OFFICIAL PROGRAMME & FORM GUIDE FRIDAY 19TH SEPTEMBER 2025
With Not the Cowboys performing after racing
A VERY WARM WELCOME TO YOU ALL FROM ALL THE TEAM HERE AT NEWTON ABBOT RACECOURSE ON WHAT IS THE RCA SUMMER JUMPS CHAMPIONSHIPS FINAL DAY - YOUR SUPPORT IS VERY MUCH APPRECIATED AND VALUED, AND WE HOPE YOU ALL HAVE AN ENJOYABLE AND SUCCESSFUL DAY’S RACING WITH US.
Our thanks very much go to our sponsors here today, who are St Austell Brewery, Marilyn Lant, First Office Print & IT Solutions, the Dartmoor Magazine (Clear Sky Publishing), the friends and family of the late, great Colin Willcocks and the RCA We hope they and their guests have a great day with us today. First Office and Clear Sky are members of our new and thriving Business Club for which details appear later in this programme.
Today sees the climax to the Summer long RCA Summer Jumps Championships and presentations for each of the four categories will be made throughout the afternoon. Sean Bowen has won the Summer Champion Jockey by a large margin, James Owen is Summer Champion Trainer and has two runners on the card today in Chillhi (16:25) and Shantou Lucky (16:55). James Moffatt is Summer Champion Small Trainer and it is great to welcome James here for the very first time at Newton Abbot, all the way from Cumbria and with two runners in the (15:48) Book Of Secrets and Mojo Ego! A big Devon welcome to James The Summer Champion owner could be decided in the final race of the Championship this afternoon! It’s currently a tie between Nigel Twiston-Davies and a group called Terrahawks, however, there are others still with a chance - Bill Hawkins who has three horses entered to run here at Newton Abbot today! Two of them run in first race (14:03) In The Air and Art Of Diplomacy. The other runner is in the (16:20) Mohawk Chief, whilst The Johnstone Partnership are a group of owners who have come from nowhere in the championship and only accumulated their first points at Fontwell earlier this month. Their horse Shantou Lucky runs in the (16:55) RCA Summer Jumps Championship Finale Handicap Chase. He’s going for a four-timer and won at Worcester and Uttoxeter earlier this week. We are all set for a tremendous finale!
After racing today the brilliant local band Not the Cowboys will be performing in the Paddock Suite, everyone is welcome to carry on the party (subject to capacity).
There’s plenty more action to come here at Newton Abbot this year with plenty happening on and off course Please have a look at our Fixture List with its raceday themes elsewhere in this official programme Next up is Monday 29th September when we will have the legend that is Native River here parading as our equine hero. Make sure you come along and get up close to this brilliant horse, who scaled the very top in his racing career On the 18th October we feature our big race of the season, the Weatherbys Intermediate Chase with £30,000 of prize money, a race picked out by Paul Nicholls as a potential starting point for the high class Caldwell Potter. Our Family Fun Series concludes on Wednesday 29th October, which has a Halloween theme so as well as all the usual kids entertainment we’ll have pumpkin craving, fancy dress, disco and more. Also, in this programme you will find our full fixture list for 2026 which we are already looking forward to! Plus, you’ll pick up information about our other events such as the upcoming Comedy and Murder Mystery evenings
Just to reflect on how we have done so far this year, and we are simply delighted to have been able to stage all our fixtures so far (today is the 15th in 2025), especially remembering 2024 when we lost 6 of our 18 racedays It’s a great testament to all the staff we have working so hard round the clock, and they deserve the best of luck for the remainder of the year
We look forward to seeing you again soon, remember to book in advance online to get your Paddock tickets for £18 rather than the on the day £20. Course Enclosure is £13.
Finally thank you to you all for supporting us through thick and thin, it is hugely valued and here’s to a memorable and successful season for all. Have a great day.
Best wishes
Newton Abbot Racecourse Board of Directors
Ian Bulpin
Anthony Mildmay-White
Nigel Payne MBE
Richard Westropp
Robert Webb-Bowen
Tom Evetts
Daniel Andrews
Milly Bersey
Sophia Upton, Ciaran McKee
Guy Lewis
Robert Cuthbert
Katherine Byam-Cook
Marc Epps (Senior), Suzannah Hoult
Joe Peoples
Tony Kaye BVSc (Hons) BA MRCVS
Teresa Cordovil, Chris Johannson
Mel Baker, Steve Fox, Andrea Kelly
Tony Ennis
Mike Stevens
John Baker
Ben Robarts
Phil Mingo, Pinnacle@ppauk.com
Stuart Taylor AWCF
George Welch (Joint Chair)
Sir Peter Austin Bt (Joint Chair)
Annette Merchant
Philip Hobbs
John Baker
A. C. O’Keeffe Dajam Ltd
Mr Keith Hadwin
Mr Luke Axel-Berg
Foxhills Racing Limited
House Family Partnership
Miss Donna Wallis
Miss Georgina Hawkings
Mr A. Brooks
Mr A. Randle
Mr Bill Hawkins
Mr C. Gordon
Mr C. Griffiths
Mr Clive Meredith James
Mr D. J. Moffatt
Mr D. Pipe
Mr Dan Skelton
Mr David Manasseh
Mr Dean Pugh
Mr Graham P. Triefus
Mr Harry Johnstone
Mr I. A. Marmion
Mr J. E. Snowden
Mr J. Hartnett
Mr J. W. Johnstone
Mr M. C. Pipe
Mr N. Sutton
Mr P. Bowen
Mr R. E. R. Williams
Mr R. Helliwell
Mr R. Tongue
Mr Roderick Chelton
Mr S. Bedlow
Mr Steve Fleetham
Mr Walid Marzouk
Mr William Corrigan
Mrs C. Guest
Mrs C. Williams
Mrs Jacqueline Fleetham
Mrs Kate Brooks
Mrs Lynne Webb
Mrs Margaret H Duprey
Mrs Myrteel Ward
Mrs Zara Johnstone
Ms. Fiona E. Rogers
Urloxhey Racing
WE HOPE THAT YOU ALL HAVE AN ENJOYABLE AND SUCCESSFUL DAY’S RACING OUR NEXT MEETING
WHERE TO EAT AND DRINK
WE HOPE YOU HAVE A GREAT DAY WITH US AT NEWTON ABBOT RACECOURSE TODAY, WE HAVE A VARIETY OF FOOD AND DRINK OUTLETS FOR YOU TO ENJOY.
