-classic morphology, MIPI group and TP53/p53+ aberrations (Figure 2A, Table 4). Patients with MYChigh tumors were on average older at diagnosis (Figure 2B), with a median age at diagnosis of 70.7 years versus 63.6 years for patients with MYClow tumors. MYC protein overexpression (MYChigh) was found to be associated with the presence of TP53 mutations and/or p53 overexpression (hereon referred to as TP53/p53+ tumors, n=35). Dual alterations of MYC and TP53/p53+ (hereon referred to as MYChigh TP53/p53+) were detected in 13 out of 250 patients (Table 4). Tumors with alterations in TP53 had a higher median expression of MYC-positive cells compared

to wild-type tumors (P<0.001) (Figure 2C) and MYChigh TP53/ p53+ cases were more likely to have high proliferation, non-classic morphology and be in a high-risk MIPI group, similar to the MYChigh group (Table 4).

MYChigh TP53/p53+ tumors have a dismal prognosis

A total of 13 patients had tumors classified as MYChigh TP53/ p53+. These patients had a very short median survival (0.9 years) and a shorter median PFS (0.5 years) compared to patients who did not show concomitant alterations in these molecules. The majority died within 3 years of diagnosis (Figure 3A). This was significantly lower compared to either one of the individual high-risk groups (Figure 3B). All patients with PFS information available with MYChigh TP53/p53+ tumors progressed within 2 years (Figure 3C) and had a shorter time to progression than either of the patient groups presenting with only one of the individual risk factors (Figure 3D). Online Supplementary Figure S8 depicts the process for classification of tumors based on MYC and TP53/p53 status. Double aberrations conferred an increased risk of death (HR=7.83, 95% CI: 4.35-14.09) and disease progression (HR=16.87, 95% CI: 7.43-38.31) (Table 2). MYChigh TP53/p53+ aberrations remained prognostic, for both OS and PFS, when adjusting for additional high-risk factors (Table 5). Of note, prognostic analysis considering only TP53 mutation and MYChigh tumors remained significant for both OS and PFS (Online Supplementary Figure S9).

MYC protein expression is not correlated with genomic aberrations

To explore the hypothesis that MYC protein overexpression can be associated with genomic rearrangements of MYC, a total of 85 cases mounted in tissue microarrays were evaluated by FISH with a MYC break-a-part probe. Of those 85 patients, 70 (82%) showed no signs of genomic alterations of MYC. Among the remaining 15 cases, three showed copy gains in less than 20% of the evaluated cells, 11 showed copy gains in more than 20% of the evaluated cells and one case showed the presence of a translocation (Online Supplementary Figure S10).

To validate the FISH findings, whole tissue sections were used. Diagnostic tissue blocks from 14 out of the 15 patients were available for further evaluation (Online Supplementary

Haematologica | 109 April 2024 1175 ARTICLE - MYC is a high-risk factor in mantle cell lymphoma J.M. Rodrigues et al.
Overall survival Progression-free survival HR (95% CI) N P PH HR (95% CI) N P PH MYChigh Dichotomized (20% cutoff) 2.34 (1.55-3.57) 251 <0.001 <0.05 1.73 (1.05-2.86) 199 <0.001 <0.05 % MYC positive cells Continuous 1.03 (1.02-1.04) 251 <0.001 <0.05 1.04 (1.00-1.05) 199 <0.001 <0.05 MYC H-score Continuous 1.01 (1.01-1.02) 85 <0.001 <0.05 1.01 (1.004-1.02) 51 <0.001 <0.05 MYChigh TP53/p53+ Categorical 7.83 (4.35-14.09) 250 <0.001 >0.05 16.9 (7.43-38.31) 198 <0.001 >0.05
Table 2. Univariable Cox proportional hazards models results. HR: hazard ratio; 95% CI: 95% confidence interval; N: number; P: probability value; PH: proportional hazard.

*Progression-free survival analysis truncated at 3 years. HR: hazard ratio; 95% CI: 95% confidence interval; P: probability value; N: number; wt: wild-type; MIPI: Mantle Cell Lymphoma International Prognostic Index.

Percentages for some variables do not add up to 100% due to rounding. *A χ2 statistical test was performed to evaluate significant differences between patients with different levels of MYC expression or those double-positive for MYC and TP53/p53 and the clinicopathological characteristics. **A χ2 statistical test was performed with Yates continuity correction to adjust for small values. N: number; P: probability value; MIPI: Mantle Cell Lymphoma International Prognostic Index.

Haematologica | 109 April 2024 1176 ARTICLE - MYC is a high-risk factor in mantle cell lymphoma J.M. Rodrigues et al.
Variable Overall survival Progression-free survival* HR (95% CI) P N HR (95% CI) P N MYChigh vs. MYClow 2.03 (1.22-3.40) 0.007 229 2.20 (1.04-4.64) 0.04 182 Age 1.08 (1.06-1.10) <0.001 229 1.08 (1.05-1.12) <0.001 182 Non-classic vs. classic morphology 1.14 (0.65-2.00) 0.65 229 1.20 (0.59-2.40) 0.62 182 High Ki-67 (>30%) vs. low (<30%) 1.52 (0.97-2.37) 0.07 229 2.79 (1.48-5.26) 0.002 182 Female vs. male 1.08 (0.72-1.61) 0.72 229 1.12 (0.61-2.05) 0.71 182 p53 overexpression vs. wt p53 expression 2.52 (1.52-4.19) <0.001 229 4.97 (2.57-9.63) <0.001 182 MYChigh vs. MYClow 1.34 (0.69-2.61) 0.38 179 1.64 (0.78-3.47) 0.20 176 MIPI risk group Intermediate High 2.17 (1.21-3.88) 8.57 (4.87-15.1) 0.009 <0.001 179 2.16 (0.95-4.90) 6.90 (3.25-14.64) 0.07 <0.001 176 Non-classic vs. classic morphology 1.26 (0.70-2.28) 0.44 179 0.99 (0.50-1.95) 0.98 176 High Ki-67 (>30%) vs. low (<30%) 1.16 (0.70-1.93) 0.57 179 2.56 (1.37-4.79) 0.003 176 Female vs. male 1.28 (0.80-2.04) 0.30 179 1.14 (0.69-2.10) 0.67 176 p53 overexpression vs. wt p53 expression 1.85 (1.05-3.26) 0.03 179 4.40 (2.32-8.35) <0.001 176
Table 3. MYC protein multivariable Cox proportional hazards models.
Characteristic MYChigh N (row %) MYClow N (row %) P* MYChigh TP53/p53+ N (row %) All others N (row %) P* Total N (%) 35 (14) 216 (86) 13 (5) 237 (95) Age ≤65 years >66 years 137 (54) 115 (46) 12 (34) 23 (66) 124 (57) 92 (43) 0.01 4 (31) 9 (69) 132 (56) 105 (44) 0.08 Sex Male Female 188 (75) 64 (25) 26 (74) 9 (26) 162 (75) 54 (25) 0.93 7 (54) 6 (46) 179 (76) 58 (24) 0.08 Ki-67 <30% ≥30% Missing 166 (69) 76 (31) 10 10 (32) 21 (68) 4 156 (74) 54 (26) 6 <0.001 3 (23) 10 (77) 0 163 (71) 66 (29) 8 <0.001** Morphology Classic Non-classic Missing 204 (84) 38 (16) 10 20 (65) 11 (35) 4 183 (87) 27 (23) 6 0.001 7 (54) 6 (46) 0 197 (86) 32 (14) 8 0.007** MIPI risk group Low Intermediate High Missing 76 (39) 61 (31) 59 (30) 56 1 (4) 9 (39) 13 (57) 12 75 (44) 52 (30) 45 (26) 44 <0.001 0 (0) 1 (12) 7 (88) 5 76 (41) 59 (32) 52 (28) 50 0.001** TP53/p53 Wild-type Mutated/overexpressed Missing 194 (85) 35 (15) 23 19 (59) 13 (41) 3 174 (89) 22 (11) 20 <0.001 - - -
Table 4. Differences in clinicopathological characteristics with a focus on established high-risk factors comparing MYChigh tumors with MYClow tumors and comparing MYChighTP53/p53+ tumors to all others.

Table S7). Results were consistent between tissue microarrays and full tissue sections. No correlation between copy number gains of MYC and protein overexpression was observed, as most of tumors with MYC copy number gains had a low frequency of cells expressing MYC protein (Online Supplementary Table S7). The presence of copy number gains was not associated with outcome (data not shown).

The single MYC-translocated MCL case had an OS of over 6 years, no other high-risk factors but a classic morphology, low Ki-67 expression, and was TP53/p53 wild-type. In line with the lack of genomic alterations, MYC showed genetic mutations in only one patient, determined by targeted sequencing of part of the SLR cohort as previously published.29 This MYC mutated case only had 4% of cells expressing MYC protein.

MYChigh tumors showed an increase in M2-like macrophage infiltration

In a recent study, we showed that the frequencies of T cells and M2 macrophages are prognostic in MCL30 and hypothesized that the composition of the microenvironment would be different in MYChigh and MYClow cases. T-cell and M2 macrophage frequencies were determined based on multiplexed immunofluorescence staining using machine learning (Aiforia software). The multiplexed immunofluo-

rescence staining included stains for CD3, CD163 and CD20. For a total of 117 patients, information was available for both multiplexed immunofluorescence and MYC status. T-cell infiltration, marked as CD3 positivity, ranged from 1.48% to 52.58% of total cells. The presence of CD163+ cells, as a surrogate marker for M2 macrophages, varied between 0.02% and 23.09% of total cells. The abundance of T cells and M2-like macrophages and the density of tumor cells in the tumor regions in MYChigh and MYClow cases were compared to assess the association with MYC status. MYChigh cases had a higher infiltration of CD163+ macrophages, whereas no difference was seen for T-cell infiltration or density of tumor cells (Online Supplementary Figure S11).

Discussion

The impact of MYC deregulation on outcome in MCL is consistently reported in the literature,10,22,23 but most studies include limited or selected cohorts. The present study of 252 MCL patients is, to the best of our knowledge, the largest study so far to evaluate clinical impact by exploring MYC protein expression and its association with clinicopathological features including established risk factors. The study is focused on the impact of MYC protein, and the

Haematologica | 109 April 2024 1177 ARTICLE - MYC is a high-risk factor in mantle cell lymphoma J.M. Rodrigues et al.
B
C
Figure 2. High-risk mantle cell lymphoma is enriched for MYChigh tumors. (A) Heatmap representing the distribution of patients with high and low MYC protein expression, TP53 mutation/p53 expression, morphology variant, proliferation (Ki-67) and age at diagnosis. (B) Association between age at diagnosis and MYChigh tumors. (C) Association between total percentage of MYC-positive cells and TP53/p53 status. Wilcoxon and t-test P values were used to evaluate statistical significance, and P values are shown. WT: wild-type; MIPI: Mantle cell lymphoma International Prognostic Index.
A

Figure 3. Patients with MYChighTP53/p53+ form a subgroup with adverse prognosis.

(A) Prognostic impact of MYChighTP53/p53+ versus all other states on overall survival. (B) Prognostic impact on overall survival for patients with tumors that were classified only as MYChigh, only TP53/p53+, both MYChighTP53/p53+ or wild-type for both markers. (C) Prognostic impact of MYChighTP53/p53+ versus all other patients on progression-free survival. (D) Prognostic impact on progression-free survival for patients with tumors that were classified only as MYChigh, only TP53/p53+, both MYChighTP53/p53+ or wild-type for both markers. Kaplan-Meier estimates were calculated and are shown. Log-rank statistics were used to evaluate the statistical significance of differences. WT: wild-type; PFS: progression-free survival.

Continued on following page.

Haematologica | 109 April 2024 1178 ARTICLE - MYC is a high-risk factor in mantle cell lymphoma J.M. Rodrigues et al. A C
B

HR: hazard ratio; 95% CI: 95% confidence interval; P: probability value; N: number.

association with gene amplifications, and rearrangements, and transcriptional activity.

Current literature on MYC in MCL has not reached a consensus on a cutoff for the definition of MYChigh.10,25,31,32 Previous studies used 10%, 20% or 26%,10,11,24 which hampers direct comparison of the impact of dichotomized groups. We applied a 20% cutoff based on the findings of a previous study on 65 MCL patients by Choe et al 24 To validate the applicability of the applied cutoff in our cohort, we further used Max Rank statistics that identified 21% as the cutoff maximizing the difference in OS in the present cohort.

Most MCL patients had tumors with a low frequency of MYC-positive cells, but 14% (n=35) of the tumors had >20% positive cells and were defined as MYChigh. The patients with

MYChigh tumors had a median OS of 2.2 years and PFS of 1.8 years. These were significantly shorter than the OS of 7.3 years and the PFS of 5.2 years for patients with MYClow tumors. The impact on outcome is similar to that previously reported by Oberley et al.10 Both elevated mRNA and protein MYC levels were associated with poor prognosis. Of interest, MYC levels violated the proportional hazards assumption, indicating that the prognostic effect of MYC protein is time-dependent, with a mainly negative impact in the first 3 years after diagnosis. To understand whether there were other high-risk features that separated MYChigh patients with OS shorter or longer than 3 years, the clinicopathological characteristics were compared and confirmed that additional high-risk factors such as being in a

Haematologica | 109 April 2024 1179 ARTICLE - MYC is a high-risk factor in mantle cell lymphoma J.M. Rodrigues et al.
Variable Overall survival Progression-free survival HR (95% CI) P N HR (95% CI) P N MYChigh TP53/p53+ 4.49 (2.32-8.70) <0.001 237 9.78 (3.93-24.32) <0.001 188 Age 1.071 (1.05-1.09) <0.001 237 1.06 (1.04-1.08) <0.001 188 Non-classic vs. classic morphology 1.23 (0.72-2.09) 0.45 237 1.35 (0.79-2.32) 0.27 188 High Ki-67 (>30%) vs. low (<30%) 1.70 (1.11-2.60) 0.02 237 1.34 (0.84-2.14) 0.22 188 Male vs. female 1.12 (0.77-1.64) 0.56 237 0.83 (0.53-1.30) 0.41 188 MYChigh TP53/p53+ 3.995 (1.71-9.31) 0.001 185 9.56 (3.75-24.34) <0.001 182 MIPI risk group Intermediate High 2.16 (1.22-3.84) 8.64 (4.92-15.19) 0.008 <0.001 185 1.87 (1.15-3.03) 5.54 (3.40-8.99) 0.01 <0.001 182 Non-classic vs. classic morphology 1.22 (0.67-2.03) 0.52 185 1.13 (0.65-1.95) 0.66 182 High Ki-67 (>30%) vs. low (<30%) 1.16 (0.71-1.91) 0.71 185 1.09 (0.69-1.72) 0.69 182 Male vs. female 1.22 (0.77-1.92) 0.78 185 0.74 (0.46-1.18) 0.46 182
Table 5. MYChigh TP53/p53+ multivariable Cox proportional hazards models.
D

high-risk MIPI group, having TP53/p53 aberrations and high proliferation were more common in MYChigh patients with an OS shorter than 3 years. Of note, women with MYChigh tumors seemed to do even more poorly than men, with only one out of nine women having an OS longer than 3 years. Although numbers are small, this indicates that there might be a sex-related difference in the adverse effects mediated by MYC.

Comparison of MYChigh and MYClow tumors with clinicopathological parameters showed that there is a positive correlation between high age and MYC overexpression in MCL. This has not been reported before. In the study by Aukema et al 26 most patients with high MYC expression were older than 65 years, although this was not specifically mentioned. High expression of MYC is also associated with older age in patients with anaplastic lymphoma kinase-positive large cell lymphomas33 and diffuse large B-cell lymphoma.34 Besides age, patients with MYChigh tumors were also enriched for other high-risk features such as high-risk MIPI group, non-classic morphology, and high proliferation. However, the negative impact of MYC on outcome was independent of these high-risk factors, with the exception of MIPI group, emphasizing the additive effect between molecular factors, which was explored further. The impact of TP53 mutations and/or p53 overexpression in MCL has been widely documented by us and others35,36 and assessment of TP53 status should be performed in routine clinical diagnostics.16 Wild-type p53-mediated apoptosis can be induced by MYC,37 and as MYC overexpression in cancer is believed to lead to deregulation of its physiological targets,38 altered TP53/p53 could synergize with MYC and lead to a more aggressive variant of the disease. Here we show that simultaneous alterations in MYC and TP53/p53 (MYChighTP53/p53+) did indeed have an additive negative prognostic effect compared to either of the aberrations alone, being associated with a median OS and PFS of only 0.9 and 0.5 years, respectively. The MYChighTP53/p53+ subgroup of patients had unfavorable clinical characteristics, with most having highly proliferative tumors, with non-classic morphology and being in a high-risk MIPI group. The presence of tumors with both aberrations had been noted in other studies,23,26,39,40 but this is the first time that an association with prognostic and clinicopathological parameters in MCL is reported. The negative effect of MYC overexpression combined with TP53 mutations, excluding patients with wild-type TP53 but high levels of p53 protein, was also confirmed. The mechanisms behind MYC and TP53/p53 crosstalk remain to be explored, but these aberrations are known to influence each other by involvement of proteins, such as BMI-1, ARF, and microRNA, including microRNA34a.41 Den et al. studied the synergetic effect of MYC and TP53/p53 abnormalities on outcome in patients with diffuse large B-cell lymphoma, similarly to this study on MCL.

In our cohort we identified only one case with MYC rearrangements, but a few cases (1.3% of the 85 evaluated cases)

showed copy gains of MYC. These results are in line with prior studies in which MYC rearrangements were rare.10,20,42 When genetic alterations have been observed, they have mainly been amplifications/copy gains rather than chromosomal translocations of MYC 31 A high frequency of MYC abnormalities has been found in only one selected cohort.23 Similarly, concurrent translocations of MYC and CCND1 have been reported only as single cases, except in a selected cohort with overrepresentation of leukemic MCL in which 5% of MCL tumors had these dual aberrations.43 Thus, we can conclude that translocations or other rearrangements involving MYC are rare in MCL at diagnosis, corresponding to less than 2% of all cases in most studies. However, in the present study MYC protein overexpression identified 14% of MCL patients with a poor prognosis and added information on high risk beyond TP53/p53, morphology and proliferation.

In other B-cell lymphomas, such as Burkitt lymphoma and diffuse large B-cell lymphoma, structural alterations involving MYC are a predominant mechanism leading to MYC overexpression.25 In MCL, we found that MYC copy number gains were not correlated with outcome or MYC mRNA or protein overexpression. The expression seems to be driven by transcriptional dysregulation and mRNA and protein expression were highly correlated with similar effects on outcome. Investigations of MYC-driven lymphomagenesis in MCL support this notion, by showing that miRNA, such as miR33b, miR96, and miR503, are pivotal in the regulation of MYC44 and that histone deacetylation is involved in the repression of transcription mediated by MYC 45 In addition, MALT1 has also been proposed as an alternative mechanism for MYC protein stabilization in MCL.46 Studies in other lymphomas show that hotspot mutations in regions that can affect protein stability are selected during lymphomagenesis and are associated with a negative impact on outcome.47 It has also been shown by Nadeau et al. that MYC and TP53 are the only genes whose alterations have an impact on outcome beyond that of the total genomic complexity.48 However, mutations of MYC do not seem to drive relapse in MCL as MYC has been shown to be less mutated in relapsed cases compared to cases at diagnosis.6 In other cancers, MYC has a role in shaping the tumor immune microenvironment, through several mechanisms. Indeed, MYC is capable of immune checkpoint regulation, like PD-L1 and MHC class I and II molecules, and promotes cytokine secretion, leading, as an example, to re-programing M1- to M2-like macrophages.49,50 We hypothesized that MYChigh tumors would have an altered immune microenvironment. Image analyses showed no differences in T-cell infiltration but MYChigh tumors were associated with increased infiltration of CD163+ cells. This suggests that M2 macrophages may contribute to an adverse outcome in such tumors and that MYC is associated with both intrinsic and extrinsic high-risk features.

Previous studies in cancer have shown the potential of MYC

Haematologica | 109 April 2024 1180 ARTICLE - MYC is a high-risk factor in mantle cell lymphoma J.M. Rodrigues et al.

inhibition to promote antitumor effects. Nonetheless, due to intrinsically disordered domains and lack of enzymatic sites, MYC has been considered undruggable.51 Several approaches have been proposed to inhibit MYC both directly and indirectly at all its levels of regulation. Recently, the first direct MYC inhibitor, the blocking peptide OMO-103 (Peptomyc), reached clinical phase studies. OMO-103 has been shown to alter the tumor microenvironment, potentiating an antitumor immune response,52 providing hope for future successful clinical use of this agent. MYC has been shown to have a role in ibrutinib resistance.53,54 Thus, also in the ibrutinib era in MCL, we expect that MYC will remain a highrisk marker and that MYC-targeting therapies may play an important role in both the diagnostic and relapsed setting. The current study included 252 MCL patients evaluated at diagnosis; their treatment during the follow-up was not homogenous. As both MYC and p53 aberrations affect a limited group of patients, results need to be validated in independent cohorts of patients, ideally under the same treatment protocol. The analyses are further limited by the fact that no mutational analyses were performed, so no correlation between different mutational sites that may affect protein stability and protein expression could be identified.

In summary, MYC protein is a high-risk marker and, in this study, was overexpressed in a significant subgroup of cases of MCL (14%). Overexpression of MYC (>20% expression) adds prognostic information beyond that of established molecular risk factors, such as TP53/p53, morphology and proliferation, for risk stratification of MCL patients. MCL patients carrying tumors with both MYChigh and TP53/p53 aberrations constitute a subgroup with a dismal prognosis, indicating additive negative effects. Previous efforts at risk stratification have included the presence of upregulation of MYC at the bulk mRNA level together with other markers in a five-gene signature that predicts survival in MCL.55 However, we propose that MYC may be assessed through routine immunohistochemistry, using a cutoff at 20% to separate high from low expression, together with routine assessment of TP53/p53 status, proliferation and MIPI group.

Disclosures

MJ has received research support from Abbvie, AstraZeneca, Janssen, Gilead, BMS and Roche, and honoraria from

References

1. Meyer N, Penn LZ. Reflecting on 25 years with MYC. Nat Rev Cancer. 2008;8(12):976-990.

2. Cai Q, Medeiros LJ, Xu X, Young KH. MYC-driven aggressive B-cell lymphomas: biology, entity, differential diagnosis and clinical management. Oncotarget. 2015;6(36):38591-38616.

3. Filip D, Mraz M. The role of MYC in the transformation and aggressiveness of ‘indolent’ B-cell malignancies. Leuk Lymphoma. 2020;61(3):510-524.

4 Ziepert M, Lazzi S, Santi R, et al. A 70% cut-off for MYC protein

Abbvie, AstraZeneca, BMS, Genmab, Janssen, Novartis, Incyte, EUSApharma, Gilead, and Roche. IG has participated in educational sessions for Jansen Cilag, and has received research support from Takeda and Lokon Pharma. KG has received research support from Janssen, and has participated in advisory boards for GSK and Nanexa. DK is employed by Aiforia Technologies Plc. The remaining authors do not have any conflicts of interest to disclose.

Contributions

JMR was involved in the conception and design of the study, performed data and statistical analyses, and wrote the manuscript. PH and MR were involved in the pathology review and FISH evaluation. LS and EG took part in the experimental and data analyses. DK was involved in data generation and technical support. CG, RR, AK, IG, and MJ were involved in the collection of clinical information and responsible for the cohorts used in this study. CWE and KG performed sequencing analysis of the N-MCL2/3 cohort. CS and AP were involved in the pathology review. SE designed the study and wrote the manuscript. All authors approved the final version of the manuscript.

Acknowledgments

The authors would like to thank the Nordic Lymphoma Group, and specifically the Nordic MCL network, the Department of Laboratory Medicine, Medical Service in Skåne, FoU-department at the Pathology Department, Uppsala University Hospital and Histohub, Division of Oncology, Department of Clinical Sciences, Lund University for assisting in the immunohistochemistry and tissue cuts.

Funding

This project has received funding from the European Union’s Horizon 2020 research and innovation programme under Marie Skłodowska-Curie grant agreement N 754299, Cancerfonden (2016/465, 19 0309Pj and 21 1561 Pj), Mats Paulssons Stiftelse för forskning, innovation och samhällsbyggande, Stiftelsen Stefan Paulssons cancerfond, and CREATE Health. All financial support was granted to SE.

Data-sharing statement

Original data and protocols are available upon request.

expression in diffuse large B cell lymphoma identifies a highrisk group of patients. Haematologica. 2020;105(11):2667-2670.

5. Riedell PA, Smith SM. Double hit and double expressors in lymphoma: definition and treatment. Cancer. 2018;124(24):4622-4632.

6. Hill HA, Qi X, Jain P, et al. Genetic mutations and features of mantle cell lymphoma: a systematic review and meta-analysis. Blood Adv. 2020;4(13):2927-2938.

7. Yi S, Yan Y, Jin M, et al. Genomic and transcriptomic profiling reveals distinct molecular subsets associated with outcomes in

Haematologica | 109 April 2024 1181 ARTICLE - MYC is a high-risk factor in mantle cell lymphoma J.M. Rodrigues et al.

mantle cell lymphoma. J Clin Invest. 2022;132(3):e153283.

8. Jain P, Wang ML. Mantle cell lymphoma in 2022 - a comprehensive update on molecular pathogenesis, risk stratification, clinical approach, and current and novel treatments. Am J Hematol. 2022;97(5):638-656.

