Page 1

The Leader Serving tipton county since 1886 | covingtonleader.com | Vol. 124, No. 39 | thursday, August 5, 2010

Election Day has arrived By Tiffany Holland tholland@covingtonleader.com Early voting wrapped up this past Saturday, July 31. However, people still have a chance to vote with the regular Election Day coming up this Thursday, August 5. As election results come in on Thursday, The Leader will keep the public updated constantly by posting the results on our

website, www.covingtonleader. com. They will be posted in front of the pay wall, so people will not have to pay anything to view the elections results. The results and election discussions will also be posted on The Leader’s Facebook fan page that anyone can take part in or just view for information. The Leader will also follow up with details about election results in next week’s paper

and feature photos of several candidates in celebration or on the campaign trail. For those who have not voted yet, this election has several hotly contested seats coming up, with some earning national attention. There are party primaries held for the office of governor, U.S. House, State House and State Senate. This is a general election for the county, with races for

county commissioner, circuit court clerk, county trustee, county sheriff, county court clerk, register of deeds, school board districts 2, 4, 6, 7 and 8, constable districts 1 – 9, and county executive. The offices of circuit court clerk, trustee, register of deeds, sheriff and county executive are running unopposed. Since the last election, some polling locations have

changed. Current polling locations are as follows: ▪ District 1, Precinct 1 Northeast Covington will vote at Collins Chapel C.M.E. Church, located at 303 W. Ripley Ave., Covington ▪ District 2, Precinct 3 Southeast Covington will vote the National Guard Armory, located at 4500 Mueller Brass Road, Covington See vote, page A3

It’s like a heat wave Record-breaking temps bring danger to county By Echo Day eday@covingtonleader.com

Phase II of Project Play took place from Friday, July 30 - Sunday, Aug. 1. Despite the heat wave and excessive heat warnings, hundreds of volunteers participated in the rebuild effort over the weekend. Above, Cendi Ramsey, Covington Mayor David Gordon and other volunteers work to install equipment while organizer Lee Johnston sets the piece in place with a forklift. The playground is nearing its completion. See A2 for more photos. Photo by Tyler Lindsey

Playground rebuild progresses despite heat

I

By TIFFANY HOLLAND tholland@covingtonleader.com

n spite of the heat hitting some of the highest temperatures of the year, hundreds of volunteers showed up this weekend for the rebuilding efforts of Project Play. As the heat beat down on the workers, many men, women, and teenagers remained hammering and drilling away on the playground, which was originally burned down by arsonists in February at Cobb-Parr Park. The work paid off since the project is near completion and no longer requires anymore community rebuilding efforts. Just a few ends need to be wrapped up and safety measures secured until the park

will be opened. Many people also played a part by donating food, water and cooling products for the workers. Even though the heat was intense, most of the volunteers never regretted being involved for a moment. “I really enjoyed it,” said William McMahon, one of the team leaders for Project Play. “I don’t have any kids to play on (the playground) but I think it will just benefit people in the area and bring people out. It turned out really nice. It is even nicer than before.” Several churches brought hoards of volunteers including their youth group, many of the local schools’ coaches and club organizers brought some of their young players and students and dozens of teachers spent their last days of

their summer vacation working to rebuild the playground. On Friday morning alone, there were 178 volunteers, according to people at the site, and many stayed well after the second shift. Children under 10 were not allowed on-site but childcare was available for volunteers. Children ages 10-14 were allowed on-site, but had work one-on-one with a parent or guardian. Those ages 14-17 were also able to participate in construction. Everyone there was doing something, even if they were not building. An opening date for Project Play has not been determined yet, but is smoothly in the works thanks to the hundreds of community members who found a positive way to benefit their community.

Munford accident kills two, injures two By Echo Day eday@covingtonleader.com MUNFORD – An accident claimed the lives of two people in Munford Friday night. According to police reports, a 1999 Ford Mercury driven by Jacob Williams was traveling along Hwy. 51 when it veered off the roadway between Big Creek Drive and Joe Joyner Road and flipped, ejecting three of its four passengers. The accident took place at approximately 11 p.m.

Visitation for Justin Stone will be held from 4-7 p.m. on Friday, Aug. 6 at Jefferson Mortuary, Millington. Funeral services will be held at 11 a.m. on Saturday, Aug. 7 at Munford High School. Interment will follow at Mt. Herman Cemetery, 3492 Quito-Drummonds Road, Drummonds. Repass will be held at Munford High School after interment. He is survived by a daughter, Mykyla Miller; mother Brenda Finnie (Douglas) Hudgins of Munford; father Michael Stone Sr.; sisters Stephanie Finnie and Myisha Stone; and brother Michael Stone Jr. Arrangements for April Lemons were unclear at press time.

Reportedly unrestrainted, Williams and passengers Justin Stone and April Lemons were thrown from the vehicle. A female riding in the passenger seat was wearing her seatbelt and

had to be extricated from vehicle, police said. Stone and Lemons were killed. Williams and the female passenger were flown to the Regional Medical Center in

Memphis where they remain hospitalized. Nearly a week later, the accident is still under investigation by the Munford Police Department. “We’re trying to find out why they veered into the median,” said police chief Jim Harger. “We’re trying to determine the cause and if alcohol was involved.” Persons with information are asked to contact investigators with the Munford Police Department at 901-8375980.

With the mercury hovering in the three-digit range for several days, the heat is definitely on. Dangerously hot temperatures have plagued the Mid-South since late last week, making residents uncomfortable at best. “The Mid-South is experiencing a dangerous heat wave with temperatures in the triple digits,” said Action News 5 meteorologist Ron Childers on the station’s weather blog. “These high temperatures coupled with high dew points create extremely high indices making dangerous conditions.” With heat indices reaching up to 126 degrees in some areas, the National Weather Service has issued excessive heat warnings, encouraging people to limit outdoor exposure. An excessive heat warning is issued when the heat index exceeds 110 degrees for more than two consecutive days. Most of the MidSouth has been under this warning since late last

See heat, page A3

Covington to donate AC units By TIFFANY HOLLAND tholland@covingtonleader.com COVINGTON – The Finance and Administration Committee recently approved for money raised by the People Helping People program to be used to donate air conditioning units to needy people who do not have air conditioning in their homes. The committee met on Aug. 8 to discuss matters concerning the budget, where Mayor Gordon stated that there was more than $9,000 in the People Helping People fund. He then suggested that part of it be allocated to needy families for air conditioning units, which will help them during the current dangerous heat wave. Alderman John Edwards made a motion for $5,000 to be earmarked from the fund to go to Delta Human Resources to administer air conditioning units for the people in need. A report from Delta Resources will be given to the city council after the units have been donated. According to Mayor Gordon, he and other city workers are looking tirelessly to find air conditioning units for homes to purchase. At the time of printing, four air conditioners have been found and are going to be distributed immediately. The People Helping People program is administered by the City of Covington to help the elderly, handicapped and needy meet their energy costs by charitable citizens adding a dollar or more to their utility bills. The city then forwards all money received to See units, page A3

Area events

This week’s week’s Featured This featuredChurch: church:

Covington • Barretville • Millington • Collierville South Tipton • South Covington Morgage Offices: South Tipton • Millington • Arlington • Collierville

Calvary Baptist Church Turn PageA7 A7forfordetails details Turn to to Page

Area events 8/6/ – 8/8/10 Tax Free Weekend 8/9/10 First Day of School


A2 • Thursday, August 5, 2010 • The Leader

Atoka city officials voice concerns over park rules By Echo Day eday@covingtonleader.com

ATOKA – As construction enters its final stages on Walker Park, several city officials have voiced concerns regarding the safety of residents and the park’s construction. During Tuesday’s meeting, these concerns prompted the Board of Mayor and Aldermen to pass park rules and agree to purchase signage. “We’ve got a problem and we need to address that,” said police chief Jessie Poole. Poole told city engineer Kevin Ledford he was concerned that pedestrian crossing was too close to the intersection of Walker Parkway and Meade Lake Road. “It’s awfully close to that corner, that’s just my opinion.” Poole also asked the board to establish park rules, such as a curfew for minors, and more lighting for parking lots, which will add to the safety of the residents using the facility. The issue of a curfew and posted rules has been brought up in several meetings since the first park on Walker Parkway was completed in 2008, but has never been resolved. “We need to quit talking about it, we need to act on it,” Poole said. The board voted to approve the curfew and, effective immediately, persons under the age of 17 are not permitted to be in any Atoka park after dark without a parent or guardian. Additionally, the board voted to establish city-wide rules for its parks. “There are several things that need to be thought through and posted at the entrances to the parks,” said Ledford. A city official said these measures will be put in place to reduce potential liability to the city. The park committee is set to meet prior to the next board meeting to develop park rules and regulations. The city also voted to put in more lighting at the park. “We need to do that if at all possible to make it more secure for the people who use it,” Poole said. Construction concerns Meanwhile, alderman Earl Billings

www.covingtonleader.com Project Players On July 30-Aug. 1, hundreds of volunteers braved tripledigit temperatures to assist in the second phase of the Project Play rebuilding effort. At left, a team works to assemble the railing and secure the spire on one of the towers. Photo by Tyler Lindsey Below, Martha Lawler, Sharman Coley and Amy Payne worked Friday afternoon to install structural supports. Photo by Echo Day

told the board he was disappointed in the company building the park. In August 2008, the Town of Atoka was awarded a $400,000 grant from the Tennessee Dept. of Environment and Conservation. A matching grant, the town was required to have assets matching $400,000 to be contributed to the construction of the park; a parcel of land worth $400,000 was donated by Munford Development Company and used to meet these requirements. The grant covers park development, parking, lighting, playground and safety surface, soccer field development, trails, restrooms compliant with the American Disabilities Act, park amenities and furnishings. R&R General Contractors bid $530,235 for the completion of the park, of which the town will have to pay $162,235. “We got took big,” he said. “I’ve not seen more than three people working.” Billings is also concerned about the walking track, which he believes has not been constructed properly. “I’ve never seen anything like this,” he told Ledford and the board. “I’ve never seen a track below the dirt or even with the dirt. When it rains, water will go under the black top and freeze it this winter and break (the black top) up! There’s no doubt in my mind, but you’re an engineer and I’m just an old country boy.” Billings said he was worried the town would be sued if the track freezes and a pedestrian falls on it. He is also concerned about the possibility of snakes in the ditches and insulted the park’s design. “I’m responsible for the design,” Ledford said. “In my defense, we put it where we had the land and we built it with the contour of the land.” Ledford told Billings he believed when it was finished, Walker Park would be a nice park for residents. Billings, though, is disappointed the contractors missed their July 2010 deadline. Ledford said the park is “shaping up nicely” and is expected to be completed in the coming weeks, just as soon as Southwest Tennessee Electric can set up the electricity.

the

Restaurant report The following are recent inspection scores for Tipton and North Shelby county establishments:

Corps reopens river to barge traffic DUVALL LANDING - Two Memphis district team members of the Corps of Engineers responded to a potentially deadly chemical spill on the Mississippi River west of Covington on Monday night, July 26, when two towboats collided spilling a highly toxic chemical into the water. From the Corps river engineering section, Mark Manning of Munford and Derrick Smith arrived on the scene of the incident Tuesday morning aboard the Memphis District survey boat Tiger Shark. “The collision ripped a three-feet-long gash in a barge carrying acrylonitrile, dumping the chemical into the water,” Smith said. “We got there at about 1:30 a.m. and assisted the Coast Guard response team in shuttling their staff to and from the wreck.” Smith said their assistance was important since neither the Coast Guard nor local emergency management officials had a response vessel immediately available that was appropriate for the mission. Because of the possible presence of toxic fumes, responders could be moved more safely around the area of the collision inside the Tiger Shark’s enclosed cabin. Acrylonitrile is a chemical used in making plastics and synthetic rubber and

Donaldson’s Produce 100

Midway Grocery 77

Inspected: June 10, 2010

Inspected: May 14, 2010

453 Liberty Church Road Brighton, TN 38011

6213 Highway 59 Mason, TN 38049

Xpress Food Mart 73

Buchanan’s Grocery 90

Hwy. 70 & 79 & 59 Mason, TN 38049

Highway 70 East Mason, TN 38049

Inspected: May 14, 2010

Inspected: May 14, 2010

Tennessee uses a 44 item inspection sheet with a maximum of 100 points; scores of 70 and above pass inspection. Thirteen of the items are considered critical. Critical items, found out of compliance, must be corrected within 10 days. Follow-up inspections are conducted to determine compliance on critical items. Failure to correct critical violations or imminent health hazards result in closure of establishments until corrections are made. Serious or repeated violations may result in revocation of the establishment’s permit. The scores are used as a tool by the state and industry to place a value on compliance to the regulations, educate the operators, and thereby encourage corrective action. Complete records of food service establishments are public records and are available for public viewing at the health department. Scores can also be found online at http://health.state.tn.us.

A publication of THE

See river, page A3

LEADER ▪

August 5, 2010

Poplar Grove Assembly invites you to hear

Rev. Finis R. “Rufus” Roberts as he brings to you,

This Man Has A Message For You

Celebrating Homecoming 2010

& Bro. Rufus Roberts’ 50 Years preaching Gods word

Sunday, August 8, 2010

Sunday School 10 a.m. • Preaching 11 a.m. • Lunch 12 p.m.

Preaching & Singing Sunday afternoon. Also take this opportunity to met our new Interin Pastor Bro Robert McDaniels


Thursday, August 5, 2010 • The Leader • A3

www.covingtonleader.com

Family wants answers after sexual assault By Echo Day eday@covingtonleader.com MUNFORD – In mid-June, a Munford High School student was sexually assaulted while attending summer school and nearly two months later, her family is still looking for answers. The victim’s godfather, whose name has been protected for her safety, said he can’t imagine what she must be going through. “What we have is a 15-year-old girl who may never be right,” he said. “She may never trust men again.” He said his goddaughter was assaulted in a bathroom at the school and accuses one 15-year-old of the assault and says a second 15-year-old has been caught on camera standing outside the bathroom while it happened. Because the case involves juvenile victims and suspects, police cannot release many details, only stating the incident occurred at the high school and a 15-year-old male from Lauderdale County has been charged with sexual assault. Tim Fite, director of schools, said the boy charged was not a student in the Tipton County school system last year, but was allowed to take a credit recovery course this summer. “The boy charged will appear before the juvenile judge which will determine placement,” said Fite. The victim’s godfather wants to know why the second boy, who is from Munford, wasn’t charged. Police chief Jim Harger said the second juvenile faces punishment through the school system. “When we reviewed the tapes it didn’t appear to be what he was accused of,” Harger said. “We felt like the school could do more than we could, even if we could get a conviction. The other boy was the one

heat

Continued from A1 week. But the heat is nothing new this summer. Neighboring Shelby County recorded its tenth heatrelated death this summer on Wednesday but only one death this summer has been blamed on the hotter-than-average temperatures. Average temperatures for the first week of August hover around 91 degrees, according to the National Weather Service, but Tuesday the mercury topped 106 degrees, breaking the record high of 104 degrees set in 1934. The heat index Tuesday afternoon reached 122 degrees. Wednesday was no different, with temperatures reaching 104 degrees. The August 4 record was set at 102 degrees in 1947. Overnight temperatures are also setting records. The higher-than-normal temperatures have also brought

unprecedented activity for first responders. Munford/Atoka Fire Chief Jay Bonson told Atoka aldermen Tuesday night his department broke a record, answering 16 calls in 12 hours. At the county’s electric companies, shut-offs have been limited as a matter of safety for customers. The excessive heat warning is expected to expire Thursday evening as a cold front makes its way to the Mid-South. It will bring with it slightly lowered temperatures and increased rain chances, Childers said. Friday’s high is still expected to be in the mid- to upper 90s. A few strong or severe thunderstorms with locally heavy rainfall could accompany the cold front Thursday night and Friday. But don’t get used to the slightly cooler temperatures as triple digits are back in the forecast just in time for school early next week.

Catch the election results for free at our website, covingtontonleader.com, and chat about the election with us on our Facebook page, facebook.com/covingtonleader.

munity, located at 228 Quito Drummonds Road, Drummonds ▪ District 7, Precinct 19 - Austin Peay will vote at

is highly flammable and toxic. There is also evidence indicating it may have carcinogenic properties when ingested in high doses. Because of the highly dangerous situation the Coast Guard established a safety zone. The zone is a seven-mile reach from the site of the collision southward and all traffic on the river was closed. This area is north of Randolph in Lauderdale County. Smith said the river closure caused a backup of 32 vessels and their tows above and below the safety zone. Reports say that three crewmen from the towboat Dixie Express were taken to a Memphis hospital complaining of

respiratory problems. One man was released but the other two were kept for treatment. When inhaled for less than an hour, acrylonitrile can cause headaches, nausea, dizziness and other symptoms according to the Environmental Protection Agency. “A Corps contractor was in the area constructing bendway weirs and also had to stop work and leave the area,” Smith added. Following initial investigations and after ensuring there was no more leakage, Coast Guard officials reopened the river around 6 p.m. on Tuesday. The Corps contractor went back to work once the traffic backup cleared the area.

units

Continued from A1 Delta Human Resources. People Helping People offers one-time assistance. It serves as a “stop gap” measure to those in need, not an on-going source of assistance. And recipients come from all walks of life, yet due to genuine hardships such as debilitating illness or recent unemployment, their financial resources are thoroughly exhausted. Money for this program was also earned at the Music on the Square events where People Helping People made food and beverages available for purchase, with the funds going to this cause. Delta Resources, a federal program, has the wherewithal for evaluating each person’s situation and which person or persons have the highest need for air conditioning, such as the elderly and young children. The motion was approved and Mayor Gordon said this project would go into the works as soon as air conditioning units are found. If Covington citizens would like to donate money to People Helping People, you can go online to www.covingtontn.com and go to the lower right corner and fill out the form or contact Covington City Hall.

Jake’s Auctions FRIDAY

8/06/10 @ 6:00 preview 3:30 Clearance Auction

Wednesday’s temperature reached more than 103 degrees in Tipton County, breaking a record set in 1947.

Continued from A1

Polls will be open from 7 a.m. to 7 p.m.

Continued from A2

who (allegedly) committed the sexual assault.” With the new school year beginning, the victim’s godfather worries for her safety as well as the safety of other students. “I want to know why he’s going to be allowed to attend this high school and possibly endanger other females?” The Tipton County Student Handbook lists punishments for various infractions. There is none listed for incidents sexual in nature. Fite said the student from Munford will appear before the Student Disciplinary Hearing Authority next week.  “They are not allowed on school grounds until all hearings have taken place,” Fite said. The victim’s godfather said he’s frustrated because he’s not receiving answers to his questions from the school board, from police or anywhere else. “I’ve fought two combat tours in Iraq to help people I don’t know,” he said. “It doesn’t seem like they are the type of people who want to help. It’s devastating and I’m frustrated because this is all falling on deaf ears.” He said his quest for answers has consumed his everyday life. He has even contacted Rep. Jimmy Naifeh, Lt. Gov. Ron Ramsey and other officials at the state level. “I’m not finding any answers. Somebody out there has to have one.” He said his goddaughter is a straight-A student who now doesn’t want to go back to school. “I’ve been in bad situations in my life … and I can’t imagine what this would do to a 15-year-old girl.” The 15-year-old who allegedly committed the assault is set to appear in court on Aug. 16. The other boy, Fite said, is expected to have a disciplinary hearing next week.

Vote

▪ District 3, Precinct 6 - Tipton West will vote at Garland Community Center, 1598 Garland Drive in the Garland community ▪ District 4, Precinct 10 - West Atoka will vote at Atoka United Methodist Church, 609 Atoka Munford Ave., Atoka ▪ District 4, Precinct 11 - East Atoka will vote at Gateway Baptist Church, 1915 Rosemark Road, Atoka ▪ District 5, Precinct 12 - Munford will vote at the city’s board room, located in between the police and parks and recreation departments at 69 College Street, Munford ▪ District 6, Precinct 14 - Southwest Tipton will vote at Poplar Grove United Methodist Church in the Drummonds com-

river

Austin Peay Elementary, located at 474 Academic Drive in the Mt. Carmel/ Clopton community ▪ District 8, Precinct 21 - West Wilkinsville voters will vote at St. Mark’s M.B. Church, 3220 Wilkinsville Road ▪ District 9, Precinct 22 - Brighton will vote at Brighton Community Center Persons who have moved or are unsure about their polling location or precinct may visit the Tipton County Election Commission at 113 Church Street in Covington for assistance. On election day, polls will be open from 7 a.m. to 7 p.m. For more information, please call the election commission at 901-476-0223.

All items in building must go. Antiques, beautiful glassware, collectibles, figurines, bookshelves, entertainment center, decorative seating, household items, pictures, aluminum porch columns, decorative lamps, kerosene heater, great box deals & more. 16228 Hwy 51 N Millington (Next to Jakes Flea Market) 901-837-2143 or 901-268-7468 J.C. Carter III#6423 App. Tony Elam#6419 App. Paul Wingard auctioneer #5989 Firm#5127

How Good Can A $189 Window Be? Good Enough To Be America’s #1

How Good Can A Window Be? Ask your Window Consultant for Details How Good Can A $189 Window How Good CanWorld A $189 $189 Window Be? Be? Good Enough Enough To To Be Be America’s America’s #1 #1 Good Enough Be America’s Good Enough To America’s #1 GoodGood Enough To Be BeTo America’s #1 #1 Series 4000

189 installed $ $ $189 189 189 installed installed installed $

Ask your your Window World Consultant Consultant for Details Details Ask Window World Consultant for AskWindow your Window Consultant for Details Ask World for White Ask your your Window WorldWorld Consultant for Details Details Double Hung Series 4000 Series 4000 Series 4000 Series 4000 Any Size Series 4000 Series 4000 White White up to 4’x6’ Options Extra White White White White Double Hung Double Hung Double Hung Hung Double Hung Window World and theDouble economic Double Hung Any Size Any Size Size Any Size Any Size stimulus plan can put money inAny your Any Size up to to 4’x6’ up to 4’x6’ Options Extra Options Extra up to 4’x6’ Options Extra up 4’x6’ Options Extra up to 4’x6’ Options Extra pocket. GetExtra up to $1,500 Credit up Tax to 4’x6’ Options

Window World and theand economic Window World and the economic this yearWindow and upand to 35%* offthe your World economic Window World the economic Window World and the economic Window World andput themoney economic stimulus plan can put money in your in your stimulus plan can in your energy bills forever. Plus, with our stimulus plan can putin money stimulus plan can put money your stimulus plan can put money in your stimulus planup can put money in your pocket. Get up to $1,500 Tax Credit pocket. Get to $1,500 Tax Credit fl exible fi nancing options, there’s never pocket. Get up toTax $1,500 Tax Credit pocket. Get up $1,500 Credit pocket. Get up to to $1,500 Tax Credit pocket. Get up to $1,500 Tax Credit this year and up to 35%* off your this year and up to 35%* off your been a better time to install America’s this year and up to 35%* off your this year and up off your this year and up to 35%* off your this year andforever. up to to 35%* 35%* off your energy bills forever. Plus, with ourwith our energy bills Plus, with our favorite replacement windows. energy bills forever. Plus, energy bills forever. Plus, with our energy bills forever. Plus, with our energy bills forever. Plus, with ournever fl exible fi nancing options, there’s never fl exible fi nancing options, there’s flnancing exible financing options, there’s never Visit ourfl 2805 Stadium Square, Jonesboro exible options, there’s never flshowroom, exible fi fi nancing options, there’s never fl exible fi nancing options, there’s never been a better time to install America’s been a better time to install America’s been a better time to install been a time install America’s We can show you windows that QUALIFY ~ America’s been a better time to install America’s been a better better time to to windows. install America’s favorite replacement windows. favorite replacement favorite replacement windows. favorite replacement windows. call for FREE in-home demonstration. favorite replacement windows. favorite replacement windows. Visit our showroom, 2805 Stadium Square, Jonesboro Visit our showroom, 2805 Stadium Square, Jonesboro Visit our showroom, 2805 Stadium Square, Jonesboro Visit Visit our showroom, 2805 Stadium Square, Jonesboro Visit our our showroom, showroom, 2805 2805 Stadium Stadium Square, Square, Jonesboro Jonesboro We can show you windows that QUALIFY ~ We can show you windows that QUALIFY Wewww.windowworld.com can show you windows that ~ QUALIFY ~ We can show you windows that We can show you windows that QUALIFY ~ Wecall canfor show you windows that QUALIFY QUALIFY ~ ~ call for FREE in-home demonstration. FREE in-home demonstration. call for FREE in-home demonstration. call for FREE in-home demonstration. call FREE in-home demonstration. call for for*Call FREE in-home demonstration. for details on 30u windows that meet government guidelines.

870-910-0189

870-910-0189 870-910-0189 901-684-6670 870-910-0189 www.windowworld.com www.windowworld.com www.windowworld.com www.windowworld.com www.windowworldmemphis.com www.windowworld.com www.windowworld.com

*Callfor fordetails details*Call on30u 30u windows that meet government guidelines. *Call for details on 30u windows that meet government guidelines. forwindows details on 30umeet windows that meet government guidelines. *Call on that government guidelines. *Call *Call for for details details on on 30u 30u windows windows that that meet meet government government guidelines. guidelines.

Helen Crigger Cemetery Old SectiOn GraveS Now Available

837-0123 Limited spaces. Call now!


OPINION www.covingtonleader.com

Thursday, August 5, 2010

Finding the truth in political problems

“President Obama has President Obama is decided that there will not a Muslim either, no longer be a “National as many claim; he has Day of Prayer” held in been associated with the May. He doesn’t want to Church of Christ since offend anyone. Where the 1980s and considwas his coners himself a cern about Christian. All of offending this information Christians can be found in last January so many places, when he I won’t even list allowed the them. It isn’t hidMuslims to ing. hold a day What bothers of prayer on me most about the capitol Internet ON THE RECORD these grounds. As rumors isn’t that an American TIFFANY CARR HOLLAND people believe Christian them without “I am offended.” If you checking the facts (I agree, copy and paste no believe things all the matter what religion you time that turn out to be are. This country was false), but that people built on freedom!!” consider this so imporThis comment has tant. been sent to me in email I went to a National and seen on Facebook by Day of Prayer ceremony myself a countless numheld on the Covington ber of times. Therefore I Court Square with 70 or feel the need to address so other people. Every it. After all, it is election Christian in town cerseason even if there isn’t tainly did not show a Presidential election. up. But I am not sayThis statement above ing just because you is completely and entire- didn’t go out and celly untrue. There is a ebrate National Prayer National Day of Prayer. Day that you are not There was one last year, Christian. That would this year and probably be wrong because many will be next year too. people had jobs and National Prayer Day things that must be done began with President at that time, right? They Truman in 1952 when he could’ve celebrated it in signed a bill proclaimprivate, right? I imaging it. In 1988, President ine the president of the Reagan made a set date United States could easfor the day on the first ily fall in this category Thursday in May. as well. Last year President With the problems Obama decided not with the economy, to host an ecumenical healthcare, taxes, oil, the service in the White environment, political House in observance of corruption… (and the National Day of Prayer, list goes on.) is this realbut instead opted to ly the biggest complaint observe the occasion pri- many people seem to vately. He DID continue find with the president? the tradition of issuing I should think not. a presidential proclaOf all the reasons to mation designating it point out that President National Day of Prayer Obama and his adminand he did not cancel istration are doing a it, but even stated that lackluster job, there are prayer is something he so many more important does every day anyway. problems to focus on. In fact, when a fedThere certainly are eral judge ruled that enough things to find National Day of Prayer fault with in the White was unconstitutional, House that are entirely the Obama administratrue and no need to tion is the defendant. make things up.

A4

Nuclear power is green power Forty years ago, at the time has the lowest per capita carbon of the first Earth Day, emissions and among the Americans became cheapest electricity costs deeply worried about in Western Europe. Italy, air and water polluBritain, Finland and tion and a population Eastern Europe all are explosion that threatexploring new reactors. ened to overrun the Russia, India, China and planet’s resources. Japan are moving ahead. Nuclear power was South Korea is selling seen as a savior to reactors to the United these environmenArab Emirates. tal dilemmas. It These countries could produce large realize that exploding amounts of low-cost, populations demand reliable clean energy. large amounts of cheap, Unlike oil, nuclear SEN. LAMAR ALEXANDER reliable electricity to power did not need to help create jobs and lift be hauled in leaking people out of poverty. tankers from countries that didn’t And nuclear power provides just like us. Unlike coal, it didn’t that. The National Academy of spew tons of pollution out of Sciences in a 2009 report said smokestacks. that the cost of nuclear power is Then Three Mile Island and equal to or lower than natural gas, Chernobyl happened. The world wind, solar, or coal with carbon pulled back, fearful of nuclear capture. Reactors can operate for technology – even though no one 80 years while wind and solar was hurt at Three Mile Island. last about 25 years. And nuclear In fact, no one has ever died as reactors operate 90 percent of the a result of a nuclear accident at time while wind and solar are an American commercial nuclear only available about a third of reactor or on a U.S. navy ship the time. (Remember: wind and powered by reactors. Chernobyl solar power can’t be stored today was the tragic result of a flawed in significant amounts.) Most technology never used in the people don’t want their lights and United States. Still, the United computers working only when States hasn’t licensed a new reacthe wind blows. tor since 1978. Nuclear plants occupy a fracNow the rest of the world tion of the land required for wind is returning to nuclear energy. or solar. For example, 20 percent France is 80 percent nuclear and of U.S. electricity comes from

D.C. VIEW

104 nuclear reactors on about 100 square miles. Producing the same amount of power from wind would require covering an area the size of West Virginia with 183,000 fifty-story turbines as well as building 19,000 miles of new transmission lines through scenic areas and suburban backyards. Nuclear fuel is available in the U.S. and is virtually unlimited. We don’t have to drill for it. We don’t have to mine it nearly as much as we do for coal. And thanks to technology, we can safely recycle “nuclear waste” and turn most of it into more fuel. After recycling, the French are able to store all of their final waste from producing 80 percent of their electricity for 30 years in one room in La Hague. A more recently realized benefit of nuclear power is its ability to combat climate change. Nuclear power emits zero greenhouse gases. Today it produces 20 percent of our nation’s electricity but 70 percent of our carbon-free electricity. Wind and solar provide less than 2 percent of our electricity and 6 percent of our carbon-free electricity today. The United States uses 25 percent of all the energy in the world. At a time when we need to produce large amounts of clean power at home at a cost that will not chase jobs overseas looking for cheap energy, Americans can’t afford to ignore nuclear power.

Everyone Proudly Voted

There ain’t nothin’ no better than a festive occabales on a mule pulled flat bedded trailer really sion in the South. Especially in the hot summer sul- involves. So it’s best we get one of us that undertry air when you can’t get yo’ breath. Going to the stands and will help us. polls and makin yo’ mark provided the opportunity My Fellow Americans can dwell that a few for some socializin’, eatin’ and down home good up weeks before the election the citizens were remindto date communicatin’ (No gossipin’ was allowed). ed, “it ain’t long before votin’. By the time they Neither was any wide open lyin’ permitted journeyed to Stewartville Lodge to cast but the truth might be stretched maybe a their vote the entire population was enerfifteen foot plow line or so. gized to be part of a movement. Friends, the northern end of Shelby Ease back in time. No television, little County was fortunate to have Mr. Paul radio except music and farm reports with as he was affectionately referred to as the just Lone Ranger and Green Hornet serials leader of the congregation. All of the in the afternoon. Some news about folks citizens respected and admired him and we never heard of, much less met. We had ‘Miss’ Sarah to watch over his flock. The newspapers about folks runnin’ for politimajority of the families in these rural comcal office, but our farmer friends were runSOUTHERN RAISIN' nin’ to slop the hogs, gather eggs and milk munities depended on him to look out for O TIS GRIFFIN them as most were dirt farmers too busy Bessie. in the field for an up date concerning poliTo ensure everyone got to make their tics. If the word philosophy entered into the conver- mark. (to select yo’ man) Simple! A good Southern sation concerning politics the answer was, “let Mr. term. Mr. Paul knew how many and who were Paul handle it as he’s smart in them things and I’ll eligible to vote. Transportation was furnished with go along with him.” school buses, and trucks loaded down headed to the The way this thing worked I found out years precinct? All of the businesses were shut down and later from Daddy on our front porch talks was employees helped out. fairly simple. Needs and wants out in the counThe workers at the bank, Mrs. Ollie Mae try were different from folks down in the middle McClanahan, Mr. G. K, Spencer and Miss Marie of Memphis. We need roads, good schools, safety Dismon were the paper handlers. Mr. Roy Stovall, and money to put in a crop which correlated with Emerson’s granddaddy, Phil’s Daddy, Mr. Howard low taxes. Now a fella’ with a white shirt and tie and Mr. Sparks, provided the ice cold refreshments that sits behind a desk just don’t understand what usually tea, Double Colas, R. C.’s and Nehis on pullin’ a misery stick down the cotton rows in the the miserable hot days. Food such as huge pots of blazin’ sun or chunkin’ hundred pound lespedeza greens, beans, pork with pans of corn bread and THE LEADER USPS 136-120 “Tipton County’s NEWSPAPER Since 1886” 2001 Highway 51 South Covington, Tennessee 38019 Published Every Thursday by Tipton County Newspapers, LLC PHONE 901-476-7116 www.covingtonleader.com

Garland s Burlison Covington s s Gift Gilt Edge s Brighton s Randolph s s Clopton Charleston Drummonds s Munford Atoka s s Quito s s Idaville Mason s s Wilkinsville Tipton s s s

Brian Blackley – Publisher/ General Manager bblackley@covingtonleader.com News Echo Day – Staff Writer eday@covingtonleader.com

Tipton County, Tennessee

The Leader (USPS 136-120) is published weekly for $33.00 per year in Tipton County, $40.00 per year in Tennessee and $47.00 elsewhere by Tipton County Newspapers, LLC, P. O. Box 529, 2001 Highway 51 South, Covington, TN 38019. Periodicals Postage Paid at Covington, TN. Postmaster: Send address changes to The Leader, P. O. Box 529, Covington, TN 38019. Reproduction of all matter contained herein is prohibited without the express consent of Tipton County Newspapers, LLC.