6 NORTHERN SYMPHONIE (GB) (34) 12 CD 5 11-6
Br B m Geordieland (FR) - Night Symphonie Sam Twiston-Davies J
O Talking Horses T
B R. J. & S. A. Carter
TIMEFORMVIEW Disappointed following an encouraging debut in bumpers and failed to build on the minor promise shown at Chepstow when finishing tailed off on handicap debut at Exeter (18.5f, good to soft) last month. Bounce back required returned to maiden company. TFR
STAR RATINGS EXPLAINED
OFFICIAL BHA RATINGS EXPLAINED
The BHA Handicappers allot ratings to horses once they have taken part in a sufficient number of races to enable the Handicappers to make a numerical assessment of each horse’s ability. The principal purpose of the ratings is to determine the weight to be carried by each runner in handicap races, with the Handicappers aiming to provide each participant with an equal chance based on its best recent form under its optimum conditions
You may be asked to provide proof of your age when placing a bet
If you cannot produce this your bet will not be accepted
BHA92
RCA SUMMER JUMPS CHAMPIONSHIPS FINALE
HERE TODAY
Here is the latest news on the categories, lots of interest and still plenty to play for in the Owners category...
Summer Champion Jockey – Sean Bowen has won this category comfortably and is currently over 300 points clear of his nearest rival.
Summer Champion Trainer – James Owen has won this category and can’t be mathematically caught. He has two runners on the card Chillhi (16:25) and Shantou Lucky (16:55)
Summer Champion Small Trainer – Cumbria based trainer James Moffatt has won this and is making the long journey down with two runners in the (15:48) Book Of Secrets and Mojo Ego for his first ever runners at Newton Abbot! A big Devon welcome to James.
Summer Champion Owner – This is very complicated and could be decided in the final race of the Championship this afternoon! It’s currently a tie between Nigel Twiston-Davies and a group called Terrahawks. However, there are still other owners that can overtake the current leaders or make it a three-way tie. They are the following:
1) JP McManus although he does not have a runner today
2) Bill Hawkins has three horses entered to run here at Newton Abbot today! Two of them run in first race (14:03) In The Air and Art Of Diplomacy. The other runner is in the (16:20) Mohawk Chief.
3) The Johnstone Partnership – This group of owners have come from nowhere in the championship and only accumulated their first points at Fontwell earlier this month. Their horse Shantou Lucky runs in the (16:55) RCA Summer Jumps Championship Finale Handicap Chase He’s going for a four-timer and won at Worcester and Uttoxeter earlier this week. If that horse wins again then it could force a three-way tie.
A thrilling end to the Summer!
THE COLIN STRATTON RETIREMENT NOVICES’STEEPLE CHASE (CLASS 3) (GBB RACE)
FOR NOVICE FOUR YRS OLD AND UPWARDS TOTAL PRIZE FUND £15000
Leading course trainer (20-25): D Skelton (18 wins from 68 runners, 26%) runs CATCH HIM DERRY Trainer-in-form (last 14 days): M Bowen (6 wins from 21 runners, 29%) runs ART OF DIPLOMACY
Longest Traveller: ART OF DIPLOMACY trained by M Bowen, Haverfordwest, 211 miles.
1 ART OF DIPLOMACY (GB) (14) 4-21111 C 9 11-12
Br B g Archipenko (USA) - Rowlestone Express James Bowen J
O Mr Bill Hawkins Mickey Bowen, Haverfordwest T
B G. E. Amey
TIMEFORM VIEW Thriving of late, extending his winning sequence to 4 with a decidedly useful effort in 6-runner handicap chase at Bangor (24.1f) a fortnight ago, driven clear. Effective at this shorter trip and the one to beat with well-being assured.
2 INTHE AIR (FR) (13) 6-54121
7 11-12
Br B g Coastal Path - Sably (FR) Ciaran Gethings J
O Mr Bill Hawkins Alastair Ralph, Bridgnorth T
B Mr Charles Magnien Air Conditioning Accessories Ltd S
TIMEFORM VIEW Resumed winning ways in 6-runner handicap chase at Stratford (17f, good, 7/2) 13 days ago, able to dominate and scoring with a bit up his sleeve. Faces a stiffer task on these terms, however. TFRHHHII BHA119
3 CATCH HIM DERRY (IRE) (167) 1P6135- C 7 11-2
Br B g Milan - Pretty Present (IRE) Harry Skelton J
O Jolly Boys Outing Dan Skelton, Alcester T
B Knocktartan House Stud The Air Ambulance Service (Warks & Northants), Ladbrokes S
TIMEFORM VIEW Progressive hurdler who recorded a fourth success in a handicap at Exeter (23.1f) in February. Ended last season with excellent efforts in Festival handicaps at Cheltenham and Aintree and has the physique to do well over fences TFRHHHHI BHA131
DECLARED RUNNERS 3 2024: GLYNN (IRE) 10 11 12 Sam Twiston-Davies 2-1 (Anthony Honeyball) 4 ran Sheepskin Cheek Pieces worn by No 1.