9 Setoodeh R, Schwartz S, Papenhausen P, et al. Double-hit mantle cell lymphoma with MYC gene rearrangement or amplification: a report of four cases and review of the literature. Int J Clin Exp Pathol. 2013;6(2):155-167.

10 Oberley MJ, Rajguru SA, Zhang C, et al. Immunohistochemical evaluation of MYC expression in mantle cell lymphoma. Histopathology. 2013;63(4):499-508.

11. Chisholm KM, Bangs CD, Bacchi CE, Molina-Kirsch H, Cherry A, Natkunam Y. Expression profiles of MYC protein and MYC gene rearrangement in lymphomas. Am J Surg Pathol. 2015;39(3):294-303.

12. Seok Y, Kim J, Choi JR, et al. CD5-negative blastoid variant mantle cell lymphoma with complex CCND1/IGH and MYC aberrations. Ann Lab Med. 2012;32(1):95-98.

13. Durot E, Patey M, Luquet I, Gaillard B, Kolb B, Delmer A. An aggressive B-cell lymphoma with rearrangements of MYC and CCND1 genes: a rare subtype of double-hit lymphoma. Leuk Lymphoma. 2013;54(3):649-652.

14 Delas A, Sophie D, Brousset P, Laurent C. Unusual concomitant rearrangements of cyclin D1 and MYC genes in blastoid variant of mantle cell lymphoma: case report and review of literature. Pathol Res Pract. 2013;209(2):115-119.

15. Liu W, Chen X, Fan J, et al. Quadruple-hit pleomorphic mantle cell lymphoma with MYC, BCL2, BCL6, and CCND1 gene rearrangements. Br J Haematol. 2021;195(4):634-637.

16. Silkenstedt E, Linton K, Dreyling M. Mantle cell lymphoma - advances in molecular biology, prognostication and treatment approaches. Br J Haematol. 2021;195(2):162-173.

17 Hoster E, Klapper W, Hermine O, et al. Confirmation of the mantle-cell lymphoma International Prognostic Index in randomized trials of the European Mantle-Cell Lymphoma Network. J Clin Oncol. 2014;32(13):1338-1346.

18. Wallace D, Reagan PM. Novel treatments for mantle cell lymphoma: from targeted therapies to CAR T cells. Drugs. 2021;81(6):669-684.

19. Kumar A, Sha F, Toure A, et al. Patterns of survival in patients with recurrent mantle cell lymphoma in the modern era: progressive shortening in response duration and survival after each relapse. Blood Cancer J. 2019;9(6):50.

20 Hu Z, Medeiros LJ, Chen Z, et al. Mantle cell lymphoma with MYC rearrangement: a report of 17 patients. Am J Surg Pathol. 2017;41(2):216-224.

21. Hernandez L, Hernandez S, Bea S, et al. c-myc mRNA expression and genomic alterations in mantle cell lymphomas and other nodal non-Hodgkin’s lymphomas. Leukemia. 1999;13(12):2087-2093.

22. Wang L, Tang G, Medeiros JL, et al. MYC rearrangement but not extra MYC copies is an independent prognostic factor in patients with mantle cell lymphoma. Haematologica. 2021;106(5):1381-1389.

23. Yi S, Zou D, Li C, et al. High incidence of MYC and BCL2 abnormalities in mantle cell lymphoma, although only MYC abnormality predicts poor survival. Oncotarget. 2015;6(39):42362-42371.

24. Choe JY, Yun JY, Na HY, et al. MYC overexpression correlates with MYC amplification or translocation, and is associated with poor prognosis in mantle cell lymphoma. Histopathology. 2016;68(3):442-449.

25. Nguyen L, Papenhausen P, Shao H. The role of c-MYC in B-cell

lymphomas: diagnostic and molecular aspects. Genes (Basel). 2017;8(4):116.

26. Aukema SM, Croci GA, Bens S, et al. Mantle cell lymphomas with concomitant MYC and CCND1 breakpoints are recurrently TdT positive and frequently show high-grade pathological and genetic features. Virchows Arch. 2021;479(1):133-145.

27. Deng M, Xu-Monette ZY, Pham LV, et al. Aggressive B-cell lymphoma with MYC/TP53 dual alterations displays distinct clinicopathobiological features and response to novel targeted agents. Mol Cancer Res. 2021;19(2):249-260.

28. Hothorn T, Zeileis A. Generalized maximally selected statistics. Biometrics. 2008;64(4):1263-1269.

29 Rodrigues JM, Porwit A, Hassan M, Ek S, Jerkeman M. Targeted genomic investigations in a population-based cohort of mantle cell lymphoma reveal novel clinically relevant targets. Leuk Lymphoma. 2021;62(11):2637-2647.

30 Rodrigues JM, Nikkarinen A, Hollander P, et al. Infiltration of CD163-, PD-L1- and FoxP3-positive cells adversely affects outcome in patients with mantle cell lymphoma independent of established risk factors. Br J Haematol. 2021;193(3):520-531.

31. Sander B, Wallblom A, Ekroth A, Porwit A, Kimby E. Characterization of genetic changes in MCL by interphase FISH on tissue sections. Leuk Lymphoma. 2007;48(7):1344-1352.

32. Gong Y, Zhang X, Chen R, Wei Y, Zou Z, Chen X. Cytoplasmic expression of C-MYC protein is associated with risk stratification of mantle cell lymphoma. PeerJ. 2017;5:e3457.

33. Lyapichev KA, Tang G, Li S, et al. MYC expression is associated with older age, common morphology, increased MYC copy number, and poorer prognosis in patients with ALK+ anaplastic large cell lymphoma. Hum Pathol. 2021;108:22-31.

34. Paul U, Richter J, Stuhlmann-Laiesz C, et al. Advanced patient age at diagnosis of diffuse large B-cell lymphoma is associated with molecular characteristics including ABC-subtype and high expression of MYC. Leuk Lymphoma. 2018;59(5):1213-1221.

35. Rodrigues JM, Hassan M, Freiburghaus C, et al. p53 is associated with high-risk and pinpoints TP53 missense mutations in mantle cell lymphoma. Br J Haematol. 2020;191(5):796-805.

36. Ferrero S, Rossi D, Rinaldi A, et al. KMT2D mutations and TP53 disruptions are poor prognostic biomarkers in mantle cell lymphoma receiving high-dose therapy: a FIL study. Haematologica. 2020;105(6):1604-1612.

37. Hoffman B, Liebermann DA. Apoptotic signaling by c-MYC. Oncogene. 2008;27(50):6462-6472.

38. Sabo A, Kress TR, Pelizzola M, et al. Selective transcriptional regulation by Myc in cellular growth control and lymphomagenesis. Nature. 2014;511(7510):488-492.

39 Malarikova D, Berkova A, Obr A, et al. Concurrent TP53 and CDKN2A gene aberrations in newly diagnosed mantle cell lymphoma correlate with chemoresistance and call for innovative upfront therapy. Cancers (Basel). 2020;12(8):2120.

40 Yamashita T, Vollbrecht C, Hirsch B, Kleo K, Anagnostopoulos I, Hummel M. Integrative genomic analysis focused on cell cycle genes for MYC-driven aggressive mature B-cell lymphoma. J Clin Exp Hematop. 2020;60(3):87-96.

41. Yu L, Yu TT, Young KH. Cross-talk between Myc and p53 in B-cell lymphomas. Chronic Dis Transl Med. 2019;5(3):139-154.

42. Michaux L, Wlodarska I, Theate I, et al. Coexistence of BCL1/ CCND1 and CMYC aberrations in blastoid mantle cell lymphoma: a rare finding associated with very poor outcome. Ann Hematol. 2004;83(9):578-583.

43. Aukema SM, Siebert R, Schuuring E, et al. Double-hit B-cell lymphomas. Blood. 2011;117(8):2319-2331.

Haematologica | 109 April 2024 1182 ARTICLE - MYC is a high-risk factor in mantle cell lymphoma J.M. Rodrigues et al.

44 Karkhanis V, Alinari L, Ozer HG, et al. Protein arginine methyltransferase 5 represses tumor suppressor miRNAs that down-regulate CYCLIN D1 and c-MYC expression in aggressive B-cell lymphoma. J Biol Chem. 2020;295(5):1165-1180.

45. Zhang X, Zhao X, Fiskus W, et al. Coordinated silencing of MYC-mediated miR-29 by HDAC3 and EZH2 as a therapeutic target of histone modification in aggressive B-Cell lymphomas. Cancer Cell. 2012;22(4):506-523.

46. Dai B, Grau M, Juilland M, et al. B-cell receptor-driven MALT1 activity regulates MYC signaling in mantle cell lymphoma. Blood. 2017;129(3):333-346.

47. Cucco F, Barrans S, Sha C, et al. Distinct genetic changes reveal evolutionary history and heterogeneous molecular grade of DLBCL with MYC/BCL2 double-hit. Leukemia. 2020;34(5):1329-1341.

48. Nadeu F, Martin-Garcia D, Clot G, et al. Genomic and epigenomic insights into the origin, pathogenesis, and clinical behavior of mantle cell lymphoma subtypes. Blood. 2020;136(12):1419-1432.

49 Dhanasekaran R, Baylot V, Kim M, et al. MYC and Twist1 cooperate to drive metastasis by eliciting crosstalk between

cancer and innate immunity. Elife. 2020;9:e50731.

50 Dhanasekaran R, Deutzmann A, Mahauad-Fernandez WD, Hansen AS, Gouw AM, Felsher DW. The MYC oncogene - the grand orchestrator of cancer growth and immune evasion. Nat Rev Clin Oncol. 2022;19(1):23-36.

51. Dang CV, Reddy EP, Shokat KM, Soucek L. Drugging the ‘undruggable’ cancer targets. Nat Rev Cancer. 2017;17(8):502-508.

52. Soucek L, Whitfield J, Martins CP, et al. Modelling Myc inhibition as a cancer therapy. Nature. 2008;455(7213):679-683.

53. Lee J, Zhang LL, Wu W, et al. Activation of MYC, a bona fide client of HSP90, contributes to intrinsic ibrutinib resistance in mantle cell lymphoma. Blood Adv. 2018;2(16):2039-2051.

54 Scapinello G, Riva M, Branca A, et al. A case of “double hit” mantle cell lymphoma carrying CCND1 and MYC translocations relapsed/refractory to rituximab bendamustine cytarabine (R-BAC) and ibrutinib. Ann Hematol. 2020;99(11):2715-2717.

55. Hartmann E, Fernandez V, Moreno V, et al. Five-gene model to predict survival in mantle-cell lymphoma using frozen or formalin-fixed, paraffin-embedded tissue. J Clin Oncol. 2008;26(30):4966-4972.

Haematologica | 109 April 2024 1183 ARTICLE - MYC is a high-risk factor in mantle cell lymphoma J.M. Rodrigues et al.

Loncastuximab tesirine in relapsed/refractory diffuse large B-cell lymphoma: long-term efficacy and safety from the phase II LOTIS-2 study

Paolo F. Caimi,1 Weiyun Z. Ai,2 Juan Pablo Alderuccio,3 Kirit M. Ardeshna,4 Mehdi Hamadani,5 Brian Hess,6 Brad S. Kahl,7 John Radford,8 Melhem Solh,9 Anastasios Stathis,10 Pier Luigi Zinzani,11,12 Ying Wang,13 Yajuan Qin,13 Luqiang Wang,13 Zhiying Cindy Xu13 and Carmelo CarloStella14

1Cleveland Clinic Taussig Cancer Center, Cleveland, OH, USA; 2Helen Diller Family Comprehensive Cancer Center, University of California, San Francisco, CA, USA; 3Sylvester Comprehensive Cancer Center, University of Miami Miller School of Medicine, Miami, FL, USA; 4University College London Hospitals NHS Foundation Trust, London, UK; 5Division of Hematology and Oncology, Medical College of Wisconsin, Milwaukee, WI, USA; 6Medical University of South Carolina, Charleston, SC, USA; 7Washington University, St. Louis, MO, USA; 8NIHR Clinical Research Facility, University of Manchester and the Christie NHS Foundation Trust, Manchester Academic Health Science Center, Manchester, UK; 9Blood and Marrow Transplant Program at Northside Hospital, Atlanta, GA, USA; 10Oncology Institute of Southern Switzerland, EOC, Bellinzona, Switzerland; 11IRCCS Azienda Ospedaliero-Universitaria di Bologna, Istituto di Ematologia “Seràgnoli,” Bologna, Italy; 12Dipartimento di Scienze Mediche e Chirurgiche, Università di Bologna, Bologna, Italy; 13ADC Therapeutics America, Inc., Murray Hill, NJ, USA and 14Department of Biomedical Sciences, Humanitas University, and Department of Oncology and Hematology, Humanitas Research Hospital−IRCCS, Milano, Italy

Abstract

Correspondence: P.F. Caimi caimip@ccf.org

Received: May 9, 2023.

Accepted: August 23, 2023.

Early view: August 31, 2023.

https://doi.org/10.3324/haematol.2023.283459

©2024 Ferrata Storti Foundation

Published under a CC BY-NC license

Therapies that demonstrate durable, long-term responses with manageable safety and tolerability are needed for patients with relapsed/refractory diffuse large B-cell lymphoma (R/R DLBCL). Loncastuximab tesirine (loncastuximab tesirine-lpyl [Lonca]), an anti-CD19 antibody conjugated to a potent pyrrolobenzodiazepine dimer, demonstrated single-agent antitumor activity in the pivotal phase II LOTIS-2 study in heavily pretreated patients with R/R DLBCL. Here we present updated efficacy and safety analyses from LOTIS-2, performed for all patients and in subsets of patients with a complete response (CR), including patients with CR who were event-free (no progressive disease or death) for ≥1 year and ≥2 years from cycle 1, day 1 of treatment. Lonca was administered every 3 weeks (0.15 mg/kg for 2 cycles; 0.075 mg/kg for subsequent cycles). As of the final data cutoff (September 15, 2022; median follow-up: 7.8 months [range, 0.3-42.6]), 70 of 145 (48.3%) patients achieved an overall response. Thirty-six (24.8%) patients achieved CR, of which 16 (44%) and 11 (31%) were event-free for ≥1 year and ≥2 years, respectively. In the all-treated population, the median overall survival was 9.5 months; the median progression-free survival was 4.9 months. Among patients with CR, median overall survival and progression-free survival were not reached, with 24-month overall and progression-free survival rates of 68.2% (95% CI: 50.0-81.0) and 72.5% (95% CI: 48.2-86.8), respectively. No new safety concerns were detected. With additional follow-up, Lonca continued to demonstrate durable, long-term responses with manageable safety and tolerability in patients with CR (clinicaltrials gov. Identifier: NCT03589469).

Introduction

In newly diagnosed diffuse large B-cell lymphoma (DLBCL), frontline therapy is potentially curative for approximately 60% of patients.1 Further, patients with newly diagnosed DLBCL who achieved event-free survival (defined as no disease progression, relapse, new anticancer treatment, or death)

for 24 months after the initial first-line immunochemotherapy were found to have an overall survival (OS) equivalent to that of the age- and sex-matched general population, suggesting that long-term responses can indicate positive outcomes for patients with DLBCL.1 However, up to 40% of patients do not respond to frontline therapy or relapse.1 Patients with relapsed/refractory (R/R) DLBCL after stem cell

Haematologica | 109 April 2024 1184 - Non-Hodgkin Lymphoma ARTICLE

transplant (SCT) or chimeric antigen receptor T-cell (CAR T) therapy or who are refractory to second-line therapy have a poor prognosis and limited treatment options.2,3 While the number of treatment options for R/R DLBCL is increasing, not all patients are eligible for, able to access easily, or able to tolerate many of these therapies.4,5 There remains a medical need for effective and accessible therapies with manageable safety and tolerability that have demonstrated the potential for long-term disease control in R/R DLBCL. Loncastuximab tesirine (loncastuximab tesirine-lpyl [Lonca]) is an antibody-drug conjugate comprising a humanized anti-CD19 monoclonal antibody conjugated through a cleavable linker to a potent pyrrolobenzodiazepine (PBD) dimer alkylating cytotoxin, SG3199.6 Upon binding to the CD19 antigen, Lonca is internalized, the linker is cleaved, and PBD dimers are rapidly released.6 The PBD dimer forms persistent DNA crosslinks in the DNA minor groove, leading to tumor cell apoptosis.7 In April 2021, Lonca received accelerated approval from the US Food and Drug Administration as a single agent for the treatment of adult patients with R/R large B-cell lymphoma after two or more lines of systemic therapy, including DLBCL not otherwise specified, DLBCL arising from low-grade lymphoma, and high-grade B-cell lymphoma (HGBCL).8 Subsequently, Lonca received European Medicines Agency conditional approval in December 2022 for the same indication.9

In the primary analysis of the pivotal phase II LOTIS-2 study (data cutoff: April 6, 2020; median follow-up: 7.3 months [range, 0.3-20.2]8), Lonca demonstrated single-agent antitumor activity and had an acceptable safety profile in heavily pretreated patients with R/R DLBCL with an overall response rate (ORR) of 48.3% and a complete response (CR) rate of 24.1%.10 In a previously presented follow-up analysis (data cutoff: March 1, 2021; median follow-up: 7.8 months [range, 0.3-31.0]), the ORR was the same as in the primary analysis, and one patient with a partial response (PR) converted to CR for a final CR rate of 24.8%. Durable responses to Lonca were observed, with a median duration of response (DOR) of 13.4 months and a median DOR in patients with CR not reached; no new safety signals were detected.11

Here we present updated long-term efficacy and safety data in patients with R/R DLBCL treated with Lonca in the phase II LOTIS-2 study, including analyses of subsets of patients with durable CR.

Methods

Study design and patients

The multicenter, open-label, single-arm phase II LOTIS-2 study (clinicaltrials gov. Identifier: NCT03589469) design and methodology were previously described.10 Briefly, key eligibility criteria included patients aged ≥18 years, investigator-defined R/R DLBCL (including DLBCL not otherwise specified, HGBCL with MYC and BCL2 and/or BCL6 rear-

rangements, and primary mediastinal B-cell lymphoma) after two or more prior systemic therapies, measurable disease (2014 Lugano criteria), and an Eastern Cooperative Oncology Group performance status of 0 to 2.

Lonca was administered on an outpatient basis intravenously over 30 minutes once every 3 weeks on day 1 of each 21day cycle at a dose of 0.15 mg/kg for the first two cycles followed by 0.075 mg/kg for subsequent cycles for up to 1 year or until disease relapse or progression. Patients with clinical benefit could continue treatment beyond 1 year upon sponsor approval. Patients received dexamethasone premedication to reduce the incidence and severity of PBD-related adverse events (AE; i.e., edema, effusion, and skin-related events).

This study was conducted in accordance with the International Council for Harmonization Good Clinical Practice guidelines and ethical principles of the Declaration of Helsinki. All participants provided written informed consent. The study protocol and amendments were approved by all relevant ethics committees.

Efficacy and safety outcomes

The primary efficacy endpoint was the ORR (defined as the proportion of patients with a CR or PR according to the 2014 Lugano classification,12 determined by independent central review). Patient disease assessment and follow-up were previously described.10 Secondary efficacy endpoints included the DOR (time from first response [CR or PR] to disease progression or death), CR rate (the proportion of patients with a CR as determined by an independent central review), relapse-free survival (RFS; the time from CR to disease progression or death), progression-free survival (PFS; the time from the start of treatment to disease progression or death), and OS (the time from the start of treatment to death from any cause).

Safety endpoints included frequency and severity of AE and serious AE, graded according to the National Cancer Institute’s Common Terminology Criteria for Adverse Events v4.0.

Statistical analyses

The primary analysis of the LOTIS-2 study was previously published (data cutoff: April 6, 2020).10 The follow-up efficacy and safety analyses reported here (data cutoff: September 15, 2022) were performed for all patients who received ≥1 dose of Lonca, in a subset of patients who achieved a best response of CR, and in subsets of patients with a best response of CR who were event-free (events defined as progressive disease or death) for ≥1 year or ≥2 years starting from cycle 1, day 1 of Lonca treatment.

Analysis of primary and secondary endpoints was previously described10 (see the Online Supplementary Appendix 1). The duration of time patients remained treatment-free post-Lonca was defined as the interval from the last dose of Lonca until the end of study for patients who did not receive subsequent anticancer therapy or the start of subsequent

Haematologica | 109 April 2024 1185 ARTICLE - LOTIS-2 1-yr/2-yr long-term responses P.F. Caimi et al.

anticancer therapy for patients who received subsequent anticancer therapy. All statistical analyses were conducted using SAS, version 9.4.

Results

Patients

As of the final data cutoff of September 15, 2022 (median follow-up, all-treated population: 7.8 months [range, 0.342.6]), a total of 145 patients received at least one dose of Lonca and were evaluable for efficacy and safety. Baseline characteristics and demographics are summarized in Table

1. Briefly, the median age was 66.0 years, 58.6% of patients were male, 6.9% of patients had HGBCL, the median number of prior therapies was 3.0, 20.0% of patients had primary refractory disease, 61.4% had disease refractory to the last prior systemic therapy, 9.7% of patients had prior CAR T therapy, and 16.6% had prior SCT.

Patient subsets of interest included patients with CR (36 [24.8%]; median follow-up: 35.0 months) and patients with CR who were event-free for ≥1 year (16 [11.0%]; median follow-up: 37.2 months) and ≥2 years (11 [7.6%]; median follow-up: 37.5 months). Among the subset of patients with CR (n=36), 38.9% were male, 13.9% had HGBCL, 13.9% had double-hit disease, 13.9% had primary refractory disease,

Patients with CR who

aR/R DLBCL was classified according to the 2016 World Health Organization classification. bThe primary analysis reported high-grade B-cell lymphoma (HGBCL) in 11 patients. CAR T: chimeric antigen receptor T cell; CR: complete response; DLBCL: diffuse large B-cell lymphoma; ECOG: Eastern Cooperative Oncology Group; NOS: not otherwise specified; R/R: relapsed/refractory; SCT: stem cell transplant.

Haematologica | 109 April 2024 1186 ARTICLE - LOTIS-2 1-yr/2-yr long-term responses P.F. Caimi et al.
All-treated N=145 Best response of CR N=36
were event-free ≥1 year N=16
event-free ≥2 years N=11 Sex, N (%) Female 60 (41.4) 22 (61.1) 13 (81.3) 9 (81.8) Age in years, N (%) Median (range) <65 ≥65 to <75 ≥75 66.0 (23-94) 65 (44.8) 59 (40.7) 21 (14.5) 67.5 (45-94) 13 (36.1) 15 (41.7) 8 (22.2) 71.0 (53-84) 3 (18.8) 7 (43.8) 6 (37.5) 70.0 (53-82) 3 (27.3) 5 (45.5) 3 (27.3) Race, N (%) White Black or African American Asian Other 130 (89.7) 5 (3.4) 3 (2.1) 7 (4.8) 34 (94.4) 1 (2.8) 0 1 (2.8) 15 (93.8) 0 0 1 (6.3) 11 (100) 0 0 0 ECOG score, N (%) 0 1 2 58 (40.0) 78 (53.8) 9 (6.2) 19 (52.8) 14 (38.9) 3 (8.3) 9 (56.3) 6 (37.5) 1 (6.3) 7 (63.6) 3 (27.3) 1 (9.1) Histology,a N (%) DLBCL, NOS HGBCLb Primary mediastinal DLBCL 128 (88.3) 10 (6.9) 7 (4.8) 31 (86.1) 5 (13.9) 0 11 (68.8) 5 (31.3) 0 8 (72.7) 3 (27.3) 0 Transformed DLBCL, N (%) 30 (20.7) 7 (19.4) 4 (25.0) 2 (18.2) Double/triple hit, N (%) Double hit Triple hit 12 (8.3) 3 (2.1) 5 (13.9) 0 5 (31.3) 0 3 (27.3) 0 Stage, N (%) I-II III-IV 33 (22.8) 112 (77.2) 9 (25.0) 27 (75.0) 3 (18.8) 13 (81.3) 2 (18.2) 9 (81.8) Prior systemic therapies, N (%) Median (range) 2 prior lines 3 prior lines >3 prior lines 3.0 (2-7) 63 (43.4) 34 (23.4) 48 (33.1) 3.0 (2-7) 15 (41.7) 5 (13.9) 16 (44.4) 2.0 (2-7) 10 (62.5) 2 (12.5) 4 (25.0) 2.0 (2-7) 8 (72.7) 1 (9.1) 2 (18.2) Refractory, N (%) Primary refractory Refractory to last therapy 29 (20.0) 89 (61.4) 5 (13.9) 11 (30.6) 2 (12.5) 5 (31.3) 0 4 (36.4) Prior SCT, N (%) 24 (16.6) 8 (22.2) 1 (6.3) 1 (9.1) Prior CAR T therapy, N (%) 14 (9.7) 3 (8.3) 2 (12.5) 0
Patients with CR who were
Table 1. Patient baseline characteristics and demographics.

and 30.6% had disease refractory to the last prior systemic therapy. In the subset of patients with CR who were eventfree for ≥1 year (n=16), 18.8% were male, 31.3% had HGBCL, 31.3% had double-hit disease, 12.5% had primary refractory disease, and 31.3% had disease refractory to the last prior systemic therapy. In the subset of patients with CR who were event-free for ≥2 years (n=11), 18.2% were male, 27.3% had HGBCL, 27.3% had double-hit disease, 0% had primary refractory disease, and 36.4% had disease refractory to the last prior systemic therapy.

