Page 1

EROTIC POEMS from the

SANSKRIT A N A N T H O LO G Y

E D I T E D A N D T R A N S L AT E D B Y

R. Parthasarathy


EROTIC POEMS FROM THE SANSKRIT

Translations from the Asian Classics


TRANSLATIONS FROM THE ASIAN CLASSICS Editorial Board Wm. Theodore de Bary, Chair Paul Anderer Donald Keene George A. Saliba Haruo Shirane Burton Watson Wei Shang


Erotic Poems from the Sanskrit An Anthology

Edited and translated by

R. PARTHASARATHY

&ROXPELD8QLYHUVLW\3UHVV೉_೉1HZ<RUN


&ROXPELD8QLYHUVLW\3UHVVZLVKHVWRH[SUHVVLWVDSSUHFLDWLRQIRUDVVLVWDQFH JLYHQE\WKH3XVKNLQ)XQGLQWKHSXEOLFDWLRQRIWKLVERRN

Columbia University Press Publishers Since 1893 1HZ<RUN೉&KLFKHVWHU:HVW6XVVH[ FXSFROXPELDHGX &RS\ULJKW‹&ROXPELD8QLYHUVLW\3UHVV All rights reserved Library of Congress Cataloging-in-Publication Data 1DPHV3DUWKDVDUDWK\5HGLWRUWUDQVODWRU 7LWOH(URWLFSRHPVIURPWKH6DQVNULWDQDQWKRORJ\>HGLWHGDQGWUDQVODWHGE\@ 5¬3DUWKDVDUDWK\ 'HVFULSWLRQ1HZ<RUN&ROXPELD8QLYHUVLW\3UHVV_6HULHV7UDQVODWLRQV IURP¬WKH$VLDQFODVVLFV_,QFOXGHVELEOLRJUDSKLFDOUHIHUHQFHVQGLQGH[ ,GHQWLϮHUV/&&1 SULQW _/&&1 HERRN _ ,6%1¬ HOHFWURQLF _,6%1 FORWKDFLGIUHHSDSHU _ ,6%1 SENDFLGIUHHSDSHU

6XEMHFWV/&6+(URWLFSRHWU\6DQVNULW³7UDQVODWLRQVLQWR(QJOLVK_ 6 DQVNULW¬SRHWU\³7UDQVODWLRQVLQWR(QJOLVK &ODVVLϮFDWLRQ/&&3.$ HERRN _/&&3.$( SULQW _ ''&¬³GF /&UHFRUGDYDLODEOHDWKWWSV OFFQORFJRY 

&ROXPELD8QLYHUVLW\3UHVVERRNVDUHSULQWHGRQSHUPDQHQW DQGGXUDEOHDFLGIUHHSDSHU

Printed in the United States of America Cover design: Jordan Wannemacher Cover illustration: 5čGKč5DMDVWKDQL.LVKDQJDUKFD²FRXUWHV\RIWKH 1DWLRQDO0XVHXP1HZ'HOKL‹SKRWRDODP\FRP


For Mohan Arjun Gautam and Masako


CONTENTS

Acknowledgments Introduction

[LLL [Y

ABHINANDA

 

AMARU

     

7KDW·V+RZ,6DZ+HU

:KR1HHGVWKH*RGV" ,QD+XQGUHG3ODFHV $7DVWHRI$PEURVLD 3LQFHUV 7KH%ULGH

ANON

/RYHUV·4XDUUHO 7KH3OHGJH $/RYHU·V:HOFRPH 5HJUHW 6WRQHKHDUWHG )HLJQLQJ6OHHS 5HPRUVH

       


:DONLQJWKH6WUHHWE\+HU+RXVH 7KH6KHHWV $:RPDQ:URQJHG $XEDGH /LNHWKH:KHHOVRID&KDULRW 7KH:RUG $Q,QYLWDWLRQ 7KH7UDYHOHU 7KH'HYRWHG:LIH 7KH.LQJGRP┬иV+DSSLQHVV +DLU :LOG1LJKWV 7KDQN2¤ИHULQJ $WWKH&UHPDWLRQ*URXQG 2QD5DLQ\'D\ :KHQ:LQWHU&RPHV -HZHOV 7KH&UHDNLQJ%HG 6KH3URWHVWV7RR0XFK 6KH'RHVQ┬иW/HW*RRI+HU3ULGH 7KH:D\VRI/RYH $/RYHU┬иV:RUG 7KH+DZN $1HHGOH 7LPH:DVWHG 7KH6FKRODU┬иV/LIH )RROLVK+HDUW 6XSUHPH%OLVV

                           

%К┤┘Ф$

 

%+$57▀ђ+$5,

  

,QD&RUQHURIWKH9LOODJH6KULQH

:LVH0HQ 3RHWV┬и([FHVVHV

рїЪрЄ╣рЄ╣рЄ╣Я│ЅрЁљріѓрЅерІДрЁхрЅерІДрІў


7KH/RYH*DPH +LSV )HDURI'HDWK 'HVLUH$ORQH $GRUDWLRQRI:RPDQ 7KH3RHW6SHDNVWRWKH.LQJ &RQWHQWPHQW 0DQ·V/LIH 2OG$JH :KLWH)ODJ

         

%+Ǵ6.$5$,,

 

%+$9$%+࢜7,

 

%+Ǵ9$.$'(9ԣ

 

BHOJA

 

%,/+$٫$

   

DEVAGUPTA

 

'+$50$.ԣ57,

 

-$*$11Ǵ7+$3$٫ˣ,7$5Ǵ-$

 

(OHPHQWDU\$ULWKPHWLF

7KH&ULWLF6FRUQHG

%LWWHU+DUYHVW

6FUDPEOLQJ2XWRIWKH:DWHU

%LWH0DUNV ,Q/LIH$IWHU/LIH $OOIRU/RYH

'UXPEHDWV

7KH:D\

,QGUD·V+HDYHQ

ᅐኂቨዧᅵቨዧዘ೉ᇹጳ


-$*+$1$&$3$/К┤

 

.К┤/,'К┤6$

   

.$5┘Ф273$/$

 

.(▀Г$Яад$

 

.▀│(0(1'5$

 

.▀│,7нБ▀Г$

 

.80К┤5$'К┤6$

 

.8Яад$/К┤

 

0К┤*+$

  

MAHODADHI

 

025,.К┤

 

:LIH

)OLJKWRIWKH'HHU 6XFK,QQRFHQW0RYHV %OHVVHG6OHHS

7KH/DPS

7KH&DPHO

$OO(\HVRQWKH'RRU

7KH5HG6HDO

$OED

)XUWLYH/RYHPDNLQJ

7KH$UWRI3RHWU\ 6FHQW

6WRS%HLQJ:LOOIXO

'RQ┬иW*R

рї│Я│ЅрЁљріѓрЅерІДрЁхрЅерІДрІў


085К┤5,

  

5К┤-$3875$3$53$Яад,

 

5К┤-$▀Г(.+$5$

 

58'5$Яад$

 

▀Г$5$┘Ф$

 

SIDDHOKA

 

▀ГнБ/К┤%+$ЯадЯадК┤5,.К┤

 

SONNOKA

 

▀Г5нБ+$5▀│$

  

9$//$┘Ф$

   

9$5К┤+$

 

+LGGHQ)LQJHUQDLO0DUNV $Q$FWRULQD)DUFH

%ORZ2XWWKH/DPS

+HU)DFH

:KDWWKH<RXQJ:LIH6DLGWRWKH7UDYHOHU

*LUO'UDZLQJ:DWHUIURPD:HOO

7KH(PSW\5RDG

7KHQDQG1RZ

'ULYHQE\3DVVLRQ

7KH6PDUW*LUO ,Q+HU'LUHFWLRQ

6HDRI6KDPH 2QWKH*UDVV 7KH(VVHQFHRI3RHWU\

3RULQJ2YHUD%RRN

рЁљріѓрЅерІДрЁхрЅерІДрІўЯ│Ѕрї│рЄ╣


9,'<К┤

   

9,.$Яад$1,7$0%К┤

  

+ROORZ3OHDVXUHV &RPSODLQW 7KH5LYHUEDQN

7KH%HG $:RUGRI$GYLFH

<2*(▀Г9$5$

)DUIURP+RPH :KHQWKH5DLQV&RPH

  

Notes Sources of Poems Bibliography Credits Index of Titles and First Lines Index

     

рї│рЄ╣рЄ╣Я│ЅрЁљріѓрЅерІДрЁхрЅерІДрІў


ACKNOWLEDGMENTS

I

WKDQN7HUHQFH'LJJRU\%DUU\*ROGHQVRKQ5REHUW*RRGZLQDQG&KULVWRSKHU0F9H\IRUWKHLUFRPPHQWVRQHDUO\GUDIWVRIWKHPDQXVFULSW, am indebted to David Shulman for his insightful remarks on eight of WKHSRHPV,KDYHEHQHĎŽWHGIURPWKHVXJJHVWLRQVRIWKHWZRDQRQ\PRXV UHYLHZHUVZKLFKKHOSHGWRLPSURYHWKHPDQXVFULSWLPPHDVXUDEO\0\ WKDQNVDUHGXHWR$P\6\UHOODQG0DULO\Q6KHϸHURIWKH,QWHUOLEUDU\/RDQ Service of the Lucy Scribner Library at Skidmore College for getting me WKH6DQVNULWERRNV,QHHGHG0\JUHDWHVWGHEWLVWRP\ZLIH6KREKDQZKR UHDGDQGUHUHDGWKHPDQXVFULSWFDUHIXOO\VHYHUDOWLPHV,IWKHSRHPVVSHDN to us, it is in large measure because of her keen ear and good sense. -HQQLIHU&UHZHDVVRFLDWHSURYRVWDQGGLUHFWRU&ROXPELD8QLYHUVLW\ 3UHVVZDVIURPWKHEHJLQQLQJHQWKXVLDVWLFDERXWWKHZRUN+HUHQFRXUDJHPHQWDQGSDWLHQFHZHUHH[HPSODU\GXULQJP\ĎŽQDOUHYLVLRQVRIWKH PDQXVFULSW0\HGLWRU-RQDWKDQ)LHGOHUDQG/HVOLH.ULHVHODVVLVWDQWPDQDJLQJHGLWRUZHUHXQIDLOLQJLQWKHLUVXSSRUW7R0LNH$VKE\P\FRS\HGLWRU,DPLQGHEWHGIRUKLVPHWLFXORXVHGLWLQJRIWKHPDQXVFULSW+HVDZWR HYHU\GHWDLODQGQRWKLQJVHHPHGWRHVFDSHKLVZDWFKIXOH\H *UDWHIXODFNQRZOHGJPHQWLVPDGHWRWKHHGLWRUVRIWKHIROORZLQJPDJD]LQHVLQZKLFKVRPHRIWKHVHSRHPVĎŽUVWDSSHDUHGHLWKHULQHDUOLHURU current versions: Indian Literature´7KH%HGÂľ´7KH/DPSÂľ´7KH3OHGJHÂľ´:LOG1LJKWVÂľ Manushi: â&#x20AC;&#x153;Bitter Harvest,â&#x20AC;? â&#x20AC;&#x153;The Riverbankâ&#x20AC;?


Modern Poetry in Translation: â&#x20AC;&#x153;Aubade,â&#x20AC;? â&#x20AC;&#x153;The Red Seal,â&#x20AC;? â&#x20AC;&#x153;The Traveler,â&#x20AC;? â&#x20AC;&#x153;A Word of Adviceâ&#x20AC;? Poetry &KLFDJR ´7KH6KHHWVÂľ Verse´-HZHOVÂľ´7KHQDQG1RZÂľ´:KR1HHGVWKH*RGV"Âľ Weber Studies´7KH$UWRI3RHWU\Âľ´&RPSODLQWÂľ

á&#x152;łá&#x2021;šá&#x152;&#x;ŕł&#x2030;á&#x201A;?á&#x2026;?á&#x2C6;łá&#x2030;¨á&#x160;&#x201A;á&#x152;Şá&#x2030;&#x2C6;á&#x2026;ľá&#x2026;Ąá&#x2021;&#x20AC;á&#x2030; á&#x2026;ľá&#x2030;¨á&#x2039;§á&#x2039;&#x2DC;


INTRODUCTION

T

KLVVHOHFWLRQRISRHPVLVSHUVRQDOLWGRHVQRWDWWHPSWWREHUHSUHVHQWDWLYHRI6DQVNULWSRHWU\LQJHQHUDO,WFRPSULVHVSRHPVWKDW , KDYH HQMR\HG UHDGLQJ DQG WKDW KDYH H[FLWHG PH , KDYH DOVR VHOHFWHG WKHP EHFDXVH , IRXQG WKHVH SRHPV PDQDJHDEOH ZLWKLQ WKH resources of modern English verse. The selection is intended for the genHUDOUHDGHUDQGORYHUVRISRHWU\ZKRPLJKWZDQWWRNQRZZKDW6DQVNULW SRHWU\LVOLNH,WRϸHUVDVDOXWDU\FRUUHFWLYHWRWKHQRWLRQVWLOOSUHYDOHQW LQWKH:HVWWKDW,QGLDQVLQWKHSDVWZHUHSUHGRPLQDQWO\RWKHUZRUOGO\DQG VSLULWXDOO\PLQGHG1RWKLQJFRXOGEHIXUWKHUIURPWKHWUXWK7KHVHSRHPV UHϰHFWDFXOWXUHWKDWFHOHEUDWHVWKHSOHDVXUHVRIWKHϰHVKZLWKRXWDQ\LQKLELWLRQLQDODQJXDJHWKDWQHYHUJLYHVRϸHQVHWKDWQHYHUFURVVHVWKHOLQH EXWDOZD\VREVHUYHVWKHFDQRQVRIJRRGWDVWH,QWKLVWKH6DQVNULWSRHWV DUHRXUFRQWHPSRUDULHVGHVSLWHWKHFHQWXULHVWKDWVHSDUDWHXV7KHSRHPV VSHDNVLPSO\DQGSDVVLRQDWHO\WRDZLGHUDQJHRIKXPDQH[SHULHQFH³ORYH IXOϮOOHGDQGORYHXQIXOϮOOHGROGDJHSRYHUW\DVFHWLFLVPDQGQDWXUH³LQ a voice that moves us even today. 7KHLQWURGXFWLRQPDNHVQRSUHWHQVHWRVFKRODUVKLSLWDWWHPSWVWRSURYLGHVRPHEDVLFLQIRUPDWLRQWRWKHUHDGHUZKRFRPHVWR6DQVNULWSRHWU\ IRUWKHϮUVWWLPHDQGZKRQHHGVJXLGDQFHRQKRZWRUHDGD6DQVNULWSRHP LQWUDQVODWLRQ7KHQRWHVDWWKHEDFNRIWKHERRNWKURZOLJKWRQVSHFLϮF HOHPHQWVRIWKHSRHPVVXFKDVODQJXDJHLPDJHU\DQGWRQHDVZHOODV RQFXOWXUHVSHFLϮFUHIHUHQFHV0\JRDOLVDPRGHVWRQHWRDZDNHQWKH


LQWHUHVWRIWKHUHDGHULQWKHSRHPE\SURYLGLQJKLPRUKHUZLWKVXFKWRROV DVDUHQHFHVVDU\IRUWKHHQWHUSULVH:KHUHYHUSRVVLEOHWKHSRHPVDUHUHDG LQDFRPSDUDWLYHFRQWH[WZLWKH[DPSOHVIURP*UHHN/DWLQ(QJOLVK&KLQHVH7DPLODQG3UčNULWSRHWU\ Erotic Poems from the SanskritFRPSULVHVSRHPVE\VHYHQW\WZRSRHWV LQFOXGLQJ VHYHQ ZRPHQ SRHWV DQG WKLUW\ϮYH DQRQ\PRXV SRHWV IURP VL[WHHQZRUNVFRPSRVHGZLWKWZRH[FHSWLRQVEHWZHHQWKHIRXUWKDQG VHYHQWHHQWK FHQWXULHV 7KH SRHWV DUH SUHVHQWHG DOSKDEHWLFDOO\ IRU WKH convenience of the reader. )RUDORQJWLPHWKUHHDQWKRORJLHVRI6DQVNULWSRHWU\LQ(QJOLVKWUDQVODWLRQKDYHKHOGWKHϮHOG,QJDOOV  %URXJK  DQG0HUZLQDQG 0DVVRQ  7KHVHDQWKRORJLHVKDYHFRQWULEXWHGVLJQLϮFDQWO\WRRXU XQGHUVWDQGLQJDQGHQMR\PHQWRI6DQVNULWSRHWU\6LQFHWKHQRWKHUWUDQVODWLRQVRI6DQVNULWSRHWU\KDYHDSSHDUHGDQGHQULFKHGWKHϮHOG0LOOHU  6HOE\  DQG%DLOH\DQG*RPEULFK   Erotic Poems from the SanskritEXLOGVXSRQWKHZRUNRIWKHVHGLVWLQJXLVKHGWUDQVODWRUV,W RϸHUVDQHZYHUVHWUDQVODWLRQWKDWLQWURGXFHVWKHULFKQHVVDQGYDULHW\RI 6DQVNULWSRHWU\WRDQHZJHQHUDWLRQRIUHDGHUVLQDUREXVWFRQWHPSRUDU\ (QJOLVKLGLRPWKDWFDSWXUHVLQVRIDUDVSRVVLEOHWKHWRQHDQGUHJLVWHURI WKH6DQVNULWRULJLQDOV7KHWUDQVODWLRQVDUHDERYHDOO(QJOLVKSRHPVWKDW FDQEHUHDGZLWKSOHDVXUHE\UHDGHUVRISRHWU\ /RYHLQDOOLWVDVSHFWVLVDIDYRULWHWKHPHRIWKH6DQVNULWSRHWV3RHPV RQWKHWRSLFRIHURWLFORYH NčPD IRUPWKHFHQWHUSLHFHRIWKHDQWKRORJLHV DQGWKHWUDQVODWLRQVUHϰHFWWKLVSUHIHUHQFH7KHSRHPVDUHRIWHQVH[XDOO\ H[SOLFLWEXWWKH\QHYHURϸHQGRXUWDVWH,QWKHLURSHQQHVVWRWKHVH[XDO H[SHULHQFHWKH\KDYHDFRQWHPSRUDU\ϰDYRUWRWKHP5HDGHUVZKRZLVK WRKDYHDJUHDWHUXQGHUVWDQGLQJRI6DQVNULWHURWLFSRHWU\PLJKWZDQWWR IDPLOLDUL]HWKHPVHOYHVZLWKWKHFRQYHQWLRQVRIWKHHURWLFPRRGVSHOOHG RXWLQVXFKWH[WVDV9čWV\č\DQD·V.čPDVࡃWUD 7KHERRNRIORYHWKFHQW  RU.DO\č‫ؾ‬DPDOOD·V$QD‫ع‬JDUD‫ع‬JD 7KHVWDJHRIWKH%RGLOHVV2QHWKFHQW  6DQVNULWHURWLFSRHWU\KDVIHZHTXDOVZLWKWKHSRVVLEOHH[FHSWLRQRIWKH HURWLFSRHPVLQWKHVRFDOOHG*UHHN$QWKRORJ\FRPSLOHGE\WKH%\]DQWLQH VFKRODU&RQVWDQWLQXV&HSKDODVLQWKHWHQWKFHQWXU\LQ&RQVWDQWLQRSOH Translation from one language into another involves some loss, as WKH%XGGKLVWPRQNDQGSUROLϮFWUDQVODWRU.XPčUDMҸYD ² IDPRXVO\