Probable S.P.’s: 5-6 Art of Diplomacy (GB), 2-1 Catch Him Derry (IRE), 11-2 In The Air (FR)
ART OF DIPLOMANCY has been thriving this summer and gets the nod to continue his excellent spell with his well-being assured Catch Him Derry, a notably progressive hurdler and a better prospect for the longer term, is sure to pose a big threat if fully tuned up for his chasing debut after a break
GREAT BRITISH BONUS SCHEME
The Great British Bonus (GBB) incentivises and rewards with breeding, buying and racing of British-bred fillies by paying out bonuses of up to £100,000 per filly And now with GBBPlus to further incentivise staying fillies and chasing mares, there are more reasons than ever to breed, buy and race British. Majority funded by the HBLB.
THE BAY TREE COTTAGE
MAIDEN HURDLE RACE (CLASS 4) (GBB RACE)
FOR MAIDEN FOUR YRS OLD AND UPWARDS TOTAL PRIZE FUND £8500
Leading course trainer (20-25): P Nicholls (55 wins from 176 runners, 31%) runs MALDINI MILANO
Trainer-in-form (last 14 days): C Gordon (2 wins from 6 runners, 33%) runs GENERAL BRIAR
Longest Traveller: TARA TIME trained by D Rees, Haverfordwest, 211 miles.
1 A PAI DE NOM (GB) (230) 25- 5 11-4
Br B g Passing Glance - Midnight Cataria Harry Skelton J
O Cherry Knoll Farm, M Ward & D Skelton Dan Skelton, Alcester T
B Pitchall Stud The Air Ambulance Service (Warks & Northants), Ladbrokes S
TIMEFORMVIEW HailsfromagoodfamilyandshapedwellwhenaclearsecondbehindasubsequentListedbumperwinneratChepstowondebutinOctober Underperformedon testing ground at Sandown in February but has been given a wind op in the interim and looks interesting upped markedly in trip on hurdles debut. TFRHHHHH BHA-
2 CINNODIN (GB) (12) 6 5 11-4
Br B g Anodin (IRE) - Cinnilla Gavin Sheehan J
O The Lakota Partnership Jamie Snowden, Lambourn T
B Ashbrittle Stud BetVictor S
TIMEFORM VIEW Fairly useful 2m Flat winner for Richard Hughes Changed hands for 27,000 gns and ran well below that level under a considerate ride on hurdles/stable debut at Fontwell (19.1f) 12 days ago Should be seen to better effect faced with a greater test of stamina here but handicaps may be more his bag TFRHHHII BHA-
3 GENERAL BRIAR
(IRE) (151) 32/26- 6 11-4
Br B g Soldier of Fortune (IRE) - Shantou Rose (IRE) Freddie Gordon (3) J
O The Morestead Augean Stables Syndicate Chris Gordon, Winchester T
B Mrs Deborah Hobson Equestrian Fencing & Timber Ltd, Goodwin Racing Ltd S
TIMEFORMVIEW PlacedbothstartsinIrishPointsandiscloselyrelatedtousefulAnnualInvictus(alsotrainedbythisyard).Well-backedwhenapromisingsecondinabumper at Fontwell (heavy) on debut but hung badly left when disappointing the following month. Could be worth another chance on hurdles debut
4 MALDINI MILANO
(IRE) (172) 102- 5 11-4
Br B g Milan - Tellthemnuttin (IRE) Harry Cobden J
O Kate & Andrew Brooks Paul Nicholls, Ditcheat T
B W. Devereux Morson Group S
TIMEFORM VIEW Winner of a very weak 3-runner bumper at Exeter on debut prior to running poorly in a Listed bumper in February when his yard weren’t firing on all cylinders. Back on track when runner-up atWorcester in March and could well progress for top yard now hurdling over a longer trip.
5 ROE AND
CO (IRE)
(222) C1/P0- 7 11-4
Br Br g Malinas (GER) - Limerick Rose (IRE) Joe Anderson (3) J
O Roe and Co Racing Jamie Snowden, Lambourn T
B Kevin Cullen BetVictor S
TIMEFORMVIEW Fetched £58,000 after landing a maiden point in 2023 but disappointed following wind surgery when pulled-up on hurdle/stable debut at Exeter Showed a bit more in a first-time tongue tie (retained) when midfield in a Chepstow novice (19.4f, heavy) but needs another step forward to get off the mark TFRHHHII BHA-
6 TARATIME (IRE) (14) P
Br B m Kayf Tara - Nurse Ratched (IRE)
O Mr C. Griffiths
B Cathal Ennis
6 10-11
Ben Jones J
David Rees, Haverfordwest T
TIMEFORM VIEW Inexpensive purchase and went with no promise on debut in a 2mWorcester maiden hurdle earlier this month. Again wears a tongue strap and has significant improvement to find over this markedly longer trip TFRHIIII BHA-
DECLARED RUNNERS 6 2024: SHAKEYATAILFEATHER (IRE) 5 10 11 Harry Skelton 9-4 (Dan Skelton) 6 ran Tongue Strap worn by No 5, 6. Running for the first time since Wind Surgery No 1.