Most baseline characteristics were similar between the all-treated population, the subset of patients with a CR, and the subsets of patients with CR who were event-free for ≥1 year and ≥2 years. The median age, the percentage of female patients, and the percentage of patients with HGBCL were higher in the subsets of patients with CR who were event-free for ≥1 year and ≥2 years than in the all-treated population. The percentage of primary refractory patients was lower among the subset of patients with CR who were event-free for ≥1 year, and substantially lower (0% vs. 20%) in the subset of patients with CR who were event-free for ≥2 years, than in the all-treated population.

Lonca exposure and patient disposition

Lonca administration and exposure are summarized in the Online Supplementary Table S1. In the all-treated population, the median number of treatment cycles was 3.0 (range, 1-26). Among patients with CR, the median number of treatment cycles was 8.0 (range, 1-26). Among patients with CR who were event-free for ≥1 year and ≥2 years, the median numbers of treatment cycles were 12.5 and 13.0, respectively.

Efficacy outcomes

As of the final data cutoff, the ORR was 48.3% (70/145),

with a CR rate of 24.8% (36/145). Among patients with CR, 44% (16/36) and 31% (11/36) were event-free for ≥1 year and ≥2 years, respectively. The median time to response for all responders was 41.0 days (range, 35-247). Among the subset of patients with CR, the median time to response was 42.0 days (range, 36-247).

Efficacy outcomes for the all-treated population and the subset of patients with CR are summarized in Table 2. The median DOR was 13.4 months (95% confidence interval [CI]: 6.9- not estimated [NE]) in the all-treated population and was not reached among patients with CR (Figure 1). Of the 36 patients with CR, it is estimated (Kaplan–Meier approach) that 82.8% (95% CI: 59.9-93.3) of patients would maintain response for 1 year, and 72.4% (95% CI: 48.1-86.8) would maintain the response for 2 years. The median PFS was 4.9 months (95% CI: 2.9-8.3) in the all-treated population and was not reached in patients with CR (Figure 2A). Of the 36 patients with CR, it is estimated (Kaplan–Meier approach) that 82.9% (95% CI: 60.0-93.3) of patients would be progression-free for 1 year, and 72.5% (95% CI: 48.2-86.8) would be progression-free for 2 years. The median OS was 9.5 months (95% CI: 6.7-11.5) in the all-treated population and was not reached in patients with CR. Of the 36 patients with CR, 12 OS events were reported, and it is estimated (Kaplan–Meier approach) that 77.1% (95% CI: 59.4-87.9) of patients would maintain survival for 1 year, and 68.2% (95% CI: 50.0-81.0) of patients would maintain survival for 2 years (Figure 2B). Among the 36 patients with CR, the median RFS was not reached (Figure 2C), and it is estimated (Kaplan–Meier approach) that 83.2% (95% CI: 60.5-93.5) and 72.8% (95% CI: 48.5-87.0) of patients would be relapse-free for 1 and 2 years, respectively.

Among patients with CR, the median duration of time patients remained treatment-free post-Lonca was 6.1 months (range, 1.0-37.5). In the subsets of patients who were event-

Haematologica | 109 April 2024 1187 ARTICLE - LOTIS-2 1-yr/2-yr long-term responses P.F. Caimi et al.
All-treated population N=145 (95% CI) Best response of CR N=36 (95% CI) Median DOR in months Probability % of maintaining response at 12 months Probability % of maintaining response at 24 months 13.4 (6.9-NR) 54.7 (37.9-68.8) 44.6 (27.9-60.0) NR 82.8 (59.9-93.3) 72.4 (48.1-86.8) Median DOR in months Probability % of maintaining PFS at 12 months Probability % of maintaining PFS at 24 months 4.9 (2.9-8.3) 33.5 (23.3-44.0) 25.9 (16.2-36.7) NR 82.9 (60.0-93.3) 72.5 (48.2-86.8) Median DOR in months Probability % of maintaining OS at 12 months Probability % of maintaining OS at 24 months 9.5 (6.7-11.5) 39.0 (30.7-47.1) 29.5 (22.0-37.4) NR
(59.4-87.9) 68.2 (50.0-81.0) Median DOR in months Probability % of maintaining RFS at 12 months Probability % of maintaining RFS at 24 months-NR 83.2 (60.5-93.5) 72.8 (48.5-87.0)
77.1
Table 2. Summary of efficacy. CI: confidence interval; CR: complete response; DOR: duration of response; NR: not reached; OS: overall survival; PFS: progression-free survival; RFS: relapse-free survival.

free for ≥1 year and ≥2 years, the median duration of time patients remained treatment-free post-Lonca was 24.8 months (range, 3.4-37.5) and 27.7 months (range, 20.7-37.5), respectively (Figure 3). None of the 11 patients with CR who were event-free for ≥2 years received new anticancer therapy; all 11 patients were censored due to patient discontinuation of the study. The most common reason for the censoring of patients with CR was study discontinuation in 15 (41.7%) patients, followed by transplant in ten (27.8%) patients. Five (13.9%) patients were censored for the start of new anticancer therapy other than transplant. Three (8.3%) patients each experienced progressive disease and death. Among the 14 (9.7%) patients in the all-treated population who were previously treated with CAR T therapy, the ORR was 42.9%. Following treatment with Lonca, 16 (11.0%) patients in the all-treated population received CAR T therapy, and 12 (8.3%) received SCT. As assessed by principal investigators, four of the five patients with a record of response achieved CR after SCT.

Safety outcomes

No new safety signals were identified during the long-term follow-up. All-grade treatment-emergent adverse events (TEAE; occurring in ≥10% of all-treated patients) and grade ≥3 TEAE are summarized in Table 3. All-grade TEAE occurred in 98.6% of patients in the all-treated population. TEAE occurring in ≥30% of the all-treated population were increased g-glutamyl transferase (GGT; 42%), neutropenia (40%), and thrombocytopenia (33%). Grade ≥3 TEAE were reported in 73.8% of patients. Grade ≥3 TEAE in ≥10% of the all-treated population were neutropenia (26%), thrombocytopenia

(18%), increased GGT (17%), and anemia (10%). No cases of secondary malignancy or myelodysplastic syndrome were reported. No deaths due to TEAE were considered to be related to Lonca.

TEAE were similar between the all-treated population and the subset of patients with CR. All-grade TEAE occurred in 100% of patients with CR. TEAE occurring in ≥30% of patients with CR were increased GGT (50%), neutropenia (42%), anemia (36%), thrombocytopenia (36%), peripheral edema (33%), and nausea (31%). Grade ≥3 TEAE were reported in 75% of patients with CR; grade ≥3 TEAE occurring in ≥10% of patients with CR were neutropenia (28%), increased GGT (19%), thrombocytopenia (19%), leukopenia (14%), and hypophosphatemia (11%). All-grade and grade ≥3 TEAE in patients with CR who were event-free for ≥1 year and ≥2 years were generally similar to those of the overall population (Online Supplementary Table S2).

In the all-treated population, 40% of patients had dose withdrawal before cycle 3, meaning that those patients did not reach the scheduled dose reduction before discontinuing treatment with Lonca. TEAE leading to treatment discontinuation occurred in 24.8% of patients in the all-treated population. The most common TEAE leading to treatment discontinuation in the all-treated population were increased GGT (12.4%), peripheral edema (2.8%), localized edema (2.1%), and pleural effusion (2.1%). Among the subset of patients with CR, TEAE leading to treatment discontinuation occurred in 41.7% of patients. The most common TEAE leading to discontinuation in patients with CR were increased GGT (19.4%), peripheral edema (8.3%), localized edema (5.6%), and pericardial effusion (5.6%).

Haematologica | 109 April 2024 1188 ARTICLE - LOTIS-2 1-yr/2-yr long-term responses P.F. Caimi et al.
Figure 1. Duration of response. Duration of response curve for the all-treated population (N=145) and the subsets of patients with a best response of complete response (CR) (N=36) and partial response (PR) (N=34). Reasons for censor included stem cell transplant. CI: confidence interval; NR: not reached.
Haematologica | 109 April 2024 1189 ARTICLE - LOTIS-2 1-yr/2-yr long-term responses P.F. Caimi et al. A B C
Continued on following page.

Discussion

In the primary analysis of the LOTIS-2 study, Lonca demonstrated antitumor activity with an ORR of 48.3%, a CR rate of 24.1%, and durable responses (median DOR, 10.3 months) in patients with heavily pretreated R/R DLBCL.10 In this longer-term follow-up analysis, with a median follow-up of 35.0 months in patients with CR, these durable responses were maintained. The ORR was consistent with the primary analysis at 48.3%, and one PR was converted to a CR for a final CR rate of 24.8%. In the all-treated population, the median DOR extended to 13.4 months. The median OS and median PFS were consistent with the primary analysis at 9.5 months and 4.9 months, respectively. Further, in this LOTIS-2 long-term follow-up analysis, 44% and 31% of the 36 patients with CR were event-free for ≥1 year and ≥2 years, respectively. In a previous study, patients with newly diagnosed DLBCL who achieved event-free survival for ≥2 years after initial therapy were found to have an OS similar to that of an age- and sex-matched general population.1 For patients with R/R DLBCL, it remains to be seen whether achieving event-free survival for ≥2 years may also translate to a comparable effect on OS and disease-specific mortality. Among the subset of patients with CR who were

event-free for ≥1 year or ≥2 years, the median duration of time patients remained treatment-free post-Lonca was greater than 24 months, with one patient remaining treatment-free as long as 37 months. Achievement of these long treatment-free intervals is likely to translate into improved measures of quality of life, as patients with non-Hodgkin lymphoma who are off treatment and disease-free have been shown to have improved quality of life compared with patients with active disease.13

Baseline characteristics were compared between the all-treated patient population and the subsets of patients with durable responses to identify potential factors predictive of long-term response to Lonca. Overall, no trends have emerged, as baseline characteristics were generally similar between the all-treated population and the subsets of patients with durable responses; however, there was a notable difference in the proportion of patients who were primary refractory in the all-treated population (20%) and the subset of patients with CR who were event-free for ≥2 years (0%), as well as a difference between the proportion of patients with HGBCL in the all-treated population (6.9%) and the subsets of patients with CR who were event-free for ≥1 year (31.3%) and ≥2 years (27.3%). Further studies are needed to expand our understanding of subgroups that

Haematologica | 109 April 2024 1190 ARTICLE - LOTIS-2 1-yr/2-yr long-term responses P.F. Caimi et al.
Figure 2. Kaplan–Meier curve. (A) Progression-free survival curve of the all-treated population (N=145) and the subset of patients with a best response of complete response (CR) (N=36). (B) Overall survival curve of the all-treated population and the subset of patients with a best response of CR. (C) Relapse-free survival curve of patients with a best response of CR. Reasons for censor in progression-free survival and relapse-free survival analyses included stem cell transplant. CI: confidence interval; NR: not reached. Figure 3. Swimmer plot of patients with complete response. Each bar represents 1 patient in the study. Response was determined by an independent review. SCT: stem cell transplant.

All-treated N=145

Best response of CR N=36

ALP: alkaline phosphatase; ALT: alanine transaminase; AST: aspartate aminotransferase; CR: complete response; GGT: g-glutamyl transferase; TEAE: treatment-emergent adverse event.

are predictive of durable response to Lonca. Preliminary biomarker studies suggest that response to treatment with Lonca is observed across a wide range of CD19 expression levels, including patients with very low levels.14 The role of CD19 expression and response to Lonca is being further explored. Additional studies to investigate methods to overcome resistance to Lonca in subgroups such as chemorefractory patients, possibly through evaluation with combination therapies, are also needed.

One question that arises in practice is how best to sequence multiple CD19-directed therapies. In this study, patients had previously received CAR T therapy and achieved an ORR similar to that of the all-treated population. This finding is consistent with previous analyses and suggests that responses can be achieved with Lonca in patients who progressed after receiving CD19-targeted CAR T therapy.15 In this long-term follow-up analysis, the safety profile of

Lonca remained consistent with previously reported safety data; no new safety concerns were detected.10,11 With the use of dexamethasone premedication, standard spironolactone diuretics, and recommendations to minimize or avoid sun exposure, TEAE considered to be related to the PBD dimer cytotoxin—edema and effusion, skin-related AE, and liver enzyme abnormalities16—were consistent with previously reported safety data. PBD dimer cytotoxin-related AE continued to be manageable, with dose delays and/or modifications.10 Increased GGT was the most common reason for treatment discontinuation, followed by edema and effusions. According to the LOTIS-2 study protocol, patients with recurrent grade ≥2 GGT elevation, after two dose reductions or dose delays >5 weeks due to GGT elevation, were discontinued from treatment with Lonca. However, treatment discontinuation due to elevated GGT does not reflect clinical practice, as elevated GGT

Haematologica | 109 April 2024 1191 ARTICLE - LOTIS-2 1-yr/2-yr long-term responses P.F. Caimi et al.
All grades N (%) Grade ≥3 N (%) All grades N (%) Grade ≥3 N (%) Any TEAE 143 (98.6) 107 (73.8) 36 (100) 27 (75.0) Increased GGT 61 (42.1) 25 (17.2) 18 (50.0) 7 (19.4) Neutropenia 58 (40.0) 38 (26.2) 15 (41.7) 10 (27.8) Thrombocytopenia 48 (33.1) 26 (17.9) 13 (36.1) 7 (19.4) Fatigue 40 (27.6) 2 (1.4) 8 (22.2)Anemia 38 (26.2) 15 (10.3) 13 (36.1) 3 (8.3) Nausea 34 (23.4) - 11 (30.6)Cough 33 (22.8) 1 (0.7) 8 (22.2)Increased blood ALP 29 (20.0) 1 (0.7) 10 (27.8)Peripheral edema 29 (20.0) 2 (1.4) 12 (33.3) 1 (2.8) Pyrexia 28 (19.3) 2 (1.4) 6 (16.7)Diarrhea 25 (17.2) 3 (2.1) 10 (27.8) 2 (5.6) Increased AST 23 (15.9) 1 (0.7) 7 (19.4)Hypokalemia 23 (15.9) 6 (4.1) 7 (19.4) 2 (5.6) Hypophosphatemia 23 (15.9) 8 (5.5) 8 (22.2) 4 (11.1) Increased ALT 22 (15.2) 4 (2.8) 5 (13.9) 1 (2.8) Decreased appetite 22 (15.2) - 6 (16.7)Leukopenia 21 (14.5) 13 (9.0) 7 (19.4) 5 (13.9) Hypomagnesemia 20 (13.8) 1 (0.7) 6 (16.7) 1 (2.8) Pruritus 19 (13.1) - 8 (22.2)Rash 19 (13.1) 1 (0.7) 8 (22.2)Vomiting 19 (13.1) - 7 (19.4)Abdominal pain 17 (11.7) 4 (2.8) 4 (11.1)Constipation 17 (11.7) - 6 (16.7)Dyspnea 17 (11.7) 2 (1.4) 5 (13.9)Insomnia 16 (11.0) - 2 (5.6)Pleural effusion 16 (11.0) 3 (2.1) 6 (16.7) 1 (2.8) Erythema 15 (10.3) 1 (0.7) 7 (19.4) 1 (2.8) Headache 15 (10.3) 1 (0.7) 3 (8.3)Photosensitivity reaction 15 (10.3) 3 (2.1) 2 (5.6) 1 (2.8)
Table 3. Treatment-emergent adverse events occurring in ≥10% of the all-treated population.

does not typically trigger the discontinuation of therapy in a patient whose disease is responding to anticancer therapy, especially without the presence of other elevated liver enzymes.17 Further, patients with GGT elevations did not present with long-term liver toxicity of any grade. One limitation of this analysis was the small number of patients with long-term responses. Further study in a large patient population is needed to understand better the characteristics of patients with long-term response to treatment with Lonca. A strength of this analysis is that the LOTIS-2 patient population is representative of a real-world population of patients with R/R DLBCL who have received multiple prior lines of therapy, including similar median ages and proportions of sex, race, patients with transformed disease, and patients with double-/triple-hit disease.18,19

In conclusion, among heavily pretreated patients with R/R DLBCL in the pivotal LOTIS-2 study, Lonca continued to demonstrate durable responses with a manageable safety and tolerability profile in this long-term follow-up analysis. Further, a subset of 11 patients with CR remained event-free for ≥2 years with no evidence of disease, no new anticancer treatment, and a median treatment-free duration of 27.7 months post-Lonca treatment.

Disclosures

PFC served as a consultant/advisor for ADC Therapeutics, BMS/Celgene, Genentech, Genmab, Kite Pharma, MEI Pharma, Novartis, and Takeda. WZA participated in advisory boards for Acrotech Biopharma, ADC Therapeutics, BeiGene, Kymera Therapeutics, and Nurix Therapeutics; and received research funding from Nurix Therapeutics. JPA received honoraria from Oncinfo and OncLive; consultant and research funding from ADC Therapeutics and Genentech; and served as consultant for Genentech. An immediate family member of JPA served on the advisory boards for Agios Pharmaceuticals, Forma Therapeutics, Foundation Medicine, Inovio Pharmaceuticals, and Puma Biotechnology. KMA received honoraria from BMS, Gilead, and Novartis. MH served as a consultant for AbGenomics, ADC Therapeutics, Celgene, Incyte, Janssen R&D, Omeros, Pharmacyclics, TeneoBio, and Verastem; participated in speaker bureaus for AstraZeneca, BeiGene, and Sanofi Genzyme; and received research support from Astellas Pharma, Spectrum Pharmaceuticals, and Takeda. BH served as a consultant for ADC Therapeutics, AstraZeneca, and BMS; and participated in a speaker bureau for BMS. BSK served as consultant for AbbVie, ADC Therapeutics, AstraZeneca, BeiGene, Celgene/BMS, Eli Lilly, Epizyme, Genentech, Genmab, Hutchmed, Incyte, Kite, MEI Pharma, Molecular Templates, Pharmacyclics, Takeda, and T G Therapeutics; and received research funding from AbbVie, ADC Therapeutics, AstraZeneca, BeiGene, and Genentech. JR served as consultant/advisor for ADC Therapeutics, BMS, Kite Pharma, Novartis, and Takeda; served as speaker for ADC Therapeutics, Seattle Genetics, and Takeda; owns stock in

ADC Therapeutics and AstraZeneca (spouse); provided expert testimony for and received honoraria from ADC Therapeutics and Takeda; and received research funding from Takeda. MS served as consultant/advisor for ADC Therapeutics and Genentech; and served on speaker bureaus for BMS, GSK, and Sanofi. AS served as a consultant/advisor for AstraZeneca, Bayer, Eli Lilly, Janssen Oncology, Novartis, and Roche; and received research funding from AbbVie, ADC Therapeutics, Amgen, AstraZeneca, Bayer, Cellestia, Debiopharm Group, Eli Lilly, Incyte, Loxo, MEI Pharma, Merck/MSD, Novartis, Pfizer, Philogen, and Roche. PLZ served as a consultant for EUSA Pharma, MSD, Sanofi, and Verastem; participated in advisory committees for ADC Therapeutics and Sandoz; participated in speaker bureaus/advisory committees for BMS, Celltrion, EUSA Pharma, Gilead, Janssen-Cilag, Kyowa Kirin, MSD, Roche, Servier, Takeda, TG Therapeutics, and Verastem. YW is an employee of ADC Therapeutics with equity and stock options in the company; and has an immediate family member employed by/stock ownership in Johnson & Johnson. YQ is an employee of ADC Therapeutics with equity and stock options in the company. LW is an employee of ADC Therapeutics with equity and stock options in the company. ZX is an employee of ADC Therapeutics with equity and stock options in the company. CCS served as a consultant/ advisor for ADC Therapeutics, Celgene/BMS, Karyopharm, MSD, Novartis, Roche, Sanofi, and Scenic Biotech; and received honoraria from AstraZeneca, Celgene, Incyte, Gilead Sciences, Janssen Oncology, MSD, and Roche.

Contributions

PFC, WZA, JPA, KMA, MH, BH, BSK, JR, MS, AS, PLZ, and CCS were principal investigators who contributed as follows: provision of patient care; data analysis and interpretation; development and critical revision of the manuscript; and provision of final approval of the submitted content. YW, YQ, LW, and ZX contributed as follows: data analysis and interpretation; statistical analyses; development and critical revision of the manuscript; and provision of final approval of the submitted content. All authors had full access to all data in the study and approved the decision to submit for publication.

Acknowledgments

Medical writing support was provided by Adrianne Spencer, PhD (CiTRUS Health Group), and was funded by ADC Therapeutics SA, in accordance with Good Publication Practice 2022 (GPP 2022) guidelines.

Funding

This study was funded by ADC Therapeutics SA.

Data-sharing statement

Proposals requesting de-identified participant data collected for the study following publication can be sent to clinical.trials@adctherapeutics.com and will be evaluated on a case-by-case basis.

Haematologica | 109 April 2024 1192 ARTICLE - LOTIS-2 1-yr/2-yr long-term responses P.F. Caimi et al.

References

1. Maurer MJ, Ghesquières H, Jais JP, et al. Event-free survival at 24 months is a robust end point for disease-related outcome in diffuse large B-cell lymphoma treated with immunochemotherapy. J Clin Oncol. 2014;32(10):1066-1073.

2. Crump M, Neelapu SS, Farooq U, et al. Outcomes in refractory diffuse large B-cell lymphoma: results from the international SCHOLAR-1 study. Blood. 2017;130(16):1800-1808.

3. Chow VA, Gopal AK, Maloney DG, et al. Outcomes of patients with large B-cell lymphomas and progressive disease following CD19-specific CAR T-cell therapy. Am J Hematol. 2019;94(8):E209-E213.

4 Westin J, Sehn LH. CAR T cells as a second-line therapy for large B-cell lymphoma: a paradigm shift? Blood. 2022;139(18):2737-2746.

5. Kansagra A, Farnia S, Majhail N. Expanding access to chimeric antigen receptor T-cell therapies: challenges and opportunities. Am Soc Clin Oncol Educ Book. 2020;40:1-8.

6. Zammarchi F, Corbett S, Adams L, et al. ADCT-402, a PBD dimer-containing antibody drug conjugate targeting CD19expressing malignancies. Blood. 2018;131(10):1094-1105.

7 Hartley JA, Flynn MJ, Bingham JP, et al. Pre-clinical pharmacology and mechanism of action of SG3199, the pyrrolobenzodiazepine (PBD) dimer warhead component of antibody-drug conjugate (ADC) payload tesirine. Sci Rep. 2018;8(1):10479.

8. ADC Therapeutics. ZYNLONTA® (loncastuximab tesirine-lpyl) [package insert]. https://www.adctherapeutics.com/wpcontent/uploads/2022/10/ZYLONTA-PI_October-2022_LOCKED. pdf. Accessed June 30, 2023.

9. European Medicines Agency. Zynlonta Product Information. https://www.ema.europa.eu/en/documents/productinformation/zynlonta-epar-product-information_en.pdf. Accessed June 30, 2023.

10 Caimi PF, Ai W, Alderuccio JP, et al. Loncastuximab tesirine in relapsed or refractory diffuse large B-cell lymphoma (LOTIS-2): a multicentre, open-label, single-arm, phase 2 trial. Lancet

Oncol. 2021;22(6):790-800.

11. Zinzani PL, Carlo-Stella C, Ai W, et al. LOTIS-2 follow-up analysis: updated results from a phase 2 study of loncastuximab tesirine in relapsed or refractory diffuse large B-cell lymphoma. Hematol Oncol. 2021;39(S2):252.

12. Cheson BD, Fisher RI, Barrington SF, et al. Recommendations for initial evaluation, staging, and response assessment of Hodgkin and non-Hodgkin lymphoma: the Lugano classification. J Clin Oncol. 2014;32(27):3059-3068.

13. Smith SK, Zimmerman S, Williams CS, Zebrack BJ. Health status and quality of life among non-Hodgkin lymphoma survivors. Cancer. 2009;115(14):3312-3323.

14 Caimi PF, Hamadani M, Carlo-Stella C, et al. CD19 expression by IHC alone is not a predictor of response to loncastuximab tesirine: results from the LOTIS-2 clinical trial and quantitative systems pharmacology modeling. Blood. 2022;140(Supplement 1):9548-9550.

15. Caimi PF, Ardeshna KM, Reid E, et al. The antiCD19 antibody drug immunoconjugate loncastuximab achieves responses in DLBCL relapsing after antiCD19 CAR-T cell therapy. Clin Lymphoma Myeloma Leuk. 2022;22(5):e335-e339.

16. Hartley JA. Antibody-drug conjugates (ADCs) delivering pyrrolobenzodiazepine (PBD) dimers for cancer therapy. Expert Opin Biol Ther. 2021;21(7):931-943.

17 Lee TH, Kim WR, Poterucha JJ. Evaluation of elevated liver enzymes. Clin Liver Dis. 2012;16(2):183-198.

18. Xie J, Wu A, Liao L, et al. Characteristics and treatment patterns of relapsed/refractory diffuse large B-cell lymphoma in patients receiving ≥3 therapy lines in post-CAR-T era. Curr Med Res Opin. 2021;37(10):1789-1798.

19 Hamadani M, Liao L, Yang T, Chen L, Moskowitz C. Characteristics and clinical outcomes of patients with relapsed/refractory diffuse large B-cell lymphoma who received at least 3 lines of therapies. Clin Lymphoma Myeloma Leuk. 2022;22(6):373-381.

Haematologica | 109 April 2024 1193 ARTICLE - LOTIS-2 1-yr/2-yr long-term responses P.F. Caimi et al.

