Page 1

Farm World News 2017 Page 1

Farm World

NEWS A P review of 7 Farm World 201

THE OFFICIAL PROMOTIONAL PUBLICATION OF FARM WORLD 2017

TO THE FARMER This is a Registered Publication POSTAGE PAID AUSTRALIA Strategic Partners

It’s a New World at Farm World 2017

F07705 F07705

Warragul. MARCH 30 - APRIL 2, 2017


Page 2 Farm World News 2017

Farm World 2017

Evans Petroleum and Farm World: A Proud History

From left: Evans Petroleum general manager Warren Evans, managing director Stuart Evans and sales manager John Schelling. Evans Petroleum are entering their 26th year of being a major sponsor of Lardner Park Events with the partnership being both fruitful and beneficial in enhancing the growth of both businesses. The partnership actually began with the Mobil brand some 50 years ago, through the then Gippsland distributors and has evolved over time where distribution companies changed as has the fuel and Lubricants brand to BP.

The BP Australia/Evans Petroleum partnership with Lardner Park is now entering its fifth year. According to Managing Director Stuart Evans, it has been an alignment, which to date has been seamless and easy to maintain. “We see the benefit of being involved with a progressive partner such as Lardner Park Events, as it allows us to portray our business in the same light, delivering a quality product and meeting our customer

expectation. These attributes has helped Evans Petroleum to grow its footprint on the Gippsland region with depots in Leongatha, Traralgon and Sale providing the infrastructure to service our farm delivery customers. This is backed with 15 retail sites in strategic locations and a fleet of B-Double and truck and dog combinations for delivering the larger bulk loads of fuel.” Evans Petroleum Sales Manager John Schelling oversees the delivery of bulk

fuel and lubricant to customers all over the South East region of Victoria, adding that the quality of product also plays a major role. “Our lubricant business assures quality of product by delivering Castrol Oils to the market as well as the tried and proven BP Lubricants to the agriculture sector. By selling a product that people trust and the service that customers expect we set ourselves apart from our opposition. Our delivery service throughout Gippsland on set days per week allows us to provide products on a regular basis therefore allowing resellers and customers to carry low stock holdings. This is also very evident in our choice of Ad Blue suppliers that led us to form a partnership with Go Blue Australia for the supply of their product to distribute to our customers and Go Blue’s as well. Being a new product Evans Petroleum elected to source a top quality product and set up a first class vehicle for our distribution. With the product available in bulk, IBC’s, 200 litre drums and 10 litre containers as well at

the retail pump at selected service stations we are well equipped for the future growth that will occur as more new diesel vehicles come into the market place.” Evans management and staff pride themselves on being local, distributing quality products to the Gippsland market place at competitive prices, employing some 130 staff who assist with keeping the local economy vibrant and maintaining the best possible service levels that we can. They believe in putting something back into the local community, which is evident in the large sponsorship base that we currently assist. “We wish Lardner Park Events all the very best with their 50th anniversary on the current site and look forward to continuing our association with them well into the future. All visitors to Farm World are very welcome to visit our site at the BP Ultimate Pavilion where we would like the opportunity to say hello and provide any assistance that you may need with fuels and lubricants.” said Mr. Evans.

WIN $2500 WORTH OF BP FUEL AT FARM WORLD 2017 Place any order for your chance to win this exclusive Farm World offer, get down and talk to the Evans team at the BP Pavillion* 4 DAYS ONLY | March 30 – April 2, Lardner Park | Winner drawn on site on April 2 $2500 gift voucher can be redeemed at any Evans BP outlet or depot on any Evans product * Conditions Apply. Limit one entry per person.

JOIN US IN CELEBRATING 50 YEARS OF FARM WORLD AT LARDNER PARK Find us at the BP Pavillion for: - Handball games and activities with AFL Gippsland - Only the highest quality fuels and lubricants, service and advice - Your chance to win $2,500 in free fuel!

ORDER YOUR NEXT FILL ONLINE EVANSPETROLEUM.COM.AU PHONE: 5662 2217 F07712

SALE | 5143 1030 TRARALGON | 5174 1138 LEONGATHA | 5667 2999

- Castrol Engineers taking all of your questions on Thursday and Friday - All the latest products and offers for your farm, family or business - Meet the Evans team from the Traralgon, Sale and Leongatha Depots

Farm World 2017

This year marks the 50th Anniversary of Farm World at Lardner Park, and Victoria’s premier agricultural event is striding into the future with a strong list of over 900 exhibitors. Demonstrations and presentations will cover food including native foods, fibre, profile chef cooking, home composting and much more. A free forum will engage farmers with the Society of Precision Agriculture and Young Farmers Ministerial Advisory Council with very topical industry speakers, focusing on precision technology, social media and how they are driving higher outputs in the farming industry today (no entry fee forum). This year will see a little nostalgia as Farm World reflects on the journey so far, we will celebrate the long-term loyalty of machinery exhibitors such as Vin Rowe, VC Traders, Gendore, R.E.N. and Alto Motors (to mention just a few) who were present in the founding years of Farm World (formerly known as The Gippsland Field Days). Still exhibiting today, they join a long list of national and regional farm machinery exhibitors with new model releases, wide ranges of stocks, and on-site experts. BJ Bearings, a long term exhibitor at Farm World, have increased their association by taking up naming rights for what was previously known as the General Interest Pavilion - now the BJ Bearings Pavilion so make sure you check out the fantastic product range and advice they have available. This year’s theme is Food & Fibre, and Saturday and Sunday will see a celebratory “Food & Fibre Fiesta” in the main Conference and Exhibition building with presentation sessions, fresh produce stalls and fibre demonstrations and sales. Learn how to take awesome photographs of food for Facebook and Instagram, cooking with essential oils, native foods, bread and cheese making demonstrations, funky basket weaving, home composting and much more. Two high profile cooking demonstrations will be conducted by the renowned Alejandro Saravia, Peruvian-born chef and owner of Pastuso in Melbourne. Women in Agriculture presented by Telstra and supported by Commonwealth Bank Australia is a much loved luncheon on Thursday (www.lardnerpark.com.au for the fantastic speaker line-up). On Friday is an early breakfast (and always highly informative) hosted by the Commonwealth Bank as a strategic partner to Farm World, followed by the Official Opening luncheon with regional Food & Fibre expert Paul Ford as the main speaker. On Friday afternoon a free-entry Forum (seats must be booked on the website) is being hosted by Society of Precision Agriculture Australia and Young Farmers Ministerial Advisory Council, with a focus on “Collaborating to Innovate.” With industry leading panel speakers (refer to website for details), focus is on precision technology in agriculture and social media and how these are driving higher outputs for farmers. Plenty of good tips and insight to be gained from this forum! The Farm World Equestrian Expo was a huge success in 2016 and this year has show-jumping, dressage, mounted games, a breed village, trade exhibits, heritage draught horses, pony rides and plenty more. Supporters loved this event last year, lining up again this year including Pakenham and Gippsland Isuzu UTE as the Main Arena partner, the Mitavite Cool Crusada Masterclass Arena, Pakenham Produce Farm World Cup, and Yarragon Rural Supplies Farm World Mini Prix. For all competition and masterclass session details, prizemoney, and sponsors please visit www.lardnerpark.com.au This year will see the introduction of several crowd-pleasing new activations. “Fittest @ Farm World,” is an epic contest pitting Gippsland farmers against Voyage Fitness gymgoers to determine who really is the fittest! Come along, pick a side and show your support. New to Farm World in 2017 is the BIG Gippsland Jersey Milk OFF challenge, consisting of timed milking challenges with noted regional media and political personalities (1 teat, 1 hand, 1 minute, most milk collected), along with commercial dairy farming education and presentations, the event will be interspersed with engaging panel discussions and theatrics with patrons between daily milk-off sessions. Plenty of retail shopping exists together with indoor trade exhibitors in the Baw Baw and BJ Bearings Pavilions, with a parcel delivery service available to assist with all those shopping purchases. Don’t forget about the new 2-day extravaganza with the Food & Fibre Fiesta on Saturday and Sunday in the main building – demonstrations and presentations together with dynamic displays and food and fibre products for sale. Information and ticketing for Farm World and functions are available for the first time, online now at lardnerpark.com.au still at 2016 ticket prices. Tickets available at the gate on the day at 2017 prices (see website for details). Lardner Park and Farm World 2017 are proud to be supported by strategic partners Commonwealth Bank of Australia, BP Evans and the Baw Baw Shire Council.


Farm World News 2017 Page 3

Please join us at Farm World 2017. Thursday 30 March - Sunday 2 April 2017

Something for everyone at CommBank Farm World site. In addition to Start Smart and other activities on site, the Bank’s breakfast panel discussion returns to Farm World this year. The invitation-only event will discuss the topic Food, Fibre, Facts and the Future: How will innovation help Australia’s food and fibre sectors achieve a profitable and sustainable future? “We are bringing together leading industry experts to talk about what innovation in food and fibre looks like, and what it might mean for the future,” Mr Cairns says. For those looking to buy equipment at Farm World, the Bank is offering an exclusive interest rate discount for qualifying energy efficient agricultural equipment. The Bank will also be bringing its pop up ATM facilities for visitors who need to withdraw cash. “Supporting our communities is an important focus for Commonwealth Bank so we’re pleased to be on board as a strategic partner again this year,” Mr Cairns says.

F07738

Commonwealth Bank is pleased to support Farm World, Victoria’s premier agricultural field day, according to Executive General Manager for Regional and Agribusiness Banking, Grant Cairns. “We’ve been supporting Farm World for more than 30 years and every year there’s something new to see. This year the Bank is bringing its virtual reality technology to Farm World for the first time, which is really exciting,” Mr Cairns says. Families and children will have the opportunity to experience Commonwealth Bank’s Start Smart program, using virtual reality to explore an educational story book while developing financial literacy skills. “Education is a key area of focus for us at Commonwealth Bank, and the Gippsland team is looking forward to bringing this interactive technology to Farm World,” he says.

Farm World 2017 Program The CommBank stand is at site 332-333 at Lardner Park near the Exhibition Centre. CommBank Pop Up ATM’s are located on site. Kids’ Activities Thursday 30 March - Sunday 2 April Dollarmites, colouring-in activities, giveaways and lots more. Women in Agriculture presentation luncheon Thursday 30 March, 12pm - 2pm Featuring Rebel Black, Human Agronomist at ‘The Rural Woman’ and Emma Germano, General Manager of ‘I Love Farms’ Lardner Park Exhibition & Conference Centre Commonwealth Bank Marquee Thursday 30 March - Sunday 2 April Activities for the whole family including a virtual reality experience through our Start Smart education program. Commonwealth Bank of Australia ABN 48 123 123 124. Australian credit licence 234945.


Page 4 Farm World News 2017

Farm World SUPER SAVINGS

Farm World 2017

SEE US AT SITE 348-351 & 422-425

SEE THE ALL NEW HUSKY RANGE

POWER STEERING, 4X4, AUTO

1

0

%

FROM

0

The business now known as Christensen’s Motorcycles was started in 1923 and purchased by the Christensen family in 1937. The business has had only five owners since 1923. Christensen’s Motorcycles has been attending Farm World since 1999 and you can be sure to expect the same high level of service and the same familiar faces at the event this year including proprietor Steve Cooper and his locally based staff. Through Christensen’s Motorcycles, Steve supports a large number of local clubs, charities and community events through donations each year. The business employs local staff and purchases its supplies from local businesses where possible. These local staff and businesses then support other local businesses to create a strong local economy. Money spent in West Gippsland businesses circulates throughout the region many times, stimulating the economy over and over. In many cases money spent outside West Gippsland never returns to the district. When considering your motorcycle needs, Steve encourages you to keep your money local and support Christensen’s Motorcycles, based in Warragul.

We are at Farm World for genuine sales. Bring your trailer, bring your credit card or cheque book. Can be taken on the day.

5600 2x4 ATVs $ 7500 FROM 4x4 ATVs $ AUTO ATVs FROM 6900 FROM

GST

Gippsland’s local ATV specialist

FINANCE

700 FUEL INJECTED VIKING

Only side-by-side vehicle capable of mustering cattle

Christensen’s Motorcycles

$

INC GST

INC GST

GST

LT-A500 FUEL INJECTED

INC GST

Gippsland’s ATV Specialist in Warragul since 1923. FREE delivery from Warragul to Bairnsdale.

1

for sales and service in Gippsland

SHEOCW IAL SPUP TO %

20

OFF

177 Queen St, WARRAGUL - 5623 2173

*Conditions apply

F07639

No

Dennis Canon (left) and Steve Cooper (right) from Christensen’s Motorcycles will be on hand at Farm World. Christensen’s Motorcycles is located at 177 Queen Street, Warragul. Phone

5623 2173 or see the team at sites 348-351 and 422-425 at Farm World.

Super Farm World specials at Sproutwell Greenhouses site

GREENHOUSE

BIG SHOW SPECIALS

Come and visit us at Sites 28 & 29 COMPLETE GREENHOUSE

Follow us on Facebook Fo

Self watering setup for every backyard. Speak to one of our friendly staff to secure one today.

W SHOCIAL SPETO UP

% 20

GREENHOUSE ONLY $

1697

OFF

ts

Self-Watering Po

SHOW SPECIAL

UPGRADE TO A PACKAGE AND SAVE! PACKAGE 1

OWAL SH PECI S

$

2697

3HOW0RICEE Total Value

$

GREENHOUSE ONLY $

1397

O UP T % OFF

20

3212

SHOW SPECIAL

UPGRADE TO A PACKAGE AND SAVE! PACKAGE 2 s'ARDEN0ROM7XM,XM( s!VAILABLEIN'REEN3ILVER&RAME s8!UTOMATIC6ENT/PENERS s0LANT(ANGERS s3HADE3YSTEM s84IERED3TAND s3MALL3ELF 7ATERING0OTS Total Value s,ARGE3ELF 7ATERING0OTS $ s"OTTLES&ERTILIZER *Limited number of packages available

$

2657

3HOW0RICEE

3197

W SHOCIAL SPETO UP

% 20

GREENHOUSE ONLY $

Sproutwell Greenhouses stylish new outdoor room.

5697

OFF

SHOW SPECIAL

UPGRADE TO A PACKAGE AND SAVE! PACKAGE 3 s'RANGE M7XM,XM( s!VAILABLEIN'REEN"LACK&RAME s8!UTOMATIC6ENT/PENERS s0LANT(ANGERS s3HADE3YSTEM s84IERED3TAND s3MALL3ELF 7ATERING0OTS s,ARGE3ELF 7ATERING0OTS s"OTTLES&ERTILIZER *Limited number of packages available

$

6797

3HOW0RICEE Total Value

$

8900

1300 657 174 sales@sproutwellgreenhouses.com.au www.sproutwellgreenhouses.com.au

F07869

s)MPERIALM7XM,XM( s!VAILABLEIN"LACK7HITE&RAME s8!UTOMATIC6ENT/PENERS s0LANT(ANGERS s3HADE3YSTEM s82EAR 7ALL+IT s3MALL3ELF 7ATERING0OTS s,ARGE3ELF 7ATERING0OTS s"OTTLE&ERTILIZER s4HERMOMETER *Limited number of packages available

Sproutwell Greenhouses is a family business that has enjoyed helping gardening enthusiasts and commercial growers achieve their vision. Based in Victoria you have the choice of visiting two display locations. Having already supplied thousands of greenhouses to everyday Australians, professional growers, nurseries, landscape gardeners, schools, community gardens and large insurance companies, they have now made it possible for interstate customers to view their greenhouses as they stock their products in a growing number of retail stores across the country. One of the main things you will experience when dealing with the team at Sproutwell Greenhouses is that you will be given the choice to purchase from three very distinct ranges of greenhouses per your requirements. Sometimes the range that appeals to you

the most will be determined by size, budget, location (if prone to high winds), style and colour. Sproutwell Greenhouses is very different from the ‘average’ greenhouse company as they try to keep their designs unique (many of which are patent designs) and they’re very transparent when it comes to showing their customers exactly what makes each range different. Be sure to visit their website and check out their new range of ShadeHouses, MultiZone Greenhouses (combination of a winter and summer house), stylish outdoor room ranges and the new innovative ‘M Series’ allowing to join any number of Greenhouses together side by side. Sproutwell Greenhouses will be at Farm World, visit Sites 28 and 29 for some of their super show specials. They can be contacted on 1300 657 174 or sales@sproutwellgreenhouses.com.au


Farm World News 2017 Page 5

Farm World 2017

A Historical Perspective In 1963, the year that marked the beginning of Beatlemania and the delivery of Martin Luther King, Jr.’s iconic “I have a dream" speech, a group of Gippsland farmers collaborated to exhibit farm machinery and plant the seed that would eventually grow to become Victoria’s premier regional agricultural event – Farm World. Originally known as The Gippsland Field Days, this iconic event started its life on a property near Longwarry followed by a series of locations in the Warragul region over the next four years. In 1967 land was contributed by some visionary local farmers to form what is now known as Lardner Park, ultimately giving Farm World a permanent home from which it could flourish - 50 years down the track we are celebrating this gamechanging move. The local community were passionate about growing the Lardner Park facility, the site gradually expanded as land was purchased or generously bequeathed from neighbouring farmers as

they passed on. From this brave initiative, back in the 1960s, Lardner Park has grown to 300 acres in size and consists of a modern convention centre capable of hosting up to 1000 delegates, over 5000sqm of undercover pavilion space, an agroforestry plantation, R&D crops and numerous other facilities. Among the more than 900 exhibitors taking part in Farm World this year, are many of the machinery exhibitors who were involved in the original Gippsland Field Days. It is an inspiration to see them maintain their involvement, with exhibitors such as Vin Rowe, VC Traders, Gendore, R.E.N. and Alto Motors continuing to exhibit through successive generations. The Tractor & Machinery Association of Australia will again recognise the Best Powered and the Best Unpowered machines with the annual TMA awards presented at Farm World. Aside from the everexpanding exhibitor list and continual increase in visitor

numbers, Farm World has also experienced highlights throughout its life including visits from Gough Whitlam and Malcolm Turnbull, both of whom have attended to open the event. Farm World was also proud to welcome Quentin Bryce to speak at the Women in Agriculture Luncheon during her time as Governor General. Over the course of the last 50 years our farming community has persevered through good seasons and bad, through floods and seemingly endless droughts. They have seen the rise and fall of wool and beef prices, changes in consumer demands and most recently, the challenge of cuts to milk prices. Events such as Farm World do more than simply passing on new skills and product knowledge; they also serve to bring the farming community together to support each other in much the same way as that first visionary group of farmers did back in the 1960s. Come along and share the love of Farm World this year with lots of new programs sup-

porting its rich history of exhibits. One of the most substantial developments in the Farm World program over the past 50 years has been the inclusion of the Women in Agriculture Luncheon and more children’s activities, such as the Animal Nursery and Agrikidz, which represent the reality that a farm is a business that the whole family contributes to.

An aerial view of the Farm World site at Lardner Park 50 years ago.

Special Chinese Lunches

available in the Baw Baw Pavilion Site BBPF5

FARM WORLD 2017 - Thursday 30th March to Sunday 2nd April ● Hours: 8.30am - 5.00pm (4.00pm Sunday). ● Admission costs gate/online: - Adults $20/18 - Child (5-8) $8/6 - Child (0-4 years) free . ● 2 Day Pass: -Adults $30/28 two day pass: admits one adult for two days. ● Family Pass: -Adults $45/38 admits two adults and up to four children. ● Gold Pass: -Adults $55/52 admits two adults for the four days.

● Farm World 2017 demonstration and presentation program - for updated details visit www.lardnerpark.com.au or download the Farm World App from the iTunes store. ● Courtesy bus service: the patron courtesy bus service runs continuously the perimeter of the site from 8.45am to 5.30pm (4.30pm Sunday). The Farm World map highlights the patron courtesy bus stops. ● Farm World map highlights the location of baby change and feeding room, First Aid, Victoria Police, toilets, catering areas and the delivery service.

CHINESE RESTAURANT Fully Licensed &BYO Eat-in or take-away

● Lardner Park contact details www.lardnerpark. hcom.au or phone 03 5626 1373.

51 Main Street, DROUIN Phone: 5625 2764

F01892

KRONE PRE-SEASON SAVINGS ENDS APRIL 30

0F.IN9AN% CE*

PA

CROSS AVAILABLE ATIRE THE EN RANGE!

*FINANCE 13-60 MTHS FOR ALL KRONE MACHINES WITH NO REPAYMENTS FOR THE FIRST 6 MONTHS. 20% DEPOSIT, MTHLY REPAYMENTS, NO RESIDUAL PAYMENTS.CONDITIONS APPLY.

SEE US AT SITE 302

F07727

3 Endeavour Street, Warragul. 3820 Phone 5623 1362


Farm World News 2017 Page 63

Page 6 Farm World News 2017

$OOJRRGWKLQJV« )DUP:RUOGLVWKHSUHPLXPDJULFXOWXUDOWUDGHHYHQWDQGKDVIRUWKHSDVW\HDUV KRVWHGWKH3DVWXUH*UDLQVDQG9HJHWDEOH'LVSOD\RQWKHODUJHVWVLWHRILWVNLQGLQ 6RXWKHUQ$XVWUDOLDDQGLVFRQFOXGLQJZLWKWKLV\HDU¶VGLVSOD\$YDVWUDQJHRISODQWVKDV EHHQJURZQRYHUWKLVWLPHVWDUWLQJZLWKPDLQVWUHDPSDVWXUHVSHFLHVIHDWXULQJ VHHGIURPWKHPDMRUVHHGEUHHGHUV7KLVKDV JLYHQIDUPHUVDQXQSDUDOOHOHGERWDQLFGLVSOD\ JURZQRQDOHYHOSOD\LQJILHOG*UDQXODU IHUWLOLVHUEOHQGVDQG7UDFH(OHPHQW3DFNV KDYHEHHQDSSOLHGDFFRUGLQJWRWKHVDPH UXOHVZHXVHRQIDUP,QODWHU\HDUVWKHGLVSOD\KDVDOVR HQFRPSDVVHGDZLGHUDQJHRIIRRGJUDLQVDQGYHJHWDEOHV 7KLVWUDGHGLVSOD\KDVSURYLGHGIDUPHUVZLWKWKHNQRZOHGJHRI KRZWRIHUWLOLVHWKHYDULRXVVSHFLHVWRRSWLPLVHWKHLUQXWULHQW  FRPSRVLWLRQPDQDJHGLQWKHVDPHZD\WKDWZRUNVRQWKHLURZQ IDUP $VLPSOHFRQFOXVLRQKDVFRPHIURPWKHGLVSOD\RYHUWKHVH \HDUV±WKHUXOHERRNIRUJURZLQJDOOSODQWVLVWKHVDPHDQG VHWLQVWRQHZKHUHYHU\RXDUHDQGZKDWHYHU\RXJURZ :KLOHDOOSODQWVDEVRUEPLQHUDOVLQGLIIHUHQWFRQFHQWUDWLRQV FRPPHUFLDOO\WKHUDQJHEHWZHHQKLJKDQGORZVRLOIHUWLOLW\LV QDUURZ 7KHILUVWORJLFDODQGPRVWFRVWHIIHFWLYHVWHSLVWRLPSURYHWKHVRLOIHUWLOLW\RI WKHZRUVWSDGGRFNVRQWKHIDUP,I\RXDUHJRLQJWRVSHQGPRQH\\RXUJUHDWHVW UHWXUQLVDOZD\VLQEULQJLQJ\RXUZRUVWSDGGRFNVXSWRVSHHG 

7KH5HWDLO7HDPDW%DVL[7UDFH(OHPHQWVFDQKHOS\RX WRQDYLJDWHWKHVWHSVLQWKHVRLOIHUWLOLW\SX]]OHE\SXWWLQJ WRJHWKHUDFRPSOHWHIHUWLOLVHUSURJUDPXVLQJWKHPRVW UHVSRQVLYHJUDQXODUIHUWLOLVHUDQG7UDFH(OHPHQW3DFNV WRDGGUHVVRQO\ZKDW\RXQHHG 6HH\RXDW)DUP:RUOG

6WHS

$VLQJOH67VRLOWHVWFRVWLQJLQF LVWKHVWDUWLQJSRLQWWRQDYLJDWHWKHVRLO IHUWLOLW\SX]]OH:HFDQKHOS\RX RUJDQLVHWKDW

6WHS

:H ZLOO KDYH D FKDW DERXW WKH UHVXOWV DQG RXWOLQH D ZD\ IRUZDUG WKHQ WKH GHFLVLRQLV\RXUV

See us at Farm World site A29

F07730

6WHS


Page 62 Farm World News 2017

Farm World News 2017 Page 7

Farm World 2017

The BIG Gippsland Jersey Milk OFF So much fun and positivity has been milked out of the dairy industry in the past year, it’s time to put a little back – introducing the BIG Gippsland Jersey Milk OFF at Farm World 2017. The concept is simple‌ It’s a Hand Milking competition - One hand - One teat One minute. The contestant who can extract the most milk within one minute wins the ‘Milk OFF’ trophy. The hook lies with the contestants, as these are not your run-of-the-mill dairy farmers‌ we’re going to see everyone from Councillors and media to baristas and school children fighting it out against their contempo-

raries for the glory of the Milk OFF trophy. The BIG Gippsland Jersey Milk OFF will kick off at 12:00pm on Thursday 30th March in the historic Rotunda with plenty of colour and interactive displays including Sallie Jones and Steve Ronald’s from Gippsland Jersey in some very eye-catching costumes. First cab off the rank will be some representatives of the next generation of dairy farmers, who will fight it out in a School Children’s MilkOff at 12:00pm on Thursday. This will be closely followed by some of the Agricultural Industry’s most proactive female representa-

NEW SEASON’S HAY FOR SALE Barrel Clover, Vetch Wheat, Barley, Oats & Balansa Clover 4x3x8 Bales all top quality, large lines. Shedded all weather access.

SITE CB 19 - 20

F07968

On show at Lardner Park Field Days

Phone Evan 0428 504 465 or Luke 0428 596 280

tives in the Women in Agriculture Milk Off at 2:30pm. The fun will continue on Friday 31st March with a political stand-off at 10:30am as Gippsland MPs and Councillors test their skill in the second day of the BIG Gippsland Jersey Milk OFF. While the local politicians may have a good understanding of the dairy industry, there are few occupations with more passion for milk than your local barista – but can they extract it themselves? Some of Gippsland’s best baristas will take the challenge in the Barista Milk Off at 12:00pm on Friday. There will be two opportunities to see some of your favourite media personalities test whether the gift-ofthe-gab translates to talent in the milk shed in the Media Milk Offs at 1:30pm on Friday and 12:00pm on Saturday. There will also be plenty of opportunities for Farm World visitors to walk away with a Milk Off trophy, in the weeks leading up to Farm World we will be giving away 12 general public tickets through local media, which include entry to Farm World and the opportunity to compete in the BIG Gippsland Jersey Milk OFF. Alongside the crowdpleasing hilarity of the BIG Gippsland Jersey Milk OFF, there will also be displays educating the crowd on the history of the dairy industry, and the contribution it makes to both the local economy and the Victorian milk supplies.

)URP WKH EHJLQQLQJV RIWKLVGLVSOD\XQWLOWKHSUHVHQW

Flashmate heat detector lights up AI program for South Gippsland dairy farmer Craig and Deb Allott are third-generation dairy farmers who sharefarm with their daughter and son-inlaw on the family property at Hazel Park in South Gippsland. During this autumn’s joining program, they used the Flashmate electronic heat detector from Gallagher for the first time and haven’t looked back yet. First off - What is Flashmate? Flashmate is an electronic heat detection device that monitors riding activity in dairy cows to work out when an animal is in standing heat. It looks for specific patterns of riding/mounting by other cows - such as frequency, amount and duration of activity – and flashes red to indicate when a cow is ready for AI. If the cow doesn’t come back into heat within 25 days of being AI’d, the Flashmate will flash green to indicate a possible conception. Previous heat detection experience: Craig has used traditional methods for detecting heats before but with mixed results. “In the past we’ve used tail-paint and tried scratchies too, which have not been really successful.