ጳጟᇹ೉ᇹቨዧወኂᅡዼᅐዧᇹኂቨ


UHPLQGHGXV´,QWKHSURFHVVRIWUDQVODWLQJD6DQVNULWWH[WLQWR&KLQHVH LW¬ORVHVDOOLWVQXDQFHV¬¬¬,W·VVRPHWKLQJOLNHFKHZLQJFRRNHGULFHDQG WKHQIHHGLQJLWWRDQRWKHUSHUVRQ1RWRQO\KDVLWORVWLWVϰDYRULWZLOO DOVRPDNHKLPZDQWWRWKURZXSµ'HVSLWHWKHHPLQHQWPRQN·VRSLQLRQ LWLVSRVVLEOHWRFDUU\DFURVVWKHϰDYRURIDSRHPIURPRQHODQJXDJHWR DQRWKHU$QGWKDWLVSUHFLVHO\ZKDWWKLVVHOHFWLRQKDVDWWHPSWHGWRGR $PRQJ WKH SUREOHPV , ZUHVWOHG ZLWK LQ PDNLQJ WKHVH WUDQVODWLRQV WKHKDUGHVWRQHSHUKDSVZDVKRZWRPDNHWKH6DQVNULWSRHPVKHDUGLQ English. Here tone and register are crucial factors. English does not have D WUDGLWLRQ RI HURWLF SRHWU\ FRPSDUDEOH WR WKDW RI 6DQVNULW 7KH VH[XDO H[SOLFLWQHVVRIVRPHRIWKHSRHPVPD\QRWEHWRWKHWDVWHRIVRPHUHDGHUV$VDUHVXOW,KDGWRPRGLI\WKHWRQHDQGUHJLVWHUZLWKRXWFRPSURPLVLQJWKHLQWHJULW\RIWKHSRHPV,QWUDQVODWLQJIURP6DQVNULWLQWR(QJOLVK RQHWUDQVODWHVQRWMXVWWKHWH[WEXWDOVRDQHQWLUHFXOWXUHDQGZRUOGYLHZ WKDWUHPDLQKLGGHQOLNHVRPDQ\URRWVEHQHDWKWKHWH[W

THE ROLE OF THE POET :KDWSUHFLVHO\ZDVWKHUROHRIWKHSRHWLQWKH,QGLDQWUDGLWLRQ",QWKH5LJ 9HGD FD²ᄽᅐᅵ ZHDUHWROG 9DUX‫ؾ‬DFRQϮGHGLQPHWKHZLVHRQH 7KULFHVHYHQQDPHVKDVWKHFRZ:KRNQRZVWKHWUDLO VKRXOGZKLVSHUWKHPOLNHVHFUHWVLIKHLVWRVSHDN WRIXWXUHJHQHUDWLRQVDVDQLQVSLUHGSRHW $FFRUGLQJWRWKHFRPPHQWDWRU6č\D‫ؾ‬D WKFHQW VSHHFK YčF LQWKH IRUPRIDFRZ aghnya KDVWZHQW\RQHPHWHUVFRUUHVSRQGLQJWRKHUEUHDVW WKURDWDQGKHDG2QO\DIWHUWKHLQWHUYHQWLRQRI9DUX‫ؾ‬D 9HGLFJRGRIQDWXUDODQGPRUDOODZ GRHVWKHSRHWZKRLVWKHZLVHRQH medhira EHFRPH WKHLQVSLUHGRQH YLSUD +LVH[FHSWLRQDONQRZOHGJHLPSRVHVDUHVSRQVLELOLW\RQKLP+HLVERWKWKHNHHSHUDQGWKHWUDQVPLWWHURIWKHWUDGLWLRQ WKDWUHJDUGHGSRHWU\DVDZD\RINQRZOHGJH,WZDVEHOLHYHGWKDWWKHVSRNHQZRUGSURSHUO\IRUPXODWHGFRXOGSURGXFHDSK\VLFDOHϸHFWRQWKH

ᇹቨዧወኂᅡዼᅐዧᇹኂቨ೉ጳጟᇹᇹ


ZRUOG7KHZRUGZDVLQYHVWHGZLWKVDFUHGSRZHU7KLVLPDJHRIWKHSRHW DVDVHHU ‫ߙޢ‬L LQWKH9HGLFSHULRGJLYHVZD\LQODWHUWLPHVWRWKDWRIWKH SRHWDVDOHDUQHGPDQRIUHϮQHGVHQVLELOLW\DQGWDVWH NDYL ZKRPDGHKLV OLYLQJDVDFRXUWSRHW1RWDOOSRHWVZHUHKRZHYHUIRUWXQDWHHQRXJKWR PDNHWKHLUOLYLQJDVFRXUWSRHWV7KHFDVHRIWKH.DVKPLULSRHW%LOKD‫ؾ‬D WKFHQW FRPHVWRPLQG$IWHUPDQ\XQVXFFHVVIXODWWHPSWVWRILQG D SDWURQKHHYHQWXDOO\IRXQGRQHLQWKH&č‫ד‬XN\DNLQJ9LNUDPčGLW\D9, 7ULEKXYDQDPDOOD U² RI.DO\č‫ؾ‬D SUHVHQWGD\%DVDYDNDO\DQLQ %LGDU'LVWULFW.DUQDWDND +HUHSDLGKLVSDWURQDKXQGUHGIROGE\FRPSRVLQJDIXOVRPHSDQHJ\ULFLQKLVKRQRU7KH'HHGVRI+LV0DMHVW\9LNUDPč‫ع‬ND 9LNUDPč‫ع‬NDGHYDFDULWD  7KHWZHOIWKFHQWXU\SRHWDQGFULWLF.ߙHPHQGUDDOVRIURP.DVKPLU WDNHVDQH[DOWHGYLHZRIWKHSRHW·VYRFDWLRQ $SRHWVKRXOGOHDUQZLWKKLVH\HV the forms of leaves KHVKRXOGNQRZKRZWRPDNH SHRSOHODXJKZKHQWKH\DUHWRJHWKHU he should get to see ZKDWWKH\DUHUHDOO\OLNH KHVKRXOGNQRZDERXWRFHDQVDQGPRXQWDLQV in themselves and the sun and the moon and the stars his mind should enter into the seasons he should go DPRQJPDQ\SHRSOH LQPDQ\SODFHV and learn their languages. :RUNVRQSRHWLFVVXFKDV5čMDߓHNKDUD·V WKFHQW An Inquiry into Poetry .čY\DPҸPčؐVD RϸHUHODERUDWHDFFRXQWVRIDSRHW·VHGXFDWLRQDQGRIWKH IDFXOWLHVKHPXVWSRVVHVVLQRUGHUWREHDSRHW His readers and listeners ZRXOGOLNHKLPEHFRQQRLVVHXUV VDK‫ޢ‬GD\DV DQGZRXOGEHHGXFDWHGDQG HQGRZHGZLWKVLPLODUIDFXOWLHV3RHWU\ZDVDKLJKO\FXOWLYDWHGDUW,WZDV SDWURQL]HGE\NLQJVDQGϰRXULVKHGLQWKHLUFRXUWV$%HUULHGDOH.HLWKKDV

ጳጟᇹᇹᇹ೉ᇹቨዧወኂᅡዼᅐዧᇹኂቨ


GHVFULEHGWKHVLWXDWLRQZHOO´7KHJUHDWSRHWVRI,QGLDZURWHIRUDXGLHQFHV RIH[SHUWVWKH\ZHUHPDVWHUVRIWKHOHDUQLQJRIWKHLUGD\ORQJWUDLQHGLQ WKHXVHRIODQJXDJHDQGWKH\DLPHGWRSOHDVHE\VXEWOHW\QRWVLPSOLFLW\ RIHϸHFW7KH\KDGDWWKHLUGLVSRVDODVLQJXODUO\EHDXWLIXOVSHHFKDQGWKH\ FRPPDQGHGHODERUDWHDQGPRVWHϸHFWLYHPHWUHVµ Sanskrit literary culture has been the subject of research and study in recent years.,KDYHSURYLGHGZKHUHYHUQHFHVVDU\KLVWRULFDOFRQWH[WVIRU WKHSRHWVWKHFLUFXPVWDQFHVDQGFRQVWUDLQWVXQGHUZKLFKWKH\ZURWHWKH VRUWRIUHFHSWLRQWKHLUZRUNUHFHLYHGDQGWKHIUXVWUDWLRQVWKH\H[SHULHQFHGLQWKHLUVHDUFKIRUDSDWURQ6DQVNULWZDVDQ´DUWLϮFLDOµODQJXDJH OHDUQHG DIWHU D ´QDWXUDOµ ODQJXDJH 3UčNULW  KDG EHHQ OHDUQHG ,W ZDV UHVWULFWHGWRWKHHGXFDWHGFODVVHVDQGZDVXVHGLQWKHFRXUWVDQGLQUHOLJLRXVLQVWLWXWLRQV$VDSDQ,QGLDQODQJXDJHLWZDVQRWWLHGWRDQ\VSHFLϮF UHJLRQ$VDUHVXOW6DQVNULWSRHWU\FDPHWRKDYHDSDQ,QGLDQDXGLHQFH 7KHFRXUWZDVWKHHSLFHQWHURI6DQVNULWOLWHUDU\FXOWXUH,WLQFOXGHGSRHWV VFKRODUVSURIHVVLRQDOUHFLWHUVRISRHWU\DQGVWRU\WHOOHUV$WSRHWV·JDWKHULQJVRUJDQL]HGE\WKHFRXUWSRHPVZHUHUHFLWHGRUVXQJSRHWU\ZDV QRWPHDQWWREHUHDG3RHWVϰRFNHGWRWKHFRXUWLQVHDUFKRISDWURQDJHLQ UHWXUQWKH\VDQJWKHSUDLVHVRIWKHNLQJ 7KH 6DQVNULW SRHW UDUHO\ H[SUHVVHV KLV RZQ WKRXJKWV DQG IHHOLQJV 7KH QRWLRQ RI LQGLYLGXDO VHOIH[SUHVVLRQ ZDV IRUHLJQ WR WKH FXOWXUH DW WKDWWLPH:KDWWKHSRHWH[SUHVVHVDUHWKHWKRXJKWVDQGIHHOLQJVRIWKH SHUVRQDHLQDJLYHQVLWXDWLRQWKHXQIDLWKIXOKXVEDQGUHWXUQLQJKRPHDW GDZQDIWHUDQLJKWZLWKDFRXUWHVDQWKHZLIHRYHUMR\HGRQVHHLQJKHU KXVEDQGUHWXUQIURPKLVWUDYHOVDEURDGWKHKHUPLWH[SUHVVLQJKLVGLVDIIHFWLRQZLWKWKHZRUOGDQGVRRQ7KHSRHW·VRULJLQDOLW\OLHVLQWKHZD\ KHH[SORLWVZRUGVLPDJHVDQGPHWHULQIDFWDOOWKHUHVRXUFHVRIWKHODQJXDJH WR PDNH DQ H[SHUWO\ FUDIWHG SRHP WKDW ZRXOG UHGRXQG WR KLV glory.

READING A SANSKRIT POEM 7KHLQWURGXFWLRQRϸHUVFORVHUHDGLQJVRIDQXPEHUSRHPVLQWKHOLJKWRI 6DQVNULWSRHWLFV/HWXVORRNDWDQDQRQ\PRXVSRHP´7KH6KHHWVµ S 

ᇹቨዧወኂᅡዼᅐዧᇹኂቨ೉ጳᇹጳ


from Amaru’s One Hundred Poems $PDUXߓDWDNDWKFHQW DQLQϰXHQWLDO DQWKRORJ\RIHURWLFYHUVHWUDQVFULEHGLQURPDQW\SHIROORZHGE\DZRUG IRUZRUGWUDQVODWLRQDQGDYHUVHWUDQVODWLRQ7KHRULJLQDOSRHPVGRQRW KDYHWLWOHV,KDYHSURYLGHGWKHWLWOHVIRUWKHWUDQVODWLRQV NYDFLWWčؐEࡃOčNWDєNYDFLGDJDUXSD‫ع‬Nč‫ع‬NDPDOLQDє NYDFLFFࡃU‫ؾ‬RGJčUҸNYDFFLGDSLFDVčODNWDNDSDGDє_ YDOҸEKD‫ع‬JčEKRJDLUDODNDSDWLWDLєVҸU‫ؾ‬DNXVXPDLє VWUL\čQčQčYDVWKDؐSUDWKD\DWLUDWDؐSUDFFKDGDSDࠃDє__ KHUH>ZLWK@EHWHOMXLFHVPXGJHGKHUH>ZLWK@ DORHSDVWHEXUQLVKHG KHUHSRZGHUULVLQJKHUHHYHQDQGSDLQWHG>ZLWK@ ODFIRRWSULQWV IROGVFUXPSOHGZLQGLQJKDLUIDOOHQVWUHZQϰRZHUV >WKH@ZRPDQ·V>LQ@HYHU\SRVLWLRQFHOHEUDWHSOHDVXUHRIPDNLQJ ORYH>WKH@VKHHWV 7KHYLUJXOHVLQGLFDWHSKUDVHRUFODXVHERXQGDULHVWKDWDUHPDUNHGZLWK Arabic numerals. 6PXGJHGKHUHZLWKEHWHOMXLFHEXUQLVKHGWKHUH ZLWKDORHSDVWHDVSODVKRISRZGHULQRQHFRUQHU DQGODFIURPIRRWSULQWVSDLQWHGLQDQRWKHU ZLWKϰRZHUVIURPKHUKDLUVWUHZQDOORYHU LWVZLQGLQJFUXPSOHGIROGVWKHVKHHWVFHOHEUDWH WKHZRPDQ·VSOHDVXUHRIPDNLQJORYHLQHYHU\SRVLWLRQ 7KHYHUVHIRUPLVDVLQJOHVWDQ]DRIIRXUOLQHV muktaka WKHFRPPRQHVW RIDOOIRUPVLQ6DQVNULWSRHWU\7KHVWDQ]DDQGQRWWKHOLQHDVLQ*UHHNDQG /DWLQSRHWU\LVWKHEDVLFVWUXFWXUDOXQLW7KHϮUVWWKUHHOLQHVRIWKHSRHP FRPSULVHQRXQ HJDJDUXSD‫ع‬Nč‫ع‬ND´DORHSDVWHµ DQGYHUE HJNYDFLW DNWDє´VPXGJHGKHUHµ SKUDVHVWKH\ODFNWKHVXEMHFWSUHGLFDWHVWUXFWXUH RIDFODXVH7KHVXEMHFW SUDFFKDGDSDࠃDє´WKHVKHHWVµ DQGWKHYHUE prathayati´FHOHEUDWHµ DSSHDURQO\LQOLQH7KHLQϰHFWLRQDOQDWXUHRIWKH ODQJXDJHDOORZVWKLVIUHHGRP7KHHQWLUHVWDQ]DLVRQHVHQWHQFH ጳጳ೉ᇹቨዧወኂᅡዼᅐዧᇹኂቨ