Polatuzumab vedotin plus bendamustine and rituximab or obinutuzumab in relapsed/refractory follicular lymphoma: a phase Ib/II study

Christopher R. Flowers,1° Matthew J. Matasar,2° Alex F. Herrera,3 Mark Hertzberg,4 Sarit Assouline,5 Judit Demeter,6 Andrew McMillan,7 Amitkumar Mehta,8 Stephen Opat,9 Marek Trněný,10 Lisa Musick,11 Jamie Hirata,11 Annie Yang11 and Laurie H. Sehn12

1Winship Cancer Institute of Emory University, Atlanta, GA, USA; 2Memorial Sloan Kettering Cancer Center, New York, NY, USA; 3City of Hope Medical Centre, Duarte, CA, USA; 4Prince of Wales Hospital and University of NSW, Sydney, New South Wales, Australia; 5Jewish General Hospital, Montreal, Quebec, Canada; 6Semmelweiss University, Budapest, Hungary; 7Center for Clinical Haematology, Nottingham University Hospitals NHS Trust, Nottingham, UK; 8University of Alabama at Birmingham, Birmingham, AL, USA; 9Clinical Haematology, Monash Health and Monash University, Clayton, Victoria, Australia; 10Charles University General Hospital, Prague, Czech Republic; 11Genentech Inc., South San Francisco, CA, USA and 12BC Cancer Centre for Lymphoid Cancer and The University of British Columbia, Vancouver, British Columbia, Canada

°Current address of CRF: MD Anderson Cancer Center, Houston, TX, USA

°Current address of MJM: Rutgers Cancer Institute of New Jersey, New Brunswick, NJ, USA

Abstract

Correspondence: C.R. Flowers

CRFlowers@mdanderson.org

Received: May 25, 2023.

Accepted: September 19, 2023.

Early view: September 28, 2023.

https://doi.org/10.3324/haematol.2023.283557

©2024 Ferrata Storti Foundation

Published under a CC BY-NC license

Follicular lymphoma (FL) is the most common type of indolent non-Hodgkin lymphoma. Despite treatment advances that have improved outcomes for patients with relapsed or refractory (R/R) FL, many patients still die from progressive disease or treatment-related toxicities. In the phase Ib/II GO29365 study (clinicaltrials.gov 02257567), the safety and efficacy of polatuzumab vedotin plus bendamustine and rituximab (Pola-BR) versus bendamustine and rituximab (BR) alone, and polatuzumab vedotin plus bendamustine and obinutuzumab (Pola-BG) as a single-arm cohort were evaluated in patients with R/R FL. Following the phase Ib safety run-in, patients were randomized 1:1 to receive Pola-BR or BR alone in the phase II stage; a separate non-randomized Pola-BG cohort was examined in the phase Ib/II expansion stage. Primary endpoints included safety and tolerability (phase Ib) and positron emission tomography complete response (PET-CR) rate by independent review committee (phase II). Overall, 112 patients were enrolled (phase Ib safety run-in: Pola-BR, N=6; phase II randomized cohort: Pola-BR, N=39; BR, N=41; phase Ib/II expansion cohort: Pola-BG, N=26). PET-CR rates were 66.7% (phase Ib safety run-in, Pola-BR); 69.2% (phase II randomized, Pola-BR); 63.4% (phase II randomized, BR); and 65.4% (phase Ib/II expansion Pola-BG). There was a higher occurrence of cytopenias with Pola-BR and Pola-BG than with BR; serious adverse events were more frequent with Pola-BR (61.4%) and Pola-BG (46.2%) than with BR (29.3%). Overall, this analysis does not demonstrate a benefit of adding Pola to BR or BG regimens for patients with R/R FL.

Introduction

Follicular lymphoma (FL) is an indolent B-cell lymphoma that accounts for 20% of all non-Hodgkin lymphomas.1

Although improved patient outcomes were observed with the introduction of anti-CD20 monoclonal antibodies, FL remains an incurable disease and patients frequently require multiple lines of treatment.2 Despite the available standard treatment options for relapsed or refractory (R/R)

FL, patients often die due to progressive disease (PD) or treatment-related toxicities.3,4 For these reasons, new therapeutic options are needed.

Polatuzumab vedotin is an antibody-drug conjugate (ADC) that targets CD79b to deliver a microtubule inhibitor, monomethyl auristatin E (MMAE), to malignant B cells.5-7 Once internalized in the cell, MMAE binds to microtubules and prevents cell division, thereby inducing apoptosis.8

Polatuzumab vedotin in combination with bendamustine

Haematologica | 109 April 2024 1194 - Non-Hodgkin Lymphoma ARTICLE

and rituximab (Pola-BR) has received approval from the European Medicines Agency and United States Food and Drug Administration for patients with R/R diffuse large B-cell lymphoma (DLBCL) based on data from the pivotal phase Ib/II GO29365 study (clinicaltrials.gov 02257567).9-11 Furthermore, obinutuzumab-chemotherapy combination demonstrated superiority compared with rituximab-chemotherapy in patients with previously untreated FL in the phase III GALLIUM study (clinicaltrials.gov 01332968).12 Improved progression-free survival (PFS) with obinutuzumab versus rituximab has been demonstrated across the most commonly used chemotherapy backbones, including bendamustine.13

Here, we present efficacy and safety data from patients with R/R FL enrolled in the GO29365 study. The cohorts included in this analysis are patients who received Pola-BR versus bendamustine and rituximab (BR) alone, and a single-arm expansion cohort of polatuzumab vedotin in combination with bendamustine and obinutuzumab (Pola-BG).

Methods

Trial conduct

This international, multicenter, open-label, phase Ib/II GO29365 study evaluated the safety, tolerability, and efficacy of Pola-BR, BR, and Pola-BG in patients with R/R FL or R/R DLBCL. Safety and efficacy results have been previously reported for the DLBCL cohorts.14,15 This analysis includes the R/R FL cohorts only.

The study protocol was approved by applicable ethics committees and institutional review boards in accordance with the International Conference on Harmonization Guidelines for Good Clinical Practice, and the Declaration of Helsinki.16 All patients provided informed consent. An Independent Review Committee (IRC), including board-certified radiologists and an oncologist experienced in malignant lymphoma, assessed all patients for end-of-treatment (EOT) response based on imaging and bone marrow biopsy

results during the phase II part of the study.

Patient population

Eligible patients were aged ≥18 years with histologically confirmed R/R FL (grade 1, 2 or 3a), and an Eastern Cooperative Oncology Group performance status (ECOG PS) of 0-2. Patients had received ≥1 prior therapy for FL and were considered relapsed or refractory to their last treatment. Patients who had received prior bendamustine were considered eligible if they had a response duration of ≥1 year following treatment. Patients were excluded if they had received treatment with any monoclonal antibodies, radioimmunoconjugate, or ADC within five half-lives or four weeks (whichever was longer) prior to cycle (C) 1, day (D) 1 of the study regimen. Full details of the inclusion and exclusion criteria are shown in Online Supplementary Table S1

Study design

The study comprised a phase Ib safety run-in stage of Pola-BR and Pola-BG, followed by a phase II randomized stage to evaluate Pola-BR versus BR, and a phase II expansion stage to evaluate Pola-BG (Figure 1), which was recruited in parallel with the randomized cohort. Patients were randomized 1:1, and stratified by duration of response to prior therapy (≤12 months vs. >12 months) and disease burden (high vs. low, as defined by the Groupe d’Étude des Lymphomes Folliculaires criteria17). Patients were treated for up to six 28-day cycles and received the regimens above with dosing of intravenous (IV) bendamustine 90 mg/m2 on D2 and D3 of C1, and D1 and D2 of subsequent cycles; IV rituximab 375 mg/m2 on D1 of each cycle; IV obinutuzumab 1,000 mg on D1, D8 and D15 of C1 and D1 of subsequent cycles; and IV polatuzumab vedotin 1.8 mg/kg on D2 of C1 and D1 of subsequent cycles.

Primary prophylaxis against neutropenia with granulocyte-colony stimulating factor was required during each cycle of therapy, according to American Society of Clinical Oncology guidelines18 or institutional standards at each site. Also, antiviral and antipneumocystis prophylaxis was

Haematologica | 109 April 2024 1195 ARTICLE - Polatuzumab vedotin combination therapy in R/R FL C.R. Flowers et al.
Figure 1. GO29365 study design: follicular lymphoma cohorts. BG: bendamustine plus obinutuzumab; BR: bendamustine plus rituximab; Pola: polatuzumab vedotin; Pola-BG: polatuzumab vedotin plus bendamustine and obinutuzumab; Pola-BR: polatuzumab vedotin plus bendamustine and rituximab; N: number; R: randomization.

required from initiation of study treatment until ≥6 months after completion of treatment.

Study assessments and endpoints

The primary endpoints were safety and tolerability (phase Ib), and IRC-assessed [18F]fluorodeoxyglucose-positron emission tomography-computed tomography (PET-CT) complete response (CR) rate using modified Lugano Response Criteria19 6-8 weeks after C6, D1 or last dose of study medication (phase II). Secondary endpoints included objective response at EOT and best objective response. Exploratory endpoints included efficacy outcomes by biomarker status (including CD79b expression, which is presented in this analysis), investigator (INV)-assessed duration of response (DOR), PFS, event-free survival, and overall survival (OS). Responses were assessed by CT or PET-CT after C3 (interim) and at EOT (primary response assessment). Follow-up CT scans were performed every six months until PD or patient withdrawal, or for up to approximately two years after completing study treatment. Patients who were in

remission after two years of scans were not required to continue surveillance imaging in this study.

Results

Patient population

Between February 3, 2015 and September 20, 2016, 112 patients with R/R FL were enrolled into separate arms of the GO29365 study as follows: phase Ib safety run-in (Pola-BR, N=6), phase II randomized cohort (Pola-BR, N=39; BR, N=41), phase Ib/II expansion cohort (Pola-BG, N=26).

Patients’ demographics and baseline characteristics are described in Table 1. Patients in all treatment groups had received a similar number of lines of prior treatment, with more than half of patients receiving ≥2 lines. Refractory status to last therapy was also similar between treatment groups, although fewer patients in the Pola-BG group had PD within 24 months of initiation of the first anti-lymphoma treatment with chemoimmunotherapy (POD24) (Table 1). High

BR: bendamustine plus rituximab; ECOG PS: Eastern Cooperative Oncology Group performance status; FLIPI: Follicular Lymphoma International Prognostic Index; Pola-BR: polatuzumab vedotin plus bendamustine and rituximab; Pola-BG: polatuzumab vedotin plus bendamustine and obinutuzumab. *No response or progression within 6 months of last treatment.†POD24: progression of disease within 24 months of initial diagnosis. Defined as progression of disease within 24 months of initiation of first anti-lymphoma treatment with chemoimmunotherapy.

Haematologica | 109 April 2024 1196 ARTICLE - Polatuzumab vedotin combination therapy in R/R FL C.R. Flowers et al.
Phase Ib safety run-in Phase II randomized Phase Ib/II expansion Pola-BR N=6 Pola-BR N=39 BR N=41 Pola-BG N=26 Median age in years (range) 68 (54-73) 65 (37-74) 63 (39-80) 62 (37-86) Age ≥65 years, N (%) 5 (83.3) 20 (51.3) 17 (41.5) 10 (38.5) Male, N (%) 2 (33.3) 21 (53.8) 18 (43.9) 14 (53.8) ECOG PS score, N (%) 0 1 2 Unknown 3 (50.0) 3 (50.0) 0 0 20 (51.3) 15 (38.5) 3 (7.7) 1 (2.6) 28 (68.3) 8 (19.5) 5 (12.2) 0 16 (61.5) 10 (38.5) 0 0 Ann Arbor stage III/IV, N (%) 6 (100) 33 (84.6) 34 (82.9) 21 (80.8) FLIPI score ≥3, N (%) 2 (33.3) 24 (61.5) 16 (39.0) 14 (53.8) Bulky disease (≥7.5 cm), N (%) 2 (33.3) 6 (15.4) 5 (12.2) 4 (15.4) Extranodal disease, N (%) 4 (66.7) 19 (48.7) 24 (58.5) 14 (53.8) Median number of prior therapies (range) 1 line, N (%) 2 lines, N (%) ≥3 lines, N (%) 2 (1-3) 2 (33.3) 2 (33.3) 2 (33.3) 2 (1-5) 18 (46.2) 9 (23.1) 12 (30.8) 2 (1-5) 20 (48.8) 7 (17.1) 14 (34.1) 2 (1-7) 10 (38.5) 5 (19.2) 9 (34.6) Prior bendamustine, N (%) 0 2 (5.1) 6 (14.6) 4 (15.4) Prior stem cell transplant, N (%) 1 (16.7) 4 (10.3) 2 (4.9) 3 (11.5) Refractory to last therapy,* N (%) 3 (50.0) 17 (43.6) 18 (43.9) 11 (42.3) Refractory to last anti-CD20, N (%) 1 (16.7) 12 (30.8) 18 (43.9) 9 (34.6) POD24 status,† N (%) 2 (33.3) 14 (35.9) 10 (24.4) 3 (11.5)
Table 1. Baseline patients’ characteristics.

levels of CD79b protein expression (H-score ≥200 or ≥2) were observed in 97/100 (97.0%) patients with FL across all cohorts in this analysis.

At the clinical cut-off date (October 21, 2021), median duration of follow up was: phase Ib safety run in (Pola-BR), 74.8 months (95% confidence interval [CI]: 70.3not evaluable [NE]); phase II randomized (Pola-BR), 62.4 months (95% CI: 60.8-64.5), (BR), 60.4 months (95% CI: 59.4-62.4); phase Ib/II expansion (Pola-BG), 65.0 months (95% CI: 61.6-65.4).

Efficacy

Efficacy outcomes in the FL cohorts are summarized in Table 2. Similar IRC-assessed PET-CR rates were observed across treatment arms at the primary response assessment: phase Ib safety run-in (Pola-BR) 66.7% (4/6 patients); phase II randomized (Pola-BR) 69.2% (27/39), (BR) 63.4% (26/41); phase Ib/II expansion (Pola-BG) 65.4% (17/26). Among patients who responded to treatment (CR or partial response), median INV-assessed DOR was 16.4 months in the phase II randomized Pola-BR group versus 18.1 months in the BR group and was not reached in the phase Ib/II expansion Pola-BG group (Online Supplementary Figure S1).

In the phase II randomized cohort, median INV-assessed PFS was 18.5 months (95% CI: 15.9-30.4) in the Pola-BR

arm and 17.8 months (95% CI: 12.5-35.0) in the BR arm (Figure 2A). In the phase Ib/II expansion (Pola-BG) arm, median INV-assessed PFS was 40.5 months (95% CI: 23.1-NE) (Figure 2B). Median OS was not reached in either the phase II randomized Pola-BR or BR arms (Figure 2C) or the phase Ib/II expansion Pola-BG arm (Figure 2D). INV-assessed PFS and OS rates by baseline risk factors are shown in Figure 3A and B. INV-assessed PFS and OS were generally similar between patients receiving Pola-BR or BR across the subgroups included.

Subsequent therapies

New anti-lymphoma therapy (NALT) data in the FL cohorts are shown in Table 3. Patients did not receive maintenance treatment as part of this regimen. One patient proceeded to receive chimeric antigen receptor T-cell therapy in the phase II randomized Pola-BR arm. In total, 9 patients received subsequent stem cell transplants (5 autologous, 4 allogeneic): one in the phase Ib safety run-in Pola-BR arm, one in the phase 1b safety run-in Pola-BG arm, 4 in the phase II randomized BR arm, one in the phase II randomized Pola-BR arm, and 2 in the Pola-BG expansion arm.

Safety

A summary of patient safety across the three treatment

End-of-treatment response,* N (%), 95% CI IRC assessed

ORR (CR/PR)

CR

Investigator-assessed

ORR (CR/PR)

CR

Best overall response† (INV), N (%), 95% CI

ORR (CR/PR)

CR

Duration of response (INV)

Patients with event, N (%)

Median in months (95% CI)

Progression-free

5 (83.3), 35.9-99.6

4 (66.7), 22.3-95.7

5 (83.3), 35.9-99.6

4 (66.7), 22.3-95.7

6 (100.0), 54.1-100.0

5 (83.3), 35.9-99.6

4/6 (66.7)

36.3 (16.1-NE)

30 (76.9), 60.7-88.9

27 (69.2), 52.4-83.0

31 (79.5), 63.5-90.7

25 (64.1), 47.2-78.8

35 (89.7), 75.8-97.1

30 (76.9), 60.7-88.9

28/35 (80.0)

16.4

30 (73.2), 57.1-85.8

26 (63.4), 46.9-77.9

33 (80.5), 5.1-91.2

26 (63.4), 46.9-77.9

37 (90.2), 76.9-97.3

27 (65.9), 49.4-79.9

23 (88.5), 69.9-97.6

17 (65.4), 44.3-82.8

23 (88.5), 69.9-97.6

18 (69.2), 48.2-85.7

24 (92.3), 74.9-99.1

21 (80.8), 60.7-93.5

BG: bendamustine plus obinutuzumab; BR: bendamustine plus rituximab; CI: Confidence Interval; CR: complete response; CT: computed tomography; INV: investigator-assessed; IRC: independent review committee; N: number; NE: not evaluable; ORR: objective response rate; PET: positron emission tomography; Pola-BR: polatuzumab vedotin plus bendamustine and rituximab; Pola-BG: polatuzumab vedotin plus bendamustine and obinutuzumab; PR: partial response. *At primary response assessment by PET. †By PET-CT or CT.

Haematologica | 109 April 2024 1197 ARTICLE - Polatuzumab vedotin combination therapy in R/R FL C.R. Flowers et al.
Phase Ib safety run-in Phase II randomized Phase Ib/II expansion Pola-BR N=6 Pola-BR N=39 BR N=41 Pola-BG N=26
Table 2. Summary of efficacy outcomes.
(14.0-27.8) 24/37 (64.9) 18.1 (13.3-39.6) 9/24 (37.5) NE (22.9-NE)
survival (INV)
with event, N (%) Median in months (95% CI) 48-month landmark, % (95% CI) 4 (66.7) 38.9 (18.4-NE) 50.0 (10.0-90.0) 30 (76.9) 18.5 (15.9-30.4) 20.4 (7.1-33.6) 27 (65.9) 17.8 (12.5-35.0) 28.5 (13.4-43.5) 11 (42.3) 40.5 (23.1-NE) 46.5 (22.3-70.8)
survival
with event, N (%) Median in months (95% CI) 60-month landmark, % (95% CI) 2 (33.3) NE 83.3 (53.5-100.0) 16 (41.0) NE 59.1 (43.2-75.1) 11 (26.8) NE 69.4 (54.2-84.7) 5 (19.2) NE 80.0 (64.3-95.8)
Patients
Overall
Patients
Haematologica | 109 April 2024 1198 ARTICLE - Polatuzumab vedotin combination therapy in R/R FL C.R. Flowers et al.
A B C D
Figure 2. Kaplan-Meier curves of investigator-assessed progression-free and overall survival. (A) Progression-free survival (PFS) in randomized polatuzumab vedotin (Pola) plus bendamustine and rituximab (Pola-BR) and bendamustine plus rituximab (BR) arms. (B) PFS in phase Ib/II expansion (Pola-BR plus bendamustine and obinutuzumab [Pola-BG]) arm. (C) Overall survival (OS) in randomized Pola-BR and bendamustine plus rituximab (BR) arms. (D) OS in phase Ib/II expansion (Pola-BG) arm. CI: Confidence Interval; N: number; NE: not evaluable.
Haematologica | 109 April 2024 1199 ARTICLE - Polatuzumab vedotin combination therapy in R/R FL C.R. Flowers et al. Continued
A
on following page.

3.

effects of baseline variables on investigator-assessed progression-free and overall survival in patients in the phase II randomized cohort treated with polatuzumab vedotin plus bendamustine and rituximab or bendamustine plus rituximab. (A) Progression-free survival (PFS). (B) Overall survival (OS). BR: bendamustine plus rituximab; CI: Confidence Interval; DOR: duration of response; ECOG PS: Eastern Cooperative Oncology Group performance status; FL: follicular lymphoma; FLIPI: Follicular Lymphoma International Prognostic Index; HR: hazards ratio; N: number; POD24: progression within 24 months of treatment; Pola-BR: polatuzumab vedotin plus bendamustine and rituximab; NE: not evaluable.

Haematologica | 109 April 2024 1200 ARTICLE - Polatuzumab vedotin combination therapy in R/R FL C.R. Flowers et al.
B
Figure Forest plot showing the

arms is presented in Table 4. The median number of treatment cycles completed was 5 (range: 1-6) in the Pola-BR arm, 3 (range: 1-6) with BR, and 6 (range: 1-6) with Pola-BG (Online Supplementary Table S2). Adverse events (AE) were the main cause of treatment discontinuation across all arms. Median duration on treatment was 4.7 months in all treatment arms. The most common all-grade and grade 3-4 AE are summarized in Table 5; infections and cytopenias were the most common. In the randomized groups, rates of all-grade and grade 3-4 neutropenia, febrile neutropenia, and anemia were greater with Pola-BR than with BR, and all-grade and grade 3-4 thrombocytopenia was greater with BR than with Pola-BR. Rates of all-grade non-hematologic AE were generally higher with Pola-BR than with BR (Table 5).

Serious AE (SAE) were observed in 27/44 (61.4%) patients who received Pola-BR, 12/41 (29.3%) patients who received BR, and 12/26 (46.2%) patients who received Pola-BG. SAE were mostly infections and infestations: Pola-BR group N=16 (including pneumonia, N=7); BR group, N=6; Pola-BG group, N=7. In the Pola-BR group, 7 patients had SAE categorized as blood and lymphatic disorders.

Peripheral neuropathy (PN) was reported in 19/44 (43.2%) patients in the Pola-BR group, 11/41 (26.8%) patients in the BR group, and 14/26 (53.8%) patients in the Pola-BG group. PN was mostly grade 1-2 in all treatment groups; grade 3 PN was reported in one patient (gait disturbance; unresolved at time of patient’s death) in the Pola-BR group and one patient (hypoesthesia; resolved 19 days after onset) in the Pola-BG group. PN was mostly resolved by the data cut-off date (PN resolved in 13/19 [68.4%] patients in the Pola-BR group, 8/11 [72.7%] in the BR group, and 10/14 [71.4%] in the Pola-BG group). Dose reductions due to PN were reported in one and 2 patients in the Pola-BR and Pola-BG groups, respectively; dose interruption due to PN was reported in one patient, in the Pola-BG group.

Secondary malignancies were reported in 4/41 (9.8%) patients in the Pola-BR group (endometrial cancer, acute myeloid leukemia, colon cancer, and Hodgkin lymphoma [each N=1]), 7/41 (17%) patients in the BR group (basal cell carcinoma, gastrointestinal adenocarcinoma [each N=2], pancreatic carcinoma, rectal cancer, squamous cell carcinoma of the skin [each N=1]), and 1/26 (4%) patient in the Pola-BG group (endometrial adenocarcinoma).

BR: bendamustine plus rituximab; CAR: chimeric antigen receptor; N: number; NALT: new anti-lymphoma therapy; Pola-BR: polatuzumab vedotin plus bendamustine and rituximab; Pola-BG: polatuzumab vedotin plus bendamustine and obinutuzumab. *Includes any monotherapy, multi-drug, or cell-based regimen.

AE: adverse event; BR: bendamustine plus rituximab; N: number; Pola-BR: polatuzumab vedotin plus bendamustine and rituximab; Pola-BG: polatuzumab vedotin plus bendamustine and obinutuzumab.

Haematologica | 109 April 2024 1201 ARTICLE - Polatuzumab vedotin combination therapy in R/R FL C.R. Flowers et al.
Phase Ib safety run-in Phase II randomized Phase Ib/II expansion Pola-BR N=6 Pola-BR N=38 BR N=41 Pola-BG N=26 Patients with ≥1 NALT, N (%) 2 (33.3) 24 (63.2) 23 (56.1) 8 (30.8) N of systemic therapy regimens received* 4 71 78 19 Patients who received ≥1
Stem
CAR T-cell therapy, N (%) 2 (33.3) 1 (16.7) 0 (0.0) 24 (63.2) 0 (0.0) 1 (2.6) 23 (56.1) 3 (7.3) 0 (0.0) 8 (30.8) 2 (7.7) 0 (0.0)
Table 3. Number of patients who received new anti-lymphoma therapy: safety-evaluable population.
systemic therapy, N (%)
cell transplant, N (%)
Phase II randomized Phase Ib/II expansion Pola-BR N=38 BR N=41 Pola-BG N=26 Total N of events 664 402 521 Patients with ≥1 AE, N (%) Grade 5 Grade 3-4 Serious AE Leading to treatment discontinuation Leading to treatment dose delay/interruption Leading to dose reduction 38 (100) 8 (21.1) 31 (81.6) 25 (65.8) 9 (23.7) 17 (44.7) 8 (21.1) 41 (100) 4 (9.8) 26 (63.4) 12 (29.3) 5 (12.2) 11 (26.8) 3 (7.3) 26 (100) 2 (7.7) 21 (80.8) 12 (46.2) 6 (23.1) 13 (50.0) 5 (19.2)
Table 4. Safety summary in the follicular lymphoma cohorts.

Grade 5 AE were observed in 8 (18.2%) patients who received Pola-BR, 4 (9.8%) patients who received BR, and 2 (7.7%) patients who received Pola-BG. Three of the events were considered by the investigator to be related to study treatment, one in each cohort. The majority of the deaths (9/14; 64%) occurred more than 90 days after the last dose of study drug. Eight patients experienced the event following PD or after initiating NALT. Grade 5 infections and infestations included pneumonia (N=1, Pola-BR), sepsis (N=1, BR), SARS-CoV-2 infection-induced pneumonia (N=1, Pola-BR), septic shock (N=1, BR), and progressive multifocal leukoencephalopathy (N=1, Pola-BG). A summary of all deaths in the safety-evaluable population is shown in Online Supplementary Table S3.