“The cows will find trees across the property that they can have a scratch against – and that’s given us false readings. Likewise tailpaint is ok but sometimes you can’t really tell if the cow is definitely ‘on’ and ready for AI.� This has meant that someone with Craig’s skill and expertise has always had to be present during milking times – to be able to recognise the patterns of when a cow is in standing heat. “A problem we had before was that cows brought in for milking might have been let go from the shed and put back out into the paddock before we’ve had the chance to properly ID which ones are in heat. “Even then, if someone with the right experience is there to keep an eye on things, an autumn joining period often means that you’re milking in near-darkness – so it’s very hard to accurately pick out the cows that are ready for AI sometimes�. Why try Flashmate then? The main reason Craig says they chose Flashmate was greater ease and efficiency in correctly identifying cows that are in heat. “I did consider they’re a bit more expensive than other options out there but

if you’re picking out more cows – and more accurately, more easily and faster too – then that helps to balance the cost out I think.� Another reason lay in the application of the Flashmates. According to Craig, applying them was also pretty easy. “We just did it during milking while the cows were on the platform. So I just went along and sprayed them with the glue while his wife, daughter and sonin-law were milking. And by the time I’d sprayed them I’d just go back to the start again and pop them on – it was pretty good to apply them and less mess than paint.� What happened next? Having applied Flashmates to 150 of his herd, two or three days passed before the first one was activated. “As soon as the Flashmate was on though, it was very easy to see and that made it a bit exciting! Within about a month, you could look across the farm at a certain paddock at night and there were green and red flashes flickering all over the place – it was like a light show – quite interesting to see.� Easier and more accurate That same light show enabled Craig and other

Want to see the latest in Electric Fencing and Animal Management? Problem solved.

WLPH ZH KDYH JURZQ DOO WKH FRPPRQ PDQ\ RI WKH LQWHUHVWLQJ VHYHUDORIWKH XQXVXDODQGHYHQMXVWIRUIXQDFOXVWHURIWKHZHLUGLQFURSVDQGSDVWXUHV

dairy workers to see exactly which cows were responding to the AI program: “The milkers can actually identify the cows without needing someone who’s got a lot of expertise in knowing the cycle patterns to watch out for. “The Flashmate allows anybody to tell what’s going on, so it’s saving us time and effort and cutting out the guesswork from other methods we’ve used in the past�. Craig notes that Flashmate accurately identified one particularly quiet cow that had never shown any signs of mounting activity in the past seven years. “We’d never seen her bulling, never picked up on a cycle before and actually selected her for AI for the first time ever because of Flashmate. In the past we’d normally have the bull pick her up later on, so that was a big bonus to see happen this time around. “Overall, I’d say Flashmate has definitely made life a lot simpler. Picking up more cattle the way it’s allowed us to, more accurately and quicker – that’s why I’m looking forward to using it again this spring joining period too.�

7KLVOHDYHVRQHODVWIURQWLHUtractor friendly, grazeable wind breaks. <HS-7,0%(5

3LFWXUHWKLVÂŤ $VWDQGDUGWKUHH-URZZLQGEUHDNRQDORFDOIDUP,PDJLQHLIWKDWZLQGEUHDNFRXOGEHWUDQVIRUPHGWRSURYLGHWKH XVXDOEHQHILWVSOXVDVXLWHRIQHZSURGXFWLRQDQGSURILWDGYDQWDJHVLQFOXGLQJ i i i i i i

*UD]HDEOHLQWHU-URZVLQDVKHOWHUHGDQGVKDG\HQYLURQPHQWZLWKLQPRQWKVRIHVWDEOLVKPHQW 7UDFWRUIULHQGO\WUHHVURZVVSDFHGWRVXLW\RXUQHHGV HJWRPHWUHVDSDUW  +D\DQGVLODJHSURGXFWLRQZLWKLQPRQWKVRIHVWDEOLVKPHQW 6XPPHUDFWLYHSDVWXUHVXQGHUKLJKSUXQHGWUHHVSURYLGLQJDSURGXFWLYHILUHEUHDN 3URGXFWLRQRIVRXJKWDIWHUGXUDEOHZRRGWKDWFRXOGEHXVHGRQIDUPWRUHGXFHFRVWVRUVROGLQWR GRPHVWLFDQGH[SRUWPDUNHWVWRSURYLGHQHZUHYHQXH (QKDQFHGFDUERQIDUPLQJFUHGHQWLDOVDQGVXEVHTXHQWUHYHQXHRSWLRQV

7KHDSSOLFDWLRQRI 0XOWL6WRUH\)DUPLQJ 06) WHFKQLTXHVLQFRPELQDWLRQZLWKQDYLJDWLQJVRLO IHUWLOLW\FDQFUHDWHVXFKDWUDQVIRUPDWLRQ 06)WDNHVWKHLQWHJUDWLRQRIWUHHVRQIDUPVWRDFRPSOHWHO\QHZ OHYHORIIHULQJDQHZGLPHQVLRQRI EHQHILWVWRWKHIDUPHU,WWUXO\LQWHJUDWHVGLIIHUHQW ³VWRUH\V´RIVRLOSDVWXUHDQGFURSVOLYHVWRFNDQG WUHHVRQRQHODQGXQLWWRFUHDWHDGLYHUVHV\VWHPZLWKDPRVDLF RISURGXFWLRQRSSRUWXQLWLHVRYHUWKH VKRUWPHGLXPDQGORQJWHUP

Visit our N EW Farm Wor ld Site

2SHUDWLRQDOO\ 06) LQYROYHV WKH SODQWLQJ RI WUHHV DW ZLGH VSDFLQJVWKDWIDFLOLWDWHWKH GHYHORSPHQWRIFURSSLQJSDVWXUHDQGRUOLYHVWRFNEHWZHHQWUHHV,WLVDIOH[LEOHRSWLRQ WKDWFDQEHWDLORUHGWRWKHQHHGVRIDQ\IDUPV7UHHVSHFLHV SODQWLQJGHVLJQSDVWXUH DQGFURSW\SHVFDQEHPRGLILHGWRVXLWGLIIHUHQWVLWHVDQGIDUPLQJV\VWHPV

#701-703

%(/7(& Introducing Westonfence

Introducing FlashMateâ&#x201E;˘

A strong, reliable permanent electric fencing solution suitable for internal subdivision, boundary fencing and feral exclusion.

An electronic heat detection device that monitors riding activity and works out when a cow is in standing heat.



)22767(3 3$571(56 :D\QH -R\)RRW 

6RXWKHUQ$XVWUDOLD

*LSSVODQG

%HOLQGD&XQQLQJKDP Be in with a chance to WIN a S10 Solar Energizer

$*5,&8/785$/ 6&,(17,67 %ULJLG:DWVRQ 

F07949

7DVPDQLD)OLQGHUV .LQJ ,VODQGV

www.gallagher.com

%$6,; 7UDFH3DFNV 5HWDLO7HDP

-867$''75((6 &OLQWRQ7HSSHU  *UD]HDEOH:LQGEUHDNV

06)LVDG\QDPLFV\VWHPWKDW FKDQJHVZLWKWKHJURZWKRIWKH WUHHV'XULQJHDUO\\HDUVFURSVFDQ EHJURZQEHWZHHQWKHWUHHVDQG ODWHUEHUHSODFHGE\PRUHVKDGH WROHUDQWSHUHQQLDOSDVWXUHV\VWHPV WKDWFRQWLQXHWRSURYLGHSURGXFWLYH OLYHVWRFNPDQDJHPHQWRSWLRQV DGMDFHQW DGMDFHQWWRODUJHWUHHV

(/,7()2''(5 -RVK*UHHQH  :HVWHUQ9LFWRULD

68132:(5 %UXFH&XWWV  (QYLURQPHQWDO)DUPLQJ

&RPHDQGVHH0XOWL 6WRUH\)DUPLQJLQDFWLRQ DWRXU)DUPZRUOGVLWHDQG GLVFXVVKRZLWFDQ HQKDQFH\RXUIDUPLQJ H[SHULHQFH


Page 8 Farm World News 2017

Farm World 2017

3rd Charolais Sale

F07742

Kactus Point Charolais are pleased to be holding their third sale at Farm World this year. On Saturday, April 1st at 1pm, 12 hand picked young Charolais bulls will be auctioned. The bulls are a combination of poll and horned bulls which are ready to go straight to work. We have added to our herd last year two Poll French Stud bulls from ANC in Queensland.

The poll bulls in the sale have low birth weight backgrounds. Kactus Point Charolais was founded by Bruce and Vera Cook in 2008 when they bought their first registered Charolais cows. They have constantly improved the genetics over the past years. The main herd began with the first pick of MixHillâ&#x20AC;&#x2122;s joined and unjoined heifers (27) when they dispersed their herd.

3rd Charolais Bull Sale Farm World - Lardner Park 2017

12 Stud Bulls

Saturday 1st April at 1.00pm

Stud Charolais Bulls to be auctioned. Breeding information available prior to sale. For further information Contact Vendor: Bruce Cook 0417 334 821 or Alex Scott & Staff: Dane Perczyk 0408 176 063

F07886

These heifers became the major nucleus of the herd and they have bought from many other sales to constantly improve their herd genetics. Over 150 stud cattle have blood lines from Boongatti, Rosedale, ANC, Nargoon, Sedalia, AYR, Carabinier, Pinay, SVY, Jay Tees, Tirrikee, Palgrove etc. The herd comprises of both E and F grades in both horned and poll form. The stud is building up on poll blood lines in both E and F grades. Bulls which are being used now are from Rosedale, ANC and Boongatti (a son of Pinay). These bulls have been producing some excellent progeny. Bruce has worked with cattle all of his life having stud cattle in 1972 including a Melbourne Show Grand Champion bull. He then moved into cross bred Charolais and then progressed into stud Charolais, His family on both sides have been in the cattle industry. Cattle are situated in Northern Victoria (Kerang / Swan Hill) and Crossover, Victoria (West Gippsland). Replacement cows are evaluated for temperament, confirmation, fertility and production. Cows are both white and red factor and they are catering for beef production. We have just joined some stud heifers of which a limited number will be available for sale later in the year (calving in Sept/Oct) and some unjoined heifers available now.

<RXUORFDO7HOVWUD WHDPDUHFRPLQJ WR)DUPZRUOG :H UHORFDOVVRZHXQGHUVWDQG\RXU XQLTXHQHHGV2XUH[SHUWVZLOOEHRQ KDQGWRKHOS\RXJHWPRUHIURP\RXU WHFKQRORJ\ :HZDQWWRGREHWWHUIRU\RXVRFRPHDQG VHHXVDWVLWHQHDUWKH%DZ%DZ 3DYLOLRQ

THINGS YOU NEED TO KNOW: The spectrum device and â&#x201E;˘ are trademarks and ÂŽ is a registered trademarks of Telstra Corporation Limited. ABN 33 051 775 556

Visit the Telstra team at Farm World At Telstra we are very proud to be part of a company that is rolling up its sleeves and investing in rural and regional Australia. Weâ&#x20AC;&#x2122;ve announced plans that could see up to $1 billion of investment and co-investment to grow and enhance our regional mobile network over the next five years. Mobile Black Spot Program The Federal Government announced Round 2 of the Mobile Black Spot Program late in 2016, with a further 16 Telstra sites to be built in Victoria. This will make a total of 125 locations in rural and regional Victoria, including 16 in the Gippsland region, to be provided new mobile services. Telstraâ&#x20AC;&#x2122;s rollout of the Mobile Black Spot Program involves more than $486 million worth of co-investment in country Australia with Telstra joining with the Federal and State Governments as well as numerous local councils to deliver state of the art mobile services to major regional transport routes, small communities and in locations prone to natural disasters. Co-investment such as this is working, and we recently activated our 100th site nationally, with more than one third of these in Victoria. NBN rollout Around 102,706 homes and businesses in Gippsland are now eligible to connect to the NBN, setting new benchmarks for the areaâ&#x20AC;&#x2122;s broadband speeds and reliability.

The FluroSat team can look at crop health and identify issues on your farm through wing cameras mounted on drones and satellites. Telstra is also providing a range of sophisticated, NBN optimised technology for home and the office to ensure customers enjoy high speed connectivity inside their home or business. These include the Telstra Air network giving people the freedom to get online at thousands of hotspots across Australia; a marketleading Wi-Fi hub; and the free T-VoiceÂŽ app that turns compatible tablets and devices into home phone handsets. Technology changing the future of farming Over the next 20 years, continued innovation and investment in technology can deliver some exciting opportunities which will change the way we live,

work, and interact. One such area of interest to regional communities is the Internet of Things (IoT) in agriculture. IoT refers to everything from cars, houses, farming equipment and public infrastructure being connected to one another through a network. In the future, the data collected through IoT will help farmers make smart decisions and reduce or potentially eliminate circumstances which can adversely impact profits and livelihoods. For example, FluroSat, a Telstra muru-D startup is building tech that could save the Australian agriculture industry millions of dollars in revenue. Using multi and hyper-spectral cameras mounted on

drones and satellites, the FluroSat team can look at crop health and identify issues that may be affecting the fields. This allows them to see problems with crops before a farmer on the ground is able to, and recommend precision fixes. Come have a chat to us at Farmworld Our local Telstra Team will be at Farmworld again this year. If youâ&#x20AC;&#x2122;d like to discover how technology can help your business, experience the Telstra Smart Home or the try latest 4G mobile devices visit site 202, near the Baw Baw Pavilion. We look forward to seeing you there, and thank you for your support.


Farm World News 2017 Page 9

For Farmworld’s BEST Log Splitter & Ride On Mower deals visit REDGUM GX200 SPLITTERR Guranteed to split your wood or your money back! Australia’ss No. Australia No.1 selling ng Honda P red Log Splitter... Powered

Full Range of Husqvarna Ride On Mowers on display! All with 36 months Interest FREE And with $698 worth of FREE* Bonus Products!

S Splits Horizontal orizontal & Verticall 4 Year Honda Engine & Splitter er Warranty

Great Buy $2,499 G

FREE $500 RedShed package kage with each RedGum GX200 Splitter purchased at Farmworld..

FREE* $399 Husqvarna 236e Chainsaw

00 ED EDIT IITTIO ON EDITION VER SIL S

RRP $2199 Special

SPLITTER

$1999 Save $200

Chipper

AND FREE* $299 Husqvarna Combi Trailer with FREE Husqvarna Helmet & Bag worth $208 & includes Battery & Charger.

Victa VZT2652 Zero Turn

- Guaranteed to split your wood or your money back. - Powered by a genuine Honda GP200 engine - Splits in both horizontal & vertical position - 2 Year Log Splitter & Engine Warranty

26HP V-Twin Briggs 52” Cut

Superceded Model HOT PRICE $4499

Morrison G380 Ride On n below dealer Buy Price JUST $1999 save $1200 400cc Powermore 38”Cut

Farmworld’s best UTV deal!

BU ONE GET ONE FREE! BUY Bu Buy a Husqvarna Chain to suit your Husqvarna chainsaw & get another ch one FREE !

PQV500 Utility Vehicle

RRP $12,900 Save $1,551 Special $11,349 includes:

Free $570 Windscreen Free $199 Roof Free $650 Winch

Pressure washer bargains!

Special Farmworld Offer. Must mention this ad.

Honda’s No.1 Selling Generator!

The RedGum Chipper powered by Honda, a, quickly chips tree branches (up to 3” thick) k) k) into valuable garden mulch. Powered by your choice of 2 Honda Engines: -

FREE

RedGum GP200 Chipper RRP $1,199

Special $999 Save $200

RedGum GX200 Chipper RRP $1,399

Special $1,199 Save $200

*Special Spe peci cial al Husqvarna Hus H usqv qvar arna na offer off o ffer er abov ab ovee excludes excl ex clud udes es TS138 TS1 T S138 38 above

Husqvarna Battery Polesaw $1097

OFFER includes: FREE $350 RedShed voucher & FREE $150 warranty y extension!

20 P2 GP RED RE ED GU G GUM UM G

$800 k bac Cash 238 C on T

$500 k bac Cash 348 S on T

Honda Eu20i Generator RRP $2099 Save $350

Farmworld Special $1749

FREE $289 BE SMART, BE SAFE KIT# with Selected Husqvarna Chainsaws

Briggs & Stratton BPW4000 Pressur Pressure Washer - 4000psi 15.1LPM 13 13.5HP Commercial Briggs engine RRP RR $1999 Save $700 Special $1299 Briggs & Stratton BPW2000 Pressure Washer - 2000psi 7.6LPM RRP $499 Save $200 Special $299

Visit us during Farm World on sites F15-16, E32-33 & F27 or our Superstores located in Bunyip, Cranbourne, Mitcham, Dandenong & ArborMaster Bayswater Phone: 1300 136 572 Mower & Ride On Superstore

More deals on www.TheRedShed.com.au

FREE $289 BE SMART, BE SAFE Kit Offer* commences April 1st or at Farmworld on the following Husqvarna Chainsaws:

135E Chain Chainsaw 40.9cc 4 40 .9cc – 1.5kW – 16” bar

Only $649 includes FREE $289 Kit

445 II Chainsaw 55.5cc – 2.6kW – 18” bar

FREE9 $28 * Kit!

Now only $249 RRP $399 Save $150

BE SMART, BE SAFE KIT includess Husqvarna Husqvvaarna Premium Ear Muffs, Muffs Pro Chaps, M Muf Chaps Clear X Protective Glasses & Cap

#

...& up to $300 Cash Back** on More Powerful Husqvarna Chainsaws

** Cashback Offer starts April 1st. Terms and Conditions apply. See instore for details. *When 536LiXP is purchased with Battery and Charger

Only $899 includes FREE $289 Kit

455R-AT Chainsaw 55.5cc – 2.6kW – 20” bar

Only $1199 includes FREE $289 Kit

*Also 440e & 450 II Chainsaws

Visit Farm World sites F15-16, E32-33 & F27 or instore at Bunyip, Cranbourne, Dandenong, Mitcham & Bayswater

Phone: 1300 136 572 F02461

236e Chainsaw

www.TheRedShed.com.au www ww w TheR Red edSh dS dS Sh hed d com au


Page 10 Farm World News 2017

Farm World 2017

Family Friendly Farm World TERRASEM C4

AERSOSEM 3002 ADD

TERRADISC 6001 with TEGOSEM 500

PÖTTINGER’s – World-Class Seeder Range

See us at Farmworld 2017

Designed in Austria. Made in Germany. Performs in Australia. New stock for this year has just arrived: „ AEROSEM pneumatic seed drill and precision planters „ TERRASEM mulch seeders „ TEGOSEM air seeders

F07720

For more information on our product line contact us at +61 3 9359 2969, www.poettinger.au

Farming is a family business in the truest sense of the word - and this is exactly what so many farming families love about it. The opportunity to grow up on a farm and spend time with parents while they work is something that most farming children treasure long into adulthood. So it makes sense that Farm World is an event that caters to the whole family. As the saying goes, if the kids are happy, the parents are happy. This is a mantra that certainly rings true at Farm World, which offers such a fun-filled family day out that even non-farming families won’t miss it! And it’s easy to see why, from endless large machinery exhibits to working dog demonstrations and horse riding events, there is so much for the kids to experience. They even have the opportunity to have a first-hand experience with the animals with the ever-popular LION DAIRY animal nursery and pony rides. The Lion Dairy Animal Nursery and Picnic Area has action all day long with the informing talks from the volunteers, petting and engaging with the animals, and the fabulous Animals of Oz daily show. In addition to family activities throughout the event, this year Farm World will launch the AgriKidz program. This innovative program focuses on school-aged children from local and peri-urban regions. Over the year, AgriKidz will share information to teach about where foods actually come from and how to grow healthy food at home, farm safety, machinery demonstrations, livestock engagement and much more. They’ll learn about the full life cycle of their produce – from the farm through to what happens behind the supermarket shelf, and on to composting and recycling. The AgriKidz program also includes a colouring competition with some fabulous prizes available. Farm World has provided some additional areas for a little rest and relaxation

– check out the grassed areas that have been left available for your comfort in front of the Exhibition & Conference Centre and directly behind the main office building. In 2012, Farm World introduced the Women in Agriculture Luncheon to their program celebrating women in rural and regional Australia. This year’s luncheon, presented by Telstra, will be held on Thursday 30th March and will feature two guest speakers. Rebel Black, launched her first business at age 22 and has spent the past 16 years creating award winning businesses, while leading development in women’s empowerment, community, tourism, education, business and social, emotional and physical wellbeing. Emma Germano, a local Gippslander from Mirboo North, boasts a Nuffield Scholarship, international relations studies, a restaurant venture and business strategy consulting under her belt. Emma works on the family farm (Germano Produce), as the Business Development and Operations Manager, which supplies cauliflower, cabbage and potato crops to the fresh market. She is also the vice president of the Victorian Farmers Federation Horticulture Group. The Women in Agriculture luncheon, together with Telstra as the Presentation Sponsor and supported by Commonwealth Bank Australia, is a signature event at Farm World and is a unique and relaxed opportunity to listen to some inspirational speakers. The new event sure to entertain and inform crowds this year is the BIG Gippsland Jersey Milk OFF. Consisting of timed milking challenges (1 teat, 1 hand, 1 minute, most milk) between local community-leaders, media, and politicians, along with commercial dairy farming education and presentations, the event will be interspersed with engaging panel discussions and theatrics with patrons between the 3 daily milk-off competitions.

Assumption College

A catholic boarding option for Gippsland families Visit us at

Farm World

Boarders studying in the Fourviere Library - part of the refurbished former boarding house.

assumption.vic.edu.au

All-round excellence Boarding vacancies are available in Years 7 – 12 for 2018. can offer your family please contact Bernie Jephson on 5782 1422 or email registrar@assumption.vic.edu.au

Assumption College Kilmore A Catholic Coeducational 7 to 12 Day and Boarding School in the Marist Tradition

347ASS F02352

To arrange a personal appointment to discuss what Assumption College

Assumption College Kilmore, a coeducational day and boarding school, has been educating students in the Catholic and Marist traditions since 1893. Its co-ed boarding program is an integral component of college life with fulltime and weekday boarding available. Being co-ed, the sense of family spirit is enhanced where each boy and girl is known, included and encouraged to be involved. The boarding houses, which are less than three years old, cater for 72 boarders. Each house accommodates 24 students: senior students have their own rooms and juniors twin share. The rooms are bright, warm and comfortable and provide each student with a desk, king-single bed, wardrobe, storage area and Wi-Fi access. Assumption promotes close links between boarding and teaching staff to enable students’ academic progress to be monitored. Daily supervised study and on-site, after-hours tutoring by teachers from the day school help boarders to reach their

full academic potential. Academic scholarships are offered to boarders entering years 10 and 11. The broad curriculum caters for students’ individual needs. At years 7 and 8 the focus is on subjects that offer breadth and balance, where students study all areas of the Victorian curriculum and are exposed to an array of digital and design technologies. They begin to make elective choices in years 9 and 10 where the emphasis is on pathways and choice. Students can select up to 16 semester-based electives over these years, providing a highly personalised learning experience and promoting student ownership of their own education. In the senior years, up to 30 VCE studies are offered, alongside school-based apprenticeships and numerous VCAL and VET courses with hospitality available in the school’s trade training centre. There are many sporting co-curricular activities including hockey, clay target shooting and lawn bowls as well as equestrianism and popular cultural pursuits: drama, debating, dance and music.


Farm World News 2017 Page 11

Farm World 2017

Learn more about what Federation University offers at their site at Farm World. Visit them at the Baw Baw Pavilion, site 27.

Your local university, opening up a world of opportunities

be strong, be KUHN

dents in fields such as business, IT, engineering and science, creating a vital link with local employers. Not only do FedUni students gain valuable workplace experience during their degree, but businesses in their region have access to the next generation of employees. And if you’re someone who thinks it’s impossible to combine your work or personal commitments with university study, you should know that many of their current students are parents, small business owners and older members of the community, who are studying at FedUni part-time or via online learning. Learn how you can join the Federation Generation. Visit them at Farm World stand BBP27 or call 1800 333 864.

F07884

(source: QILT.edu.au). Through an expanded range of courses – including recently added programs in secondary teaching, sport science, outdoor education, mechatronics engineering, and a range of new degrees in science and information technology – FedUni is delivering a diverse mix of study options, usually only found at larger metropolitan universities. Their focus on careers is also a key part of what sets them apart, with FedUni partnering with business and industry to ensure their students develop job-ready skills. For example, their degrees in nursing and education all include extensive placement experience, whether that be in local hospitals, or within primary and secondary schools across the region. They also provide workplace opportunities for stu-

ORDER KUHN NOW

AND GET SET FOR SPRING.

1.99% finance*

Pre-order your KUHN machinery for spring and take advantage of this great finance offer. Offer available until 15 April 2017.* *1/3 deposit required and / or trade. Maximum finance term 36 months on hay tools / 42 months on balers and wrappers. Conditions apply. 3 Endeavour Street, Warragul. 3820 Phone 5623 1362

SEE US AT SITE 302

F07726

Federation University Australia is proud to be part of the Gippsland region. Through their local campus in Churchill, they’re providing students with more choice, more flexibility and more opportunities to succeed. Whether you’re a VCE student about to take the next step in your education, or someone who’s returning to study for a career change or to enhance your skills, their wide range of degrees are designed to give you the knowledge that employers are looking for. Combined with the Gippsland Campus’ worldclass facilities, teaching staff, and extensive range of student support services, it’s little surprise that graduates have rated FedUni as the number one university in Victoria for teaching quality, student support, and full-time employment


Page 12 Farm World News 2017

Farm World 2017

Warragul Forest and Garden your local garden equipment dealers

Warragul Forest and Garden are your local power specialists, purchase from a local dealer for peace of mind and convenience. The friendly staff are, from left: Jason Bailey, Jo Steenholdt, Isaac Haymes, Farren Young (on mower), Nicki Kimm, Jason Kimm and Jarrod Walters.

Warragul Forest and Garden are your local garden equipment dealers. They specialise in Husqvarna chainsaws and garden equipment, Greenfield rideons and chippers, Scag, Masport lawn mowers and chippers, Oregon logsplitters, Fiskars axes, brush hooks and hand tools, Felco hand tools, Gerni pressure washers, Shindaiwa garden equipment, Echo garden equipment, Crommelins water pumps and concreting gear and Gerber knives. They also have a fully functioning workshop with three full-time mechanics and an apprentice. Visit Warragul Forest and

Garden at Farm World, site Number 447 and 521 for expert advice and great deals. Alternatively, phone 5622 1944 for more information on the services they offer.

Deep sub-soil tillage and top-soil cultivation in one pass – “The Fix Rehabilitator Plough”

A great range of EGO products will be on show at the Warragul Forest and Garden site.

DEEP SUBSOIL AND TOPSOIL TILLAGE One pass seed bed preparation

SITE C26

MADE IN AUSTRALIA FIX ENGINEERING

GRAHAM WOOD MACHINERY

Tel: (03) 5348 2669 M: 0418 508 573 www.fixengineering.com.au

Tel: (03) 5678 8880 M: 0418 591 678 www.grahamwoodmachinery.com.au

F02420

Low Horsepower Gentle on Soils Deep Aeration Incorporates Crop Residue Prepares Seed Beds Improves Soil Health Increases Productivity

See the Fix Rehabilitator Plough at Graham Wood Machinery, site C26.

THE FIX REHABILITATOR

It lifts and cracks, aerates and penetrates like no other implement. Use the Rehabilitator Plough instead of Rippers, chisel ploughs, Discs, Rotary hoes or power Harrows. The Fix Rehabilitator plough is designed to loosen and lift the soil by allowing the soil to crack along natural lines. The Tusk rollers till the top-soil producing a seed-bed and leaving the soil loose and aerated and able to capture and hold moisture. Features: ● Relatively Low Horsepower requirement ● Machines are available from 1.5m to 6 metres ● Linkage and trailed ● Extra sturdy frame The parabolic Tines can penetrate up to 500 mm, and are fitted with reversible chisel points. The two rear tusk rollers have a levelling mechanism and height adjustment. Soil is lifted, the surface is cultivated, and crop residue is partially incorporated to

speed-up decomposition. Often cereal crops, legumes and maize can be re-seeded after a one pass cultivation. Most beneficial organisms in the soil are aerobic; most detrimental organisms in the soil are anaerobic. Good aeration will inhibit the damaging organisms and encourage the beneficial ones. This will be a healthier soil which will mineralise and recycle nutrients more effectively and provide a more sustainable system. Healthy soil is the best and cheapest way to produce healthy plants. This won’t happen with toxic inputs. Soils need adequate air. So to improve your soil and save on costly and often damaging inputs, the FIX Rehabilitator Plough could well be the answer. Visit the team on site C26. Fix Engineering. Phone Mike on 0418 573 508 or 03 5348 2669 and Graham Wood on 0418 591 678 or 03 5678 8880.