7KHZRUG´VKHHWVµKDVORQJEHHQSDUWRIWKHHXSKHPLVPVIRUORYHPDNLQJ([SUHVVLRQVLQFOXGH´EHWZHHQWKHVKHHWVµ´SRVVHVVDZRPDQ·VVKHHWVµ DQG ´VKDNLQJ RI WKH VKHHWVµ 6RFLDO FRQYHQWLRQV KRZHYHU SURKLELW WKH SRHWIURPGHVFULELQJWKHYDULRXVSRVLWLRQV+HJHWVDURXQGWKHSURKLELWLRQ E\ GHVFULELQJ WKH WUDFHV OHIW E\ WKH ZRPDQ ZKR ZDV SUREDEO\ D FRXUWHVDQ JD‫ؾ‬LNč RQWKHEHGVKHHWVGXULQJORYHPDNLQJ7KHWHOOWDOHPDUNV RQWKHVKHHWV³´EHWHOMXLFHµ´DORHSDVWHµ´VSODVKRISRZGHUµ´ODFIURP IRRWSULQWVµDQG´ϰRZHUVIURPKHUKDLUµ³EHDUZLWQHVVWRDQLJKWRIZLOG ORYHPDNLQJE\WKHZRPDQ %\FRQFHQWUDWLQJDOPRVWHQWLUHO\RQWKHEDFNJURXQGWKHSRHWIRUFHV WKHUHDGHU·VDWWHQWLRQRQWKHIRUHJURXQG³WKHZRPDQ·VORYHPDNLQJLQ ´HYHU\SRVLWLRQµ,QKLV,QWHUSUHWDWLRQRI/RYH ߭‫عޢ‬JčUDGҸSLNčFD RQH of the four commentaries on Amaru’s One Hundred Poems, the commentaWRU9HPDEKࡃSčODLGHQWLϮHVHDFKRIWKHWHOOWDOHPDUNVZLWKDVSHFLϮFSRVLWLRQWKH´EHWHOMXLFHµZLWKWKH´SRVLWLRQRIWKHFDWµWKH´DORHSDVWHµZLWK WKH´SRVLWLRQRIWKHHOHSKDQWµWKH´VSODVKRISRZGHUµZLWKWKH´SRVLWLRQ RIWKHFRZµDQG´ODFIURPIRRWSULQWVµZLWKWKHXQRUWKRGR[SRVLWLRQWKH ZRPDQRQWRSRIWKHPDQ9čWV\č\DQD·V.čPDVࡃWUDRϸHUVWKHFODVVLF GHVFULSWLRQRIWKHVHSRVLWLRQV DQG  6DQVNULWSRHWU\LVEHVWXQGHUVWRRGLQWKHOLJKWRIWZRNH\FRQFHSWVrasa and GKYDQL7KHZRUGrasaPHDQV´ϰDYRUµ´UHOLVKµRU´WDVWHµ´0RRGµ ZRXOGEHDEHWWHUWUDQVODWLRQ'LϸHUHQWHPRWLRQV EKčYDV VXFKDVSDVVLRQ JULHISHDFHDQGVRRQWKDWDUHLQKHUHQWLQHYHU\KXPDQEHLQJLQGXFH WKHFRUUHVSRQGLQJPRRGV rasaV VXFKDVWKHHURWLFWKHWUDJLFWKHSHDFHIXODQGVRIRUWKWKURXJKWKHSRZHURIVXJJHVWLRQNQRZQDVGKYDQL. The ZRUGGKYDQL means “sound,” “overtones,” or “resonance.” “Suggestion” ZRXOGEHDEHWWHUWUDQVODWLRQ:KHQDQLPDJHDFWLRQRUVLWXDWLRQ VWLPulant, or YLEKčYD LVREMHFWLYHO\SUHVHQWHGLQDSRHPLWHYRNHVDVSHFLϮF HPRWLRQLQWKHUHDGHU2QFHWKHHPRWLRQLVSXUJHGRILWVLPSXULWLHVLWFDOOV IRUWKWKHFRUUHVSRQGLQJPRRGUHDOL]HGWKURXJKWKHSRZHURIVXJJHVWLRQ 7KHDHVWKHWLFH[SHULHQFHLVWKHRXWFRPHRUFXOPLQDWLRQRIWKHUHϮQHPHQW RIWKHHPRWLRQ7KHSURFHVVLPSOLHVWKH´HOHYDWLRQRIWKHFRQVFLRXVQHVVRI WKHSRHWDQGWKHUHDGHUIURPWKHSODQHRIWKHLUSULYDWHHYHU\GD\ZRUOG WRWKHSODQHRIFROOHFWLYHKXPDQH[SHULHQFHZKHUHSRHWU\LVFUHDWHGDQG enjoyed.”(DFKSRHPZLOOKDYHDGRPLQDQWrasa, and the means of achieving it is through suggestion. ᇹቨዧወኂᅡዼᅐዧᇹኂቨ೉ጳጳᇹ


Nine rasas are generally recognized: the erotic, the comic, the tragic, the cruel, the heroic, the fearsome, the loathsome, the marvelous, and the SHDFHIXO+HUHLVDOLVWRIWKHVWDEOHHPRWLRQV VWKč\LEKčYDV ZLWKWKHLUFRUUHVSRQGLQJPRRGV rasaV 

STABLE EMOTIONS 6WKč\LEKčYDV 

MOODS RasaV

'HVLUH rati  /DXJKWHU KčVD  *ULHI ߓRND  $QJHU krodha  (QHUJ\ XWVčKD  )HDU bhaya  'LVJXVW ೓೒೓MXJXSVč  :RQGHU YLVPD\D  3HDFH ߓčQWL 

7KHHURWLF ߓ‫عޢ‬JčUD

7KHFRPLF KčV\D

7KHWUDJLF NDUX‫ؾ‬D

7KHFUXHO raudra

7KHKHURLF YҸUD

7KHIHDUVRPH EKD\čQDND

7KHORDWKVRPH EҸEKDWVD

7KHPDUYHORXV adbhuta

7KHSHDFHIXO ߓčQWD

,QWKHSRHP´7KH6KHHWVµWKHWHOOWDOHPDUNVRQWKHEHGVKHHWV³´EHWHO MXLFHµ´DORHSDVWHµ´VSODVKRISRZGHUµ´ODFIURPIRRWSULQWVµDQG´ϰRZHUVIURPKHUKDLUµ³DUHLPDJHVWKDWHYRNHWKHVWDEOHHPRWLRQRIGHVLUHLQ WKHUHDGHU3XUJHGRILWVLPSXULWLHVGHVLUHWKURXJKWKHSRZHURIVXJJHVWLRQFXOPLQDWHVLQWKHPRRGRIHURWLFORYHPRUHVSHFLϮFDOO\´FRQVXPPDWLRQRIORYHµ VDؐEKRJDߓ‫عޢ‬JčUD DQDVSHFWRIHURWLFORYHWKHRWKHUEHLQJ ´VHSDUDWLRQLQORYHµ YLSUDODPEDߓ‫عޢ‬JčUD 7KHWHOOWDOHPDUNVRQWKHVKHHWV VXJJHVWDVPXFK7KH\DUHWKHRQO\FOXHVWKHUHDGHULVRϸHUHG)DPLOLDULW\ ZLWKDQFLHQW,QGLDQHURWLFSUDFWLFHVZLOOKHOSWKHUHDGHUWRPDNHVHQVHRI WKHSRHP7KURXJKWKHXVHRIVXJJHVWLRQWKHSRHWEULQJVRXWWKHLPSOLFLW PHDQLQJVRI´VKHHWVµDQLPDJHWKDWUHVRQDWHVLQWKHSRHPWRFUHDWHWKH mood of love in the reader. “Sheets” is not only a tactile image but a visual and olfactory one as ZHOO7KHSRHPLVDIHDVWRIROIDFWRU\GHOLJKWV,WUHFRJQL]HVWKHHURWLFSRVVLELOLWLHVRIVFHQWVVXFKDVDURPDWLFKHUEVDQGSHUIXPHVLQORYHPDNLQJ 2WKHUFXOWXUHVDUHHTXDOO\H[SOLFLWRQWKLVPDWWHU3URYHUEV²VD\V ´,KDYHSHUIXPHGP\EHGZLWKP\UUKDORHVDQGFLQQDPRQ&RPHOHWXV WDNHRXUϮOORIORYHXQWLOWKHPRUQLQJOHWXVVRODFHRXUVHOYHVZLWKORYHVµ

ጳጳᇹᇹ೉ᇹቨዧወኂᅡዼᅐዧᇹኂቨ


.DO\č‫ؾ‬DPDOOD·V$QD‫ع‬JDUD‫ع‬JDVSHDNVRIWKHLPSRUWDQFHRIDϮQHHQYLURQment for lovemaking: &KRRVHDFRXUW\DUGWKDWLVKLJKXSLQWKHPDQVLRQ WKDWLVVSDFLRXVSOHDVDQWDQGQHZO\ZKLWHZDVKHG WKDWLVSHUIXPHGE\LQFHQVHIURPDORHDQGRWKHUIUDJUDQW substances, WKDWLVϮOOHGZLWKWKHVRXQGRIPXVLFDOLQVWUXPHQWVDQGLVEULJKW ZLWKODPSOLJKW +HUHOHWWKHPDQPDNHORYHWRWKHZRPDQIUHHO\WRKLVKHDUW·V content. 7KHVHQVHRIWRWDODEDQGRQZLWKZKLFKWKHZRPDQPDGHORYHDOORYHU WKHEHGLVEURXJKWKRPHLQ´7KH6KHHWVµE\WKHLQVLVWHQWUHSHWLWLRQRIWKH DGYHUE´KHUHµ NYDFLW 7KHHQWLUHSRHPLVRQHVHQWHQFHZKHUHLQWKHVXEMHFW´WKHVKHHWVµ SUDFFKDGDSDࠃDє LVGHOLEHUDWHO\ZLWKKHOGXQWLOWKHYHU\ HQGWRFUHDWHVXVSHQVH7KHSRHWLQYLWHVWKHUHDGHUWRH[SHULHQFHWKHMR\ RIORYHPDNLQJYLFDULRXVO\IURPEHKLQGWKHYHLORIODQJXDJH7KHSRHPLV DQHURWLFPDVWHUSLHFH ,QWKHWUDQVODWLRQWKHIRXUOLQHVRI6DQVNULWHDFKRIZKLFKKDVVHYHQWHHQV\OODEOHVKDYHH[SDQGHGWRVL[OLQHVLQ(QJOLVKWKDWYDU\LQOHQJWK IURPQLQHWRWKLUWHHQV\OODEOHV7KHFODVVLFDOPHWHULVUHSODFHGE\IUHH YHUVH7KLVLVQRGRXEWDQLPSRYHULVKPHQWEXWLWLVDOPRVWLPSRVVLEOHWR UHSURGXFHWKHTXDQWLWDWLYHPHWHUVRI6DQVNULWLQDVWUHVVWLPHGODQJXDJH such as English. The erotic mood of the original has, I believe, come WKURXJKDQGVRKDVLWVGHOLFDWHWRQH7KHYRLFHRIWKH6DQVNULWSRHWLVKHDUG GLVWLQFWO\7KHSRHP·VUK\WKPLFϰRZLVXQPLVWDNDEOHDQGVRLVLWVXQLQhibited celebration of erotic love. %\XVLQJDVIHZZRUGVDVSRVVLEOHWKHVWDQ]DSRHPDFKLHYHVDQXQXVXDO LQWHQVLW\RIYLVLRQ,QWKLVXQLRQRIH[SHULHQFHDQGWKHZRUGWKHSRHP WDNHVWKHVKDSHRIDQHSLJUDP7KHVWDQ]DSRHPUHPDLQVDQHQGXULQJIRUP in Indian literature. &XOWXUH GHWHUPLQHV D VRFLHW\·V DWWLWXGH WRZDUG VH[ 7KLV SHUKDSV H[SODLQVZK\WKH,QGLDQYLHZRIORYHGLϸHUHGIURPVD\WKH*UHHNYLHZ *UHHN FXOWXUH IDYRUHG KRPRHURWLF ORYH RYHU KHWHURVH[XDO ORYH DV LV

ᇹቨዧወኂᅡዼᅐዧᇹኂቨ೉ጳጳᇹᇹᇹ


HYLGHQWIURPHYHQDFDVXDOUHDGLQJRI*UHHNHURWLFSRHWU\,IZRPHQϮJXUHGLQWKHSRHWLFGLVFRXUVHWKH\ZHUHLQYDULDEO\FRXUWHVDQV7DNHIRU H[DPSOH$VFOHSLDGHV·V´7KH:DLVWEDQGRI+HUPLRQHµ SS[[Y²[[YL DQG 'LRVFRULGHV·V´'RULVµ S[[L[ *UHHNZRPHQZHUHSURWHFWHGIURPPHQ RXWVLGH WKHLU LPPHGLDWH IDPLO\ /RYH SRHWU\ DGGUHVVHG WR RQH·V ZLIH LV QRQH[LVWHQW 6DQVNULW HURWLF SRHWU\ ZDV DOVR FRPSRVHG SULPDULO\ E\ PHQDVVXFKLWUHϰHFWVWKHDWWLWXGHVWRZDUGZRPHQWKDWZHUHFRPPRQ WRSDWULDUFKDOVRFLHWLHV:RPHQZKRϮJXUHGLQ6DQVNULWHURWLFSRHWU\ ZHUHJHQHUDOO\EXWQRWH[FOXVLYHO\FRXUWHVDQV8QOLNH*UHHNSRHWU\6DQVNULWSRHWU\RϸHUVH[DPSOHVRIORYHSRHPVDERXWRQH·VVSRXVH6HHIRU H[DPSOH´$XEDGHµ S DQG߭ҸOčEKDࠃࠃčULNč·V´7KHQDQG1RZµ S  $JDLQ +HUPLRQH DQG 'RULV DUH FRXUWHVDQV ZKR DUH PHQWLRQHG E\ QDPHLQWKHSRHPV,Q6DQVNULWSRHWU\QRWDVLQJOHZRPDQLVPHQWLRQHG E\QDPH:RPHQUHPDLQDQRQ\PRXV7KHLQGLYLGXDOLVUHSODFHGE\WKH W\SH &RXUWHVDQVϮJXUHSURPLQHQWO\LQ6DQVNULWHURWLFSRHWU\7KH.čPDVࡃWUD ² PDNHVDGLVWLQFWLRQEHWZHHQFRXUWHVDQV JD‫ؾ‬LNčV DQGSURVWLWXWHV YHߓ\čV &RXUWHVDQVDUHKLJKO\FXOWLYDWHGZRPHQZKRDUHVNLOOHG in the arts and cater to a select clientele. Prostitutes, on the other hand, GRQRWSRVVHVVWKHH[FHSWLRQDOTXDOLWLHVRIWKHIRUPHUDQGWKH\RϸHUWKHLU VHUYLFHVLQH[FKDQJHIRUPRQH\

ASPECTS OF LOVE (URWLF ORYH KDV WZR DVSHFWV FRQVXPPDWLRQ RI ORYH DQG VHSDUDWLRQ LQ ORYH7KHϮUVWLVDERXWORYHUV·PHHWLQJVERWKOLFLWDQGLOOLFLWDQGKDVDV LWVREMHFWWKHFRQVXPPDWLRQRIORYH7KHVHFRQGLVDERXWORYHUV·SDUWLQJV WKHEUHDNXSRIUHODWLRQVKLSVEHFDXVHWKHPDQKDVEHHQXQIDLWKIXO6HSDUDWLRQVDUHJHQHUDOO\RQO\WHPSRUDU\WKHZRPDQIRUJLYHVKHUSKLODQGHULQJ ORYHUDQGWKHWZRDUHUHXQLWHG7KHSRHPVGRQRWDOZD\VVSHFLI\ZKHWKHU the lovers are married or not. /HWXVORRNDWVRPHSRHPVWKDWLOOXVWUDWHERWKDVSHFWVRIORYH+HUHLV DSRHP´&RPSODLQWµ S E\9LG\č ϰWK²WKFHQW WKHSUHHPLQHQW ZRPDQSRHWLQ6DQVNULWIURP9LG\čNDUD·VA Treasury of Well-Turned Verse