Stewards Note:
GENERAL BRIAR: Following its run on 21/4/2025 it was reported that the horse hung left-handed in the straight.
Probable S.P.’s: 7-4 A Pai de Nom (GB), 5-2 Maldini Milano (IRE), 11-2 General Briar (IRE), 6-1 Cinnodin (GB), 10-1 Roe And Co (IRE), 100-1 Tara Time (IRE)
TFRHHHHI BHA-
TFRHHHHI BHA-
Those with hurdles experience have yet to better modest form and the trio of hurdling debutants could be most interesting A PAI DE NOM is in excellent hands and having chased home a subsequent listed bumper winner on debut, he may get back on track over this markedly longer trip following wind surgery. Maldini Milano should also appreciate the step up in distance and could easily progress, while General Briar isn’t ruled out if back in the same form as when second on his Rules debut
(CLASS 4) (GBB RACE)
FOR NOVICE FOUR YRS OLD AND UPWARDS FILLIES AND MARES TOTAL PRIZE FUND £8500
Leading course trainer (20-25): F O’Brien (25 wins from 101 runners, 25%) runs HIGHLAND HAVEN
Trainer-in-form (last 14 days): Dr R Newland & J Insole (3 wins from 25 runners, 12%) runs HILL IN BRAZIL
Fancy That: Dr R Newland & J Insole won this race in 2019 and 2020. The stable runs HILL IN BRAZIL today.
Longest Traveller: JOUEUSE ROYALE trained by O Murphy, Wilmcote, 168 miles.
1 HILL IN BRAZIL (GB) (14) 260-1 5 11-7
Br B m Blue Bresil (FR) - Tara Potter Luke Scott (3) J
O Urloxhey Racing Dr Richard Newland & Jamie Insole, Droitwich T
B James and Jean Potter Ltd Coulthursts Ltd S
TIMEFORM VIEW Runner-up on the first of 3 starts in bumpers for Nigel Twiston-Davies last season and made a successful start to her hurdle career for a new stable in 2mWorcester maiden 14 days ago. Did it smoothly and ought to be competitive under a penalty.
2 JOUEUSE ROYALE (FR) (34) 223-421
6 11-7
Br B or Br m Masked Marvel - Polane du Charmil (FR) Mr Ben Sutton (5) J
O Mr N. Sutton Olly Murphy, Wilmcote T
B Jeremy Duteuil & Germain Le Borgne Betano S
HHHII BHA-
TIMEFORM VIEW Fair maiden in Ireland who made it second time lucky for her new stable in 20.5f mares’maiden hurdle at Market Rasen last month. More will be needed under a penalty but no surprise were she to find it Refitted with the tongue tie she wore regularly in Ireland TFRHHHII BHA109
3 HIGHLAND HAVEN (GB) (169) 1620- 5 11-0
Br B m Kayf Tara - Highland Retreat Jonathan Burke J
O Mr Walid Marzouk Fergal O’Brien, Cheltenham T
B Sullivan Bloodstock Ltd BresBet S
TIMEFORM VIEW Useful bumper winner last season and rates an interesting recruit to hurdles for her good stable. TFRHHHHH BHA-
4 LYNSEY LARUE (IRE) (20) 1403-14 6 11-0
Br B m Elusive Pimpernel (USA) - Open Your Heart (IRE) Isabel Williams J
O Mr W Corrigan Racing Evan Williams, Llancarfan T
B Mr Richard Murphy Tote S
TIMEFORM VIEW Dual Irish point winner but could only manage a remote fourth of 5 on her C&D hurdle debut 3 weeks ago Needs to have come on a lot. TFRHHIII BHA-
5 BEST NIGHT (FR) (103) 4 10-12
Br Bl f Night Wish (GER) - Best Day (FR)
O David Pipe Racing Club
Jack Tudor J
David Pipe, Wellington T
B V & F Berouards, Haras Des Sablonnets & W & S Recycling S
TIMEFORM VIEW Fair form when runner-up twice over 15f on the Flat in France. The betting should help guide to expectations on hurdle debut TFRHHHII BHA-
6 LA BELLE ARGENTEE (FR) (205) 4- 4 10-12
Br Gr f Kapgarde (FR) - Cry For You (FR) Harry Skelton J
O Perfect 10 Racing Dan Skelton, Alcester T
B S.C.E.A. de La Perrigne Et al The Air Ambulance Service (Warks & Northants), Ladbrokes S
TIMEFORM VIEW From a good family Strong in the betting but ran as if needing the outing when fourth of 7 on 2m Wetherby debut (heavy) in February. In top hands and open to progress 6 months on. TFRHHHHI BHA-
7 LIZZIELOOE (GB) (57) 0 4 10-12
Br B f Dartmouth - Gertie Getaway (IRE) Rex Dingle J
O House Family Partnership
Michael Blake, Trowbridge T
B Unity Farm Holiday Centre Ltd Lydeard Farm Bush Camp & Lodge, Sb Racehorse Rehoming S
TIMEFORM VIEW 150/1 and hooded, last of 10 in bumper at Worcester (2m, good) on debut 57 days ago Outsider switched to hurdles TFRHIIII BHA-
DECLARED RUNNERS 7
4 10 12 Harry
4-1 (Daisy Hitchins) 9
Tongue Strap worn first time by No 5. Tongue Strap worn by No 2. Stewards Note: HIGHLAND HAVEN: Following its run on 3/4/2025 it was reported that the horse stopped quickly
Probable S.P.’s: 11-4 Highland Haven (GB), 3-1 La Belle Argentee (FR), 7-2 Joueuse Royale (FR), 4-1 Hill In Brazil (GB), 11-1 Best Night (FR), 40-1 Lynsey Larue (IRE), 300-1 Lizzielooe (GB)
HIGHLAND HAVEN achieved enough in bumpers to think she could win a race like this La Belle Argentee showed promise on her debut in February and may provide a bigger threat than penalised hurdle winners Joueuse Royale and Hill In Brazil
GREAT BRITISH BONUS SCHEME
PRIZE MONEY
THE DARTMOOR MAGAZINE HANDICAP HURDLE RACE (CLASS 5)
Longest Traveller: BOOK OF SECRETS & MOJO EGO trained by J Moffatt, Cartmel, 323 miles.