WARRAGUL FOREST & GARDEN

GREAT FARM WORLD DEALS NOW STOCKING EGO PRODUCTS

Greenfield Chipper

Greenfield Ride Ons

Scag Zero-Turn Mowers

YOUR LOCAL DEALER! We service & maintain what we sell.

Your local power equipment specialists, fully equipped workshops, warranty & service agents! Purchase from a local dealer for peace of mind & convenience, long after the sale!

176 Queen St, Warragul. Phone 5622 1944

F02458

SEE US AT FARM WORLD - SITES 447 & 521.Local delivery can be arranged the week following Farm World


Farm World News 2017 Page 13

Farm World 2017

VISIT SILVAN’S

NEW PRODUCT RANGE Come to Farm World 2017 and see our exciting NEW range of products including Silvan Spraying Equipment, Nobili Mulchers, Brevi Rotary Hoes, Bed Formers, Slashers DCM Spreaders and Power Harrows and our extensive range of SELECTA products.

EE OUR NEW PRODUCTS ON THE DAY! AT FARM WORLD TO S D N A T S N A V L I VISIT THE S The latest addition to the Silvan Australia range of Nobili vegetation mulchers is the hydraulic offset model TBE series with a working width from 1900 to 2600mm. The mulcher is an ideal choice behind a 70 to 180 horsepower tractor as a central or offset machine for managing pasture, roadside edges, verges or sloping ground. Already popular with local government bodies and land managers, the Nobili TBE series is equally at home on a farm.

Nobili, the Italian manufacturer of precision mulchers, has been represented in Australia by Silvan Australia for almost two decades. Nobili continues to win international markets for its mulchers based on product quality and innovation. The latest Nobili innovation is the TBE series of mulchers that can be used both centrally behind a tractor offset (left and right hand offset versions available) making them ideal for pasture mulching as well as roadside edges, verges or sloping ground. The new Nobili TBE Series therefore gives farmers, land managers and especially local government bodies a uniquely effective machine. With a working width from 1900mm to 2600mm, the TBE Series is an ideal choice for a 70 to 180 horsepower (or 60 to 130kW) tractor. The rotor blades of the Nobili TBE spin at 2205 revolutions per minute based on a PTO speed of 540 rpm with the choice of

two different blade types depending on the type of vegetation. With an all up weight from 925 to 1100 kgs, the Nobili TBE series is supplied complete with double skin, durable working skids and guards that ensure the mulched material is deposited safely on to the ground behind the machine. Silvan Australia’s machinery specialist, Gavin Wheatcroft, says Silvan has sold thousands of Nobili mulchers into all markets and application areas Australia wide and despite a number of copyists they have earned an unparalleled reputation for quality and performance. “Newly introduced, we will have the Nobili TBE Series of versatile offset mulchers available for demonstration across Australia.” For more information on the Nobili range contact Silvan Australia on freecall 1300 SILVAN (1300 745 826) or email info@silvanaust.com or see www.silvan. com.au for technical specifications.

2000L Stiletto Powerhead Sprayer

NEW CATALOGUE

CATALOGUE

900L to 2000L Capacity

P RICING PRICING A VAILABLE AVAILABLE O NS ITE ON SITE SITE J1. SITE J1

Super Series Sprayers

Full range of Nobili Mulchers on site

Visit your Silvan Machinery Dealer for more information on how you can get a 10% discount on any of our Machinery or Spraying Equipment products. *Eligible products include all items in Silvan Farm Equipment & Spraying Price Books. Not available with any other offer. F07348

Silvan Australia adds Nobili TBE Series Hydraulic Offset Mulcher

Special promotion available until 2nd April 2017

For more information download the FREE Farm World ‘APP’ or call Chris Tait on: 0425 748 945

13 1300 300 745 745 826 826

silvan.com.au sil ilvan com au

Keeping Gippsland Growing

0.75% interest currently available on New Holland construction machines.

Gendore sites at Farm World 301 - New Holland Agriculture, New Holland Construction, Alpego, Berti, Agri Spread K2 - Fleming, Gamberini, Keltec 6,7,8 - Hustler, HW Industries WARRAGUL: 180 Queen Street

LEONGATHA:

Ph: 5622 3875 Ph: 5662 4044 F02369

TOORADIN:

82-84 Yarragon Road 79-83 South Gippsland Hwy

Ph: 5998 3216

www.gendore.com.au

SERVING THE AGRICULTURAL INDUSTRY FOR MORE THAN 60 YEARS!


Page 14 Farm World News 2017

Farm World 2017

More Effective Options to manage Downer Cows

The “RiserTank” assists in the recovery process by reducing the cow’s bodyweight. Standing in warm water invigorates the cows to eat and drink. Widespread use of Steinfort AgVet’s “Pelvic Lift” & “RiserTank” over the

past 5 years have significantly increased Downer Cow recovery rates.

Developed by Gippsland based veterinarian, Dr John Steinfort, the “Pelvic Lift” & “RiserTanks” can be used together to enable farmers to more humanely & effectively transport & rehabilitate Downer Cows. The “Pelvic Lift” is designed to lift & transport cows for both short & long distances. The unique design enables 50% of the weight to be taken by the hips, like traditional hip clamps, with the other 50% taken via the pelvic seat being positioned under the pelvis, well above the udder. The addition of a webbing strap evenly lifts the brisket. As the cow is lifted horizontally, the animals back is straight & aligned, unlike using hip clamps where the hind legs are tilted down,

straining the lower back. Once a cow is lifted she can either walk away or be transported & placed in the RiserTank to further assist the recovery process. Aided by the buoyancy of water, the “RiserTank” provides a confined space in water to enable the cow to stand & feed for longer than normal. Up to half of the cow’s body weight is reduced when standing in water. Standing in warm water invigorates the cows to eat & drink. Generally a cow stands in warm water for 4 to 12 hours per session with a 2 hour break or a full rest at night. The cows are continually left in the RiserTank with the majority of water let out at the end of each session to

provide time for the cow to rest. The RiserTank is again refilled with water for the next session - this process is repeated until the cow can confidently stand without the buoyancy of water. Research in using the RiserTank has shown an 80% recovery for calving paralysis cases, with all recovered cows returning to milk within 7 days. According to Xavier Parkinson who milks 900 cows at Koroit in Western Victoria, the RiserTank has doubled their Downer Cow recovery rate & has helped them in developing a standard procedure to better manage downer cows. The use of the RiserTank has significantly saved on labour with Xavier indicating they cannot devote the

time to conventionally lift cows regularly. Sharefarmer Andrew Gaul, who milks 360 cows at Bona Vista in West Gippsland, has highlighted that cows are his biggest asset & with a Downer Cow recovery rate of approximately 90% & cows being valued at $2,000 each, the RiserTank has been a really good investment. Andrew said the key to achieving the best results is to get cows into the RiserTank as soon as possible. Studies have shown that recovery times are reduced with cows generally requiring between 1 & 3 days for a full recovery. According to Dr John

Steinfort the RiserTank is also ideal to differentiate the cows that will not recover readily. You can usually diagnose a cows condition within 10 minutes of placement in water. If a cow is unable to stand & bear some weight with water in the RiserTank, then recovery times will need to be extended or in some severe cases, euthanasia is recommended, as prognosis is very poor. For more information, case studies & videos on the “Pelvic Lift” & “RiserTank” please visit the “Steinfort AgVet” website - www.steinfortagvet.com.au

The “Pelvic Lift” is designed to lift and transport cows, enabling 50% of the weight to be taken by the hips and 50% by the pelvic seat whilst keeping the cows back horizontal.

Who is CLEAVER?

Salumi curing all year around.

The heart of the kitchen.

The CLEAVER Salumi cabinet will be a feature of the String + Salt site at Farm World this year.

Off-the-grid cooking + heating.

Iconic. Incomparably.

Site 317, Third Street, Farm World 2017

F07722

42 Smith Street Warragul, 3820 03 5622 2119 stringandsalt.com.au

CLEAVER learns from Nonna, his mistakes and YouTube he’s not keen on instruction manuals. He has a healthy respect for tradition, but appreciates the benefits of technology. CLEAVER makes things by hand and loves to share them. Sure, he doesn’t mind a bit of praise either. CLEAVER enjoys a little indulgence, sports the occasional sauce stain and never orders ‘dressing on the side.’ He drinks his whiskey neat, and saves the Coke to cook his ham hocks. He believes you can respect the beast in life and still savour it in sausages. CLEAVER understands that everything good requires patience. These salumi cabinets are brought to you in the spirit of CLEAVER, a little bit tough, a little bit fancy, a practical luxury; equally at home in the kitchen or the Man Cave. CLEAVER provides the ideal environment to air cure your own salami, proscuitto, coppacolla, sausages and more, the whole year around. String + Salt will launching their new CLEAVER Salumi Cabinet at this year’s Farm World. String + Salt’s site (Site 317 on Third Street) will also feature the handmade Falcon Range Cookers, the solid-fuel Rayburn Ranges and the iconic UK AGA cookers. It will be a hive of activity for cooking demonstrations, tastings and specials happening right across the four days of Farm World. String + Salt will also be offering a selection of ex-demo and floor stock cookers at very special prices from Falcon, Rayburn and AGA for Farm World.


Farm World News 2017 Page 15

Farm World 2017

Cow Yard Grooving!

Cutting Force is a concrete, drilling, cutting and grinding business.

We do cow yard grooving, grinding and polish concrete production output and guarantees the success of our grooving system. Polishpro is Cutting Forceâ&#x20AC;&#x2122;s sister company that provides all your grinding, polishing and coating requirements. Polishpro has experience in all areas of concrete preparation and finishing, Polishpro will be able to provide a solution to your specific job requirements. They cover the entire range of different types of projects, from new homes, existing homes, workshops, retail and manufacturing facilities to safety rectification. Please call into their stand A48 and discuss your requirements or a no obligation free quote and ask about their special Farm World Specials. For more information please visit the web site www.cuttingforce.com.au or www.polishpro.com.au or call their Sale team on 0488 742 830

Cutting Force has been established in Gippsland since 1977, servicing the entire region. Our trained operators have perofrmed the required grooving sawing to numerous Dairy & Cattle Farms with excellent results.

32 Standing Drive Traralgon F07580

Cutting Force is a locally owned and operated concrete, drilling, cutting and grinding business located here in Gippsland. Cutting force has been operating since 1977 and service the entire Gippsland Region. Cutting Force prides itself on the quality of services it provides to its customers, by working with their individual needs and time frames available. Cutting Force has demonstrated successful outcomes in providing a â&#x20AC;&#x153;proven and testedâ&#x20AC;? method of cow yard grooving. It has taken several years for Cutting Force to develop the ideal grid size and groove depth that will prevent cows from slipping and damaging themselves, therefore avoiding injury and stock loss. Cutting Force fully understands the importance of maintaining your herdâ&#x20AC;&#x2122;s

FARM WORLD 2017

Ph 1800 288 846 Mobile 0488 742 830

- Proven & Tested - Slip Prevention that works - Avoid injury to your stock & maintain your production output

FREE No obligation quotes

LONG TERM EAR TAGS

Snag Free

FREE

Sample Pack! Contact us today

Nylon Back Tag s UV Stability Proven 10 years + New Generation Livestock s Doubleprong for increased retention Tags s 99.7% Retention (producer feedback) NLIS & s Australian Owned, Designed Management Tags & Manufactured

Place centrally for greater visibility

 s3TEVEsSALES ENDUROTAGSCOMAUWWWENDUROTAGSCOMAU F07569


Page 16 Farm World News 2017

Farm World 2017

Kaiwaka Clothing is proud to be back at Farm World in 2017 We are not just any family owned business but one who has been manufacturing high-performance outdoor and wet weather clothing for over 40 years, so we really do know wet weather clothing.

Our journey began on the farm, in fact the farming heritage dates back six generations that spans from Scotland to Nova Scotia, so there is no denying we know what farmers need. While we are based in

New Zealand, we supply the ‘world’; here in Australia we supply you via our Resellers supported by our own local ‘on the ground’ staff. We know that when you work in rugged conditions, you need gear

that can handle the extremes. We design clothing that’s as tough as it is comfortable. It’s as reliable as the days are long, and it performs like your livelihood depends on it. It is worn by hard working men and women everywhere, Kaiwaka keeps you warm and dry,

whatever the elements throw at you. We invite you to come and meet with us and experience the Kaiwaka magic in the Murray Goulburn Trading Tent at Farm World on the Cnr Avenue A and Third Street (A25-26) Lardner Park.

Come and see a full range of jackets at the Kaiwaka site.

Crump Spreaders: servicing Australian Farmers for a Century

02 6025 7822

F07910

SEE US AT SITE CB36

There is no doubting that farming is not for the faint hearted, and the team at Crump Spreaders Australia pride themselves on doing their small part in assisting our Aussie farmers achieve top results with uncompromised reliability. Crump Spreaders have been a mainstay in the Australian agricultural scene since before WWI and are now manufactured by Albury Precision Engineering to ensure the product continues to remain an integral part of farming practices. Based in Albury-Wodonga, the machines are

designed to accurately spread dry free running fertilisers up to 1500 litres/ha. This includes granulated super, urea and potash to name a few. The introduction of Omya's Calciprill means Crump Spreaders can now be used to apply extremely fine lime in a granular form. Crump and Omya are working together to ensure farmers are achieving the best of both worlds in product and application as Calciprill from Bathurst is low in dust, easy to spread and breaks down rapidly in moisture. Accu-Spread and AFSA testing shows results within parameters of 5%. This offers confirmation of the integrity of the products tested ensuring that granulated products are dispensed in their intended form. The Kurrajong trailing fertiliser spreaders range from 1-3 tonnes while the Acacia three-point linkage models range from 1-2 tonnes. Deluxe models have twin outlets which can be adjusted to compensate for distribution variation. Customer feedback is an important aspect in the R&D process adopted in-house. From this, galvanised frames, hydraulic options, heavy duty tyre upgrades and road-tow kits are also now available. 30 000 spreaders have been manufactured since 1945, so earlier models are not forgotten with manuals, spare parts, stickers and information still available for many of the earlier models.

The BJ Bearings Pavilion will be BIGGER and BETTER than ever

Proudly designed & crafted in New Zealand

Kaiwaka Clothing is proud to be back at Farm World in 2017. We invite you to come and meet with us and experience the Kaiwaka magic in the Murray Goulburn Trading Tent on the Cnr of Avenue A and Third Street (A25-26) Lardner Park. SAVE 20% off the standard retail price when you buy from our stand.

Buy any Kaiwaka garment, present this ad and get a FREE BEANIE WORTH $20* kaiwakaclothing.co.nz F07945

*limit 1 per customer while stocks last, offer only available at Farm World>

BJ Bearings are a large, long-standing exhibitor at Farm World and this year they have expanded their relationship to become a Major Sponsor and take on Naming Rights of the BJ Bearings Pavilion. The BJ Bearings Pavilion will be bigger and better than ever before, with over 25 major suppliers under one roof. All the big brands will be on hand, offering Farm World ONLY bargains. Supply Manager at BJ Bearings, Gavin Smith said, “The prices are too hot to print prior to Farm World and can NOT be offered again after.” Did we mention BIG brands? The BJ Bearings Pavilion will host Kincrome, Alemlube, Led Lenser, Leatherman, Timken, Loctite, Yamaha Generators, WIA Welding, Macnaught Lubrication, Peerless Compressors, Gentech and Hot Devil -just to name a few. There will be a range of industry experts on hand throughout the four-day event to discuss the product range, advise customers and conduct training. Timken manufacturers of bearings and mechanical power transmission components will have their Interactive Truck Hub display on show in the BJ Bearings Pavilion and will be conducting daily training sessions. BJ Bearings’ Engineering Services Division will be available to talk about, train and guide in: ● Thermal imaging diagnosis ● Correct V-belt drive alignment ● Vibration analysis ● Bega fitting tools ● Bearing failure diagnosis ● Laser aligning services The Hose Division will also be on hand to discuss everything from fire-fighting hose needs to the correct hose to use to water the garden. BJ Bearings suppliers cannot expect to simply show up and sell product – no, they will be on hand throughout Farm World to advise and conduct training sessions. Suppliers include: ● WIA – Welding experts to talk about welders, welding techniques and procedures ● Gentech – For all your emergency power and fire-fighting pump needs ● Loctite – The biggest name in retaining and threadlocking ● Peerless – The experts in compressed air ● Kincrome – From the biggest work shop to a screwdriver to change a light bulb, these guys are the experts WIN a trailer of goods worth over $4000 To celebrate the 50th year of Farm World at Lardner Park, BJ Bearings will be giving away a trailer full of goods, valued at over $4000. Every purchase of $50 or more on the BJ Bearings stand will get the chance to go in the draw to win this amazing prize which will be drawn at 3.30pm Sunday. BJ Bearings – with 10 stores throughout Victoria and part of the larger Inenco group with 89 stores nationally. Not only can we cover your local needs, they can also cover you nationally through the BJ Bearings/BSC/CBC network.


Farm World News 2017 Page 17

TOTALSPAN SHEDS S E RV I NG TH E G I PPS L AN D R EG ION

Visit our showroom in Warragul for all your shed needs COMPARE BEFORE YOU BUY!  LOCALLY OWNED AND RUN FAMILY BUSINESS  REGISTERED BUILDER & LICENSED ROOF PLUMBER  AUSTRALASIA’S LARGEST MANUFACTURER OF STEEL FRAME SHEDS

 25-YEAR WARRANTY ON ALL TOTALSPAN BUILDINGS  TOP SERVICE - TOTALSPAN CAN DO ALL THE WORK FOR YOU

 ON-SITE, VISIT & QUOTE AVAILABLE FOR COMPLETE PROJECTS

 HASSLE-FREE BUILDING APPROVALS AND PERMITS  FIXED-PRICE CONTRACT, SO NO NASTY SURPRISES

Totalspan is part of the Versatile Buildings group, the largest manufacturer of steel buildings in Australasia. Our extensive range of Totalspan buildings includes garages, carports, skillion/farm sheds, heritage barns and large commercial buildings. So, if you need a big shed for home or work ask for a brochure. One look at our superior design and construction features and you’ll see why you should invest in a Totalspan building.

VISIT US AT SITE F25 AT FARM WORLD

WHO CAN? TOTALSPAN!

177 Queen Street, Warragul www.totalspan.com.au

F07671

Call us NOW on 5622 2577 for a FREE quote Licensed Builders DB-L 32051


Page 18 Farm World News 2017

WIN this trailer full of great gear

Down on the sunny Mornington Peninsula in Victoria, is a company with a secret. A&A Worm Farm Waste Systems has the key to the Worldâ&#x20AC;&#x2122;s Best Worm Driven Sewage and Organic Waste Conversion System. As we become conscious of the damage we have done to our planet, itâ&#x20AC;&#x2122;s clear that we must adopt practises in our daily living which lessen the impact of our lifestyle on the environment. This can be without any inconvenience and at very little cost to which you attain some big bonuses. All this can be achieved through worms, would you believe? Worms through the good people at A&A Worm Farm Waste System. Hereâ&#x20AC;&#x2122;s how it works, the system is simplicity itself. All that happens is that the contents of the toilet, the water from the shower, bath, dishwasher, clothes washer are piped directly to a colony of active compost worms. The A&A system then constantly introduces fresh air into the worm driven processing tank. This design feature keeps the system aerobic (totally different to a septic tank, which is anaerobic), therefore the system has no smell. The worms then turn the solid matter in the sewage with the flush water, shower, washing machine etc, to vermicast. Vermicast is a solution of suspended solid which is broken down into extremely minute particles. It is black and rich in carbon. This is then discharged into the subsurface soil where it will;

- Naturally fertilise the soil - Naturally water and fertilise your garden - Over-time transforms the top layer of soil into an incredibly rich, dark coloured growing medium. The worms, who have a voracious appetite eating at least half their weight daily, can consume and kill harmful bacteria such as e-coli, salmonella and enteric virus in the sewage, making it safe to use. If you have an A&A Worm Farm Waste system, all your organic wastes, weeds from the garden, scraps from the kitchen etc - the organic waste which your Council collects - go straight into the processing chamber never to be seen again and cost you and the Council nothing. As of December 2015, there are more than 2000 families in Australia with a trouble-free worm-driven sewage system from A&A Worm Farm, all doing their bit to repair our environment and make it safe for our children. The A&A Worm Farm Waste System is the Worldâ&#x20AC;&#x2122;s Best Practice, Fit, Flush and Forget sewage system. Operational cost fitted up to a four bedroom family home is around $20 per year, unless you include a small solar panel, in which case, it costs nothing and is all benefit. Installation is about the same as any other system. To find out more, phone A&A Worm Farm Waste Systems on (03) 5979 1877, or visit them at Farm World. Theyâ&#x20AC;&#x2122;ll look after you!

$4000 OF VALUE

Daily demonstrations by our on-site engineering team, including: - Vibration analysis - Bearing fitment - Laser alignment - Thermal imagery F07701

Celebrating 50 years of Farm

Find us

See us at site 225

%TTVSZIH 87% :MG27;%' 8 50( 2

-VYNL[ZTLSS` ZLW[PJZVY JOLTPJHS [YLH[TLU[Z ,_WLYPLUJL[OL ILULMP[ZVMH UH[\YHSZ`Z[LT \ZPUNL_JP[PUN [LJOUVSVN`

Â&#x2039;(WWYV_ WLYHUU\TLULYN`JVZ[Z;`WPJHS)9K^LSSPUN PUKLWLUKLU[S`HZZLZZLKOPSS`ZP[LZUPSLULYN`

Â&#x2039;5VJHYIVUKPV_PKLVYNYLLUOV\ZLNHZLZWYVK\JLK Â&#x2039;3V^THPU[LUHUJLÂ&#x2039;,_JLSSLU[U\[YPLU[MVY[OLNHYKLU Â&#x2039;(]LYHNL  SLZZNHYIHNL[VSHUKMPSS Â&#x2039;*HUILMP[[LKPU[VL_PZ[PUNZLW[PJ[HURZVY[YLH[TLU[WSHU[Z

Polaris loaded with safety technology

A&A WORM FARM WASTE SYSTEMS PTY LTD

Colby Breeden with the Polaris range at Marriottâ&#x20AC;&#x2122;s MPE in Leongatha.

 National Head OfďŹ ce: Unit 5/2135 Frankston-Flinders Road, Hastings Email: enquiries@wormfarm.com.au Web: www.wormfarm.com.au

SEE US AT FARM WORLD â&#x20AC;&#x2122;17 SITES: 444 - 446 & 518 - 520

Simply make a purchase of $50 from BJ Bearings at Farm World for your chance to win this amazing prize*.

OVER

;OL,U]PYVUTLU[HSS` MYPLUKS`^H`[VWYVJLZZ ZL^HNL^HZ[L^H[LY HUKVYNHUPJ^HZ[L

F07552

A system of excellence to beneficially remove sewerage and organic waste from the environment

MOWERS

â&#x2014;? Ranger â&#x2014;? ATV â&#x2014;? Youth Range

2 & 4 WHEEL

EXTENSIVE RANGE AVAILABLE

Polaris has long been the leader in all-terrain utility vehicles and in 2016 more people have chosen Polaris than any other brand. Leongatha dealer, Marriotts has announced the hard-working range now extends to 23 models with certified RollOver Protection Structures (ROPS) to satisfy OHS concerns. Combined with seat-belts with an interlock device that limits speed when the seat belt is unsecured, plus additional occupant restraints, there is a Polaris for every task and with safety front of mind. With this massive range, Polaris dominated the Side x Side market in 2015 and again in 2016 accounting for around half of all Side x Sides sold. Seating configurations start with the unique single-seat ACE which is rated to carry 261kg and towing capacity 680kg. The ACE provides a compact and narrow footprint, for extraordinary access and manoeuvrability and features ROPS and car like controls. It really is the starting point for Polaris Safety Technologies which underpin the entire Polaris Side x Side range. The Ranger series of Side x Side utility vehicles provides a vast selection of models to satisfy virtually every imaginable requirement with seating from two to six seats,

petrol, diesel and electric, 2 wheel-drive and All-Wheel-Drive plus unlocking rear diffs for turf friendly performance. With innovations such as All-WheelDescent-Control (ADC) Polaris has eliminated some of the criticisms from owners operating in hilly terrain levelled at some other Side x Side brands. Also a leader in the familiar ATV segment, Polaris provides an extensive line-up with Heavy Duty suspension construction on many models with grease nipples to extend the working life of vehicles in the harsher commercial applications such as dairy. Accessory choices are abundant and can be found in the 192 page accessories catalogue or on-line. A truly customisable package with multiple roof, door and windscreen variations means the vehicle can be adapted to suit any work environment and escape from the elements. The US company has now become the largest supplier of Side x Side utility vehicles in Australia, indeed worldwide. Not all models have all features so it is a matter of selecting the model that best satisfies your needs. For full details of specs and features, visit Marriotts at Farm World, sites 444-446 and 518-520 or call into the Leongatha showroom, phone (03) 5662 2028.

All models

Motorcycles, 4 wheelers, trailers, spray equipment, tow behind/outfront slashers

DEFENDER

FULL RANGE OF

OUTLANDER G2 CHASSIS

MOTORCYCLES

Proudly Australian made for Australian conditions

RIDE-ON MOWERS AND SLASHERS

â&#x2014;? â&#x2014;? â&#x2014;? â&#x2014;?

Lawn Mowers Brush Cutters Rotary Hoes Generators

CHECK THE RANGE

PUMPS & GENERATORS PETROL / DIESEL PUMPS

MOTORCYCLES & POWER EQUIPMENT SOUTH GIPPSLAND HIGHWAY, LEONGATHA (OPP KFC) PH: 5662 2028

F01897

MASSIVE SAVINGS

Farm World 2017

CO SE N N RV O TR IC A E CT S

PRICES WAY TOO EXCLUSIVELY AT

Farm World News 2017 Page 51


Farm World News 2017 Page 19

Page 50 Farm World News 2017

Farm World 2017

For all your commercial equipment needs

Farm World5 Stand: GIP-3 s (BJ Bearing Pavilion)

HOT TO PRINT FARM WORLD '17

GIVEAWAYS & MORE To see a great range of commercial fridges and freezers visit Ian Boer Refrigeration and Catering Equipment at site GIP35. Ian Boer Refrigeration and Catering equipment now has new offices and a showroom open in Gippsland, Vic. For the past 27 years IBR has been supplying quality commercial equipment Australia wide. Sourcing equipment locally and worldwide for supermarkets, hotels, butchers, bakeries, fast food outlets, pizza shops and restaurants, just to name a few. They has a full range of commercial storage and display refrigeration, gas and electric cooking equipment, counterline equipment, commercial dishwashers, with stainless steel benching also cookroom and general purpose shelving. Featured at Farm World this year are large freezers for bulk meat storage, upright meat hanging refrigerators.

Office Line: 1300 426 263 Office Fax: (03) 5622-0194 email: mail@ianboer.com.au Website: ianboer.com.au Head Office & Showroom: F07917

Factory 6 / 133 North Rd, Warragul, VIC 3820

And for the man cave, upright 1 and 2 door fridges and bar fridges in 1, 2 and 3 door models and deep fryers for cooking up a feed to cure the appetite. They transport Austrtalia wide and can get your items to you in a safe, quick and reliable way, with their own tailgate loader truck riding on air bag suspension. Or via one of their trustred transport contractors. Family owned and operated, they are a hands-on company, big enough to supply all your needs, small enough to care. Lease, rent, try buy also available. Check them out at Farm World stand GIP35 or on their web page ianboer.com.au or call them on 1300 426 263.

CHIPSTAR AUSTRALIA –

supplier of chippers for domestic and commercial use Another year has gone by and the product range continues to impress with their quality, reliability and innovation. NEGRI Bio-Shredders are made in Italy, carry a 2 year warranty and have genuine Honda motors. The standard of workmanship and quality of material reflect in their reliability, finish and design. CHIPSTAR – See the new Chipstar Vortex 6” drum machine with a large infeed neck and unique chip throwing system.

LINDDANA PTO and ENGINE POWERED machines are made in Denmark. The confidence of the manufacturer reflects in a 3-year warranty. The attention to detail in design and manufacture is second to none. These chippers have been supplied all over Australia, are extremely reliable and get the job done. Please visit our stand, E14+E15, and see for yourself.

Farm World Food & Fibre Fiesta!

F02485

Chippers/Mulchers for domestic and commercial use, both PTO and engine powered.