ጳጳᇹጟ೉ᇹቨዧወኂᅡዼᅐዧᇹኂቨ


6XEKčߙLWDUDWQDNRߙDFD 9LG\čLVFRPSDUDEOHWR6DSSKR ϰFD ᄽᅐᅵ LQ*UHHNDQG6XOSLFLD VWFHQWᄽᅐᅵ LQ/DWLQ +RZIRUWXQDWH\RXDUHP\IULHQGV <RXFDQVSHDNRSHQO\DERXWWKHJRLQJVRQ ZLWK\RXUORYHUVWKHLGOHWDONWKHODXJKWHU DQGIXQWKHHQGOHVVURXQGVRISOHDVXUH As for me, once my lover undid the knot of my skirt, ,VZHDU,UHPHPEHUQRWKLQJ 7KH6DQVNULWSRHWUHFRJQL]HGWKHSULPDF\RIVLJKWDQGWRXFKLQVH[XDOUHODWLRQV 9LG\č RϸHUV VXϲFLHQW SK\VLFDO GHWDLOV ZLWKRXW EHLQJ RϸHQVLYH 7KHGHWDLO´RQFHP\ORYHUXQGLGWKHNQRWRIP\VNLUWµLVSRZHUIXOYLVXDOO\ DQGWDFWLOHO\7KHVSHDNHULVUHOXFWDQWWRWDONDERXWKHUH[SHULHQFHLQWKH SUHVHQFHRIKHUIULHQGV2UJDVPUHQGHUVKHUVSHHFKOHVV7KHH[SHULHQFH LWVHOILVVRFRPSOHWHWKDWLWOHDYHVQRWUDFHRIPHPRU\6LOHQFHLVWKHRQO\ ODQJXDJHRILQWLPDF\7KURXJKVLOHQFHWKHSHUVRQDLQGLFDWHVKHUXQZLOOLQJQHVVWRFRPPXQLFDWH)RULWLVVSHHFKWKDWELQGVKHUWRWKHZRUOGLQ silence she returns to freedom. 6H[XDOO\H[SOLFLWGHVFULSWLRQVDUHJHQHUDOO\QRWFRPPRQLQ6DQVNULW SRHWU\DVWKH\PLJKWRϸHQGDJDLQVWFDQRQVRIJRRGWDVWH8QGHUWKHFLUFXPVWDQFHVZKHQDZRPDQLVSUHVVHGIRUGHWDLOVRIKHUORYHPDNLQJE\KHU IULHQGVVKHSUHWHQGVQRWWRUHPHPEHUDQ\WKLQJRIZKDWKDSSHQHG7KXV KHUIULHQGVWRJHWKHUZLWKWKHUHDGHUDUHNHSWRQHGJHE\WKHZRPDQ·V SUHWHQVH$PQHVLDPD\KDYHEHHQDZULWLQJFRQYHQWLRQXVHGWRRYHUFRPH WKHVRFLDOWDERRDJDLQVWWDONLQJRSHQO\DERXWVH[%\HϸHFWLYHO\XVLQJ DPQHVLDDVDWURSHWKHSRHWKDVVXEYHUWHGWKHFRQYHQWLRQDQGWUDQVIRUPHG D OLPLWDWLRQ LQWR D WULXPSK 6HH DOVR ´:LOG 1LJKWVµ S   DQG 9LNDࠃDQLWDPEč·V´7KH%HGµ S  7KHPRWLIRIXQW\LQJWKHNQRWRIDZRPDQ·VVNLUWRFFXUVHOVHZKHUHWRR DVLQ´7KH:DLVWEDQGRI+HUPLRQHµE\WKH*UHHNSRHW$VFOHSLDGHVRI6DPRV WKFHQWᄽᅐᅵ  Chance one day found us alone together DQGDVKDSSHQVZLWKRQHWKLQJOHDGLQJWRDQRWKHU

ᇹቨዧወኂᅡዼᅐዧᇹኂቨ೉ጳጳጟ


 ,IRXQGP\ϮQJHUVXQGRLQJWKHNQRW WKDWIDVWHQHGWKHFHLQWXUHDURXQGKHUZDLVW,WZDVVKRW  WKURXJKZLWKOLPHJUHHQMHWDQGRUJDQG\WKUHDGV DQGLQWLQ\ZKLWHOHWWHULQJRQWKHXQGHUVLGH  WKHVHZRUGVZHUHVWLWFKHG´(QMR\PHDV\RXZLVK WKRXJKDW\RXURZQSHULOIRURWKHUPHQKDYHKDQGOHGthis.” :KDWLVUHPDUNDEOHDERXWWKHSRHPVRI9LG\čDQG$VFOHSLDGHVLVWKHLUVXFcess in breathing life into a traditional symbol such as the knot. Knots UHSUHVHQWFRPSOLFDWLRQVDQGHQWDQJOHPHQWVWKDWPXVWEHRYHUFRPHEHIRUH WKHORYHUVFDQEHXQLWHG7KH8SDQLߙDGVVSHDNRIXQW\LQJWKHKHDUW·VNQRW WRDWWDLQLPPRUWDOLW\7KH%XGGKD ²ᄽᅐᅵ WDXJKWKLVGLVFLSOHVWKDW XQW\LQJWKHNQRWVRIH[LVWHQFHZDVWKHϮUVWVWHSWRZDUGOLEHUDWLRQ PRNߙD  from the cycle of birth, death, and rebirth. As a symbol, the knot is thus FKDUJHGZLWKVLJQLϮFDQFH,Q´&RPSODLQWµWKHXQW\LQJRIWKHNQRWLVIROORZHGE\DWRQJXHLQFKHHNUHPDUNDERXWPDNLQJORYHWKDWHUDVHVRQH·V LGHQWLW\´,VZHDU,UHPHPEHUQRWKLQJµHϸHFWLYHO\SXWVDQHQGWRDQ\IXUWKHUTXHVWLRQV6HHWKHQRWH S RQWKHSRHP´7KH:D\VRI/RYHµ +HUHLVDQDQRQ\PRXVSRHP´7KH3OHGJHµ S IURPAmaru’s One Hundred PoemsWKDWVSHDNVDERXWVHSDUDWLRQLQORYH +H·VEURNHQWKHSOHGJHEDQLVKHGPH IURPKLVKHDUWZKHUH,KHOGDVSHFLDOSODFH 1RPRUHLQORYHKHQRZZDONVSDVWPH like any other man. The days go by DV,NHHSWKLQNLQJRIWKLVRYHUDQGRYHUDJDLQ 'HDUIULHQG,GRQ·WNQRZZK\P\KHDUW GRHVQ·WEUHDNLQWRDKXQGUHGSLHFHV 7KHZRPDQ·VORYHUKDVQRWNHSWIDLWKZLWKKHUKHKDVLQIDFWDEDQGRQHG KHU:KHQKHSDVVHVKHULQWKHVWUHHWKHIDLOVWRUHFRJQL]HKHUVKHKDV EHFRPHDFRPSOHWHVWUDQJHU6KHLVKHDUWEURNHQ+HLVRQKHUPLQGQLJKW DQGGD\DQGVKHGRHVQRWNQRZZKDWWRGR,QKHUORQHOLQHVVVKHFRQϮGHV WRKHUIULHQGDQGZRQGHUVZK\VKHLVQRWGHDGIURPDEURNHQKHDUW,Q IHZHUWKDQWKLUW\ZRUGVLQWKHRULJLQDO6DQVNULWWKHSRHPWHOOVXVDOOWKDW

ጳጳጟᇹ೉ᇹቨዧወኂᅡዼᅐዧᇹኂቨ


WKHUHLVWRNQRZDERXWXQUHTXLWHGORYH,WLVDPDQ·VZRUOGKHGRHVZKDW KHSOHDVHV7KHZRPDQLVXVXDOO\KHOSOHVV *LYHQWKHQDWXUHRI,QGLDQSDWULDUFK\LWLVQRWXQXVXDOIRUDZRPDQ ZULWHUWRKLGHKHUQDPHDQGJHQGHU$QRQ\PLW\RϸHUHGKHUDUHIXJHIURP WKHSU\LQJH\HVRIPHQ9LUJLQLD:RROI ² ZDVSUREDEO\ULJKW ZKHQVKHVDLG´$QRQZKRZURWHVRPDQ\SRHPVZLWKRXWVLJQLQJWKHP ZDV RIWHQ D ZRPDQµ ,W LV QRW LPSUREDEOH WKDW D ZRPDQ ZURWH ´7KH Pledge.” 7KH6DQVNULWSRHPEHJLQVRQDQRPLQRXVQRWHJDWHSUHPčEDQGKH OLWHUDOO\´WKHERQGRIORYHLVEURNHQµ WKDWLVKHDUWUHQGLQJ7KHZRUGgate EURNHQ IDOOVRQWKHHDUZLWKWKHIRUFHRIDVOHGJHKDPPHU,WLVDOORYHU EHWZHHQWKHP7KHUHLVQRWKLQJPRUHWREHVDLG7KHUHVWRIWKHSRHPLV MXVWDJORVVRQWKLVSKUDVH 7KHUHLVQRVXFKWKLQJDVDZRUGIRUZRUGRUHYHQDOLQHE\OLQHWUDQVODWLRQ%\DWWHPSWLQJWREHIDLWKIXOWRWKHRULJLQDOWKHWUDQVODWLRQRIWHQ IDLOVWRGRMXVWLFHWRWKHSRHP,KDYHWULHGWRPDNH$QRQ·VGLVWLQFWLYHYRLFH KHDUGLQ(QJOLVKE\ODERULQJWRJHWWKHWRQHULJKW7KHUHVXOWLVDQHTXLYDOHQWSRHPLQ(QJOLVK7KHWUDQVODWLRQFRQYH\V,KRSHWKHZRPDQ·VKHOSOHVVQHVVZKHQFRQIURQWHGZLWKWKHHQRUPLW\RIKHUORYHU·VEHWUD\DO2IWKH ϮIW\VL[ZRUGVWKDWPDNHXSWKH(QJOLVKSRHPIRUW\WKUHHDUHPRQRV\OODEOHVVXJJHVWLQJWKHUHE\WKHVSHDNHU·VEHZLOGHUPHQWDQGLQDELOLW\WR IXOO\VSHOORXWWKHPDJQLWXGHRIKHUORVV &RPSDUH´7KH3OHGJHµZLWK(]UD3RXQG·V ² ´7KH-HZHO6WDLUV· *ULHYDQFHµ  DWUDQVODWLRQRIDSRHPE\/L%DL ²  7KHMHZHOOHGVWHSVDUHDOUHDG\TXLWHZKLWHZLWKGHZ ,WLVVRODWHWKDWWKHGHZVRDNVP\JDX]HVWRFNLQJV $QG,OHWGRZQWKHFU\VWDOFXUWDLQ $QGZDWFKWKHPRRQWKURXJKWKHFOHDUDXWXPQ 3RXQG·VFRPPHQWRQWKHSRHPLVLQVWUXFWLYH´-HZHOVWDLUVWKHUHIRUHD SDODFH *ULHYDQFH WKHUHIRUH WKHUH LV VRPHWKLQJ WR FRPSODLQ RI *DX]H VWRFNLQJV WKHUHIRUH D FRXUW ODG\ QRW D VHUYDQW ZKR FRPSODLQV &OHDU DXWXPQWKHUHIRUHKHKDVQRH[FXVHRQDFFRXQWRIZHDWKHU$OVRVKHKDV FRPHHDUO\IRUWKHGHZKDVQRWPHUHO\ZKLWHQHGWKHVWDLUVEXWKDVVRDNHG

ᇹቨዧወኂᅡዼᅐዧᇹኂቨ೉ጳጳጟᇹᇹ


KHUVWRFNLQJV7KHSRHPLVHVSHFLDOO\SUL]HGEHFDXVHVKHXWWHUVQRGLUHFW UHSURDFKµ7KHODG\LVSUREDEO\RQHRIWKHLPSHULDOFRQFXELQHVLQZKRP WKHHPSHURULVQRORQJHULQWHUHVWHGWKHUHIRUHKHGRHVQ·WVKRZXS7KH ZRPDQLQWKH6DQVNULWSRHPWDONVIUHHO\DQGRSHQO\DERXWKHUVLWXDWLRQ ´+H·VEURNHQWKHSOHGJHEDQLVKHGPHIURPKLVKHDUW¬¬¬µ7KHZRPDQLQ WKH&KLQHVHSRHPLVRQWKHRWKHUKDQGUHOXFWDQWWRVSHDNDERXWKHUVLWXDWLRQ1RWRQHZRUGRIUHSURDFKHVFDSHVKHUOLSV:KDWLVXQXVXDODERXW WKH SRHP LV LWV DGPLUDEOH UHVWUDLQW %\ VD\LQJ OLWWOH LW VD\V LW DOO 7KH LPDJHV³´MHZHOOHG VWHSVµ ´ZKLWH ZLWK GHZµ ´JDX]H VWRFNLQJVµ ´FU\VWDO FXUWDLQµ´FOHDUDXWXPQµ³RϸHUWKHUHDGHUWKURXJKWKHSRZHURIVXJJHVWLRQDURDGPDSWRWKHVLWXDWLRQLQWKHSRHPWKHODG\·VGLVDSSRLQWPHQW in love. 7KH6DQVNULWSRHWVOHIWQRDVSHFWRIORYHXQWRXFKHG7KHUHDUHHYHQD IHZSRHPVRQWKHXQRUWKRGR[ZRPDQRQWRSSRVLWLRQ YLSDUҸWDUDWD +HUH LVDQH[DPSOH´:KR1HHGVWKH*RGV"µ S IURPAmaru’s One Hundred Poems: With her tangled hair in disarray, KHUHDUULQJVVZLQJLQJZLOGO\ DQGVZHDWZLSLQJRϸWKHPDUNRQKHUIRUHKHDG WKHORYHO\ZRPDQ·VH\HVGURRS from the fatigue of riding her lover. /RQJPD\KHUIDFHSURWHFW\RX %UDKPč9Lߙ‫ؾ‬XDQG߭LYD³ ZKRQHHGVWKHJRGVQRZ" The .čPDVࡃWUDUHFRPPHQGVWKHZRPDQRQWRSSRVLWLRQZKHQWKHPDQLV H[KDXVWHGIURPORYHPDNLQJZKHQWKHZRPDQ·VSDVVLRQKDVQRWVXEVLGHG DQGZKHQDSOHDVDQWGLYHUVLRQIURPWKHQRUPDOSRVLWLRQLVGHVLUHG ²  9čWV\č\DQDH[SODLQVWKDWZLWKϰRZHUVIDOOLQJIURPKHUKDLUZLWKODXJKWHU LQWHUUXSWHGE\SDQWLQJWKHZRPDQVKRXOGSLQKHUORYHUGRZQDQGSUHVV KLPZLWKKHUEUHDVWV,QWKLVSRVLWLRQWKHZRPDQFRQTXHUVDQGVXEGXHV KHUPDQ7KHSRHPFRQWUDVWVVHQVXDOSOHDVXUHVZLWKOLEHUDWLRQ:KLOHWKH KHUPLW VKXQV VHQVXDO SOHDVXUHV IRU WKH VDNH RI H[SHULHQFLQJ GLYLQH EOLVV WKH ORYHU VKXQV GLYLQH EOLVV IRU WKH VDNH RI H[SHULHQFLQJ VHQVXDO

ጳጳጟᇹᇹᇹ೉ᇹቨዧወኂᅡዼᅐዧᇹኂቨ


SOHDVXUHV1RWHWKHLUUHYHUHQWDOPRVWEODVSKHPRXVWRQHRIWKHVSHDNHU -D\DGHYD·V WK FHQW  7KH /RYH 6RQJ RI .‫ؾߙޢ‬D *ҸWDJRYLQGD  GHVFULEHV 5čGKčPDNLQJORYHWR.‫ؾߙޢ‬DLQWKLVSRVLWLRQ´:K\GRZRPHQLQORYHWDNH GHOLJKWLQWKHVXSHULRUSRVLWLRQ"µ &RXUWHVDQVLQDQFLHQW*UHHFHRϸHUHGWKLVSRVLWLRQNQRZQDVNHO̒V WKH UDFHKRUVH RQO\WRWKHLUZHDOWK\FOLHQWV7KH*UHHN$QWKRORJ\IXUQLVKHV PDQ\H[DPSOHV+HUHLVRQH´'RULVµE\'LRVFRULGHVRI$OH[DQGULD UG cent. ᄽᅐᅵ  Stretching out the rose-assed Doris on the bed  ,EHFDPHDQLPPRUWDOLQKHUEORRPLQJϰRZHUV )RUVKHVWUDGGOLQJWKHPLGGOHRIPHZLWKKHUH[WUDRUGLQDU\IHHW  FRPSOHWHGZLWKRXWVZHUYLQJWKHPDUDWKRQRI9HQXV ORRNLQJODQJXLGO\RXWRIKHUH\HVEXWWKH\OLNHOHDYHVLQWKHZLQG as she rolled around, trembled, crimson, XQWLOWKHZKLWHϰRZZDVSRXUHGRXWIURPERWKRIXV  DQG'RULVZDVVSUHDGORRVHZLWKOLPEVUHOD[HG 6HHDOVR´6KH3URWHVWV7RR0XFKµ S DQG6RQQRND·V´'ULYHQE\3DVVLRQµ S  6DQVNULWSRHWVKDYHORQJNQRZQWKDWWKHVFHQWRIDZRPDQLVHURWLFDV WKHSRHP´:KR1HHGVWKH*RGV"µGHPRQVWUDWHV,QKLVMemoirs, Giacomo &DVDQRYD ² PDNHVWKLVREVHUYDWLRQDERXWHURWLFVFHQW´7KHUH LVVRPHWKLQJLQWKHDLURIWKHEHGURRPRIWKHZRPDQRQHORYHVVRPHWKLQJ VRLQWLPDWHVREDOVDPLFVXFKYROXSWXRXVHPDQDWLRQVWKDWLIDORYHUKDG WRFKRRVHEHWZHHQ+HDYHQDQGWKLVSODFHRIGHOLJKWKLVKHVLWDWLRQZRXOG not last for a moment.”,QERWKLQVWDQFHVWKHORYHUVUHMHFWWKHSOHDVXUHV of heaven for those of the bedroom. $ZRPDQJRLQJRXWDWQLJKWWRPHHWKHUORYHU DEKLVčULNč LVDSRSXODU PRWLILQ6DQVNULWSRHWU\DQGGUDPDDVLOOXVWUDWHGE\WKHSRHP´2QD5DLQ\ 'D\µ S IURPA Treasury of Well-Turned Verse. )RUWXQDWHLVWKHORYHUZKRKHOSVKLVPLVWUHVV WRFKDQJHFORWKHVZKHQVKHFRPHVRYHURQDUDLQ\GD\ 7KHNRKODURXQGKHUH\HVLVZDVKHGRϸE\WKHUDLQ