1 BOOK OF SECRETS (IRE) (27) 53-3230 D 7 12-0
Br B g Free Eagle (IRE) - Alice Treasure (IRE) Leah Noreci (10) J
O Keith Hadwin & DJM James Moffatt, Cartmel T
B Renata Coleman & Irish National Stud Estate Cars S
TIMEFORM VIEW In good form without winning until only seventh of 9 in handicap hurdle at Cartmel (17.2f, good) 27 days ago The sort to bounce back though. TFRHHHII
2 DICKENS (IRE) (23) 15-3113 BF 7 11-13
Br B g Excelebration (IRE) - Open Book Luke Scott (3) J
O A. C. O’Keeffe Jennie Candlish, Leek T
B Chapel Lane Farm L.T.D Equine Products UK Ltd S
TIMEFORM VIEW Went 2-2 for his current yard in 2m6f handicap at Cartmel in June Posted another very good effort despite failing to land the odds when third of 7 at Hexham (16.2f, good to firm) 23 days ago A likely player once more. TFRHHHHH BHA104
3 TOP GUY (IRE) (205) 2F1554- 5 11-10
Br B g Court Cave (IRE) - Matt Wood (IRE)
O JDJ Racing
B M. Kinsella
Harry Skelton J
Dan Skelton, Alcester T
TIMEFORM VIEW Points winner has been brought along steadily, not knocked about when fFourth of 5 in novice hurdle at Wetherby (19.7f, heavy) in Febuary. Returns for his handicap debut with more to offer TFRHHHHI BHA101
4 CHELSEA ANNIE (IRE) (11) 00/-1F 6 11-10
Br B m Mehmas (IRE) - Miss Sally (IRE)
O Dajam Ltd
B Helen Smith & Sally Mullen
Harriet Tucker (7) J
Neil Mulholland, Limpley Stoke T
TIMEFORM VIEW Made a winning hurdling debut at Worcester in June but well held both runs since, virtually refusing to race back on Flat at Windsor 11 days ago. Has somethng to prove now. TFRHHIII BHA101
5 MOJO EGO (IRE) (27) 00-0022 D BF 5 11-9
Br B g Intello (GER) - Never Green (IRE)
O Horsemen of the apocalypse
B Clare Castle Farm
Charlotte Jones J
James Moffatt, Cartmel T
TIMEFORM VIEW Has got back on track of late since fitted with blinkers, runner-up in handicap hurdle at Cartmel (17.2f, good) 27 days ago Must enter calculations nudged up 2lb TFRHHHHI BHA100
6 SACCARY (GER) (197) 050- 6 10-7
Br B g Nathaniel (IRE) - Survey (GER) Jack Tudor J
O Mrs Lynne Webb & Partners David Pipe, Wellington T
B Gestut Hof Lttlingen W & S Recycling S
TIMEFORM VIEW A fair 10f Flat winner but yet to match that form in a trio of hurdling runs, hooded when eighth of 10 in maiden at Fontwell (2m2f) 6 months ago May still do better though now going handicapping on his seasonal return. TFRHHHII BHA84
7 JACKSON’S BAY (IRE) (20) 0545-P 4 10-2
Br Ch g Joshua Tree (IRE) - Echo River (USA) Adam Wedge J
O Mr R. E. R. Williams Evan Williams, Llancarfan T
B Louis Kennedy
TIMEFORM VIEW Modest maiden hurdler who was pulled up in handicap over C&D 20 days ago Needs to take a big step forward. TFRHHIII BHA81
DECLARED RUNNERS 7
2024: DAANY (IRE) 7 10 9 Taylor Fisher 13-2 (Joe Tickle) 9 ran Hood worn by No 1, 2, 6. Blinkers worn by No 5.
Probable S.P.’s: 6-4 Dickens (IRE), 11-2 Top Guy (IRE), Mojo Ego (IRE), 6-1 Book of Secrets (IRE), 9-1 Saccary (GER), 18-1 Chelsea Annie (IRE), 25-1 Jackson’s Bay (IRE)
DICKENS hasn’t looked back since joining Jennie Candlish and is weighted to quickly resume winning ways on the back of a very good Hexham third. Dan Skelton’s Top Guy appeals as a likely improver now going handicapping and could emerge as the chief threat ahead of Mojo Ego and Saccary
Please note the Thatchers Bar end of the ground floor of the Grandstand is unfortunately closed this afternoon
You can bet with William Hill in the course bar underneath the course stand for today
Our external bar at the front of the Grandstand is open and alternative toilets can be located also at the front of the grandstand
We apologise for any inconvenience caused and we hope you enjoy your day’s racing.