Tiffany Holland – Staff Writer tholland@covingtonleader.com Tyler Lindsey – Staff Writer tlindsey@covingtonleader.com

Advertising Andy Posey — Sales aposey@covingtonleader.com Beverly Miller – Sales bmiller@covingtonleader.com

biscuits were available after votin’. Mr. Williams, Gail’s Daddy and Mr. Wayne, the store butchers, fed many a hungry soul. Neighbor, this was one time the scattered communities united, celebrated and felt good about participating. Daddy proudly said, “the best I remember everyone that could vote got to make their own mark.” Daddy continued with, “downtown sent a fella’ out here to check to make sure things were done right.” Further, “this stranger wasn’t very friendly as he just kind of walked around and done a little snoopin’.” Daddy finished with, “he talked to Mr. Paul occasionally and tried to gab with some finished voters but they just walked away.” Visibly upset, Daddy ingrained in me with, “you just can’t trust ’em carpet baggers as I recollect what they done to my granddaddy back in the Delta.” Once the votes were correctly counted, witnessed by Mr. high hat Snoopy, Mr. Paul thanked everyone, hoped they had a good time and told them to stop by if they needed anything. I was too young to understand, but legend has it many times only one candidate out of several on the ballot sheet actually got any votes. All’s well that ends well! Just another day of goin’ to the polls in our wonderful South…GLORY! All of my faithful country readers are cordially invited to my Southern Raisin’…book signing… August 15th at the Patriot Bank in Millington beginning at 2 PM.

Commercial Printing Shane Waits – Manager swaits@covingtonleader.com Richard White – Print Assistant

A publication of American Hometown Publishing

Graphic Design Sara McKee smckee@covingtonleader.com Front Office/Legal Notices Kathy Griffin – Manager office@covingtonleader.com

Front Office/Classified Advertising Teri Jennings - Classified Ads tjennings@covingtonleader.com

20

Member

09

Tennessee Press Association

PROUD MEMBER OF Tennessee Press Association and National Newspaper Association


www.covingtonleader.com

Major closures on I-40 bridge

Memphis. - Crews are preparing to conduct the first of several months of major lane closures as work to seismically retrofit the Interstate 40/ Hernando DeSoto Bridge over the Mississippi River continues. August 3, 2010 through mid-September - The I-40 Eastbound exit one off-ramp to Front Street, Riverside Drive and the Tennessee Welcome Center will be closed. All traffic will be detoured to Exit 1B at Danny Thomas Blvd. to Poplar Avenue, Front Street, and Jefferson Avenue. A detour map is attached. This is the first of three phases of major lane closures on the bridge through the mid-November. Crews will be replacing a large seismic joint on three bridge piers. During the second phase, which begins September 7, crews will reduce I-40 to one lane in each direction until the week of November 15. In addition, phase three will require

crews to close the I-40 westbound entrance ramp from Front Street and Riverside Drive in mid-October through mid-November. TDOT has created a project website, http:// www.tn.gov/tdot/ i40hd/, to keep the public informed about the upcoming project and will distribute brochures and posters to area businesses to further spread the word about the upcoming closures. For more information on travel conditions across the state visit the TDOT SmartWay website at www.tn.gov/ tdot/tdotsmartway/ <http://www.tn.gov/ tdot/tdotsmartway/> or dial 5-1-1 from any land-line or cellular phone. TDOT is also on Twitter. For up to date travel information for the Memphis area follow Memphis511 <http:// www.twitter.com/Nashville511> on Twitter or follow TN511 <http:// www.twitter.com/ TN511> for statewide updates.

School zones back The Tennessee Highway Patrol is gearing up for the school year with a heightened enforcement campaign to keep children safe in and around school zones. Cracking down on motorists who disregard laws designed to protect children and monitoring school zones and bus stops are just a few components of the enforcement effort. “As thousands of students return to the classroom on foot or in school buses, we want to remind everyone to be extra cautious around school zones,” said Department of Safety Commissioner Dave Mitchell. “The goal of the Tennessee Highway Patrol is to help local law enforcement and schools protect children from drivers who may be distracted, impatient or careless.” State Troopers are urging motorists to be alert, slow down and be careful in school zones, while also encouraging caregivers to educate children on safety measures when walking, biking or riding the bus to school. Motorists should be aware that the speed limit is 15 mph in school zones and the fine for speeding in a school zone is up to $500 dollars. It is also against the law to pass a school bus when it is stopped and loading or unloading passengers. The driver can be fined no less than $250 and up to $1,000. “Motorists can expect stiff penalties for driving unsafely in school zones and for placing our children at risk while doing so,” said THP Colonel Mike Walker. “But there is no punishment more

severe than the lifelong guilt and remorse for hitting or killing a child. We are asking everyone to do their part to help a Tennessee child make it to school and home safely.” In 2009, State Troopers issued 5,445 citations in school zones. Of those citations, 973 were speeding violations, while one citation was handed out for passing a stopped school bus. Since 2006, there has been a 15.9 percent decrease in the number of crashes occurring in school zones between the hours of 6 a.m. and 9 a.m. and the hours of 2 p.m. to 5 p.m. There was also a 13.5 percent decline in the number of school busrelated crashes between those same hours. Each day, 25 million children in the United States ride school buses, including 600,000 in Tennessee, according to the National Highway Traffic Safety Administration (NHTSA). The National Safety Council (NSC) reports approximately 26 students were killed while they were entering or exiting a bus in the U.S. last year. Close to 800 children are killed annually and many more injured going to and from school in a vehicle other than a school bus, according to the NSC. For more facts, figures & safety tips, please see the attached Safety Tips and visit our Web site: www. TN.Gov/Safet The Tennessee Department of Safety’s mission is to ensure the safety and general welfare of the public. The department encompasses the General areas of responsibility include law enforcement, safety education, motorist services and terrorism prevention.

Two names you can trust

Thursday, August 5, 2010 • THE LEADER • A5

What is sales tax weekend? When is Tennessee’s Sales Tax Holiday? Sales Tax Holidays begin every year at 12:01 a.m. on the first Friday in August and end at 11:59 p.m. the following Sunday. During this time, Tennesseans can enjoy tax-free purchases on certain clothing, school and art supplies and computers. What’s Tax-Free? Tax-free items include clothing with a price of $100 or less per item, school and school art supplies with a price of $100 or less per item and computers with a price of $1,500 or less. These items are exempt from state and local sales tax in Tennessee during the holiday. Local governments are held harmless and are reimbursed lost sales tax revenues by the state. Who Can Participate? Any individual can make a tax-free purchase during the holiday. However, items purchased for use by a trade or business are not exempt. Can I Order by Mail, Telephone, E-Mail or Internet? The holiday also includes purchases of qualified items sold via mail, telephone, e-mail or Internet if the customer orders and pays for the item and the retailer accepts the order during the holiday for immediate shipment, even if deliv-

THE FACTS:

What if I Want to Place an Item on Layaway or Pay for an Item That is Currently On Layaway? Qualified items previously placed on layaway are exempt when the final payment is made during the holiday. Items are also exempt if placed on layaway during the holiday and the final payment is made after the exemption period. When Did Sales Tax Holidays Start in Tennessee? Tennessee Code Annotated 67-6-393 established annual sales tax holidays in Tennessee in 2006. The first Sales Tax Holiday was August 4-6, 2006, saving Tennesseans about $15 million. Since then, Tennesseans have enjoyed $8 to $10 million in tax savings each holiday

An average of six school-age passengers are fatally injured inside school buses each year, but an average of 16 are killed getting on and off the bus. More than half of the children killed in school bus-related crashes are ages five to seven years old. “Inattention” and “failure to yield” were factors most often reported by police in those crashes. The Tennessee Department of Safety’s Pupil Transportation division of the Highway Patrol inspects school buses from school districts across Tennessee annually. During the 2009-10 school year, 10,595 buses were inspected with 1,138 being placed out of service. All school bus drivers in Tennessee must attend an annual training course in order to receive and maintain the school bus endorsement on their Driver Licenses. During the 2009-10 academic year, more than 12,000 received training. In 2009, State Troopers issued 5,445 citations in school zones across the state. Of those citations, 973 were issued to drivers who were speeding, while one driver was cited for passing a stopped school bus. An estimated 440,000 to 480,000 public school buses navigate roads and highways in the United States each year, traveling approximately 4.4 billion miles. School buses are nearly nine times safer than passenger vehicles. But children must take care when boarding or leaving buses. Young children are most likely to be injured around school buses because they: Hurry to get on or off the bus Act before they think Have little experience with traffic Assume motorists will see them and will wait for them to cross Don’t always stay within the bus driver’s line of sight Drop something as they are getting off the bus and run into the path of the bus to pick it up. SAFETY TIPS: FOR CHILDREN--GETTING ON AND OFF THE BUS SAFELY: Always remain in direct eyesight of the bus driver; Get to the bus stop in plenty of time; Take 10 giant steps back from the curb while waiting for the bus and 10 steps when exiting the bus; Never try to get anything left on the bus after exiting; Never reach underneath the bus; Always follow the driver’s directions for how to cross the street;

Be alert to traffic and look both ways; Always cross in front of the bus, but only when the bus driver signals it is safe to do so. Have a safe place to wait for your bus, away from traffic and the street. Stay away from the bus until it comes to a complete stop and the driver signals you to enter. Use the handrail to enter and exit the bus. When exiting, look before stepping off the bus to be sure no cars are passing on the shoulder (side of the road). Move away from the bus. Before crossing the street, take 10 “giant steps” out from the front of the bus, or until the driver’s face can be seen. Wait for the driver to signal that it’s safe to cross. Look left-right-left when coming to the edge of the bus to make sure traffic is stopped. Keep watching traffic when crossing. Be aware of the street traffic around you. Drivers are required to follow certain rules of the road concerning school buses. However, not all do. Protect yourself and watch out! FOR PARENTS: Supervise children to make sure they get to the stop on time, wait far away from the road and avoid rough play. Teach your child to ask the driver for help if he/she drops something near the bus. If a child bends down to pick up something, the driver cannot see him/her and the child may be hit by the bus. Have your child use a backpack or book bag to keep loose items together. Make sure clothing and backpacks have no loose drawstrings or long straps that could get caught in the handrail or bus door. Encourage safe school bus loading and unloading. If you think a bus stop is in a dangerous place, talk with your school office or transportation director about changing the location.

Steam Away Carpet Cleaning Steam Your Dirt Away, Not Your Carpet

3 Rooms $49.95

5 Rooms $69.95

5 Rooms Sofa & Loveseat

$129.95

Call To Schedule Your Appointment Today!

(901) 482-5892

Vehicles moving in the opposite direction as the bus are also required to stop unless they are on a divided highway. Never pass on the right side of the bus where children are entering and exiting. This is illegal and can have tragic results! WHEN RIDING A BIKE: Mind all traffic signals and/or the crossing guard -- never cross the street against a light, even if you don’t see any traffic coming. Walk your bike through intersections. Walk with a buddy. Wear reflective material...it makes you more visible to street traffic. WHEN RIDING IN A CAR: You might have heard before that most traffic crashes occur close to home...they do. Safety belts are the best form of protection passengers have in the event of a crash. They can lower the risk of injury by 45%. You are four times more likely to be seriously injured or killed if ejected from the vehicle in a crash. Everyone needs to be buckled up properly. That means older kids in seat belts, younger kids in booster seats and little kids in child safety seats.

(901)476-8632 thorntonshomefurnishing.com

M&W

Glass Co., Inc. • Sunrooms • Screened Rooms • Metal & Canvas Canopys

FOR DRIVERS: Yellow flashing lights on the bus indicate that it is preparing to stop and load or unload children. This means cars need to slow down and prepare to stop. It is illegal to pass a school bus with its red flashing lights and stop signal arm activated. Vehicles may not pass until the flashing red lights and signals are turned off or when the bus driver motions them through. Vehicles traveling in the same direction as the bus are always required to stop.

Monthly Specials

995 Hwy 51 N. • Covington, TN 38019 476-5432 • Closed Wednesdays

What if the Item is Backlogged or on Backorder? If a customer wishes to order a certain tax-free item during the holiday and it is not in stock, the item remains tax-free upon delivery. In other words, backlogs and backorders outside the buyer’s control will not affect the exempt status of tax-free items. Intentionally delayed sales are taxable.

Safe transportation for students

Over 10 Years Experience Providing Quality Service

SHOE BARN

ery is made after the exemption period.

Commercial & Residential FREE ESTIMATES

837-2392

149 Commercial Dr. Atoka

It’s a Miracle Year of Wellness During the month of August... All New Patients Will Receive Their First 2 Visits for only $20.10 Examination, Spinal Scans X-Rays, Written Report of Findings & 1st Adjustment 25% of all Proceeds Benefit the Tipton Cares Organization!

Call Today For Your Appointment!!

Cannon Chiropractic

(901) 840-2234 76 Tabb Dr., Suite C Munford Tues-Sat. www.cannonchiropractic.com


FAITH

www.covingtonleader.com

Thursday, August 5, 2010

A6

Towing Available

Professional Tuning/Diagnostics Major and Minor Repairs

Voted 1st place for Best Machanic for 2009

KEN RYMANOWICZ

127 Industrial Road, Ste. B Covington, TN 38019

901-476-5039 Free Quotes Residential/Commercial

(901) 476-2741 No job too big or too small

SIMONTON’S

PETER SIMONTON Cell: 301-3578

Painting & Home Improvement

Home Health Care of West Tennessee Inc.

Phone 901- 840-4663 13690 Hwy 51 S., Ste. 101 Atoka, TN 38004

Design - Build

ROSE

Contractors

476-9600

CONSTRUCTION

Bill McGowan & Co. Complete Insurance Service 100 N. Tipton • Munford • 837-0191

MASON, TN 38049 CERTIFIED WELDERS 0/24!",%7%,$).'s&!2- #/--%2#)!,).$5342)!, !,5-).5-34!).,%337%,$).'

0(  

RICHARD, DANNY& DICKEY BYRD

CITY OF COVINGTON Gas Company 200 W. Washington • 476- 9531

"Serving you with warmth"

WOOTEN OIL CO. 513 Sanford Ave. 901-476-2684

BigRiver.net DSL Lite 22.95 $

872-7772 Member

BAPTIST

ACTS II COMMUNITY CHURCH 106 Star Shopping Lane Covington, TN 38019 901-475-1732

CORNERSTONE COMMUNITY CHURCH 3030 Drummonds Rd Atoka, TN 38004 901-840-4326

ANTIOCH M.B. CHURCH 1785 Wooten Street Covington, TN 38019 901-476-5811

CROSSROADS COMMUNITY CHURCH AT THE NAZARENE 3865 Beaver Rd Munford, TN 38058 901-837-2545

ANTIOCH BAPTIST CHURCH 190 Antioch Road Munford, TN 38058 901-837-9635

EBENEZER CUMBERLAND PRESBYTERIAN CHURCH 70 Witherington Rd Mason, TN 38049 901-294-2670

ASSOCIATED REFORMED PRESB 81 Church Ave Brighton, TN 38011 901-476-7233 ATOKA U.M. CHURCH 609 Atoka-Munford Ave Atoka, TN 38004 873-8454 ATOKA EVANGELICAL PREB 1041 Atoka Idaville Rd Atoka, TN 38004 837-3500 AVERY CHAPEL CME 2365 Leighs Chapel Road Covington, TN 38019 901-476-2337 BEAVER BAPTIST 9344 Holly Grove Rd Munford, TN 38058 901-837-2904 BETHEL BAPTIST CHURCH 55 Andrea Dr. Munford, TN 38058 837-2247 BETHEL CUMBERLAND PRESBYTERIAN 3406 Tracey Rd Atoka, TN 38004 837-0343 BIG HATCHIE BAPTIST ASSOCIATION 1390 Hwy. 51 N Covington,TN 38019 901-476-6759 CAMPGROUND U. M. CHURCH 3183 Drummonds Road Drummonds, TN 38023 837-4629 CANAAN BAPTIST CHURCH 211 Main Street N Covington, TN 38019 476-8782 CAREY CHAPEL AME 4955 Ballard Slough Rd Burlison, TN 38015 475-2288 CALVARY BAPTIST CHURCH 2010 Highway 51 S Covington, TN 38019 476-4433 CALVERY BIBLE CHURCH 894 Munford Ave Munford, TN 38058 837-8563

901-476-0333 1-877-676-5455 TOLL FREE

Home Care & Hospice TIPTON Medicare Certified • Joint Commission Accredited

Assisted Living In Your Own Home Caregivers Bonded & Insured (901)-475-0073

In Home Care

Frank Climer & Sons Paving & Sealing Co. INC.   s  s    No Job Too Small or Too Large

BRIGHTON PHARMACY & GIFT SHOP 1880 Old Hwy 51 • Brighton, TN 38011 Phone: 901-837-8981 • Fax: 901-837-8986 Chuck Porter • Owner/Pharmacist Robin Porter • Owner/Buyer

CENTRAL BAPTIST CHURCH 755 Lucy Kelly Rd. Brighton, TN 38011 901-475-4422 CENTRAL CHRISTIAN CHURCH 400 South Maple Street Covington, TN 38019 901-476-6858 CHARLESTON BAPTIST CHURCH 8642 Hwy 179 Stanton, TN 38069 901.476.8479

ELM GROVE CHURCH OF CHRIST 2016 Elm Grove Rd Burlison, TN 38015 901-476-5440 ELM GROVE UNITED METHODIST CHURCH 1108 Elm Grove Rd. Burlison, TN 38015 901-476-8799 FAITH BAPTIST CHURCH 900 Simmons Rd Drummonds, TN 38023 901-837-2683 FELLOWSHIP BIBLE CHURCH 6920 Highway 59 W Burlison, TN 38015 901-476-1008 FIRST ASSEMBLY OF GOD CHURCH 1422 Old Hwy 51 Brighton, TN 38011 901-837-0950 FIRST BAPTIST CHURCH OF ATOKA 102 Kimbrough Ave Atoka, TN 38004 901-837-0663 FIRST BAPTIST CHURCH OF MUNFORD 521 Giltedge Rd. Munford, TN 38058 901-837-1559 FIRST BAPTIST CHURCH OF COVINGTON 211 S. Main St. Covington, TN 38019 901-476-2489 FIRST BAPTIST CHURCH OF MASON 359 Hwy 70 E Mason, TN 38049 MasonBaptistChurch.com FIRST BRIGHTON BAPTIST CHURCH 132 East Woodlawn Ave. Brighton, TN 38011 476-6180 FIRST PRESBYTERIAN CHURCH OF COVINGTON 403 S. Main St. Covington, TN 38019 901-476-2434 FIRST UNITED METHODIST CHURCH 145 West Church Ave Covington, TN 38019 901-476-9694 GARLAND UNITED METHODIST 1613 Garland Drive Covington, TN 38058 901-476-9334 GATEWAY BAPTIST CHURCH 1915 Rosemark Rd Atoka, TN 38004 901-837-8087 GRACE TEMPLE APOSTOLIC CHURCH 8923 Mt Carmel Rd Covington, TN 38019 901-475-1008 GREAT EXPECTATIONS COGIC 2053 Highway 51 S. Covington, TN 38019 901-476-6666

201 Lanny Bridges • Covington TN.

476-4492

Open 24 hrs.

RIVER OF LIFE 220 Beaver Rd Munford, TN 38058 901-837-8781

JEHOVAH'S WITNESS OF COVINGTON 1150 Old Brighton Rd Covington,TN 38019 901-475-2110

SALEM PRESBYTERIAN CHURCH 3400 Atoka-Idaville Road Atoka, TN 38004 901-837-8210 SHILOH MB CHURCH 584 John Hill Rd Brighton, TN 38011 901-476-0081

LIBERTY BAPTIST 2097 Holly Grove Rd. Covington, TN 38019 901-476-5273 LIGHTHOUSE PRAISE TEMPLE 826B HWY 51 COVINGTON, TN 38019 901-294-3866

SIMONTON ASSEMBLY OF GOD 4100 Munford Gilt Egde Brighton, TN 38011 901-837-2168

MT. LEBANON ASSEMBLY 7560 Hwy 51 North Henning, TN 38041

SMYRNA BAPTIST CHURCH 7512 Hwy 59 W Burlison, TN 38015 901-476-6178

MT. TIPTON CHRISTIAN METHODIST EPISCOPAL CHURCH Brighton Clopton Rd. Brighton, TN 38011 901-476-1165 MUNFORD BAPTIST CHURCH 1253 Munford Ave Munford, TN 38058 901-837-9276 MUNFORD FIRST UNITED METHODIST 57 Tipton Rd Munford, TN 38058 901-837-8881 MUNFORD PRESBYTERIAN 25 Tipton Road Munford, TN 38058 901-837-6721 NEW BEGINNING CHURCH 1460 Atoka Idaville Rd. Atoka, TN 38004 901-412-0241 NEW BEGINNINGS CHURCH 2357 Wilkinsville Rd Drummonds, TN 30823 901-835-5683 NEW HORIZON CHURCH OF GOD 1099 Hwy 51 N Covington, TN 38019 901-489-0447 NEW LIFE COMMUNITY CHURCH 5123 Highway 176 Covington, TN 38019 901-476-0062 NEW LIFE PRESBYTERIAN CHRUCH 133 Munford Ave Munford, TN 38058 901-837-6804

ST. MATTHEW MB CHURCH 296 Mason-Charleston Rd. Stanton, TN 38069 901-476-5935 ST JOHN MISSIONARY CHURCH 2086 Atoka-Idaville Rd Atoka, TN 38004 901-837-2474

OAK GROVE BAPTIST CHURCH 4048 Highway 59 W Covington, TN 38019 901-476-7259

TABERNACLE UNITED METHODIST CHURCH 4258 Highway 179 Covington 901-756-1071

PLEASANT GROVE BAPTIST CHURCH 1602 Highway 59 West Covington, TN 38019 901-476-7645

TEMPLE OF PRAISE 8323 Richardson Landing Drummonds, TN 38023 901-835-3462

PLEASANT GROVE BAPTIST CHURCH 4625 Highway 59 S Covington, TN 38019 901-476-7016

HATCHIE CHURCH OF CHRIST 1372 Highway 51 N Covington,TN 38019 901-476-9709

QUITO UNITED METHODIST 4580 Quito Drummonds Rd. Millington, TN 38053 901-835-2318

HOLLY GROVE CUMBERLAND PRESBYTERIAN 4538 Holly Grove Rd Covington,TN 38019 901-476-8379

RANDOLPH ASSEMBLY OF GOD CHURCH 1135 Randolph Rd. Burlison, TN 476-8244

This Devotional & Directory is made possible by these businesses who encourage all of us to attend worship services

ST. MATTHEWS EPISCOPAL CHURCH 303 S. Munford Street Covington, TN 38019 901-476-6577

ST. STEPHENS M.B. CHURCH 3827 Hwy 51 North Covington, TN 38019 901-476-1559

NEW SALEM UNITED METHODIST 7803 Munford Gilt Edge Burlison, TN 38015 901-476-8536

COLLINS CHAPEL C.M.E. CHURCH 303 W. Ripley Avenue Covington, TN 38019 901-476-3094 -Church House 901-826-5132- Pastor

Tires - Brakes & Towing

ST. MARK AME CHURCH 842 Tipton Road Munford, TN 38058 (901) 837-1456

ST. PAUL EPISCOPAL CHURCH 2406 Hwy 70 East Mason, TN 38049 901-294-2641

POPLAR GROVE U.M.C. 228 Quito Drummonds Rd. Drummonds, TN 38023 901-835-2568

HEBRON COMMUNITY CHURCH Rayburn Rd. Covington, TN 38019

ST. ALPHONSUS CATHOLIC CHURCH 1225 Highway 51 S Covington, TN 38019 901-476-8140

ST. JOHN MISSIONARY BAPTIST CHURCH Highway 59 West 901-476-7009

GRACE OUTREACH WORSHIP CENTER 795 Tennessee Ave Covington,TN 38019

COVINGTON ASSEMBLY OF GOD 1861 Hwy 51 South Covington, TN 38019 901-476-9592

SOUTH TIPTON ASSEMBLY OF GOD 538 Simmons Rd. Drummonds, TN 38023 837-2140

ST. LUKE BAPTIST CHURCH 632 St. Luke Rd. Covington, TN 38019 901-476-9746

CLOPTON U. M. CHURCH 5285 Brighton Clopton Rd Brighton, TN 38011 901-476-5512

Richard Todd- Owner

-Since 1888-

HOSANNA MINISTRIES 13779 Hwy 51 S. Atoka, TN 38004 901-840-4540

GREATER ST. JOHN MBC 411 Shelton Street Covington, TN 38019 901-476-4765

New & Used Tires

Highway 51 South Covington Tn. 476-2240

THE REFUGE 749A N. Main St Covington, TN 38019 901-603-3897

CHURCH OF CHRIST 873 Hwy 51 N. (Quality Inn) Covington, TN 38019 901.475.9443

Custom Wheels

Covington Granite works

HOPE COMMUNITY CHURCH 2086 Atoka-Idaville Rd. Atoka, TN 38004 901-491-8138

PLEASANT GROVE METHODIST 314 Gainesville Rd Covington, TN 38019 901-476-3162

RAVENSCROFT EPISCOPAL CHAPEL 8219 Hollygrove Rd. Brighton, TN 38011 901-837-1312 REDEEMING GRACE LUTHERAN 123 Quinton Drive Munford, TN 38058 901-840-2086

TIPTON CHURCH OF GOD IN CHRIST 470 Watson Rd Munford, TN 38058 901-837-8356 TRINITY BAPTIST CHURCH 5954 Brighton Clopton Rd. Brighton, TN 38011 901-476-8889 TRINITY EPISCOPAL CHURCH 11886 Main St. Mason, TN 38049 VICTORY BAPTIST CHURCH 5422 Drummonds Rd Drummonds, TN 38023 901-835-2280 WESTERN VALLEY BAPTIST 836 Church Rd. Covington, TN 38019 901-475-1255 WESTSIDE ASSEMBLY NON-DENOMINATIONAL 33 Paulette Circle Covington, TN 38019 WILLOW GROVE MISSIONARY BAPTIST CHURCH 618 Willow Grove Rd. Covington, TN 38019 901-476-7337

Bull Insurance Corporation Life • Health • Home • Car 216 W. Pleasant Ave • 901-476-4601 www.bullinsurance.com

Covington Funeral Home Magnolia Gardens Cemetery

3499 Highway 51 South 476-3757 (Phone) 476-5373 (Fax) “Caring for the Community with Compassion”


www.covingtonleader.com

Thursday, August 5, 2010

A7

West Tennessee Home Improvements Home Maintenance, Decks, Fences, Patios, Painting, Tile

25 Years Experience

901-485-7666

If you have a problem, we have a solution.

"Affordable & Accommodating"

476-4000 Scrapyard & Recycling Center 170 Hodge Lane • Stanton, TN 38069

901-476-8415

McBride Stitt & Williams Insurance and Wealth Management

BUSINESS • HOME • AUTO • FARM • LIFE • HEALTH Tel: 901-476-7137 • Fax 901-476-3560 Cornerstone Assembly of God is located at 5041 Mt. Carmel Road, Brighton. Services are held each Sunday morning at 10 a.m.; Worship at 11 a.m. ; Sun evening at 6 p.m. and Wednesday evening at 7:30p.m. The pastor is Robert Gross.

Securities offered through LPL FINANCIAL, member FINRA/SIPC

Saddle Up Guns & Ammo ww.saddleupguns.com 1015 B Hwy 51 North • Covington, TN

(901)476-0607

Church of the week form

Jay Ridings Cell: 619-5991 John Evans Cell: 201-9426

Rightway Christian Bookstore

Name: _____________________________________________________________________________________ Address: ___________________________________________________________________________________

Pre Spring Choral Attire Sale

741 B Hwy 51 North Covington, TN 38019

Jan. 1, 2010 - March 31, 2010

VBS Material & Sunday School Curriculum

Pastor(s): __________________________________________________________________________________

(901) 476-8003

Steven Newman - Manager 2054 Highway 54 South • P.O. box 189 Covington, TN 38019-0189 Office: 901-476-4936

Service times: ______________________________________________________________________________

Wooten Tractor Co.

2031 Highway 51 South • Covington , TN 38019

What's Wrong? Recently a Bible class teacher asked his class, “What’s wrong with America?” One student gave what he thought was a smart aleck answer and responded, “I don’t know and I don’t care.” The student was surprised by the next words of his teacher. Instead of being reprimanded for his response, the teacher said, “That’s right!” Ignorance (not knowing) and apathy (not caring) are the two greatest problems that face our country and the church. The following statements have often been made and applauded as true. “What you don’t know won’t hurt you.” “Ignorance is bliss!” Several years ago, the Hatchie River bridge on US Hwy. 51 collapsed. Several died on that bridge because they were not aware of the problems concerning the bridge. Did what they not know not hurt them? On the contrary, what they did not know caused them to lose their lives that night and wake up in eternity. A bank customer went to the doctor for a routine check up. By chance, the doctor ran a particular test that showed he had an aneurysm in a major artery. The artery could have ruptured at any time and he would have bled to death before the problem could have been detected. Did he wish he had not found out about his problem? Had he rather have been ignorant about his condition? Of course not, he was thankful to the doctor for his diligence and regards him as having saved his life. The above underscore the fact that ignorance is not a good thing. In fact, it may be harmful or even fatal in a physical sense. Some family members who have a loved one with a terminal illness will not tell them the truth about their condition judging that it is better that they do not know. Does not that loved one deserve to know? There may be business he wants to finish. His life may not be right with the Lord. How can we withhold information that might

affect one’s eternal destiny? The majority in this world and even in our country and community do not want to know about God. They are content to live as they please without God. They seldom attend any church or pray or even think of God unless there is a crisis in their lives. They reason that things are going pretty well for them, therefore God must be happy with them. They think if something were wrong, God would let them know. They mistake God’s “blessing” with God’s approval. Jesus makes it clear that the unjust enjoy the same blessings as the just. Mt 5:45 That ye may be the children of your Father which is in heaven: for he maketh his sun to rise on the evil and on the good, and sendeth rain on the just and on the unjust. The majority of us are like the proverbial ostrich with its head buried in the sand and exposed everywhere else thinking it is safe and protected and not understanding it is vulnerable. God will allow us to believe a lie, to ignorantly believe we are all right and the way we are going is all right. 2Th 2:11 And for this cause God shall send them strong delusion, that they should believe a lie: 12 That they all might be damned who believed not the truth, but had pleasure in unrighteousness. Yes, God does tell us when we are wrong and when we are right. It is not by direct revelation or some windfall that blesses us or calamity that befalls us. (Remember Job.) He tells us by His Word but most of us do not know the Word. Joh 6:63 It is the spirit that quickeneth; the flesh profiteth nothing: the words that I speak unto you, they are spirit, and they are life. Joh 12:48 He that rejecteth me, and receiveth not my words, hath one that judgeth him: the word that I have spoken, the same shall judge him in the last day. We know about politics, the weather, science, mathematics and business but we do

This Devotional & Directory is made possible by these businesses who encourage all of us to attend worship services

Phone : 476-2631

not know the answer to the greatest questions of eternal consequence, “ What must I do to be saved?” and “What must I do to keep saved?” James gives us the answer to our lack of knowledge. Jas 1:25 But whoso looketh into the perfect law of liberty, and continueth therein, he being not a forgetful hearer, but a doer of the work, this man shall be blessed in his deed. Only looking into the book (the Bible) and being obedient to it will save us. Man’s lack of knowledge is not something new. Hosea lamented for his people concerning the same problem. Ho 4:6 ¶ My people are destroyed for lack of knowledge: because thou hast rejected knowledge, I will also reject thee, that thou shalt be no priest to me: seeing thou hast forgotten the law of thy God, I will also forget thy children. We tend to think that God will overlook our ignorance of His will and His way but He will not. Ac 17:30 And the times of this ignorance God winked at; but now commandeth all men every where to repent. You can be going down the highway and the speed limit change from 55 to 45. You may miss the sign. If the trooper pulls you over, we will not excuse you for not knowing the speed limit was lower. Ignorance of the law of the land is no excuse. Ignorance of God’s law is no excuse either. The Bible is crystal clear about who will be punished when Jesus comes again. Listen to Paul’s words. 2Th 1: 7 And to you who are troubled rest with us, when the Lord Jesus shall be revealed from heaven with his mighty angels, 8 In flaming fire taking vengeance on them that know not God, and that obey not the gospel of our Lord Jesus Christ. Those who do not know and those who do not obey will be lost. With all God has done for us He expects (and has the right so to do) us to know Him and His Word. Anything less is unacceptable!

RL COULSTON & SONS Building Supplies / Contractor Covington, TN

476-9718

0 89 1 ce Maley - Yarbrough Funeral Home Inc. Sin

Covington Memorial Gardens, Inc. "To Better serve Humanity"

Landon B. Yarbrough - President 1701 Hwy. S. Covington Obituary Line: 476-9753 • Fax line: 476-1349 476-9778

Sunday School 9:00 am & 10:30 am Sunday Worship 9:00am,10:30am,6:00 pm Wed. Services - 6:30 pm

TV Broadcast on Millington Cable Sunday's 10 a.m. & 9 p.m.