ᇹቨዧወኂᅡዼᅐዧᇹኂቨ೉ጳጳᇹጳ


DQGKHUVKHHUEOXHFORWKFOLQJLQJWRKHUVKDSHO\EUHDVWV UHYHDOVWKHQDWXUDOEHDXW\RIKHUĎŽJXUH 7KHFULWLF9Lß&#x201C;YDQÄ?WKD WKFHQW PHQWLRQVHLJKWSODFHVDVEHLQJVXLWDEOH IRUORYHUVWRPHHWDĎŽHOGDJDUGHQDUXLQHGWHPSOHWKHKRXVHRIDIHPDOH messenger, a grove, an inn, a cremation ground, and the bank of a river. 7KHUDLQ\VHDVRQ -XQHWR6HSWHPEHU LVHVSHFLDOO\IDYRUHGIRUORYHPDNLQJ7KHFODVVLFH[DPSOHRIWKHPRWLIRFFXUVLQWKHĎŽIWKDFWRIß­ŕĄ&#x192;GUDND¡V SOD\ The Little Clay Cart 0â&#x20AC;ŤŢ˘â&#x20AC;ŹFFKDNDŕ &#x192;LND WK FHQW  ZKHUH WKH KHURLQH 9DVDQWDVHQÄ?VHWVRXWDWQLJKWLQWKHUDLQWRPHHWKHUORYHU&Ä?UXGDWWD Let the clouds burst into rain or thunder RUKXUOGRZQOLJKWQLQJEROWVIURPDERYH Neither cold nor heat can change the minds RIZRPHQVHWWLQJRXWWRPHHWWKHLUORYHUV 7KHUHDGHUZLWQHVVHVWKHORYHULQ´2QD5DLQ\'D\ÂľXQGUHVVLQJKLV PLVWUHVVZKRLVVRDNHGZLWKUDLQDSUHOXGHWRWKHLUHYHQWXDOORYHPDNLQJ7KHSRXULQJUDLQVXJJHVWVDVPXFK1RZKHUHLVWKLVPRWLIPRUHSHUVLVWHQWWKDQLQ%ROO\ZRRGPRYLHVZKHUHUDLQGUHQFKHGKHURLQHVZULWKH about on the screen, crooning songs. The motif also occurs in Greek SRHWU\ÂłIRULQVWDQFHLQ´7KH8QIDLWKIXO:LIHÂľE\3KLORGHPXVRI*DGDUD FD²á&#x201E;˝á&#x2026;?á&#x2026;ľ  In the middle of the night I stole from my husbandâ&#x20AC;&#x2122;s bed $QGFDPHWR\RXVRDNHGZLWKUDLQ $QGQRZDUHZHJRLQJWR 6LWDURXQGDQGQRWJHWGRZQ To business, and not bill and coo, And love like lovers ought to love? 6DQVNULWSRHWLFFRQYHQWLRQLQIRUPVXVWKDWLIDZRPDQKDVORYHRQKHU PLQGQRWKLQJFDQVWRSKHU3RHPDIWHUSRHPHQDFWVXQEOXVKLQJVFHQHV

á&#x152;łá&#x152;łá&#x152;łŕł&#x2030;á&#x2021;šá&#x2030;¨á&#x2039;§á&#x2039;&#x2C6;á&#x160;&#x201A;á&#x2026;Ąá&#x2039;źá&#x2026;?á&#x2039;§á&#x2021;šá&#x160;&#x201A;á&#x2030;¨


LQZKLFKZHZLWQHVVYROXSWXRXVZRPHQWKHLUKDLUDQGFORWKHVLQGLVDUUD\O\LQJVSUDZOHGDFURVVEHGVH[KDXVWHGIURPYLROHQWORYHPDNLQJ $JHQUHRI6DQVNULWSRHWU\LVGHYRWHGWRWUDYHOHUV SDWKLNDє ZKROHDYH EHKLQGZLYHVRUORYHUVDVWKH\VHWRXWRQDMRXUQH\WRVHHNWKHLUIRUWXQH 7KHZRPHQGRHYHU\WKLQJLQWKHLUSRZHUWRVWRSWKHPRUGHOD\WKHLUJRLQJ DZD\2IWHQWKH\HQOLVWWKHVHUYLFHVRIWKHLUJLUOIULHQGVWRSHUVXDGHWKHLU husbands or lovers to change their minds. They are unsuccessful most of WKHWLPH,QWKHHQGWKHZRPHQUHFRQFLOHWKHPVHOYHVWRWKHVLWXDWLRQDQG IRQGO\ORRNIRUZDUGWRWKHGD\ZKHQWKH\ZLOOEHUHXQLWHGZLWKWKHLUORYHG ones. 7KHJHQUHϮUVWPDGHLWVDSSHDUDQFHLQWKH3UčNULWDQWKRORJ\7KH6HYHQ Hundred Poems 6DWWDVčҸ FRPSLOHGE\WKH6čWDYčKDQDNLQJ+čOD VWFHQW  RI3UDWLߙࠃKčQD SUHVHQWGD\3DLWKDQLQ0DKDUDVKWUD ,QFRQWUDVWWR6DQVNULWWKH´ZHOOPDGHµRU´UHϮQHGµODQJXDJHWKHUHZHUHPDQ\YHUQDFXODUVNQRZQDV3UčNULWVWKH´RULJLQDOµRU´QDWXUDOµODQJXDJHV2QHVXFK 3UčNULWLV3čOLWKHODQJXDJHRIWKHHDUOLHVW%XGGKLVWVFULSWXUHVWKH7LSLࠃDND 7KHWKUHHEDVNHWVVWFHQWᄽᅐᅵ /HWXVORRNDWWKHIROORZLQJSRHPE\ 1LߙSDࠃD  IURP7KH6HYHQ+XQGUHG3RHPV: My heartless lover, I hear, LVJRLQJDZD\WRPRUURZ *URZORQJ+RO\1LJKWVRWKDW QRWRPRUURZDZDLWVKLP 7KH\RXQJZRPDQSUD\VWRWKHJRGGHVVRIWKHQLJKW5čWULWRSUHYHQWWKH GD\IURPEUHDNLQJVRWKDWKHUORYHUFDQFRQWLQXHWRUHPDLQZLWKKHU LQVWHDGRIJRLQJDZD\RQDMRXUQH\6KHGHPDQGVWKDWWLPHLWVHOIVWRSIRU KHU6XFKH[WUDYDJDQWLPDJHU\LVQRWXQXVXDOLQORYHSRHPVWKDWWKULYH RQK\SHUEROH8QGHUO\LQJKHUSUD\HULVWKHSDLQIXOUHDOLW\WKDWWLPHLVD UHPLQGHURIRXUPRUWDOLW\DQGWKDWVKHOLNHHYHU\RQHHOVHLVKHOSOHVV EHIRUHLWVRPQLSRWHQFH6KHNQRZVDOOWRRZHOOWKDWWKHQLJKWZLOOHQGDQG ZLWKGD\EUHDNKHUORYHUZLOOOHDYHKRPH+HUSDLQKHUIUXVWUDWLRQDQGKHU LQDELOLW\ WR VWRS KHU ORYHU IURP OHDYLQJ DUH FRQFHQWUDWHG LQ WKH ZRUG ´KHDUWOHVVµ,QKHUGHVSHUDWLRQVKHWXUQVWRWKHJRGGHVVIRUKHOS

ᇹቨዧወኂᅡዼᅐዧᇹኂቨ೉ጳጳጳᇹ


7KHUHLVDϰLSVLGHWRWKH´WUDYHOHUµSRHPV,QDIHZLQVWDQFHVWKH PLVWUHVVRIWKHKRXVHLQYLWHVDORQHO\WUDYHOHUWRVSHQGWKHQLJKWZLWK KHUZKHQKHUKXVEDQGLVJRQHRQDMRXUQH\DVLQWKHIROORZLQJSRHPE\ $UWKD  DOVRIURP7KH6HYHQ+XQGUHG3RHPV. :LWKDVQHHUWKHZRPDQKDGRϸHUHG WKHWUDYHOHUDVWUDZPDWWRVOHHSRQ DWGDZQVKHUROOVLWXSZHHSLQJ 7KHWUDYHOHULVRQKLVZD\KDYLQJVSHQWWKHQLJKWPDNLQJORYHWRKHU+H OHDYHVDWGDZQQHYHUWRUHWXUQ6RWKHZRPDQZHHSV3HUKDSVWKH\KDG VOHSWRQWKHVDPHVWUDZPDWWKDWVKHQRZUROOVXS7KHPDWEHFRPHVD UHVRQDQWLPDJHWKDWQHJRWLDWHVWKHWUDQVLWLRQIURP´VQHHUµWR´ZHHSLQJµ 7KHWUDYHOHU·VXQH[SHFWHGYLVLWWXUQVWKHZRPDQ·VZRUOGXSVLGHGRZQ The Sanskrit anthologies continued the tradition initiated by 7KH6HYHQ Hundred Poems+HUHLVDQH[DPSOH´7KH7UDYHOHUµ S IURPThe Mark RI/RYH ߭‫عޢ‬JčUDWLODND  0\KXVEDQGLVDZD\RQEXVLQHVV WKHUH·VEHHQQRZRUGIURPKLP +LVPRWKHUOHIWWKLVPRUQLQJIRUKHUVRQLQODZ·V her daughter has had a child. I’m alone and in the full bloom of youth. +RZFDQ,PHHW\RXWRQLJKW" ,WLVHYHQLQJ%HRQ\RXUZD\WUDYHOHU $ZRPDQLQYLWHVDWUDYHOHUWRVSHQGWKHQLJKWZLWKKHUKHUKXVEDQGLV ´DZD\RQEXVLQHVVµDQGKHUPRWKHULQODZKDVJRQHWRKHUVRQLQODZ·V 7KHSRHPHPSOR\VDUKHWRULFDOϮJXUHNQRZQDVXSVLGHGRZQODQJXDJH³ WKDWLVVD\LQJRQHWKLQJDQGPHDQLQJH[DFWO\WKHRSSRVLWH%\WHOOLQJWKH WUDYHOHU´%HRQ\RXUZD\µVKHLVLQIDFWLQYLWLQJKLPLQWRKHUKRXVH7KLV LV RQH RI WKH IHZ SRHPV LQ 6DQVNULW DERXW D ZLIH·V LQϮGHOLW\ 6HH DOVR -DJKDQDFDSDOč·V´:LIHµ S DQG9LG\č·V´7KH5LYHUEDQNµ S 6RFLDO FRQYHQWLRQVSURKLELWDZRPDQIURPWDONLQJWRDVWUDQJHU%XWWKHVSHDNHU LQWKHSRHPVXEYHUWVWKRVHFRQYHQWLRQVE\LQGLUHFWO\DVNLQJWKHWUDYHOHU

ጳጳጳᇹᇹ೉ᇹቨዧወኂᅡዼᅐዧᇹኂቨ


WR VSHQG WKH QLJKW ZLWK KHU 2WKHU ´WUDYHOHUµ SRHPV LQ WKLV VHOHFWLRQ DUH´$Q,QYLWDWLRQµ S .HߓDࠃD·V´7KH&DPHOµ S 0RULNč·V´'RQ·W *Rµ S DQG5XGUDࠃD·V´:KDWWKH<RXQJ:LIH6DLGWRWKH7UDYHOHUµ S  7KHSDUDOOHOVEHWZHHQWKH3UčNULWDQG6DQVNULW´WUDYHOHUµSRHPV´:LWK DVQHHUWKHZRPDQKDGRϸHUHGµDQG´0\KXVEDQGLVDZD\RQEXVLQHVVµ DUHREYLRXV7KHIRUPHUGLVSHQVHVZLWKLQQXHQGRDQGGRXEOHHQWHQGUH ZKLOHWKHODWWHUUHYHOVLQWKHP6KRUQRIHPEHOOLVKPHQWVWKH3UčNULWSRHP LVPRUHQDWXUDOLQLWVWRQHDQGDFKLHYHVLWVHϸHFWVWKURXJKRUGLQDU\HYHU\GD\LPDJHVVXFKDVDVWUDZPDW7KH6DQVNULWSRHPLVRQWKHRWKHUKDQG GUDPDWLFLWHQDFWVDOLWWOHVFHQHDQGXVHVDOOWKHUHVRXUFHVRIWKHODQJXDJH WRDFKLHYHLWVHϸHFWV ´7UDYHOHUµSRHPVDUHPLUURULPDJHVRISRHPVIHDWXULQJWKHDEKLVčULNč. ,QWKHODWWHUSRHPVLWLVWKHZRPDQZLWKORYHRQKHUPLQGZKRVHWVRXW XQGHUFRYHURIGDUNQHVVWRPHHWKHUORYHUDQGVSHQGWKHQLJKWZLWKKLP ,QWKHIRUPHULWLVWKHWUDYHOHUZKRLVLQYLWHGE\WKHZRPDQLQWRKHUKRXVH WRVSHQGWKHQLJKWZLWKKHU%RWKOLDLVRQVDUHLOOLFLWDQGVRFLDOO\GLVDSSURYHG ,W LV WKHUHIRUH QRW VXUSULVLQJ WR ϮQG SRHWV ZULWLQJ DERXW LOOLFLW ORYHLQDVRFLHW\ZKHUHDZRPDQ·VFKDVWLW\LVFORVHO\JXDUGHGERWKEHIRUH DQGDIWHUPDUULDJH$QFLHQW,QGLDQZRPHQOLNHZRPHQHOVHZKHUHZDQWHG RZQHUVKLSRIWKHLUERGLHVZKLFKSDWULDUFK\GLGHYHU\WKLQJLQLWVSRZHU WRGHQ\1RZKHUHLVWKHEDWWOHRIWKHVH[HVPRUHYDOLDQWO\IRXJKWWKDQLQ WKHVHOLWWOHNQRZQVWDQ]DSRHPVVRPHRIZKLFKKDYHPLUDFXORXVO\VXUYLYHGLQWRRXURZQWLPH 7KHLQϮGHOLW\RIWKHPDQRIWHQFDXVHVVHSDUDWLRQEHWZHHQWKHORYHUV 7KHZRPDQ·VSULGHLVKXUWDQGVKHIHHOVRϸHQGHG7KHPRWLIRIWKHRϸHQGHG ZRPDQ PčQLQҸ LVDIDYRULWHRIWKHSRHWV7KHUHLVDGUDPDWLFWHQVLRQWR WKHSRHPVZKHUHWKLVPRWLIRFFXUVDVLQWKHSRHP´6KH'RHVQ·W/HW*RRI +HU3ULGHµ S 7KHVHSDUDWLRQLVQRWLQGHϮQLWHWKHORYHUVHYHQWXDOO\ reunite. She turns aside his eyes, riveted on her breasts, by embracing him. 6KHSXWVURXJHRQKHUOLSV

ᇹቨዧወኂᅡዼᅐዧᇹኂቨ೉ጳጳጳᇹᇹᇹ


VHHLQJKLVOLSVEXUQIRUKHUV 6KHVWRSVKLVKDQGRQKHUFURWFK by closing her thighs tight. Tactfully, she neither rejects her husband’s love QRUOHWVJRRIKHUSULGH 7KHZRPDQLVXQDEOHWRWHOOKHUKXVEDQGWRKLVIDFHWKDWVKHLVRXWUDJHG E\KLVLQϮGHOLW\ZKHQKHUHWXUQVKRPHDIWHUYLVLWLQJDFRXUWHVDQ,QKHU KHOSOHVVQHVVVKHWULHVWRSXQLVKKLPE\UHMHFWLQJDQ\LQWLPDF\7KDWLVDV IDUDVVKHZLOOJR6KHVLPSO\GRHVQRWKDYHWKHSRZHUWRZDONRXWRQKHU KXVEDQGZKHQKHFKHDWVRQKHU7KHPRWLILVDVWDSOHRIGHYRWLRQDO bhakti  SRHWU\DVLQWKHIROORZLQJOLQHVIURPD%HQJDOLGHYRWLRQDOSRHP´7KH 0DUNVRI)LQJHUQDLOV$UHRQ<RXU%UHDVWµE\*RYLQGDGčVD WKFHQW  ZKHUH5čGKčFULHVKHUKHDUWRXWDW.‫ؾߙޢ‬D·VLQϮGHOLWLHV 7KHPDUNVRIϮQJHUQDLOVDUHRQ\RXUEUHDVW and my heart burns. .RKORIVRPHRQH·VH\HVXSRQ\RXUOLSV darkens my face. ,DPDZDNHDOOQLJKW 6HHDOVR´$:RPDQ:URQJHGµ S 0DKRGDGKL·V´6WRS%HLQJ:LOOIXOµ S DQG߭UҸKDUߙD·V´7KH6PDUW*LUOµ S  $QGKHUHLVDSRHPWKDWLOOXVWUDWHVERWKDVSHFWVRIORYH´7KHQDQG 1RZµ S E\߭ҸOčEKDࠃࠃčULNčDZRPDQSRHWSUREDEO\IURPVRXWKHUQ ,QGLD7KHKRQRULϮFVXϲ[EKDࠃࠃčULNč QREOHYHQHUDEOH SRLQWVWRKHUGLVtinguished status. 0\KXVEDQGLVWKHVDPHPDQZKRVWROHP\YLUJLQLW\ 7KHVHDUHWKHVDPHPRRQOLWQLJKWV WKHVDPHEUHH]HϰRDWVGRZQIURPWKH9LQGK\DPRXQWDLQV WKLFNZLWKWKHVFHQWRIϰRZHULQJMDVPLQH ,WRRDPWKHVDPHZRPDQ<HW,ORQJZLWKDOOP\KHDUW for the thicket of reeds by the river WKDWRQFHNQHZRXUZLOGMR\RXVORYHPDNLQJ