Collect your winnings at our on-course shops or sho at any William Hill shop any lliam
Leading course trainer (20-25): E Williams (18 wins from 126 runners, 14%) runs D’JO DELA BARRIERE Trainer-in-form (last 14 days): J Owen (13 wins from 57 runners, 23%) runs CHILLHI
Longest Traveller: CHILLHI trained by J Owen, Newmarket, 248 miles.
1 ONEMOREFORTHEROAD (GB) (245) 23524P- C 10 12-0
Br B g Yorgunnabelucky (USA) - Vinomore Ben Jones J
O Rupert Dubai Racing Ben Pauling, Naunton T
B Donna Wallis Fitzdares S
TIMEFORM VIEW Useful hurdler/chaser for Neil King The betting should help guide to expectations on first run for the
Pauling yard after 8 months off. TFRHHHII BHA125
2 MOHAWK CHIEF (USA) (23) 432131
5 11-4
Br B g Quality Road (USA) - Wedding Vow (IRE) James Bowen J
O Mr Bill Hawkins Mickey Bowen, Haverfordwest T
B Orpendale, Chelston & Wynatt
TIMEFORM VIEW Fair Flat winner who has come good over hurdles this summer, winning maiden at Market Rasen (2 1/2m, heavy) and novice at Hexham (2 1/2m, good to firm). More needed back in a handicap but further progress can’t be discounted in current mood TFRHHHHI BHA115
3 PRINCE ZALTAR (FR) (27) 40-41P4
8 11-3
Br B g Prince Gibraltar (FR) - Alizeyra (FR) Harry Skelton J
O The Blind Squirrels Dan Skelton, Alcester T
B Mrs Corinne Rouffie Huve Tote S
TIMEFORM VIEW Fairly useful hurdler/chaser for Philip Rothwell in Ireland. Ended time over there with a creditable fourth of 12 over hurdles at Killarney in August and has joined a top stable for his career in Britain. Interesting TFRHHHHH BHA114
4 CHILLHI (IRE) (7) 0-2P141 5 11-1
Br B g Churchill (IRE) - Hi Katriona (IRE)
Nathan Howie (3) J
O Deva Racing SE James Owen, Newmarket T
B Mr John Webb Deva Racing Group S
TIMEFORM VIEW Three wins (1 Flat, 2 hurdle) since joining the prolific James Owen yard at the start of the summer The latest success came in a Stratford handicap hurdle this month under Nathan Howie. Respectable effort back on the Flat since. Can go well again. TFRHHHHI BHA112
5 D’JO
DELA
BARRIERE (FR) (21) 6-13555
6 10-8
Br B g Choeur du Nord (FR) - Morning Rose (GER) Miss Eleanor Williams (7) J
O BAYTREE Evan Williams, Llancarfan T
B Mrs Joselita Planchenault
TIMEFORM VIEW Won a 20.5f handicap hurdle at Plumpton in May but has run below that level on all 4 outings since. Only 1lb above that winning mark but others arrive with more pressing claims TFRHHIII BHA105
DECLARED RUNNERS 5 2024: WONDERFUL EAGLE (GER) 5 10 11 Micheal Nolan 11-10 (Philip Hobbs & Johnson White) 8 ran Visor worn by No 2, 4.
PRINCE ZALTAR is well treated on his peak Irish form now starting out for Dan Skelton and gets the vote, with confidence in his chance increased should the betting vibes be strong Chillhi might give him most to think about
BETTING TICKETS
Customers
THE RCA SUMMER JUMPS CHAMPIONSHIP FINALE HANDICAP STEEPLE CHASE (CLASS 5)
FOR FOUR YRS OLD AND UPWARDS TOTAL PRIZE FUND £10000
OWNERS PRIZE MONEY. 1ST £4039, 2ND £2019, 3RD £1010, 4TH £505, 5TH £252. (PENALTY VALUE £5281) WEIGHTS RAISED 1LB AND PARAGRAPH 34 OF THE WEIGHTS AND HANDICAPPING CODE COMPLIED WITH WHERE APPLICABLE
RACE ANALYSIS
Leading course trainer (20-25): E Williams (18 wins from 126 runners, 14%) runs BENNY BALOO, BLACKACRE and POOROLDMACKLEY
Br Gr m Beaumec de Houelle (FR) - Caline des Bordes (FR) Callum Pritchard (5) J
O Steve & Jackie Fleetham Debra Hamer, Carmarthen T
B Emmanuel - Julien Leclerc, Isabelle Mous
TIMEFORMVIEW Dualwinner overfencesinFranceand betteredpreviousefforts ontheseshoresreturnedtothis spherewhen secondina weak5-runnerFakenham handicap (21f, good) in May. However, well held both subsequent starts and now makes her debut for another new yard. TFRHIIII
TIMEFORM VIEW Has returned to form with a vengeance since joining James Owen and equippped with a visor, making it 3-3 for the yard with minimum fuss in a Uttoxeter handicap chase (2 1/2m, good) onTuesday, just a day after scoring over hurdles atWorcester Hard to oppose under a penalty. TFRHHHHH BHA86 (+16)
3 MCGREGORS CHARGE
(GB) (13) 232413 BF 7 11-5
Br B g Recharge (IRE) - Triggywinkle (FR) Ben Godfrey J