First Utility District Tipton County “Natural Gas is Best” Phone 901-476-9525 901-476-0714

Hwy. 59W. and Bringle Road

Whitley & Hughes Family Eye Care Modern eye care with a hometown commitment!

68 Doctors Drive Munford 837-0188

312 South Main St. Covington 476-8614

3080 Hwy. 51 S. Covington TN 38019

476-8500

This Devotional & Directory is made possible by these businesses who encourage all of us to attend worship services TUESDAY NIGHT SPECIAL Reg. Hamburger 1 & 2 1/2 price 5p.m. - 11 p.m. #

#

Open Sun - Thurs. 9 a.m. - 11 p.m. Fri - Sat. 9 a.m. midnight 710 Hwy.51 N. Covington 476-1307

FRED'S

Covington SUPER DOLLAR STORE Munford 476-3364 837-2000 Deborah Vanbeukering D.O.

Covington Pediatrics

Certified Prosthetist & Orthotist

Artificial Limb & Brace Care For All Your Needs

FIRST BAPTIST CHURCH 5010 West Union, Millington, TN 38053 901-872-2264

Jimmie L. Beasley, M.D.

Jon Knickerbocker, CPO, FAAOP Call for Appointment Ph: 901-388-1388 • Fax: 901-388-1771 1400 B. Hwy 51 N. • Covington, Tn 38019 Toll Free: 1-877-389-1388 innovativeoandp@earthlink.net

WOODS

SALES & SERVICE

Member

901-476-2686 Check Advance • Jewelry • Title Loans

Pawn Shop 14382 Hwy. 51 S.

Atoka, TN 38004 (901)837- Cash (2274) • (Across from 51 furn)

DAN PICKARD OWNER MICAH FULCHER MANAGER

1998 Hwy. 51 S. P.O. Box 911 Covington, TN 38019

COVINGTON SELF STORAGE 91B Peeler Street • (901) 476-5760

$27 Move-In Special New On-Site Management • Code Access Entry Gates

Hometown Medical Services, LLC

Make Your Pet’s Grooming Experience a Pleasant One

111 Munford St. South • Covington, TN 38019 901-476-9996 • 901-476-9986 Fax Alan Hopkins, Msn, Rn, Cs, Acnp

Telephone 901-476-1155

PET SALON (901) 476-2196

Linda B. Mills Cell (901) 489-5559


A8 â&#x20AC;˘ Thursday, August 5, 2010 â&#x20AC;˘ THE LEADER

www.covingtonleader.com

Obituaries Ada Price

Date of Death â&#x20AC;&#x201C; July 20, 2010 Mrs. Ada Price of Covington expired on Tuesday, July 20, 2010 at Baptist Hospital in Covington. Services were held on Friday, July 30 at Emmanuel Temple with burial in Townsend Cemetery, both in Covington. She leaves to celebrate her life seven children: Shirley (Leslie) Nathaniel of Rochester Hills, Mich., Marjorie (Fletcher) Holland and Joeretha (Thomas) Nelson both of Southfield, Mich., Vernell (John) MaGee of Royal Oak, Mich., Estella (Authur) Brown of West Bloomfield, Mich., Ronnie (Earlene) Price and Wardell Price, both of Covington; sister Christine Gilliam of Chicago, Ill.; 14 grandchildren and 17 great grandchildren. Preceding her in transition were her parents Peter and Willie Johnson Gilliam, children Mary Benson and Keary Alexander Price Jr., six siblings and two grandchildren. The Leader (Covington, Tenn.) August 5, 2010

Mary Annie Harwell Douglas Date of Death â&#x20AC;&#x201C; July 22, 2010

Suddenly, without a final farewell, God called home yet another servant, Mary Annie Harwell Douglas of Somerville, on July 22, 2010. She passed away at Methodist North Hospital in Memphis. She was a member of Williamson Chapel M.B. Church in Mason, where she was funeralized on Saturday, July 31, 2010 with Pastor Michael Bonner officiating. Burial took place in the church cemetery. Her legacy of love will remain in the hearts of her children Etta Nash, Carolyn Douglas, Regina Morton, and Herman (Brenda) Douglas, all of Memphis, Dallis (Cynthia) Douglas, Randy Douglas, Rochester and Patrick Douglas all of Somerville; siblings Evangelist Frances Stanback and Charlene Wilkerson, both of Mason, Alberta Williams and Charlie Harwell, both of Somerville, and Jeanette Long of Cleveland, Ohio; one sister-n-law, Dorothy Jean Harwell ,of Memphis; 12 grandchildren, 4 great grandchildren, a host of relatives and friends. Mother Douglas was preceded in transition by her parents Arthur and Amy Lue Harwell, daughter Lander Jean Douglas and siblings Willie and Arthur L. Harwell, Jr. The Leader (Covington, Tenn.) August 5, 2010

Mary Ruth Taylor

Date of death â&#x20AC;&#x201C; July 22, 2010 Mary Ruth Taylor, 71, of Brighton, passed away on Thursday, July 22 at Dyersburg Regional Medical Center. She was a retired caterer for Cotton Boll Catering and a licensed beautician as well as a member of Trinity Full Gospel Church. She loved her computer games, crocheting and reading her Bible. Services were held on Sunday, July 25 at the Munford Chapel. She was buried in Helen Crigger Cemetery. She was preceded in death by her husband, John Albert Taylor; son Ronald Niles Hamer; sister Ann Compton; grandson Ronald McKenzie; brothers Jimmy Carlton, Tommy Carlton, Wayne Carlton and J.R. Carlton; and parents Bennie Odell and Pearline Mitchell Carlton. Mrs. Taylor is survived by daughters Kim (Dale) McKenzie of Brighton, Pearl (Thurston) Walker of Henning, Carol Taylor of Covington and Barbara (Frank) Migliaccio of Covington; sons Donald (Kathy) Hamer of Covington, Kenneth (Teresa) Hamer of Covington and Robert (Tracy) Taylor of Brighton; sisters Carolyn White of Covington, Nadine Stewart of Burlison, Sue Carlton of Byhalia, Miss. and Debra Woods of Gates; brother Ronnie Carlton of Covington; 15 grandchildren and six great-grandchildren. Memorials may be made to the Multiple Sclerosis Association. The Leader (Covington, Tenn.) August 5, 2010

Robert Boyd Martin

May 27, 1957- July 27, 2010 Robert Boyd Martin was born on May 27, 1957 and departed this life on Tuesday, July 27, 2010. Services were held at Faith United Baptist Church in Nashville on Monday, August 2 with the Rev. Roosevelt Walker Sr. officiating. He was preceded in death by his father, Herschel Martin, and a brother, Stevie Martin. His memory will be cherished by his devoted wife, Debra Martin; son David Robinson of Germany; stepsons Ryan and Brandon Campbell; mother Mary Sue Martin and grandmother Willie Holland, both of Covington; in-laws Isaiah and Willie Mae Burton of Burlison; brothers Herbert (Patricia) Brown of San Bernadino, Calif., Melvin Brown Sr. of North Chicago, Ill., John Martin of Covington and Kenneth Martin of Dyersburg; sister Barbara Mosley of Batavia, Ill.; a host of aunts, uncles, nephews, nieces, cousins and other relatives and friends. The Leader (Covington, Tenn.) August 5, 2010

Bill Murphy

March 29, 1930 - July 27, 2010 Bill Murphy, 80, of Morris, Ill., was born on March 29, 1930, and died on Tuesday, July 27, 2010, in Effingham, Ill. on his way to Tennessee to visit family. He is the son of Dutes and Agnes Murphy and joined the U.S. Army where he served in the Korean Conflict. Mr. Murphy was honorably discharged in 1952. He married the former Bonnie Gilliant on July 16,

Community Events

1953 in Hernando, Miss. The couple made their home in Morris, Ill. Mr. Murphy was employed with Diamond International until 1972, then joined the Local 75 in Joliet where he worked in construction until his retirement in 1992. Survivors include his wife Bonnie; daughter Aaronda (Steve) Neuwirth of Morris, Ill.; son Randy S. Murphy of Morris; grandchildren Michelle Murphy of Eureka, Calif., United States Marine Corps PFC Jessica Murphy of North Carolina and Randee of Morris; great-grandchild Cosco Stone of Eureka, Calif.; sisters Mildred (James) Coats of Burlison and Junalle Cromwell of Covington; numerous nieces and nephews. He was preceded in death by his parents, brothers Gene Murphy and Richard (Busty) Murphy and sisters Betty Griffen and Grace Billings. Services were held in Morris, Ill, on Saturday, July 31 at First United Methodist Church where he was a member. Burial took place at Evergreen Cemetery with full military honors conducted by the Morris Color Guard. The Leader (Covington, Tenn.) August 5, 2010

Elton â&#x20AC;&#x153;Little Eâ&#x20AC;? Parker Jr. Date of death â&#x20AC;&#x201C; July 27, 2010

Elton â&#x20AC;&#x153;Little Eâ&#x20AC;? Parker Jr., 20, of Covington, passed away on Tuesday, July 27, 2010 at Aurora St. Lukeâ&#x20AC;&#x2122;s Medical Center. He was a student at Anthem College. Visitation will be held on Friday, Aug. 6 from 2-7 p.m. at Barlow Funeral Home, with family hours from 5-7 p.m. Saturday visitation will begin at 1 p.m. and last until the service begins at 2 p.m. Funeral services will be conducted at Canaan Grove Missionary Baptist Church on Saturday, Aug. 7 with burial following in Malone Cemetery. Mr. Elton Parker Jr. is survived by his mother, Verletta Harper Parker; brothers Shannon Harper and Martin C. Catron Jr.; maternal grandmother Freddie Gibson and paternal grandmother Esly Mae Parker. The Leader (Covington, Tenn.) August 5, 2010

Gearlean Holland

October 11, 1937 â&#x20AC;&#x201C; July 30, 2010

The Community Calendar is a free service offered by The Leader. We make every effort to include all submissions for this section, however these items are printed as space becomes available. To guarantee your event to be in the paper would require paid advertising. A complete list appears in the Community Events section on our web site, www.covingtonleader. com. August 5 There will be a Joint Economic & Community Development Board meeting at 9a.m. Thursday, August 5 at the Covington City Hall. August 6 There will be a benefit singing for Dessie Fike at 7p.m. August 6th at Westside Church located at 33 Paulette Circle, Covington 3 miles west on Hwy 59. Westside local singers will be featured. For more information contact Bro. J. N. Austill 476-0851.

Canaan Grove Baptist Church will be having a Christian Education retreat from 9a.m. â&#x20AC;&#x201C; 12p.m. August 7th. The theme is â&#x20AC;&#x153;A Call to Commitment in the Body of Christâ&#x20AC;?. For more information, contact, Irene J. Williamson 901476-3608 or 901-626-1751. The email address is IreneIJW3608@aol.com. The Church is located at 1715 Mason- Malone Rd. Mason. Bro. James R. Simmons, 294-2990. Prom Dress Ministries will host their 3rd annual Back 2 School Drive at 1:30p.m. Sat., August 7 at First United Methodist Church. Eligibility forms are distributed SEE EVENTS, PAGE A9

August 7 The men of Clopton United Methodist Church will have their monthly

Mhealth ILLINGTON care center â&#x20AC;&#x153;There is no reason to live alone.â&#x20AC;? Come Join Our Family t#FE/VSTJOH'BDJMJUZ XIJDIJODMVEFTBTLJMMVOJU

901-873-3290

Gearlean Holland, 72, of Munford, passed away on Friday, July 30, 2010. She was a former cook at Penny Pantry. Visitation will be held on Friday, Aug. 6 from 4-7 p.m. at Jefferson Mortuary, 7788 Church Street in Millington. Services will be held at noon on Saturday, August 7 at St. John M.B. Church, 1998 Atoka-Idaville Road, Atoka. Interment will follow at St. John Community Cemetery in Atoka. The Leader (Covington, Tenn.) August 5, 2010

community breakfast from 7-9:30a.m. Saturday, Aug. 7. All proceeds will go to the churchâ&#x20AC;&#x2122;s building fund. CUMC is located at 5285 BrightonClopton Road.

TERMITES

CHRIS Oâ&#x20AC;&#x2122;BRIEN Manager

TN CHARTER 640

476-9070

Milton H. Ferrell

Date of death - July 31, 2010 Milton H. Ferrell, 79, of Drummonds, died on Saturday, July 31, 2010 at Methodist North Hospital. He was a retired farmer. Services were conducted on Tuesday, Aug. 3 at the Munford Funeral Chapel. He leaves his son, Richard Push; sister Sharon Haywood; brother H.T. Ferrell Jr.; and four grandchildren. The Leader (Covington, Tenn.) August 5, 2010

Annie Marjorie Johnson Date of death - July 31, 2010

Annie Marjorie Johnson, 80, of Atoka, who never met a stranger, was called to her eternal home on Saturday, July 31, 2010. She was a loving wife, mother, grandmother and great-grandmother. Funeral services were held on Wednesday, Aug. 4 at High Point Funeral Chapel, 3788 Summer Avenue, Memphis. Burial will be private. She will be greatly missed by her husband of 60 years, Ernie; children Barbara Moore, Debra Cody and John Johnson; nine grandchildren; six great-grandchildren; and a host of other loving family members and friends. She was preceded in death by her daughter, Linda Hensley. She will be remembered for her clever sense of humor and honest approach to life. Her passion for sewing, arts and crafts has been passed on throughout several generations of family and friends, bringing joy to each and every one they touched. Marjorie was an amazing woman whose strength and kindness clearly touched everyone she met.

Words cannot express our sincere thanks to you for your many acts of kindness shown to us during Wayneâ&#x20AC;&#x2122;s sickness and death. Your support to us at this difficult time was greatly appreciated. We thank you for your prayer, cards, food, visits at the funeral home, flowers and memorials. Wayne would have been so touched by the love and support that was shown to him. We extend a very special thanks to Bro. Norman Crittenden, Methodist Hospice Team, Hometown Florist and Munford Funeral Home. God Bless you and Thank you again for everything. The Wayne Sloan Family

Dr. Zaidi & Associates

Specializing in Internal Medicine, Sleep Disorders, and Pulmonary Medicine

Syed A. A. Zaidi, MD

The Leader (Covington, Tenn.) August 5, 2010

Board Certified Internal Medicine & Pulmonary Medicine

Justin Travelle Stone

326 Asbury Avenue, Ste 101 Ripley, TN 38063

December 1, 1987 â&#x20AC;&#x201C; July 31, 2010 Justin Travelle Stone, 22, of Munford, died on Saturday, July 31, 2010, at Baptist Memorial HospitalTipton. He was a 2006 graduate of Munford High School. A candlelight vigil was held on Wednesday, Aug. 4 at Mt. Herman A.M.E. Church, 3748 Quito-Drummonds Road, Dixonville. Visitation will be held from 4-7 p.m. on Friday, Aug. 6 at Jefferson Mortuary, 7788 Church Street, Millington. Funeral services will be held at 11 a.m. on Saturday, Aug. 7 at Munford High School, 1080 McLaughlin Drive, Munford. Interment will follow at Mt. Herman Cemetery, 3492 Quito-Drummonds Road, Drummonds. Repass will be held at Munford High School after interment. He is survived by a daughter, Mykyla Miller; mother Brenda Finnie (Douglas) Hudgins of Munford; father Michael Stone Sr.; sisters Stephanie Finnie and Myisha Stone; and brother Michael Stone Jr.

731-221-1637 Specializing in: Cholesterol Management Diabetes Management Cancer Screenings Smoking Cessation Heart Disease Blood Pressure Management Sports Physicals Shingles Vaccines Offered

DOT Physicals Weight Loss Clinic Pulmonary Function Testing Ultrasound Services/Arterial Disease Screening Allergy Testing Preventative Management (Womenâ&#x20AC;&#x2122;s Health) Osteoporosis Testing and Treatment

Lipotropic injections offered for weight loss. Call for details. â&#x20AC;˘ 24 Hour answering service â&#x20AC;˘ Convenient appointment times â&#x20AC;˘ Most insurances accepted and filed for your convenience â&#x20AC;˘ Visa/Mastercard accepted â&#x20AC;˘ Accepting new patients â&#x20AC;˘ Friendly staff


Thursday, August 5, 2010 • THE LEADER • A9

www.covingtonleader.com

EVENTS

Continued from A8 by DHS. Must present form to receive supplies. Supplies are very limited. No early birds please. Services while supplies last. For more information, contact CasSandra at (901) 4765994. August 8 Macedonia United Methodist Church will be having Revival on August 8-10. At 5p.m. on the 8th there will be a potluck supper and at 6p.m. the Service will start. Revival services will begin at 7p.m. August 9&10 with snacks following each night. The church is located at 11508 Macedonia Rd. Central Christian Church Youth will be serving a spaghetti luncheon after the August 8th morning service, plates are $5, eat in or carry out and will help fund a special project for one of the missionaries they support. The Church is located at 400 S. Maple Street in Covington. Poplar Grove Assembly of God will be having their Homecoming August 8th. Service starts at 9:45 am. with Bro. Rufus Roberts preaching at 11 a.m. and local singers will be performing. The Church is located in Drummonds. August 9 The Covington High School/Crestview Middle School Band Booster Club will meet at 7p.m. August 9 in the CHS Band room. All parents/Guardians of band students at either school are encouraged to attend. August 13 Trust Company Bank “A branch of the Bank of Mason” will be hosting an American Cancer Society BBQ Pork Butt fundraiser.

Pre orders will be taken now through August 13. Pick up date will be from 3-4:30p.m. August 28 at Trust Company Bank 1270 Old Hwy 51 S. Brighton. The Butts are 8-10 lbs. and cost $25. Purchases can be made at the following locations. Trust Company BankKathleen Glass, 901475-0003, First Citizens National Bank-Wanda Bomar, 901-837-0117 ext.128, Baptist-TiptonCynthia Roberts, 901475-5505 or Baptist Home Medical EquipmentPhyllis Hicks, 901-5810144. All proceeds benefit the American Cancer Society. August 21 There will be a Community Crime Awareness meeting at 2 p.m. August 21 at Popular Grove United Methodist Church family life center 228 Quito Drummonds Rd., Drummonds. Guest speakers will be Poncho Chumley and Lieutenant Shannon Beasley. August 28 Trust Company Bank will be hosting the 1st Annual American Cancer Society Celebrity Dinner/ Silent Auction from 5-7p.m. Saturday, August 28. Tickets $10 per adult and $5 for children (11 year old and under). The event will be held at the banquet hall at Trust Company bank 1270 Old Hwy 51 S., Brighton. The menu will be BBQ sandwich, Backed Beans, Cole Slaw, Dessert, Ice Tea or Water. Entertainment will be Ryan Hamner Four Time Survivor from Georgia. For reservations call Kathleen Glass 476-0003, Wanda Bomar 837-0117 ext.128, Cynthia Roberts, 475-5505 or Phyllis Hicks, 581-0144. October 9 The CHS Class of 1980 will be having its 30th

year class reunion Oct. 8 and 9. For more information, contact Leigh Bradshaw Buie at (731) 343-4250 or by email at leighbuie@aol.com or Jacqueline HeastonOwens, joenayowens@ aol.com.

Contact Shirley Ward at 837-9355 or 412-4869 for more information The Tipton Amateur Radio Society meets the third Monday of every month at 7 p.m. in Atoka City Hall, Atoka.

The Covington Sportsplex is now accepting registration for the Fall youth soccer league. The league is open to ages 4-15. The fee is $40 per child. For more information, please contact the Sportsplex at 476-3734. Play will begin

On-going events Dunham Lodge #150 F&AM, 113 East Washington in Covington holds its monthly stated meeting on the third Thursday of every month.

in late August. The deadline to register will be August 16.

saddleupguns.com 476-0607

Helping Hands meets the first Thursday of each month at the home of Christine and Larry Knight, 253 Elm Grove Road in Burlison. Ransomed Riders Chapter of CMA meets the fourth Monday of each month at Heritage Cafe in Munford. Meal at 6 p.m., meeting at 7 p.m. For more information call Phil Cathey at 388-8145. The seekers Class of Fellowship Bible Church, 6920 Highway 59 West, in Burlison, invite everyone to join them for aerobic fitness every Tuesday night at 7 p.m. Two hundred cookbooks of “Sharing Our Wealth: 175 Years and Still Cooking!” written by members of Clopton United Methodist Church have been reordered. Books are $15 each. Call Marion Davis, 476-7576, to order. The MOMS Club of Munford Area meets several times a month for play dates and other events. Email momsclubofmunfordtn@ yahoo.com or Contact Kristen at 413- 6822. Tipton County Republican Women meet monthly on the second Saturday of each month at the Heritage Café. 9 Bass Ave. Munford.

Baskin Truck Parts, LLC 1844 Hwy 51 S. • Covington, Tn 38019 • (901) 476-2626 Hours: Mon. - Fri. 7 a.m. - 5 p.m. • Sat. 7 a.m. - Noon

WE BUY SCRAP If you can’t bring it to us, we will pick it up Competitive Prices • Conveniently Located No Gimmicks - Just Fair Prices Turn you scrap into Cash at Baskin Truck Parts, LLC We have been in business for over 50 years. We sell parts for 18 wheeler trucks. We sell late model 18 wheeler trucks, trailers & equipment

“We want your business”


A10 • Thursday, August 5, 2010 • THE LEADER

www.covingtonleader.com

Patriot Bank names employees of the quarter (Covington, TN) - Patriot Bank has announced that Tonya Jones and Rita Turner have been named Employees of the Quarter for the Second Quarter of 2010. Tonya Jones was nominated for Employee of the Quarter by Denna Krosp, Vice President and branch manager at Patriot Bank Barretville, where Tonya is Head Teller. According to Denna Krosp, Tonya was selected as Employee of the Quarter (Customer Service) because she has all the attributes of the P.A.T.R.I.O.T acronym. “Tonya is a very good teller and knowledgeable about job but she still is interested in learning new procedures,” said Krosp. “She has a professional work ethic and while she handles over half of the transactions at our branch, she is always taking on extra tasks. She is willing to do any

Rita Turner with Keith Barger

job that needs to be done,” Krosp said. As an example, Krosp noted that Tonya reworked all the teller reports on her own in order to make them look better and easier to read. She also took over the job of laminating newspaper articles and photos for the Barretville location and other Patriot locations. “I really appreciate the ‘goextra-mile’ attitude Tonya brings to work every day,” added Krosp. Tonya joined Patriot Bank in 2008 with 11 years experience in the local banking community. She is a graduate of Munford High and a lifelong resident of Tipton County. She is married to Shawn Jones and they have one son, Spencer. In her free time, Tonya enjoys scrapbooking, baking and watching Spencer play basketball and baseball. Rita Turner was nominated

Tonya Jones with Deanna Krosp

TWRA duck blind drawings The date and locations have been set for duck blind drawings in West Tennessee on TWRA’s Wildlife Management Areas. Drawings on all of the areas will be Saturday August 7, 2010. Registration will be 7:00 a.m. - 10:00 a.m. with the drawings to begin at 10:00 a.m.To participate in the annual blind drawing, individuals must: Be at least 16 years of age Appear in person. Not have applied for more than one area. Possess one of the following licenses and permits (except at Reelfoot where only an annual Reelfoot Preservation Permit is required). No licenses or permits will be available at blind drawing locations. Residents: Lifetime Sportsman License. Sportsman License (Type 04). Type 01 License and Type 91 Permit. Type 166 License and Type 91 Permit or Type 167 Permit. Proof of age (residents born before March 1, 1926) and Type 91 Permit

Nonresidents: Type 71 License and Type 91 Permit. Type 73 License and Type 91 Permit Drawings will be held at the following locations: Gooch Unit A (35 blinds). Town of Obion - City Park. Reelfoot (53 blinds) Ellington Hall at Reelfoot State Park Visitors Center, Kentucky Lake (Camden Units I&II, Harmon’s Creek, Big Sandy, and Gin Creek) (75 blinds) Little League Ballfield in Big Sandy. Barkley Unit I (25 blinds) Stewart County High School. Tigrett (17 blind sites) Dyersburg Fairgrounds (First Citizens Pavillion). West Sandy (42 blinds) Location will be the Livestock Barn at the Henry Co. Fairgrounds in Paris, TN. TWRA would like to remind people attending the blind drawings that rules and regulations state - No person shall buy, sell, or barter, or offer to buy, sell or barter the privilege of signing on a draw blind. Violation of this is a Class B misdemeanor.

for Employee of the Quarter (Administrative or Operations) by Keith Barger, Executive Vice President of Patriot Bank and Patriot Bank Mortgage. Rita currently serves as the Post Closing Specialist for Patriot Bank Mortgage but according the Barger, Rita wears many hats in the mortgage division. “Rita keeps the work flow running smoothly and performs many duties in addition to her post closing work. She is right in there helping us with everything from managing construction loans to working on final loan documents to preparing our quality control audits. Rita is a valuable member of our team who always has a willing attitude to help others and seeks out opportunities daily to assist our customers. The Mortgage department is often very

hectic and we are always fighting deadlines but Rita always remains calm and professional. She is a blessing to work with and a true asset to Patriot Bank.” Rita has been in banking since 1980 and joined Patriot Bank in 2006 as a mortgage closer. A Memphis native, Rita and her husband of 29 years, Jeff Turner, live in Bartlett. Rita and Jeff have two children, Amber, a junior at Freed Hardeman and Chad, a local musician. In her free time Rita enjoys reading but more importantly, watching Amber play volleyball at Freed-Hardeman or watching Chad play in his band. Congratulations to Tonya and Rita for being named Patriot Bank Employees of the Second Quarter for 2010.


www.covingtonleader.com

Thursday, August 5, 2010 • THE LEADER • A11

Leader Crossword Thursday, August 5th Edition. The Hole Truth ACROSS

2

1

1. "Barbarella" director Roger 6. Jazz style for Charlie Parker 9. Like a beaver, perhaps 14. "Maria __" ('40s hit) 15. AP rival 16. Single-handedly 17. Certain circus star 18. Sample the sherry 19. Permanent location? 20. It has holes 23. The Marlins' home: Abbr. 24. "Pygmalion" author 25. Any of the Chicago 7, e.g. 27. Cartoon skunk Le Pew 30. HBO competitor 32. Car bomb? 33. Prefix with glottis or dermis 34. Shoe attachments 36. Comes down in buckets 39. Mudville complement 41. Deep-six 43. In perfect alignment 44. 1983 movie with Mr. T 46. Welles character 47. Entrepreneuraiding org. 48. Surfer, these days 50. Common surgical replacement 51. 180-degree turns, slangily 52. Waldheim was its president 55. Management level

3

5

4

6

7

8

9

14

15

16

17

18

19

20

21

28

30

39 44

53

63

55

56

59

60

65

66

67

68

69

70

71

72

64

62

51

50

58

61

47

54

57

38

43

42

49

48 52

36

46

45

37

26

35

41

40

13

32

31

34

33

12

23

25

29

11

22

24 27

10

8/1/2010

American Profile Hometown Content

57. Librarian's admonition, maybe 58. It has holes 63. Grofé's "Grand Canyon __" 65. Conventioneer's topper 66. Sine or tangent 67. Loud, as the surf 68. Multipurpose truck 69. Large computer key 70. Lionesses lack them 71. Letters for Leary 72. Taunt

DOWN 1. November paraders 2. What "there oughta be" 3. Moore of "G.I. Jane" 4. Actually existing

40. Vane direction 42. Charlemagne's father 45. North African tribesmen 49. Cruise port, briefly 51. Suave 52. State of India 53. "Star Trek" lieutenant 54. Worth two thumbs down 56. White-plumed bird 59. "__ Make a Deal" 60. "__ boy!" 61. Baloney 62. Folk wisdom 64. Menlo Park monogram

5. Everglade 6. Attack by surprise 7. Aunt Bee's charge 8. Kilted musician 9. Lessened the pressure 10. Taking after 11. It has holes 12. __ Gay (Hiroshima bomber) 13. Kidney-related 21. Playbill listings 22. Two cents' worth 26. "__ You Babe" 27. Hang in the balance 28. Monumental 29. It has holes 31. First name in afternoon TV 35. Disinfected 37. Keeler of "42nd Street" 38. Salty septet

Sudoku Puzzle #1890-D

2 3 4 1 5 6 3 7 8 9 5 2 4 6 3 5 1 7 9 8 4 8 2 6 3 9 5 1

© 2009 Hometown Content

5 7 2 1 9 3

1 4 3 8 7 6

3 1 7

8 4 6

5 9 2

6 1 9 2 4 5 7 8 3

© 2009 Hometown Content

2 8 4 3 1 7 6 5 9

3 5 7 9 6 8 1 2 4

7 3 1 4 8 2 9 6 5

4 6 8 7 5 9 2 3 1

9 2 5 6 3 1 4 7 8

CROSSWORD

The Hole Truth

Sudoku Solution #1890-D

8 9 6 5 2 4

Difficult

V

A D

E

L

T

A M

S W P

I

E P

E P

I

N

N

I

I

I

A

L

O N

S

I

P

S

A

L

O N

C H

E

E S

E

F

L

A

C A

L

E R S

S

S

H A W

E

S

H O

T

A P

E

S

C R A P

U S

E R

U P

D C C A B A U S

E A G

B O P

M

E N A

R A D

I

Y U G O P

S

O U R S T

K A N

E

H

P

U E R

E R

E

I

R U

E

S

B A

E

Y S

T

I

B O W L

I

N G B A

L

L

E

F

Z

R A

T

I

O

A R O A R

U

T

E

E N

T

E R

M A N

L

S

D

T

S

H H

S

U

I

T T

R

E S

I

A E

E A S

E

8/1/2010

TO ADVERTISE HERE CALL 476-7116 This space is available call 476-7116

This space is available call 476-7116


A12 â&#x20AC;˘ Thursday, August 5, 2010 â&#x20AC;˘ THE LEADER

www.covingtonleader.com

AARP Driver Safety Program The next AARP Driver Safety Course of the year will be offered August 24th and 25th (Tuesday and Wednesday) at the Covington Senior Center, 401 So. College St., Covington. It will be sponsored by Brighton Bank. The Course is geared to Seniors 50 years old and above. It covers defensive driving, rules of the road, Tennessee laws, automobile safety and physical changes that Seniors experience.

Those who have had a good driving record for the past three years will receive a discount on their auto insurance for the following three years. The cost is $12 for AARP Members and $14 for non-members. Class hours are 8:30 a.m. to 12:30 p.m. A free breakfast will be served from 8 a.m. to 8:30 a.m., and a free lunch will be served at 12:30 p.m., both days. To register, call Vicki

Smith, at 476-5353 or Jim Novotny, at 476-0477. All Seniors who took the course in 2007, must be recertified in 2010 to continue receiving a discount on their Auto Insurance.

Advertise with us! Call 901-476-7116

Junior Auxiliary Corner Your Junior Auxiliary chapter may have been pretty quiet lately but we have been busy working on projects for the new year. You can always keep up with us by joining us on our Facebook page at www.facebook. com/juniorauxiliarytipton. We held an Open House to introduce JA to ladies who are interested in becoming members earlier this month. We hope that the ladies who expressed interest with be joining us soon. They would all be a great addition to our organization. The Annual Stuff the Bus drive for school supplies will be this Saturday, August 7 from 9 - 1 at two locations in the county. We will be at Walmart in Covington and Fredâ&#x20AC;&#x2122;s in Munford. Just look for the tent with the smiling JA ladies. All types of school supplies are needed as well as cash donations. This is tax free weekend for Tennessee so you will not have to pay taxes on your purchases of school supplies that you are buying. We have a new project called Crown Club which is for 10th and 11th grade girls to provide them an opportunity to grow through service to others in our community. The program will promote leadership skills with our youth and will instill in them an appreciation for volunteering. Junior Auxiliary members will be present at all meetings as well as all projects. For more information visit our website at www.tiptoncountyja. org or contact Renee Wooten at 901-233-9820. Fall Frenzy chair, Noel Howe, has been busy getting everything ready for this yearâ&#x20AC;&#x2122;s event. We already have many vendors confirmed and many more expected! With a larger location, we will be able to accommodate more people this year. We are very excited about what is planned for this year. For information about this event, visit our website. Thank you for your continued support of what we are doing. Without the community behind us, we would not have the spirit and energy to do what we are doing. Sponsored by IPL Industrial Services

Annual Stuff the Bus School Supplies Drive

Help the students referred by Tipton County Schools get the school supplies they need for this year. August 7th 9am-1pm Covington Location - Wal-Mart Munford Location - Fredâ&#x20AC;&#x2122;s Take advantage of the TAX FREE weekend to help the children succeed in school

We are currently accepting applications for our Crown Club program for 10th & 11th grade girls. For more information, visit www.tiptoncountyja.org

MAXIMIZE YOUR TIME

MINIMIZE YOUR WORK! ZG327

ZG227

Â&#x2026;)1 $ZMJOEFS ,VCPUB(BTPMJOF&OHJOF Â&#x2026;Âł.PXFS%FDL Â&#x2026;4FNJ1OFVNBUJD 'MBU'SFF  'SPOU$BTUFS5JSFT Â&#x2026;)ZESPTUBUJD5SBOTNJTTJPO

Â&#x2026;)1 $ZMJOEFS ,VCPUB(BTPMJOF&OHJOF Â&#x2026;Âł.PXFS%FDL Â&#x2026;)ZESPTUBUJD5SBOTNJTTJPO Â&#x2026;1SP$PNNFSDJBM.PXFS

L3240

RTV500

Â&#x2026;)1 $ZMJOEFS ,VCPUB%JFTFM&OHJOF Â&#x2026;$IPJDFPG5SBOTNJTTJPO Â&#x2026;0QUJPOBM(SBOE$BC XJUI%FMVYF'FBUVSFT Â&#x2026;1FSGPSNBODF.BUDIFE *NQMFNFOUT"WBJMBCMF

Â&#x2026;)1 $ZMJOEFS,VCPUB (BTPMJOF&OHJOF Â&#x2026;8%XJUI8%4FMFDUJPO Â&#x2026;'JUT*O5IF#BDL0G"'VMM4J[F  -POH#FE1JDLVQ5SVDL Â&#x2026;7BSJBCMF)ZESP5SBOTNJTTJPO 7)5

Â&#x2026;0SBOHFPS3FBMUSFFÂŽ$BNPVGMBHF .PEFMT"WBJMBCMF

$0 DOWN, 0% A.P.R. FINANCING FOR UP TO 60 MONTHS* ON SELECT NEW KUBOTAS!