Discussion

In this study, efficacy outcomes were generally consistent across treatment groups. High IRC-assessed PET-CR rates were observed in all treatment arms at EOT (Table 2) and were comparable to results reported in the GADOLIN (bendamustine + obinutuzumab) and AUGMENT (lenalidomide + rituximab) trials.20,21 Furthermore, overall response rate and best overall responses were similar across treatment arms.

In the randomized arms, time-to-event endpoints were similar in patients treated with Pola-BR and BR. Notably, despite five years of follow up, the median DOR was not reached for the Pola-BG arm. The median PFS was twice as long for patients in the Pola-BG group than in the Pola-BR group, although patients were not randomized between these arms and the 95% CI for DOR and PFS overlapped. In this small cohort, there was a lower proportion of patients in the Pola-BG group with POD24, and the median age was lower, compared with patients in the Pola-BR arm, which may explain the longer median PFS with Pola-BG versus Pola-BR. The efficacy benefits previously reported with polatuzumab vedotin in the R/R DLBCL cohorts of this study9 were not observed in this current analysis of patients with R/R FL. As expected, higher objective response and CR rates were observed with the triplet combination of Pola+BR than with the doublet combination of Pola+R reported in the phase II ROMULUS study (clinicaltrials.gov 01691898), in which the objective response rate for patients with FL was 70% (95% CI: 47-88), and the CR rate was 45% (95% CI: 23-68).22 However, differences in study design and patient populations limit the value of cross-trial comparisons. Hematologic toxicities were more frequent in the Pola-BR group than in the BR or Pola-BG groups. For example, higher rates of grade 3/4 neutropenia were observed with

13

19 (73.1)

16 (61.5)

16 (61.5)

14 (53.8)

11 (42.3)

8 (30.8)

4 (15.4)

2 (7.7)

7 (26.9)

0 (0.0)

13 (50.0)

9 (34.6)

6 (23.1)

6 (23.1)

6 (23.1)

AE: adverse event; BR: bendamustine plus rituximab; Pola-BR: polatuzumab vedotin plus bendamustine and rituximab; Pola-BG: polatuzumab vedotin plus bendamustine and obinutuzumab; SOC: system organ class. *Most common blood and lymphatic system disorder AE defined as incidence ≥10% (any grade) in any treatment group. †Most common non-hematologic disorder AE defined as incidence ≥20% (any grade) in any treatment group.

Haematologica | 109 April 2024 1202 ARTICLE - Polatuzumab vedotin combination therapy in R/R FL C.R. Flowers et al.
Phase II randomized Phase Ib/II expansion Pola-BR N=38 BR N=41 Pola-BG N=26 All grade Grade 3-4 All grade Grade 3-4 All grade Grade 3-4 Blood and lymphatic disorders, N (%)* Neutropenia Febrile neutropenia Thrombocytopenia Anemia Lymphopenia 17 (44.7) 6 (15.8) 4 (10.5) 6 (15.8) 3 (7.9) 12 (31.6) 6 (15.8) 1 (2.6) 4 (10.5) 3 (7.9) 11 (26.8) 2 (4.9) 8 (19.5) 5 (12.2) 3 (7.3) 8 (19.5) 2 (4.9) 4 (9.8) 0 (0.0) 3 (7.3) 8 (30.8) 2 (7.7) 5 (19.2) 3 (11.5) 3 (11.5) 8 (30.8) 2 (7.7) 3 (11.5) 1 (3.8) 3 (11.5) Non-hematologic disorders, N (%)† Infections (SOC) Nausea Fatigue Diarrhea Constipation Decreased appetite Pyrexia Pneumonia Headache Asthenia Vomiting Dyspnea Alopecia Peripheral neuropathy Upper respiratory tract infection 31 (81.6) 22 (57.9) 16 (42.1) 16 (42.1) 10 (26.3) 10 (26.3) 9 (23.7) 9 (23.7) 8 (21.1) 8 (21.1) 7 (18.4) 4 (10.5) 1 (2.6) 6 (15.8) 3 (7.9) 14 (36.8) 0 (0.0) 2 (5.3) 4 (10.5) 0 (0.0) 0 (0.0) 1 (2.6) 7 (18.4) 0 (0.0) 2 (5.3) 0 (0.0) 0 (0.0) 0 (0.0) 0 (0.0) 0 (0.0) 20 (48.8)
(31.7)
13
(31.7) 9 (22.0) 8 (19.5) 5 (12.2) 5 (12.2) 3 (7.3) 5 (12.2) 3 (7.3) 8 (19.5) 4 (9.8) 0 (0.0) 5 (12.2) 8 (19.5) 4 (9.8) 0 (0.0) 0 (0.0) 0 (0.0) 0 (0.0) 0 (0.0) 1 (2.4) 1 (2.4) 0 (0.0) 0 (0.0) 1 (2.4) 0 (0.0) 0 (0.0) 0 (0.0) 1 (2.4)
6 (23.1) 0 (0.0) 2 (7.7) 1 (3.8) 0 (0.0) 1 (3.8) 0 (0.0) 0 (0.0) 0 (0.0) 0 (0.0) 0 (0.0) 0 (0.0) 0 (0.0) 0 (0.0) 0 (0.0)
Table 5. Summary of the most common adverse events.

Pola-BR than with BR or Pola-BG, resulting in higher rates of febrile neutropenia and infections. SAE were also higher in the Pola-BR group; febrile neutropenia and pneumonia were the most frequently reported SAE. In this analysis, safety results were found to be consistent with the known safety profiles of polatuzumab vedotin, bendamustine, obinutuzumab, and rituximab.10,11 However, the rate of PN in the BR group (11/41; 26.8%) was surprising, since PN is not typically associated with BR.23,24 PN reported during the study was mostly grade 1-2 in all treatment groups, and in the BR group, nine out of eleven (81.8%) patients with PN experienced grade 1 events. Despite higher rates of AE, there was no difference in rates of treatment discontinuation between the study arms.

Baseline characteristics, including number of prior therapies and refractory status, were generally balanced between treatment arms, except for some characteristics associated with a better prognosis in the Pola-BG arm. These characteristics included younger median age, lower POD24 rate, patients with ECOG PS 0-1, and a longer duration from initial diagnosis and time since last treatment in the Pola-BG group than in the Pola-BR and BR groups. Among baseline variables, Ann Arbor stage I/II disease and prior autologous stem cell transplant appeared to be associated with more favorable outcomes with Pola-BR versus BR alone, although patient numbers in some of the subgroups were too small to draw definitive conclusions.

As most patients with FL experience relapse, and duration of response typically diminishes with subsequent lines of treatment, safer and more effective treatment options are needed.25 Adding polatuzumab vedotin to rituximab results in improved efficacy compared with rituximab monotherapy;22,26 however, a similar add-on benefit was not observed when combining Pola+BR. One potential rationale for the lack of benefit observed when adding polatuzumab vedotin to bendamustine combined with an anti-CD20 agent may be related to the considerable activity of bendamustine in patients with FL.20 In the current study, adding polatuzumab vedotin to BR did not improve on the already high response rates observed with BR/BG alone. The combination of polatuzumab vedotin plus rituximab could be a well-tolerated option in some patients with R/R FL who may not be candidates for bendamustine-based chemotherapy regimens. A limitation of this study was the modest sample size for all three study arms, in particular, the Pola-BG arm, in which only 26 patients were enrolled. Also, inclusion of patients who had previously received bendamustine with a response duration of ≥1 year (~10% of the population) could be considered a limitation, given the known negative impact of bendamustine on bone marrow.27

In conclusion, no difference in efficacy was observed between Pola-BR and BR, although higher rates of cytopenias and SAE were reported in patients who received Pola-BR versus BR alone. This analysis does not demonstrate a benefit of adding Pola to BR regimens for patients with R/R FL.

Disclosures

CRF reports consultancy for AbbVie, Bayer, BeiGene, Celgene, DenovoBiopharma, Foresight Diagnostics, Genentech Inc., F. Hoffmann-La Roche Ltd., Genmab, Gilead, Karyopharm, Pharmacyclics/Janssen, SeaGen, and Spectrum; research funding from 4D, AbbVie, Acerta, Adaptimmune, Allogene, Amgen, Bayer, Celgene, Cellectis, EMD, Gilead, F. Hoffmann-La Roche Ltd., Genentech Inc., Guardant, Iovance, Janssen Pharmaceutical, Kite, Morphosys, Nektar, Novartis, Pfizer, Pharmacyclics, Sanofi, Takeda, TG Therapeutics, Xencor, Ziopharm, Burroughs Wellcome Fund, Eastern Cooperative Oncology Group, National Cancer Institute, and V Foundation, Cancer Prevention and Research Institute of Texas: CPRIT Scholar in Cancer Research; and receives Foresight Diagnostics and NPower stock options. MJM reports consultancy for ADC Therapeutics, AstraZeneca, Bayer, Daiichi Sankyo, Epizyme, F. Hoffmann-La Roche Ltd., Genentech Inc., IMV Therapeutics, Juno Therapeutics, Karyopharm, Merck, MEI Pharma, Rocket Medical, Seattle Genetics, TG Therapeutics, Teva, and Bayer; research funding from AstraZeneca, Bayer, Genentech Inc., IGM Biosciences, Janssen, Pharmacyclics, F. Hoffmann-La Roche Ltd., and Seattle Genetics; honoraria from ADC Therapeutics, Bayer, Daiichi Sankyo, Epizyme, IMV Therapeutics, Janssen, MEI Pharma, Pharmacyclics, Genentech Inc., F. Hoffmann-La Roche Ltd., and Seattle Genetics; and receives Merck stocks. AFH reports consultancy for BMS, Genentech Inc., Merck, Seattle Genetics, AstraZeneca, Karyopharm, ADC Therap, Takeda, Tubulis, Regeneron, Genmab, Pfizer, Caribou, AbbVie and Adicet Bio; and research funding from Bristol Myers Squibb, Genentech Inc., Merck, Seattle Genetics, Kite Pharma, Gilead, AstraZeneca, and ADC Therapeutics. MH reports advisory board participation and honoraria for F. Hoffmann-La Roche Ltd., Takeda, Otsuka, BeiGene, Gilead, Janssen, Novartis, and Mundipharma. SA reports consultancy for Genentech Inc., F. Hoffmann-La Roche Ltd., Astra Zeneca, Novartis, BMS, Jazz, Gilead, Amgen, BeiGene, AbbVie, and Paladin; research funding for Novartis; and honoraria from Genentech Inc., F. Hoffmann-La Roche Ltd., Astra Zeneca, Novartis, BMS, Jazz, Gilead, Amgen, BeiGene, AbbVie, and Paladin. JD reports consultancy for AbbVie, BMS, Janssen-Cilag, Novartis, Pfizer, Takeda; and honoraria for Pfizer. AMc reports honoraria from F. Hoffmann-La Roche Ltd., Takeda, Amgen, and Prosthetics; and has served on speakers’ bureaux for F. Hoffmann-La Roche Ltd. AM reports research funding from Incyte, Takeda, Forty Seven Inc./Gilead, Juno Pharmaceuticals/BMS, Celgene/BMS, Innate Pharmaceuticals, Seattle Genetics, TG Therapeutics, Affimed, Merck, Kite/Gilead, F. Hoffmann La-Roche Ltd., Genentech Inc., I-MAB; consultancy for Gilead, AstraZeneca, Pharmacyclics, Seattle Genetics, Incyte, Morphosys/Incyte, TG Therapeutics, Kyowa Kirin, Novartis, BMS, BeiGene; and has served on speakers’ bureaux for Gilead, AstraZeneca, Pharmacyclics, Seattle Genetics, Incyte, Morphosys/Incyte, Kyowa Kirin, BMS, BeiGene. SO reports consultancy for AbbVie, AstraZeneca, BeiGene, CSL Behring,

Haematologica | 109 April 2024 1203 ARTICLE - Polatuzumab vedotin combination therapy in R/R FL C.R. Flowers et al.

Gilead, Jansssen, Merck, F. Hoffmann-La Roche Ltd., and Takeda; research funding for AbbVie, AstraZeneca, BeiGene, CSL Behring, Gilead, Janssen, Pharmacyclics, F. Hoffmann-La Roche Ltd., Sandoz, and Takeda; honoraria from AbbVie, AstraZeneca, BeiGene, CSL Behring, Gilead, Jansssen, Merck, F. Hoffmann-La Roche Ltd., and Takeda; and advisory board participation for AbbVie, AstraZeneca, BeiGene, CSL Behring, Gilead, Janssen, Merck, F. Hoffmann-La Roche Ltd., and Takeda. MT reports consultancy for Takeda, BMS, Incyte, AbbVie, Amgen, F. Hoffmann-La Roche Ltd., Gilead Sciences, Janssen, Morphosys, Novartis, and Zentiva; and research funding from F. Hoffmann-La Roche Ltd., Takeda, and Novartis. LM, JH and AY are employees of Genentech Inc., and hold Genentech Inc. and F. Hoffmann-La Roche Ltd. stocks/stock options. LHS reports consultancy for AbbVie, Acerta, Amgen, Apobiologix, AstraZeneca, BMS/Celgene, Gilead, Incyte, Janssen, Kite, Karyopharm, Lundbeck, Merck, Morphosys, F. Hoffmann-La Roche Ltd., Genentech Inc., Sandoz, Seattle Genetics, Servier, Teva, Takeda, TG Therapeutics, Verastem; research funding from F. Hoffmann-La Roche Ltd., Genentech Inc., Teva; and honoraria from AbbVie, Acerta, Amgen, Apobiologix, AstraZeneca, BMS/Celgene, Gilead, Incyte, Janssen, Kite, Karyopharm, Lundbeck, Merck, Morphosys, F. Hoffmann-La Roche Ltd., Genentech Inc., Sandoz, Seattle Genetics, Servier, Teva, Takeda, TG Therapeutics, and Verastem.

Contributions

JH, LM, CRF and LHS designed the clinical study and inter-

References

1. Monga N, Nastoupil L, Garside J, et al. Burden of illness of follicular lymphoma and marginal zone lymphoma. Ann Hematol. 2019;98(1):175-183.

2. Casulo C, Barr PM. How I treat early-relapsing follicular lymphoma. Blood. 2019;133(14):1540-1547.

3. Salles G. How do I sequence therapy for follicular lymphoma? Hematology Am Soc Hematol Educ Program. 2020;2020(1):287-294.

4 Sarkozy C, Maurer MJ, Link BK, et al. Cause of death in follicular lymphoma in the first decade of the rituximab era: a pooled analysis of French and US cohorts. J Clin Oncol. 2019;37(2):144.

5. Dornan D, Bennett F, Chen Y, et al. Therapeutic potential of an anti-CD79b antibody-drug conjugate, anti-CD79b-vc-MMAE, for the treatment of non-Hodgkin lymphoma. Blood. 2009;114(13):2721-2729.

6. Polson AG, Ho WY, Ramakrishnan V. Investigational antibodydrug conjugates for hematological malignancies. Expert Opin Investig Drugs. 2011;20(1):75-85.

7 Doronina SO, Toki BE, Torgov MY, et al. Development of potent monoclonal antibody auristatin conjugates for cancer therapy. Nat Biotechnol. 2003;21(7):778-784.

8. Assi R, Masri N, Abou Dalle I, et al. Polatuzumab vedotin: current role and future applications in the treatment of patients with diffuse large B-cell lymphoma. Clin Hematol Int. 2021;3(1):21.

9 Sehn LH, Herrera AF, Flowers CR, et al. Polatuzumab vedotin in relapsed or refractory diffuse large B-cell lymphoma. J Clin Oncol. 2020;38(2):155.

preted clinical data. AY contributed to the statistical analysis. LM and CRF wrote the manuscript with input and approval of the final version from all co-authors. All authors collected and analyzed the data, reviewed the data, provided critical review of the manuscript, confirmed the completeness and accuracy of the results and the trial’s fidelity to the protocol, and agreed on its submission for publication.

Funding

This study was sponsored by F. Hoffmann-La Roche Ltd. and Genentech, Inc. Third-party editorial assistance, under the direction of the authors, was provided by Carla Smith MSc of Ashfield MedComms, an Inizio company, and funded by F. Hoffmann-La Roche Ltd.

Data-sharing statement

For eligible studies, qualified researchers may request access to individual patient level clinical data through a data request platform. At the time of writing, this request platform is Vivli. https://go.roche.com/data_sharing. For up-to-date details on Roche’s Global Policy on the Sharing of Clinical Information and how to request access to related clinical study documents, see here: https://go.roche.com/data_sharing. Anonymized records for individual patients across more than one data source external to Roche cannot, and should not, be linked due to a potential increase in risk of patient re-identification.

10. European Medicines Agency. POLIVY® Summary of Product Characteristics. https://www.ema.europa.eu/en/documents/ product-information/polivy-epar-product-information_en.pdf. Accessed December 1, 2022.

11. U.S. Food and Drug Administration. POLIVY® Prescribing information. https://www.accessdata.fda.gov/drugsatfda_docs/ label/2023/761121s008lbl.pdf. Accessed December 1, 2022.

12. Hiddemann W, Barbui AM, Canales MA, et al. Immunochemotherapy with obinutuzumab or rituximab for previously untreated follicular lymphoma in the GALLIUM study: influence of chemotherapy on efficacy and safety. J Clin Oncol. 2018;36(23):2395-2404.

13. Townsend W, Hiddemann W, Buske C, et al. Obinutuzumab plus chemotherapy demonstrates long-term benefit over rituximab plus chemotherapy in patients with previously untreated follicular lymphoma: final analysis of the GALLIUM study. Hemasphere. 2022;6(S3):107-108.

14 Sehn LH, Herrera AF, Flowers CR, et al. Polatuzumab vedotin in relapsed or refractory diffuse large B-cell lymphoma. J Clin Oncol. 2020;38(2):155-165.

15. Sehn LH, Hertzberg M, Opat S, et al. Polatuzumab vedotin plus bendamustine and rituximab in relapsed/refractory DLBCL: survival update and new extension cohort data. Blood Adv. 2022;6(2):533-543.

16. World Medical Association. World Medical Association Declaration of Helsinki. Ethical principles for medical research

Haematologica | 109 April 2024 1204 ARTICLE - Polatuzumab vedotin combination therapy in R/R FL C.R. Flowers et al.

involving human subjects. Bull World Health Organ. 2001;79(4):373-374.

17 Brice P, Bastion Y, Lepage E, et al. Comparison in low-tumorburden follicular lymphomas between an initial no-treatment policy, prednimustine, or interferon alfa: a randomized study from the Groupe d’Etude des Lymphomes Folliculaires. Groupe d’Etude des Lymphomes de l’Adulte. J Clin Oncol. 1997;15(3):1110-1117.

18. Smith TJ, Bohlke K, Lyman GH, et al. Recommendations for the use of WBC growth factors: American Society of Clinical Oncology Clinical Practice Guideline Update. J Clin Oncol. 2015;33(28):3199-3212.

19 Cheson BD, Fisher RI, Barrington SF, et al. Recommendations for initial evaluation, staging, and response assessment of Hodgkin and non-Hodgkin lymphoma: the Lugano classification. J Clin Oncol. 2014;32(27):3059-3068.

20 Cheson BD, Chua N, Mayer J, et al. Overall survival benefit in patients with rituximab-refractory indolent non-Hodgkin lymphoma who received obinutuzumab plus bendamustine induction and obinutuzumab maintenance in the GADOLIN study. J Clin Oncol. 2018;36(22):2259-2266.

21. Leonard JP, Trneny M, Izutsu K, et al. AUGMENT: a phase III study of lenalidomide plus rituximab versus placebo plus rituximab in relapsed or refractory indolent lymphoma. J Clin Oncol. 2019;37(14):1188-1199.

22. Tilly H, Morschhauser F, Bartlett NL, et al. Polatuzumab vedotin in combination with immunochemotherapy in patients with previously untreated diffuse large B-cell lymphoma: an openlabel, non-randomised, phase 1b-2 study. Lancet Oncol. 2019;20(7):998-1010.

23. Hagemeister F, Manoukian G. Bendamustine in the treatment of non-Hodgkin’s lymphomas. Onco Targets Ther. 2009;2:269-279.

24. Rummel MJ, Niederle N, Maschmeyer G, et al. Bendamustine plus rituximab versus CHOP plus rituximab as first-line treatment for patients with indolent and mantle-cell lymphomas: an open-label, multicentre, randomised, phase 3 non-inferiority trial. Lancet. 2013;381(9873):1203-1210.

25. Erblich T, Montoto S. Treating relapsed follicular lymphoma. Expert Rev Hematol. 2018;11(5):403-410.

26. Ghielmini M, Schmitz S, Cogliatti S, et al. Prolonged treatment with rituximab in patients with follicular lymphoma significantly increases event-free survival and response duration compared with the standard weekly x 4 schedule. Blood. 2004;103(12):4416-4423.

27. Liewer S. Toxicity of bendamustine therapy. The Oncology Pharmacist. 2021. https://www.theoncologypharmacist.com/cat egories?view=article&secid=15091:faculty-perspectives-may2013-vol-4-no-3-top&artid=15761:toxicity-of-bendamustinetherapy&catid=4022. Accessed September 14, 2023.

Haematologica | 109 April 2024 1205 ARTICLE - Polatuzumab vedotin combination therapy in R/R FL C.R. Flowers et al.

Ribosomal protein S3 mediates drug resistance of proteasome inhibitor: potential therapeutic application in multiple myeloma

Gege Chen,1* Xuejie Gao,1* Xinyan Jia,1 Yingcong Wang,2 Li Xu,1 Dandan Yu,2 Shuaikang Chang,1 Hui Deng,1 Ke Hu,1 Guanli Wang,1 Bo Li,3 Zhijian Xu,3 Yumeng Lu,2 Huaping Wang,2 Ting Zhang,2 Dongliang Song,2 Guang Yang,2 Xiaosong Wu,2 Huabin Zhu,2 Weiliang Zhu3 and Jumei Shi1

1Department of Hematology, Shanghai East Hospital, Tongji University School of Medicine; 2Department of Hematology, Shanghai Tenth People’s Hospital, Tongji University School of Medicine and 3CAS Key Laboratory of Receptor Research, State Key Laboratory of Drug Research, Drug Discovery and Design Center, Shanghai Institute of Materia Medica, Chinese Academy of Sciences, Shanghai, China

*GC and XG contributed equally as first authors.

Abstract

Correspondence: J. Shi shijumei@tongji.edu.cn

W. Zhu wlzhu@simm.ac.cn

Received: January 20, 2023.

Accepted: September 15, 2023.

Early view: September 28, 2023.

https://doi.org/10.3324/haematol.2023.282789

Published under a CC BY license

Multiple myeloma (MM) remains incurable due to drug resistance. Ribosomal protein S3 (RPS3) has been identified as a non-Rel subunit of NF-κB. However, the detailed biological roles of RPS3 remain unclear. Here, we report for the first time that RPS3 is necessary for MM survival and drug resistance. RPS3 was highly expressed in MM, and knockout of RPS3 in MM inhibited cell growth and induced cell apoptosis both in vitro and in vivo. Overexpression of RPS3 mediated the proteasome inhibitor resistance of MM and shortened the survival of MM tumor-bearing animals. Moreover, our present study found an interaction between RPS3 and the thyroid hormone receptor interactor 13 (TRIP13), an oncogene related to MM tumorigenesis and drug resistance. We demonstrated that the phosphorylation of RPS3 was mediated by TRIP13 via PKC δ, which played an important role in activating the canonical NF-κB signaling and inducing cell survival and drug resistance in MM. Notably, the inhibition of NF-κB signaling by the small-molecule inhibitor targeting TRIP13, DCZ0415, was capable of triggering synergistic cytotoxicity when combined with bortezomib in drug-resistant MM. This study identifies RPS3 as a novel biomarker and therapeutic target in MM.