O Mr Roderick Chelton Ella Pickard, Taunton T
B Roderick Chelton
TIMEFORMVIEW Proved pretty consistent at a lowly level since switched to chasing and, helped by the favourite’s weak finish, finally opened his account under a positive ride at Perth (3m, good to firm) last month. Didn’t do much wrong when third at Stratford next time and should give another good account. TFRHHHII BHA85
4 BENNY BALOO (GB) (484) 5153/32- 8 11-5
Br Ch g Schiaparelli (GER) - Tarabaloo Isabel Williams J
O Mrs C. Williams Evan Williams, Llancarfan T
B R. W. Metcalfe
TIMEFORMVIEW WinningpointerwhomadeitsecondtimeluckyoverfencesforTimEasterby,landingaMarketRasennovices’handicapingoodstyleonBoxingDay2023. Best effort since when runner-up at the same course last spring, but subsequent absence is naturally a concern. One of 3 runners for her yard. TFRHHHII BHA85
5 POOROLDMACKLEY (IRE) (19) 11-3451 C 6 11-4
Br Ch g Getaway (GER) - Parkview Delight (IRE) Miss Eleanor Williams (7) J
O BAYTREE Evan Williams, Llancarfan T
B Mr Daniel Keating
TIMEFORMVIEW Back-to-back winner over fences/hurdles in April and added to his tally when accounting for 10 rivals in aWorcester handicap hurdle (23f, good) recently Just 1lb higher back over fences and should make his presence felt, granted a clean round of jumping (didn’t jump well on latest chase start). TFRHHHII BHA84
6 BLACKACRE (GB) (12) 23-6115 CD BF 6 11-1
Br B g Black Sam Bellamy (IRE) - Tullow Tonic (IRE) Adam Wedge J
O Baytree Evan Williams, Llancarfan T
B Tom Weston
TIMEFORMVIEW Immediate improvement with a visor enlisted last month, bagging back-to-back C&D handicap chases within the space of 9 days Failed to deliver when bidding for the hat-trick at Fontwell recently, though, and now tried in first-time blinkers TFRHHHII BHA81
7 SHEEKA SUPREME (IRE) (166) 06005P- 7 10-3
Br B m Flemensfirth (USA) - Thanks Awfully (IRE) Conor Ring J
O Foxhills Racing Limited Grace Harris, Shirenewton T
B Mr K. D. Cotter Michelle Harris, Grace Harris Racing S
TIMEFORM VIEW Successful in Irish points in October 2022, but she hasn’t shown much under Rules thus far TFRHIIII BHA69
DECLARED RUNNERS 7 2024: HOLD YOUR FORT (IRE) 8 12 2 James Best 9-2 (Debra Hamer) 10 ran Blinkers worn first time by No 6. Tongue Strap worn by No 1. Visor, Tongue Strap worn by No 2.
Stewards Note:
BLACKACRE: Following its run on 7/9/2025 it was reported that the trainer could not explain the poor run. SHEEKA SUPREME: Following its run on 6/4/2025 it was reported that the horse hung badly right-handed
SHANTOU LUCKY is another advertisement for the prowess of the James Owen yard when it comes to breathing new life into out-of-form recruits from rival stables Indeed, the 8-y-o is unbeaten in three quickfire appearances for new connections and he is a sizeable step ahead of the handicapper here (officially 9lb‘well-in’) following his fautless display back over fences at Uttoxeter on Tuesday. Mcgregors Charge gets the nod ahead of Pooroldmackley for forecast purposes
BOOKMAKERS
INDIVIDUAL BOOKERS can be found in front of the stands in all enclosures. TOTE windows are situated throughout the racecourse. Britbet operate SP Betting Shops in both enclosures which accept every type of bet.
GENERAL FACILITIES
Look out for the charity Racing to School today; you shouldn’t miss them as they will be leading a group of local pupils and their teachers through every corner of the racecourse for an action-packed day of fun challenges and discovery. The charity works nationwide with over 250 schools, and this year will reach around 16,000 young people – at UK racecourses, trainers’yards and studs
They deliver free, outdoor activity days to support the learning and to boost the self-confidence of children aged nine and above Racing to School uses racing venues as unique, fast-moving classrooms full of opportunities to practise and improve subjects like maths, literacy and problem-solving.
The charity is only able to support young people’s education through the kind donations it receives. Please scan this QR code to donate, if you can.