WOOTEN TRACTOR CO. Ă&#x201C;äĂ&#x17D;ÂŁĂ&#x160;79Ă&#x160;xÂŁĂ&#x160;-"°Ă&#x160;UĂ&#x160; "6 /" ]Ă&#x160;/ Ă&#x160;UĂ&#x160;901-476-2631 * $0 down, 0% A.P.R. ďŹ nancing for terms up to 60 months on purchases of select new Kubota equipment from available inventory at participating dealers through 9/30/2010. Example: A 60-month monthly installment repayment term at 0% A.P.R. requires 60 payments of $16.67 per $1,000 borrowed. 0% A.P.R. interest is available to customers if no dealer documentation preparation fee is charged. Dealer charge for document preparation fee shall be in accordance with state laws. Only Kubota and selected Kubota performance-matched Land Pride equipment is eligible. Inclusion of ineligible equipment may result in a higher blended A.P.R. Not available for Rental, National Accounts or Governmental customers. 0% A.P.R. and low rate ďŹ nancing may not be available with customer instant rebate (C.I.R.) offers. Financing is available through Kubota Credit Corporation, U.S.A., 3401 Del Amo Blvd., Torrance, CA 90503; subject to credit approval. Some exceptions apply. Offer expires 9/30/2010. See us for details on these and other low-rate options or go to www.kubota.com for more information. K950-21-92114-7


Thursday, August 5, 2010 • THE LEADER • A13

www.covingtonleader.com

Covington Manor nears completion By TIFFANY HOLLAND tholland@covingtonleader.com

The Covington Manor Nursing and Rehabilitation Home is getting a new look and changing its perception with its new “Get Well, Go Home” program. With 80% of its renovations and new wing complete, many patients and family members are already experiencing the changes. This month a new state-of-the-art therapy gymnasium will be ready for use and almost all the new rooms have been built with hotel-like amenities and are in the final stages of renovation. The “Get Well, Go Home Program” treats patients in rehabilitative therapy by surrounding them with the comforts of home and encouraging social and family activities. “This is not a stereotypical nursing home program,” said Scott Hurst, the nursing home administrator. “The number one priority is to solidify family contacts because the best place to get well is at home.

So not only are we making it easier for families to see their loved ones and ease the travel burden but we are making every effort to give the new renovated facilities the feeling of home.” The new renovations include hardwood floors, a juice and coffee bar, wooden chandeliers, flat screen televisions for every patient, a new gym and workout room, an outdoor picnic area and a lounge with new sofas and tables for visitors to see their friends and loved ones. Made to house 43 patients, the new wing of the nursing home is designed with all the comforts of home to encourage patients to get better by easing them into their rehabilitative routines. There is even a graduation every week for patients who have become well enough to go home. Dozens of patients have already graduated from the program. People can soon see one of those patients featured on a promotional billboard along Highway 51. “We are changing the perception of our custom-

BMH recognizes employees for service BMH – Tipton’s Service First committee recently recognized employees who have been mentioned by name at least five times by the patients they have cared for during the past year. Service First is a Baptist initiative which exemplifies the Golden Rule by treating others in the manner in which you would wish for yourself or your family. These employees have consistently displayed the Service Values of

Friendliness, Responsiveness and Professionalism in their various disciplines. Their patients have identified them as having taken their needs to heart and provided for them exceedingly. BMH-Tipton congratulates our 5 Star Winners on their commitment and devotion to providing the highest quality of care to the patients of Tipton County.

Find us on Facebook at facebook.com/covingtonleader

W Bankruptcy? Chapter 7 Chapter 13

Law Firm

Call the Attorneys at Ward Williams, PLLC

837-9355

From left to right: Donna Worlds, Tasha Ballard, Camille Ballard, Tom Isaak, Becky Rogers. Tammy Freeman, Annette Williams, Mike Ballard, Regina Ingram, Glenda Blackwell, Kim Strickland, Daran Millner, Joan Coltrane. (not pictured): Helen Deneka, Janine Seagrave, Jessica Tyus, Margaret Green, Pennie Vaughn

Neola Farms accepts award for growth By ECHO DAY eday@covingtonleader.com A Tipton County couple recently because one of three West Tennessee recipients of the Tennessee Small Business Development rising star award, the organization announced last week. Mike and Charline Lenager, who own and operate Neola Farms in the Holly Grove community, were chosen to receive the award due to their tremendous amount of growth in recent years, said Dyersburg State Community College – Naifeh Center Dean Jamie Frakes. “Over the last year, year-anda-half, they have proven their staying power in the business,” Frakes, former West Tennessee TSBDC director, said. “They consistently market their brand and their product successfully and have been really outstanding business owners.” As a result of their marketing efforts, said Frakes, they have seen an increase in sales and are well on their way to establishing a long-lasting business. “I think their business will be around here for a long, long time. They’ll make Tennessee proud because they have a great quality product.” The Lenagars raise Tipton County cattle and do it the way their grandparents did. And many

ers,” said Hurst in a press release. “(The customers) may have been afraid to enter a “nursing home” after hospitalization because they did not know we have an excellent program! We are proud to offer these rehab services to meet the needs of Tipton County residents who have recently been hospitalized with complex medical conditions. “ The remodeling for the program began in February and costs $700,000 which is funded by the state and Medicare. Patients in “Get Well, Go Home” are admitted by local doctors and the Tipton County Hospital that resides just across the street so patients do not have to travel far, which is often hard on people with this need of care. Covington Manor will have a grand opening once the remodeling is complete and Hurst invites community organizations to come out and volunteer anytime and see the new renovations being done. It is located at 1992 Highway 51 in Covington.

restaurants in the region are taking notice, serving their superior quality beef and offering their diners the one-of-a-kind taste that comes from Neola Farms. Currently, 26 restaurants and three hotels in West Tennessee – including the Westin Hotel, Grill 83 and the Peabody – serve Neola Farms beef. Additionally, their beef is served at St. Jude. “We’re also shipping all over the region,” Mike said. For the Lenagars, offering the best quality beef is one thing they’re doing right. Keeping it local is another. They purchase their cattle from five local farms, including Claybrook Farms north of Covington. Their Tipton County cattle is fed Tipton County corn, says Mike. He is proud of purchasing the cattle locally, stating that it helps the local economy and local farmers.

The Lenagars also receive their business counseling locally, turning to DSCC’s Small Business Development Center for guidance. “They really provide a great venue at DSCC with counseling,” said Mike. The TSBDC is a network of professional business consultants with 12 centers and two satellite offices in 14 cities throughout the state of Tennessee. The TSBDC prides itself on providing expert business advice to all types of businesses - manufacturers, retailers, service providers or professionals; the center exists to help business owners help themselves. The organization annually presents seven rising star awards to small businesses in Tennessee. For more information on TSBDC, please visit www.tsbdc.org.

Stuff the Bus on Saturday The Tipton County Junior Auxilary presents "Stuff the Bus" this Saturday, August 7th. New school supplies will be collected at Walmart in Covington and Fred's in Munford.The items collected will be donated to children in need. It will continue on this Tax Free Weekend from 9 a.m. - 1 p.m. For more information or to contact organizers, go to www.tiptoncountyja.org.

Evening & Weekend Appointments available

99 Doctors Drive, Suite 300 Munford, TN 38058

PET OF THE WEEK Arabella and her sister, Angelia, were rescued from the pound in Covington, TN by C.A.R.E. The girls are only about 18-20 weeks old. They are together in a loving foster home where they are getting a lot of attention and being socialized with children, cats & other dogs. Arabella is a bit shy but warms up quickly. Arabella needs a family that will give her lots of love and let her know that not all people are bad. She has a beautifully sweet disposition and warms up to you after just a few minutes. If you’re interested in adopting Arabella, please go to www.covingtonanimalrescueeffort.com and click on “adoption procedure”. Adoption fee is $125 and includes her spay, puppy shots, bordetella vaccine and heartworm check. You can also see C.A.R.E.S. rescue dogs on the facebook page, “CARE Covington Animal Rescue Official Page.” Join the group and watch for new rescues! SPONSORED BY:

Something Special 117 West Court Sq. Covington 475-4477

230 South Washington Ripley 731-635-4470

My name is BIG BOY I like to rough and tumble a little, but I sure love my tummy scratched. And I will sit quietly at your feet if you want to scratch my head. I love children of all ages and ride very quietly in the car (I sleep). I am black and white with very attractive markings - if I do say Big Boy so myself. I love people and other dogs. Oh, and did I mention I love children too? I am 50 LBS of love and affection. I really need someone to love me and give me a good home. Please contact Dogs 2nd Chance for a local trial adoption. Adoption application, adoption fee and references required. http://www.dogs2ndchance.org/ adoption-application, http://dogs2ndchance.org/ for more info email dogs2ndchance@gmail.org

A Dogs 2nd Chance Sponsored by:

Groomindogz 901-837-1085

Mon. - Fri. 7am - 6pm *open some Saturdays

76 Tabb Dr. Ste. K • Munford, TN 38058


A14 • Thursday, August 5, 2010 • THE LEADER

www.covingtonleader.com

Civic Corner

EXCHANGE CLUB TALKS ABOUT HIGHER EDUCATION Continuing education classes at Dyersburg State Community College were the focus at a recent meeting of the Covington Exchange Club. Dr. Loren Crownʼs class, Mini Med School, offers an opportunity for the general public to learn about a broad range of issues from basic anatomy and physiology to health care reform and end of life issues. Birgit Northcutt, representing the Division of Continuing Education, described an offering of classes that are available at the Covington Campus, as well as online classes. Pictured are Exchange Club members Rick Peeler and Trish Williams, Dr. Loren Crown and Birgit Northcutt.

MCDANIEL DISPLAYS TAEKWONDO SKILLS FOR EXCHANGE CLUB Callie McDaniel, a 13 year old student at Crestview Middle School, exhibited her Taekwondo skills at the Covington Exchange Club on August 3. At age 6, Callie started classes at Masonʼs ATA Black Belt Academy where her father, Josh McDaniel, is a 3rd degree certified instructor and her mother, Tiffany, is a 1st degree and program director. Callie recently brought home the gold medal from the Taekwondo Sparring World Championships. In the photo Callie (center) is pictured with her parents, Josh and Tiffany McDaniel, along with James Smith, Program Chair and Trish Williams, Club President.

Gilt Edge Bernadine McAfee

I talked to Bertha Walker on July 20th. It was her birthday. Glyn Bomar of Savannah had called before I did. She and her grandson Josh hope to come to her Uncle Carl Harchfield’s birthday is July 31. The dinner will be in the Family Life Center at Beaver Baptist Church. They hope to come to Munford to visit Ed and Bertha a little while. Ruth Taylor is in the hospital in Dyersburg. Some of her family is staying with her. The Chaplin came to see them and it was Garrett Sweeney, a former pastor at Randolph Assembly of God Church. Sympathy to the loved ones of Ruth Carlton Taylor. On the prayer list: Linda Pugh, Rev. A.A. Lawrence and wife, Charlotte Mindy Tankersly, Megan Hobock, June Glass, Barry Dillender, Shawn Cousar, Louise

Burlison Eddie Kellum

Hello from Burlison. I solved a great mystery this week here in Burlison. Tomatoes have been being placed on our porch this summer and we didn’t have a clue where they were coming from, but Sunday morning as I was drinking my coffee and preparing for church I saw someone pull up at my drive and stop. I went to the door and there was yet another sack of tomatoes laying there but this time I saw who the Good Samaritan was. I’m not going to divulge their identity, but I do want to thank them for their generosity. We have really been enjoying those tomatoes. Last month after our city meeting Ms. Faye Alsbrook gave me a book that she had just finished reading. The book was written by Rick Bragg and was about his life. He grew up very poor in the rural south with an abusive alcoholic father early in his life. His mother picked cotton and took in ironing to buy food for Rick

Bomar, Lois Conger, Polly Branch, Nadine Kellum, Patra Ballard, Dell Ferguson, the folks at Kelley’s Chapel, Rev. Mike and Elaine Roberts, Donnie Rita and Will Haislip, all the men and women in the military, Zack Wallace, Ed Walker, Rev. Jimmy Bridges, Hazel Mooneyham, Emma Sue Turnage, Kathryn Glass, Hop Gibbons, Otis Poole, Clara McMillin, Tony Rhea and his mother, also Louise Kellum and Roy Randolph. Sympathy to the loved ones of Wayne Sloan. He was the Mayor of Gilt Edge. Bertha Walker’s family helped her celebrate her birthday. The day after Connie and John Blyue visited her and Ed and took her a gift. They also saw where Martha Chapman lives and did some shopping in Munford. The Gilt Edge Church of Christ had a gospel meeting July 18-23 with evangelist Gerald R. Reynolds. The

minister is Daniel Dalton. Worship is Sunday at 10 a.m. Bible study is at 11 a.m. The evening worship is 6 p.m. Weekly bible study is Wednesday at 7:30 p.m. The daily radio program is 1250 AM, Monday – Friday 12:45 and 5:30 p.m. I would like to say hello to Tracy Schneider Morris of Ripley and to Angie Haynes of Atoka. Tracy has a dentist office and Angie works there. They also have a great group of ladies that also work there. Pastor Larry Brown of the Recovery Center of Gilt Edge preached at Westside Church on Friday night. His wife was with him. It was also his birthday. August 8th, Poplar Grove Assembly of God will be having their homecoming service. The church will be celebrating the 50th anniversary of Brother Rufus Roberts’s ministry. The church is located at 2600 Glen Springs Road in Drummonds.

and his two brothers. Rick finds a way out through his talent of writing and goes on to win a Pulitzer Prize. Some people have a way with words that take you to the places they’re writing about so it’s like your there with them. You get to know the characters, you can see them, you can experience everything they’re feeling and it’s like you are a part of the story. Rick Bragg is this kind of writer. The book is titled “All Over but the Shoutin”. Thanks Ms. Faye. I really enjoyed the book and would recommend it to all Burlison article readers. On July 24th, the Lindsey brothers, Gabriel and Jacob left for a week long Missionary trip to Baja, Mexico. While there, they and others built 9 houses for needy families. There were over 350 missionaries who went to Baja. Daily, the missionaries went into the surrounding villages to minister the Word and Love of Jesus Christ. Their highlight was the children of Mexico. The children would come down from their mountain shanties to V.B.S. The generosity and friendliness of the Mexican

people was astonishing. Both Lindsey brothers cannot wait to go back to see their new friends. They sincerely thank everyone who sponsored and prayed for them. The Lord’s Spirit has changed both brothers forever. Please don’t forget to vote. Thursday is your last chance for the local elections. Last week I wrote that if you don’t vote you can’t complain. Well my beautiful and smart wife, Paula pointed out to me that this is still America and we have the right to vote or not. I don’t like to admit it but she is oh so right. Oh and by the way, she is a voter. Who am I to tell anyone else what they should do or should not do? However, Paula and I both believe that everyone should exercise their right to vote. If you have any information for future articles call me at 901-476-2683 or e-mail me at kellumeddie@ yahoo.com. Until next time have a blessed week. Eddie Kellum

News, tips or story ideas? Email us or call 476-7116

NEW MEMBERS AT THE LIONS CLUB The Covington Lions Club welcomed new members this past week. Pictured is president Bill Enzor, new members Sarah Brasfield, Walter Black and Doris Glosson and Lions Secretary Ruth Wallace.

CROWN SPEAKS TO LIONS CLUB L to R: Lion President Bill Enzor, Speaker Dr. Loren Crown, Pragram Chairperson Gail Johnson, speaker Birgit Northcutt. The Lions Club met at Dyersburg State Community College to hear speakers on Fall Mini Med School.

Advertise your business in our up and coming special sections! Our Sections include:

• Football Preview • Celebrate Munford • Heritage Day If you are interested in advertising your business, sponsoring a page, or placing an ad for a family member in our paper, please call Andy Posey or Beverly Miller at The Leader today. Don’t let this opportunity pass you by!

Office: 476-7116 Andy Cell: 517-6085 Beverly Cell: 409-4818


Thursday, August 5, 2010 • THE LEADER • A15

www.covingtonleader.com

Summer heat a concern as school year begins NASHVILLE, Tenn. – With the predicted heat index at or above 100 degrees for the remainder of the week, Tennesseans need to make wise decisions to protect themselves and their children from heat-related illnesses, especially as the 2010-2011 school year begins in some counties across the state. “It’s important for parents and caregivers to make sure children are properly hydrated,” said Health Commissioner Susan R. Cooper, MSN, RN. “With morning temperatures above 80 degrees, kids waiting on the bus stop should have water available just like those who are participating in outdoor activities in the afternoon. Consider providing your child a water bottle to have on hand throughout the day.” Some of the illnesses caused by extreme heat include heat exhaustion, heat cramps, sunburn and heat rash. Symptoms include dizziness, heavy sweating, muscle cramps, rapid heart beat, nausea, headaches and cold/ clammy skin. The most lifethreatening heatrelated illness is heat stroke, which causes the death of approximately 400 people nationwide die each year. The condition occurs when the body is unable to regulate its temperature, which rises quickly without the ability to cool down. If emergency treatment is not provided, heat stroke can cause death or permanent disability. Symptoms include body temperature above 103 degrees Fahrenheit; red, hot and dry skin without sweating; rapid, strong pulse; throbbing headache; dizziness; nausea; confusion; and loss of consciousness. “Take the necessary steps to protect and care for the young and the elderly, who are at greater risk in extreme heat. Avoid being outside during the hottest part of the day, and never leave anyone unattended in a car,” said Cooper. Schools affiliated with Tennessee Secondary School Athletic Association must abide by its heat policy, which outlines requirements for practice and competing in high temperatures and prohibits all activities when the heat index is in excess of 104 degrees Fahrenheit. For more information, contact your child’s school or district office. The Centers for Disease Control and Prevention offers a few simple steps to avoid these preventable illnesses. Drink fluids frequently. Don’t wait until you are thirsty to drink. Remember to consume non-alcoholic, low-sugar drinks in hot weather.

Replace salt and minerals. Heavy sweating from increased temperatures can deplete your body’s salt and minerals. Non-alcoholic drinks, like sports drinks, can help you replenish these reserves. Wear appropriate clothing and sunscreen. Choose lightweight, light-colored, loose-fitting clothing, as well as a wide-brimmed hat and sunglasses with UV protection. Wear SPF 15 or higher sunscreen every day. Schedule outdoor activities carefully. Try to limit outdoor activity to morning and evening hours with rest breaks in shady areas, if available. Pace yourself. If you are unaccustomed to working or exercising in a hot environment, start slowly and increase effort gradually. If your heart is pounding or you are gasping for breath, stop the activity and rest in a cool, shady area. Stay cool indoors. If your home does not have air conditioning, go to the mall or library to cool off. Cool showers or baths, as well as keeping your stove and oven off, are other ways to cool down inside. Use the buddy system. Partner with a friend and watch for signs of heatrelated illness in each other. Senior citizens are more susceptible, so if you are over 65, ask a friend to check on you over the phone twice a day. If you know someone in this age group, remember to check on them at least twice a day. Monitor those at high risk. Infants and children under 4 years of age, people over 65, people who are overweight, those who overexert themselves during work or exercise and people who are physically ill (especially those who have heart disease or high blood pressure, take certain medication, or suffer from insomnia, depression or poor circulation) are especially at risk. Call for immediate medical assistance if you believe you or another person is experiencing heat stroke. While waiting on emergency assistance, get the victim to a shady area, cool them rapidly using cool water and monitor body temperature until it reaches 101 to 102 degrees Fahrenheit, and do not give the victim any fluids to drink. For more information about heatrelated illnesses, including prevention and treatment tips, visit the CDC’s website at www.bt.cdc.gov/disasters/extremeheat/heat_guide.asp.

Ultimate salad-tossing contest FRANKLIN, Tenn. – July 30, 2010 – Are you the ultimate salad spinner? Do you have a potato salad that knocks your socks off? Then www.justapinch. com has the contest for you! Just A Pinch Recipe Club invites creative hometown cooks to share their favorite salad recipes in its “Ultimate Salad Toss” for a chance to win a trip to Nashville, Tenn., and a $1,000 cook’s dream shopping spree at The Viking Store. Entries will be accepted through 5 p.m. CDT, Sept. 30, 2010. All salad recipes from Just A Pinch Recipe Club members are eligible, from green salad to pasta salad to gelatin salad to potato salad and more. Lettuce is welcome, but not required! Recipe entries for the “Ultimate Salad Toss” should be submitted on the Club’s website at www.justapinch.com. The ultimate salad will be crowned champion based on originality, ease of preparation, presentation and pure deliciousness. The recipe submitter and the winning salad will be featured at www.justapinch.com the week of Oct. 5. The winner also will be the special guest at the Just A Pinch Blue Ribbon Showcase in October, where they will prepare their winning salad recipe with Janet Tharpe, Recipe Club host-

ess. The Blue Ribbon Showcase will be held at the Viking Culinary Arts Center in Franklin, Tenn., located just minutes from Nashville. The grand prize includes:?- Roundtrip airfare for two to Nashville, Tenn. - Two nights hotel accommodations Two tickets to a Grand Ole Opry performance (subject to scheduling and availability) - A $1,000 cook's dream shopping spree at The Viking Store in historic downtown Franklin, Tenn. For more information on the “Ultimate Salad Toss”, visit www.justapinch.com. Founded in 2010, the Just A Pinch Recipe Club® is an online community of hometown cooks across America who view and rate thousands of recipes, as well as swap and chat about recipes, build menus, access grocery lists and get coupons for recipe ingredients and other household items. The Club offers free memberships and premium perks. For more information, visit www.justapinch.com.

Bands

battle

summer

heat

With Tipton County band camps taking place last week, high school music programs deal with an intense heat wave. Though high temperatures were an obstruction, the show must go on. Check out the front page of this week's Lifestyles section to find out more.

DANCING ON THE GULF Haylee Ann Taylor won first place in a national competition with her dance team named Five Little Monkeys. Here, she is pictured at Panama City, Fla. where the competition took place. She takes dance classes at Show Stars Dance Studio in Brighton. Taylor is six years old.

USDA announces Conservation Reserve Program sign-up WASHINGTON, D.C. – July 26, 2010 - Agriculture Secretary Tom Vilsack today announced that a general sign-up for the Conservation Reserve Program (CRP) will begin on August 2, 2010 and continue through August 27, 2010. During the sign-up period, farmers and ranchers may offer eligible land for CRP's competitive general sign-up at their county Farm Service Agency (FSA) office. The 2008 Farm Bill authorized USDA to maintain CRP enrollment up to 32 million acres. Jim Miller, Agriculture Under Secretary for Farm and Foreign Agriculture Services, made the announcement on behalf of Secretary Vilsack during a conference call with reporters. "America's farmers and ranchers play an important role in improving our environment, and for nearly 25 years, CRP has helped this nation build sound conservation practices that preserve the soil, clean our water, and restore habitat for wildlife," said Miller. "Today’s announcement will help us create a greener and healthier America, and I encourage all interested farmers and ranchers to contact their local FSA office to learn more how to take advantage of this opportunity.” To help ensure that interested farmers and ranchers are aware of the sign-up period, USDA has signed partnership agreements with several

conservation and wildlife organizations, which will play an active role in USDA’s 2010 CRP outreach efforts. Additionally, Secretary Vilsack has recorded two public service announcements, which are available to the press and public at www.fsa.usda.gov/psa. CRP is a voluntary program that assists farmers, ranchers and other agricultural producers to use their environmentally sensitive land for conservation benefits. Producers enrolling in CRP plant long-term, resourceconserving covers in exchange for rental payments, cost-share, and technical assistance. CRP protects millions of acres of America's topsoil from erosion and is designed to improve the nation's natural resources base. Participants voluntarily remove environmentally sensitive land from agricultural production by entering into longterm contracts for 10 to 15 years. In exchange, participants receive annual rental payments and a payment of up to 50 percent of the cost of establishing conservation practices. By reducing water runoff and sedimentation, CRP also protects groundwater and helps improve the condition of lakes, rivers, ponds and streams. Acreage enrolled in the CRP is planted to resourceconserving vegetative covers, making the program a major contributor to wildlife population

increases in many parts of the country. As a result, CRP has provided significant opportunities for hunting and fishing on private lands. Land currently not enrolled in CRP may be offered in this sign-up provided all eligibility requirements are met. Additionally, current CRP participants with contracts expiring this fall covering about 4.5 million acres may make new contract offers. Contracts awarded under this sign-up are scheduled to become effective Oct. 1, 2010. FSA implements CRP on behalf of Commodity Credit Corporation. FSA will evaluate and rank eligible CRP offers using an Environmental Benefits Index (EBI) for environmental benefits to be gained from enrolling the land in CRP. The EBI consists of five environmental factors (wildlife, water, soil, air and enduring benefits) and cost. Decisions on the EBI cutoff will be made after the sign-up ends and after analyzing the EBI data of all the offers. Those who would have met previous signup EBI thresholds are not guaranteed a contract under this sign-up. In addition to the general sign-up, CRP's continuous sign-up program will be ongoing. Continuous acres represent the most environmentally desirable and sensitive land. For more information, visit http://www. fsa.usda.gov/crp.


A16 • Thursday, August 5, 2010 • THE LEADER

www.covingtonleader.com

Championship on Chargers’ minds flexible to suit our personnel. Wheeler says, “ We’ll be better able to platoon from this defensive set and it allows us to use four defensive backs which is what I like. Our DBs are very athletic and I think that will serve us well this season.” Late last Friday in his office, Coach Wheeler reflected on the fall camp and looked ahead to the 2010 campaign. “ This has been a really good camp. We worked in pads this year. Last year we didn’t. We started with 50 and ended with 50 this year. After

By Steve Holt Special to The Leader

A once proud and virtually invincible Covington Charger football program has been a bit moribund of late, but signs of life are stirring. Heard in the locker room as the team broke two-a-days to end fall camp, “ We’re taking our first steps toward a state championship.” That wasn’t a coach; it was a player on a still young, untested squad with few wins in the past few seasons to back up such optimism. “Yet”, says, head coach Marty Wheeler, “ There’s a different feel this year from last. There’s growth. We’re improved. We’re stronger.” CHS has one new/old addition to the coaching staff, J.R. Kirby, who after departing Covington in 2006 for stints at Ripley and Haywood, returns to the Charger fold to mentor the defensive line and quarterbacks. Coach Jon Katrosh continues as defensive co-coordinator but has added duties this season coaching offensive tackles and tight ends. In one more tweak, head freshman coach David Sage will don a pair of headsets and signal in offensive plays and take a bit more of a role in the offense. Offensively CHS will make use of its speed in the backfield to keep opposing defenses off balance. The overall team is stronger and more athletic than last season and will be able to open some holes to get those racehorses into the open field. Coach Wheeler says that the passing game is ahead of what he anticipated and that we are throwing the ball with better accuracy and selectivity than in the past. The Chargers will run a 3-4 defenCoach Marty Wheeler looks on as the Chargers prepare for a scrimmage sive scheme this year to take advantage of their athleticism and speed. The against Liberty. The season opens at home on August 20 against the Frayser Rams. Photo by Tiffany Holland. coaching staff feels that this defense best suits our players and is the most

Brighton attends cheer camp The Brighton High School Cheerleaders attended UCA Cheer Camp this summer. They spent 4 busy days learning cheers and dances as well as ways to promote school spirit and support out athletic teams. They also competed for several awards while at camp. The freshmen squad attended University of Memphis. They received 1st place for their home pom, second place for Camp Champ in Dance and were awarded a trophy for superior squad.

They also received several superior Blue and gold ribbons for their knowledge of material taught. Brighton's Varsity squad attended UCA Camp at UT Martin in July. They brought home numerous Blue and gold superior ribbons, First place trophy for their Fight song dance, Camp Champs in Cheer and Camp Champs in Dance. Freshmen McKenzie Smith, Sophmore Veronica Butler and Senior Kimi Jennings were chosen as UCA All American.

what we put them through it’s remarkable. That’s the first time that has happened that I remember”, he said.” “ We play in a tough region. It’s very competitive. Our non-region games are rivalries. Every week is a challenge, the way football should be. The optimism I heard in that “steps toward a state championship” comment may be premature but it’s encouraging. Pride and desire are key to a winning program.” Wheeler continued, “ We’ll take our lumps this year in wins and losses. We are very young. But it has been good and fun. There has been a lot of coaching going on. The players are really competitive amongst one another. They have realized that if they are not getting the job done and get replaced that they may not get back in there because others want it more. We may have lost a few because of that. Overall we have some depth. We have to stay healthy on the offensive and defensive lines. If we do and play well on those two lines, we’ll be OK with our record.” The season opens at Covington Athletic Field on August 13 with the annual area Jamboree. Kick-off is set for 5:30 pm heat index permitting. The regular season opens for the Chargers at home on August 20 versus the Frayser Rams with the kick-off set for 7:30 pm.

Youth Soccer League The Covington Sportsplex is now accepting registration for the Fall youth soccer league. The league is open to ages 4-15. The fee is $40 per child. For more information, please contact the Sportsplex at 476-3734. Play will begin in late August. The deadline to register will be August 16.

Brighton High School attended UCA cheer camp recently. Pictured are the Freshman cheerleaders. Front Row: McKenzie Smith. Christy Piercy Row 2: Alexis Dickerson, Destiny King, Carrie Taylor, Tiffany Brewster Row 3: Rylee Gray, Brittani Wise, Katie Hudson, Megan Woods Abby Armstrong Row 4: Ms. Roberta, Charly Wood

Experience. Honesty. Integrity.

Floor Sample Sale Sofas from

$

699

Everything marked down!! 139 Wesley Reed • Atoka 837-9885

Purchasing a home can be one of the most thrilling experiences of a lifetime. Whether you’re a first-time home buyer, moving to another home, or refinancing your current residence, you’ll find First State Mortgage offers more home loan choices matched with sound lending advice. First State puts the needs and abilities of your family first. Call Deborah Lane at First State Mortgage today! Atoka 11300 Hwy. 51 South 901-853-6860 (office) • 901-359-5843 (mobile) dlane@first-state.net

www.first-state.net

Subject to credit approval. Some restrictions apply.

Conventional • First-Time Home Buyer • FHA • VA • THDA • Guaranteed Rural Housing Loans


Thursday, August 5, 2010 â&#x20AC;˘ THE LEADER â&#x20AC;˘ A17

www.covingtonleader.com

Locally loaded team wins world series

By STEVE HOLT Special to The Leader The Memphis Royals, a team chock full of talent from Tipton County, were the wire-to-wire winners of the ASPBA (American Semi-Pro Baseball Association) World Series this past weekend at USA stadium sweeping through the opposition 5-0 in the double elimination tournament. The squad includes former CHS players, Bradley Williams, Tony Marbry and Hunter Marbry; Jesse Brooks from Brighton; Hunter Dawson, Aaron Fultz and Tyler Heulsing of Munford and former Millington stars Kyle Lewis and Austin Moody. Hereâ&#x20AC;&#x2122;s a recap of their championship winning weekend. July 29 - Memphis Royals 6 Florence (AL) Nitro 3 Royals 200 031 0 6 3 1 Nitro 002 000 1 3 8 1 WP Ivan Nails (6-0) LP Jordan West (7-4) Royals 30-4 Nitro 18-7 The Royals managed only 3 hits in the game but two were homers; a 2-run shot by Kyle Lewis in the top of the 1st and a solo homer by Chris Mitchell, his team lead-

ing 18th, in the 5th. After a slow start, Ivan Nails allowed only 2 hits after the 3rd inning to pick up his 6th win against no losses in the complete game victory. July 30 Game 1 â&#x20AC;&#x201C; Memphis Royals 3 Memphis Redbirds 0 Redbirds 000 000 0 0 41 Royals 000 102 x 3 50 WP Aaron Fultz (1-1) LP Ledell Lowe S- Garrett Pepper (2) Royals 31-4

Former major leaguer Aaron Fultz allowed 4 hits and struck out 8 in 5 innings to get the win over the Redbirds. Garrett Pepper hit a 2-run homer in the bottom of the 6th inning to give the Royals a little insurance. Pepper also pitched the last 2 innings of scoreless ball to get the save as the Royals shut out the Redbirds. July 30 Game 2 â&#x20AC;&#x201C; Memphis Royals 5 Pine Bluff (AR) Braves 4 Braves 101 000 002 0 481 Royals 002 000 002 1 590 WP Bradley Williams (5-1) LP Seth Lee Royals 32-4 Braves 20-9

Hunter Dawson drove in Alan Wright with the winning run with no outs in the bottom of the 10th inning. Wright had walked to lead off the inning and had advanced to 2nd on a wild pitch. A single by Michael Ferguson and an intentional walk to Jeff Duncan to load the bases preceded Dawsonâ&#x20AC;&#x2122;s game winner. Bradley Williams got the win having struck out the side in the top of the 10th. The Royals had staged a 2 out comeback in the bottom of the 9th on a 2-run double off the bat of Josh Maurizi after the Braves had taken a 2 run lead in the top of the frame. Royals starter, Tony Marbry, had a great outing going 8 innings allowing only 5 hits while striking out 8. Michael Ferguson led the Royals with 3 hits including a double.