Introduction

Multiple myeloma (MM), a terminal differentiation of plasma cell hematological malignancy, typically evolves from asymptomatic precursor stages, i.e., monoclonal gammopathy of undetermined significance (MGUS) and smouldering multiple myeloma (SMM), which progress to symptomatic MM.1,2 MM is characterized by the infiltration of clonal plasma cells into the bone marrow (BM), producing high levels of M-protein (monoclonal globulin or immunoglobulin [Ig] fragment) and inducing end-organ damage, i.e., CRAB –hypercalcemia, renal injury, anemia, and/or bone lesions.1,2 While the overall survival (OS) of patients with MM has markedly improved with the introduction of chimeric antigen receptor T-cell immunotherapy, autologous stem cell transplantation, and novel agents like proteasome inhibitor bortezomib, immunomodulatory agents, and antibodies targeting cell surface molecules, a large majority of patients

still relapse and eventually become refractory owing to the complex genetic heterogeneity and clonal evolution of MM.3,4 Genomic alterations, including IgH translocations and hyperdiploidy, occur as early as in the precancerous stages MGUS and SMM, from which MM develops.5 The evolution of MM is reflected in the progressive increase in the number and complexity of genomic alterations, leading to universal aneuploidy and recurrent chromosomal aberrations, which are usually classified as chromosomal instability.5,6 Ribosomal protein S3 (RPS3), a component of the 40S subunit of the eukaryotic ribosome, directly participates in ribosome maturation and translation initiation.7 However, RPS3 is a multifunctional protein implicated in several extra-ribosomal events including DNA repair, apoptosis, selective gene transcription, and host-pathogen interactions, which are mediated by specific post-translational modifications, such as phosphorylation, methylation, and neddylation.8-11 Notably, RPS3 has been identified as a non-

Haematologica | 109 April 2024 1206 - Plasma Cell Disorders ARTICLE

Rel subunit of nuclear factor-κ B (NF-κB), capable of cooperating with NF-κB Rel proteins to regulate specific NF-κB target gene transcription.11,12 In resting cells, RPS3 interacts with NF-κB p65-p50-IκBα complexes in the cytoplasm.11,12 Extracellular stimuli, like tumor necrosis factor α (TNF-α) or lipopolysaccharides, trigger the canonical NF-κB pathway; IκB proteins are phosphorylated by activated IκB kinase (IKK) complex, which then induces the proteasomal degradation of IκB and its degradation from NF-κB complexes; NF-κB Rel complexes and non-Rel subunit RPS3 translocate from the cytoplasm to the nucleus, dramatically stabilizing the binding of NF-κB Rel subunits to specific κB sites that are involved in regulating multiple physiological conditions, e.g., cell survival, apoptosis, radioresistance, and immunoglobulin κ light chain gene expression in B cells.12-14 However, the detailed biological roles of RPS3 remain largely unknown. The thyroid hormone receptor interactor 13 (TRIP13) gene, located on the short arm p15 of chromosome 5, is one of the ten chromosomal instability genes highly linked to MM drug resistance and rapid relapse.15-17 We previously identified TRIP13 as an oncogene of MM and demonstrated that overexpression of TRIP13 promotes MM tumorigenesis, tumor progression, and drug resistance, making it a potentially novel therapeutic target of MM.15-17 Besides MM, elevated TRIP13 expression triggers malignant transformation and cancer development in breast cancer, colorectal cancer, lung adenocarcinoma and head and neck cancer.18-21 The AAA-ATPase TRIP13 protein, a member of a large AAA+ protein superfamily of ring-shaped P-loop NTPases, contributes to the regulation of spindle assembly checkpoints and DNA repair pathways during cell division.22-24 Recently, we have elucidated the crystal structure of wild-type human TRIP13 protein at a resolution of 2.6 Å, based on which we identified the first small-molecule inhibitor of TRIP13, DCZ0415, capable of binding to TRIP13 and exerting potent anti-myeloma activity by impairing DNA repair and inhibiting NF-κB pathway.17 However, the precise mechanisms of TRIP13 in mediating the drug resistance of MM remains unclear. Here, we demonstrated for the first time that RPS3 was necessary for MM survival and drug resistance, suggesting that it is a novel potential biomarker and therapeutic target in MM. Moreover, TRIP13-mediated phosphorylation of NF-κB non-Rel subunit RPS3 by PKCδ is important in activating the canonical NF-κB signaling and inducing drug resistance in MM. Notably, the inhibition of NF-κB signaling by DCZ0415 was capable of triggering synergistic drug-resistant MM cytotoxicity when combined with bortezomib.

Methods

Cells and patient samples

Cell lines were purchased from the American Type Culture Collection (Mananssas, VA, USA) or obtained as described in our previous articles.25,26 All samples were obtained from

patients with MM and normal donors who gave informed consent in accordance with the Declaration of Helsinki. Approval was obtained by the Shanghai Tenth People’s Hospital Institutional Review Board. Details are available in the Online Supplementary Appendix

Reagents and antibodies

DCZ0415 was synthesized at Shanghai Institute of Materia Medica, Chinese Academy of Sciences. Reagents and antibodies were purchased as detailed in the Online Supplementary Appendix.

Plasmids and viral transduction

The full-length cDNA of human TRIP13 and RPS3 were synthesized and cloned into the pLVX-EGFP-IRESpuro (Invitrogen, Carlsbad, CA, USA). The RPS3 mutation was generated by quick change point mutagenesis (Toyobo, Osaka, Japan). Details are available in the Online Supplementary Appendix

In vitro assays

In vitro assays including cell viability, EdU cell proliferation assay, colony formation, apoptosis measurement, cell cycle analysis, quantitative real-time polymerase chain reaction (qRT-PCR), nuclear and cytoplasmic protein extraction, dual-luciferase reporter assay immunoblotting, co-immunoprecipitation (Co-IP) and immunofluorescence were performed as described previously.17,27 Details are available in the Online Supplementary Appendix and Online Supplementary Table S1.

CRISPR/Cas9-mediated gene knockout

Knockout cells were generated using lentivirus-mediated CRISPR/Cas9 technology as described previously.17 The single guided RNA (sgRNA) sequences targeting human TRIP13 was: #1, TGAGTAGCTTTCTAACACTC, #2, CCAAGCTGTCCCAAAGCCCA. The sgRNA sequences targeting human RPS3 were: #1, CTCACCTCTACACTGCCCTC, #2, CTTTCCAGAGGGCAGTGTAG. Details are available in the Online Supplementary Appendix.

RNA sequencing

Total RNA was extracted using the RNA-Quick purification kit (ES Science, Shanghai, China) and preserved using TRIZOL (Ambion, Austin, TX, USA), which was sent to OE biotech Co., Ltd. (Shanghai, China) for RNA-sequencing (RNA-seq) analysis. Details are available in the Online Supplementary Appendix.

Gene expression analysis using publicly available data sets

The Kaplan-Meier analysis of OS and progression-free survival (PFS) in 436 newly diagnosed MM patients related to RPS3 expression was performed using the database with GSE136324. Gene expression profiles for healthy donors, patients with MM, MGUS, SMM and relapsed MM were performed using the Gene Expression Omnibus data sets (GSE5900 and GSE6477), 208692_at is the probe for RPS3.

Haematologica | 109 April 2024 1207 ARTICLE - RPS3 mediates MM survival and drug resistance G. Chen et al.

Gene expression analysis was performed using Partek Genomic Suite 6.6 with fold changes calculated as relative changes compared to normal plasma cells. Fold changes of at least 2-fold with a P<0.05 and a false discovery rate (FDR)<0.05 were considered for further analysis.

Animal studies

MM cells were injected subcutaneously into athymic nude mice (5-week-old). All animal procedures were approved by the Institutional Review Board of the Shanghai Tenth People’s Hospital (approval no. SHDSYY-2020-991). Details are available in the Online Supplementary Appendix.

Statistical analysis

All data are presented as the mean ± standard deviation of three separate experiments. Statistical significance was determined by Student’s t test or ANOVA using SPSS v22.0 (IBM, Armonk, NY, USA). P<0.05 was considered statistically significant. The CalcuSyn software program (Biosoft, Ferguson, MO, USA) was used to quantify the synergy of the two drugs, and a 95% confidence interval (CI) <1 indicated synergistic activity.

Results

TRIP13 activates the canonical NF-κB signaling

We first determined the role of TRIP13 in regulating NF-κB signaling by using RNA-seq analysis in TRIP13 overexpressing (TRIP13-OE) and the corresponding empty vector (EV)-transfected ARP-1 cells. The RNA-seq data analysis showed a subset of genes that were differentially expressed upon TRIP13 overexpression, including 533 upregulated genes and 232 downregulated genes (Figure 1A). The gene set enrichment (GSEA) analysis indicated that overexpression of TRIP13 in MM cells was positively correlated with NF-κB signaling activation (Figure 1B). In order to confirm the results, we performed immunoblotting to investigate the expression levels of proteins involved in NF-κB signaling and found that TRIP13 overexpression in MM cells effectively elevated levels of p-IKKb and p-IκBα (Figure 1C). Meanwhile, TNF-α elevated levels of NF-κB downstream p-IκBα, but knockout of TRIP13 in MM cells partly eliminated TNF-α-induced elevation of p-IκBα (Figure 1D). Moreover, we extracted NFκB p65 proteins in both nucleus and cytoplasm in TRIP13 OE and corresponding EV MM cells and observed that high expression of TRIP13 promoted the translocation of NF-κB p65 into the nuclei (Figure 1E). Similarly, knockout of TRIP13 partly eliminated TNF-α-induced nuclear translocation of NF-κB p65 (Figure 1F).

TRIP13 interacts with NF-κB non-Rel subunit RPS3

We subsequently performed liquid chromatography-tandem mass spectrometry (LC-MS/MS) to identify the potential interacting proteins of TRIP13. TRIP13-tagged Flag (Flag-TRIP13)

and Flag-vector were transfected into HEK293T cells to construct transient strains; TRIP13 and its binding proteins were then purified by Flag beads, and proteins interacting with TRIP13 were identified by mass spectrometry. More than 600 proteins interacting with TRIP13 were identified. We were interested in RPS3 as its key role in regulating NF-κB signaling (Figure 2A). We performed exogenous Co-IP in HEK293T cells transfected with Flag-TRIP13, HA-tagged RPS3 (HA-RPS3), or both constructs and observed that RPS3 interacted with TRIP13 (Figure 2B). We also confirmed the interaction between RPS3 and TRIP13 in ARP-1 cells via endogenous Co-IP (Figure 2C). Immunofluorescence showed that RPS3 was co-localized with TRIP13 in the cytoplasm under normal conditions, which then translocated into the nucleus when NF-κB signaling was activated by TNF-α (Figure 2D).

TRIP13 regulates the phosphorylation of RPS3 via PKCδ

In order to understand the regulatory mechanism of RPS3 and TRIP13, we assessed the PRS3 expression in MM cells (ARP-1 and OCI-MY5) with stable overexpression of TRIP13. There was no significant difference in total RPS3 expression between TRIP13-overexpressed MM cells and the corresponding control (Online Supplementary Figure S1A). Meanwhile, knockout of TRIP13 in MM cells using CRISPR-Cas9 had no significant effect on total RPS3 expression (Online Supplementary Figure S1B). The phosphorylation status of RPS3 has been studied in conjunction with its biological function. We, therefore, investigated the phosphorylation status of RPS3 in MM cells with stable overexpression of TRIP13 in the presence or absence of TNF-α. RPS3 was immunoprecipitated from TRIP13-OE and the corresponding EV MM cells, and then the phosphorylated residues were enriched by phosphorylated threonine (p-Thr), serine, and tyrosine. We observed that RPS3 was highly phosphorylated at threonine residue(s), especially in the presence of TNF-α (Figure 3A). In order to investigate the mechanism of phosphorylation, we performed mass spectrometry phosphoproteomic analysis to identify the potential phosphorylation sites of RPS3. Interestingly, phosphorylated threonine 221 (T221) on RPS3 was identified as a specific site that was affected by TRIP13 (Figure 3B; Online Supplementary Figure S2A). We then mutated the threonine 221 on RPS3 to alanine (T211A) by in vitro site-directed mutagenesis to inactivate the original phosphorylation site in MM cells and observed the expression of downstream effector protein p-IκBα in NF-κB signaling. Our results showed that the RPS3 T211A blocked TRIP13-induced phosphorylation of IκBα (Figure 3C), suggesting that the phosphorylation of RPS3 at T221 site is responsible for the TRIP13-driven NF-κB activation. Moreover, we have successfully generated a rabbit polyclonal antibody specific for RPS3 phosphorylated on T221. Immunoblotting analysis revealed a significant upregulation of phosphorylated RPS3 levels upon overexpression of TRIP13 in MM cells (Figure 3D). Subsequently, we conducted an investigation

Haematologica | 109 April 2024 1208 ARTICLE - RPS3 mediates MM survival and drug resistance G. Chen et al.

(A) RNA-sequencing analysis of the differentially expressed transcripts in empty vector (EV) and TRIP13-OE ARP-1 cells (red and blue represent high and low mRNA expression levels, respectively). Case represents ARP-1 cells stably transfected with TRIP13-OE; wild-type (wt) represents ARP-1 cells stably transfected with EV. (B) Gene set enrichment analysis (GSEA) indicated a positive correlation between TRIP13 overexpression and NF-κB signallng activation. NES: normalized enrichment score. (C) Immunoblotting analysis of proteins levels involved in canonical NF-κB signaling (IKKb, p-IKKb, IκBα, p-IκBα) in EV and TRIP13 OE ARP-1/OCI-MY5 cells. Actin served as a loading control. (D) Immunoblotting confirmed the knockout of TRIP13 (TRIP13-KO) in ARP-1 cells via CRISPR-Cas9 (upper panel). TRIP13-KO or the corresponding control ARP-1 cells were stimulated with or without TNF-α (30 ng/mL, 30 minutes), followed by immunoblotting analysis of IκBα and p-IκBα proteins levels (lower panel). Actin served as a loading control. (E) EV and TRIP13-OE ARP-1 cells were collected. Cytosolic and nuclear proteins were then extracted using a nuclear and cytoplasmic protein extraction kit, followed by immunoblotting analysis of NF-κB p65 levels in the cytoplasm and nucleus. Lamin B1 and GAPDH were used as loading controls for the nucleus and cytoplasm, respectively. (F) Confocal micrographs of TRIP13-KO and the corresponding control ARP-1 cells stimulated with or without TNF-α (30 ng/mL, 30 minutes). The fixed cells were stained with anti-NF-κB p65 (red) and the nuclear dye DAPI (blue). Scale bars =10 µM.

to ascertain the contribution of RPS3 in TRIP13-mediated drug resistance in MM cells. We reduced RPS3 expression in TRIP13-OE MM cells with short interfering RNA targeting RPS3 (siRPS3). Then, the TRIP13-OE, TRIP13-OE+siRPS3, or the EV-transfected MM cells were treated with bortezomib. Consistent with the previous findings, we found that overexpression of TRIP13 induced bortezomib resistance in MM; knockdown of RPS3 re-sensitized the effects of bortezomib on TRIP13-OE MM cells (Figure 3E).

Protein kinase C δ (PKCδ) is a serine-threonine protein kinase that has been demonstrated to phosphorylate T221 residues

of RPS3.28,29 In order to further validate the involvement of phosphorylation of T221 in the TRIP13-driven canonical NFκB activation, we first performed endogenous Co-IP with TRIP13 antibody in ARP-1 cells and observed an interaction of RPS3, TRIP13, and PKCδ (Figure 3F). Then, TRIP13-OE or EV MM cells (ARP-1/OCI-MY5) were treated with a potent and selective PKCδ inhibitor, BJE6-106. Immunoblotting showed that BJE6-106 suppressed TRIP13-induced activation of proteins in NF-κB signaling (Figure 3G), suggesting that PKCδ is responsible for the TRIP13-driven canonical NF-κB activation. We also determined the effect of BJE6-106 on

Haematologica | 109 April 2024 1209 ARTICLE - RPS3 mediates MM survival and drug resistance G. Chen et al.
A D E F B C
Figure 1. TRIP13 activates the canonical NF-κB signaling.

were transfected with Flag-TRIP13, HA-RPS3, or both constructs. Cell lysates were immunoprecipitated using anti-Flag and the immunoprecipitants or input were analyzed by immunoblotting with anti-HA or anti-Flag. (C) Endogenous co-immunoprecipitation was conducted with ARP-1 cells using anti-RPS3, followed by immunoblotting using anti-TRIP13 or anti-RPS3. Anti-IgG was used as a non-specific control. (D) Confocal micrographs of ARP-1 cells stimulated with or without TNF-α (30 ng/mL, 30 minutes). The fixed cells were stained with anti-TRIP13 (green), anti-RPS3 (red), and the nuclear dye DAPI (blue). Scale bars =10 µM.

the transcriptional activity of NF-κB in TRIP13-OE or EV MM cells by using a dual-luciferase reporter assay. The results revealed that overexpression of TRIP13 induced significant activation of NF-κB transcription, but the effect could be reversed by BJE6-106 (Figure 3H). We previously demonstrated that overexpression of TRIP13 induced bortezomib resistance in MM cells.15,17 We further determined whether PKCδ inhibitor could overcome TRIP13-induced bortezomib resistance of MM cells. TRIP13-OE or EV MM cells were treated with BJE6-106 in the presence or absence of bortezomib. Consistently, we observed that bortezomib significantly suppressed cell viability of EV MM cells but had no obvious effect on TRIP13-OE MM cells (Online Supplementary Figure S2B). Additionally, a significant decrease of cell viability was observed in TRIP13-OE MM cells in the presence of BJE6-106 and bortezomib (Online Supplementary Figure S2B).

RPS3 is highly expressed in multiple myeloma and is required for multiple myeloma survival in vitro and in vivo We determined the expression of RPS3 in MGUS, SMM, MM, relapsed MM and normal donors in two independent publicly available data sets. RPS3 was significantly overex-

pressed in MGUS, SMM, MM and relapsed MM compared to that in the corresponding normal donors (Figure 4A). We also compared the RPS3 messenger RNA (mRNA) levels in CD138-enriched plasma cells from five patients with MM and peripheral blood mononuclear cells from normal donors using qRT-PCR and confirmed high levels of RPS3 mRNA in MM (Online Supplementary Figure S3A). We further examined RPS3 expression using immunoblotting and observed upregulated RPS3 protein levels in patients with MM compared to that in the normal donors (Figure 2B). Meanwhile, immunohistochemistry using BM biopsies from patients with MM and normal donors showed higher RPS3 expression in MM than in the normal donors (Online Supplementary Figure S3B). Additionally, the Kaplan-Meier analysis showed that MM patients with higher RPS3 expression had significantly shorter overall survival and PFS (Figure 4C).

In order to elucidate the biological function of RPS3, RPS3 expression in MM cells (ARP-1/OCI-MY5) was stably knocked out using sgRNA targeting RPS3 (sg-RPS3) by CRISPR-Cas9 (Figure 4D). Results from Cell Counting Kit (CCK)-8 and EdU cell proliferation assays showed that knockout of RPS3 significantly suppressed proliferation of MM cells (Figure 4E;

Haematologica | 109 April 2024 1210 ARTICLE - RPS3 mediates MM survival and drug resistance G. Chen et al.
A B C D
Figure 2. TRIP13 interacts with NF-κB non-Rel subunit RPS3. (A) Peptides (upper panel, shaded regions) of RPS3, identified via mass spectrometry. Characteristic peptides of RPS3 identified by secondary mass spectrogram (lower panel). (B) HEK293T cells

Online Supplementary Figure S3C). Cell apoptosis analysis showed that RPS3 knockout induced significant MM cell apoptosis (Online Supplementary Figure S3D), which was further supported by increased levels of cleaved caspase

3/8/9 proteins in sg-RPS3 MM cells (Online Supplementary Figure S3E). Additionally, cell-cycle analysis suggested that knockout of RPS3 disrupted cell-cycle progression, with G2/M-phase arrest (Online Supplementary Figure S3F). Con-

Haematologica | 109 April 2024 1211 ARTICLE - RPS3 mediates MM survival and drug resistance G. Chen et al.
A C E F G H D B
Continued on following page.

3.

PKC

. (A) ARP-1 cells stably transfected with lentivirus-mediated human TRIP13-cDNA (TRIP13-OE) or the empty vector (EV) were stimulated with or without TNF-α (30 ng/mL, 30 minutes). Cell lysates were immunoprecipitated using anti-RPS3 and the immunoprecipitants or input were analyzed by immunoblotting with anti-TRIP13, anti-RPS3, anti-phosphorylated threonine (p-Thr). Actin served as a loading control. (B) Mass spectrometry phosphoproteomic analysis identified phosphorylated threonine 221 (T221) on RPS3. (C) Threonine 221 on RPS3 was mutated to alanine (T211A). EV and TRIP13-OE multiple myeloma (MM) cells were then transfected with RPS3 (WT) or T211A, followed by immunoblotting with IκBα or p-IκBα antibodies. Actin served as a loading control. (D) Immunoblotting detection of protein levels of RPS3 and phosphorylated RPS3 (p-RPS3) in EV and TRIP13-OE ARP-1/OCI-MY5 cells. Actin served as a loading control. (E) TRIP13-OE transfected with short interfering RNA targeting RPS3 (TRIP13-OE+siRPS3) or siCON (TRIP13-OE+siCON), or EV ARP-1 (left panel) and OCIMY5 (right panel) MM cells were treated with vehicle or bortezomib (5 nM) for 48 hours, followed by CCK-8 assay analysis of cell viability. Data are shown as mean ± standard deviation with P value based on unpaired t test (N=3, *P<0.05, **P<0.01). The experiments were repeated 3 times. (F) Endogenous co-immunoprecipitation was conducted with ARP-1 cells using anti-TRIP13, followed by immunoblotting using anti-TRIP13, anti-PKCδ, or anti-RPS3. Anti-IgG was used as a non-specific control. (G) EV and TRIP13-OE MM cells were treated with the 0.1 µM PKCδ inhibitor (PKCδi), BJE6-106, for 24 hours, followed by immunoblotting with IKKb, p-IKKb, IκBα or p-IκBα antibodies. Actin served as a loading control. (H) EV and TRIP13-OE ARP-1 (left panel) and OCI-MY5 (right panel) MM cells were transiently transfected with NF-κB luciferase reporter. The cells were then treated with or without 0.1 µM PKCδi (BJE6-106) for 24 hours, followed by a dual-luciferase reporter assay analysis of NF-κB transcriptional activity. Data are shown as mean ± standard deviation with P value based on unpaired t test (N=3, **P<0.01). The experiments were repeated 3 times.

sistently, immunoblotting demonstrated that RPS3 knockout significantly reduced the levels of G2/M-phase-related proteins including CDC25C, Cyclin B1, and CDK1 (Online Supplementary Figure S3G). In order to further evaluate the efficacy of RPS3 in MM growth in vivo, we established a MM xenograft model via subcutaneous injection of RPS3-knockout ARP-1 or the corresponding control cells in nude mice. As expected, RPS3 knockout significantly suppressed tumor growth in vivo (Figure 4F; Online Supplementary Figure S3H). Meanwhile, much lower tumor weight was observed in the RPS3-knockout group than in the control group (Online Supplementary Figure S3I). Additionally, immunohistochemistry showed that the proliferation marker Ki-67 was obviously decreased in the RPS3 knockout group than in the control (Online Supplementary Figure S3J). TUNEL assays revealed that RPS3 knockout induced increased cell apoptosis compared to the control (Online Supplementary Figure S3J).

RPS3 overexpression induces proteasome inhibitor resistance in multiple myeloma and is negatively correlated with multiple myeloma survival

We overexpressed RPS3 in the MM cells (ARP-1/OCI-MY5) using lentivirus-mediated human RPS3-cDNA (Figure 5A). We first evaluated the effect of RPS3 on MM proliferation with RPS3 overexpressed (RPS3-OE) or the empty vector (EV)-transfected MM cells. CCK-8 and EdU cell proliferation assays showed that overexpression of RPS3 significantly increased proliferation of MM cells (Figure 5B; Online Supplementary Figure S4A). RPS3-OE or EV-transfected MM cells were then treated with increasing concentrations of proteasome inhibitors bortezomib or carfizomib. Interestingly, we found that the proteasome inhibitors significantly decreased the cell viability of EV MM cells but had no obvious effects on RPS3-OE MM cells (Figure 5C; Online Supplementary Figure S4B). Additionally, colony formation assay showed that while RPS3 overexpression increased colony formation of MM, the proteasome inhibitors decreased the colony formation rate of EV MM cells but had a much less

effect on RPS3-OE MM cells (Online Supplementary Figure S4C, D). In order to further examine the in vivo efficacy of RPS3-induced drug resistance of MM, RPS3-OE or EV ARP-1 cells implanted subcutaneously in nude mice were treated with bortezomib or the vehicle. Consistent with the findings in vitro, we observed that bortezomib significantly suppressed tumor growth in the EV group but had no obvious effect on tumors in the RPS3-OE nude mice (Figure 5D; Online Supplementary Figure S4E). Meanwhile, immunohistochemistry showed an increase in Ki-67 expression in RPS3-OE tumors (Online Supplementary Figure S4F). Additionally, RPS3-OE mice treated with or without bortezomib displayed a significant decrease in survival as compared to that in mice in the EV or EV + bortezomib group (Figure 5E).

DCZ0415 synergizes with bortezomib in drug-resistant multiple myeloma cells in vitro and in vivo

Proteins involved in NF-κB signaling were activated in bortezomib-resistant (BR) cells (Online Supplementary Figure S5A). We also evaluated the expression of RPS3 at both mRNA and protein levels, including both total and phosphorylated forms, in isogenic pair of MM cell lines with induced resistance to bortezomib (H929/H929R and RPMI-8226/RPMI-8226R5).