On Saturday 1st and Sunday 2nd April, the Lardner Park Conference Centre will be converted into a Food & Fibre Fiesta showcasing produce, products and information sessions in inspiring ways. The Food & Fibre Fiesta promises a festive ambience of exhibitor sales, demonstrations and workshops running free-of-charge throughout the weekend. The program of demonstrations and workshops will roll over throughout the day, so visitors can stop and listen as they wish. You can learn the wonder of simple, handmade food with a Pasta Making demonstration, a Bread and Cheese Making demonstration from inspirational entrepreneur, author and advisor, Rebel Black. Then watch as acclaimed Peruvian-born chef, Alejandro Saravia from Pastuso restaurant in Melbourne, inspires the crowd, bringing the strong flavours and variety of Peruvian cuisine to life in his two beef cooking demonstrations on Saturday. And of course, these days a good meal does not exist until it’s shared on social media. We have the very talented Michelle Cann from String + Salt on hand to teach us the

tricks behind taking mouth-watering sharable food images on an iPhone. Health and sustainability are both enduring trends shaping how our agricultural produce interacts with our bodies and our environment. Julie Weatherhead from Peppermint Ridge will hold a demonstration showcasing the flavour and diversity of Australian native foods, and Doterra Essential Oils will illustrate how cooking with essential oils can harness the power of nature to revolutionise the way many families are managing their health. The Food & Fibre Fiesta will be decorated with bountiful produce from the Baw Baw Food Hub, East Gippsland Food Cluster, Tarago Cheese, Ripplebrook Winery (and many more) opening our eyes to the abundance of fresh, organic produce available in our own backyard… and if growing your very own fresh produce is your passion, be sure not to miss the comprehensive Home Composting presentation. With all this inspiration, you’re likely to need a good, strong coffee to get you started – luckily there will also be a barista-led demonstration to help you pick up all the tips on pouring the perfect brew.

*Image for illustration purposes only. Trailer included in prize comes with a cage.

See and hear the roar of the Gulf Western Ute on-site

World at Lardner Park

F07702

*Drawn Sunday, April 2 at 3.30pm

in the BJ Bearings Pavillion


Page 20 Farm World News 2017

Farm World 2017

Protect yourself, your family and your employees

The ATV Lifeguard is a segmented Roll Bar that helps give crush protection on an upturned Quad bike. Quad bikes are a leading cause of death on has the ability to deflect around your body or farms. Recently, the Victorian Government limbs on impact. It will not collapse or flatten together with the Victorian Farmer Federation and is designed to support a quad bike off the (VFF) have announced a $600 rebate for all ground and help to provide crush protection eligible farmers to fit OPD (Operator for you. Protection Devices) to quad bikes. The segmented design will mould around The ATV Lifeguard is a segmented Roll Bar you in the event of a rollover. The arc shape that helps give crush protection on an allows you to push and roll the bike off you or upturned Quad bike. It is designed to hold up wriggle out from underneath to help stop you a Quad in excess of 350kg, can be simply becoming trapped. mounted to the rear carrier and does not signProtect yourself and get a ATV Lifeguard fitificantly alter the stability of the Quad bike. ted today and receive the rebate before it is The ATV Lifeguard is designed to be flexible too late. Call Trac Mac Farm Equipment in and yielding, instead of hard and rigid. The Drouin on 5625 1522 to find out more inforsegmented construction is a new concept that mation.

STEELINE GIPPSLAND

Garages, sheds, garaports, barns and portables - buy direct from your local manufacturer and save

Steeline Gippsland is the only local manufacturer of sheds, carports, garages, barns, and garaports in Latrobe Valley. Unlike our competitors not only do we employ local people in Latrobe valley but we also pride ourselves with the fact that we use only Bluescope and Colourbond steel rather than using imported Steel. As we manufacture all our products from start to finish in our Traralgon Factory we are able to offer the customer the option of full customisation of your desired commercial or residential shed, garage, garaport, barn or our new portable dwellings. Our prices are also extremely competitive. We also manufacture roofSteeline Gippsland are very excited to present their PODS which stands for portable outdoor stor- ing, fascia, gutters, custom age. PODS are excellent for storage sheds, caravan park accommodation, granny flats, school made flashings, batten’s and camps or pool houses and can be supplied in a flat pack kit ready for installation in your back colourbond fencing. yard. The possibilities of the POD are only limited by your imagination. The base kit comprises of Come and See Adrian, main frame, outdoor sheeting, standard sliding door and interior wooden floor. Sam and the team at our display site 226 at FARMWORLD for great specials and giveaways. Alternatively visit our showroom and factory located at 53 – 60 Eastern Road, Traralgon 7.30 – 4.30 Weekdays. Phone 5176 5866.

Adrian Burgiel (left), manager and Sam McLaverty, sales of Steeline Gippsland P/L can help with all your portable outdoor storage needs.

Farm World Equestrian Expo Competition Events

Come and see us at Site CB1-3 and EE8 Pakenham Produce & Saddlery

F02486

Ph: 03 5941 1844 2 Bormar Drive (Crn Bald Hill Rd), Pakenham, VIC 3810

The Farm World Equestrian Expo will return to Lardner Park from March 30 to April 2, 2017. Some of Australia’s finest competitors will travel to Gippsland to compete in dressage, show jumping and games events across a four-day program, which kicks off on Thursday with an HRCAV Dressage event for all levels of riders. Friday and Saturday will see Equestrian Australia show jumping events take place in the Isuzu UTE Main Arena on a course designed by Sydney Olympian and Gippsland local, Gavin Chester. The course promises to be a challenge, with jumps ranging from 90 to 140cm, with $10,000 in prize money up for grabs in events including Friday's Yarragon Rural Supplies Mini Prix and Saturday's iconic Pakenham Produce Farm World Cup. Other competition class sponsors include Drouin Vet Clinic, EFO and Denholm and Christian Fencing. Several riders of note will be competing in Saturday’s show jumping events including Jasmine Dennison (2015 National Junior Champion, from Mt Eliza), Russell Johnstone (1996 Olympian, and competitor at the Nation Cup Shows in Finland, Norway and Sweden, from Whittlesea), Ally and Andrew Lamb (both successful World Cup competitors, from Dennison), Paul Brent (successful World Cup competitor, has been listed on the Elite Squad, from

Coldstream), and finally Brook Dobbin who will be defending his title as the 2016 Pakenham Produce Farm World Cup winner and is also a successful World Cup competitor (from Yarra Glen). The Farm World Equestrian Expo debuted at Farm World in 2016, during which a Games Masterclass demonstrated various tests of skill for the crowd. This year the program has been extended to include a full day of Games Championships on Sunday. There will be several top-performing Games riders including Alice Greig. Alice rode on the winning Australian team at Nation Championships in 2015, and continued her success in 2016 placing 8th in the Australian Individual Championships, 2nd in the Australian Teams Championships, 5th in the Australian Pairs Championships, and competing at the World Pairs Championships in Denmark. Quite an impressive riding resume considering she is not yet 21 years old! Stunning trophy rugs for the competitions are provided by Arch and Alex with further support sponsorship for the event from Gippsland Premium Quarries and Yaraandoo Park Concepts. To keep up with the latest in news and announcements for the Farm World Equestrian Expo follow their Facebook page.

PROTECT YOURSELF, YOUR FAMILY AND YOUR EMPLOYEES

TracMac Farm Equipment, Drouin - Call 5625 1522 for more info today

0 60 $ R OU NOW Y AIM TE CL REBA

F07599

QUAD BIKES ARE A LEADING CAUSE OF DEATHS ON FARMS

The Victorian Government with the Victorian Farmer Federation (VFF) are offering a $600 rebate for all eligible farmers to fit an Operator Protection Device to quad bikes. ATV Lifeguard is the world’s first flexible, crush protection device designed to be easily mounted onto the steel frame of your quad bike. The unique segmented design has been extensively tested by Workcover and is proven to save lives. Come find us on site CB-126 at Farm World 2017.


Farm World News 2017 Page 21

Farm World 2017

Healthy soils need plenty of air visual inspection. With a spade, dig out a block of soil to the dimensions of 20cm x 20cm x 25cm deep. If there is a clear line between a profusion of roots at the top of the soil block in a dark crumbly soil, and then a lower layer of hard, dense packed looking soil, the soil structure is poor. A good soil structure and a healthy worm population go hand in hand. Earthworms are a good indicator of the soils biological status. In a well structured, healthy and fertile soil there should be more than 20 worms in every spade sample. If there is less than 10, there is a good chance there is a problem with the soil structure and the quickest and easiest solution is likely to be mechanical aeration or tined rippers to improve this soil structure. During the late winter and early spring months is the best time for aeration. When there is enough moisture in the soil to allow aerators to penetrate and break up the hard pan of sub soil below the root system, lift and loosen the top soil and allow spring rains to absorb and retain into the soil. James Engineering in New Zealand has been developing, testing and working with farmers for over 30 years in the development of aerators to improve soil structure. Their new series of aerators feature fine shank tines with individual coulters fitted for minimal top surface disturbance. Tyne spacing and shape, designed to break up and loosen the hard pan and compacted soils underneath. Two types of models are available with both shear bolt protection or new style auto reset tines are available for grounds with rocks or stumpy conditions. Mike Keys from James Engineering says it is more ever important to get the most out of your pastures. With the ever increasing costs of fertilisers and the costs of renovating your pasture, aeration can be a more cost effective alterative. Aeration can improve soil structure, assist in unlocking soil fertility and improve root development of pastures for greater ability to produce grass. TracMac Farm Equipment will be displaying the range of James aerator on their stand CB126 at Farm World 2017 or you can contact us on 5625 1522 or 0418 515510.

Donâ&#x20AC;&#x2122;t keep putting good fertilizer on compacted soils that canâ&#x20AC;&#x2122;t absorb it. Aeration can improve moisture retention and allow the roots to penetrate deeper to absorb the moisture. Aeration will also promote healthy worm and micro organism development that improves soil fertility. VISIT US AT SITE:

NOW AT 86 ROBERTS CRT, DROUIN 5625 1522

CB126

0418 515 510

Custom Sheds Made to Order

F07576

SOIL fertility is generally held to be the most significant factor in maximising pasture and crop growth. For years we have done tests that are designed to establish the PH levels and if there are any deficiencies in essential mineral levels in the soil, and if so, apply the appropriate fertilisers to correct these. But with the recent increase in fertiliser prices and lack of availability, alternative methods may be needed to keep improving soil fertility. One way can be the use of aerators to loosen compacted soils, allowing oxygen to enter the soil and can unlock these nutrients that are retained in the soils. The limitation of the oxygen supply to soils has a direct effect on plants and a severe effect on the myriad of micro and macro soil organisms that are essential in establishing and maintaining a healthy and productive soils. A sure sign of compaction is the root system of the plants. In compacted soils the plant roots tend to grow sideways, so growth will be limited by intensive competition for and less availability of soil moisture and nutrients. Plants will also tend to have their crowns higher out of the ground, so they are more susceptible to damage from grazing and treading. Autumn â&#x20AC;&#x2DC;pullingâ&#x20AC;&#x2122; of rye grass will also be more of a problem. Greater depth of root structure will give a greater ability to produce grass growth during dry times and will unlock nutrients retained in the soil. Also aeration can be good to improve pastures that are starting to drop their growth rates but still have a good grass base to work with. Aeration can release lock-up nutrients and allow the root system to redevelop without the expensive and time out of action of a full pasture renovation. Another sign of compacted soils is the inner ability of the soil to absorb moisture from the recent rains. If the ground is showing signs of water logging with water remaining to the top of the surface, aeration will greatly benefit the soils ability to absorb moisture and then allow the plants root system to utilise this moisture during the summer months. Soil structure can easily be checked by

Great FARMWORLD SPECIALS Come See Us at â&#x20AC;&#x2DC;Stand 226â&#x20AC;&#x2122;

Phone: 5176 5866 Carports * Barns * Awnings * Sheds * Garaports Pods * Open Bays * Fencing * Guttering * Patios

WITH

EMAILGIPPSLAND STEELINECOMAUsWEBSITEWWWSTEELINECOMAU

*Conditions apply

F07629

Farmworld Expo Stand 226 (Pavillion Entrance)

Every shed order received at FARMWORLD, YOU will go into the draw to WIN one of two MOTORISED ESKYS!


Page 22 Farm World News 2017

FROM

0%

FROM

0%

FINANCE*

FINANCE*

DISCO MOWER

VOLTO TEDDER

Top chop quality MAX CUT mower bar

MAX SPREAD VOLTO spreading system

SAFETY LINK drive train protection

PERMALINK system for continuous power transfer

Outstanding ground-contour following

CLAAS power drawbar for comfort and stability

V-Belt drive with double gearbox for smooth running Easy maintenance, with fast access to all points

Large tyres ensure minimal ground pressure Optimal adjustment to different crop conditions

FROM

0%

FROM

0%

FINANCE*

FINANCE*

LINER RAKEVARIANT BALER PROFIX tine arm - tough & wear-resistant

Variable bale size with forced bale start

Continuously lubricated sealed swathing drive

Dual tension arm system with density control

Optimal ground-contour following with new fully ï¬&#x201A;oating

Heavy duty larger diameter 4 tine rotor

suspension

Continuous chain lubrication

High working speeds and output performance

Fast wrapping and unloading

*Standard CLAAS Financial Services terms, conditions and fees apply. 0% pa available on CAT 1 equipment only. 1/3 deposit and 2 x half yearly repayments in arrears. Offer valid until 31/03/2017 or while stocks last.

Gearing you up for success.

claasharvestcentre.com

F07708

See us at Field Days. Sites CB104 - 110 & CB115 - 121.

LEONGATHA 2/4 McPherson Street Brett Scorah 0419 465 086 Scott Sellings 0417 591 600 WARRAGUL 2-3 June Court Stuart McLaren 0428 234 475 Luke Sibson 0447 234 477


Farm World News 2017 Page 23

FROM

FROM

2.99%

2.99

%

FINANCE*

FINANCE*

AXOS 320 CX & LOADER

ARION 430 CIS & LOADER

87 HP – $85,690

130 HP – $109,890

INCL

GST

4 cylinder 4.4 L turbo charged engine REVERSHIFT clutchless powershuttle Flexible TWINSHIFT 20F/20R transmission 60 L/min hydraulic flow Factory fitted CLAAS FL80 CP Loader

INCL

GST

4 cylinder 4.5 L turbo charged engine Flexible QUADRISHIFT 16F/16R transmission ELECTROPILOT - electronic loader joystick 98 L/min hydraulic flow Factory fitted CLAAS FL100 Loader

FROM

2.99

3.49%

%

FINANCE*

FINANCE**

ARION 620 C & LOADER

AXION 800

140 HP – $118,690

205 HP – $164,890

INCL

GST

6 cylinder 6.8 L turbo charged engine Flexible QUADRISHIFT 16F/16R transmission Full 4 corner cab suspension 98 L/min hydraulic flow Factory fitted CLAAS FL120 Loader

GST

Super-efficient, high performance 6.7 L FPT engine 24F/24R HEXASHIFT powershift transmission Compact design and long wheelbase for manoeuvrability and stability REVERSHIFT clutchless reverser HYDROSTABLE adjustable four-point cabin suspension

See us at Field Days. Sites CB104 - 110 & CB115 - 121. *Standard CLAAS Financial Services terms, conditions and fees apply. 2.99% pa available with 20% deposit and 36 monthly repayments in arrears. **Standard CLAAS Financial Services terms, conditions and fees apply. 3.49% pa available with 20% deposit and 3 x annual repayments after 1 months. Offers valid until 31/03/2017 or while stocks last.

Gearing you up for success.

INCL

LEONGATHA 2/4 McPherson Street Brett Scorah 0419 465 086 Scott Sellings 0417 591 600 WARRAGUL 2-3 June Court Stuart McLaren 0428 234 475 Luke Sibson 0447 234 477

claasharvestcentre.com

F07709

FROM


Page 24 Farm World News 2017

% 0% 1.99 FINANCE*

FROM

FROM

FINANCE*

FINANCE*

FROM

1.99%

KE & KG ROTARY CULTIVATOR

CATROS & CATROS + DISC HARROW

Optional rollers to suit ground conditions

3 -12 m working widths

Quick change blades

510 mm diameter serrated discs

Models from 2.5 m - 6 m working widths

Working depths from 5 to 15 cm

220 hp gearbox (300 hp option)

Contour Frame for the perfect following of ground

Green Drill ready for catch crops

contours

Easy adjustable levelling boards

Running gear folds completely over the machine

FROM

1.99

1.99%

%

FINANCE*

ZA-M 1501 FERTILISER SPREADER

FINANCE*

UF MOUNTED SPRAYER

12-36m spreading widths

Tank capacities of 900 to 1,800 litres

Optional electronic packages available

Boom working widths from 12 to 28 metres

Highly accurate Soft Ballistic System

Slim-line spray agent tank

1500L - 3000L hopper capacity

3-fold shock absorbed suspension

Stainless steel componentry

2â&#x20AC;? suction port with suction hose

See us at Field Days. Sites CB104 - 110 & CB115 - 121. *Standard CLAAS Financial Services terms, conditions and fees apply. 1.99% pa available with 33% deposit and 12 monthly repayments in arrears. Offer valid until 31/03/2017 or while stocks last.

Gearing you up for success.

LEONGATHA 2/4 McPherson Street Brett Scorah 0419 465 086 Scott Sellings 0417 591 600 WARRAGUL 2-3 June Court Stuart McLaren 0428 234 475 Luke Sibson 0447 234 477

claasharvestcentre.com

F07710

FROM


Farm World News 2017 Page 25

VISIT US AT FARM WORLD Sites: CB104-110 and CB115-121

CLAAS HARVEST CENTRE HAS YOUR DRILL NEEDS COVERED...

big small

TO weâ&#x20AC;&#x2122;ve got them all! Fo FFor o ssm small mall a l ffa farms arm rms mss Ideal on a wide range of soil conditions and types 2.7m working width with 150mm row spacing

DUNCAN Renovator classic

For medium/large farms and contractors Ideal on light/sandy or stony/rocky soils 2.875 working width with 125mm row spacing

DUNCAN Renovator mk4

Air seeder

Sout So uth h Gi Gipp ipp psl slan and d 2-4 4 McP cP h he ersson n Sttrree ree eet, et,t Leo ong ngat gatth ha a

v

2.85m working width with 150mm row spacing

04 419 9 591 91 620 20 0417 0417 04 7 59 91 1 600 0 0419 04 19 465 19 65 08 86 6

For medium to large farms Ideal on heavy/clay, light/sandy or rocky soils 2.875m working width with 125mm row spacing Gravity seeder

For medium/large farms and contractors Ideal on heavy/clay or light/sandy soils 3m or 3.5m working width with 127mm or 150mm row spacing

DUNCAN Renovator as5300

Gravity seeder

CLAAS Harvest Centre Anth An t on th o y Bl B ac cks k ha aw Sc Scot cot ott Sell ott Sellllin Se ings gs Bret Br e t Sc cor orah h

Ideal on heavy/clay or light/sandy soils

DUNCAN Renovator TFD

Gravity seeder

Gravity seeder

DUNCAN enviro dd30

For small to medium farms

For large farms and contractors Ideal on heavy/clay or light/sandy soils 5.1m or 5.3m working width with 125mm or 150mm row spacing Air seeder

CLAAS Harvest Centre

Giipp G psl slan nd 2-3 3 Jun une e Co Cour our urt,t,t, War a ra ragu ul Lu uke k Sib bso son on Stua Stua St uart rrtt McLLar a en n

04 447 4 23 34 4 47 77 7 0 28 04 28 23 34 4 475 5 F07711

DUNCAN eco seeder


Page 26 Farm World News 2017

Farm World News 2017 Page 43

Farm World 2017

Ranch style designs at their best ASK THE R BOYS ABOUT THEI LD OR FARM W SPECIALS

Since 1949, Simonds have been building affordable, quality homes for families across the nation. Their knowledge, expertise and superior workmanship have earned them the highest accolades in the business, but over and above that, it is their emphasis on customer care that truly makes them one of Australia’s greatest builders. Simonds have an exclusive Ranch style range with 6 plans and 10 facades to choose from. We are confident you’ll be able to find a plan that suits your land and needs perfectly within our range. From our simplistic yet spacious 21 square home the Heathcote, which features 3 bedrooms and 2 bathrooms all the way up to our 36 square Omeo. The Omeo 36 boasts 4 huge bedrooms with walk in robes, 4 living areas and a generous alfresco. This stunning home has a wide traditional homestead layout with a broad entrance which flows into an enormous open plan kitchen dining and family

Premium Quality Garages and Sheds at city prices!

RM VISIT OUR FA AY ● Garages ● Barns ● Carports ● Workshops WORLDDISPL 29 8&2 ● Industrial buildings ● Lofty garages ● Farm sheds SITE 22

Buy direct from the manufacturer Zincalume or 20 colours to choose from. See us at Farm World for quality structures at affordable prices.

Simond’s Omeo 2700 with the Kyoto facade. area surrounded by large windows to take in the ambiance of country living. Local expert, Warragul’s consultant Jamie power is a prime example of Simonds commitment to service. “Our award-winning homes are only a part of the reason why Simonds is so highly regarded. It is our genuine approach to helping our homebuyers through the building process that sets us apart from the rest.” Says Jamie. Jamie assists with every detail of the build, right until the day the customers move in.

You can select from our range of standard sizes or we can custom build to suit your exacting requirements

Contact Dave, Steven or Jason at our display centre at 188 Argyle St, Traralgon Phone 5174 5311 www.eurekagarages.com.au

F07553

● Laverton 9314 1245 ● Ballarat 5336 2227 ● Bendigo 5448 3099, ● Traralgon 5174 5311 ● Cambellfield 9357 9590 ● Shepparton 5823 5233. The Omeo features an enormous open plan kitchen and family area

“Our role is to make sure the home building journey is as smooth and as easy as possible. For some people, this will be their first time building a home and it can be daunting process, so we do everything we can to make them feel at ease.” Part of Simonds exceptional service includes offering home buyers a range of home options, “We understand that everyone has different requirements, so we always provide choices to suit their budget,” adds Jamie. Two such choices, the award-winning Rio and the Nicholson are now on display at Waterford Rise Estate in Warragul, Jamie is keen to show future homeowners through these beautiful homes, so get in touch to find your dream home today! Contact Jamie Power on 0413 697 799 or visit our display centre at Waterford Rise Estate, 1-3 Hillgrove Close, Warragul. Open Monday to Friday 12pm to 5pm and weekends 11am to 5pm.

The Rio was recently awarded by the Master Builders Association of Victoria f or being the Best Volume Builder Display Home $350,0 0 0 - $500,000

BUILD YOUR DREAM HOME WITH THE GREAT AUSTRALIAN BUILDER. Building your dream home doesn’t have to cost you sleepless nights. Our dedicated team in Warragul make the homebuilding process effortless with their extensive local knowledge and excellent customer service. Discover amazing value fixed price packages and a range of house and land options to suit your lifestyle and budget. Get in touch today. Jamie Power

F02454

Executive Sales Consultant

CONTACT JAMIE POWER 0413 697 7999 simonds.com.au


Page 42 Farm World News 2017

Farm World News 2017 Page 27

Farm World 2017

Big year for a big bale feeder Gary

BLACKWOOD

mp

Member for Narracan

www.garyblackwood.com.au 3/24 Mason Street WARRAGUL 3820 ph. 5623 1960 Funded from Parliament’s Electorate 2I¿FH &RPPXQLFDWLRQV%XGJHW

Big year for a Big Bale feeder. Other features like heavy duty chassis, walking beam axles with floatation tyres, large storage bins and 2 remote operation are all designed to make feeding bales quick and easier. With now several units out in operation, they are proving to be more than living up to our expectations. Some owners have now fed out thousands of bales and have found them easy to use and able to handle all types of bales, some weighting over 1200kg. Farmers like the ability to go into a large herd of cows and feed out up to 3 bales without getting out of the tractor seat. This is a great safety feature as anyone who has experienced trying to get the plastic and nett off the second bale in a mob of hungry cows. For more information and details about the range of McIntosh Bale Feeders including the new Multi Bale Feeder please visit Trac Mac Farm Equipment on site CB126 or phone on 03 5625 1522.

THE BIG BALE SPECIALISTS NEW MULTI 4 BALE FEEDER DO YOU HAVE A LARGE HERD AND DO MULTIPLE TRIPS FEEDING YOUR STOCK? THEN THE NEW MCINTOSH MULTI 4 BALE FEEDER IS FOR YOU! This award winning bale feeder has been carefully designed to handle all types of round bale silage and hay, without fuss. With it’s four bale capacity, clever design and rugged construc on, that makes the Mul 4 bale feeder simple and easy to operate.

BALE FEEDERS - SINGLE, DOUBLE and TROUGH MODELS

Eureka Premium Sheds

Visit the Eureka Garage display and you’ll meet the ‘Shedmen’ Dave, Jason and Steven. All of their products carry an unconditional guarantee against any faulty workmaship or materials and are manufactured at their West Sunshine Plant incorporating the latest technology and equipment. Because they are the manufacturers of most components in their structures they can offer extremely competitive prices. Eureka Garages specialise in building sheds to suit their clients’ specific needs. For example, if you need a barn with a mezzanine floor and bay sizes to suit stables, Eureka Garages will design and custom build your barn to suit. All of their structures are built using high tensile steel for a stronger, more durable building. They’re built using the Portal Frame principle giving you far more clearance and head room. They have been servicing the industry for over 20 years and have become well aware of what the industry requires and have developed their buildings to suit. The buildings are recommended for their design, strength and ease of construction and are respected throughout the industry as a top quality product made to last. This is supported by the fact that they have a number of resellers throughout Victoria that base their business purely on their quality products. Eureka Garages and farm sheds include custom orders and complete precision made kits for easy and economical do-it-yourself erection. Engineer’s drawings, building certificate, plus a complete construction manual are included. If you wish, all building or designs can be fully erected for you, quickly and efficiently to the highest professional standards. They guarantee prompt delivery throughout the whole of the Melbourne and metropolitan area and they can organise freight on your behalf for country and interstate deliveries. They invite you to take advantage of their expertise in the manufacture and supply of steel garages etc. which include first class customer service second to none. Pick up a brochure on the Lofty Garage at Farm World and talk to Dave, Steven or Jason about their Lofty display at the Traralgon display yard. This unique two-storey garage offers the user many alternatives to the average garage. Built using steel stud and noggin house frames, you can insulate and line the internal walls just as you would a normal house, perfect for extending the family home, moving out of town to small acres, or even for a holiday home. Eureka Garages roll-form most garage materials themselves, so by purchasing a Eureka product the middle man is eliminated and the savings are passed on to you, the customer. Visit the display at Farm World, site No. 228 and 229 or call Eureka Garages, 188 Argyle Street, Traralgon on 5174 5311.

McIntosh Bale Feeders are designed with strength, performance and uncompromising quality to handle your bale feeding requirements. All machines have been carefully designed to reduce breakdowns and give trouble free opera on for years to come.

TITAN SERIES SILAGE WAGONS - FROM 8 TO 28m3 With their carefully thought out design, all steel construc on and large range to choose from McIntosh Silage Wagons have the strength, performance and durability that you can rely on. Unique features: · 13mm Titan Series floor and elevator chains - Almost twice the strength of standard 10mm chain. · 5mm steel floors, 3mm pressed steel sides, fully welded - no bolts or rivets to come loose. · Large high capacity 1200mm wide cross conveyers with op onal chain, slat and side mounted elevators available. · Larger floor and elevator sha s with seated gearbox floor drive system for greater reliability · Heavy duty chassis, axles and wheel combina on We have plenty of op ons to suit your individual needs

STRENGTH / DURABILITY / PERFORMANCE www.mcintosh.net.nz FOR YOUR NEAREST DEALER PLEASE CONTACT: 86 ROBERTS CRT, DROUIN 5625 1522 0418 515 510

VISIT US AT SITE:

CB126 F07575

F07604

2016 has certainly been a big year for McIntosh with their new Multi Bale Feeder. At the machines release at Farm World 2016 the Multi Bale Feeder won the TMA (Tractor & Machinery Association) Best NonPowered Machine of the year. Then at the 2016 Elmore field days, they were proud to receive the Weekly Times Best Imported Machine of the Year award for its innovative design, unique features and the ability to improve farming efficiency. This has been a great result for McIntosh Brothers from New Zealand together with their Australian partner Trac Mac Farm Equipment. Listening to customer’s needs, they have been working closely together over the past 18 months to develop this brand new design. The new Multi Bale Feeder is designed to load, carry and feed out up to four round bales of silage or hay in one load. This will greatly improve the efficiently and feed out times for farmers that feed larger herds. The unique twin ram bale loading system allows the operator to lift and hold the bales above the platform to allow easy removal of the nett and wrap. This is especially suitable for roto-cut silage bales that can fall apart once the nett has been removed. The bale transfer system pushes each bale up into the feeding cradle. The specially designed feeder slats allows the easy transfer of the bales, but ensuring plenty of aggression for consistent feeding. The dual sided cradle allows accurate control of feeding out the fodder, no matter which way the bale is placed into the cradle. The new style vertical drop side feeder chains assist in the prevention of the wheels running over the material.