ጳጳጳᇹጟ೉ᇹቨዧወኂᅡዼᅐዧᇹኂቨ


7KLVLVDMXVWO\IDPRXVSRHPLWVWULNHVDSHUVRQDOQRWHVRPHWKLQJWKDW RQH GRHV QRW RIWHQ FRPH DFURVV LQ 6DQVNULW SRHWU\ +LQGX VFULSWXUHV HQFRXUDJHVH[DVRQHRIWKHIRXUOHJLWLPDWHDLPVRIOLIHIRUWKHKRXVHKROGHU ,QWKH+LQGXYLHZZRPDQKDVDIDUJUHDWHUHURWLFGLVSRVLWLRQWKDQPDQ DQGKHUGHOLJKWLQWKHVH[XDODFWLVIDUJUHDWHU$WH[WSXWVLWZHOO´:DQW RIVH[XDOHQMR\PHQWLVGHFD\DQGROGDJHIRUZRPHQµ7KHVSHDNHUZKR LVDZRPDQFRQWUDVWVWKHWZRVWDJHVRIKHUUHODWLRQVKLSZLWKKHUPDQRQH ZKHQWKH\ZHUH\RXQJXQPDUULHGORYHUVDQGWKHRWKHUZKHQWKH\DUHD PLGGOHDJHGFRXSOH6KHUHFDOOVZLWKJHQXLQHUHJUHWWKHLU´ZLOGMR\RXV lovemaking” on moonlit nights by the riverside among the “thicket of UHHGVµZLWKQRWDFDUHLQWKHZRUOGDZD\IURPWKHSU\LQJH\HVRIKHUIDPLO\DQGQHLJKERUV1RZPDUULDJHZLWKDOOWKHUHVSRQVLELOLWLHVLWHQWDLOV KDVSXWRXWWKHϮUHVRIORYH 6KHUHϰHFWVRQKHULOOLFLWSUHPDULWDOORYHϮQGLQJLWWREHIDUULFKHUDQG PRUHVDWLVI\LQJWKDQPDULWDOORYH&RPLQJIURPDZRPDQSRHWWKLVLVDQ H[WUDRUGLQDU\VWDWHPHQW,PSOLFLWLQWKHSRHPLVWKHUHFRJQLWLRQWKDWOLNH HYHU\WKLQJHOVHLQWKHZRUOGORYHWRRLVVXEMHFWWRFKDQJH³DIDFWWKDWZH ϮQGKDUGWRDFFHSW:HH[SHFWSHUPDQHQFHLQORYH7KHRQHQHVVWKDW VKHKDGH[SHULHQFHGDWϮUVWDVDORYHULVQRWWKHUHDQ\PRUH1RZPDUULHGVKHORRNVEDFNDWWKDWSHULRGLQWKHLUOLYHVDQGLVXQKDSS\3HUKDSV KHUKXVEDQGLVQRORQJHULQORYHZLWKKHU 7KH HOHPHQWV³´PRRQOLW QLJKWVµ DQG ´EUHH]Hµ³KDYH QRW FKDQJHG DQGQHLWKHUKDVVKH6KHLVVWLOOWKH´VDPHZRPDQµDQG\HWRQHWKLQJKDV FKDQJHG³WKHLUORYH1RWRQO\KDVWLPHZHDNHQHGWKHERQGVRIORYHLWKDV DOVRH[SRVHGWKHIUDJLOLW\RIWKHLUUHODWLRQVKLS,WLVWKLVNQRZOHGJHWKDW PDNHVKHUXQKDSS\,WLVLPSRVVLEOHWRUHSURGXFHLQ(QJOLVKWKHPXVLF RI WKHRULJLQDO6DQVNULW,WLVDFULGHFRHXUWKDWZHDUHDOOWRRIDPLOLDU ZLWKLQ(QJOLVKSRHWU\DQGUDUHO\PHHWZLWKLQ6DQVNULWSRHWU\ZKLFKE\ WUDGLWLRQLVLPSHUVRQDO´7KHQDQG1RZµKDVPXFKLQFRPPRQZLWKVXFK SRHPVDVWKHDQRQ\PRXVVL[WHHQWKFHQWXU\(QJOLVKO\ULF´:HVWHUQ:LQGµ :HVWURQZ\QGHZKHQZ\OOWKRZEORZ 7KHVPDOOHUD\QHGRZQHFDQUD\QH³ &U\VW\IP\ORYHZHULQP\DUP\V $QG,LQP\EHGDJD\QH

ᇹቨዧወኂᅡዼᅐዧᇹኂቨ೉ጳጳጳጟ


,Q6DQVNULWHURWLFSRHWU\LWLVWKHPDOHYRLFHWKDWZHLQYDULDEO\KHDU%XW ߭ҸOčEKDࠃࠃčULNč VSHDNV LQ D UHFRJQL]DEOH ZRPDQ·V YRLFH WKDW DϸHFWV XV GHHSO\6KHVSHDNVQRWRQO\IRUKHUVHOIEXWDOVRIRUDOOZRPHQ7KDWLVWKH SRHP·VHQGXULQJDSSHDO

ASCETICISM 5HQRXQFLQJWKHZRUOGWRGHYRWHRQHVHOIWRRQH·VOLEHUDWLRQLVOLNHVHQVXDO SOHDVXUHVRQHRIWKHIRXUOHJLWLPDWHDLPVRIOLIH7KHUHQRXQFHUOHDYHVKLV IDPLO\EHKLQGDQGOLYHVWKHOLIHRIDZDQGHULQJKHUPLW 0RUHWKDQDQ\RWKHUSRHWLQRXUVHOHFWLRQ%KDUW‫ޢ‬KDUL FDᅐᅵ LQ his Three Hundred Poems ߭DWDNDWUD\čGLVXEKčߙLWDVDؐJUDє IDPRXVO\ZUHVWOHGZLWKWKHVLWXDWLRQRIWKHKHUPLW+HLVNHHQO\DZDUHWKDWDOOWKLQJV SDVVWKDWQRWKLQJHVSHFLDOO\VHQVXDOSOHDVXUHVLVSHUPDQHQW(YHQDVKH HQMR\VWKHPRPHQWKHVHHPVWRUHJUHWLW,WLVWKLVDZDUHQHVVWKDWPDNHV KLVYHUVHVRSRLJQDQW7KRXJKKHNQRZVWKDWVHQVXDOSOHDVXUHVDUHϰHHWLQJKHDEDQGRQVKLPVHOIWRWKHPZKLOHWKH\ODVW6HQVXDOSOHDVXUHVDUH IRU%KDUW‫ޢ‬KDULHPERGLHGLQZRPHQKHVSHDNVDJDLQDQGDJDLQRIWKHSOHDVXUHV WKDW D ZRPDQ·V ERG\ RϸHUV %XW ZRPHQ LQ KLV SRHPV DUH LQHUW objects, images that he fondly gazes on. Though his eyes see the “skull EHQHDWKWKHVNLQµKHLVXQDEOHWRZLWKGUDZKLVJD]H7KLVFRQϰLFWLVDWWKH KHDUWRI%KDUW‫ޢ‬KDUL·VSRHWU\DVLQWKHSRHP´:LVH0HQµ S  ,QWKLVVKDOORZϮFNOHZRUOG ZLVHPHQFKRRVHWZRFRXUVHV IRUDWLPHWKH\NHHSWKHFRPSDQ\RIPLQGV VWHHSHGLQWKHRFHDQRIZLVGRP 7KH\VSHQGWKHUHVWZLWKQXELOH\RXQJZRPHQ ZKRVHIXOOKLSVDQGEUHDVWV JORZZLWKWKHSOHDVXUHRIKLGLQJ PHQ·VLPSDWLHQWKDQGV LQWKHGHSWKVRIWKHLUWKLJKV 7KHSRHPRYHUZKHOPVXVE\LWVDVVDXOWRQWKHVHQVHVLWSUHVHQWVLPDJHV RIZRPHQ·VEUHDVWVKLSVDQGWKLJKVDOOZDLWLQJWREHDURXVHGE\´PHQ·V

ጳጳጳጟᇹ೉ᇹቨዧወኂᅡዼᅐዧᇹኂቨ


LPSDWLHQWKDQGVµ7KHIRUHSOD\VXJJHVWVWKHSRVVLELOLW\RIHYHQWXDOFRQVXPPDWLRQZKLFKLVQRWH[SOLFLWO\VSHOOHGRXW%KDUW‫ޢ‬KDULOHDYHVLWWRWKH UHDGHU·VLPDJLQDWLRQWRFRPSOHWHWKHVFHQH(YHU\EUXVKVWURNHRIWKLV HURWLFVFHQHLVGLFWDWHGE\WUDGLWLRQ<HW%KDUW‫ޢ‬KDULJRHVEH\RQGWUDGLWLRQ E\VSHDNLQJRIVHQVXDOSOHDVXUHVLQWKHVDPHEUHDWKDVWKHSXUVXLWRIVHOI NQRZOHGJHWKDWZRXOGXOWLPDWHO\OHDGWROLEHUDWLRQ+HGRHVQRWSULYLOHJH RQHRYHUWKHRWKHU+HSUHVHQWVXVZLWKWKHUHDOLW\RIPDQ·VSUHGLFDPHQW *LYHQWKHRSWLRQVIHZPHQZRXOGFDUHWR´NHHSWKHFRPSDQ\RIPLQGV VWHHSHGLQWKHRFHDQRIZLVGRPµZKHQWKHDOWHUQDWLYHLVVRPXFKPRUH DWWUDFWLYH3KLORVRSKLFDOSRHWWKDWKHLVKHVHHVWKHYDOXHRIVHQVXDOSOHDVXUHVDQGRILWVSRODURSSRVLWHOLEHUDWLRQ7KLVRSSRVLWLRQLVEXLOWLQWRWKH +LQGXWUDGLWLRQLWVHOIWKDW%KDUW‫ޢ‬KDUL·VSRHWU\LQWHUURJDWHV7KHVLWXDWLRQ PDNHV IRU WHQVLRQ WKDW LV UHϰHFWHG LQ WKH XQHDV\ WRQH ,W LV WRQH WKDW DFFRXQWVIRUWKHIRUFHRIWKHSRHP /LNH%KDUW‫ޢ‬KDUL$VFOHSLDGHVWRRPRXUQVWKHLPSHUPDQHQFHRIVHQVXDOSOHDVXUHV7KHVSHDNHULQWKHSRHP´7R+LV0LVWUHVVµXUJHVKLVFRPSDQLRQWRJLYHKHUVHOIXSWRKLPVLQFHWKHUHDUH´QRORYHUV¬¬LQWKH XQGHUZRUOGµ <RXGHQ\PHDQGWRZKDWHQG" 7KHUHDUHQRORYHUVGHDULQWKHXQGHUZRUOG 1RORYHEXWKHUHRQO\WKHOLYLQJNQRZ 7KHVZHHWQHVVRI$SKURGLWH³ ೉೉೉೉೉೉೉೉೉೉೉೉೉೉೉೉EXWEHORZ But in Acheron, careful virgin, dust and ashes :LOOEHRXURQO\O\LQJGRZQWRJHWKHU %XW%KDUW‫ޢ‬KDULWDNHVWKHHSLJUDPRQHVWHSIXUWKHUE\XVLQJWKHRFFDVLRQ IRUSKLORVRSKLFUHϰHFWLRQ+HLVHQRXJKRIDSUDJPDWLVWZKRDFFHSWVWKH KXPDQ QHHG IRU VHQVXDO SOHDVXUHV EXW LV DZDUH WKDW KH QHHGV WR PRYH EH\RQGWKHP+HGRHVQRWRIFRXUVHVHHVHQVXDOSOHDVXUHVDVDQREVWDFOHWR OLEHUDWLRQKHJRHVDJDLQVWWUDGLWLRQLQWKLVUHVSHFW&RQVLGHULQJWKHWLPHV he lived in, his thinking is revolutionary. He is unrivaled by any other 6DQVNULWO\ULFSRHWZLWKWKHH[FHSWLRQRI.čOLGčVD6HHDOVR%KDUW‫ޢ‬KDUL·V ´+LSVµ S +LVLVDXQLTXHYRLFHLQ6DQVNULWSRHWU\

ᇹቨዧወኂᅡዼᅐዧᇹኂቨ೉ጳጳጳጟᇹᇹ


$FKDUDFWHULVWLFWKDW%KDUW‫ޢ‬KDUL·VSRHPVVKDUHZLWKWKRVHRI$VFOHSLDGHVLVWKDWERWKSRHWVFDVWWKHLUSRHPVDVHSLJUDPV7KHSRHPVDUHVKRUW FRQFUHWHDQGRIWHQLURQLF7KHKLJKO\LQϰHFWHGQDWXUHRI6DQVNULWDQG *UHHNPDNHVSRVVLEOHDQXQXVXDOFRQFLVHQHVVRIH[SUHVVLRQ7KHSRHPV RI%KDUW‫ޢ‬KDULDQG$VFOHSLDGHVDUHFODVVLFH[DPSOHVRIWKHJHQUH 6DQVNULWSRHWVKDGDQHQGOHVVIDVFLQDWLRQZLWKZRPDQ·VERG\ZKLFK they invariably described through a series of conventional images. %KDUW‫ޢ‬KDUL ULGLFXOHV VXFK SRHWV LQ KLV SRHP ´$GRUDWLRQ RI :RPDQµ S¬   IRU IROORZLQJ WUDGLWLRQ EOLQGO\ DQG IRU QRW EHLQJ LQQRYDWLYH enough in their use of imagery: 7KRVHOXPSVRIϰHVKKHUEUHDVWV DUHFRPSDUHGWRJROGHQERZOV 7KDWVWRUHKRXVHRISKOHJPKHUIDFH LVFRPSDUHGWRWKHPRRQ 'DPSZLWKXULQHKHUWKLJK LVVDLGWRVXUSDVVWKHHOHSKDQW·VWUXQN /RRNKRZSRHWVHPEHOOLVKKHUYLOHERG\ (YHQ.čOLGčVDZDVQRWDERYHXVLQJVWRFNLPDJHV%KDUW‫ޢ‬KDULUDLVHVDQ LPSRUWDQW FULWLFDO LVVXH KHUH WKH 6DQVNULW SRHW·V XWWHU VXEVHUYLHQFH WR WUDGLWLRQHYHQDWWKHH[SHQVHRIKLVRZQFUHDWLYLW\2IWHQRQHSRHPLVQR GLϸHUHQWIURPDQRWKHU%KDUW‫ޢ‬KDULLVDϮQHH[DPSOHRIDSRHWZKRGRHV QRWIDOOLQWRWKLVFDWHJRU\+LVSRHWU\FRQVWDQWO\VXUSULVHVXVZLWKLWVZLW DQGLQYHQWLYHQHVVPXFKDV-RKQ'RQQH·V ² SRHWU\GRHVDVLQ WKHVHOLQHVIURP´(OHJ\7R+LV0LVWUHVV*RLQJWR%HGµ   )XOOQDNHGQHVV$OOMR\VDUHGXHWRWKHH As souls unbodied, bodies unclothed must be 7RWDVWHZKROHMR\V¬¬¬ ೉೉೉೉೉೉೉೉೉೉೉೉&DVWDOO\HDWKLVZKLWHOLQHQKHQFH +HUHLVQRSHQDQFHPXFKOHVVLQQRFHQFH 'RQQHWRROLNH%KDUW‫ޢ‬KDULZDVWURXEOHGE\WKHQHHGIRUVHQVXDOSOHDVXUHV DQGZLVKHGWRPRYHEH\RQGWKHP+LVSRHWU\VXJJHVWVDVPXFK

ጳጳጳጟᇹᇹᇹ೉ᇹቨዧወኂᅡዼᅐዧᇹኂቨ


/RQJEHIRUH%KDUW‫ޢ‬KDULSRHWVKDGZUHVWOHGZLWKWKLVFRQϰLFW+HUHLV DQH[DPSOH´6RQJRID)RUPHU3URVWLWXWHµE\9LPDOčIURPWKH3čOLSongs of the Elder Nuns 7KHUҸJčWKčWK²UGFHQWᄽᅐᅵ  <RXQJDQGRYHUEHDULQJ³ GUXQNZLWKIDPHZLWKEHDXW\ ZLWKP\ϮJXUHLWVϰDZOHVVDSSHDUDQFH³ ,KHOGRWKHUZRPHQLQFRQWHPSW +HDYLO\PDGHXS,OHDQHG against the brothel door DQGϰDVKHGP\ZDUHV/LNHDKXQWHU ,ODLGP\VQDUHVWRVXUSULVHIRROV ,HYHQWDXJKWWKHPDWULFNRUWZR DV,VOLSSHGP\FORWKHVRϸ DQGEDUHGP\VHFUHWSODFHV 2KRZ,GHVSLVHGWKHP 7RGD\KHDGVKDYHGZUDSSHG LQDVLQJOHUREHDQDOPVZRPDQ I move about or sit at the foot RIDWUHHHPSW\RIDOOWKRXJKWV All ties to heaven and earth I have cut loose forever. 8SURRWLQJHYHU\REVHVVLRQ ,KDYHSXWRXWWKHϮUHV 7KH3čOL%XGGKLVWSRHWVUHSODFHGWKHSURIDQHODQJXDJHRIWKH6DQVNULW SRHWVZLWKDVDFUHGRQH7KH\DEDQGRQHGWKHORYHSRHWU\RIWKH6DQVNULW SRHWVDQGUHSODFHGLWZLWKDSRHWU\WKDWVSHDNVRIOLEHUDWLRQIURPWKHF\FOH RIELUWKGHDWKDQGUHELUWKWKHSHUIHFWEOLVVWKDWZDVVRXJKWE\HYHU\ %XGGKLVWPRQNDQGQXQ7KLVLVHQWLUHO\LQNHHSLQJZLWKWKHWHDFKLQJVRI WKH%XGGKDZKLFKFRQVLGHUVH[XDOGHVLUHDQREVWDFOHWRHQOLJKWHQPHQW