We observed a notable upregulation of p-RPS3 in BR MM cells, while no significant differences were found in the expression levels of RPS3 at both mRNA (data not shown) and total protein levels when comparing BR MM cells with their sensitive counterparts (Online Supplementary Figure S5A). Our previous paper demonstrated that DCZ0415, a small inhibitor specifically targeting TRIP13, induced cell death by inhibiting the NF-κB signaling pathway.17 We further investigated the effects of DCZ0415 on NF-κB signaling. Immunoblotting showed that DCZ0415 significantly inactivated proteins (p-IKKb, p-p65, and p-IκBα) involved in NF-κB signaling (Online Supplementary Figure S5B). Meanwhile, immunofluorescence observed that DCZ0415 effectively hijacked the nuclear translocation of NF-κB p65 in H929R cells (Online Supplementary Figure S5C). In order to gain

Haematologica | 109 April 2024 1212 ARTICLE - RPS3 mediates MM survival and drug resistance G. Chen et al.
Figure TRIP13 regulates the phosphorylation of RPS3 via δ

Figure 4. RPS3 is overexpressed in multiple myeloma and is required for multiple myeloma survival in vitro and in vivo. (A) Analysis of RPS3 expression in normal donors (NPC), monoclonal gammopathy of undetermined significance (MGUS), smouldering multiple myeloma (SMM), multiple myeloma (MM) and relapsed MM by using 2 independent publicly available data sets from NCBI Gene Expression Omnibus (GEO) database under accession numbers (left GSE5900, right GSE6477). Statistics were calculated using Wilcoxon rank sum test. (B) Immunoblotting showed upregulated RPS3 protein levels in patients with MM and MM cell lines compared with that of the normal donors. Actin served as a loading control. (C) Kaplan-Meier curves of overall survival (OS) and progression-free survival (PFS) in 436 newly diagnosed MM patients related to RPS3 expression. The dataset was obtained from NCBI GEO database with GSE136324. Significant differences were calculated by log-rank Mantel-Cox test. (D) Immunoblotting confirmed the knockout of RPS3 in MM cells (ARP-1/OCI-MY5) by single guided RNA (sgRNA) targeting RPS3 (SgRPS3) using CRISPR-Cas9. Sg-Control represents MM transfected with empty vector (EV). Actin served as a loading control. (E) Cell survival of MM transfected with Sg-RPS3 or Sg-Control was measured by CCK-8 assay. The Y-axis represents the optical density (OD) value corresponding to the viability of the cells. Data are shown as mean ± standard deviation with P value based on two-way ANOVA (N= 3, *P<0.05). The experiments were repeated 3 times. (F) ARP-1 cells transfected with Sg-RPS3 or Sg-Control were subcutaneously injected into nude mice. Graphic represents curves of the tumor growth in nude mice. Data are shown as mean ± standard deviation with P value based on two-way ANOVA (N= 5, **P<0.01).

further insights into the mechanistic effects of DCZ0415, we conducted additional investigations on its impact on RPS3 expression. MM cells were treated with increasing doses of DCZ0415, or TRIP13-OE MM cells were treated with or without DCZ0415. Immunoblotting revealed a significant reduction in p-RPS3 levels upon treatment with DCZ0415 in both MM cells and TRIP13-OE MM cells, indicating that the TRIP13/RPS3 axis might be involved in DCZ0415-induced cell death (Figure 6A, B). We further determined the effects

of DCZ0415 on RPS3-knockout or the sgControl-transfected wild-type MM cells, and observed that knockout of RPS3 significantly reduced the sensitivity of MM cells to DCZ0415 (Figure 6C). In order to determine whether the effects of DCZ0415 on drug-resistant cells was dependent on TRIP13RPS3 axis, we treated TRIP13-OE, TRIP13-OE+siRPS3, or the corresponding EV cells with increasing doses of DCZ0415. CCK-8 assay revealed that treatment of TRIP13-OE cells with DCZ0415 exhibited augmented cytotoxicity, while this

Haematologica | 109 April 2024 1213 ARTICLE - RPS3 mediates MM survival and drug resistance G. Chen et al.
A B C D E F

multiple myeloma and is negatively correlated with

(A) Immunoblotting confirmed overexpression of RPS3 in multiple myeloma (MM) cells (ARP-1/OCIMY5) stably transfected with lentivirus-mediated human RPS3-cDNA (RPS3-OE). EV represents MM cells stably transfected with empty vector. Actin served as a loading control. (B) Cell survival of MM transfected with RPS3-OE or EV was measured by CCK-8 assay. The Y-axis represents the optical density (OD) value corresponding to the viability of the cells. Data are shown as mean ± standard deviation (SD) with P value based on two-way ANOVA (N= 3, *P<0.05). The experiments were repeated 3 times. (C) CCK8 assay examined cell viability of RPS3-OE or EV MM cells treated with increasing doses of bortezomib (0-80 nM) for 48 hours. Data are shown as mean ± SD with P value based on unpaired t test (N= 6, **P<0.01). The experiments were repeated 3 times. (D) RPS3-OE and EV ARP-1 cells implanted subcutaneously in nude mice were treated with bortezomib (1 mg/kg, twice/week) or vehicle. Graphic represents curves of the tumor growth. Data are shown as mean ± SD with P value based on two-way ANOVA (N= 3, ***P<0.001). (E) RPS3-OE and EV ARP-1 cells implanted subcutaneously in nude mice were treated with bortezomib (1 mg/ kg, twice/week) or vehicle. Kaplan-Meier and log-rank analysis of the median overall survival of mice in the 4 groups. Significant differences were calculated by log-rank Mantel-Cox test (N=10, EV-Control vs. EV-Bortezomib, P=0.0059; EV-Control vs. RPS3-Control, P<0.0001; EV-Bortezomib vs. OE-Bortezomib, P<0.0001; RPS3-Control vs. OE Bortezomib, non-significant).

effect was partially attenuated upon knockdown of RPS3 (Figure 6D). These findings indicate that DCZ0415 holds immense potential for drug resistant MM. We further determined the effects of DCZ0415 on drug resistance in MM. BR MM cells (H929R and RPMI-8226R5) were first treated with increasing doses of DCZ0415 for 72 h. CCK-8 assay

showed that DCZ0415 significantly decreased cell viability of H929R/RPMI-8226R cells in a dose-dependent manner (Online Supplementary Figure S6A). Flow cytometry revealed that DCZ0415 significantly promoted apoptosis of BR cells, which was further supported by increased levels of cleaved caspase-3/8/9 and PARP proteins in BR cells treated with

Haematologica | 109 April 2024 1214 ARTICLE - RPS3 mediates MM survival and drug resistance G. Chen et al.
A B D E C
Figure 5. RPS3 overexpression induces proteasome inhibitor resistance in multiple myeloma survival.

TRIP13-RPS3 axis. (A) Multiple myeloma (MM) cells (ARP-1 and OCI-MY5)

treated with increasing doses of DCZ0415 (0-20 µM) for 72 hours (h), followed by immunoblotting detection of RPS3 and p-RPS3 levels. Actin served as a loading control. (B) Empty vecotor (EV) or TRIP13-OE MM cells treated with or without DCZ0415, followed by immunoblotting detection of TRIP13, RPS3 and p-RPS3 levels. Actin served as a loading control. (C) MM cells (ARP-1 and OCI-MY5) transfected with siRPS3 or the corresponding control (siCON) were treated with increasing doses of DCZ0415 (0-32 µM) for 72 h, followed by CCK-8 assay analysis of cell viability. Data are shown as mean ± standard deviation with P value based on two-way ANOVA (N= 3, *P<0.05). (D) TRIP13-OE+siRPS3, TRIP13-OE+siCON, or the corresponding EV cells with increasing doses of DCZ0415 for 72 h, followed by CCK-8 assay analysis of cell viability. Data are shown as mean ± standard deviation with P value based on two-way ANOVA (N= 3, *P<0.05).

DCZ0415 (Online Supplementary Figure S6B, C). We further determined the effects of DCZ0415 in combination with bortezomib. Colony formation assay showed that bortezomib alone had no obvious effect on colony formation rates of BR cells, but treatment with bortezomib in combination with DCZ0415 had much lower colony formation rates than that of those treated with DCZ0415 or bortezomib alone (Online Supplementary Figure S6D), suggesting that DCZ0415 treatment resensitized BR MM cells. Additionally, the median dose effect analysis was used to calculate the CI values

between DCZ0415 and bortezomib. Interestingly, we found a high synergy between DCZ0415 and bortezomib, with the CI values <1 both in H929R and RPMI-8226R5 MM cells (Figure 7A). Additionally, immunoblotting showed that the combination of DCZ0415 and bortezomib induced an observable decrease in levels of p-IKKb and p-IκBα in both H929R and RPMI-8226R5 cells (Figure 7B). We also determined whether DCZ0415 treatment could enhance the sensitivity of BR MM cells to bortezomib in vivo by establishing a MM xenograft model using nude mice subcutaneously injected

Haematologica | 109 April 2024 1215 ARTICLE - RPS3 mediates MM survival and drug resistance G. Chen et al.
A C D B
Figure 6. The antimyeloma activity of DCZ0415 is dependent on were

multiple myeloma cells in vitro and in vivo. (A) H929R (upper panel) and RPMI-8226R5 (lower

cells were treated with vehicle, bortezomib (2-32 nM), and DCZ0415 (0.2-3.2 µM) alone or in combination for 72 hours (h), followed by CCK-8 assay analysis of cell viability. Confidence interval (CI) values were calculated using the Chou–Talalay method (right panel). (B) Immunoblotting detection of the protein levels of IKKb, p-IKKb, IκBα, and p-IκBα in H929R (left panel) and RPMI-8226R5 (right panel) cells treated with the medium, bortezomib (20 nM), and DCZ0415 (10 µM) alone or in combination. (C, D) Nude mice bearing H929R multiple myeloma (MM) tumors were treated with vehicle, bortezomib (1 mg/kg, twice/week), and DCZ0415 (50 mg/kg, twice/week) alone or in combination. (C) Graphic represents curves of the tumor growth. Data are shown as mean ± standard deviation with P value based on two-way ANOVA (N=4, *P<0.05, **P<0.01). (D) Weight of mice.

with H929R cells. Consistent with the findings in vitro, we observed that DCZ0415 treatment was pivotal in re-sensitizing BR MM cells in vivo (Figure 7C; Online Supplementary Figure S6E, F). Meanwhile, the body weights of the mice had no significant difference among groups during treatment (Figure 7D). Moreover, immunohistochemistry and TUNEL assays showed that the co-administration of DCZ0415 and bortezomib induced a decrease in Ki-67 and an increase in apoptosis, compared with that in the vehicle, DCZ0415, or bortezomib alone (Online Supplementary Figure S6G).

Discussion

The development of drug resistance is a clinical challenge observed in a variety of therapeutic approaches. Despite the establishment of novel therapeutic interventions, MM remains invariably incurable owing to the development of drug resistance and subsequent relapse.30

RPS3 can interact with the p65 subunit of NF-κB, thereby facilitating NF-κB binding to DNA and preferentially directing it to specific κB sites in the promoters of target genes.11,12 Other studies have shown that the inhibitor of κB kinase b (IKKb) can phosphorylate RPS3 at serine 209 and enhance the binding of phosphorylated RPS3 with importin-α, facilitating RPS3 entry into the nuclear transporter pathway.13 IKKb is the major kinase that phosphorylates IκBα, leading to its degradation from NF-κB complexes.12 The NF-κB dimers translocate into the nucleus, where they bind to specific DNA sites and activate the transcription of target genes.12 It has been reported that the secreted RPS3 protein is an indicator of some malignant tumors.14,31,32 RPS3 is capable of regulating melanoma cell growth and apoptosis by targeting Cyto C/Ca2+/MICU1-dependent mitochondrial signaling.32 Moreover, RPS3 is a key control point of radioresistance in glioblastoma and non-small cell lung cancer by promoting the repair of DNA damage.14,33 Here, we found for the first time that RPS3 was significantly overexpressed in MM, and

Haematologica | 109 April 2024 1216 ARTICLE - RPS3 mediates MM survival and drug resistance G. Chen et al.
A B C D
Figure 7. DCZ0415 synergizes with bortezomib in drug-resistant panel)

its overexpression status correlated with poor prognosis of patients with MM. The knockout of RPS3 could induce cell cycle arrest and cell apoptosis in MM. Importantly, overexpression of RPS3 could promote MM proliferation and confer proteasome inhibitor resistance to MM, as demonstrated in a mouse model which showed that RPS3 overexpression could significantly shorten survival even under the treatment of bortezomib. Our findings in the current study first demonstrate that RPS3 is closely associated with drug resistance and poor prognosis in MM. RPS3 could be a potential therapeutic target of MM. The small molecule inhibitors specifically targeting RPS3 could be developed for the treatment of MM and to overcome proteasome inhibitor resistance.

TRIP13 is identified as a driver of B-cell malignancies.15-17 We previously demonstrated that overexpression of TRIP13 is functionally linked to drug resistance of MM, and inhibition of TRIP13 can be an effective target for the treatment of MM.15,17 We also found that inhibition of TRIP13 could suppress the activation of NF-κB-dependent transcription.15 Moreover, many studies indicate that the NF-κB pathway is widely involved in mediating the progression and drug resistance in MM.34-36 Therefore, we hypothesized that TRIP13 could activate the NF-κB pathway in MM. In order to confirm this, we performed RNA-seq analysis and found that TRIP13 was positively correlated with the activation of NF-κB pathway. Moreover, results of immunoblotting and immunofluorescence suggested high expression of TRIP13 activated proteins involved in NF-κB signaling and an increase in the transfer of NF-κB p65 from cytoplasm to nucleus. In order to further investigate the specific mechanism of how TRIP13 activated the NF-κB pathway, we overlaid the list of proteins identified in the TRIP13 co-immunoprecipitation group from the LC-

δ/PRS3/ NF-κB

in multiple myeloma. RPS3 is necessary for multiple myeloma (MM) survival and drug resistance. TRIP13 acts as a mediator through binding PKCδ and RPS3 to promote the phosphorylation activation of RPS3 by PKCδ, which further activates canonical NF-κB signaling and inducing cell survival and drug resistance of MM. The inhibition of NF-κB signaling by DCZ0415, a small molecule inhibitor targeting TRIP13, is capable of overcoming drug resistance of MM cells.

MS/MS analysis. Of note, RPS3, a non-Rel subunit of NF-κB known to regulate several physiological processes, was first identified to interact with TRIP13 in our current study. In order to understand the regulatory mechanism between TRIP13 and RPS3, we performed a series of in vitro experiments and found no effect on the expression of RPS3 regardless of whether TRIP13 was overexpressed or knocked down. Studies have shown that post-translational modifications play important roles in regulating the various extraribosomal functions of RPS3.10 Specifically, the phosphorylation status of RPS3 can influence its binding function.10,12 Here, we demonstrate for the first time that RPS3 is hyperphosphorylated at threonine residues when TRIP13 is overexpressed, and T221 on RPS3 is identified as a specific site that was affected by TRIP13. However, TRIP13 itself has no kinase activity. In line with previous reports that PKCδ could phosphorylate RPS3 at T221 site,28,29 we observed that PKCδ was involved in the phosphorylation of RPS3 and the activation of NF-κB pathway in the context of TRIP13 overexpression. Additionally, selective inhibition of PKCδ could also overcome TRIP13-induced bortezomib resistance of MM. Overall, TRIP13 acts as a mediator through binding PKCδ and RPS3 to promote the phosphorylation activation of RPS3 by PKCδ, which further activates NF-κB signaling, including cell survival and drug resistance of MM (Figure 8). TRIP13 has been identified as an AAA-ATPase.22-24 Currently, the detailed mechanisms underlying the regulation of the TRIP13-RPS3 axis, including the role of TRIP13 ATP hydrolysis and other potential factors, are the focus of ongoing studies in our laboratory. We found that protein expression levels of TRIP13 and phosphorylated RPS3 in BR MM cells were significantly higher than that in bortezomib-sensitive ones. And we observed hyperactivation of the NF-κB pathway in drug-resistant cells.

Haematologica | 109 April 2024 1217 ARTICLE - RPS3 mediates MM survival and drug resistance G. Chen et al.
Figure 8. A working model depicting the major molecular mechanisms of the TRIP13-PKC signaling axis

It has been reported that MM cells hijack stromal cells to secrete cytokines to activate the NF-κB pathway, resulting in tumor growth and drug resistance.37 In our previous study, DCZ0415 acted as a small molecule inhibitor that could target TRIP13 and induce cell death by inhibiting the NF-κB signaling pathway.17 Intriguingly, we found in the current study that DCZ0415 significantly decreased levels of p-RPS3 in both MM cells and TRIP13-OE MM cells. Our previous paper demonstrated that the antimyeloma activity of DCZ0415 was dependent on TRIP13.17 In the current study, we observed that the knockout of RPS3 induced the loss of sensitivity MM cells to DCZ0415. Moreover, treatment of TRIP13-OE cells with DCZ0415 exhibited augmented cytotoxicity, while this effect was partially attenuated upon knockdown of RPS3. These findings indicate that DCZ0415 holds immense potential for drug-resistant MM, and the effects of DCZ0415 on drug-resistant cells is dependent on TRIP13-RPS3 axis. Our previous paper reported the antimyeloma activity of DCZ0415 in primary cells derived from drug-resistant patients with myeloma.17 The findings in current study provide additional insights into the significant role of DCZ0415 in synergistically enhancing the efficacy of bortezomib in drug-resistant MM both in vivo and in vitro, providing the preclinical framework for combination clinical trials. Mechanically, DCZ0415 combined with bortezomib had a potent role in suppressing the activation of the NF-κB pathway.

In conclusion, our current studies have identified a novel

References

1. van de Donk N, Pawlyn C, Yong KL. Multiple myeloma. Lancet. 2021;397(10272):410-427.

2. Cowan AJ, Green DJ, Kwok M, et al. Diagnosis and management of multiple myeloma: a review. JAMA. 2022;327(5):464-477.

3. Nishida H. Rapid progress in immunotherapies for multiple myeloma: an updated comprehensive review. Cancers (Basel). 2021;13(11):4.

4. Podar K, Leleu X. Relapsed/refractory multiple myeloma in 2020/2021 and beyond. Cancers (Basel). 2021;13(20):5.

5. Alagpulinsa DA, Szalat RE, Poznansky MC, Shmookler Reis RJ. Genomic instability in multiple myeloma. Trends Cancer. 2020;6(10):858-873.

6. Neri P, Bahlis NJ. Genomic instability in multiple myeloma: mechanisms and therapeutic implications. Expert Opin Biol Ther. 2013;13(Suppl 1):S69-82.

7 Mitterer V, Murat G, Rety S, et al. Sequential domain assembly of ribosomal protein S3 drives 40S subunit maturation. Nat Commun. 2016;7:10336.

8. Lee SB, Kwon IS, Park J, et al. Ribosomal protein S3, a new substrate of Akt, serves as a signal mediator between neuronal apoptosis and DNA repair. J Biol Chem. 2010;285(38):29457-29468.

9. Gao X, Hardwidge PR. Ribosomal protein s3: a multifunctional target of attaching/effacing bacterial pathogens. Front Microbiol. 2011;2:137.

10 Graifer D, Malygin A, Zharkov DO, Karpova G. Eukaryotic ribosomal protein S3: a constituent of translational machinery

role of TRIP13-PKCδ/PRS3 in consistently activating NF-κB during the development of resistance against proteasome inhibitor therapy in MM. This work raises the possibility and provides the first proof of concept in mouse models that targeting RPS3 in combination with the MM first-line therapeutic bortezomib may be a suitable way to overcome therapy resistance.38

Disclosures

No conflicts of interests to disclose.

Contributions

JS, GC, XG and WZ designed the experiments, analyzed data and prepared the manuscript. GC, XJ, YW, L-X, DY, SC, H-D, K-H, GW, B-L, ZX, YL, HW, T-Z, DS, G-Y and XW performed the experiments. All authors discussed the results and approved the final version of the manuscript.

Funding

This work was supported by the grants from the National Natural Science Foundation of China (grant no. 82170200, 81900210, 82070224, 82000220 and 81971529); Shanghai Sailing Program, China (21YF1435000).

Data-sharing statement

Original data is available by contacting the corresponding authors.

and an extraribosomal player in various cellular processes. Biochimie. 2014;99:8-18.

11. Wan F, Anderson DE, Barnitz RA, et al. Ribosomal protein S3: a KH domain subunit in NF-kappaB complexes that mediates selective gene regulation. Cell. 2007;131(5):927-939.

12. Wan F, Lenardo MJ. The nuclear signaling of NF-kappaB: current knowledge, new insights, and future perspectives. Cell Res. 2010;20(1):24-33.

13. Wan F, Weaver A, Gao X, Bern M, Hardwidge PR, Lenardo MJ. IKKbeta phosphorylation regulates RPS3 nuclear translocation and NF-kappaB function during infection with Escherichia coli strain O157:H7. Nat Immunol. 2011;12(4):335-343.

14 Yang HJ, Youn H, Seong KM, Jin YW, Kim J, Youn B. Phosphorylation of ribosomal protein S3 and antiapoptotic TRAF2 protein mediates radioresistance in non-small cell lung cancer cells. J Biol Chem. 2013;288(5):2965-2975.

15. Tao Y, Yang G, Yang H, et al. TRIP13 impairs mitotic checkpoint surveillance and is associated with poor prognosis in multiple myeloma. Oncotarget. 2017;8(16):26718-26731.

16. Li C, Xia J, Franqui-Machin R, et al. TRIP13 modulates protein deubiquitination and accelerates tumor development and progression of B cell malignancies. J Clin Invest. 2021;131(14):e146893.

17 Wang Y, Huang J, Li B, et al. A small-molecule inhibitor targeting TRIP13 suppresses multiple myeloma progression. Cancer Res. 2020;80(3):536-548.

18. Lan J, Huang J, Tao X, et al. Evaluation of the TRIP13 level in

Haematologica | 109 April 2024 1218 ARTICLE - RPS3 mediates MM survival and drug resistance G. Chen et al.

breast cancer and insights into potential molecular pathways. J Cell Mol Med. 2022;26(9):2673-2685.

19 Sheng N, Yan L, Wu K, et al. TRIP13 promotes tumor growth and is associated with poor prognosis in colorectal cancer. Cell Death Dis. 2018;9(3):402.

20 Li W, Zhang G, Li X, et al. Thyroid hormone receptor interactor 13 (TRIP13) overexpression associated with tumor progression and poor prognosis in lung adenocarcinoma. Biochem Biophys Res Commun. 2018;499(3):416-424.

21. Banerjee R, Russo N, Liu M, et al. TRIP13 promotes error-prone nonhomologous end joining and induces chemoresistance in head and neck cancer. Nat Commun. 2014;5:4527.

22. Alfieri C, Chang L, Barford D. Mechanism for remodelling of the cell cycle checkpoint protein MAD2 by the ATPase TRIP13. Nature. 2018;559(7713):274-278.

23. Ye Q, Rosenberg SC, Moeller A, Speir JA, Su TY, Corbett KD. TRIP13 is a protein-remodeling AAA+ ATPase that catalyzes MAD2 conformation switching. Elife. 2015;4:e07367.

24. Sarangi P, Clairmont CS, Galli LD, Moreau LA, D’Andrea AD. p31(comet) promotes homologous recombination by inactivating REV7 through the TRIP13 ATPase. Proc Natl Acad Sci U S A. 2020;117(43):26795-26803.

25. Hu L, Li B, Chen G, et al. A novel M phase blocker, DCZ3301 enhances the sensitivity of bortezomib in resistant multiple myeloma through DNA damage and mitotic catastrophe. J Exp Clin Cancer Res. 2020;39(1):105.

26. Xie Y, Wang Y, Xu Z, et al. Preclinical validation and phase I trial of 4-hydroxysalicylanilide, targeting ribonucleotide reductase mediated dNTP synthesis in multiple myeloma. J Biomed Sci. 2022;29(1):32.

27. Chen G, Hu K, Sun H, et al. A novel phosphoramide compound, DCZ0847, displays in vitro and in vivo anti-myeloma activity, alone or in combination with bortezomib. Cancer Lett.

2020;478:45-55.

28. Kim TS, Kim HD, Kim J. PKCdelta-dependent functional switch of rpS3 between translation and DNA repair. Biochim Biophys Acta. 2009;1793(2):395-405.

29 Kim TS, Kim HD, Shin HS, Kim J. Phosphorylation status of nuclear ribosomal protein S3 is reciprocally regulated by protein kinase Cdelta and protein phosphatase 2A. J Biol Chem. 2009;284(32):21201-21208.

30. Robak P, Drozdz I, Szemraj J, Robak T. Drug resistance in multiple myeloma. Cancer Treat Rev. 2018;70:199-208.

31. Nagao-Kitamoto H, Setoguchi T, Kitamoto S, et al. Ribosomal protein S3 regulates GLI2-mediated osteosarcoma invasion. Cancer Lett. 2015;356(2 Pt B):855-861.

32. Tian Y, Qin L, Qiu H, et al. RPS3 regulates melanoma cell growth and apoptosis by targeting Cyto C/Ca2+/MICU1 dependent mitochondrial signaling. Oncotarget. 2015;6(30):29614-29625.

33. Kim W, Youn H, Lee S, et al. RNF138-mediated ubiquitination of rpS3 is required for resistance of glioblastoma cells to radiation-induced apoptosis. Exp Mol Med. 2018;50(1):e434.

34 Baud V, Karin M. Is NF-kappaB a good target for cancer therapy? Hopes and pitfalls. Nat Rev Drug Discov. 2009;8(1):33-40.

35. Vrabel D, Pour L, Sevcikova S. The impact of NF-kappaB signaling on pathogenesis and current treatment strategies in multiple myeloma. Blood Rev. 2019;34:56-66.

36. Vo JN, Wu YM, Mishler J, et al. The genetic heterogeneity and drug resistance mechanisms of relapsed refractory multiple myeloma. Nat Commun. 2022;13(1):3750.

37. Fabre C, Mimura N, Bobb K, et al. Dual inhibition of canonical and noncanonical NF-kappaB pathways demonstrates significant antitumor activities in multiple myeloma. Clin Cancer Res. 2012;18(17):4669-4681.

38. Moreau P, Richardson PG, Cavo M, et al. Proteasome inhibitors in multiple myeloma: 10 years later. Blood. 2012;120(5):947-959.