CONDITIONS
First Race 2.03 - THE COLIN STRATTON RETIREMENT NOVICES’ STEEPLE CHASE (CLASS 3) (GBB RACE) Distributed in accordance with the Stakes and Prize Money Code £8169 to the winning horse The second to receive £3763, and the third £1881. for novice four yrs old and upwards. Enter by noon, September 13th and pay £45 stake, Declare by 10.00 a.m. September 17th. Weights: 4-y-o 10st 5lb; 5-y-o and up 11st 2lb Fillies and mares allowed 7lb Penalties, a winner of a Class 3 to Class 5 steeple chase 6lb Of 2 steeple chases or of a Class 1 or Class 2 steeple chase 10lb Excluding the winner, the Official BHA Rating of any horse taking part in this race will not be increased due to performance in this race, provided the horse has had at least four prior completed runs over Steeple Chases and/or Hurdles combined No allowance to take a Horse’s weight below 10st 2lb St. Austell Brewery are kindly supporting the prize money for this race and will present a memento to the winning owner In addition, a cash prize of £60 will be awarded to the lad or girl in charge of the best turned out horse in this race 7 entries at £45. - Closed September 13th, 2025. Owners Prize Money. Winner £6260; Second £3131; Third £1565. (Penalty Value £8169)
SEE PAGE 13 FOR THIS RACE
Second Race 2.38 - THE BAY TREE COTTAGE MAIDEN HURDLE RACE (CLASS 4) (GBB RACE) Distributed in accordance with the Stakes and Prize Money Code £4629 to the winning horse The second to receive £2132, the third £1065 and the fourth £533. for maiden four yrs old and upwards. Enter by noon, September 13th and pay £27 stake, Declare by 10.00 a.m. September 17th. Weights: 4-y-o 11st 1lb; 5-y-o and up 11st 4lb Fillies and mares allowed 7lb Mrs. Lant has kindly supported the prize money for this race and will present a memento to the winning owner. In addition, a cash prize of £60 will be awarded to the lad or girl in charge of the best turned out horse in this race 9 entries at £27. - Closed September 13th, 2025. Owners Prize Money. Winner £3547; Second £1774; Third £887; Fourth £444. (Penalty Value £4629.10) SEE PAGE 14 FOR THIS RACE
Third Race 3.13 - THE FIRST OFFICE PRINT AND IT SOLUTIONS MARES’ NOVICES’ HURDLE RACE (CLASS 4) (GBB RACE) Distributed in accordance with the Stakes and Prize Money Code £4629 to the winning horse The second to receive £2132, the third £1065 and the fourth £533. for novice four yrs old and upwards fillies and mares only, which have not won more than two hurdle races. Enter by noon, September 13th and pay £29 stake, Declare by 10.00 a.m. September 17th. Weights: 4-y-o 10st 12lb; 5-y-o and up 11st Penalties, a winner of a hurdle race 7lb Of 2 hurdle races 12lb First Office Print & IT Solutions have kindly supported the prize money for this race and will present a memento to the winning connections In addition, a cash prize of £60 will be awarded to the lad or lass in charge of the best turned out horse in this race 16 entries at £29. - Closed September 13th, 2025. Owners Prize Money. Winner £3547; Second £1774; Third £887; Fourth £444. (Penalty Value £4629.10)
SEE PAGE 18 FOR THIS RACE
Fourth Race 3.48 - THE DARTMOOR MAGAZINE HANDICAP HURDLE RACE (CLASS 5) Distributed in accordance with the Stakes and Prize Money Code £4752 to the winning horse The second to receive £2187, the third £1093, the fourth £547 and the fifth £272. for three yrs old and upwards, Rated 0-105. Enter by noon, September 13th and pay £19 stake, Declare by 10.00 a.m. September 17th. Penalties, after September 6th, 2025, for each hurdle race won 7lb. The Dartmoor Magazine has kindly supported the prize money for this race & will present a memento to the winning owner In addition a £60 cash prize will be awarded to the lad or lass responsible for the best turned out horse in this race 18 entries at £19. - Closed September 13th, 2025. Owners Prize Money. Winner £3635; Second £1817; Third £909; Fourth £455; Fifth £227. (Penalty Value £4752.90) SEE PAGE 22 FOR THIS RACE
Fifth Race 4.20 - THE COLIN WILLCOCKS MEMORIAL HANDICAP HURDLE RACE (CLASS 3) Distributed in accordance with the Stakes and Prize Money Code £7921 to the winning horse The second to receive £3645, the third £1822, the fourth £912 and the fifth £454. for four yrs old and upwards, Rated 0-130 (also open to such horses rated 131 and 132 - see Standard Conditions). £45 stake if the horse is rated 104 or higher, or £9 stake if the horse is rated 103 or lower with £36 extra if the horse is declared to run Declare by 10.00 a.m. September 17th. Penalties, after September 6th, 2025, for each hurdle race won 7lb The family of Colin Willcocks are kindly supporting the prize money for this race and will present a memento to the winning owner In addition, a cash prize of £60 will be awarded to the lad or girl in charge of the best turned out horse in this race. 13 entries at £45. - Closed September 13th, 2025. Owners Prize Money. Winner £6059; Second £3029; Third £1515; Fourth £758; Fifth £378. (Penalty Value £7921.50)
SEE PAGE 26 FOR THIS RACE
Sixth Race 4.55 - THE RCA SUMMER JUMPS CHAMPIONSHIP FINALE HANDICAP STEEPLE CHASE (CLASS 5) Distributed in accordance with the Stakes and Prize Money Code. £5281 to the winning horse The second to receive £2430, the third £1215, the fourth £608 and the fifth £303. for four yrs old and upwards, Rated 0-100 Enter by noon, September 13th and pay £26 stake, Declare by 10.00 a.m. September 17th. Penalties, after September 6th, 2025, for each steeple chase won 7lb The RCA has kindly supporting the prize money for this race and will present a memento to the winning owner In addition, a cash prize of £60 will be awarded to the lad or girl in charge of the best turned out horse in this race 14 entries at £26. - Closed September 13th, 2025. Owners Prize Money. Winner £4039; Second £2019;Third £1010; Fourth £505; Fifth £252. (Penalty Value £5281) Weights raised 1lb and paragraph 34 of the Weights and Handicapping Code complied with where applicable.
SEE PAGE 28 FOR THIS RACE
NEWTON ABBOT RACECOURSE, A GREAT DAY OUT FOR ALL 2026 FIXTURES