Page 28 Farm World News 2017

Farm World 2017

F07972

Claas Harvest Centre is the Gippsland home of Duncan Ag seed drills Claas Harvest Centre Gippsland (Warragul) and South Gippsland (Leongatha) are your local Duncan Ag seed drill dealers. With over 14 seed drills in its range, plus the ability to customise, Duncan Ag has a product to suit, no matter what your requirements. The Duncan seed drill is an economic long-term commitment.By sowing now you can plan to have more grass over winter and with the correct seed you will see the long term benefit of having more silage and hay in future harvests. Direct drilling avoids the delay in paddock rotation and with the optional covering harrows attached it allows the seeding process to be finished off successfully. There are many satisfied Duncan seed drill owners. Here’s what some of them had to say. A fifth-generation farmer made his decision to buy a Renovator Classic only after quite a bit of market research. “I liked the overall machine despite it being a little dearer, and appreciate its potential resale value. I knew it to be a versatile machine although I did think I’d reached its limits with the faba beans. However, I now know that Duncan Ag produces a bean wheel that easily adapts the drill for such large seeds.” He makes the point that calibration for each job is essential. “Seed size may differ from year-to-year and it would be unreliable to simply reset the seeder to last year’s calibration figure. The Duncan calibration system is far and away the

COME AND SEE US AT Farm World Site #CB37-39

For further information on Duncan Ag seed drills, contact the team at Claas Harvest Centre - Farm World Sites CB104 - 110 and CB115 - 121. simplest and most accurate system on the market today.” “It is the Duncan Renovator Classic that has enabled us to build up good supplies of winter feed and stable grazing for our stock. I reckon the Renovator Classic will stand up against any drill for pasture and a wide range of seeds” “I’ve had no problems with it, and before purchasing it, I spoke with several farmers and my brother. He had purchased a Duncan seed drill and was very satisfied and I’ve got to say the robust construction, reliability, and ease of setting up has satisfied me too.” “We have learned the importance of pasture renovation and the need for this to be completed at the appropriate time. This was never more apparent than after the Black Saturday bushfires which destroyed much of our grasslands. Our community witnessed the incredible regeneration achieved through the collaborative use of a Duncan Eco Seeder kindly loaned to us by Duncan Ag, and that imple-

ment has become the seed drill of choice for a good number of farmers in our region. We see direct seeding as the most important activity on farms today.” “Growing good quality grass is of vital importance. Direct seeding offers the opportunity to get seed in the ground without having to withstand the time and expense of conventional cultivation, but with the grass harvested it will be imperative a replacement pasture or crop be quickly established to maintain bottom-line profit. This is where a quick spray off and direct seeding meets those time constraints and does so in a cost-efficient manner. The importance of getting seed into the ground at the right time is often the difference between success and failure in terms of bottomline profit.” To find out more about Duncan Ag seed drills please contact the Claas Harvest Centre team at Farm World sites CB104-110 & CB115-121.

Dual floor chain gearboxes with 4, 14x50 25ton chains with auto chain tensioning, hydraulic or spring suspensions.

TSW Spreaders range from, 8t-34t 8.6-33m3. Spread by the ton or the cubic metre with inbuilt GPS, Task Controller and maps in ISOXML.

Silage loader wagons from 29 to 48m3 wide, 2200mm pickup with Hydropneumatic suspension, 34mm chop length with 53 knives, 1950mm wide rotor fills the cargo area to the edge, hydraulic or spring suspension, factory fitted scales, wide range of tyres, ISOBUS compatible

1000mm PTO driven spreading discs with independent cam and overun clutches spreading up to 25 metres easily.

F02301

www.bergmann-goldenstedt.de T: 0456 002 326 E: megahire@outlook.com


Farm World News 2017 Page 29

Farm World 2017

NEW SEEDERS for PASTURE and FODDER CROPS

Pasture Management New Release - 4 in 1 Seeder!! Fix and Exaktor Seed-Boxes

4 in 1 Seeder and FIX Seed Boxes MORE PRODUCTION -- UNIFORM COVERAGE, NO GAPS, LESS WEEDS

3.0 metre 4 in 1 Pasture Renovator and total coverage seeder without cultivating

Site C26 AIR 8 Kit Hydraulic Fan Save $1000’s at $13,500 + GST Fix Seed Box with optional drive wheel kit

Special Deals on Seed-Boxes

4 in 1 Pasture Seeder, 3m Level, harrow, seed and roll. NEW RELEASE! Great features. handle seeds from clovers to peas, pasture grasses to cereals and are available as separate items to mount on top of power harrows, chisel plows, aerators and cultivators. On display at Farm World, Site C26, will be the FIX Seed boxes. The 4 in 1 PURPOSE BUILT PASTURE SEEDER. Along with EXAKTOR seed-boxes and the HATZENBICHLER AIR 8 pneumatic Seeder covering up to 6 metres. Also for your inspection on SITE C26 will be the

WHOPPA CHOPPA HAY AND SILAGE FEEDER, SOIL AERATORS, FIX REHABILITATOR PLOUGH, Vegetable WEED-FIX and TILL-FIX. Visit www.grahamwood

machinery.com.au on the wwweb and YouTube. Call Graham Wood on 0418 591 678 or 03 5678 8880 and Mike Fix on 0418 508 573.

Seed Box Kits for mounting on power harrows, aerators & speed multi-disc. PO Box 54 Grantville, 3984 Phone: (03) 5678 8880 Graham Wood 0418 591 678 or Mike Fix 0418 508 573 www.grahamwoodmachinery.com.au www.fixengineering.com.au

F02419

LEVEL, HARROW, SOW and ROLL in one FAST PASS to Pasture Renovate or Total Re-sow The natural way for pasture seed to germinate is near the surface, in firm contact with the soil. Bury the seed, it dies. Sowing in lines or rows doesn’t make any sense either, as the empty spaces between the rows will allow weeds to grow with obvious loss of production. The 4 in 1 Seeder for fast pasture establishment and earlier production. This machine is designed for sowing pastures into either worked ground or more importantly into existing pastures, either to rejuvenate or totally re-sow without the need to cultivate. The versatile Fix 4 in 1 Seeder effectively sows from rough rocky hill country to river flats and is excellent for both pasture management and renovation as it is for sowing summer fodder crops such as lucerne, brassicas, millet etc. into cultivated soil. Available in a full 2m and 3m working width, and for the really large operators 2x2m coupled for 4m coverage. The FIX seed-boxes are ground-driven through cassettes with several ratios and the seed drops on to a metal deflector plate which fans out the seed to give an even distribution over the entire paddock. The new FIX seed-boxes

s l a e D n o i t a r b e Cel

1 75 Years

D L R O W M R A F T A

SITE CB102-103

Contact Murray and Jason...it’s a CASE IH celebration year...with deals to match

JX 110 FARMALL

110 HP SUPER EFFICIENT WITH FRONT END LOADER WITH STD 2m BUCKET Air 8 air seeder KIT, 400L hopper, 8 precision outlets, 6m with hydraulic blower, suit cereals at BARGAIN PRICE.

● ●

Family Friendly Attractions at Farm World Equestrian Expo

70,000 ($77,000 INC GST)

UNBEATABLE FINANCE: 0.99%

4 Years Monthly Repayments. Deposit required. (Cash or Trade)

LIFESTYLE FARMER SPECIAL

FARMALL 25B

FRONT END LOADER PACKAGE WITH 4 IN 1 BUCKET

3 Cyl Diesel 27 HP Front Wheel Assist ● 2 Year 2000hrs Warranty ● ●

19,990

SELL ONLY $ F01889

The Farm World Equestrian Expo runs from Thursday 30th March until Sunday 2nd April, with a full program of competitive events, masterclasses and demonstrations for serious horse enthusiasts. Yet there is also plenty to see for those of us with a more casual interest. The Mitavite Cool Crusada Arena will host demonstrations from the increasingly popular Western Riding discipline with their wide western-style saddles, colourful riding attire and exciting rope work sure to entertain the crowd. Meanwhile there will be a series of displays of impressive strength in the Heritage Draught Horse Club Demonstration Area. Pony rides will be on offer for the children (Saturday and Sunday), and the Foal App Breed Village will showcase various breeds including local studs and unusual breeds which will certainly be worth a look. The trade exhibit area will offer an extensive array of the latest products, rider livery, feed supplies and equine-related resources so you will not go home empty handed. To keep up with the latest in news and announcements for the Farm World Equestrian Expo follow their Facebook page.

$

Wet Clutch, 40 k Transmission 3 Year, 3000hrs Red Cover Protecton PLUS

($21,989 INC GST)

Trafalgar: 8-14 Saleyard Rd, 5633 1588 Maffra: 2 Empire PL, 5141 1700 Leongatha: 120 Horn St, 0412 610 903


Page 30 Farm World News 2017

Farm World 2017

Women in Agriculture Luncheon to feature Rebel Black and Emma Germano Current Lardner Park Chairman and owner/operator of Nickelby at Darnum, Angela Betheras was on the Lardner Park

Committee when she won the RIRDC Rural Women's Award in 2011. So, she put forward a presentation to the board… “Why not make the

Thursday of Farm World ‘Ladies Day?’ And not in a ‘selling pots and pans’ sort of way, but genuinely recognise that women play a very signifi-

cant role in agriculture, and celebrate that.” And thus, the Women in Agriculture Luncheon was launched in 2012. The Women in

Loose Lick Mineral & Vitamin Supplement A range of weather-resistant supplements specifically formulated for cattle, sheep, goat, horse and alpacas.

WEATHER RESISTANT COST EFFECTIVE SCIENTIFICALLY FORMULATED

1800 337 955

info@propharma.com.au

www.propharma.com.au

F07611

Online shop: www.propharma.com.au

Propharma has been manufacturing and providing services to the stockfeed, veterinary, pharmaceutical and food industries for over 43 years. They have an excellent reputation for high quality, dependability and are well known for specialising in custom manufacture of small quantities. Blending: Propharma uses ribbon blenders to create homogenous blends of dry powders, blending quantities between 500kg to 1500kg. Our Milling

D&D

DIESEL SERVICES Dieci Telehandlers - Hay Master - Poultry Pro - Construction Morooka Rubber Tracked Crawlers IHI Mini Excavators

Machinery Sales, Hire, Parts, On-Site Service & Repair F07573

www.dnddiesel.com.au Contact us 03 9799 8699

to crops for the Australian fresh market. Emma has a Bachelor of Arts & Science in International Relations & Biology; she received a Nuffield Scholarship in 2014, which enabled her to visit Europe, Israel, Brazil and China to research global export opportunities for vegetables and other primary produce. Her broad range of skills and experience include a restaurant venture and business strategy consulting, she is currently the Vice President of the Victorian Farmers Federation Horticulture Group. This year ‘s luncheon, presented by Telstra, will be held from 12:00 – 2:00pm on Thursday 30th March, tickets will cost $45.00 which includes entry to Farm World, Women in Agriculture presentations, lunch and a glass of wine or soft drink on arrival.

process uses hammer mills to reduce powdered or granular materials to a particle size of 180m. Sieving provides services for raw materials sieving through an 180um screen to remove oversize particles and foreign materials. Propharma licensed facilities has the resources and experience to repack powders and dry material from one pack size to another. Propharma Australia has designed a range of Weather Shield Loose Lick Supplements to meet the vitamin and mineral requirements for cattle, dairy cows, replacement heifers and beef cattle; grazing and feedlot sheep, dry cows (to be used for cows

prior to calving to supply available magnesium and phosphorus with minimal calcium content), horses, goats and alpacas. Weather Shield Loose Lick Supplements provide a very efficient and cost effective form of supplementation, as individual animals will only take as much as they need. Propharma Australia provides Electro G, which has been formulated by Propharma to provide electrolyte and nutritional supplementation for young calves, lambs and foals. All manufacturing at Propharma is conducted according to the principles required under the Code of Good Manufacturing Practice.

Great products, great service at the right price

Proud to introduce Dieci Telehandlers to our range of Equipment

LiuGong - Wheel Loaders - Excavators - Skid Steer

NSW Rural Women’s State Advisory Committee, former President of the Australian Opal Centre and is a Legatee. She holds qualifications in business, food coaching, forensic healing, community development and training and assessment. Rebel’s business, THE Rural Woman, provides a range of online and inperson programs and events to empower rural women to thrive where they are. The business was named a Regional Online Hero by Google in 2015, and was a national winner of the Collective+Lexus Start Up Pitch Competition in 2016. Emma Germano is a Gippsland local, hailing from Mirboo North where she is the Business Development and Operations Manager for ‘Germano Produce’, a 120 hectare family-operated farm supplying cauliflower, cabbage and pota-

Premix Manufacturers, Custom Blending, Milling, Sieving and Packaging

Available in 5 - 25kg Bags or Bulk Bags.

03 9794 7166

Agriculture Luncheon has since grown in popularity to become a signature event at Farm World, providing the perfect platform, to not only hear from inspirational speakers but also to liaise and network with a room full of talented, proactive women. This year’s luncheon, which is presented by Telstra, will feature two very exciting guest speakers, Rebel Black and Emma Germano. Rebel Black launched her first business at age 22 from an office on the opal fields at Lightning Ridge, NSW. She has spent the past 16 years creating award winning businesses, while leading development in women’s empowerment, community, tourism, education, business and social, emotional and physical wellbeing. Rebel is a Fellow of the Australian Rural Leadership Foundation; a former member of the

D&D Diesel Services has been operating for over 20 years and have extensive experience in Earthmoving and Construction equipment, along with Trucks, Cranes and other diesel/hydraulic machinery. The team at D&D Diesel Services recognize the pressures faced by our customers and go the extra mile to ensure our customers go away with a smile. D&D Diesel Services are led by founder David Kapahnke, who has expanded the business with a team and product range second to none. Offering an extensive range of Earthmoving equipment, D&D Diesel Services are the proud Victorian distributor for the LiuGong Loaders / Excavators / Skid steers, Morooka Crawler Dumpers, Dieci Telehandlers and IHI Mini Excavators D&D Diesel Services has developed great relationships with their valued clients over many years of business and are growing their client base from service, repairs and spare parts network. Offering a wide range of new services, partnering with trusted world renowned brands. If you are in the market for new equipment and want to be assured that you have service and back up from a respected local business, contact D&D Diesel Services. they can assist you with Sales, Hire, Maintenance and Repair. The philosophy is based on providing great products with great service at the right price. D&D Diesel Services welcome your business. Find them at Farm World on site E28-29, or call 9799 8699, email sales@dnddiesel.com.au, or find them at www.dnddiesel.com.au


Farm World News 2017 Page 31

GET READY FOR SPRING WITH KUHN HAY AND SILAGE MACHINES

MOWERS

BALERS

RAKES

WRAPPER

S

www.kuhn.com.au F02308

*Offer available to any customer who buys two KUHN machines in one transaction (excluding square balers). One-third deposit required and / or trade. Maximum ďŹ nance term 36 months. See your local dealer for more details and terms and conditions.


Page 32 Farm World News 2017

New life for older batteries, BATTERY ADDITIVE Longer life for newer batteries

Farm World 2017

Battery Conditioner Gives Maximum Battery Performance and Longer Battery Life

tt Ag at ssbaa ee eee-Quus SSSe Site C/17it eld te S si or ge D W ita w F e er P n rm -H E r FaAg ou 04 -3 4 VG 3 te 2 SiS E3 o1.e0a NNit uip

Battery Revitalizer Revitalizer & Conditioner Conditioner Battery • Dissolves sulphation build-up on lead acid batteries internal plates. Dissolves sulphation build-up • Many Increasesfarmers battery holding capacity and stops corrosion of lead plates. in our Recharge Conditioning • Ideal for batteries in low use situations as much as double Increases charge holding capacity Program are getting 8 to 10 years out ofbattery theirlife. • Simply dose with the required amount and charge the battery.

• • Just dose them when you buy them, treat •batteries. Stops corrosion ofand lead plates Call into the Recharge stand and give talk to them us about them every two years an overnight battery Save battery $$$$$$$’s charge twice a -year between treatments Available at:maintenance Available at: eliminate the sulphation problem.

and

F07613

Yes, you can treat sealed batteries. Simply drill into Visit each cell, treat, charge and reseal with our website or call us for your nearest outlet ska-flex auto or a plastic bung.

PH: 1300 853 422 2-Litre available via mail order www.recharge.net.nz

Mail order ph 422 Farmers mailbox 1800 81 66TL1611653 99 Ph 1300 853 www.recharge.net.nz 0427 669 177 - www.recharge.net.nz C0402

Gerard and Debbie can be found at N-10a at Farm World this year.

Sulphation build-up is a major problem with lead acid and calcium acid batteries and Recharge Battery Conditioning Program can as much as double battery life, according to Gerard Anselmi of RECHARGE Battery Revitalizer & Conditioner. How Recharge works: As batteries age, more and more of the sulphur ions in the sulphuric acid electrolyte that should be holding the electrons or charge build up on the internal lead plates as lead sulphate or sulphation. This build-up does two things. Firstly it reduces the battery’s charge holding capacity by removing the sulphur ions from the electrolyte, and secondly it acts

like rust on steel and corrodes the lead until the plates collapse and cause premature battery failure. “Every battery you buy has already started to sulphate and they just get worse until they die”, says Anselmi. A RECHARGE treatment will dissolve the lead sulphate build-up turning those sulphur ions back into sulphuric acid holding electrons. “We are chemically reversing the sulphation build-up process, one chemical reaction to counter another,” says Anselmi. “Once treated, a battery is is essentially running at full capacity, provided the lead plates are still in good condition and prevention is the key. “Dead batteries are dead, so forget about them,” says Anselmi. “Treat batteries early, repeat every 2 to 3 years for starting batteries or every 3 to 4 years for bigger traction batteries like inde-

pendent power supplies, fork lifts, golf carts and scissor hoists.” Gerard and Debbie will be at the Farm World Field Days 2017 on site N-10a. The 500ml farmer pack works out at around $4.50 per car battery. A more cost effective 2 litre commercial pack is also available and that pack can also be purchased on line at www.recharge.net.nz. However, as RECHARGE is acid based, it is dangerous goods and expensive to freight; the 2 litre bottle is therefore the only one that we sell directly and it is far cheaper at the field days. And yes, you can treat sealed batteries simply by drilling into each cell, treating and resealing with silicone, sika-flex or a plastic bung. Recharge is also great for deep cycle batteries like forklifts, golf carts, scissor hoists and lighting system batteries.

Farm World Equestrian Expo

Zuidberg Tracks now available in Australia

Zoe Boulton of Sale clears a jump at the Farm World Equestrian Expo Showjumping last year.

Increased grip, less ground pressure, whatever the conditions

www.burder.com.au www.zuidbergtracks.com Burder AgAttachments 4-8 Kerr Street Wangaratta Victoria P: 03 57 222343 E: info@burder.com.au F07748

FARM WORLD SITE CB13-CB15

The Farm World Equestrian Expo will return to Lardner Park from 30th March to 2nd April 2017. Back by popular demand for its second year, the Farm World Equestrian Expo is a must-see for anyone with a passion for horses. Some of Australia’s finest competitors will travel to Gippsland to compete in dressage, show jumping and games events across a four-day program, which kicks off on Thursday with an HRCAV Dressage event for all levels of riders. Friday and Saturday will see Equestrian Australia show jumping events take place in the Isuzu UTE Main Arena on a course designed by Sydney Olympian and Gippsland local, Gavin Chester. The course promises to be a challenge, with jumps ranging from 90 to 140cm, with $10,000 in prize money up for grabs in events including Friday's Yarragon Rural Supplies Mini Prix and Saturday's iconic Pakenham Produce Farm World Cup. Other competition class sponsors include Drouin Vet Clinic, EFO and Denholm and Christian Fencing. The Equestrian Expo debuted at Farm World in 2016, during which a Games Masterclass demonstrated various tests of skill for the crowd. This year the program has been extended to include a full day of Games Championships on Sunday. Alongside the Isuzu UTE Main Arena, there will be a variety of Masterclasses held over course of the four-day Expo providing specialist advice from the best in the industry, along with the opportunity to ask questions and seek advice relating to your own horses. The Mitavite Cool Crusada Arena will feature demonstrations and larger scale Masterclasses, while the second Masterclass Arena will offer the opportunity to hear tips from the best and ask questions. Masterclasses are supported in sponsorship by International Horse Breeders (IHB) and Racing Victoria’s Off The Track. Some highlights include Sandi Simons’ strategies for overcoming loss of confidence and advice on training problem horses, Adam Wootten’s techniques for developing successful show jumping horses developed from training some of Australia’s most successful horses, and Nicole Magoffin on how to correctly follow the German Training Scale and identify your horse’s strengths and weaknesses in regard to the scale. Farm World Equestrian Expo will encompass a range of general interest horse exhibits and displays including the increasingly popular Western Riders demonstrations, Heritage Draught Horses, pony rides and the Foal App Breed Village will showcase various breeds including local studs and unique breed societies. The trade exhibit area includes an extensive array of equestrian-related exhibitors providing all the latest products, feed supplies and equine related resources. Stunning trophy rugs for the competitions are provided by Arch & Alex with further support sponsorship for the event from Gippsland Premium Quarries and Yaraandoo Park Concepts. To keep up with the latest in news and announcements for the Farm World Equestrian Expo follow their Facebook page.


Farm World News 2017 Page 33

Farm World 2017

Norwood Sawmills

Come and see us at site

F06493

CB94A-95

sales@ sales @geoffstools.com.au

www.norwoodsawmills.com/au

Come and see the team at Norwood Sawmills at Farm World, site number CB94A for all your premium quality portable mills.

Norwood Sawmills has been designing and building premium quality portable mills for more than 20 years. A Canadian based company, Norwood Sawmills manufactures in Canada and supplies to more than 100 countries worldwide, now including Australia. Norwood supplies many options for milling timber, from a basic portable chain sawmill to a range of band sawmills that varies in size from a 26 inch diameter log to a 36 inch diameter log with options to add hydraulics log turners rollers plus trailer options. The sky is the limit. Norwood invests heavily in R&D, focusing on developing technology that cuts the time it takes to mill each log into dimensional timber. By eliminating operator functions and speeding up cycle times, Norwood Sawmills achieves greater productivity and therefore profitability. Come and see them at Farm World site number CB94A for demonstrations. Or contact them on 1300406984 or www.norwood sawmills.com.au

The German Tillage Specialist’s Australian launch at Farm World

Burder AgAttachments, one of Australia’s largest manufacturers of Front End Loaders, ForkLifts and Agricultural attachments has recently been appointed as the exclusive distributor for Rabe tillage equipment from Germany, which are part of the Gregoirre Besson group, one of Europe’s premier manufacturers of cultivation equipment. With a passion for Excellence – Rabe’s pedigree of more than 125 years of experience in developing and manufacturing highly innovative technologies for tillage and cultivation provides the foundation for a successful partnership with Burder AgAttachments for ‘both’ today and tomorrow. “Passion for Excellence is Rabe’s motivation driver in any step of the delivery process.” Starting with the design, innovation and robustness of the products, the quality of production, the expertise in sales, service and parts support. Excellence is the final result and a sign of the overall commitment from the employees in Rabe’s European factories. Mr Mark Francis, Rabe’s manager for the Asian region said “We at Rabe feel that the knowledge and experience Burder has in the Australian market, coupled with their excellent technical support will serve the Rabe product well. With a wide range of cultivation equipment ‘and the evolving nature of the Australian agri-business sector we are certain Burder will be able to provide the Australian farmer with technologies to meet the new environment that Australian agriculture is facing. Having an existing manufacturer distributing our products gives both companies a unique, independent selling point, and a great position in the Australian market.” “After months developing this deal and mapping a rollout plan, it’s great to get our collaboration underway” said Adam Fendyk, Burder Group General Manager. “We are very pleased to have our own Burder Brand associated with Rabe.” Adam states “having already manufactured agricultural equipment locally, it just makes sense to join forces with one of Europe’s largest and best known cultivation equipment brands. This is a great addition to our existing suite of products and complements our existing range of products well.” Burder is anticipating that the new business generated will create several new positions in the company. Adam states “to make deals even easier to complete, Burder will be employing skilled staff to deliver the service dealers expect for the new products.” Added to the 60-strong manufacturing, design and sales team based in Wangaratta Victoria, Burder is well placed to meet the needs of the Australian rural sector. With the first inventory, due to land in Australia towards the end of February, Burder is set for a big year with a great range of cultivation equipment for the Australian farmer. The collaboration between Burder and Rabe will be officially launched at Farm World, Lardner Park, Warragul March 30 – April 2. You can view the new range at site CB13-CB15.

x x x x x x x

FARM WORLD SITE CB13-CB15

x

www.burder.com.au www.rabe-gb.de Burder AgAttachments 4-8 Kerr Street Wangaratta Victoria P: 03 57 222343 E: info@burder.com.au F07749

Burder AgAttachments and Rabe cultivation equipment

Long line tillage range including: Speed Tillers Mould Board Ploughs Combi Disc/Tines Off Set Disc Harrows Chisel Ploughs Deep Rippers Power Harrows Front Mounted Implements


Page 34 Farm World News 2017

See us at Farm World Site 1

Meets the changing needs of agriculture Princes Hwy, Trafalgar. Ph: 5633 1866 Product specialists on-site at Farm World

KZ2461D

● 24hp Yanmar Diesel Engine ● Hydrostatic Drive ● 10 Gauge Fabricated Double Lip Construction ● 61” Cutting Width ● 14 Position Height of Cut Adjustment

KIOTI RIDE ON & ZERO TURN MOWERS

YOUR COMPLETE FARMING SOLUTION

$15,990 INC GST

More models to choose from RX8030

CS2610 ROPS ● ● ● ● ● ● ●

KZ2552 ● ● ● ● ●

Standard Features

Standard Features

● ● ● ● ● ● ●

26hp 4WD Power Steering Industrial Tyres Ergonomic Operator Station Large 1131cc Diesel Engine Tight Turning Circle HST Transmission

80hp Daedong Diesel Engine Power Fwd/Rev Shuttle 24 x 24 Transmission European Designed Wet Clutch 4-Wheel Drive with Diff Lock Power Steering Radial Tyres (RX 8030)

KZ2552 - 42 INCH

$4,900

FROM

FROM

$16,990

PX1052CP

Standard Features

Standard Features

● 42hp Daedong Diesel Engine ● 4WD ● H ST Transmission or 9x3 Transmission ● Twin Pedal (HST version) ● High Ground Clearance ● HST Transmission ● Power Steering ● Hydraulic Remotes (STD)

● ● ● ● ● ● ● ●

100 hp Perkins Diesel Engine Power Fwd/Rev Shuttle 32 x 32 Transmission Hydraulic Push Button Hi/Lo European Designed Wet Clutch 4-Wheel Drive with Diff Lock Power Steering Radial Tyres

FROM

FROM

$23,990 INC GST

$68,000 INC GST

$5,500

Petrol Version

● 500cc Engine ● 2 Range CVT Transmission ● 4WD with Diff Locks ● Top speed 60 km/h ● Easy Tilt with Gas Strut MECHRON 500 - PETROL

$13,900 INC GST Diesel Version

● 22 hp Daedong Diesel Engine ● 2 Range CVT Transmission ● 4WD with Diff Locks ● 3 Seater with Seat Belts ● Hydraulic Tilt Tray ● Variety of optional extras

KL2042

● 76hp Daedong Diesel Engine ● Fwd/Rev Shuttle ● 24 x 24 Transmission ● 4 Wheel Drive with Diff Lock ● Power Steering ● Auto Hydraulic Independent (PTO) ● Incl 4 in 1 loader

● ● ● ● ●

INC GST

UTILITY VEHICLES

RX7620 CAB Standard Features

INC GST

KZ2552 - 52 INCH

$45,000 INC GST

INC GST

CK4210 HST

Briggs & Stratton Engine 20hp Hydrostatic Drive 42” Cutting Width 7 Position Height of Cut Adjustment

MECHRON 2200

$20,900 INC GST Diesel Version

$3,300

FROM

INC GST

$44,000 INC GST TM

Briggs & Stratton Engine 25hp Hydrostatic Drive 57” Cutting Width Electrical Deck Lifter

FARM WORLD SPECIALS

SLASH DOWN PRICES LD R O W M R A F T A D R A W O H A H WIT

● ● ● ●

● Hydraulic Tilt Tray 22 hp Daedong Diesel Engine ● Variety of optional extras ● Long tray 2 Range CVT Transmission 4WD with Diff Locks INC MECHRON 2300 3 Seater with Seat Belts GST

$21,600

UNBEATABLE DEALS FOR 2017 HD 5/12 C

EHD SLASHER

HD SLASHER

NUGGET SLASHER

GIPPSLAND’S ONLY FULL RANGE SALES AND REPAIRS

NO. 1 CONTRACTORS’ CHOICE

THE TOUGH ALL-ROUNDER

THE GENERAL PURPOSE LEGEND

SPARE PARTS, SALES

HDS 7/12 HD 3.7/35 PB CAGE

www.altomotors.com.au | (03) 5633 1866

Princes Hwy, Trafalgar. Ph: 5633 1866 www.altomotors.com.au


Farm World News 2017 Page 35

See us at Farm World Site 1

Sales, Spare parts and Servicing in Trafalgar Princes Hwy, Trafalgar. Ph: 5633 1866

WE’VE GOT THEM ALL

ALTO MOTORS ARE YOUR LOCAL AUTHORISED JCB DEALER FOR SALES, SERVICE AND PARTS. NOW STOCKING THE

JCB RANGE OF GENERATORS

THE LATEST IN CONSTRUCTION GEAR | FARM WORLD SPECIALS EXTENDED FOR A LIMITED TIME!