6KDULQJ+RPHWRZQ5HFLSHV&RRNLQJ7LSVDQG&RXSRQV %\-DQHW7KDUSH

6XPPHU*ULOOLQJ$OO6WDU&XPLQ*ULOOHG3RUN&KRSV ³7KHVHSRUN FKRSVDUHVR MXLF\DQGIXOO RIIODYRUWKDW WKH\WDVWHOLNH VWHDN´ /HDK6WDFH\ -RQHVERURXJK71 3RS

5

HDG\WRVKRZRII\RXUJULOOLQJFKRSV":HOO/HDK 6WDFH\KDVFRPHXSZLWKD%OXH5LEERQUHFLSHWKDW ZLOOPDNH\RXORRNOLNHWKHXOWLPDWHJULOOPDVWHU+HU FXPLQIXHOHGPDULQDGHLVWKHVWDURIWKLVIDVWDQGHDV\ GLVK1RWRQO\GRHVLWDGGDGLVWLQFWLYHVPRNLQHVVWRWKH SRUNEXWLWDOVRGRHVZRQGHUVVHDOLQJLQWKHFKRSVÂśQDWXUDO PRLVWXUH,OLNHWKHPDULQDGHVRPXFKLQIDFWWKDW,FDQÂśW ZDLWWRWU\LWRXWRQGLIIHUHQWPHDWVDVZHOO7KLVUHFLSH LVDVXUHÂżUHZD\WRZRZ\RXUIULHQGVDQGIDPLO\DW\RXU QH[WFRRNRXW+DSS\JULOOLQJ 6HHVWHSE\VWHSSKRWRVRI/HDK6WDFH\ÂśV&XPLQ *ULOOHG3RUN&KRSVUHFLSHDQGWKRXVDQGVPRUHIURPRWKHU KRPHWRZQ$PHULFDQVDW

ZZZMXVWDSLQFKFRPSRUNFKRSV

<RXœOODOVR¿QGDPHDOSODQQHUDQGFRXSRQVIRUWKHUHFLSH LQJUHGLHQWV(QMR\DQGUHPHPEHUXVH³MXVWDSLQFK´

/HDK6WDFH\

July 31 Semi-final Game Memphis Royals 5 Hattiesburg (MS) Black Sox 4

-Janet

&XPLQ*ULOOHG 3RUN&KRSV

Black Sox 010 300 000 00 4 10 2 Royals 002 010 100 01 5 10 1

'LUHFWLRQV

:KDW<RX1HHG

FHQWHUFXW ERQHOHVVSRUNFKRSV

Â&#x2021; 3ODFHWKHSRUNFKRSV IURPWKHIULGJHWKH LQDFDVVHUROHGLVK ODVWKRXUEHIRUH OD\LQJĂ&#x20AC;DW JULOOLQJ FYHJHWDEOHRLO Â&#x2021; 1H[WPL[WRJHWKHU Â&#x2021; *ULOORQPHGLXPORZ FVR\VDXFH WKHUHPDLQLQJ IRUDERXWPLQXWHV LQJUHGLHQWVLQDERZO RQHDFKVLGHRUXQWLO FZRUFHVWHUVKLUH FRRNHGWKURXJK , VDXFH Â&#x2021; 3XQFWXUHWKHSRUN DOZD\VVSRRQRQWKH FKRSVDOORYHUZLWK WVSPLQFHGJDUOLF PDULQDGHWRRZKLOH DIRUN3RXUWKH WKH\DUHFRRNLQJ  WVSFXPLQ PDULQDGHRQWRS 'LVFDUGPDULQDGH RIWKHFKRSVWKHQ WEVSEURZQVXJDU ZKHQÂżQLVKHG UHIULJHUDWH FRRNLQJ KRXUVĂ&#x20AC;LSSLQJWKHP VDOWDQGSHSSHUWR RYHURQFHZKLOH Â&#x2021; 6HUYHV WDVWH PDULQDWLQJ5HPRYH

WP Hunter Dawson (4-1) Royals 33-4 Black Sox 42-6 Bradley Williams led off the 11th inning by SEE BASEBALL, PAGE A18

6XEPLWWHGE\/HDK6WDFH\-RQHVERURXJK71 3RS ZZZMXVWDSLQFKFRPSRUNFKRSV

(901)476-8632

ZZZMXVWDSLQFKFRPSRUNFKRSV M W L K  N K

thorntonshomefurnishing.com

Covington practices late into the evening. Photo by JeďŹ&#x20AC; Ireland.

$14

Covington struggles with Liberty in scrimmage By Jeff Ireland sports@covingtonleader.com Like the regular season, the high school preseason has its share of ups and downs. Such has been the case for the Charger program the last few weeks. After some good practices last week, Covington struggled in a scrimmage against Liberty on Monday afternoon. Liberty, which plays in a larger division and is coming off a very strong 2009 season, outscored Covington for the majority of the game. â&#x20AC;&#x153;They got after us and showed us a lot of areas we need to improve on,â&#x20AC;? said Covington coach Marty Wheeler. â&#x20AC;&#x153;My biggest disappointment was our stamina, but thatâ&#x20AC;&#x2122;s easily fixed. Weâ&#x20AC;&#x2122;ve got to be in shape by Aug. 20 (the season opener) and we will.â&#x20AC;?

With the soaring temperatures keeping Covington off the practice field until about 7 p.m. on Tuesday, Wheeler took that time to review film from the Liberty scrimmage. â&#x20AC;&#x153;I thought we had a really good film session,â&#x20AC;? said Wheeler. â&#x20AC;&#x153;I got after them today and they responded pretty well.â&#x20AC;? Covington will host another scrimmage tomorrow at approximately 6 p.m. against Evangelical Christian School. On Aug. 13 Covington will host a jamboree. The action will open up at 5:30 p.m. with Munford vs. Haywood. Obion vs. Tipton-Rosemark Academy and Ripley vs. Brighton will follow, with Covington vs. Briarcrest wrapping up the action.

All You Can Eat Specials Catfish

$14 $7.00 Off our 6 Month Subscription* Sign up TODAY and SAVE! PLUS FREE Classified AD!

Savings so Hot.....Youâ&#x20AC;&#x2122;ll want to Stop, Drop & Roll FREE CLASSIFIED AD COUPON Ad Copy_____________________________________________________________________ _____________________________________________________________________________ _____________________________________________________________________________ _____________________________________________________________________________

To redeem yourFree ClassifiedAD simply fill out the coupon and bring it by ouroffice at 2001 Hwy 51 S. ormail to P.O. Box 529 along with yoursubscription order.

------------------____$14.00 In-County-Six Months YES! Start My Subscription TODAY!

YES! Please charge my credit card. I agree that my credit/debit card or checking account will be charged for my current subscription rate. Any changes to ongoing subscription rates will be included. Your subscription will be automatically renewed on the agreed renewal date. You may cancel your subscription at any time.

Card Holderâ&#x20AC;&#x2122;s Name:

(with fries, hushpuppies, choice of green beans or slaw)

Sunday - Wednesday $10.99 Friday & Saturday $12.99

Address

(with fries, hushpuppies, choice of green beans or slaw)

City

Sunday - Wednesday $12.99 Friday & Saturday $14.99

State Expiration Date

Thursday Specials

Zip

Phone No. FILL OUT FORM AND MAIL PAYMENT TO: OR CALL 901-476-7116

Margaritas, Wine and Draft Beer: Buy one get one free

Check enclosed #

JTâ&#x20AC;&#x2122;s

The Leader P. O. Box 529 Covington, TN 38019 **Classified ad valid only with paid Subscription. Must be redeemed within 30 Days of Payment.

Burgers & Wings 76 Tabb â&#x20AC;˘ Munford, TN 38058 â&#x20AC;˘ 901-837-9339

A17.indd 1

________________

Card Holderâ&#x20AC;&#x2122;s Signature

Wings only or Wings & Catfish

Dine-in Only $.50 wings all day

$14

$14

Please make check payable to The Leader

Limit One Coupon Per Family Maximum 15 Words Not For Business Use Good For One Publication

* Must not have been a Subscriber for past 30 Days

8/4/10 1:39:35 PM


A18 • Thursday, August 5, 2010 • THE LEADER

BASEBALL

Continued from A15 getting hit by a pitch. He then scored the winning run all the way from 1st base on a throwing error loaded with only one out in both the 7th and 9th innings. Hunter Dawson got the win pitching 4 innings of scoreless ball in relief. Jesse Brooks paced the Royals at the plate going 3 for 5 with a double and 2 RBI. August 1 Championship Game Memphis Royals 17 Austin (TX) Mudcats 16 Mudcats 400 606 0 16 19 3 Royals 403 061 3 17 15 3

www.covingtonleader.com WP Garrett Pepper (2-0) LP Jason Rangel als 34-4 Mudcats 27-6

Roy-

On the day, Bumpous was 3 for 4 with 2 home runs and 4 RBI. Hunter Marbry went 3 for 5 with a triple and 3 RBI. Winning pitcher Pepper also homer, a 3 run shot in the 3rd inning. The last three games were a physical ordeal for the Royals as they played a 10 and 11 inning game on Saturday finishing at 1:00 am on Sunday and then playing the Championship game at 11:00 am on Sunday.

Tony Marbry’s single down the 3rd base line with 2 out in the bottom of the 7th drove in Kody Bumpous with the game winning run to cap off an error filled slug fest and give the Royals a come from behind ASPBA World Series Championship. Down 16-14 entering the final frame, Hunter Dawson reached on an infield single with one out. Jesse Brooks walked and Garrett Pepper struck out for the 2nd out. Hunter Marbry and Bumpous followed with RBI singles to knot the score before Tony Marbry’s championship sealing hit.

Real Estate For Sale By Owner

Soccer kicks off its season in scrimmage

3 BR, 2 BA, $114,000.00 will co-op Call 401 Faulkner Heights 901-605-7776 Country Charmer on 2.5 Acres with pond, hardwood and tile throughout 1st floor, luxury master bath, venetian bronze fixtures, beautiful sun room across back with slated tile, large deck across back of home.

4247 Brighton Clopton Road

$170,000

10620 Hwy 51, South #3 Call Jennifer Hearn at Atoka, TN 38004

(901) 497-1736

(901) 837-7355

For Sale By Owner

3 BR, 2 BA, Over 1400 sq.ft. $123,500.00

Munford and Brighton players battle for a 50/50 ball during action last Saturday in Millington. Munford, Brighton and Millington scrimmaged one another multiple times in preparation for the upcoming season. Photo by Jeff Ireland

DeWitt earns highest honors

BPD promotes officers Recently, the Brighton Police Department has enjoyed honoring two officers with promotions. Patrolmen Carter Magee and Craig Pifer of the Brighton Police Department were promoted two weeks ago to lieutenant and investigator respectively. Lieutenant Magee (left) has contributed to Brighton’s police force since 1995.

“I’m just glad to come to work for Chief Durham,” said Magee. Chief Durham is banking on Pifer (right) because of his promising investigative skills. “My heart and soul has been in investigation ever since I’ve been in the job,” said Pifer. “I’m just glad to be able to meet the needs of the department.”

Jeff & Linda DeWitt announce their son, Jason DeWitt, has earned the rank of Eagle Scout, the highest honor in the Boy Scouts of America. He is a member of Troop 66 in Munford, which meet at Munford United Methodist Church. He will be celebrating his Eagle Scout Court of Honor on Saturday, August 14th. Jason’s Eagle project was renovating the playground for Woodlawn Baptist Academy and Day Care in Millington. Jason is a sopho-

Call 901-605-7776

264 Bloomington

For Sale By Owner 4 BR, 21/2 BA, Walk-in Shower, jacuzzi, 1850 sq.ft. $164,900.00 will co-op

Call 901-605-7776

54 Beverly more at Munford High School. He is also a member of the Academic Knowledge Team & Spanish Honor Society.

204 Hwy. 51, South Suite B Covington Office (901) 476-2121 www.Century21propertyplace.com Each Office is Independently Owned and Operated

Property Place

REDUCED

$ 105,900

$ 260,000

Ask About Poison Ivy Vaccine

78 EAGLE TRACE RD.

1438 DOWNING RD.

The prestigous neighborhood of “The Links” is where you’ll find this 4 bdrm 3 bath home. Features include: fireplace, hardwood floors, laundry room, office, bonus room, granite countertops, patio and much more!! Call today for your personal tour !!

A breeze is always blowing at this secluded country home. 4 bedrooms 2 bath home on 3.25 ac. VERY quiet area. Remodeled with new cabinet, counter tops, fixtures, paint,new AC unit, carpet and a deck. This is a “Must See”

Starting in April Covered By Most Insurances

$ 99,900 427 MAPLE ST. N.

This beautiful Victorian home is located in the Here’s the GREAT deal you’ve been looking for!! 5 heart of downtown Covington. Wonderful features bdrm 3.5 bath with 2700 sq ft inground pool, work in this home include, large diningroom, fireplaces, shop laundry room and more. Call today!! hardwood floors, and a breath taking wrap around front porch. Call for your personal tour today!!

Hometown Medical Service

SOLD

901 476-9996 South Munford Street Covington, TN 38019

2010 Chrysler Sebring

$ 165,000 306 WOODMONT CV.

DALE & LAURIE MCCLERKIN REAL ESTATE AGENTS

SPOUSES SELLING H USES

MOTOR CITY

Cell (901) 493-2278

2006 Nissan Murano SL

10518 Hwy. 51 • Atoka, TN (901) 840-1485

X662 14K miles, Loaded

$

16,995

$

17,900

Leather, Sat. Radio, Loaded 13K miles

2007 Chevy C1500 KC

X407 Nice Ride!

A18.indd 1

2008 Altima SE

2007 Corolla LE

2010 Dodge Avenger RT

X640

Financing to fit everyone’s needs! * ALL VEHICLES PRE-TITLED. SALE PRICE INCLUDES $299 DOC. FEE PHOTOS FOR ILLUSTRATION ONLY. SALE PRICES GOOD ON DATE OF PUBLICATION ONLY. SUBJECT TO PRIOR SALE.

$

12,995

X584

$

37K miles

11,995

X110 30K miles, Ready to go!

$

X690

$

Great Ride! 31K miles

17,995

2007 Scion TC

16,900

X092

$

Loaded, Sporty, 32K miles

10,995

2006 Impala SS

2007 Prius Hybrid

2006 Saturn Ion

X656

X643

8486A

Loaded

$

13,595

48 mpg

$

13,995

AC, PL, Auto, Tilt

$

6,995

8/4/10 1:50:42 PM


LIFESTYLES www.covingtonleader.com

Thursday, August 5, 2010

B1

Music programs heat up during band camp By TYLER LINDSEY tlindsey@covingtonleader.com Before climbing down from a highrise tower, Brighton High School band director Jonathan Findley ordered his band inside late last Friday morning for the students’ safety. Like other band directors in Tipton County schools, he adhered to the advice to move all outdoor practice inside if the heat index reaches 104 degrees. But throughout the county, the hindering heat wave altogether failed to cancel high school band camps last week. Munford High School’s assistant principal, Courtney Fee, calls their marching band Munford’s “pride and joy.” It’s easy to see why because over the last 10 years the MHS band has maintained state and national recognition in the USSBA State Championship. This year is shaping up to be a continuation of that trend. The new program begun during band camp is called “Revolution and Triumph.” The aim is to musically and visually portray the country’s successful independence through the Revolutionary War. “The program is an inspiring, patriotic story,” said band director Peter Colin. “I’m extremely excited about it.” Directors say that the music program has always sought ways to challenge themselves every year and this fall is no different. With band members climbing upwards of 190, it will be a big undertaking to meet their goal to stylistically strive to not only improve but to evolve and stay relevant. “The kids have been incredible during camp,” said Colin. “These students are the toughest to ever come through our program.” In addition, a team of parents have come through for the students during camp. They stationed themselves alongside of their daughters and sons with plenty of water and medical attention at hand for any student found in need. “The parents have been a really big help,” said Fee. “It’s with their help that the band is so successful.” Band directors Barry Trobaugh, Gary Fite and Peter Colin have goals in sight and hope to improve the students’ skill sets this year. “We want to make Munford proud,” said Colin. “We couldn’t do it without the community.”

While Munford aims to improve, likewise are the Covington High School band’s goals. The CHS marching band has looked to gain a further footing in yearly progress in preparation for this year. Katie Eaton is the band director at Covington High School and takes on a double load at Crestview Middle School, too. Their program for half-time performances is built around selections from the band Journey. The program includes songs many will remember like “Don’t Stop Believing” and “Separate Ways.” Eaton worked with the band last spring in early preparation for this year learning two Journey songs. Closer to the school year, the group has continued preparing ahead of time two weeks ago by having drum line camp a week before full band camp. “Everyone is a step ahead,” said Eaton. “We are far ahead this time of year than we were last year.” She has beat the heat by planning her band camp around the hottest part of the day. “We focused on drill and formations outside early in the morning,” said Eaton. “Then we held music rehearsal inside during midday. Towards the evening we went back outside.” Alongside learning the formation side of marching, Eaton coached the band in memorization. Her skills allow the band to make the best of both worlds. This is because Eaton is able to write her own marching formations. This ability results in Eaton knowing exactly how both footwork and music work together the best. Eaton scheduled a couple of events toward the end of the camp as well. On Thursday, the band held a special concert for parents to show how hard they worked and the progress they made. As a sort of finale, the CHS band traveled to Murfreesboro to attend Drums Corps International. Here, they saw the best of the best in the nation and sought ways to apply what they learned. All in all, it seems that it was a good experience. “I am very excited this year,” said Eaton. “The kids have such a positive energy. The band camp performance speaks wonders for how hard they worked.” So keep your eyes and ears open for Tipton County’s high school marching bands this year at sporting events.

(Top) The MHS brass section rushes to line up. (Second from top) The MHS marching band practices formations. (Second from bottom, left) BHS student Karah Spearman focuses intently on the drum majorʼs directions. (Second from bottom, right) Saxophonists take orders from BHS band director Findley. (Bottom) The CHS drum line nails down rhythm syncopations. Photos by Tyler Lindsey

Boyd gets buff for “Battle on the Bluff ” By TIFFANY HOLLAND tholland@covingtonleader.com At the “Battle on the Bluff” bodybuilding competition the announcer called James Boyd to come out in front of the audience and do his poses. With rock music blaring and lights shining, Boyd came out on stage, and the crowd of more than a thousand people went wild with cheers and screams. When he left the stage he could still hear the people cheering. This seems typical for most contestants in a bodybuilding competition, but it was not the usual for Boyd. Unlike many of the younger contestants, Boyd is a 69-year-old Brighton resident. Being the oldest man in the competition did not hurt his spirits at all, or his chances. Boyd ended up placing fifth in his division of men over 50. However, Boyd contends that he did not enter the competition with a goal to place, but did it just for himself. “I didn’t care if I won,“ said Boyd. “It’s about what you can do for yourself. As long as I walked out on stage once, I won.”

Entering a bodybuilding competition was not anywhere in his mind three years ago. After a visit with the doctor, Boyd found out he was overweight and suffered from high blood pressure. It was then he decided to change and headed to ATC Fitness Center in Brighton in 2007 and got on a health program. “When I went back to the doctor, he was shocked,” Boyd said, laughing. “He couldn’t believe I actually took his advice and followed through with it. I lost probably 20 or 30 pounds.” After keeping up with gym and staying in good health he happened to see a bodybuilding competition taking place in Tunica while he was at a business convention. One of the men in the competition was 60 years old. Boyd then realized he was capable of trying out the field. He headed back to his gym and got with his trainer, Finus Russell, who helped him get on board with bodybuilding. After many strenuous workouts and a lot of drive, Boyd decided to

enter his first bodybuilding competition – Chris Caudy’s “Battle on the Bluff” in Sam’s Town. There were 91 competitors in total and Boyd was placed in the Grand Master Division for men over 50 years of age. During the competition, each man must come out on stage and flex in eight specific poses. When his name was announced and he stepped on stage, Boyd was floored by the crowd response of cheering and applause. “I just thought I can’t believe this,” said Boyd. “The people went nuts. It was just a great feeling.” Boyd said he did this as a personal goal and that he was not scared, since he had made up his mind to do it a long time ago. Even though he was competing for himself, to Boyd’s surprise, he came in fifth place. “I really enjoyed it,” said Boyd. “You never know what you can do until you try it.” Boyd proves that this statement is definitely true at any age. And has the huge trophy on his desk to prove it.

James Boyd executes the “crab” pose during “Battle on the Bluff” at Samʼs Town. He placed fifth in the competition. Photo by T.R. Stewart

Have an interesting idea for a feature story? Come visit or call us at 476-7116.

B1.indd 1

8/4/10 11:10:22 AM


B2 • Thursday, August 5, 2010 • THE LEADER

www.covingtonleader.com

Crawford, Max exchange vows

William and Jackie Adair of Senatobia, Miss. and Larry Crawford of Murfreesboro are pleased to announce the recent marriage of their daughter, April Nicole Crawford, of Memphis, to Justin Max, of Memphis. Mr. Max is the son of David and Anita Max of Atoka. The wedding took place at Savannah Woods Plantation in Collierville on May 15 at 4 p.m. Wilson Wages officiated the ceremony. Miss Crawford was given in marriage by William Adair. The bride’s attire consisted of a champagne casablanca wedding gown with beadwork and embroidery on sleek satin with a sweetheart neckline. Her flowers were roses and calla lilies in shades from pinks to creams. The matron of honor was Ginger Taylor and bridesmaids were Anna Hawkins and Courtney Gryszko. Cadence Ogden served as the flower girl and Jacob Pugh was the ring bearer. Paul McGovern was the best man and Brandon Moore and Dylan Chapman were groomsmen. Jason Payne, Nick Givens and Brandon Avery served as ushers. The rehearsal dinner was given

TIPTON COUNTY’S

Most Wanted Seen one of these people? If so, call: 24-hour number: Central Dispatch 901-475-4300 Sheriff’s Office Tipline: 901-475-3307; email: sheriff@tiptonco.com Tipton County CrimeStoppers 901-476-4411 Or contact any local law enforcement agency to report any of these people.

The new Mr. and Mrs. Justin Max by the grooms parents, David and square cake. The bottom and top Anita Max, at The Butcher Shop tiers were yellow cake and the in Germantown. The reception middle tier was strawberry cake. was held at Savannah Woods The newlyweds traveled to St. Plantation following the cerLucia for their honeymoon. emony. The couple currently resides in The couple had a three-tiered, Memphis.

Akers, Jewell Edward Born: 06/23/1979 629 Tucker Street, Covington, TN 38019 Charge: Theft over $1,000

Goodwin, James Wallace Born: 01/01/1960 235 Washington Ave., Mason, TN 38049 Charge: DUI

Hatchel, Ricky Lee Born: 07/24/1987 16989 Highway 59 W., Drummonds, TN 38023 Charge: Aggravated Assault w/ Injury

Jones, Michael Born: 01/22/1965 2052 Tracy Rd. Memphis, TN 38116 Charge: Theft over $1,000

Jones, Octavius Santrail Born: 09/09/1979 290 English St. Jackson, TN 38305 Charge: Murder

Perkins, Navian Rashad Born: 06/19/1978 2572 Hawkins Mill Memphis, TN 38127 Charge: Forgery

Pinner, Casey Layne Born: 07/08/1978 61 Rogers Corner Rd. Atoka, TN 38004 Charge: Poss. Marijuana w/ Intent to Sell

Spray, Andrew John Born: 01/12/1984 1597 Porterville Rd. Atoka, TN 38004 Charge: Convicted Felon in poss. of firearm

Thomas Jr., Eddie Tyrone Born: 11/19/1988 735 Adkins Rd. Burlison, TN 38015 Charge: Burglary

Williams, James Dwayne Born: 05/06/1977 4633 Valley Stream Memphis, TN 38128 Charge: Failure to Appear

Leader columnist to host booksigning Local author and Leader columnist Otis Griffin has announced a book signing event in Millington for his new book Southern Raisin’. The public is invited to attend the event, which will be from 2-5 p.m. on Sunday, Aug. 15 at Patriot Bank, 8376 Highway 51 North. The book is currently available at Amazon.com and will be available for purchase at Patriot Bank in Millington the day of the book signing. Griffin has been writing stories and essays for almost 15 years. Many residents of West Tennessee are familiar with his column of the same name as the book, which is published weekly in The Leader, The Millington Star and The Bolivar Bulletin.

OTIS GRIFFIN

The column draws from Griffin’s memories of growing up and living in the rural South. “I just tell stories that people can relate to,” said Griffin. “Some

Shower honors Coffee, Shopher Bride-to-be Jennifer Coffee and fiance Stephen Shopher were honored with a wedding shower on Sunday, July 25. Family and friends attended the bridal shower given by Mrs. Ruth Ray and Mrs. Becky Stanley at the Stanley’s home in Rosemark. Jennifer and Stephen are students at The University of Tennessee at Martin and have set their wedding date for Sept. 18, 2010 in Covington.

Cocorans welcome third son Bill and Tracy Corcoran of Atoka are the proud parents of a son, Joseph Glen Corcoran. He was born July 12, 2020 at St. Francis Hospital in Bartlett and weighed eight pounds and 14 ounces. Proud brothers at home are Travis and Ian. Grandparents are Glen and Glenda Downing of Tipton, David and Gini Sanders of Atoka and Bill and Susan Corcoran of Munford. Great grandmothers are Mrs. Joseph Corcoran of Jacksonville, Fla. and Mrs. Elon Spellings of Memphis.

of my stories are humorous, some are nostalgic and some are sad, but they always tell the truth and people like that. I try to have something in each story that people can identify with.” The book is a compilation of 12 years of his columns. Unlike the column, the book, which runs 804 pages, will feature photographs with some of the stories. In addition to his writing, Griffin is very involved in charitable work for the Shriners Children’s Hospital and Griffin has tied his two projects together by pledging to donate one dollar from every book sold to benefit the hospital. With this effort, Griffin is giving back to the community he loves through his words and his deeds.

Do you know who killed Johnny Poole? Your information may be worth up to $1,000 in cash!

On Oct. 25, 1988, Johnny Poole's partially burned body was found in a pickup truck near the boat landing at Piljerk, near the Hatchie River in Tipton County. The 23-year-old Poole had also been shot in the back. If you have any information about this crime, call CRIME STOPPERS 901-476-4411 You will not have to give your name. You will not have to testify in court To be considered for a reward, all information must be given directly to CRIME STOPPERS OF TIPTON COUNTY

A service of:

THE LEADER Serving All of Tipton County

Tipton County Sheriff’s Office DO NOT ATTEMPT TO ARREST OR DETAIN ANY OF THE SUBJECTS OF THE WARRANTS LISTED IN THIS DATABASE. The list is current at the time of publishing and therefore recent changes in the status of warrants may not be reflected. It is possible that some warrants have been resolved and the matter is no longer pending. This information is being provided as a service to the public; however, neither the Tipton County Sheriff’s Office nor The Leader cannot guarantee nor assume any liability for the accuracy of the information at the time of use. All warrants must be verified for accuracy through our system prior to an apprehension. All persons charged are presumed innocent until proven guilty in a court of law. NO ATTEMPT SHOULD BE MADE TO APPREHEND THESE INDIVIDUALS EXCEPT BY LAW ENFORCEMENT OR PEACE OFFICERS. SOME INDIVIDUALSO MAY BE ARMED AND SHOULD BE CONSIDERED DANGEROUS. If you recognize a name on the list, if you find your name, or if you find a discrepancy, please contact the Tipton County Sheriff’s Office at 475-3300 or via email at sheriff@tiptonco.com.

B2.indd 1

8/4/10 11:32:35 AM


www.covingtonleader.com

Mt. Carmel

Elaine Watkins • 476-7093 It’s a hot Monday night. Stifling, in the 80s. I will be so glad when this heat wave ends and we’re out of the warning! And it rains again! Early voting is over and we had about 6,000 vote early in Tipton County, out of 33,000 registered voters. Thursday is going to be a long day! Beginning at 7 a.m. The “boys” have worked all day in this heat moving a fence for the widening of Highway 14. Paving is being done and it won’t be long before the stretch from Fast Times to Austin Peay Elemetary School is finished. Carter Coughlan, Jeff and Christie’s son, has been helping Clint get the combine ready, and also with the fences. We will miss him when school starts back! Liz went back to work today and Justin is keeping Lyla. She was really dreading going back, especially since they have fired four nurses on her shift and are now short-handed, not hiring any more because of the new building they will be moving into in September. It will be nice, though. But I know she is missing Lyla. Blanche Jordan Scott is having a booksigning for her book about her experiences with Elvis at the Davis-Kidd Booksellers on Perkins Extended on Saturday at 1. Delores Whaley and I want

to go and meet her. If you are an Elvis fan, go get one of her autographed books! Roy Randolph is recovering from surgery and Joyce Whaley has a few more tests. Erin Brown is home from China after eye treatments and she is supposed to improve during the next year. John Fletcher is doing well after a heart transplant and Hazel Mooneyham had surgery on her heart. Eric and Shirley Jones, Kenneth Mason, Bill Stimpson and Phyllis McIntosh are in our prayers, as well as so many others and all our servicemen and women. Mike and Bonita Rogers are going to Henderson tomorrow to help Justin and Ashli move into their new home. Justin will be our Wednesday Summer Series preacher on the 11th. Bonita is excited about seeing Ashli for the first time since she has been expecting. Their first grandchild is due in November! It was good to see everyone back safely from the whitewater rafting trip on Saturday. And to see Jeff Phillips back from his mission trip to Brazil. We heard about that and saw photos last night at church. Glad he had a safe trip. The ACTs group will have Movie Night at Jeff and Jennifer’s house on the 6th and will have the Devo at Covington Manor on the 8th. Happy Birthday this week

goes to Paulette Graham and Dale Laxton on Aug. 2, to Linda Gordon on the 3rd, to Ken Bringle and Meghan Laxton on the 4th, to J. J. Brown, Mary Joyce Coughlan and Carter Coughlan on the 6th and to Nicholas Bogle on the7th! Happy Anniversary to Barry and Kristie Maxwell on August 2nd! Sympathy is extended to Brandon Matlock on the death of his great-grandmother, 103year-old Malissa Matlock, and to Virginia Baxter on the death of her niece, Rebecca Ann Carter. These families have my prayers. Colby Turner, son of Richard and Kanet of Walla Walla, Washington, has been visiting the Jeff Phillips family for a couple of weeks and I’m sure is going back home soon for school, if he hasn’t left yet. It was good to see him; he has grown! We miss the Turner family! Well, the children go back to school for a half day on the 3rd. Fast summer! “Thanks for Reading” this week goes to Carolyn Orr! Sa-lute! This week’s Farmer’s Almanac Quote: “Green up! If possible, do errands during non-peak hours to avoid idling your car’s engine in heavy traffic.” Good idea! Stay cool! And I hope you voted! Until next week . . .

Bibb, Blakeman exchange vows Dr. and Mrs. William E. Bibb of Munford are pleased to announce the recent marriage of their daughter, Rachel W. Bibb of Munford, to D.W. Blakeman Jr. of Brighton. Mr. Blakeman is the son of Mr. and Mrs. Darrell W. Blakeman of Brighton. The wedding took place at Salem Associate Reformed Prebyterian Church in Atoka on Friday, July 11 at 6 p.m. The bride’s father, Dr. William E. Bibb, officiated the wedding and her brother, William “Eric” Bibb III, walked her down the aisle. The music was rendered by Serenading Strings from Memphis. The bride’s attire was a sequin, candlelight, off-the-shoulder gown with three flowers in her hair. Her earrings were created using the diamonds from her mother and grandmother’s engagement rings and was designed by Jezabel’s in Covington as her “something old.” The flowers were of bright colors and gerber daisies and hydrangeas from Hometown Flowers. The matron of honor was the bride’s mother, Sally Bibb. The best man was the groom’s father, Darrell Blakeman. The bride’s cousin, Emma Fletcher, was the flower girl, and the ring bearer was the groom’s nephew, Rowdy Franks. The groom’s cousins, Robert Hudson Blankenship and John Robert Shoaf, served as ushers. The rehearsal dinner was given by the groom’s parents at the Bald Butcher in Covington. The reception

Military Matters Army SPC Anthony A. Liddell has graduated from basic infantry training at Fort Benning, Columbus, Ga. During the nine weeks of training, the soldier received training in drill and ceremonies, weapons, map reading, tactics, military courtesy, military justice, physical fitness, first aid, and Army history, core values and traditions. Additional training included development of basic combat skills and battlefield operations and tactics, and experiencing use of various weapons and weapons defenses available to the infantry crewman. He is the son of Joan Liddell of Duncan Drive, Atoka, Tenn. Liddell received a bachelor's degree in 2006 from Amridge University, Montgomery, Ala.

Find us on Facebook! facebook.com/ covingtonleader

This space p is available! Call us to advertise at 476-7116 Mr. and Mrs. D.W. Blakeman was held at Covington Country Club. The couple had chocolate-filled, vanilla cupcakes and vanilla-filled, chocolate cupcakes done by Mandy Lynch. The groom’s cake was keylime pie tarts with “B’s” on each one. The newlyweds flew out of Nashville on June 18 and arrived in Exuma, Bahamas and spent 10 days at Sandal’s newest resort—Sandal’s Emerald Bay. The couple currently resides in Brighton.

Part-time Sales Position MUST have resume NO Phone Calls

S A L E S TA X

FREE WEEKEND

WHO MAY MAKE TAX-EXEMPT PURCHASES There is no requirement that purchases be made only for students. If an item is tax exempt, anyone may make the purchase tax-free. What Items are Tax-Free at Le Chic Boutique · Undergarments · Belts · Sweaters · Dresses · Coats · Jeans · Jackets · All Tops · Shoes · All Bottoms It’s a great time to start shopping for Fall.