Haematologica | 109 April 2024 1219 ARTICLE - RPS3 mediates MM survival and drug resistance G. Chen et al.
Single-cell analysis of the CD8+ T-cell compartment in multiple myeloma reveals disease specific changes are chiefly restricted to a CD69- subset suggesting potent cytotoxic effectors exist within the tumor bed

James Favaloro,1,2* Christian E. Bryant,1,3* Edward Abadir,1,3 Samuel Gardiner,4 Shihong Yang,1 Tracy King,1,3 Najah Nassif,2 Lisa M. Sedger,5,6 Richard Boyle,7 Douglas E. Joshua1,3 and P. Joy Ho1,2,3

1Institute of Hematology, Multiple Myeloma Research Laboratory, New South Wales Health Pathology, Royal Prince Alfred Hospital, Camperdown; 2School of Life Sciences, University of Technology Sydney, Ultimo, Sydney; 3Sydney Medical School, the University of Sydney, Sydney; 4Sydney Local Health District Clinical Research Institute, Royal Prince Alfred Hospital, Camperdown; 5Institute for Clinical Pathology and Medical Research (ICPMR), New South Wales Health Pathology, Westmead Hospital, Westemead; 6Center for Virus Research, Westmead Institute for Medical Research, Westmead and New South Wales, Sydney and 7Orthopedics Department, Sydney Local Health District, Royal Prince Alfred Hospital, Camperdown, New South Wales, Australia

*JF and CEB contributed equally as first authors.

Abstract

Correspondence: J. Favaloro james.favaloro@health.nsw.gov.au

C.E. Bryant christian.bryant@health.nsw.gov.au.

Received: May 14, 2023.

Accepted: September 28, 2023.

Early view: October 5, 2023.

https://doi.org/10.3324/haematol.2023.283062

©2024 Ferrata Storti Foundation

Published under a CC BY-NC license

Multiple myeloma (MM) is an incurable disease of the bone marrow (BM) characterized by the uncontrolled proliferation of neoplastic plasma cells. While CD8+ T cells have an established role in disease control, few studies have focused on these cells within the MM tumor microenvironment (TME). We analyzed CD8+ T cells in the BM and peripheral blood (PB) of untreated patients with MM and non-myeloma controls using flow cytometry, mass cytometry and single-cell RNA sequencing, using several novel bioinformatics workflows. Inter-tissue differences were most evident in the differential expression of Granzymes B and K, which were strongly associated with two distinct subsets of CD8+ T cells delineated by the expression of CD69, accounting for roughly 50% of BM-CD8+ T cells of all assessed cohorts. While few differences were observable between health and disease in the BM-restricted CD8CD69+ T-cell subset, the CD8+CD69- T-cell subset in the BM of untreated MM patients demonstrated increased representation of highly differentiated effector cells and evident compositional parallels between the PB, absent in age-matched controls, where a marked reduction of effector cells was observed. We demonstrate the transcriptional signature of BM-CD8+ T cells from patients with MM more closely resembles TCR-activated CD8+ T cells from age-matched controls than their resting counterparts.

Introduction

Multiple myeloma (MM) is an incurable disease of the bone marrow (BM). It is preceded by the premalignant stage monoclonal gammopathy of undetermined significance (MGUS) and is characterized by the uncontrolled proliferation of neoplastic plasma cells (PC).1 Healthy BM is a heterogeneous tissue that is highly vascularized and the site of hematopoiesis.2 The BM acts as a reservoir of antigen-experienced CD8+ tissue-resident memory T cells

(TRM)3 and long-lived PC.4 MM has an established detrimental effect on this compartment,5 as the BM transforms to an increasingly hypoxic, inflammatory, myeloma-promotive tumor microenvironment (TME), non-conducive to normal homeostasis.6

Substantial evidence exists to support the concept that CD8+ T cells play an important role in disease control.7 We have previously shown that T-cell receptor (TCR) Vb restricted terminally differentiated CD8+ T-cell (TTE) clonal expansions are detectable in the peripheral blood (PB) of

Haematologica | 109 April 2024 1220 - Plasma Cell Disorders ARTICLE

patients with MM and their presence correlates with improved patient outcomes.8 These cells have a senescent secretory effector phenotype,9 including low levels of programmed cell death protein 1 (PD-1), which may in part explain the poor results with anti-PD-1 monotherapy.10 T cells circulate between the BM and PB, and in MM, cells entering the TME are exposed to myeloma-associated antigens.11 Recently, we demonstrated that clonally expanded TCRVb restricted CD8+ TTE, capable of exerting specific killing of autologous MM cells in vitro, are detectable in the BM of several patients.12 Despite this, the effect of the TME on these crucial effectors, as well as the plethora of other CD8+ T-cell subsets has not been investigated indepth. Thus, a comprehensive analysis of CD8+ T cells in the BM and PB of patients with MM may permit a greater understanding of disease and the host immune response. In this study, we analyzed CD8+ T cells in the BM and PB of age-matched controls, premalignant MGUS, and untreated, newly diagnosed (ND) patients with MM using flow cytometry, mass cytometry and single-cell RNA sequencing (scRNA-Seq). We show that CD8+ T cells from the BM of all subjects can be divided based on the expression of CD69 and these cells demonstrate unique, disease-associated Granzyme expression patterns. We further show the transcriptional signature of BM-CD8+ T cells from patients with MM resemble TCR-activated CD8+ T cells from agematched controls.

Methods

Patients and controls

MGUS and NDMM patients, diagnosed by the International Myeloma Working Group criteria, were recruited through the Department of Hematology, Royal Prince Alfred Hospital (RPAH). Age-matched controls without diagnosed malignancy or active infection, undergoing hip arthroplasty were recruited through the Department of Orthopedic Surgery, RPAH. Characteristics of patients and controls are summarized in Table 1. Paired BM and PB samples were collected and analyzed by mass cytometry, flow cytometry or scRNAseq. The study was approved by the Institutional Human Research Ethics Committee. All patients provided informed consent before sample collection, following the amended Declaration of Helsinki.

Single-cell RNA/T-cell receptor sequencing

Purified CD8+ cells were isolated from cryopreserved samples through a two-stage enrichment using a human CD8+ T-cell Isolation kit (Miltenyi Biotech) followed by FACS sorting as CD45+CD8+CD4-CD56- cells on a BD FACS Aria II. Single cells were encapsulated for cDNA synthesis and barcoded using the Chromium Single-cell 5′ V(D)J Reagent kit v1.1 (10x Genomics) followed by library construction according to the manufacturer’s recommendations. Libraries were sequenced on an Illumina NovaSeq 6000 (NovaSeq Control

NDMM: newly diagnosed multiple myeloma; MGUS: monoclonal gammopathy of undetermined significance; FISH: fluorescence in situ hybridization; IgA: immunoglobulin A; IgG: immunoglobulin G; R-ISS: Revised International Staging System; LDH: lactate dehydrogenase; N/A: not applicable.

Haematologica | 109 April 2024 1221 ARTICLE - Single-cell analysis of CD8+ T cells in multiple myeloma J. Favaloro et al.
Characteristics NDMM N=21 MGUS N=3 Controls N=12 Age in years, median (range) 72 (48-90) 62 (56-65) 66 (57-83) Sex: male, N (%) 14 (66) 1 (33) 4 (25) R-ISS stage, N (%) R-ISS 1 R-ISS 2 R-ISS 3 4 (19) 14 (67) 3 (14) N/A N/A N/A N/A N/A N/A Isotype, N (%) IgG IgA Light chain 13 (62) 5 (24) 3 (14) N/A N/A N/A N/A N/A N/A Cytogenetics, N (%) 17p deletion −1p and/or +1q 19 (90) 1 (5) 9 (47) N/A N/A N/A N/A N/A N/A FISH, N (%) t(4;14) t(14;16) del17p 21 (100) 3 (14) 0 (0) 0 (0) N/A N/A N/A N/A N/A N/A N/A N/A LDH U/L median (range) Above normal, N (%) 155 (84-279) 1 (5) N/A N/A N/A N/A
Table 1. General and clinical characteristics of patients and controls.

Software v.1.6.0 / Real-Time Analysis v.3.4.4) using a NovaSeq S4 reagent kit (Illumina). Bioinformatics analysis is detailed in the Online Supplementary Appendix.

Flow and mass cytometry

Flow cytometry was performed with monoclonal antibodies (mAb) targeting surface antigens (Online Supplementary Table S1), fixed and permeabilized using either fixation/ permeabilization buffer (BD Biosciences) for assessment of intracellular cytokines or Foxp3/Transcription Factor Staining Buffer Set (Thermo-Fisher Scientific) for assessment of transcription factors, then stained with mAb specific to intracellular proteins Granzyme B, Granzyme K and Perforin in perm/wash buffer (BD Biosciences) or TCF-1 in permeabilization buffer (Thermo-Fisher Scientific). Analysis of flow cytometry data was performed using FlowJo (Version 10.8.1, BD Biosciences). Mass cytometry utilized an expanded panel of antibodies (Online Supplementary Table S2) and is detailed in the Online Supplementary Appendix. Gating of T-cell subsets followed our previously defined approach (Online Supplementary Figure S1).

Statistical analysis

The non-parametric Mann-Whitney U and the Wilcoxon Signed Rank test were used to compare unpaired and paired data sets respectively. Statistical significance was determined at P<0.05 for all statistical analyses and was performed using GraphPad Prism version 9.01 (GraphPad Software) or R (v. 4.2.1 [see Online Supplementary Appendix]).

Results

Unsupervised clustering reveals an unequal distribution of memory, effector and naïve-like subsets in the bone marrow and peripheral blood of newly diagnosed multiple myeloma patients

Although CD8+ T cells are well documented to contribute to disease control in MM,7 the effect of the TME on these cells is poorly understood. We constructed a transcriptomic map of CD8+ T cells purified from the BM and PB of newly diagnosed multiple myeloma (NDMM) patients using the 10x genomics platform (Online Supplementary Figure S2A). After strict quality control (QC), we recovered transcriptional data from an average of 6,929 cells from paired BM and PB samples and an average of 1,146 genes and 3,317 unique molecular identifiers (Online Supplementary Table S3). Unsupervised clustering in an integrated analysis revealed six clusters (Figure 1Ai), with broad differences between BM and PB samples observable on Uniform Manifold Approximation and Projection (UMAP), with PB cells containing a more prominent terminal effector population than those from BM (Figure 1Aii). Canonical transcriptional signatures, assisted by the cell type identification R package “SingleR”, in conjunction with reference datasets, permitted annota-

tion of clusters (Figure 1B; Online Supplementary Table S4). The dominant cluster was representative of activated and/ or stressed CD8+ effector memory T cells (TEM), defined by the expression GZMK, several AP-1 associated genes: DUSP2, JUN, DUSP1, JUNB and FOS, and activation markers CD69 and CD74, in addition to reduced expression of genes associated with naïve T cells (TN) and central memory T cells (TCM) (i.e., SELL, LTB, CCR7 and IL7R). The second most dominant cluster, representative of CD8+ TTE was characterized by genes associated primarily with cytotoxicity: GNLY, GZMB, NKG7, PRF1 and LGALS1, in addition to reduced expression of genes that defined both the dominant TEM cluster and smaller TN and TCM clusters. The TN cluster was identified by genes associated with cell homing, metabolism and stemness: SELL, LTB, CCR7, and TCF7 and reduced expression of genes associated with TEM and TTE. Beyond the three major clusters, three smaller clusters were identified: (i) the first comprising a mixture of cytotoxic cells characterized by expression of GZMA, KLRB1 and KLRD1 and reduced expression of naïve-associated genes was designated as a cytotoxic memory cluster (Cyto-TEM); (ii) a small cluster characterized by higher than average levels of five genes associated with chemotaxis: CCL4, CCL3, CCL4L2, XCL2 and XCL1 shares features of recently defined pre-exhausted T cells (PREEX);13 (iii) the smallest cluster shared many features with TN, additionally expressed high levels of IL7R and LGALS3 and clustered between the larger TN and TEM clusters and was deemed to represent TCM.

The first three clusters accounted for more than 75% of all cells from both the BM and PB. However, differences in cluster distribution were evident: the dominant TEM cluster as well as TN and PRE-EX clusters were enriched in the BM, whereas the TTE cluster predominated the PB (Figure 1C). Single-cell gene set enrichment analysis (sc-GSEA) revealed enrichment towards the hallmark gene sets of hypoxia and tissue necrosis factor (TNF) α signaling via nuclear factor (NF)-κb in all but the TN and TCM clusters in the BM as compared to the PB (Online Supplementary Figure S2B), most evident in the dominant TEM subset, but did not demonstrate overt inter-tissue differences with regards to other signaling or metabolic pathways (Online Supplementary Table S5).

An unsupervised, high-dimensional approach reveals inter-tissue differences highlighted by distinct Granzyme expression patterns

Inter-tissue differences were evident when stratifying clusters by the level of gene expression (Figure 2A; Online Supplementary Table S6), mainly restricted to genes that defined the TEM and TTE subsets (Online Supplementary Figure S2C), reflecting the compositional differences between these two tissue compartments. Although the TN, TCM and TTE clusters demonstrated little to distinguish between BM and PB, BM-CD8+ TEM demonstrated a greater level of both gene expression and proportion of cells expressing all genes that defined the cluster, except for CD74 which was comparable

Haematologica | 109 April 2024 1222 ARTICLE - Single-cell analysis of CD8+ T cells in multiple myeloma J. Favaloro et al.

T-cell clusters found through unsupervised clustering. (A) Uniform Manifold Approximation and Projection (UMAP) of identified clusters. After stringent quality control (detailed in the Online Supplementary Appendix) revealed poor quality data for 2 bone marrow (BM) samples (excluded from further analysis), Seurat clustered CD8+ T cells from paired BM and peripheral blood (PB) of newly diagnosed multiple myeloma (NDMM) patients (N=2) into 6 clusters. Each dot represents a single cell colored according to (i) cluster or (ii) tissue compartment (BM = blue, PB = red). (B) Single-cell heat map illustrating transcriptional heterogeneity of CD8+ T cells. Each vertical line represents a single cell demonstrating the expression level, relative to the average expression level (upregulated = yellow, downregulated = purple) of the top 10 unique genes (y-axis) contributing to the transcriptional signature of each of the 6 identified clusters arranged by size of cluster (colored) and tissue (BM = blue, PB = red). (C) Bar plot quantifying cluster distribution. Quantification of the number of cells (y-axis) contributing to each identified cluster (color) from each of the contributing samples (x-axis). TEM: effector memory T cells; TTE: terminally differentiated CD8+ T cells; TN: naive T cells; Cyto TEM: cytotoxic effector memory T cells; PRE EX: pre-exhausted T cells; TCM: central memory T cells.

between the two tissues (Figure 2A; Online Supplementary Figure S2C). While the Cyto TEM and PRE EX clusters appear ontologically related, both showed marked differences between the BM and PB, with cells from BM co-expressing high levels of genes that defined the TEM cluster and PB cells co-expressing genes that defined the TTE cluster (Figure 2A; Online Supplementary Figure S2C). Quantification of the five human Granzymes revealed that while GZMA, GZMH and

GZMM were similar between clusters within the BM and PB (Online Supplementary Figure S2D), GZMK was largely restricted to the BM and GZMB to the PB, with the exceptions of the PB TEM and BM TTE clusters respectively, which are non-dominant clusters in the PB and BM respectively (Figure 2B). Overlaying expression of several cluster-defining genes revealed a high level of co-expression of CD69 and GZMK, largely restricted to the BM, while co-expression of

Haematologica | 109 April 2024 1223 ARTICLE - Single-cell analysis of CD8+ T cells in multiple myeloma J. Favaloro et al.
A B C
Figure 1. Distribution and quantification of CD8+

PRF1 demonstrated no overlap with GZMK but a high degree of overlap with GZMB, particularly in the PB (Figure 2C).

Flow cytometry reveals disease-associated differences

Flow cytometry was performed on paired BM and PB samples from NDMM patients and age-matched controls (N=12)

to both determine if the same patterns observed in gene expression were reflected in protein expression and to query the effect of disease. CD69 protein expression was restricted to cells from the BM, with a small but not significant reduction in the proportion of CD8+ T cells expressing CD69 in NDMM patients relative to age-matched controls

to the same cluster in the opposing tissue (solid = upregulated,

= downregulated). (B) Violin plots showing expression levels (y-axis) of GZMB (top) and GZMK (bottom)

of GZMB in the TTE

by tissue (BM = blue, PB = red). The box highlights similar

(C) Uniform Manifold Approximation and Projection (UMAP) highlighting co-expression of Granzyme B and Granzyme K (orange) with CD69 and Perforin (green) in the BM (top) and PB (bottom). Boxes highlight clusters with high levels of co-expression (yellow). TEM: effector memory T cells; TTE: terminally differentiated CD8+ T

Haematologica | 109 April 2024 1224 ARTICLE - Single-cell analysis of CD8+ T cells in multiple myeloma J. Favaloro et al.
A B C
Figure 2. Unsupervised clustering reveals tissue restricted Granzyme expression patterns. (A) Dot plot illustrating the top 10 unique genes (x-axis) contributing to the identification of each of the 6 identified clusters (y-axis, colored, separated by tissue (bone marrow [BM] = blue, peripheral blood [PB] = red)). The size of each dot represents the percentage of cells within a cluster expressing a given gene and the intensity of the color represents the average expression level relative transparent across the 6 identified clusters, separated inter-tissue expression levels cluster. cells; TN: naive T cells; TCM: central memory T cells.

(medians 41.4% and 53.8%; P=not significant [NS]) (Figure 3A; Online Supplementary Figure S3A). Canonical subset distribution across the two broad subsets within the BM demonstrated a reduction in TN (medians 12.3% and 28.4%; P=NS), and a significant decrease in TCM (medians 20.6%

and 27.6%; P=0.0449), mirrored by a significant increase in TTE (medians 30.4% and 10.6%; P=0.0023) in the CD8+CD69subset in NDMM patients relative to age-match controls, but no differences in the proportion of TEM (Figure 3Bi). In contrast, the CD8+ TEM subset accounted for the majority of

(circles;

age-matched controls (square; N=12) and

canonical CD8+ T-cell subsets in the broad BM-CD8+CD69- (i, open shapes) and BM-CD8+CD69+ (ii, solid shapes) subsets of age-matched controls (squares; N=12) and NDMM patients (circles; N=12). (C)

Granzyme B (top), Granzyme K (middle) or Granzyme B-/K- (bottom) in (i) PB-CD8+ (left; hollow red), (ii) BM-CD8+CD69-, (middle; hollow blue) and (iii) BM-CD8+CD69+, (right; solid blue) of age-matched controls (squares; N=6) and NDMM patients (circles; N=6). (D) Median fluorescence intensity (MFI) of Perforin expression across the Granzyme B+ (top) Granzyme B+/K+ (middle) or Granzyme K+ (bottom) subsets in (i) BM-CD8+CD69- (left; hollow blue) and (ii) BM-CD8+CD69+ (right; solid blue) of age-matched controls (squares; N=6) and NDMM patients (circles; N=6). Significance levels: *P<0.05, **P<0.01; Mann-Whitney U test. NS: not significant; TEM: effector memory T cells; TTE: terminally differentiated CD8+ T cells; TN: naive T cells; TCM: central memory T cells.

Haematologica | 109 April 2024 1225
- Single-cell analysis of CD8+ T cells in multiple myeloma J. Favaloro et al.
ARTICLE
A B C D
Figure 3. Tissue-restricted Granzyme expression patterns reveal disease-associated differences. (A) Quantification of the proportion of CD8+ T cells within the bone marrow (BM) co-expressing CD69 in newly diagnosed multiple myeloma (NDMM) patients N=12). (B) Quantification of Proportion of cells expressing

all CD8+CD69+ cells, however, no significant differences were observed between patient cohorts in any subset (Figure 3Bii). Contrasting the transcriptional assessment where cells expressed either GZMB or GZMK, flow cytometry revealed co-expression of both Granzyme B and Granzyme K in both NDMM patients and age-matched controls (Online Supplementary Figure S3A). NDMM patients demonstrated a significant increase in the proportion of both BM-CD8+CD69(median 64.3 vs. 18.7%; P=0.022) and PB-CD8+ T cells (median 64.0 vs. 32.5%; P=0.0087) expressing Granzyme B compared to age-matched controls, paralleled by significantly fewer Granzyme-negative cells in these two subsets (median 21.5 vs. 49.8%; P=0.022) (median 19.0 vs. 44.5%; P=0.0152) (Figure 3Ci, ii). Further, Granzyme B expression patterns in the BMCD8+CD69- subset of NDMM patients mimicked expression patterns observed in the PB closer than age-matched controls (average ratio of BM-CD8+CD69-: PB-CD8+: 1.01 vs. 0.36 NDMM patients vs. age-matched controls; P=0.026) (Online Supplementary Figure S3B). In contrast, while Granzyme K was largely restricted to the BM-CD69+ subset (though not exclusive), the expression did not differ between health and disease (Figure 3Ciii). Overall, while marked differences in Granzyme expression patterns were observable between patient cohorts in both the PB-CD8+ (Online Supplementary Figure S3Ci) and BM-CD8+CD69- subsets (Online Supplementary Figure S3Cii), the BM-CD8+CD69+ subset appeared almost identical (Online Supplementary Figure S3C iii). Compositional alterations of the BM-CD8+CD69- subset in MM were further reinforced by analysis of canonical subset

distribution, where a significant difference (P=0.0312) in the distribution of TTE was observable between the two BM subsets in NDMM, but not in age-matched controls (Online Supplementary Figure S3D).

In keeping with compositional similarities of Granzyme expression, perforin expression in the BM-CD8+CD69- subset appeared to mimic that observed in the PB in NDMM patients, but not age-matched controls (Figure 3D; Online Supplementary Figure S4A). While perforin expression was higher in all Granzyme subsets in the PB-CD8+ subset of NDMM patients (Online Supplementary Figure S4B), it was significantly higher in Granzyme B-expressing cells in the BMCD8+CD69- subset (Figure 3Di); applying to both Granzyme B single positive (average median fluorescence intensity [ave. MFI] 5,907 vs. 2,567; P=0.0411) and Granzyme B+/K+ (ave. MFI 1,590 vs. 699; P=0.0158) cells. Although BM-CD8+CD69+GZB+T cells consisted of only a minority of cells in both cohorts, NDMM patients again demonstrated a marked increase in perforin expression compared to age-matched controls (ave. MFI 377 vs. 2,175; P=0.0087) (Figure 3Dii).

Mass cytometry demonstrates CD8+CD69⁺ effector memory T cells are phenotypically restrained relative to their CD69- counterparts

In order to obtain a more comprehensive phenotype, and further interrogate the effect of the microenvironment on the BM-dominant TEM subset, we performed FlowSOM analysis14 of paired BM and PB samples from MGUS and NDMM patients. This revealed four metaclusters enriched in the BM

Haematologica | 109 April 2024 1226 ARTICLE - Single-cell analysis of CD8+ T cells in multiple myeloma J. Favaloro et al.
A B C Continued on following page .

phenotypically restrained compared to cells shared between

the contribution of the 4 metacluster (MC) (MC4: blue, MC18: orange, MC20: red and MC24: purple) overrepresented in the bone marrow (BM) of monoclonal gammopathy of undetermined significance (MGUS) (top) and newly diagnosed multiple myeloma (NDMM) (bottom) patients (remaining MC: grey). (B) t-distributed stochastic neighbour embedding (tSNE) visualization of identified MC within the BM (left) and peripheral blood (PB) (right) in MGUS (top) and NDMM (bottom) patients. The right half of each plot is occupied entirely by 4 MC (highlighted by the dark blue dashed ovals). Each dot represents an individual cell, colored by the assigned MC. (C) tSNE visualization of CD69 expression showing restriction to the same region that encompasses the 4 BM-restricted MC, colored by the level of expression from low (blue) to high (red). (D) Heat map showing the phenotype of the 25 MC. MC4, MC18, MC20, and MC24 contain CD69+ effector memory T cells (TEM) (left) are BM-restricted, with the remaining 21 MC shared between BM and PB. The color represents the median intensity of the signal from low (blue) to high (red) for an individual marker (row) in an individual MC (column).

of both MGUS and NDMM (Figure 4A). Visualization of cluster distribution on t-distributed stochastic neighbor embedding (tSNE) (Figure 4B) revealed these four metaclusters as cells expressing high levels of CD69 (Figure 4C), confirming tissue-restricted expression of this protein. Despite accounting for approximately half of all cells in both cohorts, FlowSOM determined these cells sufficiently homogeneous as to cluster them into only four metaclusters, suggesting the bulk of phenotypic heterogeneity exists across the 21 metaclusters shared between BM and PB (Figure 4D).

Flow cytometry demonstrates enhanced levels of CD38 and CD69 differentiate health and disease within the bone marrow-CD8+CD69+ population

Focusing on differences within the BM, FlowSOM analysis of high dimensional flow cytometry data of the BM-CD8+ TEM subset revealed differences between MM and age-matched controls were largely restricted to levels of expression of markers associated with TCR-activation, CD38 and CD69, but not CD25 (Figure 5A). However, differences were not restricted to the dominant CD8+ TEM subset, with manual analysis revealing significantly higher levels of CD69 expression evident in MM compared to age-matched controls evident across all antigen-experienced cells (Figure 5B). CD38 was similarly expressed at significantly higher levels in all canonical subsets in both the BM-CD8+CD69and BM-CD8+CD69+ T cells in MM (Figure 5C). Analysis of

inhibitory markers PD-1 and TIGIT revealed disease-associated differences evident only within the CD69- subset; BM-CD8+CD69- TTE demonstrated significantly fewer cells expressing PD-1 in MM compared to age-matched controls (Figure 5D). Similarly, significantly fewer BM-CD8+CD69- TEM and TTE expressed TIGIT in MM compared to age-matched controls (Figure 5E).

Broad dissimilarities between BM-CD8+CD69- and BMCD8+CD69+ TEM subsets were evident in expression patterns of the interleukin-7 receptor α (IL-7R/CD127) and killer cell lectin-like receptor G1 (KLRG1), markers associated with effec