Princes Highway, Trafalgar P 03 5633 1866

Gippsland’s Home of Vicon

2.95% Finance Available Only 10% deposit required ● Available till 30 September, 2017 ●

12VERS

SPRAY FROM

L 25L - 400

SINGLE &L TWIN REES OPTION FROM0L

LINKAGES SPRAYER FROM 00L 400L - 19

300L - 60

LONG RANGE REMOTE SYSTEM

FOR ALL YOUR SPRAYING SOLUTIONS

1300 745 826

silvan.com.au


Page 36 Farm World News 2017

Farm World 2017

Harrison F-Trucks are a leading supplier of F-Series range.

F07943

Welcome to Harrison F-Trucks the home of the F-Series F150 and Super Duty It’s been over a decade since The Harrison Motoring Group introduced the F- Series to the Australian public with a ADR approved local Conversion. It is through an exacting and thorough testing procedure and constantly evolving research and development that Harrison FTrucks is able to offer today’s premium FSeries to the Australian market. From independently tested and engineered parts right down to crash testing air bags – safety and quality is always at the forefront of this constant evolution of exacting conversion standards. Harrison F-Trucks, once converted have been returned to the USA and travelled over 5,000 miles around the Michigan Proving Ground. On return the F-Series was sent to outback Australia to travel a further 30,000 kilometres. Such rigorous , comprehensive standards and testing ensures the vehicle exceeds all Full Volume Australian Design Rules and Motor Vehicle Standards Regulations 1989 which are audited by the Australian Government Department of Infrastructure & Transport approved the Full Volume Compliance.

Safety, quality and reliability – Harrison FTrucks 50 million kilometres and still going strong. From the Top End to Tasmania and all parts in between with over 600 F- Series traversing this great continent you’ll see a Harrison F- Truck being supported by our 4 year / 130,000 KMS Warranty – our 24/7 day a Road Side Assist and our 24/7 Technical Support Assist. With a dedicated service facility and a full range of parts and accessories to suit most models, why not make us your one stop shop. With over 50 New and Pre Owned trucks in stock we are sure to have a vehicle to suit all needs. Come visit us at Farm World Lardner Park and see why Harrison F-Trucks are Australia’s leading supplier of the F-Series Range. Please contact us to further discuss how we can be of assistance or to arrange a suitable time to inspect and drive any of the available range. We are located in Melton, Victoria in Melbourne’s West. Or visit us online at www.harrisonftrucks.com.au

Book a FREE nutritional assessment today A tailored nutrition program from CopRice is the smart way to maximise the health and performance of your herd. CopRice dairy pellets provide \RXUFRZVZLWKDVFLHQWLÀFDOO\ balanced, highly digestible and consistent ration based on their nutritional requirements and available feed. The bottom line is improved production at less cost. Book a free RQIDUPFRQVXOWDWLRQZLWK\RXUORFDO CopRice nutrition expert today and ÀQGRXWZK\SHOOHWVDUHWKHVPDUWZD\ to maximise your feed dollar.

Graham Francis Yanakie, Victoria

®Registered trademark of CopRice, a division of Ricegrowers Limited, trading as SunRice. CPA17070A

F02414

www.coprice.com.au 1800 267 742


Farm World News 2017 Page 37

Helecal Rotar Solar Pumping Systems for all applications. Installed throughout Gippsland

CM Household Pressure Systems Benefits: ● Self priming ideal for above or below ground ● Robust design to ensure longest life possible ● User friendly interface ● All stainless steel construction ● Four year replacement warranty

Quality European Grundfos offers the premium quality range of pumps for all domestic farming & commercial applications Great Offers on all GRUNDFOS models

Quality European Preformance and reliability. Up to 6 Year parts and labor warranty.

Valley Pumps sell, service and design MONO solar systems to suit your needs.. High head and whole farm are easily achieved with MONO solar systems. Benefits include ability to operate with minimal maintenance for many years in the remotest of enviroments.

Yanmar TF 120 / Mono 620 ASP 6000 LPH 120 meter HEAD Engine Watchdog Extended range fuel tank

Was $15,500

DAB JETCOMN 62 MPCX AND 102 MPCX Electronic control household pump suitable for a small to medium household or a fantastic garden pump. .6 HP 40 LPM 400 KPA 1 HP 60 LPM 400 KPA

DAB 300MP PUMP Designed for pumping from tanks, rivers and dams. These pumps are reliable in the toughest of enviroments. Suitable for stock water or large gardens.

ALL DAB PUMPS DISCOUNTED FOR FARM WORLD

Discounts on all stock at Farm World

VISIT US ONSITE OR CALL

POLY TANKS AUSTRALIA

NOW LE AVAILAB TE IN REMO L CONTRO

Pump an d ta Package nk ORDER receive S ex discoun tra ts

COME and SEE the new 4WD AS940 Sherpa Rough Terrain Lawn Mower

www.asmotor.com.au

Urban Poly tanks are certified to Australian Standards.

Come and see us at Site 331 in Third St at Farm World All pumps operating on site

F02360.indd

W

inc gst

The MONO agricultural surface pump [ASP] is a water transfer pump and has been designed to pump water from rivers, dams, ponds or tanks upto 240m head. The ASP has been tested and proven in the field over a wide range of water pumping applications with maximum efficiency and reliability.

Rough Terrain Lawnmower T! ORLD 1S

Special offer $12,900


Page 38 Farm World News 2017

Farm World 2017

Visit Totalspan Sheds at site F25 at Farm World. Stuart Gowans (left), Kerry Gowans and Damien Lisle can assist with all your shed requirements.

Totalspan Sheds

F07919

- your local shed builder Totalspan is a locally owned and operated business that prides themselves on their attention to detail and customer service. Totalspan Sheds is your one stop shop for quality steel buildings included in their range of carports, garages, farm sheds and barns. Totalspan handle the whole process from start to finish supplying the kit, concrete and construction with all the necessary permits and certificates. The business is backed by one of the largest shed companies in Australasia. They use only quality Australian BlueScope Steel which is supported by a 25 year structural warranty. They are registered builders DB-L 32051 and licensed Plumbers (Class 10a Roofing). Their unique design and bolted portal

frame ensures a strong building with more usable space due to the design of the internal frame. Totalspan Sheds have established partnerships with experienced and skilled teams of local builders, engineers and suppliers, which enables them to deliver on time, on budget and to specification. Totalspan Sheds will be at Site F25 at Farm World. Visit the friendly, expert staff for more information on their services. Alternatively, for a low stress shed building experience, call them now on 5622 2577 or click on totalspan.com.au They are more than happy to come to you for a free, no obligation site-visit to discuss your shed requirements. Totalspan is located at 177 Queen St, Warragul.

John Duff & Co Distributor of Shell Products SUPPLYING GIPPSLAND FOR OVER 55 YEARS

Your Gippsland distributor of Shell quality fuels and lubricants Call us today or see us at Farm World site E20-21 to discuss your bulk fuel and lubricant needs

52 Sybella Avenue KOO WEE RUP Ph: 5997 1277 â&#x20AC;&#x2DC; For a fill on the farm or fuel on the road, give John Duff & Co a go!â&#x20AC;&#x2122;

F07729

Email: admin@jduf f.com.au


Farm World News 2017 Page 39

Farm World 2017

Massey Ferguson expands utility range with the new MF5700 Series cab tractors manufacturing tools and techniques, they still retain our traditional straightforward operation, dependability and value for money,” says Paul. MF5700 Series features: • MF5709 (92hp), MF5710 (102hp) AGCO POWER 4.4 litre, four cylinder turbocharged, mechanical fuel injected engine Most modern straightforward transmission Massey Ferguson engineers at Beauvais, France developed a completely new transmission with hydraulic reverse shuttle and 12 synchronised forward/reverse speeds which are engaged with two straightforward levers mounted on either side of the driver’s seat. The levers act directly on the selector rails, which offer simple, easy and reliable operation - one lever shifts the gears, while the other selects high or low range. Operator Platform Both models are available with comfortable, flat floor platform operator environments with logical and easy to use controls that are operated manually and thanks to good, ergonomic design all fall to hand easily. An analogue instrument panel provides information on engine speed, fuel level and temperature as well as housing the warning lights for 4WD, PTO, diff-lock and other functions. A digital display shows PTO speed, engine hours and forward speed. A fully approved ROPS frame is fitted as standard on both

models with an optional sun canopy. Rear Axle The modern, heavy duty, structural casting rear axle design contains new inboard reduction units and oil-immersed brakes. Responsive electronic hitch control combines with straightforward operation of the lever. Maximum rear lift capacity is 3,300kg. Completely new hydraulic power Massey Ferguson has developed a completely new open-centre hydraulic system for the Global Series, which exceeds the flow and pressure demands of most modern applications and implements. This employs a responsive, high pressure gear pump to supply the main services including rear linkage and auxiliary spool valves, while another pump provides lower pressure for the auxiliary hydraulic circuits including the steering, 4WD and diff-lock engagement as well as PTO control. This dual circuit system ensures there is always sufficient flow for continuous, efficient operations. Centre drive four-wheel drive The modern gearbox design provides an additional output shaft to provide drive to the front axle. The drive shaft is tucked neatly underneath the centre of the gearbox and engine and is fully guarded for protection. Four-wheel drive is engaged electro-hydraulically on the move, through a simple, robust ‘dog-tooth’

clutch. It is permanently engaged by spring pressure and released by hydraulic pressure. The purpose-built 4WD front axles with hydrostatic steering, offer excellent maneuverability and enhanced traction. For more information about the MF5700 Global Series please contact your local dealer or visit www.masseyferguson.com.au or call into site B21-23 & C24 at Farm World.

Massey Ferguson has announced the addition of a cab model to the MF5700 series range.

PREMUM ENGINE OILS & LUBRICANTS SUITED FOR ALL INDUSTRIES Atlantic Oils is an independently owned Australian company producing premium engine oils and lubricants for the Forestry, Agricultural, Transport, Mining, Automotive and Industrial sectors. Whether your line of business is cattle, sheep, dairy or crop farming, we have the right products to suit your vehicles and machinery.

COME AND SEE DAVID FOSTER AND THE TEAM @ STAND CB21 AT THE FARM WORLD SHOW

Ph: 03) 9768 3307 Fax: 03) 9768 2832

Certified Manufacturers of

6A Nicholas Drive Dandenong South Victoria 3175 www.atlanticoil.com

F07979

Massey Ferguson, a worldwide brand of AGCO, has announced an extension to its Global Series utility tractor range with the addition of a cab model on the MF5700 Series range. Two new larger and more powerful models at 92hp and 102hp continue on from the successful MF4700 Series (74hp - 82hp) that was released in Australia and New Zealand in 2014. “The release of the new MF4700 Series in 2014 was an exciting initiative as it allowed us to offer customers a new concept in utility tractors with a choice of build-specifications, options and accessories at exceptional value,” says Paul Morris, Product Manager for Massey Ferguson. “The new MF5700 Series further increases the offering and provides added flexibility for customers wishing to tackle heavier tasks with a straightforward and dependable tractor.” Massey Ferguson’s Global Series is the result of a $350 million investment in a completely new, clean sheet design with more than 90% of the parts and components being engineered specifically for the tractors. “Unlike the majority of other tractors in the sector, which are based on earlier designs and components, the Massey Ferguson Global Series has been designed and built in the 21st Century and is purposebuilt for modern applications. While using the very latest, advanced engineering and

OUR best

utility Tractor yet ...AND WE’VE BUILT A FEW GOOD ONES OVER THE YEARS!

NEW MF 5700 SERIES | 92 – 102 HP N UNBEATABLE PERFORMANCE EVERY DAY U

CONTACT YOUR YO LOCAL MF DEALER FOR A REAL DEAL MASSEYFERGUSON.COM.AU | FREECALL 1800 802 914 MASSEY FERGUSON®, MF®, the triple-triangle logo® is a worldwide brand of AGCO. © 2017

F02305

4 cylinder powerful, reliable and fuel efficient AGCO POWER engines N New 12 x 12 fully synchronised transmission for smoother operation with a good selection of gears PPower shuttle with adjustable response of shuttle for smooth operation LLarge 4,000 kg rear 3 point lift capacity to handle big jobs EElectronic linkage with draft control offers precise operation of linkage regardless of application 2 auxiliary spool valves with a high hydraulic flow of 98 litres per minute

SEE THE NEW CAB MODEL AT FARMWORLD!


Farm World News 2017 Page 41

Farm World 2017

WARRAGUL

Vin Rowe Farm Machinery Celebrates 50 years The Vin Rowe Farm Machinery success story began in 1961 when Vin Rowe, after working for Laceys of Sale (General engineers and agricultural machinery retails), moved to Warragul to open and manage a new branch for the company. The business was established as a New Holland Machinery and David Brown Tractor dealer. In the early 60â&#x20AC;&#x2122;s, West Gippsland was a booming dairy area and one of the most productive in the country. Vin, together with local agricultural machinery dealers John Woods and Earl French, founded the Warragul Field Days (now known as Farm World) which quickly outgrew its home on a property near Longwarry and other temporary homes, before setting up residence at Lardner Park in 1967. From the innovation of these three local operators, Farm World has grown to be one of Australiaâ&#x20AC;&#x2122;s largest farm machinery exhibitions. In 1970, Vin took over the business in Warragul himself and formed Vin Rowe Pty Ltd. Soon after, the company took on the Datsun Car Franchise and moved to its current Endeavour Street premises. However, in the mid 70â&#x20AC;&#x2122;s, with the discontinuance of milk contracts and a general downturn in dairy farming, it became obvious that the company needed to diversify its product line. During the same period, Melbourneâ&#x20AC;&#x2122;s urban sprawl was increasing and as a result many vegetable growers moved from the outskirts of the city to Gippsland. Whilst still involved with the dairy farming industry, Vin sought out involvements with suppliers of equipment compatible with vegetable growersâ&#x20AC;&#x2122; needs. Around this time the company became the Australian Importer and Distributor for the Danish carrot machinery manufacturer Asa-Lift. By bringing the Faun 1600 harvester into the country Vin was part of something of a revolution in the Australian Potato Industry with the advent of automated harvesting. This helped to establish a sound foundation for the development of the company. In 1983, Vinâ&#x20AC;&#x2122;s son, Graham Rowe took over the running of the business. Further realising the need for diversity, Graham expanded the import and distribution section which is today a very important part of the business. Vin Rowe Farm Machinery has continued its family tradition by appointing Grahamâ&#x20AC;&#x2122;s son, Nick Rowe as a Director. Nick is now the 3rd generation of the Rowe family to join the company, Graham and Nick are joined by Stephen Pike as Director. Graham Rowe said: â&#x20AC;&#x153;My father taught me honesty and dependability, and I strongly encourage these principles to remain as the company continues to grow today. The brief of the company today is to import and sell the most innovative machinery available, to offer the best possible service after the sale and to treat and respect our customers as friends.â&#x20AC;? Vin Rowe are the Australian Importer and distributor of an extensive range of European equipment including AVR Potato Equipment, Asa-Lift Vegetable harvesting Equipment, Baselier and Struit tillage equipment, the complete range of Valentini Tillage and Stone Crusher equipment, and the Pasquali BCS range of walking tractors. In addition, they also import and distribute the Artsway feed mixer machines from the USA. They will be exhibiting at Farm World from Thursday 30th of March until Sunday 2nd of April 2017, showcasing their range of Kubota/Krone tractors and equipment, Kuhn Agricultural Equipment and general farm machinery.

CELEBRATES 50 YEARS OF FARM WORLD WITH THIS FANTASTIC OFFER

^

FARM WORLD 2017 NAVARA DRIVE DAYS Experience Navara 4x4 Ability Thursday 30th March to Sunday 2nd April 11am-12pm and 2-3pm daily Book your MY17 Navara Experience now by calling Alicia Hill on 5623 6212 or see us at Farm World 2017 Stand No T9.

Ph5623 56236212 6212 | | 4-6 4-6 Howitt Howitt Street, Street, Warragul Ph Warragul warragulnissan.com.au warragulnissan.com.au LMCT 10173

LMCT 10173

AFRPSDULVRQUDWHIRUDSSURYHGSHUVRQDODSSOLFDQWVDQGDQQXDOSHUFHQWDJHUDWHIRUDSSURYHGEXVLQHVVDSSOLFDQWVRI1LVVDQ)LQDQFLDO6HUYLFHV $XVWUDOLDQ&UHGLW/LFHQFH1XPEHU RQO\0D[LPXPWHUPPRQWKV 7HUPVFRQGLWLRQVDQGIHHVDSSO\7KLVFRPSDULVRQUDWHLVWUXHRQO\IRUWKHH[DPSOHJLYHQDQGPD\QRWLQFOXGHDOOIHHVDQGFKDUJHV'LIIHUHQWWHUPVIHHVRURWKHUORDQDPRXQWVPLJKWUHVXOWLQDGLIIHUHQWFRPSDULVRQUDWH&RPSDULVRQ UDWHIRUWKHSXUSRVHRIWKH1DWLRQDO&UHGLW&RGHLVEDVHGRQD\HDUVHFXUHGORDQRIDOWKRXJKWKLVRIIHUUHODWHVWRDPRQWKWHUPRQO\&RQVXPHU$352IIHUDYDLODEOHRQQHZDQGGHPRQVWUDWRU1LVVDQ1DYDUD 5DQJHSXUFKDVHGEHWZHHQDQGDQGGHOLYHUHGE\([FOXGHV*RYHUQPHQW5HQWDODQG1DWLRQDO)OHHWFXVWRPHUV:DUUDJXO1LVVDQUHVHUYHVWKHULJKWWRYDU\H[WHQGRUZLWKGUDZWKLVRIIHU

F02401

Vin Rowe Farm Machinery has been exhibiting at Farm World since its inception.

Burra Foods are currently recruiting new milk supply. For milk supply enquiries please contact Peter Fort on 0417 332 141 or Paul Bills 0477 507 099

F07664

PROUD SPONSORS OF THE LARDNER FIELD DAYS 2017


Page 42 Farm World News 2017

Farm World News 2017 Page 27

Farm World 2017

Big year for a big bale feeder Gary

BLACKWOOD

mp

Member for Narracan

www.garyblackwood.com.au 3/24 Mason Street WARRAGUL 3820 ph. 5623 1960 Funded from Parliament’s Electorate 2I¿FH &RPPXQLFDWLRQV%XGJHW

Big year for a Big Bale feeder. Other features like heavy duty chassis, walking beam axles with floatation tyres, large storage bins and 2 remote operation are all designed to make feeding bales quick and easier. With now several units out in operation, they are proving to be more than living up to our expectations. Some owners have now fed out thousands of bales and have found them easy to use and able to handle all types of bales, some weighting over 1200kg. Farmers like the ability to go into a large herd of cows and feed out up to 3 bales without getting out of the tractor seat. This is a great safety feature as anyone who has experienced trying to get the plastic and nett off the second bale in a mob of hungry cows. For more information and details about the range of McIntosh Bale Feeders including the new Multi Bale Feeder please visit Trac Mac Farm Equipment on site CB126 or phone on 03 5625 1522.

THE BIG BALE SPECIALISTS NEW MULTI 4 BALE FEEDER DO YOU HAVE A LARGE HERD AND DO MULTIPLE TRIPS FEEDING YOUR STOCK? THEN THE NEW MCINTOSH MULTI 4 BALE FEEDER IS FOR YOU! This award winning bale feeder has been carefully designed to handle all types of round bale silage and hay, without fuss. With it’s four bale capacity, clever design and rugged construc on, that makes the Mul 4 bale feeder simple and easy to operate.

BALE FEEDERS - SINGLE, DOUBLE and TROUGH MODELS

Eureka Premium Sheds Visit the Eureka Garage display and you’ll meet the ‘Shedmen’ Dave, Jason and Steven. All of their products carry an unconditional guarantee against any faulty workmaship or materials and are manufactured at their West Sunshine Plant incorporating the latest technology and equipment. Because they are the manufacturers of most components in their structures they can offer extremely competitive prices. Eureka Garages specialise in building sheds to suit their clients’ specific needs. For example, if you need a barn with a mezzanine floor and bay sizes to suit stables, Eureka Garages will design and custom build your barn to suit. All of their structures are built using high tensile steel for a stronger, more durable building. They’re built using the Portal Frame principle giving you far more clearance and head room. They have been servicing the industry for over 20 years and have become well aware of what the industry requires and have developed their buildings to suit. The buildings are recommended for their design, strength and ease of construction and are respected throughout the industry as a top quality product made to last. This is supported by the fact that they have a number of resellers throughout Victoria that base their business purely on their quality products. Eureka Garages and farm sheds include custom orders and complete precision made kits for easy and economical do-it-yourself erection. Engineer’s drawings, building certificate, plus a complete construction manual are included. If you wish, all building or designs can be fully erected for you, quickly and efficiently to the highest professional standards. They guarantee prompt delivery throughout the whole of the Melbourne and metropolitan area and they can organise freight on your behalf for country and interstate deliveries. They invite you to take advantage of their expertise in the manufacture and supply of steel garages etc. which include first class customer service second to none. Pick up a brochure on the Lofty Garage at Farm World and talk to Dave, Steven or Jason about their Lofty display at the Traralgon display yard. This unique two-storey garage offers the user many alternatives to the average garage. Built using steel stud and noggin house frames, you can insulate and line the internal walls just as you would a normal house, perfect for extending the family home, moving out of town to small acres, or even for a holiday home. Eureka Garages roll-form most garage materials themselves, so by purchasing a Eureka product the middle man is eliminated and the savings are passed on to you, the customer. Visit the display at Farm World, site No. 228 and 229 or call Eureka Garages, 188 Argyle Street, Traralgon on 5174 5311.

McIntosh Bale Feeders are designed with strength, performance and uncompromising quality to handle your bale feeding requirements. All machines have been carefully designed to reduce breakdowns and give trouble free opera on for years to come.

TITAN SERIES SILAGE WAGONS - FROM 8 TO 28m3 With their carefully thought out design, all steel construc on and large range to choose from McIntosh Silage Wagons have the strength, performance and durability that you can rely on. Unique features: · 13mm Titan Series floor and elevator chains - Almost twice the strength of standard 10mm chain. · 5mm steel floors, 3mm pressed steel sides, fully welded - no bolts or rivets to come loose. · Large high capacity 1200mm wide cross conveyers with op onal chain, slat and side mounted elevators available. · Larger floor and elevator sha s with seated gearbox floor drive system for greater reliability · Heavy duty chassis, axles and wheel combina on We have plenty of op ons to suit your individual needs

STRENGTH / DURABILITY / PERFORMANCE www.mcintosh.net.nz FOR YOUR NEAREST DEALER PLEASE CONTACT: 86 ROBERTS CRT, DROUIN 5625 1522 0418 515 510

VISIT US AT SITE:

CB126 F07575

F07604

2016 has certainly been a big year for McIntosh with their new Multi Bale Feeder. At the machines release at Farm World 2016 the Multi Bale Feeder won the TMA (Tractor & Machinery Association) Best NonPowered Machine of the year. Then at the 2016 Elmore field days, they were proud to receive the Weekly Times Best Imported Machine of the Year award for its innovative design, unique features and the ability to improve farming efficiency. This has been a great result for McIntosh Brothers from New Zealand together with their Australian partner Trac Mac Farm Equipment. Listening to customer’s needs, they have been working closely together over the past 18 months to develop this brand new design. The new Multi Bale Feeder is designed to load, carry and feed out up to four round bales of silage or hay in one load. This will greatly improve the efficiently and feed out times for farmers that feed larger herds. The unique twin ram bale loading system allows the operator to lift and hold the bales above the platform to allow easy removal of the nett and wrap. This is especially suitable for roto-cut silage bales that can fall apart once the nett has been removed. The bale transfer system pushes each bale up into the feeding cradle. The specially designed feeder slats allows the easy transfer of the bales, but ensuring plenty of aggression for consistent feeding. The dual sided cradle allows accurate control of feeding out the fodder, no matter which way the bale is placed into the cradle. The new style vertical drop side feeder chains assist in the prevention of the wheels running over the material.


Page 26 Farm World News 2017

Farm World News 2017 Page 43

Farm World 2017

Ranch style designs at their best ASK THE R BOYS ABOUT THEI LD OR FARM W SPECIALS

Since 1949, Simonds have been building affordable, quality homes for families across the nation. Their knowledge, expertise and superior workmanship have earned them the highest accolades in the business, but over and above that, it is their emphasis on customer care that truly makes them one of Australia’s greatest builders. Simonds have an exclusive Ranch style range with 6 plans and 10 facades to choose from. We are confident you’ll be able to find a plan that suits your land and needs perfectly within our range. From our simplistic yet spacious 21 square home the Heathcote, which features 3 bedrooms and 2 bathrooms all the way up to our 36 square Omeo. The Omeo 36 boasts 4 huge bedrooms with walk in robes, 4 living areas and a generous alfresco. This stunning home has a wide traditional homestead layout with a broad entrance which flows into an enormous open plan kitchen dining and family

Premium Quality Garages and Sheds at city prices!

RM VISIT OUR FALAY ● Garages ● Barns ● Carports ● Workshops WORLD DISP 29 8&2 ● Industrial buildings ● Lofty garages ● Farm sheds SITE 22

Buy direct from the manufacturer Zincalume or 20 colours to choose from. See us at Farm World for quality structures at affordable prices.

Simond’s Omeo 2700 with the Kyoto facade. area surrounded by large windows to take in the ambiance of country living. Local expert, Warragul’s consultant Jamie power is a prime example of Simonds commitment to service. “Our award-winning homes are only a part of the reason why Simonds is so highly regarded. It is our genuine approach to helping our homebuyers through the building process that sets us apart from the rest.” Says Jamie. Jamie assists with every detail of the build, right until the day the customers move in.

You can select from our range of standard sizes or we can custom build to suit your exacting requirements

Contact Dave, Steven or Jason at our display centre at 188 Argyle St, Traralgon Phone 5174 5311 www.eurekagarages.com.au

F07553

● Laverton 9314 1245 ● Ballarat 5336 2227 ● Bendigo 5448 3099, ● Traralgon 5174 5311 ● Cambellfield 9357 9590 ● Shepparton 5823 5233. The Omeo features an enormous open plan kitchen and family area

“Our role is to make sure the home building journey is as smooth and as easy as possible. For some people, this will be their first time building a home and it can be daunting process, so we do everything we can to make them feel at ease.” Part of Simonds exceptional service includes offering home buyers a range of home options, “We understand that everyone has different requirements, so we always provide choices to suit their budget,” adds Jamie. Two such choices, the award-winning Rio and the Nicholson are now on display at Waterford Rise Estate in Warragul, Jamie is keen to show future homeowners through these beautiful homes, so get in touch to find your dream home today! Contact Jamie Power on 0413 697 799 or visit our display centre at Waterford Rise Estate, 1-3 Hillgrove Close, Warragul. Open Monday to Friday 12pm to 5pm and weekends 11am to 5pm.