NEW ARRIVALS! Have you heard? We have the NEW Spanx and Not Your Daughter’s Jeans too! www.lechic-boutique.com

August 6, 7, & 8 Mon-Fri 10am-6pm

Sat 10am-4pm

102 East Court Square • Covington, TN 38019 • 901.475.1530

Thursday, August 5, 2010 • THE LEADER • B3

Tipton County Commission on Aging events Free Delivery 1984 Rosemark Road, Ste. A • Atoka, TN • 840-1998 JUST FOR FUN Wacky Wednesdays - You never know what you will find at the Covington Senior Center on Wacky Wednesdays. On Aug. 11, we will hold Wacky Wednesday Wacky Games that are sure to bring a hardy laugh and some friendly competition. Wednesday, Aug. 18 is movie and popcorn day. Please join us that day for the hilarious movie, “Old Dogs”, starring John Travolta and Robin Williams. The last Wacky Wednesday, Aug. 25, we will play the ever popular, Wacky Bingo with fabulously wacky prizes. Don’t miss out on all the wacky fun and bring a friend. Creative Aging - THEY’RE BACK!! That wonderful trio of guys, known as the “Drivin Sideways Band”, will be jammin’ this month at the Covington Senior Center. The party gets started at 10 a.m. on Friday, Aug. 13. So put on your dancing shoes and join us for a morning of great entertainment. Wii Games - Get exercise and have fun playing your favorite games on our Wii. Join Kelly every Thursday at 9:30 a.m. in the CSC dining room. All skill levels are welcome and if you don’t know how, we’ll teach you! Gamepalooza - What a name! What fun! Gamepalooza is held every Friday afternoon at 1 p.m. in the downstairs meeting room. Participants are welcome to come out and join in the fun and games. Currently there are several that play Canasta, Rummikub, Scrabble and Bridge. You are sure to find your game of choice on this day or bring one of your choosing. Craft Club - Dena Ray and Roberta Trice do an awesome job with this club. The craft club meets this month on Monday, Aug. 9, 23 and 30 at 10 a.m. upstairs at the CSC. Everyone is welcome to join in and new ideas are always welcomed. Book Club - The TCCA Book Club holds a light discussion about various books or articles each month. Facilitator, Mrs. Charlene Mashburn is sure to bring a great read guaranteed to produce a hearty laugh for your soul. The club meets on the third Monday of the month at 10 a.m. at the CSC. August’s topic is American History. Bible Study - Bible Study is held at the CSC on Thursday mornings at 10 a.m. This non-denominational class is open to all and the facilitator is Mrs. Mary Carswell. Bending Needles Quilting Club - Have you seen the latest quilt being sewn by the club? The TCCA Quilters do a marvelous job with each quilt. All are welcome to join the club and no experience is necessary. The quilters meet each Tuesday and Thursday morning from 8-11 a.m. in the craft room. EDUCATIONAL 2010 Annual Conference - Tennessee Federation for the Aging and Tennessee Association of Senior Centers 2010 Annual Conference and Exhibition will be held in Murfreesboro from Tuesday Aug. 31-Sept. 2, 2010. Tuesday, Aug. 31 will be Senior Citizens Day at the Conference. A full day of FUN, FUN, FUN for the LOW, LOW, LOW price of just $30! The day trip to Murfreesboro includes sit down luncheon, Senior Day seminars, TFA membership and round trip transportation to the Conference. Call Kelly for more information or to register. Computer Classes - This introductory class is designed for new computer users. It starts with the most basic of skills, such as how to properly turn on and off the computer and using the mouse to get around. You will practice typing, write simple letters, use a spread sheet and go onto the internet. Class dates are Sept. 2, 9, 23, 30, Oct. 7, 21, 28 and Nov. 11, 17, 18 and the cost is just $20. That’s a great deal for $2 a class. Please call the TCCA office to make a reservation and schedule payment. Class size is limited so please make your reservation soon! TO YOUR HEALTH Health Screenings - The wonderful folks at Covington Manor will be at the CSC on Wednesday, Aug. 11 to perform various health screenings including blood pressure as well as blood sugar testing. They will begin testing promptly at 9 a.m. and will be here until everyone has been seen. On Wednesday, Aug. 18 at 9 a.m. Ms. Cindy from Baptist Home Health will take blood pressure

readings and Tuesday, Aug. 24 at 9 a.m. Ms. Roslyn from Dr. Potter’s office will do the same. TCCA has partnered with local healthcare providers to offer this service. The healthcare agencies volunteer for these clinics free of charge and occasionally they are called away to emergencies so please understand if/when they are unable to come. Clinics are also available at Garland and Munford Senior Centers. Mini Med School - Dr. Loren Crown, who has over 35 years experience in medical practice, teaching and administration, will be at the Covington Senior Center on Friday, Aug. 20 at 10 a.m. He will be discussing his upcoming “Mini Med School” for the general public. This course is being offered in the fall at Dyersburg State Covington Campus and is designed to improve your understanding of the human body and help you take charge of your own health. Please makes plans to attend this valuable and informative program. Get Fit, Stay Fit - Join Randy every Monday, Wednesday and Friday at 9:15 a.m. at the CSC for 45 minutes of great stretching and strengthening exercises. This is just right for everyone 55 and older. Tap Dance Class - Kay Catterton, our volunteer instructor always welcomes new students. The tap class meets on Wednesdays at 10:30 a.m. in the TCCA dance room. You are never too old to tap your way to a healthy heart. The cost is $20 for a 10 week session. Line Dance Class - Classes meet every Wednesday at 9:30 a.m. in the TCCA dance room and at the Munford Senior Center every Monday at 9 a.m. Contributions are welcomed at both sites. Mrs. Juanita Joyner is the instructor. These energetic ladies may be seen all around the area as they entertain at local nursing homes and senior centers. They are great ambassadors for TCCA! Water Aerobics - Water aerobics is easy on your joints but still gives your heart and major muscle groups a great work out! Each Wednesday morning a group of seniors travel to the Millington Y for water aerobics. The bus leaves the CSC promptly at 6:30 a.m. and the cost for ten sessions is $30. Currently, there’s room for more riders to attend. Please call the CSC for reservations and contributions for transportation are always appreciated. CAREGIVER PROGRAMS “Helen’s House” Adult Day/ Respite Service - Helen’s House currently has openings offering a great opportunity for those with some degree of memory loss or dementia to have a safe and therapeutic experience while their family caregivers enjoy a time for personal business or other activities. Helen’s House is licensed by the State of Tennessee. Helen’s House is open Monday, Wednesday and Friday from 8 a.m. to 3 p.m. Please call Anita for more information or to receive a registration packet. Caregiver Wellness/Support Groups meet across Tipton County… All shared information is confidential--- “what is said here, stays here”- Meal contributions are requested and transportation is available on a limited basis. Reservations for all meetings are appreciated. • South Tipton Caregiver Wellness Group- This group meets the first Tuesday of the month at Munford Presbyterian Church Fellowship Hall from 5:30-7 p.m. The facilitator is Mr. Neil Bell. • “…For Men Only” Caregiver Wellness Group - This group meet the second Monday of the month at TCCA meeting room from 5:30-7 p.m. The facilitator is Mr. Russell Lindsay. • Lunch Bunch Caregiver Wellness Group - This group meet the third Tuesday of the month at TCCA meeting room from 12:30-2 p.m.. The facilitator is Mrs. Darlene Hopper Spaulding. • TCCA Breast Health Wellness Group - Please join Sue Wheeler on the second Monday of the month at Covington Senior Center dining room from 5:30-7 p.m. • TCCA Grandparents/ Relatives as Parents Wellness Group - This is a support group for all relative parents that are facing life changes. This group meets at TCCA meeting room the second Thursday of the month from 5:30-7 p.m.. The facilitator is Mrs. Kathy Strahan.


B4 • Thursday, August 5, 2010 • THE LEADER

Atoka

Mashburn who celebrated two evenings, on Friday with friends and on his real birthday on Saturday with families. First Baptist Church of Atoka had revival this past week with Tom Ferrell bringing the services. And Sunday, August 8, Sunday School Fellowship at 9:30 a.m. bring a breakfast food to share. The Widows in Need club will meet at 6 p.m. on August 16. And speaking of birthdays, Tiffany Brantley,

Mabel Smith • 837-8017 Dear Readers, Carl Hartsfield had a lovely birthday gathering on Saturday. Two-hundred and ten folks were there to help him celebrate his 91st birthday. Special guests were his baby sister Wilma Hanks and her son and family. It was found that William Boyd was the oldest person there are 94 years. Another birthday celebration. There was William

www.covingtonleader.com Steve Hendrickson, Amy Fisher, Gordon Welch, Allen Fisher, Ken Billings, Christy Hight, Lindsey Wilson, Brice Fite, Wayne Buller, Paul Billings, Cole Cousar, Vivian Vance, Robert Vance Jr., Sarah Rowland, Monte Conway, Rose Nichols, Eva Waters, Annie Bramble. Our prayer list: Rodney Waits, Brice Fite, Carolyn Max, Pat Lloyd, Billy Lumpkin, Bill Stimpson, Hunter Box, Boyd Gorham, Martha Eskridge, Gordon Roberts, David Mashburn, Carolyn Murphy, Jenni Cacy, Dean

Amanda Kitchens, Eddy Glover, Alyssia Chapman, Sandra Ralph, Vickie Hughes, Charles Walker, Andy Billings, Allen Williamson, J.J. Brown, Jimmy Lloyd McKee, Randy Cousar, Dee Alsbrook, Sherry Lynn Pinner, Eric Bibb, Pat Prater, Autumn Cooper, Mabel Smith, Beverly Smith, Jo Billings, Ora Lee White, Taylor Martin, Wanda Moody, Cecil Starnes, Christopher Starnes, Mary Hill, Glenn Starnes, Sandy Henry, Tommy Carocci, Jimmy Wilson, Michael Patrick,

Almyra

Hi everyone, Hope Libby Click this heat index will soon be history. I can still remember as a child playing outside with sweat all over me and never giving it a second thought about stopping whatever we were doing and going in. In the city of Memphis, all the neighborhood kids played out until dark, then inside for supper and back outsdie for a game called “hide-and-seek.” The older I get those “old” memories are clearer than yesterdays. Speaking of Memphis, this week marks the 70th anniversary of our dear old Elvis. I’m sure the Graceland area will be swamped. That brings forth another opportunity for me to mention Blanch Jordan Scott’s book signing scheduled for this Saturday at the Davis-Kidd bookstore at Poplar and Perkins at 1 p.m. Mrs. Blanch’s book in entitled Elvis: A Boy From Tupelo to a Man From Memphis. It’s a terrific story and a book with many wonderful pictures. Thanks Blanch, I love mine. This week I was able to start eating regular food again, following my dental instructions of soft food for two weeks. The things we take for granted. We have another grandchild’s birthday this week. Miss Hannah Grace Quinn will be 14 years old this Saturday. Happy birthday, Hannah! We love you and hope it is the greatest! Clopton Fun-fest is just around the corner. The date is Saturday, Septem-

ber 4 from 10 a.m.-8 p.m. The address is 5285 Brighton-Clopton Rd. in Brighton. Hope to see you there. There will be music, several bands, concession stand, and children’s activities. Booth rentals available. For booth information you may contact Joelle May at 409-7323. Salem Presbyterian Church Worship is at 11 a.m. Each Sunday morning. Rev. Charles Todd is the minister. Everyone is always welcome. Women’s bible study will be tonight, August 5 at the church building at 7 p.m. Birthday wishes this week go to many. We will start with Michael Arney, Marianne Miller, Gerald McDaniel, Stephen Miller, Maker Osbourn, Helen Lucado and Austin Waits. Hope they are each the greatest! Sharon Presbyterian Church Worship is at 9 a.m. each Sunday morning. Rev. Charles Todd is our minister. Everyone is always welcome. We are always grateful for our Dunlap residents who are able to be with us. Happy birthday this week to Juanita Waits. Hope it is the greatest! Covington Church of Christ Worship is at 10:30 a.m. each Sunday morning and again at 5:30 Sunday afternoon. Bible study is at 9:30 a.m. Sunday mornings and again at 7 p.m. on Wednesday evenings. Brother Mike Rogers is our minister. Brother Jeff Philips is our associate minister. Everyone is always welcome. We have several on our sick and prayer list at this time. Brother Roy Randolph had surgery this week so please remember him. Erin Brown, granddaughter of

Frank and Marlene Brown, returned from China, after going through an eye procedure which has enabled her to be able to see a little better for the first time in her life. It will still take a long time for a massive improvement. Our prayers are with you all. Happy birthday this week goes to Paulette Graham, Dale Laxton, Kinda Gordon, Ken Bringle, Meghan Laxton, J.J. Brown, Mary Joyce Coughlan, Carter Coughlan and Nicholas Bogle. Hope they are each the greatest! Happy anniversary to Barry and Kristie Maxwell! Hope it is the greatest! We extend our sympathy to Virginia Baxter in the death of her niece, Rebecca Ann Carter and to Brandon Matlock in the death of his great-grandmother, Melissa Matlock. In closing, we are so excited about my daughter Terri Ann Barber and her family returning home, or back to Tipton County this week. I want to know what to do with bother my girls being together again for the first time in years. Also Charlie’s cousin Carolyn Ramage had her son Keith and two grandsons, Samuel and Kevin, visiting here this week. They are from Spain. Ours are all so close, I can’t imagine how quickly time must go when your time is limited. Another neighbor Thornton and Patsy Fee had their son Kirk and two Grandsons Alex and Baxter visiting this week as well. Their home is Bowling Green, Ken. I’m sure they have all made some wonderful memories. Have a great week everyone.

Dunlap

in June again because of the heat, so I waited till August and look what I got, HOT!! Oh well, at least it’s not freezing cold, right! So our yard sale is this Friday and Saturday, here at Dunlap Retirement Center. It will begin at 9:00 and will go till dark more than likely, if I don’t drop with a heat stroke by then anyway! Ha! Last year when I had it, it was in the three digits just like this

year! But last year those were the only three days of the year that we had three digit temps! Go figure, now here we are this year with it planned and it’s the same thing, oh well, God is good!!! Please come on over and have a good time with us. We’re even going to have a lady come and set up a little thing that you can get drinks and some

Kathy Keiter•476-7014 Hello everyone! Hope you’re all doing great and staying cool! With some of the hottest days of the summer coming up I’m already dreading this weekend! Yes this weekend is our annual “yard Sale”!!!! Oh my goodness, I said last year I was not going to do it

• Decks • Arbors • Fences For Free Estimates

901-246-2802 Call Richard

10620 Highway 51 S., Ste 5 Atoka ( Next to Hometown Realty)

901-837-4743

Monograming, Embroidery, Gift Items Sewing Supplies, Vinyl Art Tues. - Thurs. 10 a.m. - 6 p.m. Fri. 10 a.m. - 5 p.m. • Sat. 10 a.m. - 3 p.m. amazingthreads2sew@aol.com

Allergy testing coming soon! Tel: (901) 476-9115s&AX  

1, 2 & 3 Bedrooms Available!

475-3475

ry Hur hey’re re t befoall gone

Prices Include Cable Tv And Water

Greg T. Williams

102 W Liberty Ave • Covington, TN 38019 901-476-7138 • Cell - 901-734-6363

Securities are offered through LPL FINANCIAL, Member FINRA/SIPC

Price excludes court cost and filing fees

1003 S. College St. Covington, TN 38019 901.475.0805 Fax 901.475.4068 covingtondental@gmail.com

$399.95 Now Installing SEAMLESS GUTTERS Call for a free estimate 901-483-6257 901-476-5263

24 COLORS TO CHOOSE FROM LISCENSED AND INSURED 37 YEARS EXPERIENCE LOCALLY OWNED

R.L. Jackson, MBA, CFP® LPL Registered Principal ® Chartered Financial Analyst

•Retirement Planning • Qualified Plans

475-0102

Under New Management

Securities offered

•Individual Insurance • Investment Products

107 W. Pleasant (on the square)

Located next to Covington High School

www.lpl.com/richard.jackson

Investment Management

Jobi Teague Attorney

Dentistry for Children & Adults

901-761-4442

McBride Stitt & Williams

$350 without children $450 with children

Michelle Woodward, D.D.S

Affordable Luxury Living

Jackson Investment Management

through LPL Financial Member FINRA/SIPC

UNCONTESTED DIVORCE

Open Weekends By Appointment Only!

SUNRISE APARTMENTS

GUY V. TEACH, MD Internal Medicine “Specializing in adult care” Habla Español Office Hours: Monday-Friday 8am-5pm 1995 hwy 51 S, ste 206 Covington, Tennessee 38019

Novac, David Kemp. And we have dinner and study each Wednesday night at 6 p.m. Come and join us at Quisenberry Hall.

CONTINUED ON PAGE B9

Guaranteed Lowest Prices

Amazing Threads 2 Sew

Glidewell, Pam Hill Bundy, Tony Bennett, Courtney Shaefer, John Fletcher, Dave Barnett, Katie Burke, Arthur McElyn, Robert Wayne McMillen, Laura Peel, Bill Peele, Phyllis McIntosh, Colin Alley, Ron Miller, Lisa Tennyson, Kay Regis, Teresa Connell, Willie Harden, Sylvia McBride, Courtney Hendley, Karen Ellen, Clyde Currie, Ben Pylant, Bill Parker, Doug Carter, Amy

Turning Wrenches 207 Hwy. 51 South • Covington, TN 38019

(901)476-4002 • Full auto repair (minor/major) • Complete paint/body shop • Towing/recovery service (24 hours) • Mobile unlocking (24 hours)

Owners Wayne Caviness (901) 356-1274

Daniel Rogers (901)351-3492

TOXIC MOLD TESTING WHOLE HOUSE SPECIAL (2 Air Samples & Moisture Test)

Call Today 901-233-3603


www.covingtonleader.com Omni Visions. Free classes ming now. Find out about our and monthly financial per 731-293-5351 or visit mnivisions.com today. y

51 Pawn Shop buys scrap gold. Necklaces, bracelets, rings, earrings - We buy guns too!!! 837-2274.

purchase a new mobile home between now and July 09? Come in and make your purchase and let us help you. DICK MOORE INC. 901873-4663 or 1-800-745-0928.

Thursday, August 5, 2010 â&#x20AC;˘ THE LEADER â&#x20AC;˘ B5

lease, excellent references required.

NEW APA P RTMENTS for rent on the court square. 1BR. $700/MO plus deposit.. 901-476-4505.

paint and new c 9664 Holly Grove R qualified buyers. ton County, y ne $115,000.9327 Riv by Forrest area. 3B Real Estate Mart,

I BUY JUNK CARS. DON'T MESS TWO-AND-THREE-BEDROOM WITH THE REST CALL SAM. 901FREE..... 3 USED MOBILE HOMES WANTED DISTRIBUTORS W for T wnhomes in Brighton. Excellent To 1IPOFr'BYr$IFDLVTPVUPOMJOFXXXDPWJOHUPOMFBEFSDPNGPSDMBTTJÄ&#x2018;FEMJTUJOHTBOENPSF 351-8025. 901-873-4663 or 1-800-745-0928. and fun home business $30 h l C ll 901 476 8000 901 AFFORDABLE LAWN CARE, APARTMENTS FOR RENT 901 117 PROFESSIONAL FREE ESTIMATES. CONTACT JOSHUA POSEY AT 901-517Welder Fabricator minimum 3 yr TWO-AND-THREE-BEDROOM 6069 OR KYLE PILKINGTON experience & ability to work from Townhomes in Brighton. ExcelAT 901-848-4703 drawings. Welding & fitting test lent schools. Call 901-476-8000 107 DRIVERS will be given. Competitive pay & DOES YOUR HOUSE NEED A or 901-201-0956. benefits. Apply at Rose Machine FACE LIFT? Let us Help !! Qual902 & Tool, Covington, TN. 901-476- ity Painting & Home Repair. For HOMES FOR RENT 2202. Clean & Speedy Results. FREE ESTIMATES. Call Greg @ 901- 2 BR 1 BA HOUSE, COVING122 277- 9295 No answer, Leave TON C/H/A Stove Rent $525 Childcare No experience? Dep $500 476-8894 Message No problem! CHILDCARE AVAILABLE F/T MR. MOBILE, I COME TO 3 BR 1 BA HOUSE $800 RENT P/T and after school. References 5716 Bride Rd. 14-Day YOU!! Oil changes, Brakes, Mi- $700 DEP available. Located 2 Miles from local training in Jackson, TN nor tune-ups, and More. Call Covington 901-603-6674 Austin Peay Elem. Two openings. 901-201-9287. 3 BR 1 BA $550/MN $550/DEP Great pay * Benefits Great rates. Call Heather 590Job security 109 Tatlock 59 West. Tracy, 9283 for info. Student tuition loans available 485-8299 CHILDCARE IN MY MUNFORD NOTICE OF PUBLIC REVIEW Placement assistance. 3 BR 2 BA $700 MN $700 DEP The Tennessee Department of Transportation (TDOT) announces the beginning of a 30-day Christian home M - F 6a.m. Call 1-800-423-8820 review and comment period on its 2011-2014 State Transportation Improvement Program Please Call 731-738-5858 6p.m. meals and snacks includwww.drive-train.org (STIP). The STIP establishes projects for major construction and Public Transit over the References required Nine miles ed 20 yrs experience 837-2801, for training opportunity with four-year period, which will utilize available and projected Federal funds. The review North of Covington 389-7072

EMPLOYMENT

DRIVING FOR A CAREER?

with the

CLASSIFIEDS To Place Your Ad Call 476-7116

REAL ESTATE

DRIVE-TRAIN

119 E. L. Morgan Drive, Jackson, TN 38305

GREAT HOME TIME, ACT FAST! U.S. Xpress is now hiring for an expanding dedicated account. â&#x20AC;˘ Dedicated Account â&#x20AC;˘ Drop and Hook Freight â&#x20AC;˘ Home every other weekend â&#x20AC;˘ Great pay and benefits Requires CDL A and 3 months OTR experience. Donâ&#x20AC;&#x2122;t miss out. Call today!

HOUSE KEEPING 11 YEARS experience. Honest and Dependable weekly biweekly references available. Karyn 901262-6449

3 BR, 1 BA HOME ON 1 ACRE. Private lot, newly painted on Kelly Chapel Rd. in Burlison. No Pets $550 rent, $500 dep. 4762892.

PETS & LIVESTOCK

4 BR 1 BA, SHOP $1000 RENT $1000 DEP Section 8 OK 2990027 4 BR HOUSE NEAR COVINGTON C/H/A $625 MN, 1 BR Duplex in Covington No Pets $395 MN 476-5547

DOGS, CATS & SUPPLIES 201 Westenn Livestock Supply 843 East Street (Next to Wallâ&#x20AC;&#x2122;s Body Shop) BlackGold, Diamond, Purnia, ADM, Nutrena Feed Available Gates, Panels, Fencing Supplies

Duplexes: 2 BR $500 mo., 3 BR $600 mo. No Pets. Call 837-6159 or 553-3857.

901-476-4419

866-475-3621

www.usxjobs.com

MOBILE HOMES FOR RENT 903 2BR 1 BA APPLIANCES FURNISHED yard kept No Pets $400MN $200 DEP Call 4767716

2, 8 MONTH OLD PART JACK RUSSELL TERRIER PUPPIES FREE TO GOOD HOME. BOTH ARE MALES. 901-605-2766

3 BR AND 2 BR MOBILE HOMES. Smithville Trailer Park 901-476-2947

Driver

DEDICATED REGIONAL ROUND TRIP RUNS: SAREPTA, LA TO ST. LOUIS, MO G.D. Leasing of IN is hiringfor Falcon Transport. â&#x20AC;˘ Dedicated Pay â&#x20AC;˘ Consistent Home Time â&#x20AC;˘ CDL-A required; 21yoa â&#x20AC;˘ Must have 6 moâ&#x20AC;&#x2122;s exp. â&#x20AC;˘ Paid Holidays â&#x20AC;˘ 401K options and more! Call Ted 866-543-3735 or apply online at www.falcontransport.com DRIVERS - CDL-A SIGN-ON Bonus PAID at orientation! Teams make .46 up to .82cpm split! O/Oâ&#x20AC;&#x2122;s make Top Industry Pay! Call R&R Trucking Today! 866-204-8006 DRIVERS: CRST NEEDS YOU! IMMEDIATE opportunities! No CDL, No problem! CDL Training available. Great Benefits & Start earning $750-800/wk! Call Today! 1-800-820-4521 DRIVERS: OTR NEEDED! Get More Miles! $.35 cpm w/2yrs Exp. Home most weekends, Full Benefits! Randy: 888-557-2206 www.hammontransportationinc. com

MEDICAL/HEALTHCARE

115

GARAGE SALES SALE Fri. & Sat. 8am-3pm Jeans $1, Tops 50¢ & up, Furniture & Baby Clothes 254 Ray Lane take Hwy 54 E. to Ray Lane, turn go 1/4 mile, watch for signs 192 AL ST. ATOKA, FRIDAY 7-? Menâ&#x20AC;&#x2122;s and kids clothes, furniture, toys, misc. and UT stuff. 5152 HWY 59 S. COVINGTON, SAT. Aug. 7 Cleaning out attic, boats, trailers, hunting & fishing, 200 Chevy Silverado, house hold, clothes, & lots of misc. AUG 7 AT THE RITZ THEATER IN Covington. Office furniture and household goods 7a.m. - 2 p.m. BRIGHTON ASSEMBLY OF GOD Friday and Saturday 7-2 INSIDE Sausage Biscuits, Breakfast Hot dogs, lunch WE MOVED SALE SAT. 7-4 387 Miss Helen Circle, Brighton Clothes, utility trailer, pictures, misc YARD SALE FRIDAY & SATURDAY 541 Stafford Rd. Behind Dunlap Retirement Center.

MISCELLANEOUS

320

LARGE ANTIQUE GERMAN OAK china cabinet & bar, 16 1/2 ft. 90 HP boat & more 356-3612

WANTED TO BUY

328

Wanted!

GOLD & SILVER

RNâ&#x20AC;&#x2122;s & LPNâ&#x20AC;&#x2122;s LOOKING FOR A CHANGE? NEED STABILITY? IMMEDIATE OPENINGS â&#x20AC;˘Shift Pay Differential â&#x20AC;˘Flex Schedule â&#x20AC;˘No Call Off â&#x20AC;˘Competitive Salary â&#x20AC;˘State Paid Retirement â&#x20AC;˘Paid Vacation/Sick Time â&#x20AC;˘Medical BeneĂ&#x20AC;ts â&#x20AC;˘Educational BeneĂ&#x20AC;ts â&#x20AC;˘Safe/Secure Environment West Tennessee State Penitentiary Henning, TN Call 731-738-5044 ext. 2227 for info EXPERIENCED Medical Assistant needed for Primary Care Clinic in Covington, Send resume P.O. Box 1062 Covington Tn. 38019 RNâ&#x20AC;&#x2122;S & LPNâ&#x20AC;&#x2122;S NEEDED FOR Weekdays & weekends immediately. Please call Nelda at 731660-6493 or go online w w w . tennesseepersonalassistance.or g

Think Small Think

Classified

Top Dollar Paid Jezabelâ&#x20AC;&#x2122;s 476-5206 Open Mon. - Fri. 10-5 Sat. 10-4

I BUY JUNK CARS FREE PICK UP CALL SAM 351-8025 51 Pawn Shop buys scrap gold. Necklaces, bracelets, rings, earrings - We buy guns too!!! 8372274.

INSTRUCTION PIANO LESSONS: Sign up now for fall piano lessons. $12 / lesson 476-0842

PROFESSIONAL Handy Sisters Services: Will clean yards, flower beds, garages, sheds and attics, also do painting, wallpapering and interior decorating. Free estimates, commercial and residential. Sherry Koonce 901-476-1595 or Pam Rogers 901-837-0967, cell: 901-848-5092

DOES YOUR YARD NEED WORK? Need a handy man? Just too HOT!! Let me do your work. Reasonable Rates, FREE Estimates! Call Jim @ 901-8320227. No answer leave message.

period is to provide citizens, affected public agencies, employees of transportation agencies, various stakeholder groups and other interested parties a reasonable opportunity to comment on the STIP. The STIP will be available in hard copy for review at TDOTâ&#x20AC;&#x2122;s four Regional OfÂżces during normal business hours, Monday-Friday, through September 5, 2010. The locations are as follows: Region 1: 7345 Region Lane, Knoxville, TN 37914, (865) 594-2400; Region 2: 4005 Cromwell Road, Chattanooga, TN 37421, (423) 892-3430; Region 3: 6601 Centennial Blvd., Nashville, TN 37243, (615) 350-4300; Region 4: 300 Benchmark Place, Jackson, TN 38301, (731) 935-0100. It can also be accessed by going to TDOTâ&#x20AC;&#x2122;s home page at www.tn.gov/tdot. Written comments may be submitted at any time during the comment period to: Mr. Jim Moore, Transportation Director, Suite 600, James K. Polk Bldg, 505 Deaderick Street, Nashville, TN 37243-0341, (615) 741-3301, www. TDOT.Comments@tn.gov. In addition, appropriate TDOT staff will be available at the Regional OfÂżces to answer questions and accept comments on the following dates: Region 1: Tuesday, August 17, 2010, 2:00 â&#x20AC;&#x201C; 5:00 p.m. EDT; Region 2: Monday, August 16, 2010, 2:00 â&#x20AC;&#x201C; 5:00 p.m. EDT; Region 3: Tuesday, August 24, 2010, 2:00 â&#x20AC;&#x201C; 5:00 p.m. CDT; Region 4: Thursday, August 12, 2010, 2:00 â&#x20AC;&#x201C; 5:00 p.m. CDT. TDOT will respond to all comments. The Tennessee Department of Transportation is an Equal Opportunity Employer and does not discriminate on the basis of race, age, sex, religion, color, disability or national origin.

ARE YOU LOOKING FOR A MANUFACTURED HOME? CHECK US OUT BEFORE YOU BUY. EASY LIVING HOMES LLC. <3WAY> HUMBOLDT, TN 731-784-5033

MH FOR RENT 2 BR 2 FULL BATH water & sewage paid No pets no children $500 dep $400 MN 8377544 MOBILE HOME LOT ON KELLY CHAPEL RD. Very Private. 4762892.

ROOMMATES

905

PRIVATE ROOM in Grandmothers home. Safe country area $75 a week. Less for help. 8355868

NEW 5BD 3BA DBLWIDE, DEL CONDOMINIUMS/TOWNHOUSES 907 SET AND A/C WOW 2BR, 1.5BA. Townhouse apart$64995! 100% ments, Covington. w/BR upstairs. $575/MO, $575/Deposit. FINANCING WITH A No Pets. 331-9668. CLEAR DEED WAC. 954 EASY LIVING HOMES L TRAILERS <3WAY> HUMBOLDT, Wholesale Trailers, LLC TN 731-784-5033 Farm Land: Sale, Rent or Wanted 703 14 ACRE PASTURE W/BARN IN BRIGHTON 901-476-9417

LOTS & ACREAGE

705

BEAUTIFUL WOODED BUILDING Site in Tipton County 5.13 acres. Located in Drummonds/ Munford school district for homes or DW mobile home. 901-3317114 or 901-837-0899 FOR SALE 10 ACRES Completely fenced 4 wires. Elan Grove Rd. Burlison, $60,000 OBO 476-6498.

COMMERCIAL & INDUSTRIAL COMM./INDUST. PROPERTY FOR RENT 802 COMMERCIAL BUILDING FOR RENT in Brighton. Perfect for daycare... Call Laurie McClerkin with C21 Property Place at 4932278 COMMERCIAL BUILDING, 1027 Hwy 51 N. 451-2476 GREAT LOC. APPROX. 1200 SQ. FT. Store, 619 Hwy 51 So. Covington. 1st Mo. rent free. Call 901-361-4369 PILKINGTON PROPERTIES Commercial Building for rent 650 Hwy 51 S. Covington, $600 MN $400 deposit 484-2770

REAL ESTATE RENT

(731) 668-1147 .EW'OOSE.ECKs!LL3IZESs%QUIPMENT4RAILERS *ACKSON 4ENNESSEEs#ELL   X

Ingram Micro in Millington is looking for experienced maintenance technicians to repair, maintain, and troubleshoot all types of powered and non-powered conveyors, forklifts, electrical/electronic systems, and other maintenance and operation of utility, facility and operational equipment.. Minimum Requirements: High School graduate, GED. Vocational school certificate a plus. One year experience in industrial maintenance. Skilled in several of the following disciplines: Welding Electric Hydraulic Pneumatic

Forklift Maintenance & Repair HVAC Plumbing

This is not exhaustive of all duties and responsibilities. Must be willing to operate machinery to include forklifts, maintenance tools, and test equipment. Must be willing to work any schedule and overtime as required. PLC, VFDâ&#x20AC;&#x2122;s, Servo, and Automation Control experience a plus. Ingram Micro views diversity as one of our primary competitive advantages. Ingram Micro is an equal opportunity employer. M/F/D/V. Please fax resumes to Human Resources, 901-873-8880.