ᇹቨዧወኂᅡዼᅐዧᇹኂቨ೉ጳጳጳᇹጳ


1RZKHUHLVWKLVLGHDPRUHIRUFHIXOO\VWDWHGWKDQLQWKH$‫ع‬JXWWDUD1LNč\D *UDGXDOVD\LQJV ´0RQNV,NQRZRIQRRWKHUIRUPWKDWVRFDSWLYDWHV WKHPLQGRIDPDQWKDQWKHIRUPRIDZRPDQ,NQRZRIQRRWKHUYRLFHQR RWKHUVFHQWQRRWKHUWDVWHQRRWKHUWRXFKWKDWVRFDSWLYDWHVWKHPLQGRI DPDQDVWKHYRLFHWKHVFHQWWKHWDVWHWKHWRXFKRIDZRPDQµ While %KDUW‫ޢ‬KDULDFFHSWVVHQVXDOSOHDVXUHVLPSHUPDQHQWDVWKH\DUH9LPDOč UHMHFWVWKHPDVDQREVWDFOHWRHQOLJKWHQPHQW+HUUHVSRQVHLVHQWLUHO\LQ NHHSLQJZLWKWUDGLWLRQ ,WLVVDLGWKDW6DQVNULWSRHWU\LVLPSHUVRQDO³WKDWLVWKHSRHWKDVWDNHQ KLPVHOIRXWRIWKHVLWXDWLRQLQWKHSRHPDQGVSHDNVWRXVQRWGLUHFWO\EXW WKURXJKDSHUVRQD6SHFLϮFVDUHRPLWWHGVRDUHWKHQDPHVRILQGLYLGXDOV :LWKWKHHUDVXUHRIDOOSDUWLFXODUVWKHVLWXDWLRQLVUHSUHVHQWHGDVWKHGLVWLOODWLRQRIDXQLYHUVDOKXPDQH[SHULHQFHWKDWHYRNHVDVLQJOHPRRGVXFK DVWKHHURWLFRUWKHKHURLF7KHSRHPLWVHOIIROORZVWKHHVWDEOLVKHGFRQYHQWLRQVRISRHWLFVWKRXJKRFFDVLRQDOO\LWEUHDNVRXWRIWKHPWRH[SORUH QHZSRVVLELOLWLHV%KDUW‫ޢ‬KDULVWDQGVDWWKHFURVVURDGVRIWUDGLWLRQDQG LQQRYDWLRQ+HUHLQOLHVKLVHQGXULQJDSSHDODQGWKHUHDVRQZK\KHLVDEOH WRVSHDNWRXV

NATURE /HWXVORRNDWWKHIROORZLQJOLQHVIURP´,%XLOW0\+XWµDSRHPE\7DR4LDQ FD² DOVRNQRZQDV7DR<XDQPLQJ ,SOXFNFKU\VDQWKHPXPVXQGHUWKHHDVWHUQKHGJH Then gaze long at the distant summer hills. The mountain air is fresh at the dusk of day: 7KHϰ\LQJELUGVWZRE\WZRUHWXUQ ,QWKHVHWKLQJVWKHUHOLHVDGHHSPHDQLQJ <HWZKHQZHZRXOGH[SUHVVLWZRUGVVXGGHQO\IDLOXV 7KHSRHWLVDORQHFRQWHPSODWLQJDQDWXUDOVFHQHIURPKLVKRPHRYHUORRNLQJ0RXQW/XLQ-LDQJ[LSURYLQFHLQVRXWKHDVWHUQ&KLQD7KHUHLVDKLQWRI LQWLPDF\EHWZHHQKLPDQGWKHVFHQHWKDWKROGVDPHDQLQJIRUKLPWKDW

ጳቈ೉ᇹቨዧወኂᅡዼᅐዧᇹኂቨ


FDQQRWEHSXWLQWRZRUGV7KH'DRLVWFODVVLFDaodejing 7KH:D\DQGLWV SRZHUWK²UGFHQWᄽᅐᅵ VD\VDVPXFK´2QHZKRNQRZVGRHVQRWVSHDN RQHZKRVSHDNVGRHVQRWNQRZµ:HQRWLFHLQ7DR·VSRHPWKHDEVHQFHRI SDWKHWLFIDOODF\³WKDWLVHQGRZLQJQDWXUHZLWKKXPDQTXDOLWLHVZKLFK LQIRUPVPXFKRI(QJOLVK5RPDQWLFSRHWU\ 8QOLNH&KLQHVHSRHWU\ZKHUHLPDJHVRIWKHQDWXUDOZRUOGRIWHQDSSHDU 6DQVNULWSRHWU\FRQWDLQVIHZUHIHUHQFHVWRQDWXUH7KH6DQVNULWSRHWVZHUH XVXDOO\SDWURQL]HGE\NLQJVDQGOLYHGLQFLWLHVVXFKDV8MMD\LQҸ 8MMDLQLQ 0DGK\D3UDGHVK DQG.čQ\DNXEMD .DQQDXMLQ8WWDU3UDGHVK &RXQWU\ VFHQHVZHUHQRWWRWKHLUWDVWHDQGWKHUHIRUHWKH\ϮJXUHGLQIUHTXHQWO\LQ WKHLUSRHWU\7KHUHDUHKRZHYHUVRPHH[FHSWLRQVQRWDEO\<RJHߓYDUD FD ² DQG$EKLQDQGD FD² ZKRZHUHERWKIURP%HQJDO+HUH LVDSRHP´:KHQWKH5DLQV&RPHµ S E\WKHIRUPHU 7KHULYHURYHUϰRZLQJLWVEDQNVϮOOVP\KHDUWZLWKGHOLJKW RQWRSRIDFDQHEUDNHDVQDNHLVDVOHHS DPRRUKHQFDOOVRXWJHHVHFODPRU KHUGVRIGHHUJDWKHULQNQRWV WKHWKLFNJUDVVLVZHLJKHGGRZQE\VWUHDPVRIDQWV DQGWKHMXQJOHIRZOLVGUXQNZLWKMR\ <RJHߓYDUDKDVDJLIWIRUGHVFULELQJFRXQWU\VFHQHVUHDOLVWLFDOO\³WKDWLV GHVFULELQJ´WKLQJVDVWKH\DUHµ7KHSRHW·VREVHUYDQWH\HVFDQVWKHFRXQWU\VLGHDQGIRQGO\UHFRUGVHYHU\GHWDLORIWKHVFHQHWKDWFRPHVWROLIHZLWK WKHPRQVRRQ/LNHWKH´MXQJOHIRZOµWKHVSHDNHUWRRLVRYHUMR\HG%XWWKH SRHP VWRSV WKHUH ,W PDNHV QR DWWHPSW WR HYDOXDWH WKH H[SHULHQFH RI ´GHOLJKWµWKDWWKHVSHDNHUIHHOV0DQDQGQDWXUHDUHQRWRQHDVLQWKH&KLQHVHSRHPDVDUHVXOWRIWKHLUHQFRXQWHU1RUGRZHFRPHDFURVVKHUH DQ\WKLQJOLNHWKHLPSDVVLRQHGSHUVRQDOXWWHUDQFHRID:RUGVZRUWK ²  DVLQWKHIROORZLQJSDVVDJHIURP´/LQHV&RPSRVHGD)HZ0LOHV$ERYH 7LQWHUQ$EEH\µ   ¬¬¬$QG,KDYHIHOW $SUHVHQFHWKDWGLVWXUEVPHZLWKWKHMR\ 2IHOHYDWHGWKRXJKWVDVHQVHVXEOLPH

ᇹቨዧወኂᅡዼᅐዧᇹኂቨ೉ጳቈᇹ


2IVRPHWKLQJIDUPRUHGHHSO\LQWHUIXVHG :KRVHGZHOOLQJLVWKHOLJKWRIVHWWLQJVXQV And the round ocean and the living air, $QGWKHEOXHVN\DQGLQWKHPLQGRIPDQ¬¬ $V D SRHW ZULWLQJ ZLWKLQ D WUDGLWLRQ WKDW GHPDQGHG IRUPDO SHUIHFWLRQ <RJHߓYDUD GLG QRW VXFFXPE HQWLUHO\ WR WKH W\UDQQ\ RI IRUP +LV IHZ SRHPVRQFRXQWU\VFHQHVDUHDEUHDWKRIIUHVKDLU$EKLQDQGDSUDLVHV his realism: :RUGVEORVVRPHGZKHQ<RJHߓYDUDVSRNH RIWKH5HYčDQGWKH9LQGK\D RI3XOҸQGUDDQG3čPDUDZRPHQ and of a message drifting through a storm.

ANONYMITY ,Q ´6WDWXV RI ,QGLDQ :RPHQµ WKH LQϰXHQWLDO DUW KLVWRULDQ $QDQGD . &RRPDUDVZDP\ ² REVHUYHG´>$QRQ\PLW\@LVRQHRIWKHSURXGest distinctions of the Hindu culture. The names of the ‘authors’ of the HSLFVDUHEXWVKDGRZVDQGLQODWHUDJHVLWZDVDFRQVWDQWSUDFWLFHRIZULWHUVWRVXSSUHVVWKHLURZQQDPHVDQGDVFULEHWKHLUZRUNWRDP\WKLFDORU IDPRXVSRHWWKHUHE\WRJDLQDEHWWHUDWWHQWLRQIRUWKHWUXWKWKDWWKH\ ZRXOGUDWKHUFODLPWRKDYH¶KHDUG·WKDQWRKDYH¶PDGH·µ Much of SanVNULW SRHWU\ WKDW KDV VXUYLYHG LV DQRQ\PRXV :H NQRZ LW RQO\ IURP PHGLHYDO DQWKRORJLHV WKDW EHJDQ WR DSSHDU LQ SULQW LQ WKH QLQHWHHQWK FHQWXU\ VHH´1RWHVµSS² :HNQRZQRZWKDW´.čOLGčVDµDQG ´%KDYDEKࡃWLµDUHQRWWKHUHDOQDPHVRIWKHVHSRHWVWKH\DUHSVHXGRQ\PV 7KHSUDFWLFHRIQDPLQJDSRHWE\DQHSLWKHWIURPKLVRUKHUSRHPZDV IDLUO\FRPPRQ7DNHWKHQDPH.DU‫ؾ‬RWSDODIRULQVWDQFH7KHHSLWKHWRFFXUV LQWKHSRHP´7KH/DPSµ S ´6KHWKHQKXUOHGDWWKHODPSWKHORWXV IURPKHUHDUDQGSXWRXWWKHTXLYHULQJϰDPHµ7KHSRHWLVNQRZQRQO\ E\KLVHSLWKHW´>7KH3RHWRI@WKH/RWXVIURPWKH(DUµ:HGRQRWNQRZKLV

ጳቈᇹᇹ೉ᇹቨዧወኂᅡዼᅐዧᇹኂቨ


UHDOQDPH7KLVLVKLVRQO\SRHPWKDWKDVVXUYLYHG/LNHZLVH%KDYDEKࡃWL LVVRQDPHGEHFDXVHLWLVEHOLHYHGWKDWWKHJRG߭LYD %KDYD RϸHUHGKLP ´KRO\ DVKHVµ RU ´OXFNµ EKࡃWL  +LV QDPH ZRXOG WKHUHIRUH PHDQ ´>7KH 3RHW:KR:DV@%OHVVHGE\߭LYDµ+LVUHDOQDPHZDVKRZHYHU߭UҸNDQࠃKD 1ҸODNDQࠃKD 8GXPEDUD ZKHUH ߭UҸNDQࠃKD PHDQV ´RQH LQ ZKRVH WKURDW GZHOOVWKHJRGGHVVRIHORTXHQFHµ6LHJIULHG/LHQKDUGKDVDQLQWHUHVWLQJ WDNHRQWKH6DQVNULWSRHWV·XVHRISVHXGRQ\PV´:KHUHDVSVHXGRQ\PVLQ Western literature are designed to give anonymity, the names chosen by Indian NDYLV>SRHWV@DUHWDNHQQRWWRKLGHWKHLULGHQWLW\EXWWRUHIHUWRWKH JORU\UDQNRUVRPHSDUWLFXODUJLIWSRVVHVVHGE\WKHSRHWµ 7ZR ZRPHQ SRHWV DUH NQRZQ E\ VRPHZKDW XQXVXDO HSLWKHWV -DJKDQDFDSDOč $:RPDQ:KR:LJJOHV+HU%RWWRP DQG9LNDࠃDQLWDPEč $:RPDQZLWKD)DW5XPS %RWKQDPHVDSSHDUWREHϮFWLWLRXVVLQFHQR ZRPHQH[FHSWSURVWLWXWHVZRXOGKDYHVXFKQDPHV

POETS AND THEIR PATRONS /RQJEHIRUH%KDUW‫ޢ‬KDUL6DQVNULWKDGFHDVHGWREHDVSRNHQODQJXDJHDQG KDGEHFRPHSULPDULO\DOLWHUDU\ODQJXDJHWKDWϰRXULVKHGLQWKHFRXUWV XQGHUWKHSDWURQDJHRINLQJV3RHWVWUDYHOHGIDUDQGZLGHLQVHDUFKRI SDWURQV7KH\UHJDUGHGWKHPVHOYHVDVWKHVROHFXVWRGLDQVRIWKHZRUGDQG VHOGRPGHIHUUHGWRWKHDXWKRULW\RINLQJV2IWHQWKH\IHOORXWZLWKWKHLU SDWURQVDVWKHIROORZLQJSRHP´7KH3RHW6SHDNVWRWKH.LQJµ S E\ %KDUW‫ޢ‬KDULLQGLFDWHV <RXDUHDORUGRIULFKHVZRUGVREH\P\FDOO <RXDUHDPDQRIDUPV P\XQG\LQJHORTXHQFHYDQTXLVKHVSULGH 7KRVHEOLQGHGE\ZHDOWKVODYHIRU\RX but they are eager to hear me to rid their minds of evil. 6LQFH\RXKDYHQRUHVSHFWIRUPHNLQJ ,UHVSHFW\RXHYHQOHVV,VKDOOOHDYH

ᇹቨዧወኂᅡዼᅐዧᇹኂቨ೉ጳቈᇹᇹᇹ


$IHZSRHWVKDYHEHHQDWRGGVZLWKWKHVWDWH7KHFODVVLFH[DPSOHLV WKH5XVVLDQ-HZLVKSRHW2VLS0DQGHOVWDP ² ZKRVHSRHP´7KH 6WDOLQ(SLJUDPµ FRPSRVHG1RYHPEHU LQZKLFKKHPDGHIXQRIWKH 6RYLHWGLFWDWRUOHGWRKLVDUUHVWWKHIROORZLQJ\HDUDQGWRHYHQWXDOGHSRUtation to Kolyma in Siberia for “counterrevolutionary activities.” MandelVWDP·VFRQWHPSWIRU6WDOLQLVHYLGHQWLQWKHVHOLQHV %XWZKHQHYHUWKHUH·VDVQDWFKRIWDON it turns to the Kremlin mountaineer, WKHWHQWKLFNZRUPVKLVϮQJHUV KLVZRUGVOLNHPHDVXUHVRIZHLJKW WKHKXJHODXJKLQJFRFNURDFKHVRQKLVWRSOLS the glitter of his boot-rims. %KDUW‫ޢ‬KDULLVQRWDVEUXWDODV0DQGHOVWDPLQKLVGHQXQFLDWLRQRIWKHNLQJ (PSRZHUHG ZLWK ´XQG\LQJ HORTXHQFHµ KH VKRZV WKH NLQJ KLV SODFH 5HVSHFWLQJWKHNLQJ´HYHQOHVVµKHOHDYHV+HLVQRWRQHWRWUDGHKLVVHOI UHVSHFWIRUSDWURQDJHHYHQLIWKHSDWURQLVD´ORUGRIULFKHVµ 1RWDOOSRHWVKDGVXFKFRQIURQWDWLRQDOUHODWLRQVKLSVZLWKWKHLUSDWURQV 7KH7DPLOSRHW$XYDL\čU QG²UGFHQW PRXUQVWKHGHDWKRIKHUSDWURQ $WL\DPč‫ؽ‬1HࠃXPč‫ؽ‬$xFLLQEDWWOHLQVRPHRIWKHPRVWPHPRUDEOHSRHPV LQWKHODQJXDJHDVLQWKHVHOLQHVIURPWKHSRHP´%XW7KDW7LPH+DV3DVVHG 1RZµ 7KHVSHDUWKDWSLHUFHGKLVFKHVWDQGGURSSHG DOVRSLHUFHGWKHKDQGVRIWKHPDQ\ZKRFDPHWRKLPVHHNLQJ DOPV LWSLHUFHGWKHZLGHERZOVRIJUHDWLQFRPSDUDEOHEDUGV LWSLHUFHGWKHWRQJXHVRISRHWVVNLOOHGLQSXWWLQJZRUGV together, DQGEOXUUHGWKHSXSLOVLQWKHVRUURZIXOH\HVRIWKRVHZKR GHSHQGHGRQKLP :KHUHLVKHQRZRXUORUGDQGPDLQVXSSRUW"