The Rio was recently awarded by the Master Builders Association of Victoria f or being the Best Volume Builder Display Home $350,0 0 0 - $500,000

BUILD YOUR DREAM HOME WITH THE GREAT AUSTRALIAN BUILDER. Building your dream home doesn’t have to cost you sleepless nights. Our dedicated team in Warragul make the homebuilding process effortless with their extensive local knowledge and excellent customer service. Discover amazing value fixed price packages and a range of house and land options to suit your lifestyle and budget. Get in touch today. Jamie Power

F02454

Executive Sales Consultant

CONTACT JAMIE POWER 0413 697 7999 simonds.com.au


Page 44 Farm World News 2017

Farm World 2017

Automatic Gate Operators Install your own D.I.Y. Gate Automation Kit OR call us to ask for your local Dealer & Installer. If you want to view before you invest, talk to our friendly crew at the

Farm World, site no E24 On our website, you can read articles and view photos of automatic gate operators (installed by people just like you) prior to your online purchase.

R R R

2 extra remotes 2 wireless keypads or 2 w/less push buttons Steel Mount plate/s

Solar $1,295 SolarSingle SingleDIY DIYKits Kits - $1,295 Mains MainsSingle SingleDIY DIYKits Kits-- $1,195 $1,195 Solar SolarDouble DoubleDIY DIYKits Kits-- $1,695 $1,795 Mains MainsDouble DoubleDIY DIYKits Kits- -$1,595 $1,695

The Paal Castlereagh Kit Home.

Ambition rewarded

%2186 2))(5 The original and the bestâ&#x20AC;Ś The XP Series, Australian-Made Gate Operators from SUN-POWER. Field-proven for over 25 years. Easy to install, reliable and remote controlled! 3 remote controls are standard in our kits but thanks to the bonus offer, thatâ&#x20AC;&#x2122;s 5 remotes in total, 2 keypads and a mount plate!

 F07734

Design based on RICHMOND

Design based on CAMDEN

Visit us at

FARM WORLD

t/37d0611/0617

sales@sungateaustralia.net www.sungateaustralia.net

The courage and determination of owner builders who tackle challenging projects single-handed is admirable. Brendon of Lilydale, Victoria, built Paal Kit Homesâ&#x20AC;&#x2122; large Castlereagh design on a deeply sloping block and made a magnificent job of it. As well, he saved at least a quarter of a million dollars by tackling as much as possible of the work himself. The commanding outlook was achieved by positioning the house and deck on 88 steel piers that were nearly three metres high at the deck edge. Fascinated by the engineering side of the project and never daunted by challenges, Brendon taught himself new skills, including pier placement and support for the elevated timber flooring. He combined his long-service and annual leave to make a strong start on the house, later employing a professional plasterer to save time.

He used the mandatory tradespeople for roofing, plumbing and electricals. While admitting that his 420 square metre home, including a double-garage and deck, was ambitious, he said, â&#x20AC;&#x153;It was also straightforward in a lot of respects. Iâ&#x20AC;&#x2122;m very happy with the result. Itâ&#x20AC;&#x2122;s certainly an achievement.â&#x20AC;? A building surveyor, who inspected the construction at various stages, said, â&#x20AC;&#x153;Iâ&#x20AC;&#x2122;ve been in the game for 40 years, and I havenâ&#x20AC;&#x2122;t seen it done as well as you have.â&#x20AC;? Brendon confesses: â&#x20AC;&#x153;Our neighbours initially felt sorry for me, out there every day in rain or hail or sunshine, but they now take their hats off.â&#x20AC;? You too can become an owner builder and save big money building the Paal way. Call Paal Kit Homes on 03 9720 1222 to enquire today.

Design based on HARTLEY

Design based on HAWKESBURY

PAAL are Australiaâ&#x20AC;&#x2122;s leading manufacturer of steel frame kit homes. You too can become an owner builder and save big money building the Paal way.....we make it easy for you. All Paal home designs are ďŹ&#x201A;exible and can be modiďŹ ed to suit you personal preferences. Visit us at Farm World or call into our display showroom 259 Canterbury Road, Bayswater North....03 9720 1222

Since 1970

www.paalkithomes.com.au F07589

Stand 118/119


Farm World News 2017 Page 45

Farm World 2017

Farm World Equestrian Expo Masterclasses

Lardner Park Events Chairman Angela Betheras is looking forward to the Farm World Equestrian Expo this year. of a variety of exercises. Tori Jeffress has been riding since she was seven and developed an early interest in dressage. Discovering a unique talent, Jose Mendez taught her the classical way of dressage and Tori has been training dressage bareback and bridle-less ever since. She will demonstrate some trick training using only seat, leg and voice aids in her Liberty Dressage Demonstration. Nicole Magoffin is a Grand Prix dressage rider based in Queensland and a member of the Queensland State Dressage Squad, she currently competes her mare Jaybee Ryana at PSG/Inter1. Nicole has trained in the USA under Steffen Peters and will present a Masterclass which explains how to correctly follow the German Training Scale,

identifying a horseâ&#x20AC;&#x2122;s strengths and weaknesses in regard to the scale, and how to put this knowledge into everyday practice. Brett and Khris Hands will provide an introduction to the rapidly growing western riding sport of Reining and Ranch Riding. Brettâ&#x20AC;&#x2122;s career highlights include winning the RA Highpoint Rookie of the Year title, back to back VRHA Rookie Pro titles, and the NSWRA state show in his first year. Brett and his wife Khris are passionate about reining and ranch riding, and other than training and showing their own horses, they love to teach other riders of all levels and see them successfully grow in the sport. To keep up with the latest in news and announcements for the Farm World Equestrian Expo follow their Facebook page.

F01890

Back by popular demand for its second year, the Farm World Equestrian Expo will be held at Lardner Park from 30th March to 2nd April 2017 and is a must-see for anyone with a passion for horses. A variety of Masterclasses will be held over the fourday program providing specialist advice from the best in the industry, along with the opportunity to ask questions and seek advice. The Mitavite Cool Crusada Arena will feature demonstrations and larger scale Masterclasses, while the second Masterclass Arena will offer the opportunity to hear tips from the best and ask questions. Sandi Simons will address the common issue of lost confidence following a fall. She will explain the most common ways that riders lose their confidence and share her unique knowledge and cues to get the nervous rider out of the arena and safely back on the road with confidence intact. Adam Wootten has been show jumping for over 20 years, during which he has produced some of Australiaâ&#x20AC;&#x2122;s most successful show jumpers, from young horses to Grand Prix. Adam has travelled the world competing and training, including a stint in the United States under the tuition of George Morris. He will present a Masterclass with his working pupil and World Cup rider Taylah Lambert which will share techniques for developing a successful show jumping horse, including a demonstration

BUYERSâ&#x20AC;&#x2122; ADVANTAGE â&#x20AC;&#x2DC;The Advantage is all yoursâ&#x20AC;&#x2122;

Buy a new Toyota at Farm World & receive a FREE tow bar

ACROSS THE ENTIRE 2017 HILUX 4X4 RANGE

FREE ON ROAD COSTS^

+

SPECIAL PRIMARY PRODUCERS OFFER ONLY

BONUS ~

PREMIUM STEEL BULL BAR

Warragul Toyota 1 Endeavour Street, Warragul T 03 5623 1331 LMCT 11009

warragultoyota.com.au

Come and see us at site 254 at Farm World

2ĆŠHUDSSOLFDEOHIRU3ULYDWH%URQ]HDQG6LOYHUĆŤHHWFXVWRPHUVDQGSULPDU\SURGXFHUVRQO\DWSDUWLFLSDWLQJGHDOHUV2ĆŠHUDYDLODEOHRQYHKLFOHVSXUFKDVHGE\XQOHVVRĆŠHUH[WHQGHG&RPSOLPHQWDU\2Q5RDGVLQFOXGHVPRQWKVUHJLVWUDWLRQ PRQWKVFRPSXOVRU\WKLUGSDUW\LQVXUDQFH &73 DPD[LPXPGHDOHUGHOLYHU\FKDUJHDQGVWDPSGXW\~3ULPDU\3URGXFHURQO\RĆŠHULQFOXGHVRQH3UHPLXP6WHHO%XOO%DUDQGGHDOHUĆŞWPHQW)RUPRUHLQIRUPDWLRQSOHDVHVSHDNZLWK\RXUGHDOHU 7

F02356

^


Page 46 Farm World News 2017

Farm World 2017

Kanga Farm Equipment has a new name Farm Implements P/L is an Australian owned and run company that specialises in tractor implements. It is the new name after the

merger of Kanga Farm Equipment (the manufacturing company) and Caroni Implements (the importing company).

The new entity is still owned and run by the Alcott family and their focus remains on supplying high quality 3-Point Linkage

BJ’S STUD CATTLE

Implements for Australian farmers to use in Australian conditions. With the merger, KANGA FARM EQUIPMENT became the ‘house brand’ of Farm Implements. The implements are designed and engineered based on the data and feedback they have received from 35 years in the Australian Agricultural Implement industry. The KANGA FARM EQUIPMENT range consists of Rotary Cutters (slashers), Grader Blades, Post Hole Diggers, Rippers, Carryalls and Cultivators. There are multiple product

ranges which means they can offer an implement to suit the majority of tractor makes and models available in Australia. As well as KANGA, Farm Implements are the Australian distributors of CARONI IMPLEMENTS, COSMO and SICMA. CARONI IMPLEMENTS are importers of components and parts (genuine and non-genuine) for agricultural implements with the majority of parts sourced from Europe. COSMO is an Italian company which has specialised in fertilizer spreaders and spreading technology for

over 25 years. The range includes trailer and linkage fertiliser spreaders from 180ltr to 1900ltr, with either disc or pendulum spreading solutions. SICMA is an Italian manufacturer of Rotary Hoes, Flail Mulchers and Finishing Mowers of the highest quality. The range included Rotary Hoes from 1.0m – 3.0m (15-160hp), Flail Mowers (15-30hp Series), Flail Mulchers (30-100hp) and Finishing Mowers. Over 35 years you witness a lot of change, but at the end of the day you won’t last long in the industry unless the products you offer are

reliable, designed/engineered for Australian conditions and supported locally. All the implements offered by Farm Implements come with a 12 month warranty, are supported through an extensive national dealer network and backed by an extensive parts inventory. A wide range of KANGA, COSMO and SICMA products will be on display at site C32 during Farm World, so please feel free to stop and talk to the staff. Alternatively, please visit our website www.farmimplements.com.au or talk to one of the sales team by calling 03 9706 5166.

Owner Ben Fraser 84 Solomons Road Lillico 0402 860 822 benfraser56@hotmail.com Stud Consultant Erin Grylls 0408 356 927

F07686

BJ’S STUD CATTLE IS A RED ANGUS STUD LOCATED IN WEST GIPPSLAND. WE OFFER GENETICS FROM LOCAL AND IMPORTED GENETICS. WE WOULD LIKE TO WELCOME YOU TO COME VISIT US AT FARM WORLD AT SITE A5A WHERE WE WILL HAVE OUR BULLS ON DISPLAY. OUR FEATURE BULL THIS YEAR IS RED TER-RON RELOAD 703T IMPORTED FROM CANADA.

An aerial view of Farm World last year.

Tractor Implement Specialists Kanga Rotary Cutters a clear clean cut above Rotary Hoes Kanga Rotary Cutters come with HOT DIPPED GALVANISED decks*

Pendulum Spreaders

Pasture Toppers & Multi Head Rotary Cutters

Twin Spin Spreaders

Grader Blades Independently reviewed and approved compliant with the OH&S Industry Safety Standard for Slashers

Cement Mixer Post Hole Digger

Flail Mulchers

Spinner Spreaders * Excludes Mini Range and Trailing Pasture Topper

16 Cahill Street, Dandenong, Victoria, 3175

Phone: 03 9706 5166 www.farmimplements.com.au F02423


Farm World News 2017 Page 47

Farm World 2017

Whatever life throws at you, we’re the dentist you can turn to - General dentistry - Cosmetic dentistry - Braces for adults and children

COSMO BULLY Products If you are in the market for an affordable, high quality Rotary Hoe, Flail Mulcher or Power Harrow, the COSMO BULLY range could be just the product for you. Designed and engineered in Europe in collaboration with COSMO Srl (global leader in fertiliser spreaders), the COSMO BULLY range is made by the world’s largest Rotary Hoe manufacturer. The aim is to make quality agricultural machinery affordable and early indications suggest they have got the right balance between price and quality. The COSMO range consists of five different models of Rotary Hoes (20 – 140hp), three models of Flail Mulcher (15-100hp) and two models of Power Harrow (50-120hp). The Rotary Hoes are gear drive, fitted with six blades per flange, complete with CE Safety Guards and PTO shaft. The range starts at $2,000 for 90cm (36”) UL Series (20-45hp) with models and sizes right through to 305cm (120”) UHH series (90-140) at $12,000. The Flail Mulchers are a mid-height body and come standard with hammers, rear roller, rear mulching ‘rakes’, CE Safety Guards, adjustable skids and

a gearbox with built-in free wheel. The small TSS series (15-28hp to suit compact tractors) starts at $3,400 inc. GST. Then there is the 30-70hp FM series (from $3,600) with the larger 100hp BPF Series, standard with hydraulic side shift, starting at $6,950. The COSMO BULLY Power Harrow range consist of the 60-90hp SRP Series and the new 90-120hp M Series. The SRP Series is available in 150cm ($5,750), 175cm ($6,250) and 200cm ($7,000). The new M Series is being released at Farm World and will be available in two sizes – 2.5m (100”) and 3.0m (120”). The 2.5m has an RRP of $11,000 inc. GST while the 3.0m (120”) will be $12,300 incl. GST. All COSMO BULLY Power Harrows come standard with CE Safety Guards, adjustable rear levelling bar, multispeed gearbox and PTO shaft while rollers (Packer Roller or Cage Roller) are an optional extra. COSMO BULLY will be in display at site C32 during Farm World. If you cannot make it to Farm World, more information can be found at www.cosmobully.com or talk to one of the sales team by calling 03 9706 5166.

- Happy Gas for nervous patients - No fuss payment plans - Emergency appointments

WARRAGUL DENTAL CARE

FREE dental screenings on offer at Farm World!

Proudly serving Warragul and surrounds for over 35 years

Visit us at the Health and Wellbeing section, Site 4.

T 5623 5588 49 Victoria St Warragul

www.warraguldentalcare.com.au

F02499

The Cosmo Bully UH Rotary Hoe will be on show at site C32.

Bully Multi Speed Gear Drive Rotary Hoes 1.5m-3.0m (50-140hp) from $6,500 inc. GST

ON DISPLAY SITE C32

Power Harrows 1.5m-3.0m (50-120hp) from $5,750 inc. GST

FM-m Mulcher – Manual Shift FM from $3,600 inc. GST

UH Rotary Hoe – 50-75hp ffrom $4,250 inc. GST

UM Rotary Hoe – 35-50hp

F02424

from $2,950 inc. GST

BPF Mulcher BP B F 100hp Mu from $6,9 $6,950 inc. GST

FM-h Mulcher – Hydraulic Shift from $4,500 inc. GST

UL Rotary y Hoe – 15-45hp from $2,000 inc. GST

www.cosmobully.com www c

03-9706-5166 info@cosmobully.com


Page 48 Farm World News 2017

Farm World 2017

KUHN mower conditioners offer optimum cut Mowing your Spring Lucerne crop just got a whole lot more efficient, with KUHN launching a new front-mounted disc mower conditioner, ideal for high-powered tractors. “The KUHN FC 3525 DF front mower conditioner is a new model and offers some exceptional features including 30-degree ground adaption, reliable attachments and unlimited visibility,” said Managing Director of KUHN Farm Machinery, Bruno Fetiveau. “The machine also provides a maintenance-free OPTIDISC cutter bar, hydro-pneumatic lift-control suspension and a quick

The new Kuhn FC 3525 DF front mower in action.

have been designed to travel over tough terrain. “The machine can oscillate left to right at an angle of up to 30 degrees and cover a vertical travel range of nearly 70cm,” Bruno said. “It’s also quick and easy for farmers to change conditioning speeds, with two conditioning speeds (755 or 1,000 min-1) simply done by adjusting a central lever.” “The model also offers an adjustable overlap between the front and rear units, that can be adjusted hydraulically between 30 and 70cm,” Bruno said. “And farmers can forget about fixing twisted side covers, with the mower

offering flexiprotect polythene side covers that bend without breaking or damaging the mower.” Farmers can pre-order the FC 3525 DF front mower conditioner and FC10030 DF rear mower conditioners now, with 0.99% finance available until the 15 April 2017. “The machine really does offer farmers high cutting quality, outstanding reliability, high output and reduced operating costs.” For more information and to learn more about the KUHN difference visit www.kuhn.com.au

Power like nothing else

Established

1886

Real Estate & Livestock Agents Servicing the Gippsland region from the mountains to the sea for over 130 years. Come and enjoy a coffee and a chat with the friendly staff from Alex Scott at this year’s Farm World...

SITE 314. You’ll find our offices at... Korumburra

Leongatha

Wonthaggi

5655 1133

5662 0922

5672 1911

Inverloch

Venus Bay

Grantville

5663 7111

5678 8433

5674 1111 Cowes

Pakenham

Warragul

5952 2633

5941 1111

5623 4744

Melbourne

Berwick

Lang Lang

8610 6578

9707 2000

5997 5599

F07602

Website www.alexscott.com.au

release knife system.” The innovative machine can also be combined with the KUHN FC 10030 DF to create a triple mower combination. “This combination provides an exceptional working width of 9.93 meters with a quality cut and quality conditioning,” explained Bruno. “Farmers have also told us they love the new functional look of the front mower conditioner, based on a shark fin, that improves visibility and subtly integrates the suspension unit, which is responsible for an exceptional ground adaption.” The flexible front mowers

R & J Batteries established in 2006, are Australia’s fastest growing Battery Company, they stock an extensive range of batteries to suit most applications from generators to trucks and large earthmoving equipment. The batteries are designed to withstand the harshest operating conditions providing you the power you need and reliability you can trust. R & J Batteries have been entrusted by some of the largest names globally, in battery manufacturing to distribute their products Australia wide, names like ACDelco, Optima, Fullriver, Delkor, Hardcore, BAE and many more. They are also the largest independent distributor of Fuchs lubricants in Australia, covering Automotive, Agricultural, Mining and Industrial applications. The Hardcore range of batteries are designed to operate in the most extreme environments that Australia can offer, which traditionally sees standard batteries prematurely fail. They have successfully tested these products over and over again, resulting in many operators demanding them by name. They have developed these batteries to cover Truck, Agricultural, Earth Moving and Industrial applications, with models to suit American, European, and other specialist fitments. ACDelco, a division of global powerhouse General Motors, sought R & J Batteries to distribute batteries throughout most of Australia, ensuring Holden Dealerships always have stock on hand. The ACDelco range of batteries offer vehicle specific fit-

ments, meaning no modifications are required when installing, unlike some other brands, and offer a *36 month Australia wide warranty. Being a leader in the automotive industry, ACDelco batteries are made to exacting standards required for original equipment, resulting in tomorrow’s technological advancements being available today. As the Australian distributor of Fullriver VRLA batteries, R & J Batteries strive to ensure caravan, boating and RV owners alike have no trouble sourcing this much sought after product. As Australia’s premium AGM battery brand, it is their job to ensure you have access, no matter where you are across Australia. Their Delkor batteries are renowned for quality, in fact one of the best in the world. Produced in state-of-the-art production facilities, backed by a rigid and thorough quality-control process. The Delkor range are globally recognised as a no nonsense Hi Performance battery, just ask anyone who has used them, so when you require reliability, demand Delkor. With regular weekly service runs throughout Gippsland, and many established distributors stocking their brands throughout Gippsland, they have you covered, no matter where you operate. Come and see R&J Batteries on stand BBP 19, in the Baw Baw Pavilion, or call 1300 769 282 for more information. *30 Month Warranty is for private use only.

| 100% AUSTRALIAN OWNED AND PROUDLY INDEPENDANT

Proud distributors of:

ACDelco, Hardcore & Fuchs Generators - Trucks - Earthmoving - Commerical See us at Farm World, stand BBP 19 in the Baw Baw Pavilion

1300 769 282 | rjbatt.com.au


Farm World News 2017 Page 49

SPECIAL HOLDEN FARM WORLD CA$H BACK OFFER 4 DAYS

ONLY

COLORADO

TRAILBLAZER

TRAX

CAPTIVA

ASTRA

BARINA

See the Holden team at Farm World sites 452 - 454 and 526 - 528 Offers strictly only available at Farm World, Lardner Park, March 30 - April 2

WA R R A G U L

Cnr Queen & Pearse Sts, Warragul.

Ph: 5622 0000

Princes Hwy, Traralgon

Ph: 5175 7000

LMCT 10285

8 Koonwarra Rd, Leongatha

Ph: 5662 4070

F02367

LMCT 10285

LMCT 9790


Farm World News 2017 Page 19

Page 50 Farm World News 2017

Farm World 2017

For all your commercial equipment needs

Farm World5 Stand: GIP-3 s (BJ Bearing Pavilion)

HOT TO PRINT FARM WORLD '17

GIVEAWAYS & MORE To see a great range of commercial fridges and freezers visit Ian Boer Refrigeration and Catering Equipment at site GIP35. Ian Boer Refrigeration and Catering equipment now has new offices and a showroom open in Gippsland, Vic. For the past 27 years IBR has been supplying quality commercial equipment Australia wide. Sourcing equipment locally and worldwide for supermarkets, hotels, butchers, bakeries, fast food outlets, pizza shops and restaurants, just to name a few. They has a full range of commercial storage and display refrigeration, gas and electric cooking equipment, counterline equipment, commercial dishwashers, with stainless steel benching also cookroom and general purpose shelving. Featured at Farm World this year are large freezers for bulk meat storage, upright meat hanging refrigerators.

Office Line: 1300 426 263 Office Fax: (03) 5622-0194 email: mail@ianboer.com.au Website: ianboer.com.au Head Office & Showroom: F07917

Factory 6 / 133 North Rd, Warragul, VIC 3820

And for the man cave, upright 1 and 2 door fridges and bar fridges in 1, 2 and 3 door models and deep fryers for cooking up a feed to cure the appetite. They transport Austrtalia wide and can get your items to you in a safe, quick and reliable way, with their own tailgate loader truck riding on air bag suspension. Or via one of their trustred transport contractors. Family owned and operated, they are a hands-on company, big enough to supply all your needs, small enough to care. Lease, rent, try buy also available. Check them out at Farm World stand GIP35 or on their web page ianboer.com.au or call them on 1300 426 263.

CHIPSTAR AUSTRALIA –

supplier of chippers for domestic and commercial use Another year has gone by and the product range continues to impress with their quality, reliability and innovation. NEGRI Bio-Shredders are made in Italy, carry a 2 year warranty and have genuine Honda motors. The standard of workmanship and quality of material reflect in their reliability, finish and design. CHIPSTAR – See the new Chipstar Vortex 6” drum machine with a large infeed neck and unique chip throwing system.

LINDDANA PTO and ENGINE POWERED machines are made in Denmark. The confidence of the manufacturer reflects in a 3-year warranty. The attention to detail in design and manufacture is second to none. These chippers have been supplied all over Australia, are extremely reliable and get the job done. Please visit our stand, E14+E15, and see for yourself.

Farm World Food & Fibre Fiesta!

F02485

Chippers/Mulchers for domestic and commercial use, both PTO and engine powered.

On Saturday 1st and Sunday 2nd April, the Lardner Park Conference Centre will be converted into a Food & Fibre Fiesta showcasing produce, products and information sessions in inspiring ways. The Food & Fibre Fiesta promises a festive ambience of exhibitor sales, demonstrations and workshops running free-of-charge throughout the weekend. The program of demonstrations and workshops will roll over throughout the day, so visitors can stop and listen as they wish. You can learn the wonder of simple, handmade food with a Pasta Making demonstration, a Bread and Cheese Making demonstration from inspirational entrepreneur, author and advisor, Rebel Black. Then watch as acclaimed Peruvian-born chef, Alejandro Saravia from Pastuso restaurant in Melbourne, inspires the crowd, bringing the strong flavours and variety of Peruvian cuisine to life in his two beef cooking demonstrations on Saturday. And of course, these days a good meal does not exist until it’s shared on social media. We have the very talented Michelle Cann from String + Salt on hand to teach us the

tricks behind taking mouth-watering sharable food images on an iPhone. Health and sustainability are both enduring trends shaping how our agricultural produce interacts with our bodies and our environment. Julie Weatherhead from Peppermint Ridge will hold a demonstration showcasing the flavour and diversity of Australian native foods, and Doterra Essential Oils will illustrate how cooking with essential oils can harness the power of nature to revolutionise the way many families are managing their health. The Food & Fibre Fiesta will be decorated with bountiful produce from the Baw Baw Food Hub, East Gippsland Food Cluster, Tarago Cheese, Ripplebrook Winery (and many more) opening our eyes to the abundance of fresh, organic produce available in our own backyard… and if growing your very own fresh produce is your passion, be sure not to miss the comprehensive Home Composting presentation. With all this inspiration, you’re likely to need a good, strong coffee to get you started – luckily there will also be a barista-led demonstration to help you pick up all the tips on pouring the perfect brew.

*Image for illustration purposes only. Trailer included in prize comes with a cage.

See and hear the roar of the Gulf Western Ute on-site

World at Lardner Park

F07702

*Drawn Sunday, April 2 at 3.30pm

in the BJ Bearings Pavillion


Page 18 Farm World News 2017

WIN this trailer full of great gear

Down on the sunny Mornington Peninsula in Victoria, is a company with a secret. A&A Worm Farm Waste Systems has the key to the Worldâ&#x20AC;&#x2122;s Best Worm Driven Sewage and Organic Waste Conversion System. As we become conscious of the damage we have done to our planet, itâ&#x20AC;&#x2122;s clear that we must adopt practises in our daily living which lessen the impact of our lifestyle on the environment. This can be without any inconvenience and at very little cost to which you attain some big bonuses. All this can be achieved through worms, would you believe? Worms through the good people at A&A Worm Farm Waste System. Hereâ&#x20AC;&#x2122;s how it works, the system is simplicity itself. All that happens is that the contents of the toilet, the water from the shower, bath, dishwasher, clothes washer are piped directly to a colony of active compost worms. The A&A system then constantly introduces fresh air into the worm driven processing tank. This design feature keeps the system aerobic (totally different to a septic tank, which is anaerobic), therefore the system has no smell. The worms then turn the solid matter in the sewage with the flush water, shower, washing machine etc, to vermicast. Vermicast is a solution of suspended solid which is broken down into extremely minute particles. It is black and rich in carbon. This is then discharged into the subsurface soil where it will;

- Naturally fertilise the soil - Naturally water and fertilise your garden - Over-time transforms the top layer of soil into an incredibly rich, dark coloured growing medium. The worms, who have a voracious appetite eating at least half their weight daily, can consume and kill harmful bacteria such as e-coli, salmonella and enteric virus in the sewage, making it safe to use. If you have an A&A Worm Farm Waste system, all your organic wastes, weeds from the garden, scraps from the kitchen etc - the organic waste which your Council collects - go straight into the processing chamber never to be seen again and cost you and the Council nothing. As of December 2015, there are more than 2000 families in Australia with a trouble-free worm-driven sewage system from A&A Worm Farm, all doing their bit to repair our environment and make it safe for our children. The A&A Worm Farm Waste System is the Worldâ&#x20AC;&#x2122;s Best Practice, Fit, Flush and Forget sewage system. Operational cost fitted up to a four bedroom family home is around $20 per year, unless you include a small solar panel, in which case, it costs nothing and is all benefit. Installation is about the same as any other system. To find out more, phone A&A Worm Farm Waste Systems on (03) 5979 1877, or visit them at Farm World. Theyâ&#x20AC;&#x2122;ll look after you!