Quality Manager Mid Continent Nail Corporation, located in Poplar Bluff, Missouri, is seeking candidates qualified to manage all aspects of quality within the company. The successful candidate will have extensive quality management experience in a manufacturing environment. Experience in the fastener industry would be a definite plus. Duties will include but are not limited to - inspecting and verifying the quality of inbound raw materials and outbound finished product; communicating quality procedures; and working directly with customers and suppliers. Excellent verbal and written communications skills and good computer skills are necessary. We offer competitive wages and benefits, including group health insurance, paid vacation/holidays, a 401(k) plan, etc. Qualified candidates should send a confidential resume to â&#x20AC;&#x201C; Mid Continent Nail Corporation ATTN: Director of Human Resources 2700 Central Avenue Poplar Bluff, MO 63901 dcreg@magnumfasteners.com We are an Equal Opportunity Employer


B6 • Thursday, August 5, 2010 • THE LEADER

www.covingtonleader.com

Public Notices SUBSTITUTE TRUSTEE’S SALE WHEREAS, default having been made in the payment of the debts and obligations secured to be paid by that certain Deed of Trust executed on August 5, 2002, by William Cooper and Norma Cooper to Equity Title, Trustee, as same appears of record in the Register’s Office of Tipton County, Tennessee, under Book 1019, Page 539, (“Deed of Trust”); and WHEREAS, the beneficial interest of said Deed of Trust was last transferred and assigned to Bank of America, National Association as successor by merger to LaSalle Bank National Association, as Trustee for the C-BASS Mortgage Loan Asset-Backed Certificates, Series 2007-SP2; and WHEREAS, Bank of America, National Association as successor by merger to LaSalle Bank National Association, as Trustee for the C-BASS Mortgage Loan Asset-Backed Certificates, Series 2007-SP2, the current owner and holder of said Deed of Trust, (the “Owner and Holder”), appointed the undersigned, Nationwide Trustee Services, Inc., as Substitute Trustee by instrument filed for record in the Register’s Office of Tipton County, Tennessee, with all the rights, powers and privileges of the original Trustee named in said Deed of Trust; and NOW, THEREFORE, notice is hereby given that the entire indebtedness has been declared due and payable as provided in said Deed of Trust by the Owner and Holder, and that the undersigned, Nationwide Trustee Services, Inc., Substitute Trustee, or his duly appointed attorneys or agents, by virtue of the power and authority vested in him, will on Thursday, August 19, 2010, commencing at 10:00 AM at the North Door of the Tipton County Courthouse, Covington, Tennessee, proceed to sell at public outcry to the highest and best bidder for cash, the following described property situated in Tipton County, Tennessee, to wit: Land situated in Tipton County Tennessee to with: Tract I: 1384 Indian Creek Beginning at a stake the Northeast corner of Thomas Faught’s 1.35 acre tract in E.W. Yarbro’s South line; thence South 29 3/4 West 485 feet to a stake the Southeast corner of the 1.98 acre tract in the center of the Brighton and Holly Grove Blacktop Road; thence with the same South 60 1/2 East 140 feet to a stake the Southeast corner of Thomas Faught’s 4.18 acre tract: thence North 32 1/4 East 247 feet to a stake; thence north 14 3/4 East 200 feet to a stake the Northeast corner of Thomas Faught’s 4.18 acre tract in E. W. Yarbro’s South line: thence north 84 3/4 West 109 feet to the beginning containing 1.66 acres Tract II: 1400 Indian Creek Beginning at a stake the Northeast corner of a 1.21 acre lot in the name of Thomas Faught in E. W. Yarbro’s South line; thence South 10 1/2 West 284 feet to a stake in the center of the Brighton and Holly Grove Blacktop Road the Southeast corner of the 1.21 acre tract; thence with said road South 50 1/2 East 137.5 feet to a stake; thence north 26 East 376 feet to a stake in E.W. Yarbro’s South line; thence North 84 3/4 west 175 feet to the beginning, containing 1.17 acres. Beginning at a stake the Northeast corner of Thomas Faught’s 1.17 acre tract in E.W. Yarbro’s South line; thence South 26 West 376 feet to a stake, the Southeast corner of the 1.17 acre tract in the center of the Brighton and Holly Grove Blacktop Road; thence with the same South 50 1/2 East 137.5 feet to a stake in same; thence North 29 3/4 East 488 feet to a stake in E.W. Yarbro’s South line; thence North 84 3/4 west 175 feet to the beginning, containing 1.35 acres. There is excepted out of the above all that part occupied by the Brighton & Holly Grove Blacktop Road as its right-of-way. Vernon L Lancaster and wife Joyce conveyed to Joe L. Jenkins August 30, 1976 recorded August 31, 1976 at Book 392, Page 60, in the Tipton County Register’s Office. (Tract 1) Thomas N. Faught and wife Juanita Faught conveyed to Joe L. Jenkins March 30, 1973 and recorded April 8, 1973, at Book 343, Page 89, in the Tipton County Register’s Office. (Tract 2) Also being the same property conveyed to grantors William Cooper and Norma Cooper by warranty deed being recorded simultaneously herewith in said Register’s Office PROPERTY ADDRESS: 1384 Indian Creek Road, Brighton, TN 38011 CURRENT OWNER(S): William Cooper and Norma Cooper The sale of the above-described property shall be subject to all matters shown on any recorded plan; any unpaid taxes; any restrictive covenants, easements or set-back lines that may be applicable; any prior liens or encumbrances as well as any priority created by a fixture filing; and any matter that an accurate survey of the premises might disclose. SUBORDINATE LIENHOLDERS: Joe L. Jenkins OTHER INTERESTED PARTIES: N/A All right and equity of redemption, statutory or otherwise, homestead, and dower are expressly waived in said Deed of Trust, and the title is believed to be good, but the undersigned will sell and convey only as Substitute Trustee. The right is reserved to adjourn the day of the sale to another day, time, and place certain without further publica-

tion, upon announcement at the time and place for the sale set forth above. THIS IS AN ATTEMPT TO COLLECT A DEBT. ANY INFORMATION OBTAINED WILL BE USED FOR THAT PURPOSE. Nationwide Trustee Services, Inc., Substitute Trustee c/o PP Nationwide Trustee Services, Inc. 1587 Northeast Expressway Atlanta, GA 30329 (770) 234-9181 (ext. ) File No.: 416.1003684TN Web Site: www.jflegal.com Insertion Dates: 07/22/10, 07/29/10, 08/05/10

SUBSTITUTE TRUSTEE’S SALE WHEREAS, default having been made in the payment of the debts and obligations secured to be paid by that certain Deed of Trust executed on October 26, 2006, by Lynnda J. Robbins and Gillie W. Robbins to Lenders Title And Escrow, Trustee, as same appears of record in the Register’s Office of Tipton County, Tennessee, under Book 1310, Page 173, (“Deed of Trust”); and WHEREAS, the beneficial interest of said Deed of Trust was last transferred and assigned to Bank of America, National Association as successor by merger to LaSalle Bank National Association, as Trustee under the Pooling ans Servicing Agreement dated as of February 1, 2007, GSAMP Trust 2007-HE1; and WHEREAS, Bank of America, National Association as successor by merger to LaSalle Bank National Association, as Trustee under the Pooling and Servicing Agreement dated as of February 1, 2007, GSAMP Trust 2007-HE1, the current owner and holder of said Deed of Trust, (the “Owner and Holder”), appointed the undersigned, Nationwide Trustee Services, Inc., as Substitute Trustee by instrument filed for record in the Register’s Office of Tipton County, Tennessee, with all the rights, powers and privileges of the original Trustee named in said Deed of Trust; and NOW, THEREFORE, notice is hereby given that the entire indebtedness has been declared due and payable as provided in said Deed of Trust by the Owner and Holder, and that the undersigned, Nationwide Trustee Services, Inc., Substitute Trustee, or his duly appointed attorneys or agents, by virtue of the power and authority vested in him, will on Thursday, August 19, 2010, commencing at 12:00 PM at the North Door of the Tipton County Courthouse, Covington, Tennessee, proceed to sell at public outcry to the highest and best bidder for cash, the following described property situated in Tipton County, Tennessee, to wit: Lot 52, Section B, Squire’s Grove Subdivision, as shown on plat of record in Plat Cabinet D, Slide 28, in the Register’s Office of Tipton County, Tennessee, to which plat reference is hereby made for a more particular description of said lot. Being the same property conveyed to Lynnda J. Robbins and Gillie W. Robbins from Joshua I. Simmons and Sara Beth Simmons by Warranty Deed recorded 8/30/04 in Book 1159, Page 795. PROPERTY ADDRESS: 60 Oxford Drive, Atoka, TN 38004 CURRENT OWNER(S): Lynnda J. Robbins and Gillie W. Robbins The sale of the above-described property shall be subject to all matters shown on any recorded plan; any unpaid taxes; any restrictive covenants, easements or set-back lines that may be applicable; any prior liens or encumbrances as well as any priority created by a fixture filing; and any matter that an accurate survey of the premises might disclose. SUBORDINATE LIENHOLDERS: First Horizon Home Loan Corporation OTHER INTERESTED PARTIES: N/A All right and equity of redemption, statutory or otherwise, homestead, and dower are expressly waived in said Deed of Trust, and the title is believed to be good, but the undersigned will sell and convey only as Substitute Trustee. The right is reserved to adjourn the day of the sale to another day, time, and place certain without further publication, upon announcement at the time and place for the sale set forth above. THIS IS AN ATTEMPT TO COLLECT A DEBT. ANY INFORMATION OBTAINED WILL BE USED FOR THAT PURPOSE. Nationwide Trustee Services, Inc., Substitute Trustee c/o SBS Nationwide Trustee Services, Inc. 1587 Northeast Expressway Atlanta, GA 30329 (770) 234-9181 (ext. ) File No.: 416.0933815TN Web Site: www.jflegal.com Insertion Dates: 07/22/2010, 07/29/2010, 08/05/2010

SUBSTITUTE TRUSTEE’S SALE WHEREAS, default having been made in the payment of the debts and obligations secured to be paid by that certain Deed of Trust executed on December 23, 2005, by Michelle Pfrenger aka Michele Pfrenger and Matthew Pfrenger to American Title, Trustee, as same appears of record in the Register’s Office of Tipton County, Tennessee, under Book No. 1253,

Page 90, (“Deed of Trust”); and WHEREAS, the beneficial interest of said Deed of Trust was last transferred and assigned to Deutsche Bank National Trust Company, as Trustee under Pooling and Servicing Agreement dated as of April 1, 2006 Morgan Stanley ABS Capital I Inc. Trust 2006-NC3 Mortgage Pass-Through Certificates, Series 2006-NC3; and WHEREAS, Deutsche Bank National Trust Company, as Trustee under Pooling and Servicing Agreement dated as of April 1, 2006 Morgan Stanley ABS Capital I Inc. Trust 2006NC3 Mortgage Pass-Through Certificates, Series 2006-NC3, the current owner and holder of said Deed of Trust, (the “Owner and Holder”), appointed the undersigned, Nationwide Trustee Services, Inc., as Substitute Trustee by instrument filed for record in the Register’s Office of Tipton County, Tennessee, with all the rights, powers and privileges of the original Trustee named in said Deed of Trust; and NOW, THEREFORE, notice is hereby given that the entire indebtedness has been declared due and payable as provided in said Deed of Trust by the Owner and Holder, and that the undersigned, Nationwide Trustee Services, Inc., Substitute Trustee, or his duly appointed attorneys or agents, by virtue of the power and authority vested in him, will on Thursday, August 19, 2010, commencing at 10:00 AM at the North Door of the Tipton County Courthouse, Covington, Tennessee, proceed to sell at public outcry to the highest and best bidder for cash, the following described property situated in Tipton County, Tennessee, to wit: Lot 106 of Woodlawn Plantation, Section “D”, Plat Cabinet “E”, Slide 176, in the Register’s Office for Tipton County, Tennessee which plat reference is hereby made for a more particular description of said property. Being the same property conveyed to Matthew Pfrenger and Michele Pfrenger by deed from Timbs Builders and Supply Company, L.P filed for record in Book 933, Page 214, Register’s Office for Tipton County Tennessee, dated 3/15/01. Property address known as: 110 Woodshire Lane, Brighton, Tennessee 38011, Tipton County. Note: Michelle Pfrenger is AKA Michele Pfrenger PROPERTY ADDRESS: 110 Woodshire Lane, Brighton, TN 38011 CURRENT OWNER(S): Michelle Pfrenger aka Michele Pfrenger and Matthew Pfrenger The sale of the above-described property shall be subject to all matters shown on any recorded plan; any unpaid taxes; any restrictive covenants, easements or set-back lines that may be applicable; any prior liens or encumbrances as well as any priority created by a fixture filing; and any matter that an accurate survey of the premises might disclose. SUBORDINATE LIENHOLDERS: N/A OTHER INTERESTED PARTIES: N/A All right and equity of redemption, statutory or otherwise, homestead, and dower are expressly waived in said Deed of Trust, and the title is believed to be good, but the undersigned will sell and convey only as Substitute Trustee. The right is reserved to adjourn the day of the sale to another day, time, and place certain without further publication, upon announcement at the time and place for the sale set forth above. THIS IS AN ATTEMPT TO COLLECT A DEBT. ANY INFORMATION OBTAINED WILL BE USED FOR THAT PURPOSE. Nationwide Trustee Services, Inc., Substitute Trustee c/o IMR Nationwide Trustee Services, Inc. 1587 Northeast Expressway Atlanta, GA 30329 (770) 234-9181 (ext. ) File No.: 5005.1003475TN Web Site: www.foreclosurehotline.net Insertion Dates: 07/22/2010, 07/29/2010, 08/05/2010

SUBSTITUTE TRUSTEE’S SALE Sale at public auction will be on Thursday, August 12, 2010 at 12:00 noon at the North entrance of the Tipton County Courthouse, Covington, TN pursuant to Deed of Trust executed by Webb Supply, Inc. to Charles M. Ennis, Trustee, recorded at Book 1303, Page 698 and conducted by Clifton E. Darnell, Substitute Trustee, all of record in the Tipton Co. Register’s Office. Owner of Debt: Patriot Bank The following real estate located in Tipton Co., TN will be sold to the highest cash bidder subject to all unpaid taxes, prior liens and encumbrances of record: Being a part of the William T. Corcoran, and Tracy Lee Corcoran tract recorded in Deed Book 1149, Page 439, being a part of the same property conveyed to Virginia Thompson Sanders recorded in Deed Book 1012, Page 248, in the Register’s Office lying on the east side of Tipton Road in the Seventh Civil District of Tipton County, Tennessee, being more particularly described as follows: Beginning at the northwest corner of residue to the William T. Corcoran and Tracy Lee Corcoran tract recorded in Deed Book 1149, page 439,

of which this parcel is a part, said point being in the centerline of Tipton Road, said point also being 684.02’ south of the centerline intersection of Cobb Avenue and Tipton Road, then along a creek on the southwest line of the Michael Duffy 9.72 acre tract recorded in Deed Book 1238, page 705, the following nine courses; South 74 deg. 11’ 48” East, passing an iron pin found at 35.20’, but continuing for a total distance of 156.99 feet; South 57 deg. 40’ 45” East, 143.29 feet; South 32 deg. 59’ 35” East, 107.95 feet; South 38 deg. 58’ 40” East, 102.42 feet; South 44 deg. 23’ 45” East, 63.67 feet; South 33 deg. 35’ 50” East, 65.54 feet; South 58 deg. 55’ 36” East, 62.27 feet; South 30 deg. 27’ 59” East, 42.14 feet; South 43 deg. 29’ 36” East, 71.55 feet to an iron pin found on the west right of way line of the Illinois Central Railroad; then South 50 deg. 25’ 13” West, 618.47 feet along the said R.O.W. line to an iron pin found; then South 88 deg. 24’ 22” West, 178.10 feet along the said R.O.W. line to the centerline of Tipton Road; then North 06 deg. 32’ 12” East, 145.34 feet along the said centerline to a point; then along the east line of the Buddy Kuhstoss tract (DB 787, PG 972) the following four courses: North 58 deg. 52’ 03” East, 270.26 feet to an iron pin found; North 06 deg. 44’ 09” East, 185.31 feet to an iron pin found; North 41 deg. 48’ 05” West, 135.97 feet to an iron pin found; North 67 deg. 23’ 30” West, 141.20 feet to the centerline of Tipton Road; then along the said centerline the following three courses; North 01 deg. 46’ 58” East, 116.95 feet; North 00 deg. 43’ 13” East, 118.36 feet; North 00 deg. 49’ 07” East, 50.08 feet to the Point of Beginning. Also commonly known as 0 Tipton Road, Atoka, TN Owner(s) of Properties: Webb Supply, Inc. All right and equity of redemption, statutory and otherwise, homestead and dower are expressly waived in said Deed of Trust, and the title is believed to be good, but the undersigned, will sell and convey only as Substitute Trustee. The right is reserved to adjourn the day of the sale to another day, time, and place certain without further publication, upon announcement at the time and place for the sale set forth above. This is an attempt to collect a debt and any information obtained will be used for that purpose. Clifton E. Darnell, Substitute Trustee 2820 Summer Oaks Dr., Bartlett, TN 38134 Publication dates: July 22, July 29 and August 5, 2010

NOTICE OF PUBLICATION IN THE CIRCUIT COURT OF TENNESSEE FOR THE TWENTY-FIFTH JUDICIAL DISTRICT AT COVINGTON TIPTON COUNTY STATE OF TENNESSEE, ON RELATION OF THE COMMISSIONER OF THE DEPARTMENT OF TRANSPORTATION, FOR AND ON BEHALF OF SAID DEPARTMENT, AND TIPTON COUNTY, TENNESSEE; PETITIONER, VS. A TRACT OF LAND IN TIPTON COUNTY, TENNESSEE CONTAINING 0.140 ACRES; and KATIE MAE HARRIS; A Resident of Tipton County, Tennessee, DEFENDANTS. DOCKET NO. 6731 PROJECT NO. 84003-221714 STP-14(39) TRACT NO. 9 JURY DEMAND Please take notice that on the 9th day of July, 2010 a Petition was filed in this Court against you, pursuant to Section 29-17701 et seq of the Tennessee Code Annotated, praying for the condemnation for public purposes of the hereinafter described tract of land in which you have or may have an interest or right. The Petitioner seeks to acquire said property rights for the improvement of S.R. 14 (Austin Peay Highway) in Tipton County, Tennessee. The property to be condemned in this cause is more particularly described as follows: PROJECT 84003-221714 TIPTON COUNTY TRACT 9 TP-14(39) Map 099, Parcel 021.01 FEE SIMPLE BEGINNING at a ROW marker and point of intersect of the present and proposed east ROW lines of Terry Lane (also the subject property owner’s south property line) 25.02 feet left of Terry Lane proposed centerline Station 54 + 10.22 (282.68 feet right of SR 14 (Austin Peay Highway) proposed centerline Station 1082 + 33.05),; thence along the present east ROW line of Terry Lane as follows: in a curve to the right with a radius of 815.00 feet and an arc distance of 109.75 feet to a point 17.19 feet left of the new proposed centerline Station 52 + 91.37; thence N 20˚48’43” E 57.26 feet to a point of intersect with the subject property owner’s north property line 1.50 feet left of Terry Lane new proposed centerline Station 52 + 33.35; thence along the subject

property owner’s north property line S 85˚58’00” E 73.35 feet to a point of intersect with the proposed east ROW line of Terry Lane 223.70 feet right of SR 14 (Austin Peay Highway) proposed centerline Station 1084 + 15.02; thence along the proposed east ROW line of Terry Lane as follows: S 39˚13’39” W 98.81 feet to a ROW marker 247.00 feet right of SR 14 (Austin Peay Highway) proposed centerline Station 1083 + 19.00; thence S 30˚19’30” W 93.06 feet to the point of beginning and containing 0.140 acres, more or less. This property is to be acquired for use in the improvement of S.R. 14 (Austin Peay Highway) in Tipton County, Tennessee. You must plead, answer, or except to same as provided by law, or the Petition will be taken as confessed against you, whereupon the case will then be set for a hearing upon the record and in your absence. IT IS ORDERED that publication of this notice be made for four consecutive weeks in The Covington Leader, a newspaper published in Tipton County, Tennessee. This the 9th day of July, 2010. CIRCUIT COURT CLERK

SUBSTITUTE TRUSTEE’S SALE Default having been made in the payment of the debts and obligations secured to be paid in a certain Deed of Trust executed the 15th day of November, 2006, by Joe A. Curtis and Kimberly A. Curtis to Jerry P. Spore, as Trustee, as the same appears of record in the Office of Register of Tipton County, Tennessee, in Book 1311, Pages 473-482, and the owner of the debt secured having appointed the undersigned as Substitute Trustee in accordance with the provisions of the said Deed of Trust, by Appointment of Substitute Trustee appearing of record in Book 1482, Page 555, in said Register’s Office, and the owner of the debt secured having requested the undersigned to advertise and sell the property described in and conveyed by said Deed of Trust, all of said indebtedness having matured by default in the payment of a part thereof, at the option of the owner, this is to give notice that David J. Harris, Substitute Trustee, will, on Friday, August 20, 2010, commencing at 11:00 a.m. at the north door of the Tipton County Courthouse in Covington, Tipton County, Tennessee, proceed to sell at public outcry to the highest and best bidder for cash, the following described real property, to-wit: Situated in the County of Tipton, State of Tennessee: Description of a 10.00 acre tract being the Kimberly Ann Roberts property as recorded in Deed Book 631 – Page 448, said property being located on the West side of Highway 14 in the 7th Civil District of Tipton County, Tennessee. Beginning at a found iron in the West R.O.W. line of Highway 14 being the Easternmost southeast corner of Kimberly Ann Roberts as recorded in Deed Book 631 – Page 448, also being the Southernmost Southwest corner of the Robin L. Roberts property, Deed Book 641 – Page 886, thence in a Southwestwardly direction, along said R.O.W. line, S 44 deg. 05’ 27” W, 100.00 feet to a found iron being the Southwest corner of this tract; thence in a Northwestwardly direction, along a West line of this tract, N 44 deg. 53’ 43” W, passing a found iron at 686.15 feet at the water edge of a lake, but in all a distance of 870.09 feet to an angle point; thence N 07 deg. 25’ 55” E, 518.81 feet to the Northwest corner of this tract, also being the exterior corner of Robin L. Roberts, also being in the East line of William Clay Ballard, Deed Book 625 – Page 285; thence in a Southeastwardly direction, along an East line of this partition and a West line of Robin L. Roberts, the following (3) courses: S 53 deg. 00’ 56” E, 300.00 feet to an angle point; thence N 81 deg. 41’ 13” E, passing a found iron post at the waters’ edge of a lake at 290.34 feet, but in all a distance of 360.34 feet to a found iron being the Northeast corner of this tract and an interior of Robin L. Roberts; thence in a Southeastwardly direction, along the East line of this tract and a West line of Robin L. Roberts, S 01 deg. 43’ 41” E, 637.31 feet to the point of beginning and containing 10.00 acres, more or less. Being the same property conveyed to Kimberly Ann Roberts (now Kimberly Ann Curtis) at Book 631, page 448 of the Tipton County Register’s Office, Kimberly Ann Curtis wants to insure that the above described property is now held as tenants by the entireties by Joe Alden Curtis, Jr. and wife, Kimberly Ann Curtis. Less and Except: Property conveyed to the State of Tennessee in Warranty Deed of record at Book 1287, Pages 185-186 in the Tipton County Register’s Office to which reference is hereby made for a more particular description of said property. Property Address: 8135 Austin Peay/8135 Hwy. 14 S., Brighton, TN

(legal description governs over property address) Owner of Property: Joe A. Curtis and wife, Kimberly A. Curtis Maker of Note: BDKY Holdings, LLC Holder of Note: BancorpSouth Bank Interested Party: First Tennessee Bank National Association BDKY Holdings, Inc. Y & W Technologies, LLC Raymond H. Roberson Charles E. Williamson Willis T. Yates Joe A. Curtis and Kimberly A. Curtis All right and equity of redemption, statutory right of redemption, homestead and dower are waived in said Deed of Trust, and the title is believed to be good, but the undersigned will sell and convey only as Substitute Trustee. This sale is subject to all matters shown on any applicable recorded plat or plan; any unpaid taxes, interest and penalty which exist as a lien against said property (said taxes shall not be prorated); any restrictive covenants, easements or set back lines that may be applicable; any equitable or statutory rights of redemption not otherwise waived in the Deed of Trust, including rights of redemption of any federal, state, or local governmental agency; rights or claims of parties in possession; and any filed or unfiled liens, adverse claims or encumbrances that may exist against the property which have priority over the Deed of Trust under which the foreclosure was held. All bidders are urged to conduct a title examination before bidding. The right is reserved to adjourn the day of the sale to another day certain without further publication, upon announcement at the time and place for the sale set forth herein. David J. Harris Substitute Trustee Burch, Porter & Johnson, A Professional Limited Liability Company Attorneys at Law 130 North Court Avenue Memphis, TN 38103 901/524-5000 Publication Dates: July 29, August 5, and August 12, 2010

SUBSTITUTE TRUSTEE’S NOTICE OF FORECLOSURE SALE Default having been made in the terms, conditions, and payments provided in a certain Deed of Trust dated SEPTEMBER 20, 2005, executed by MELINDA MCGRATH TRIPLETT (A/K/A MELINDA ANN MCGRATH, A/K/A MELINDA ANN PERRY), to MONTE S. CONNELL, Trustee, of record in RECORD BOOK 1233, PAGE 585, AND RE-RECORDED IN RECORD BOOK 1243, PAGE 309, in the Register’s Office for TIPTON County, Tennessee and to J. PHILLIP JONES, appointed as Substitute Trustee in an instrument of record in the Register’s Office for TIPTON County, Tennessee, to secure the indebtedness described, the entire indebtedness having been declared due and payable by U.S. BANK, NATIONAL ASSOCIATION, as provided in said Deed of Trust, J. PHILLIP JONES, will by virtue of the power and authority vested in me as Substitute Trustee, on TUESDAY, AUGUST 24, 2010 AT 12:00 P.M. (NOON), AT THE NORTH DOOR OF THE TIPTON COUNTY COURTHOUSE IN COVINGTON, TIPTON COUNTY, TENNESSEE, sell to the highest bidder for cash, free from the equity of redemption, homestead, and dower, and all other exemptions which are expressly waived, and subject to any unpaid taxes, if any, the following described property in TIPTON County, Tennessee, to wit: PROPERTY LOCATED IN THE COUNTY OF TIPTON, TENNESSEE: PART OF THE LOT 39, TWIN LAKES SUBDIVISION, SECTION “B” AS RECORDED IN PLAT CABINET A, SLIDES 195 & 196 IN THE REGISTER’S OFFICE OF TIPTON COUNTY, TN AND BEING SITUATED IN THE 7TH CIVIL DISTRICT OF SAID COUNTY AND BEING MORE PARTICULARLY DESCRIBED AS FOLLOWS: BEGINNING AT A FOUND IRON POST ON THE WEST RIGHT OF WAY LINE OF TWIN LAKES CIRCLE BEING THE NORTHEAST CORNER OF LOT 39, TWIN LAKES SUBDIVISION ALSO BEING THE SOUTHEAST CORNER OF LOT 38; THENCE SOUTHEASTWARDLY ALONG SAID RIGHT OF WAY LINE BEING THE EAST LINE OF LOT 39, THENCE SOUTH 14 DEGREES, 49 MINUTES, 21 SECONDS EAST, 100.00 FEET TO THE SOUTHEAST CORNER OF LOT 39, ALSO BEING THE NORTHEAST CORNER OF LOT 40; THENCE S O U T H W E S T W A R D LY ALONG THE SOUTH LINE OF LOT 39, ALSO BEING THE NORTH LINE OF LOT 40; THENCE SOUTH 75 DEGREES, 10 MINUTES, 39 SECONDS WEST, 410.84 FEET TO THE SOUTHWEST CORNER OF LOT 39, ALSO BEING THE NORTHWEST CORNER OF LOT 40 AND

(continued on B8)


Thursday, August 5, 2010 • THE LEADER • B7

www.covingtonleader.com

Public Notices ON THE EAST BANK OF BOMAR LAKE; THENCE NORTHWESTWARD WITH THE WEST LINE OF LOT 39, ALSO BEING THE EAST BANK OF SAID LAKE; THENCE NORTH 07 DEGREES, 43 MINUTES 44 SECONDS WEST, 97.64 FEET TO AN ANGLE POINT; THENCE NORTH 39 DEGREES, 44 MINUTES, 27 SECONDS WEST, 3.43 FEET TO THE NORTHWEST CORNER OF LOT 39, ALSO BEING THE SOUTHWEST CORNER OF LOT 38; THENCE NORTHEASTWARDLY ALONG THE SOUTHWEST LINE OF LOT 39, ALSO BEING THE SOUTH LINE OF LOT 38; THENCE NORTH 75 DEGREES, 10 MINUTES, 39 SECONDS EAST, 143.23 FEET TO A POINT; THENCE SOUTH 14 DEGREES 49 MINUTES, 21 SECONDS EAST, 1.0 FEET TO A POINT; THENCE NORTH 75 DEGREES, 10 MINUTES, 39 SECONDS EAST 50.0 FEET TO A POINT; THENCE NORTH 14 DEGREES, 49 MINUTES, 21 SECONDS EAST WEST 1.0 FEET TO A POINT; THENCE NORTH 75 DEGREEES, 10 MINUTES, 39 SECONDS EAST 198.0 FEET TO THE POINT OF BEGINNING. BEING THE SAME PROPERTY CONVEYED TO MELINDA MCGRATH TRIPLETT, UNMARRIED, BY DEED DATED SEPTEMBER 20, 2005 OF RECORD IN RECORD BOOK 1233 PAGE 582 IN THE REGISTER’S OFFICE OF TIPTON COUNTY, TENNESSEE. THIS IS IMPROVED PROPERTY KNOWN AS 339 TWIN LAKES CIRCLE, MUNFORD, TENNESSEE 38058. MAP 095I GROUP A CONTROL MAP 095P PARCEL 039.0 THE SALE OF THE SUBJECT PROPERTY IS WITHOUT WARRANTY OF ANY KIND, AND IS FURTHER SUBJECT TO THE RIGHT OF ANY TENANT(S) OR OTHER PARTIES OR ENTITIES IN POSSESSION OF THE PROPERTY. THIS SALE IS SUBJECT TO ANY UNPAID TAXES, IF ANY, ANY PRIOR LIENS OR ENCUMBRANCES LEASES, EASEMENTS AND ALL OTHER MATTERS OF RECORD INCLUDING BUT NOT LIMITED TO THE PRIORITY OF ANY FIXTURE FILING. IF THE U.S. DEPARTMENT OF THE TREASURY/ INTERNAL REVENUE SERVICE, THE STATE OF TENNESSEE DEPARTMENT OF REVENUE, OR THE STATE OF TENNESSEE DEPARTMENT OF LABOR AND WORK FORCE DEVELOPMENT ARE LISTED AS INTERESTED PARTIES IN THE ADVERTISEMENT, THEN THE NOTICE OF THIS FORECLOSURE IS BEING GIVEN TO THEM, AND THE SALE WILL BE SUBJECT TO THE APPLICABLE GOVERNMENTAL ENTITIES RIGHT TO REDEEM THE PROPERTY, ALL AS REQUIRED BY 26 U.S.C. 7425 AND T.C.A. 67-1-1433. IF APPLICABLE, THE NOTICE REQUIREMENTS OF T.C.A. 35-5-117 HAVE BEEN MET. THE RIGHT IS RESERVED TO ADJOURN THE DAY OF THE SALE TO ANOTHER DAY, TIME AND PLACE CERTAIN WITHOUT FURTHER PUBLICATION, UPON ANNOUNCEMENT AT THE TIME AND PLACE FOR THE SALE SET FORTH ABOVE. THE TRUSTEE/SUBSTITUTE TRUSTEE RESERVES THE RIGHT TO RESCIND THE SALE IN THE EVENT THE HIGHEST BIDDER DOES NOT HONOR THE HIGHEST BID WITHIN 24 HOURS, THE NEXT HIGHEST BIDDER AT THE NEXT HIGHEST BID WILL BE DEEMED THE SUCCESSFUL BIDDER. OTHER INTERESTED PARTIES: NONE ON RECORD THIS IS AN ATTEMPT TO COLLECT A DEBT AND ANY INFORMATION OBTAINED WILL BE USED FOR THAT PURPOSE. This day, July 26, 2010. This is improved property known as 339 TWIN LAKES CIRCLE, MUNFORD, TENNESSEE 38058. J. PHILLIP JONES, Substitute Trustee J. PHILLIP JONES SUBSTITUTE TRUSTEE SUITE C-205, NASHVILLE HOUSE ONE VANTAGE WAY NASHVILLE, TN 37228 (615) 254-4430 29jul3w

SUBSTITUTE TRUSTEE’S SALE WHEREAS, default having been made in the payment of the debts and obligations secured to be paid by that certain Deed of Trust executed on November 23, 2005, by John D. Yarbro and Pam Yarbro to Tipton and Owen Title/David E. Owen, Trustee, as same appears of record in the Register’s Office of Tipton County, Tennessee, under Book No. 1246, Page 712, (“Deed of Trust”); and WHEREAS, the beneficial interest of said Deed of Trust was last transferred and assigned to Deutsche Bank National Trust Company, as Trustee under Pooling and Servicing Agreement dated as of April 1,