ጳቈᇹጟ೉ᇹቨዧወኂᅡዼᅐዧᇹኂቨ


3RHWVGHSHQGHGRQNLQJVIRUWKHLUOLYHOLKRRGNLQJVGHSHQGHGRQSRHWVWR VSUHDGWKHLUIDPHDQGJORU\LQXQG\LQJVRQJ 7KHIROORZLQJDQHFGRWHIURPDELRJUDSK\RIWKHPHGLHYDOSRHW+DULKDUD WKFHQW WHOOVXVKRZIUXVWUDWLQJWKHUHODWLRQVKLSEHWZHHQWKH SRHWDQGKLVSDWURQFDQVRPHWLPHVEH /RUG:KHUHGRHVDPDQJR":KHUHGRHVKHOLHGRZQ" :KRPGRHVKHVSHDNWR"$QGWRZKRPUHFLWHKLVSRHPV" :KHUHGRHVKHSXUVXHXQGLVWXUEHGWKHDUWRISRHWU\" $WZKRVHFRXUWGRHVKHVROLFLW" :LFNHGIRROVKDYHWDNHQRYHUWKHZRUOGDQGWKHUHLVQRWKLQJ WKHZLVH+DULKDUDZKRNQRZVWKHWUXWKFDQGRDERXWLW 'LVHQFKDQWHG ZLWK OLIH +DULKDUD UHQRXQFHV WKH ZRUOG DQG EHFRPHV D PRQN%KDUW‫ޢ‬KDULDVZHKDYHVHHQH[HPSOLϮHVWKLVWHQGHQF\PRUHWKDQ DQ\RWKHUSRHW ´:LWKRXWVFKRODUVKLSQRFODVVLFDOWH[WFRXOGVXUYLYHDQGEHUHDGµ REVHUYHGWKHFODVVLFLVW'¬6&DUQH5RVV´EXWVFKRODUVKLSDORQHFDQQRWSUHVHUYHDSRHWDVDYLWDOSUHVHQFH7KDWLVWKHWDVNRISRHWVDQGJRRGUHDGHUV RISRHWU\IURPJHQHUDWLRQWRJHQHUDWLRQµ,KRSHWKDW´SRHWVDQGJRRG UHDGHUVRISRHWU\µZLOOHQVXUHWKHVXUYLYDORIWKHVHEUHDWKWDNLQJSRHPV IURPWKH6DQVNULWDOEHLWLQWUDQVODWLRQZKLFKKDVRϸHUHGWKHPDQDIWHUOLIHLQDQRWKHUODQJXDJH6DQVNULWSRHWU\OLNH*UHHNDQG/DWLQSRHWU\LV our common inheritance.

NOTES   'DQLHO +¬ + ,QJDOOV WUDQV An Anthology of Sanskrit Court Poetry: 9LG\čNDUD·V´6XEKčߙLWDUDWQDNRߙDµ+DUYDUG2ULHQWDO6HULHV &DPEULGJH0DVV+DUYDUG8QLYHUVLW\3UHVV    -RKQ%URXJKWUDQVPoems from the Sanskrit +DUPRQGVZRUWK8. 3HQJXLQ    :¬60HUZLQDQG-0RXVVDLHϸ0DVVRQWUDQV6DQVNULW/RYH3RHWU\ 1HZ<RUN&ROXPELD8QLYHUVLW\3UHVV 

ᇹቨዧወኂᅡዼᅐዧᇹኂቨ೉ጳቈጟ


  %DUEDUD6WROHU0LOOHUWUDQV7KH+HUPLWDQGWKH/RYH7KLHI6DQVNULW 3RHPV RI %KDUWULKDUL DQG %LOKD‫ؾ‬D 1HZ <RUN &ROXPELD 8QLYHUVLW\ 3UHVV    0DUWKD$QQ6HOE\WUDQVDQGHG*URZ/RQJ%OHVVHG1LJKW/RYH3RHPV from Classical India 1HZ<RUN2[IRUG8QLYHUVLW\3UHVV    /RYH/\ULFVE\$PDUX%KDUW‫ޢ‬KDULDQG%LOKD‫ؾ‬D, trans. Greg Bailey and 5LFKDUG*RPEULFK&OD\6DQVNULW/LEUDU\ 1HZ<RUN1HZ<RUN8QLYHUVLW\3UHVV-RKQDQG-HQQLIHU&OD\)RXQGDWLRQ    .XPčUDMҸYDTXRWHGLQ0DUWKD3¬<&KHXQJHGAn Anthology of ChiQHVH'LVFRXUVHRQ7UDQVODWLRQ9ROXPH)URP(DUOLHVW7LPHVWRWKH%XGdhist Project 0DQFKHVWHU8.6W-HURPH    59LQDer Rig-Veda: Aus dem Sanskrit ins Deutsche übersetzt und PLWHLQHPODXIHQGHQ.RPPHQWDUYHUVHKHQYRQ.DUO)ULHGULFK*HOGQHU, ed. DQGWUDQV.DUO)ULHGULFK*HOGQHUYROV+DUYDUG2ULHQWDO6HULHV ² &DPEULGJH0DVV+DUYDUG8QLYHUVLW\3UHVV² 6HH SDJHV²LQWKHSUHVHQWYROXPHIRUDOLVWRIDEEUHYLDWLRQV   .DYLND‫ࠃؾ‬KčEKDUD‫ؾ‬D RI .ߙHPHQGUD HG 3DQGLW 'KXQGKLUDMD 6DVWUL %DQDUDV&KDXNKDPED6DQVNULW6HULHV2ϲFH YROV 4XRWHGLQ0HUZLQDQG0DVVRQ6DQVNULW/RYH3RHWU\²7KHWUDQVODWLRQLVE\0HUZLQ   .čY\DPҸPčؐVDRI5čMDߓHNKDUDUHY.¬65DPDVZDPL6DVWUL6LURPDQL *DHNZDG·V2ULHQWDO6HULHVQRUGHG UHSU%DURGD2ULHQWDO,QVWLWXWH0DKDUDMD6D\DMLUDR8QLYHUVLW\RI%DURGD    $%HUULHGDOH.HLWKSUHIDFHWRA History of Sanskrit Literature /RQGRQ2[IRUG8QLYHUVLW\3UHVV YLL4XRWHGLQ%URXJKPoems from the Sanskrit   6KHOGRQ3ROORFN´6DQVNULW/LWHUDU\&XOWXUHIURPWKH,QVLGH2XWµLQ Literary Cultures in History: Reconstructions from South Asia, ed. ShelGRQ3ROORFN² %HUNHOH\8QLYHUVLW\RI&DOLIRUQLD3UHVV  and Sheldon Pollock, The Language of the Gods in the World of Men: SanVNULW&XOWXUHDQG3RZHULQ3UHPRGHUQ,QGLD %HUNHOH\8QLYHUVLW\RI &DOLIRUQLD3UHVV   $6  LQ $PDUXߓDWDND ZLWK WKH 6DQVNULW FRPPHQWDU\ WKH 5DVLNDVDxMҸYLQҸ RI $UMXQDYDUPDGHYD HG 3DQGLW 'XUJDSUDVDG DQG .DVLQDWK3DQGXUDQJ3DUDE %RPED\1LUQD\D6DJDUD3UHVV 

ጳቈጟᇹ೉ᇹቨዧወኂᅡዼᅐዧᇹኂቨ


 $PDUXߓDWDNDZLWKWKH6DQVNULWFRPPHQWDU\WKH߭‫عޢ‬JčUDGҸSLNč of 9HPDEKࡃSčOD HG DQG WUDQV &KLQWDPDQ 5DPFKDQGUD 'HYDGKDU UHSU1HZ'HOKL0RWLODO%DQDUVLGDVV    $ODLQ'DQLpORXWUDQV7KH&RPSOHWH.čPD6ࡃWUD7KH)LUVW8QDEULGJHG Modern Translation of the Classic Indian Text 5RFKHVWHU9W3DUN6WUHHW 3UHVV    *¬%0RKDQ7KDPSL´5DVDDV$HVWKHWLF([SHULHQFHµJournal of Aesthetics and Art CriticismQR     The Bible: Authorized King James Version, introduction and notes by 5REHUW&DUUROODQG6WHSKHQ3ULFNHWW2[IRUG:RUOG·V&ODVVLFV 2[IRUG 2[IRUG8QLYHUVLW\3UHVV    $QD‫ع‬JDUD‫ع‬JD RI .DO\č‫ؾ‬DPDOOD HG ZLWK D +LQGL WUDQVODWLRQ DQG FRPPHQWDU\E\5DP6DJDU7ULSDWKL 'HOKL&KDXNKDPED6DQVNULW 3UDWLVKWKDQ    965LQ6XEKčߙLWDUDWQDNRߙDFRPS9LG\čNDUDHG'¬'.RVDPEL DQG9¬9*RNKDOH+DUYDUG2ULHQWDO6HULHV &DPEULGJH0DVV +DUYDUG8QLYHUVLW\3UHVV    6KHURG6DQWRVWUDQVGreek Lyric Poetry: A New Translation 1HZ<RUN 1RUWRQ    $6LQ'XUJDSUDVDGDQG3DUDE$PDUXߓDWDND  9LUJLQLD:RROIA Room of One’s Own 6DQ'LHJR+DUFRXUW%UDFH -RYDQRYLFK    (]UD3RXQG´7KH-HZHO6WDLUV·*ULHYDQFHµLQTranslations 1HZ<RUN 1HZ'LUHFWLRQV    ´1RWHµLELG   $6LQ'XUJDSUDVDGDQG3DUDE$PDUXߓDWDND   /RYH 6RQJ RI WKH 'DUN /RUG -D\DGHYD·V ´*ҸWDJRYLQGDµ ed. and trans. %  DUEDUD6WROHU0LOOHU 1HZ<RUN&ROXPELD8QLYHUVLW\3UHVV     $P\5LFKOLQThe Garden of Priapus: Sexuality and Aggression in Roman Humor 1HZ+DYHQ&RQQ<DOH8QLYHUVLW\3UHVV    *LDFRPR &DVDQRYD TXRWHG LQ +DYHORFN (OOLV Studies in the PsyFKRORJ\RI6H[9ROXPH6H[XDO6HOHFWLRQLQ0DQ 3KLODGHOSKLD'DYLV     965LQ.RVDPELDQG*RNKDOH6XEKčߙLWDUDWQDNRߙD

ᇹቨዧወኂᅡዼᅐዧᇹኂቨ೉ጳቈጟᇹᇹ


  6čKLW\DGDUSD‫ؾ‬DRI߭UҸ9LߓYDQčWKD.DYLUčMDHGZLWKDFRPPHQWDU\ E\3DQGLW6UL.ULVKQD0RKDQ7KDNXU.DVKL6DQVNULW6HULHVUG HG 9DUDQDVL&KDXNKDPED6DQVNULW6HULHV2ϲFH    0‫ޢ‬FFKDNDࠃLNDRI߭ࡃGUDNDHGZLWKWKHFRPPHQWDU\RI3‫ޢ‬WKYҸGKDUD by Kasinath Pandurang Parab, rev. Vasudev Laksman Sastri PansiNDUWKHG %RPED\1LUQD\D6DJDUD3UHVV    .HQQHWK5H[URWKWUDQVPoems from the Greek Anthology $QQ$UERU 8QLYHUVLW\RI0LFKLJDQ3UHVV    Das Saptaçatakam des Hâla, ed. Albrecht Weber, Abhandlungen für die .XQGHGHV0RUJHQODQGHV%DQG1R /HLS]LJ%URFNKDXV    ,ELG  ߀WXVDؐKčUD LQFOXGLQJ WKH FRPPHQWDU\ RI 0D‫ؾ‬LUčPD DQG ߭‫عޢ‬JčUDWLODNDHG9DVXGHY/DNVPDQ6DVWUL3DQVLNDUWKHG %RPED\ 1LUQD\D6DJDUD3UHVV    965LQ.RVDPELDQG*RNKDOH6XEKčߙLWDUDWQDNRߙD   (GZDUG&'LPRFN-UDQG'HQLVH/HYHUWRYWUDQVIn Praise of Krishna: Songs from the Bengali *DUGHQ&LW\1<'RXEOHGD\    965LQ.RVDPELDQG*RNKDOH6XEKčߙLWDUDWQDNRߙD   4XRWHGLQ-RKDQQ-DNRE0H\HUSexual Life in Ancient India: A Study in WKH&RPSDUDWLYH+LVWRU\RI,QGLDQ&XOWXUHYROV /RQGRQ5RXWOHGJH DQG.HJDQ3DXO    3DXO.HHJDQHGThe New Penguin Book of English Verse /RQGRQ3HQJXLQ   %6  LQ ߭DWDNDWUD\čGLVXEKčߙLWDVDؐJUDє RI %KDUW‫ޢ‬KDUL HG ' ' .RVDPEL6LQJKL-DLQ6HULHVQR %RPED\%KDUDWL\D9LG\D%KDYDQ    'XGOH\)LWWVWUDQVPoems from the Greek Anthology 1HZ<RUN1HZ 'LUHFWLRQV    %6LQ.RVDPEL߭DWDNDWUD\čGLVXEKčߙLWDVDؐJUDєRI%KDUW‫ޢ‬KDUL   -RKQ 'RQQH ´(OHJ\  7R +LV 0LVWUHVV *RLQJ WR %HGµ LQ John Donne’s PoetryHG$UWKXU/&OHPHQWVQGHG 1HZ<RUN1RUWRQ     7KHUDDQG7KHUҸ*čWKč6WDQ]DV$VFULEHGWR(OGHUVRIWKH%XGGKLVW2UGHU of ReclusesHG+HUPDQQ2OGHQEXUJDQG5LFKDUG3LVFKHO3čOL7H[W 6RFLHW\QGHG /RQGRQ/X]DF 

ጳቈጟᇹᇹᇹ೉ᇹቨዧወኂᅡዼᅐዧᇹኂቨ


 4XRWHG LQ +¬ : 6FKXPDQQ The Historical Buddha, trans. M. O’C. :DOVKH /RQGRQ$UNDQD    $UWKXU:DOH\WUDQVTranslations from the Chinese 1HZ<RUN.QRSI     Lao Tzu: Tao Te ChingWUDQV'&/DX +DUPRQGVZRUWK8.3HQJXLQ    965LQ.RVDPELDQG*RNKDOH6XEKčߙLWDUDWQDNRߙD   :LOOLDP:RUGVZRUWK´/LQHV&RPSRVHGD)HZ0LOHV$ERYH7LQWHUQ Abbey,” in Selected PoemsHG-RKQ2+D\GHQ /RQGRQ3HQJXLQ    6HH'DQLHO+¬+,QJDOOV´$6DQVNULW3RHWU\RI9LOODJHDQG)LHOG <RJHߓYDUD DQG +LV )HOORZ 3RHWVµ Journal of the American Oriental SocietyQR -XO\²6HSWHPEHU ²   965LQ.RVDPELDQG*RNKDOH6XEKčߙLWDUDWQDNRߙD   $QDQGD.&RRPDUDVZDP\´6WDWXVRI,QGLDQ:RPHQµLQThe Dance RI6KLYD)RXUWHHQ,QGLDQ(VVD\VUHYHG 1HZ<RUN1RRQGD\3UHVV     6LHJIULHG/LHQKDUG$+LVWRU\RI&ODVVLFDO3RHWU\6DQVNULW3čOL3UčNULW, $+LVWRU\RI,QGLDQ/LWHUDWXUHYROIDVFHG-DQ*RQGD :LHVEDGHQ+DUUDVVRZLW] Q   %6LQ.RVDPEL߭DWDNDWUD\čGLVXEKčߙLWDVDؐJUDєRI%KDUW‫ޢ‬KDUL   &ODUHQFH%URZQDQG:¬60HUZLQWUDQVThe Selected Poems of Osip Mandelstam 1HZ<RUN1HZ<RUN5HYLHZ%RRNV ²  31  LQ 3X‫ޡ‬DQč‫ޡࡃؽ‬X FRPS 3HUXQW̒YD‫ؽ‬čU HG $XYDL &X 7XUDLFDPLSSLOODLYROV 7LUXQHOYHOL6RXWK,QGLD6DLYDVLGGKDQWD 3XEOLVKLQJ:RUNV6RFLHW\²   53LQ3UDEDQGKDNRߙDRI5čMDߓHNKDUD6ࡃULHGZLWKD+LQGL WUDQVODWLRQE\-LQD9LMD\D6LQJKL-DLQ6HULHVQR 6DQWLQLNHWDQ :HVW%HQJDO$GKLVWKDWD6LQJKL-DLQD-QDQDSLWKD    '¬6&DUQH5RVVPindar 1HZ+DYHQ&RQQ<DOH8QLYHUVLW\3UHVV  ²

ᇹቨዧወኂᅡዼᅐዧᇹኂቨ೉ጳቈᇹጳ

Erotic Poems from the Sanskrit: An Anthology, edited and translated by R. Parthasarathy  

Classical Sanskrit literature boasts an exquisite canon of poetry devoted to erotic love. Noted translator and scholar R. Parthasarathy cura...

Erotic Poems from the Sanskrit: An Anthology, edited and translated by R. Parthasarathy  

Classical Sanskrit literature boasts an exquisite canon of poetry devoted to erotic love. Noted translator and scholar R. Parthasarathy cura...