2006 Morgan Stanley Capital I Inc. Trust 2006-HE2 Mortgage Pass-Through Certificates, Series 2006-HE2; and WHEREAS, Deutsche Bank National Trust Company, as Trustee under Pooling and Servicing Agreement dated as of April 1, 2006 Morgan Stanley Capital I Inc. Trust 2006-HE2 Mortgage PassThrough Certificates, Series 2006-HE2, the current owner and holder of said Deed of Trust, (the “Owner and Holder”), appointed the undersigned, Nationwide Trustee Services, Inc., as Substitute Trustee by instrument filed for record in the Register’s Office of Tipton County, Tennessee, with all the rights, powers and privileges of the original Trustee named in said Deed of Trust; and NOW, THEREFORE, notice is hereby given that the entire indebtedness has been declared due and payable as provided in said Deed of Trust by the Owner and Holder, and that the undersigned, Nationwide Trustee Services, Inc., Substitute Trustee, or his duly appointed attorneys or agents, by virtue of the power and authority vested in him, will on Thursday, August 26, 2010, commencing at 10:00 AM at the North Door of the Tipton County Courthouse, Covington, Tennessee, proceed to sell at public outcry to the highest and best bidder for cash, the following described property situated in Tipton County, Tennessee, to wit: Lying and being in Tipton County, Tennessee, and thus described: Being Lot No. 2, Sunnyside Subdivision and thus described: Beginning at the north end of a 20 foot radius being 30 feet west of the centerline of Sunnyside Road and 20.44 feet north of the north line of Sunnyside Cove, thence north 1 degree 14 minutes west 279.59 feet along the west line of Sunnyside Road to a stake , thence west 203.24 feet to a stake, thence south 300 feet to a stake on the north side of Sunnyside Cove (50 feet wide), thence east 186.22 feet along the north side of Sunnyside Cove to the west end of a 20 feet radius, thence northeastwardly 31.84 feet around said radius to the point beginning and containing 1.40acres, more or less. According to survey of V.F. Melton, Surveyor. And being the same property conveyed to John D. Yarbro and wife, Pam Yarbro by deed of record at book 623, Page 80 of the Register’s Office of Tipton County, Tennessee. Map 79, Parcel 39.00 PROPERTY ADDRESS: 2183 Sunnyside Road, Brighton, TN 38011 CURRENT OWNER(S): John D. Yarbro and Pam Yarbro The sale of the above-described property shall be subject to all matters shown on any recorded plan; any unpaid taxes; any restrictive covenants, easements or set-back lines that may be applicable; any prior liens or encumbrances as well as any priority created by a fixture filing; and any matter that an accurate survey of the premises might disclose. S U B O R D I N A T E LIENHOLDERS: Timbs Builder and Supply OTHER INTERESTED PA R T I E S : N/A All right and equity of redemption, statutory or otherwise, homestead, and dower are expressly waived in said Deed of Trust, and the title is believed to be good, but the undersigned will sell and convey only as Substitute Trustee. The right is reserved to adjourn the day of the sale to another day, time, and place certain without further publication, upon announcement at the time and place for the sale set forth above. THIS IS AN ATTEMPT TO COLLECT A DEBT. ANY INFORMATION OBTAINED WILL BE USED FOR THAT PURPOSE. Nationwide Trustee Services, Inc., Substitute Trustee c/o IMR Nationwide Trustee Services, Inc. 1587 Northeast Expressway Atlanta, GA 30329 (770) 234-9181 (ext. ) File No.: 5005.1017920TN Web Site: www.foreclosurehotline.net Insertion Dates: 07/29/2010, 08/05/2010, 8/12/2010

SUBSTITUTE TRUSTEE’S SALE Default having been made in the payment of the debts and obligations secured to be paid by a certain Deed of Trust executed March 27, 2006 by Jeffery J. Rasar, A Married Person and Wife, Sheri Denise Rasar to Larry A. Weissman, as Trustee, as same appears of record in the office of the Register of Tipton County, Tennessee, in Book 1266 Page 807, and the undersigned having been appointed Substitute Trustee by instrument recorded in Book 1442 Page 611, in the said Register’s Office, and the owner of the debt secured, Litton Loan Servicing, L.P., having requested the undersigned to advertise and sell the property described in and conveyed by said Deed of Trust, all of said indebtedness having matured by default in the payment of a part thereof, at the option of the owner, this

is to give notice that the undersigned will, on Friday, August 20, 2010 commencing at 10:00 AM, at the Front (North) Door of the Courthouse, Covington, Tipton County, Tennessee proceed to sell at public outcry to the highest and best bidder for cash, the following described property, to-wit: Situated in County of Tipton, State of Tennessee. Lot 3, Milo Subdivision, as described in Plat Book 2, Page 12 in the Tipton County Register’s Office, to which plat reference is hereby made for a more particular description of said lot. Subject to subdivision restrictions building lines and easements at Plat Book 2, Page 12, in the Tipton County Register’s Office. Property Address: 104 Fannie Drive, Brighton, TN. All right and equity of redemption, homestead and dower waived in said Deed of Trust, and the title is believed to be good, but the undersigned will sell and convey only as Substitute Trustee. ARNOLD M. WEISS, Substitute Trustee Weiss Spicer Cash PLLC 208 Adams Avenue Memphis, Tennessee 38l03 90l-526-8296 File # 2075-086031-FC Published: July 29 August 5 August 12 Litton Mortgage Servicing Center, Inc./Jeffrey Rasar

NOTICE TO CREDITORS R. D. NO P2794 ESTATE OF Roberta SitterRussell. (Deceased) Notice is hereby given that the 26th day of July, 2010. Letters of Testamentary in the respect of the estate of Roberta Sitter-Russell, deceased, were issued to the undersigned by the Chancery Court of Tipton County, Tennessee. All persons, resident and non-resident, having claims, matured or unmatured, against her estate are required to file same with the clerk of the above named Court within the earlier of four months from notice or 12 months from decedent’s date of death, otherwise their claims will be forever barred. This 5th day of August, 2010. James Allen Sitter, Executor 5thAug2wp Tipton County Chancery Court Judy Billings, Clerk and Master 1801 S. College St., Suite 110 Covington, TN 38019

NOTICE TO FURNISHERS OF LABOR AND MATERIALS TO: Rose Construction, Inc. PROJECT NO.: 84063-3406-94 CONTRACT NO.: CNH713 COUNTY: Tipton The Tennessee Department of Transportation is about to make ¿nal settlement with the contractor for construction of the above numbered project. All persons wishing to ¿le claims pursuant to Section 54-5-122, T.C.A. must ¿le same with the Director of Construction, Tennessee Department of Transportation, Suite 700 James K. Polk Bldg., Nashville, Tennessee 37243-0326, on or before 09/10/10. NOTICE TO FURNISHERS OF LABOR AND MATERIALS TO: Ferrell Paving, Inc PROJECT NO.: 84007-3220-94 CONTRACT NO.: CNH579 COUNTY: Tipton The Tennessee Department of Transportation is about to make ¿nal settlement with the contractor for construction of the above numbered project. All persons wishing to ¿le claims pursuant to Section 54-5-122, T.C.A. must ¿le same with the Director of Construction, Tennessee Department of Transportation, Suite 700 James K. Polk Bldg., Nashville, Tennessee 37243-0326, on or before 09/10/10.

Notice is hereby given that on August 11, 2010 at 11:30 a.m. the following will be sold at public auction to the highest bidder. Sale to be held at: 51 Mini Storage 13890 Hwy 51 S. Atoka, TN 38004 Unit#s 16 Cynthia Dyer 18 Carey Ross 24 Heather Hutto 29 Gail Hood 33 Christopher Weaver 36 Stephen Warwick 37 Gregg Lambert 38 Stephen Warwick 49 Wanda Floyd Vehicle StorageCarlotta OGwin All sales final. Cash Only. Management reserves the right to accept or refuse any bid. Tenants may satisfy their indebtedness anytime prior to the sale.

TO ADVERTISE HERE CALL 476-7116 GENERAL ELECTION NOVEMBER 2, 2010 A general election is hereby called and ordered for Tipton County, Tennessee, to be held on Tuesday, November 2, 2010. At this time, we will be voting for electors for Governor, U.S. Senate, U.S. House of Representatives—8th. Congressional District, and Tennessee House of Representatives—81st. District, and Tennessee House of Representatives—94th. District. Also, the following municipalities will be held in conjunction with the general election. Atoka- Mayor and 3 Aldermen Burlison- 1 Councilman Covington- Mayor and 3 Aldermen Garland- Mayor, 6 Aldermen and a Recorder Gilt Edge- 1 Councilman Gilt Edge-1 Councilman (unexpired term) Munford- 3 Aldermen The above municipal elections have an August 19, 2010 12 noon qualifying deadline with May 21, 2010 being the first day a petition may be issued. The last day to register to vote in person or hand deliver by-mail forms is Monday, October 4, 2010. By-mail voter registration forms must be postmarked no later than Monday, October 4, 2010. By-mail forms for someone unable to appear in person to register may be picked up at the Election Commission office. Early voting for both elections will be October 13, 2010 through October 28, 2010. The Tipton County Election Commission office is located at 113 E. Church St. in Covington, TN. Regular office hours are Monday through Friday from 8:00 a.m. to 5:00 p.m. We will be closed for all holidays. We may be contacted at 476-0223, fax 476-0233 or by e-mail election@tiptonco.com. Tipton County Election Commission Theta Rone, Chairman James L. Sneed, Commissioner Kay Bergen, Commissioner Maurine Cannon, Commissioner Georgia Dawson, Commissioner

PUBLIC NOTICE TIPTON COUNTY , TENNESSEE PROPOSED BUDGET FOR THE FISCAL YEAR ENDING JUNE 30, 2011 TO BE FUNDED WITH THE CERTIFIED PROPERTY TAX RATE OF DESCRIPTION GENERAL FUND PROPERTY TAX RATE ESTIMATED REVENUE & OTHER SOURCES LOCAL TAXES STATE OF TENNESSEE FEDERAL GOVERNMENT OTHER SOURCES TOTAL ESTIMATED REVENUES & OTHER SOURCES ESTIMATED EXPENDITURES & OTHER USES SALARIES OTHER COST TOTAL ESTIMATED EXPENDITURES & OTHER USES ESTIMATED BEGINNING FUND BALANCE- JULY 1 ESTIMATED ENDING BALANCE - JUNE 30 EMPLOYEE POSITIONS HIGHWAY/PUBLIC WORKS FUND PROPERTY TAX RATE ESTIMATED REVENUE & OTHER SOURCES LOCAL TAXES STATE OF TENNESSEE FEDERAL GOVERNMENT OTHER SOURCES TOTAL ESTIMATED REVENUES & OTHER SOURCES ESTIMATED EXPENDITURES & OTHER USES SALARIES OTHER COST TOTAL ESTIMATED EXPENDITURES & OTHER USES ESTIMATED BEGINNING FUND BALANCE- JULY 1 ESTIMATED ENDING BALANCE - JUNE 30 EMPLOYEE POSITIONS GENERAL PURPOSE SCHOOL FUND PROPERTY TAX RATE ESTIMATED REVENUE & OTHER SOURCES LOCAL TAXES STATE OF TENNESSEE FEDERAL GOVERNMENT OTHER SOURCES TOTAL ESTIMATED REVENUES & OTHER SOURCES ESTIMATED EXPENDITURES & OTHER USES SALARIES OTHER COST TOTAL ESTIMATED EXPENDITURES & OTHER USES ESTIMATED BEGINNING FUND BALANCE- JULY 1 ESTIMATED ENDING BALANCE - JUNE 30 EMPLOYEE POSITIONS DEBT SERVICE FUND PROPERTY TAX RATE ESTIMATED REVENUE & OTHER SOURCES LOCAL TAXES OTHER SOURCES TOTAL ESTIMATED REVENUES & OTHER SOURCES ESTIMATED EXPENDITURES & OTHER USES DEBT SERVICE PRINCIPAL COST DEBT SERVICE INTEREST COST OTHER USES TOTAL ESTIMATED EXPENDITURES & OTHER USES ESTIMATED BEGINNING FUND BALANCE- JULY 1 ESTIMATED ENDING BALANCE - JUNE 30

$

$

2.34 $ 2.34 $ 2.34 ACTUAL ESTIMATED RECOMMENDED 2008-2009 2009-2010 2010-2011 0.69

0.75

$

0.77

$ 9,287,067 878,240 95,000 3,497,127 $ 13,757,434

$ 9,947,027 1,130,752 740,500 3,245,957 $ 15,064,236

$

9,884,194 1,083,297 156,000 3,441,751 14,565,242

6,274,988 7,435,265 $ 13,710,253 $ 8,690,707 $ 8,737,888 164.00

6,342,369 8,469,897 $ 14,812,266 $ 8,737,888 $ 8,989,858 166.00

$

$

0.07

$

$

$ $ $

6,853,306 8,900,726 15,754,032 8,989,858 7,801,068 167.00

0.07

$

0.07

$ 2,237,862 1,857,779 482,266 $ 4,577,907

$ 2,262,300 2,669,045 1,015,596 $ 5,946,941

$

2,244,060 2,478,193 2,583,010 7,305,263

1,462,360 2,357,711 $ 3,820,071 1,945,741 2,703,577 50.00

1,556,966 4,540,851 $ 6,097,817 2,703,577 2,552,701 53.00

$

$

1.11

$

$

1,609,927 5,788,999 7,398,926 2,552,701 2,459,038 56.00

1.11

$

1.11

$ 14,830,923 57,269,715 121,192 1,332,732 $ 73,554,562

$ 14,815,000 58,219,000 140,000 1,026,000 $ 74,200,000

$

15,100,000 59,450,000 128,000 1,022,000 75,700,000

47,811,055 26,311,221 $ 74,122,276 9,586,364 9,018,650 1,208.00

48,221,060 25,978,940 $ 74,200,000 9,018,650 9,018,650 1,216.00

$

$

0.47

$

$

48,431,060 27,268,940 75,700,000 9,018,650 9,018,650 1,220.00

0.41

$

0.39

$ 4,871,283 8,032,633 $ 12,903,916

$ 4,282,790 1,245,000 $ 5,527,790

$

4,044,997 3,245,000 7,289,997

6,165,650 1,164,193 6,336,135 $ 13,665,978 12,901,068 12,139,006

5,361,650 591,593 2,098,714 $ 8,051,957 12,139,006 9,614,839

$

$

4,349,650 1,950,243 173,991 6,473,884 9,614,839 10,430,952


B8 • Thursday, August 5, 2010 • THE LEADER

www.covingtonleader.com

Public Notices PUBLIC NOTICE

PUBLIC NOTICE

A public meeting of the West Tennessee Rural Planning Organization – Technical Committee (WTRPO-TC) will be held on Tuesday, August 17, 2010, at 1:30 p.m. CDT, at the University of Memphis-Millington Center, 6500 Navy Road, Millington, TN. The WTRPO-TC is responsible for comprehensive, regional, multi-modal transportation planning in Fayette, Lauderdale and Tipton Counties. The WTRPO is partially funded by the Tennessee Department of Transportation (TDOT). The agenda will include a TDOT presentation of the Transportation Planning Report (TPR) for the State Route 384 corridor located in Tipton County, and providing a recommendation to the WTRPO Executive Board for the next TPR study request. The agenda will also include updates on regional transportation projects of interest to the WTRPO. For further information, or if you would like a complete agenda, please contact Dan Frazier, WTRPO Coordinator at 901-379-7857, fax (901) 3797865; or email dan.frazier@shelbycountytn.gov. To ensure compliance with the Americans with Disabilities Act (ADA), persons with disabilities that require aids or services to participate in the above referenced meeting may contact the WTRPO Coordinator to make accessibility arrangements no less than five days prior to the August 17, 2010, WTRPO-TC meeting. The WTRPO & TDOT do not discriminate based on race, color or national origin in federal or state sponsored programs, pursuant to Title VI of the Civil Rights Act of 1964 (42 U.S.C. 2000d). 5aug1w

The Town of Brighton Beer Board will have a meeting on Tuesday August 10th at 7:00 PM to discuss and vote upon application by Dollar General Store #10154 located at 1754 Old Hwy. 51 South, Brighton, TN 38011.

The Leader is available at 63 locations throughout Tipton County. Check us out at covingtonleader.com

(901)476-8632 thorntonshomefurnishing.com

NOTICE!! If You Smell Gas, Here is What To Do 1.

Do not operate any electrical switches, or strike matches, or activate any ignition source. If inside, open doors and windows. Telephone your gas company at the emergency number listed below. If strong odor persists, alert other occupants and get clear of premises. Stand by until qualified personnel arrive.

2. 3. 4. 5.

FIRST UTILITY DISTRICT OF TIPTON COUNTY Emergency No. 476-9525

CITY OF COVINGTON GAS COMPANY Emergency No. 476-7163

POPLAR GROVE UTILITY DISTRICT OF TIPTON COUNTY Emergency No. 837-0182

CITY OF MUNFORD GAS DEPARTMENT Emergency No. 837-0171

A PUBLIC SERVICE NOTICE TO NATURAL GAS CUSTOMERS of First Utility District of Tipton County, City of Covington Gas Company, Poplar Grove Utility District of Tipton County, Town of Mason and the City of Munford Gas Department.

TOWN OF MASON GAS COMPANY Emergency No. 496-5980

Public Notice

READ PUBLIC NOTICES! IT’S YOUR RIGHT!

A notice for property located on Tax Map 98G, Group ‘A’, Parcel 6.00 on the southwest corner of Old Memphis Road and Brighton Clopton Road encompassing 1.0 acre owned by Lemuel G. Beaver. You are hereby notified that this property has extremely tall weeds and if not remedied within ten (10) days, the county will remedy this violation for you with all cost associated with the remediation being assesses as a lien on the property. The estimated total cost associated with the remediation is $700.00 plus a $150.00 administration fee. If you wish, you may request a hearing by returning a copy of this notice in person within ten (10) days to the Building Inspector’s Office located at 220 Highway 51 North, Suite #3 in Covington, TN 38019.

TO ADVERTISE HERE CALL 476-7116

SCRAPYARD AND RECYCLING CENTER 170 Hodge Lane • Stanton, TN 38069

901-476-8415

Cash Reward For Your Business For every invoice totalling $100, you will receive a ticket that will be entered into a drawing every Friday evening for $150.00!!! The winner will be posted the following week! New Drawing begins every Monday. Example: An invoice totaling $100-$199= 1 Ticket $200-$299= 2 Tickets $300 - $399= 3Tickets ING CL CY RE

SC RA PY AR D

AND

CENTER

-Coupon-

$0.05 Premium on Aluminum, Cans! Bring this coupon in for an additional $0.05 per pound on Aluminum Cans. 170 Hodge Lane Stanton, TN 38069 Phone: (901) 476-8415 Original coupon only

1 coupon per visit

For information call 901-476-8415 The owners, Reld and Tonya Hodge appreciate your participation!


Thursday, August 5, 2010 • THE LEADER • B9

www.covingtonleader.com

Jamestown DarSay Burton

Greetings When today’s news gives us so much news, some of it good, most of it, bad! That’s when we as Christians tend to rely upon God’s mercies to help us to get through. All families get their share of news, be it good news or bad. All of us get our news! This past week was our family’s turn once again. But as difficult as our news was, our faith in God is helping all of us cope. And cope we all will, simply because God’s love and mercy sustains us each day and it always will. Continue praying for all of us especially the Martin and Burton families of Jamestown, Covington and Nashville. Bright Hill M.B. Church played host to the Union Peace Association last week. A special thanks to Pastor S.P. Cole and all of the members at Bright Hill. Several people celebrated their birthdays over this past week. Happy wishes to them and to you if yours

Brighton Debe Simonton

My Dear Friends,

It has been a hard couple of weeks. The weather has yet to let up on us. Our yards are turning brown and our plants are drying up. I suppose this is why it is called the “dog days of summer”. Sunday night we were watching a program that reminded all of us to reflect on how we felt during the winter months. Neal and I agreed we had rather be cold than smoldering. But not every one agrees with that. My staff will probably never complain that the shop is too cold. Our air has been out since Saturday and as of Monday evening it is still out. Blessed am I to have a good group of stylists that are being very patient. I would like to clear up a mistake from two weeks ago. Mike Malone was not in a car accident. It was Mike Stafford. I caught the error and called the paper but I guess it didn’t get to the right person. The Malone family are some of Neal and my friends and are very nice people. So again I apologize. School is just about ready

is now. Our sister Annette Burton is now the age of a road sign as of August 1! Now I am not going to say which one as there are several speed signs. You know the ones: 20, 30, 35, 45, 55, 75, 80? So many signs out there and as of August 1 she can now claim one of them as her very own! Happy birthday, little sister and many, many more for you. Others celebrating are Ruth Alston on August 2; Brenda Bounds, Anthony Cross Sr., Danelle Clewis and Nevaha Young on August 3; Juanita Tolbert on August 5; Gary Hill and Christy Youn on August 6; and Carl Burton sr. and Michael Gray on August 9. We are praying still for Bessie Cobbs, Jennie Stewart, Doris King, Ruth Alston, Cornell Sherrill, Danny Heaston, Vivian Dickerson, Willie Mae Burton, Willie Perthenia Hodge, Kimel Hodges, Charlene Sneed and family, Re. Pink Sherrill Jr., Carlotta Jones, Connie and Christine Brown, Eula Culbreath and family, Vernard “Big Boy” Burton, Ada Fletcher, Patra Ballard, John Burton, Joe Heaston Sr., Posey Reed and family, Jessie Lawson,

to start. They go a half a day tomorrow and start next Monday. Football and band are gearing up for a super season. Meet the Band was held last Friday night and they are sounding so good. Their music is mostly from the ‘70s. Football will have several new items for sale in the Spirit Trailer. The team still may have a few Cardinal Cards for sale. Wells Kitchen is offering $2 off an entree and many more local businesses have great bargains. My friend Charlee passed away Monday the 26th. We promised to take care of her son, Jon-Allen. She was not able to afford any life insurance so there is a fund set up for her funeral costs at Regions Bank in Jon-Allen Baker’s name. We did this in lieu of flowers. Jon-Allen is 15 and is now a member of BHS band. Please pray for us during this transition time. Please remember your elderly family and friends and neighbors too. These extreme temperatures can bring tragedies too fast and too often this time of year. Your pets need extra water and all day shade. Please give me a call if I need to post something or if I get it wrong. Much love to all Debe

Cortez Lee, Jeffery Mosley Sr., Mary Burton, Nadine Kellum, Joe Malone and family, Rhonda Heaston, McLin and Family, Percy White and family, John and Cleo Thompson, Robert Smith and family, Pauline Yarbrough, Ruth Griffin, Ina Yarbrough, Rufus Garner, Ellouise Vaughn, Ethel Tipton, Emma Brown, John Bommer and fmaily, Eddie B. Woods and family, Beulah Wakefield and family, and the Clewis’s of Palestine, Tex., Minister Pearl Andrews, LaRue Albritton, Pres. Jessie Cooke, his wife Gwen, Pam Springfield, Gloria Sherrill, Joann Bell, Mildred Sherrill and the Jamestown Community Health Organization for the yard sale event last Saturday on Hwy. 51 in millington, especially as hot as the day was on everyone, the turn out was great! This is all for now, I am rewriting last week’s thought, which came to you as a printing error: “When you go through life without a purpose, it’s like running around in circles!” Until next time...

Find out who’s who in our Best of the Best section!

Caleb & Carson Rose

Dunlap

Continued from B4 food, so come over and eat lunch and shop for some good deals. As you know, we do ours a little different than a regular yard sale. We do donations only! It all goes for buying cleaning supplies, small appliances when one goes out in the buildings, and Bingo prizes. So it’s for a good cause, you can’t ever tell, you might run up on something you just can’t live without!! Let’s see, for the month of August we only two b’days. The first one is Ms. Jean Bell on the 28th, “Happy B’day” Ms. Jean; we hope your day is a great one and that you are able to spend time with family and friends! The second one is one of my wonderful staff, Teya Hart! Happy B’day” Teya, sure hope yours is going to be incredible seeing that you are off that day, “Go Girl” enjoy! We would like to welcome our new board members to the Dunlap Board of Directors! They are, Tim Honeycutt, John Moore, Richard Delk, Denise Garner and Linda Clarke. Welcome ladies and gentlemen to our Dunlap family! We always hate to lose our board mem-

bers that go off, but I know the Lord will turn these folks into the best members we’ve ever had! I would like to thank Meredith Cavin, Barbara McFarland, Pee Wee Maughan, Kelly Henson and Jeff Huffman, thank you all so very much for your time and commitment you gave to Dunlap for the past four years!!! If you see them out and about, please tell them thanks for their service! As always, I want to let you know of the rooms we have available this month, we have one apartment, and two rooms, so if you know of someone who really no longer needs to be living alone, please talk to them about Dunlap and let them know what a wonderful place this is to live!! The apartment is independent living and the retirement rooms, well let’s just say you don’t have to do a thing!! We’ll cook, clean and do your laundry! Now keep in mind this is a retirement community, not a nursing home, so come on out and join us!!! Until next week give somebody a hug and let them know how special they are to you.

Caleb & Carson Rose Caleb and Carson are the sons of Craig and Melissa Rose. Their grandparents are Jim and Peggy Blakely and Don & Gloria McKee.

We can take care of your automotive needs. 24 Hour Towing Service Light & Heavy Duty OCTOBER

JIM’S AUTO BODY & TOWING

S M T W T F S 3 10 17 24 31

4 11 18 25

5 12 19 26

6 13 20 27

476-0682

1 7 8 14 15 21 22 28 29

832 Highway 51 South Covington, TN

2 9 16 23 30


B10 • Thursday, August 5, 2010 • THE LEADER

www.covingtonleader.com

Next Miss Tipton County to be crowned By ECHO DAY eday@covingtonleader.com

Saturday evening Leah Rogers will take her last walk as the reigning Miss Tipton County, a title she has held for a year. Hosted each August at the Historic Ruffin Theatre in downtown Covington, the pageant crowns a worthy young woman to make appearances as the face of Tipton County. The pageant, said its organizers, also helps young women defray the costs of a college education. “It’s about their education and talent,” said Miss Tipton County Director Mary Gail Elam. “Our pageants help to build their personal character.” The winner, the young lady who will be chosen as Miss Tipton County 2010, will receive the largest scholarship in the state from a pageant. Other finalists will also receive scholarships. Elam said a total of $5,100 will be given to pageant contestants this year. And because Miss Tipton County is a preliminary local pageant, the winner has the opportunity to become the next Miss America through competing in Miss Tennessee in June 2011. Saturday seven girls are competing to win the local title. Elam said the board is “very pleased” with the number of contestants, which has risen this year over past years. Vying for the coveted crown are Brittany Combs, daughter of Johnny Combs and Bonnie Woodward of Brighton; Carly Gordon, daughter of Dr. David and Mrs. Ruth Gordon; Chelsea Kellum, daughter of LeRoy and Kimberly Kellum of Burlison; Sherrie Lemons, daughter of Leon and Christine Lemons of Atoka; Justin Moritz, daughter of Scott and Suzanne Moritz of Brighton; Kimberly Townsend, daughter of Bill Townsend and Connie Townsend of Atoka; and Stephanie Tynes, daughter of Stephen and Pansy Tynes. Kellum and Lemons are newcomers to the Miss Tipton County pageant, while the other contestants have either been titleholders or have competed for the crown in the past. Gordon, Townsend and Combs were both involved in last year’s pageant. Townsend is also a former Miss Teen Tipton County and Tynes and Moritz were final-

ists in a former Miss Teen Tipton County pageant. “We also have a variety of talents this year,” Elam said. “We have three solo vocals, contemporary dance, a tumbler, monologue and Kim is vocal and instrumental.” Talent is what weighs the most with judges, accounting for 35 percent of each contestant’s total score. The pre-pageant private interview is worth 25 percent, eveningwear is worth 20, swimsuit is worth 15 and on-stage interview is worth 5 percent. Percentages are set by the Miss American Organization, the pageant’s parent association, said Elam. Admitting being nervous about the winners each year, Elam said she is excited to see how the winner changes during her reign. “It doesn’t matter who they choose, I always worry if the person is right for the role, but within three months you see they grow into the role. It’s amazing.” WMC-TV reporter and Covington native Justin Hanson will host this year’s pageant. Judges will be Vicki Ridenhour of Madison County, Nikki Berry of Shelby County, Chris Bryant of Shelby County, Luke McGarrh of Mississippi and Christian Vranich of Fayette County. Other titleholders will be recognized during the pageant. Current titleholders include the first Little Miss Tipton County, 6-year-old MaKenzie Craig, who is the daughter of Joey and Casey Craig of Atoka; Miss Teen Tipton County Lacy Barnett, daughter of Darrell and Lisa Barnett of Drummonds; and Miss Junior Teen McCallie Ruffin, daughter of John Tom and Katie Ruffin of Brighton. On Sept. 19, the county will crown its first Little Miss Cotton Bowl. The pageant is open to girls from birth to age 12 and crowns will be won in five age divisions. Applications for this pageant will be available at Miss Tipton County. The 13th annual Miss Tipton County pageant will be held on Saturday, Aug. 7 at 7 p.m.

JUSTIN MORITZ

KIMBERLY TOWNSEND

SHERRIE LEMONS

CHELSEA KELLUM

Charger Beat It’s hard to believe but the school year has begun with a bang in the Dog Days of August. Great things are brewing for the 2010-11 year at CHS and The Charger Beat is back for its 19th year to bring you all the news that’s fit to print from your community’s high school. Here we go.

Tipton, a nursing clinical instructor at Dyersburg State Community College and a Captain in the U.S. Navy Nurse Corps.

CHELSEA KELLUM

Last August, Leah Rogers was crowned Miss Tipton County 2009 by Loren Dean, the previous titleholder. On Saturday, Rogers will crown Miss Tipton County 2010. Pictured are each of the contestants in the competition. The even will be on August 7th at the Ruffin Theater in Covington

Fletcher earns masters Diane Fletcher, of Brighton, was presented a masters hood and awarded a Master of Science in Nursing degree from South University, Savannah, Ga. during ceremonies held on June 18-19, 2010. She graduated with high honors achieving a 4.0 GPA. The masters degree in nursing is designed for registered nurses who want to enhance their knowledge, develop teaching skills, and use research in nursing practices. Diane is an Emergency Department staff member at BMH-

CARLY GORDON

BRITTANY COMBS

From the Principal's Desk… Summer vacation has come to an end and the school year is ready to begin. We are prepared to welcome back all of our students for a successful year of teaching and learning in the classroom; competing on athletic fields and courts and serving our community as great citizens. We have many challenges facing us as standards get more rigorous and proficiency levels rise. Our goals are focused on advanced scores in Algebra 1, English, Biology and US History, but our major area of attention will be meeting the bench-

Catfish caught

Coloring contest winners

marks on all the subtests on the ACT examination. Our students need to meet these benchmarks so that they will feel confident that they will be able to make the marks in college to be successful in their next stage of academic endeavors. If we do all we can to increase ACT scores, then our community will be benefited by students well prepared for the job market by colleges and universities. We are excited to welcome students this week for registration and then for a year of preparing them for success in the next stages of their lives. We encourage each of you to work with us at CHS as we attempt to meet these goals to make your son’s or daughter’s school years the most rewarding and successful that they can be. Peggy Barber Murdock Principal, Covington High School

SCV to hold banquet The Simonton-Wilcox Camp No. 257, Sons of Confederate Veterans is sponsoring a banquet at Post Office Barbque, Highway 51 South at Brighton next Thursday, Aug. 12 at 6:30 p.m. The program will commemorate the annual Tipton County Confederate Reunions held at Brighton from the 1880's until 1941. Russ Bailey will deliver the program. Non-members and guests are welcomed. The cost is $10 per person for the Barbeque meal with all the trimmings. For reservations contact Russell Bailey 476-3744 or 476-7842. The annual reunions were festive occasions for the people of Tipton County. Prominent political leaders and guests from many states usually attended. The reunions were among the leading social events of Tipton County and were sponsored by the veterans of the Joe Brown Bivouac Camp No. 1148, United Confederate Veterans.

LOOKING FOR A VEHICLE?

Pictured are the first place winners of the coloring contest sponsored by Bancorp South. From left to right are Haylee Carlew, Lilyan Williams, Bancorp President Ralph Cousar and Hunter Belk.

CALL CRAMER 901-570-0424

Curtis Fayne of Covington caught some fish on a private lake. He is pictured here holding one four-pound Bass, one three-pound Bass, and one catfish that is approximately 13 pounds.

MHS Cougars

MUNFORD HIGH SCHOOL C L A S S O F 1 9 9 0 20 YEAR REUNION

Homer Skelton Ford Millington “Hard work is all I know” millingtonford.com

Sportman’s Choice, Inc. HandgunCarrying Carrying Permit Handgun PermitClasses Classes

Pictured are the second place winners of the coloring contest sponsored by Bancorp South. From left to right are Mina Judith Weldy, Bancorp President Ralph Cousar, and Katie Gibson.

CPU Etc.

803 Hwy. 51 North • Covington, TN 38019

476-8818 Computer Repairs • Computer Sales Computer Rentals Virus Removal • Free Estimates

B10.indd 1

September 24- 26th

Registration Deadline: August 1, 2010

Tuesday Thursday• nights hours/night Everyand Saturday 1 Day• •4 8 Hours Every Saturday • 1 Day • 8 Hours $85.00 including ammunition $85.00 including ammunition Couples Special - $125.00 Couples Special - $125.00 Free1 hour 1 hour range timethis with this class Free range time with class($10 Value)

($10 Value)

Get Ready for the Time of Your Life….. Reminisce about days gone by, renew friendships and make new memories!

Specials!

Invitations have been mailed. If you did not receive one or need more details, please contact:

Buy any of your ammo from us and receive “Free” range time.

Jamie Justice or 901-828-7119 tribemomma@aol.com

Sherri Scott Kidd 901-476-2399

Limited time offer

8440 Highway 51 South, Suite A • Brighton, TN 38011 901-8403006 • www.sportsmanschoice3006.com

8/4/10 12:05:17 PM

The Leader - August 5, 2010  

Weekly edition of The Leader - Aug. 5, 2010

Read more
Read more
Similar to
Popular now
Just for you