$4000 OF VALUE

Daily demonstrations by our on-site engineering team, including: - Vibration analysis - Bearing fitment - Laser alignment - Thermal imagery F07701

Celebrating 50 years of Farm

Find us

See us at site 225

%TTVSZIH 87% :MG27;%' 8 50( 2

-VYNL[ZTLSS` ZLW[PJZVY JOLTPJHS [YLH[TLU[Z ,_WLYPLUJL[OL ILULMP[ZVMH UH[\YHSZ`Z[LT \ZPUNL_JP[PUN [LJOUVSVN`

Â&#x2039;(WWYV_ WLYHUU\TLULYN`JVZ[Z;`WPJHS)9K^LSSPUN PUKLWLUKLU[S`HZZLZZLKOPSS`ZP[LZUPSLULYN`

Â&#x2039;5VJHYIVUKPV_PKLVYNYLLUOV\ZLNHZLZWYVK\JLK Â&#x2039;3V^THPU[LUHUJLÂ&#x2039;,_JLSSLU[U\[YPLU[MVY[OLNHYKLU Â&#x2039;(]LYHNL  SLZZNHYIHNL[VSHUKMPSS Â&#x2039;*HUILMP[[LKPU[VL_PZ[PUNZLW[PJ[HURZVY[YLH[TLU[WSHU[Z

Polaris loaded with safety technology

A&A WORM FARM WASTE SYSTEMS PTY LTD

Colby Breeden with the Polaris range at Marriottâ&#x20AC;&#x2122;s MPE in Leongatha.

 National Head OfďŹ ce: Unit 5/2135 Frankston-Flinders Road, Hastings Email: enquiries@wormfarm.com.au Web: www.wormfarm.com.au

SEE US AT FARM WORLD â&#x20AC;&#x2122;17 SITES: 444 - 446 & 518 - 520

Simply make a purchase of $50 from BJ Bearings at Farm World for your chance to win this amazing prize*.

OVER

;OL,U]PYVUTLU[HSS` MYPLUKS`^H`[VWYVJLZZ ZL^HNL^HZ[L^H[LY HUKVYNHUPJ^HZ[L

F07552

A system of excellence to beneficially remove sewerage and organic waste from the environment

MOWERS

â&#x2014;? Ranger â&#x2014;? ATV â&#x2014;? Youth Range

2 & 4 WHEEL

EXTENSIVE RANGE AVAILABLE

Polaris has long been the leader in all-terrain utility vehicles and in 2016 more people have chosen Polaris than any other brand. Leongatha dealer, Marriotts has announced the hard-working range now extends to 23 models with certified RollOver Protection Structures (ROPS) to satisfy OHS concerns. Combined with seat-belts with an interlock device that limits speed when the seat belt is unsecured, plus additional occupant restraints, there is a Polaris for every task and with safety front of mind. With this massive range, Polaris dominated the Side x Side market in 2015 and again in 2016 accounting for around half of all Side x Sides sold. Seating configurations start with the unique single-seat ACE which is rated to carry 261kg and towing capacity 680kg. The ACE provides a compact and narrow footprint, for extraordinary access and manoeuvrability and features ROPS and car like controls. It really is the starting point for Polaris Safety Technologies which underpin the entire Polaris Side x Side range. The Ranger series of Side x Side utility vehicles provides a vast selection of models to satisfy virtually every imaginable requirement with seating from two to six seats,

petrol, diesel and electric, 2 wheel-drive and All-Wheel-Drive plus unlocking rear diffs for turf friendly performance. With innovations such as All-WheelDescent-Control (ADC) Polaris has eliminated some of the criticisms from owners operating in hilly terrain levelled at some other Side x Side brands. Also a leader in the familiar ATV segment, Polaris provides an extensive line-up with Heavy Duty suspension construction on many models with grease nipples to extend the working life of vehicles in the harsher commercial applications such as dairy. Accessory choices are abundant and can be found in the 192 page accessories catalogue or on-line. A truly customisable package with multiple roof, door and windscreen variations means the vehicle can be adapted to suit any work environment and escape from the elements. The US company has now become the largest supplier of Side x Side utility vehicles in Australia, indeed worldwide. Not all models have all features so it is a matter of selecting the model that best satisfies your needs. For full details of specs and features, visit Marriotts at Farm World, sites 444-446 and 518-520 or call into the Leongatha showroom, phone (03) 5662 2028.

All models

Motorcycles, 4 wheelers, trailers, spray equipment, tow behind/outfront slashers

DEFENDER

FULL RANGE OF

OUTLANDER G2 CHASSIS

MOTORCYCLES

Proudly Australian made for Australian conditions

RIDE-ON MOWERS AND SLASHERS

â&#x2014;? â&#x2014;? â&#x2014;? â&#x2014;?

Lawn Mowers Brush Cutters Rotary Hoes Generators

CHECK THE RANGE

PUMPS & GENERATORS PETROL / DIESEL PUMPS

MOTORCYCLES & POWER EQUIPMENT SOUTH GIPPSLAND HIGHWAY, LEONGATHA (OPP KFC) PH: 5662 2028

F01897

MASSIVE SAVINGS

Farm World 2017

CO SE N N RV O TR IC A E CT S

PRICES WAY TOO EXCLUSIVELY AT

Farm World News 2017 Page 51


F09775

Page 52 Farm World News 2017


Farm World News 2017 Page 53

Farm World 2017

What is happening at Oringi?

Under New Ownership Australian Owned Oringi Protection Wear keeps you warm and dry when you need it most.

Oringi Protection Wear keeps the kids dry when on the farm. See their range at Site T17 at Farm World this year. Oringi have jumpers, socks and gloves in an attractive selection of colours for men and women. Quality NZ-made socks are made for Oringi by The Kiwi Sock Co of Norsewood, an iconic name in woollen garments. These, we have been told, are “the best work socks around.” A large range of good work gloves are also available. So if you work outdoors, Oringi have you covered from top to toe. Of further interest is the limited stock of golf and leisure jackets that are waterproof, windproof and warm. These stylish jackets are available in a variety of styles, with something to suit most people, and can be found on the specials page of the website

www.oringi.com.au and will be available at the upcoming field days. The Oringi website illustrates the range of products available. There are concise descriptions of each style, including sizing, pricing and colours. With the options of freephone, email, internet or conventional mail for ordering, an easy, fast purchase and delivery is guaranteed. Drop in to our site at Farm World and say hi and have a firsthand look at our gear and chat to our friendly staff who are more than happy to assist. Farm World Site T17, 30 March to 2 April 2017. Interested? Freephone 1800 674 640, visit website www.oringi.com.au or email us admin@oringi.com.au

M6 0 0 M600 & LOADER

106,900 +GST

$

Come see us at Farmworld Field Day Site T17. 2/17 Hunter Road, Healesville 3777 Ph: 1800 674 640 Email: admin@oringi.com.au F07637

Oringi Protection Wear changed hands mid last year and are now Australian owned - they are dedicated to maintaining the high standard of service and support their customers are used to. For people who work on the land, who are fed up with having to endure heavy, uncomfortable, and restrictive rainwear and workwear. Oringi Protection Wear is a mail order company based in Victoria for approximately 20 years providing garments that are 100 per cent waterproof and windproof, lightweight, strong and machine washable. These garments have been designed by farmers for farmers and they are manufactured for Oringi in Belgium by a company that was established in the 1950s to produce protective clothing for the workers on the North Sea oil rigs. That this company is now a major supplier of industrial clothing in the Northern Hemisphere is an indication of the quality and durability of its products. With an extensive range of waterproofs that include non-split pants and bib overalls, raincoats, vests, aprons, dairy sleeves, dairy smocks and more. Some of the Oringi range has been especially designed for horse riders, farmers – including dairy and general wear. Oringi have a good selection of woollen jumpers in 80 per cent wool 20 per cent nylon mix, in two styles. The jumpers are made in New Zealand to Oringi specifications and offer very good value. Also available is a line of Possum/Merino knitwear.

Website: www.oringi.com.au

5115. 4 G 5115.4G & LOADER

87,900 +GST GST

$

FROM

1.49% P.A.

*CONDITIONS APPLY

T D 0 0 1 F A 62,500 +GST

$

*For more information contact your dealer. Offer valid on all models advertised.

36 Standing Drive, Traralgon East, VI C, 3844 Australia P: 03 5175 6200 | W: www.williamadams.com.au John: 0409 949 582 | Travis: 0428 137 497

510 5. 4 G

5105.4 4G & LO OADER 5105.4G LOADER

80,900 +GST

$

F01899

00 DT & LOADER AF 100


Page 54 Farm World News 2017

Farm World 2017

ALPHABETICAL EXHIBITOR LISTINGS - 2017 EXHIBITOR NAME BRANDS SITE NUMBER A & A Worm Farm Waste Systems225 AAA Kracht Dist - Water Purifiers213A AAA Quality Socks57-59 AAI Limited trading as ApiaBBP20 Accredo Australia Pty LtdBBP30 Adele's Shoe Gallery207 Advanced Machine Tools Pty Ltd316 Advanced Therapy Spas (Aust) P/LBJP42-43 Advantage FeedersA41 Advantec Australasia Pty LtdCB35 AGCO Australia LtdB21-23 + C2-4 AgPower & TransportJ1. Agri-gene P/LA33 Ahern Australia Pty Ltd322 Airtec CorporationCB22 AJ's Eventuate / Rezman Pty Ltd103-106 + C27 Alex Scott & Staff Pty Ltd314 All Buttoned UpBJP32 Allframe SteelF28 Alot of Good StuffEC26 Alpine Trout FarmO/S TICKET BOX C Alternative Growing Solutions P/LF21 Alto Motors1-2 Animals of OzLION DAIRY & DRINKS ANIMAL NURSERY. AnitoneEE18 Anlyn HerefordsA6A Anne of DromanaBJP72-73 Anu ToolsCB53-54 Aqua BladeTM10 ARB Traralgon241-243 Arch & AlexEE27-29 Arcus Rural ProductsE2 Artwerx69 Assumption CollegeBBP13 Atlantic Lubricants P/LCB21 Auspit114 Aus-Sharp18 Aussie Broadband P/LBBP33 Aussie Bush Hats227 Aussie CompostCB77 Aussie Kids at WorkBJP77 Aussie Outdoor MatesN14 Aussie Wool Comfort25 Australian Alpaca Association of Vic Eastern RegionLP1 Australian Belgian Blue Cattle SocietyA8 Australian Dairy BuildersB14 Australian Galloway AssociationA11 Australian Labor Party309 Australian Leather Seal (Belpard Australia)51-52 + N12 Australian Red Poll Cattle Breeders IncA9 Australian Tyre Traders704-705 Ausworkwear & SafetyBJP1-5 Autobarn232 Award RV SuperstoreBBP10-11 B.J Bearings P/LBJ BEARINGS PAVILION BA Group Australia P/LCB79-82 Bale Up HayfeedersA39-40. Bargain BootsCB113A-114 Barracuda Pools P/L4 Basic Invoice Pty LtdBBP7 Basix Trace ElementsPASTURE, GRAIN & VEGETABLE DISPLAY AREA Baw Baw Old Engine & Auto Club Inc. HISTORIC ENGINE DISPLAY - CB Baw Baw Shire CouncilBBP8-9 Bega Cheese LimitedB8 Bendigo Clothing P/LN7-8 Bendigo Hats & HosesN3-5 Berrima EngineeringCB58+CB86 Better Living AustraliaBJP10-12 Big Event Scooter HireOUTSIDE T/BOX B. Bio Natural SolutionsBBP24 Bison EngineeringF26 BJ Stud CattleA5A-5B BKT TyresCB29-30 Blerick Tree Farm38-39 Bling with a Zing50 Blonde 'd' Aquitaine SocietyCB6-7 Blue Gum Forest Nursery34-35 Blue Sky Windows Co Pty Ltd310 Bluewater Campers Pty Ltd212A Bolts & Industrial SuppliesD8-9+E8-9 Brand Developers Live EventsBJP53-54 Brandy Creek EstateEC27 Brown WiggB29-30 + C10-11 Browns Stockfeed Pty LtdA37 Buchanan Park Welsh Black Cattle StudA14-15 Bunnings112-113 Bunyip SaddleryEE1 BupaBBP30A Burder Ag AttachmentsCB11-13+CB15 Burke and Wills119+224 Burra Foods Australia Pty Ltd238 Bushman's Tanks342-344+416-418 Bushwares Sales45 C4 CoffeeBBPF1 Callipari Wine / Ned Kelly RedBJP7 Campbell FloatsEE52-54 Caricatures by ViccasBJP64 Carraro Tractors515 Case IHCB102 Central Steel BuildCB89 Cervus EquipmentCB50 + CB78 CFMOTO Australia346-347 + 420-421 Chairo Christian SchoolBBP31-32 Chemvet Australia Pty LtdA42 Chipstar Australia Pty LtdE14-15 ChooktredTM4-5 Christensens Motorcycles348-351+422-425 Christopher Scott FurnitureBJP55-57 Claas Harvest Centre GippslandCB104-110+CB115-22 Clark Equipment Sales Pty Ltd706-708 Clark TanksCB51-52

Cleanquip235 ClipexB31-34 Club Creek Bulb Farm64 Coffee A-La-Cart247 + EC VERANDAH 1 Combi Clamp Pty LtdB18-19 Commonwealth Bank332-333 Compass Pools Vic Pty Ltd318 Concept & Newlands CaravansT13-14 Concrete Texturing ServicesB17 CongrooveB3 Connelly Home Improvements67 CopriceA32 Corry MarketingBJP24 Corwest Pty LtdBJP75 Country All OverN9 Country Mobile Warehouse36-37 Country Solar Systems Vic216 CozyoskoBJP70 Crafty Animals54 Crump SpreadersCB36 Cushions and DecorBJP27 Custom Creations by Ryan Parsons41 Cutting Edge KnivesBJP14-15 D & D Diesel Services Pty LtdE28-29 Dairing YarnEC17 Dairy Shelters AustraliaB20 Daken ASVCB130-132 Danish BakehouseBBPF14 Darnum Park EstateEC25 Daviesway Pty LtdC31 Dean & McCabe Windmills Pty LtdF29 DeLaval Pty LtdB15-16 Delivery Service (Drouin Sth Primary School)DELIVERY SERVICE-CAR PARK 1 Department of Economic Development, Jobs, Transport and ResourcesBBP17-18 Department of Human Services - CentrelinkBBP3 Diggers Clothing Co210 Dingo Dudes107 Discount Cable TiesCB33-34 Discovery Horse Floats AustraliaEE60 Dorper Sheep Society of Aust. IncF26B Dream-time Wholesale Nursery70-72 Drouin Warragul & Districts Apex Club323 Duckfeet AustraliaBJP58-59 Dumac PumpsA30 Duncan AgCB40-41 + CB68-70 Dutch Poffertjes (Country Fair Poffertjes Pty Ltd)BBPF4 Eastern DistributorsCB124A Edgewood Outdoor Furniture41 EFO EquestrianEE12-13 EGBP Building SurveyorsBJP6 Elektra MagnesiumBJP26 Emmett4HorsesEE26 Emo's Leather Goods21 Enduro Tags Pty LtdC7 EnviroPro Alternatives Pty LtdF30 Eureka Garages & Sheds228-229 European Tools Australia30 Evans Petroleum BPEVANS PETROLEUM BP PAVILION Evison GrainA21-23 Extend Security Pty LtdCB61 EziloaderG12 EzyRollover CrushA47 Falcon UAVD15 Family & Children's Services202 Farm Automation AustraliaA39-40.. Farm Houses of Australia311 Farm Implements Pty LtdC32 Farm Mapping ServicesA38 Farm Tech Machinery Pty LtdCB98 FarmgardD16-17+E16-17 Farming Equipment DistributorsCB49 Federation University AustraliaBBP27 Fence-Line SolutionsF31 Fern Gardens31 Fernleigh AngusA2 Fix EngineeringC26. Fleming BerriesEC19 Flight Centre - WarragulBJP79 Foal AppEE9 Fonterra AustraliaBBP1-2 Formplex212 Fraser Metal FabricationEE3 FujiClean AustraliaE20 Fun WheelsBJP51 Furniture WorldBJP48-49 Gallagher Australia P/L701-703 GE Silos P/LCB60 GEA Farm Technologies Australia Pty LtdB4 Gendore Tractors & Machinery P/L301+ K2 + 6-8 Genetics Australia Co-operative LimitedA28 George Morgan Sawmills540 Gift Girl63 GiltrapCB42-44+CB70-73 GippsDairy312 Gippsland & Southern Limousin Breeders Promotion GroupA16-17 Gippsland Country Life MagazineBJP30 Gippsland HerefordsA19 Gippsland Premium Quarries Pty LtdEE7 Gippsland Regional Australian Pony Stud Book Society Promotional GroupF23-24 Gippsland StrawberriesEC21 Gippsland Tree TrimmerCB55 Gippsland Veterinary HospitalE21 Global AccessC25 GM Holden Ltd452-454+526-528 Go-Getta Kelpie StudLP YARDS Goldstar Trading Pty LtdBJP23 Gordon Harris LeadlightsBJP80 GOTAFE NCDEBBP4 Gourmet GozlemeBBPF7

as at March 9, 2017

Gourmet MorselsBJP47 Graham Wood MachineryC26 Graham's SeedsC24 Grand Ridge BreweryTM6 Grand Ridge Propagation & Cheviot Sheep Stud111 Greenfield Mowers402 + 509 Greg Allan Farm Machinery Pty LtdCB97 Grow Heirloom Seeds65-66 Grow-Fresh Greenhouses & Glasshouses115-116 Guernsey Cattle Soc of Aust Inc (Vic Branch)A34 GW Tractors (Qld) Pty LtdCB125 Halen VansT3 Hand Made & Crafted Products60 Hardwood Mills/Norwood Sawmills AustraliaCB94A-95 Hardy SpicerF5 Harrison F-Trucks231 Hayes ProductsD1 Hayley Marie CandlesBJP76 Haysaver Hay FeedersB13 Heavenly Scented Roses40 Hecton Products Australia LtdE5 Herbal Teas AustraliaEC28 Heritage Draught Horse ClubEE Heritage Water Tanks307 Hi Water Concrete Tanks47 Highland Ponies AustraliaBV1-2 Hilltop HorsewearEE55 Homestar Promotions P/L53 + GIP38 Hong Kong InnBBPF5 Hornby & Sons Sawmills109 HorseFloats at MorningtonEE63-64 Horse-In-The-BoxEE41-42 HorselandEE24-25 Horserail AustraliaEE62 Horseware AustraliaEE43-45 Horsley WholesaleD5 Hose FactoryF13-14 Hy Gain Feeds Pty LtdEE6 Ian Boer RefrigerationBJP35 Ideal Tools544 iHealth SaunasBJP45-46 IndoorsOutdoors Blinds & ShadesBBP5-6 Inlon Agrimec GroupB37-38 + C18-19 Innordic AustraliaEE35-36 Inverloch Marine348-351+422-425. InvirgoD2 Isuzu UTE Australia256-257+326-327 J & M Brain Safety WearE4 Jacuzzi Pakenham215+217 Jeffs Shed Pty LtdT5-5A Jetmaster Victoria Pty Ltd208 Jindi Farm Bush FoodsF8 JMR Enterprise's13 John Berends Implements P/LC28 John Deere DealersCB96 John Duff & Co Pty Ltd431+506 JSL/ Discount Mower SalesD10-11+E10-11 Kactus Point CharolaisCB4-5 Kanga Loaders GlobalC14 Karcher Pty LtdA1 KC Bill's BBQF10 Keenan P/LB36+C17 Kiel Industries23 Kooyong Furniture48-49 Kubota Tractors Australia Pty LtdC1 Kuhn Farm MachineryCB133-136 Kustom Kegs Wine Barrel FurnitureN10 Kymco448-449+522-523 Ladelle24 Latrobe Valley Forklifts440 Laucke MillsCB62 Lauren Murphy PhotographyBJP22 Leadoux TurkeysBBPF6 LED Light CoN6 Leeks Workwear12 Leicht's Country Industries Australia (CIA)C15-16 Lely Australia Pty LtdCB101 Leonie's Photographic Images62 Letzgetwired55 LGPM Process InnovationCB32 Liberal Party - Victorian Division240 Lightwave TechnologyCB45+CB73 Lion Dairy & DrinksLION DAIRY & DRINKS ANIMAL NURSERY Lions Club of WarragulLIONS CATERING AREA-o/s BBP Littl JueyBJP36 Livestock Improvement P/LA29 Lizard Moleskin Jeans27 Logan ContractingCB27-28 Lollie-Lovers245 Lorna Doone Charolais StudA18 Lucas Mill Pty.Ltd.545-546 Magnum IndustriesEE62. Magnum WeldersE25 MalAndy Outdoor Adventure Pty LtdG14-15 Mansfield Tools214 Marriotts Motorcycles & Power Equipment Pty Ltd444-446+518-520 McCarthy CateringCB56-57+CB84-85 McKEECO General Engineering Pty Ltd524 Mega Cheap Hardware42-44 MegahireCB37-39 Melbourne Camper Trailer CentreT15-16 Melbourne Water244 Melbourne's Mower CentreE32-33 + F15-16 + F27 Metal Corp SteelCB17-18 Metal Form Group328-329 MG TradingA25-26 + B1-2 Middy's Data & ElectricalBJP33 Miles Honda Motorcycles & Power Equipment548-550+609-610 Miley's Tackroom SuppliesEE37-38 Miris ProductsEC32 MitaviteEE16-17

Mobius Materials RecoveryE22 MStar Desserts (Aus) ColomboBBPF13 Mt Baw Baw ScoutsO/S BBP SOUTH Muck Runner Pty LtdCB111-112+CB122 MultiCube StockfeedsEE46 Munro Engineers Pty LtdC22-23 Murray Grey Group BreedersA7 National Hearing CareH&W2 Navy Community Engagement HMAQS CerberusBJP13 NBF - Nuts bout Fruit108 Neale Goad Automotive (Ballarat Mahindra)CB23-CB24 Nelson SilosA10 New Age Caravans GippslandT1-2 Niagara TherapyBJP67-69 Northern Feed SystemsA39-40 Norton Gates Pty LtdCB99-100 Now BuildingsE3 Nucerity InternationalBJP52 NutriSoil Liquid FertiliserCB90 O.P.S. Country TanksE34-35 + F17-18 Oak & Swan SourdoughEC20 Olympia GoldBJP65 Omya Australia Pty LtdF22 Onesteel Recycling345 Oringi Pty LtdT17 Outback Campers258-259 Outdoor Enterprises Pty LtdD12 Ozpig Australia Pty LtdN15 Paal Kit Homes118 Pachinko Hats60 Page Bros RVT10-12 Pakenham Isuzu UTE Gippsland Isuzu UTEEE Pakenham Produce & SaddleryCB1-3 + EE8 Pakenham Western Wear and SaddleryEE49 Pam's PoniesEE57-59 Parmalat - LongwarryBBP34 + BBP36 Perry's Lemon Myrtle68 Peter Stevens MotorcyclesG9-11 PFG AustraliaK1 Pioneer Water Tanks & LinersCB83 Pitstop Men's Health ChecksH&W1 Plastek Poly Products252-253 Polaris442-443 + 516-517 Polishpro (Marine Parade Pty Ltd)A48 PolymasterCB63-64+CB91-92 Portable PowerN11 Porta-Grazer AustEE14 Pottinger Australia Pty Ltd426-429 + 501-504 Power Hound AustraliaC20-21 Prodesign Engineering230 Professional Nibbler248-249 Progressive ControlsE24 Propharma Australia P/LDAIRY 1-2 Quik Corp (Aust) P/LCB59 + CB87 R.P.S IndustriesEE65 Rabobank239 Raedean RedsA3-4 Rat Zapper Victoria46 Rawleighs HealthcareBJP74 Rayner's OrchardF26A RB Sellars250-251+320-321 Recharge Battery AdditiveN10A Red Gum Farm Rustic Furniture223 Red River StockyardsB24-27 Redfox MachineryE12 Rhino Water TanksCB75 Rhinolinings Gippsland419 Ride On Mower Sales802-803 Ridley Agriproducts P/LA27 Rigdale Limousin StudA6 Ripplebrook WineryEC31 Robinvale Estate211 Robson ToolKing534-535 Rocktape AustraliaEE39-40 Ropes PlusF6-7 Roylaines Photo & Electronics315 RPM Australia - Pacific Pty LtdC8-9 Rural FinanceE1 Rural Product MarketingD6-7+E6-7 Safer Quads411 Safety Steel Structures17 Salami Shack209 Saving You Solar213 ScentsyBJP28 Schinckel HayrakesCB46-47 + CB74 Scotch College, MelbourneBBP14 Select Coatings Pty LtdE23 Semex Pty LtdA43 Seymour Rural EquipmentCB76 ShedfastCB31 Sheds N HomesBBP40 Shipsey's Nurseries32 Silvan AustraliaJ1 Simmental Beef CattleA12 Simonds HomesBBP39 Skin DetoxBJP66 Slushies, Slurpies & More413 Small Horse Tractors AustC5-6 SmartSteel DesignsBJP71 Snooze Fountain GateBJP60-62+BJP81-83 SnugglebunBJP41 Soil Management SystemsF4 Solahart Gippsland10A Solar Dynamics412 Solartronics Gate ControllersCB113 Sonaray AustraliaBBP22 Sonshine Toy LibraryO/S BB PAV.. Sota Tractors804-805 South Devon Cattle SocietyA13 South East Organic Fertilizer514 Southern Rural WaterBBP19 Southern Skin Cancer ClinicBJP16-17 SpikaE26-27 Spitwater Victoria308 Sproutwell Greenhouses28 + 29 Squatter - Australia's Classic Farming GameBJP63 Squid Inc Pty LtdBBPF3 St Fiacres FarmEC29

St Paul's Anglican Grammar SchoolBBP25-26 Stainless Steel Tanks Pty LtdB5 Steel Enterprises InternationalTM8 Steeline Gippsland Pty Ltd120+226 Step Forward OrthoticsBJP44 Stephen Pasture Seeds P/LE18-19+F1-2 Sticky Stuckey's HoneyBJP21 String + Salt317 Sumitomo TyresCB88 Swagman Tours Pty LtdN1-2 Sweet BetsyF9 Tandderwen Nursery15 TankformersCB25-26 Tarago River CheeseEC30 Taylex IndustriesBJP34 Telstra - Gippsland201-202 The Australian Wool StoreBJP78 The Bunyip Beekeeper/Bee Bubbles253A The Cajun KitchenBBPF2 The Chef's ToolboxBJP31 The Dancing HorseEE69 The Fire Pit GalleryN13 The Greek Wrap CompanyBBPF8-9 The Jolly Lolly Trolley11 The NationalsBBP15 The Tractor CompanyCB65-67 The Ultimate Hayfeeder430+505 The Weekly Times233-234 Think Livestock P/LDAIRY 3-4 Timboon Fine Ice CreamBBPF11 Timeless Toys61 TiscaCB48 Top Glaze Roofing Systems Pty LtdBBP16 Total Livestock GeneticsA35 Total StockfeedsDAIRY 6 Totalspan Sheds WarragulLION DAIRY & DRINKS ANIMAL NURSERY Tow and Farm (Metalform Dannevirke) Ltd3 Toyota Material Handling441 Trac Mac Farm Equipment P/LCB126-129 TractorHouse AustraliaD14 Traditional Baked Potatoe CoBBPF10 Traf Tractor & MachineryCB103 Tri NatureBJP8 TriTech Lubricants AustralasiaD3-4 Turbo Reel IrrigationLAKE SITE 1 Turbosawmill Australia546A Twins PantryBJP9 Tyntynder Stockfeeds P/LCB19-20 Uncle John's Fresh LicoriceBJP37 United Forklift and Access SolutionsF11-12 Valley Horse WearEE31-32 Valley Pumps & Irrigation Systems331 Valley View Nursery Garden & Farm110 Valton Feeding SolutionsB9-11 VaterhardwareE30-31 VC TradersC29-30 Vehicle & Equipment Finance Pty LtdCB123-124 Venus PackagingE13 Vic Engineering & Silos P/LA49 Victorian Workcover AuthorityBBP28-29 Viking Genetics Australia Pty LtdDAIRY 5 Vin Rowe Farm Machinery P/L302-304 Vision AustraliaH&W3 Vision-Mart22 W.B. CateringLP2 Walterscheid Australia P/LBBP12 WAM AustraliaD13 Warragul & District Kennel & Obedience Club Inc.WORKING SHEEP DOG TRIAL AREA Warragul Dental CareH&W4 Warragul Forest & Garden447+521 Warragul Marine CentreG7-8 Warragul Nissan & Warragul MitsubishiT6-9 Warragul Renault340-341+414-415 Warragul Solar & Gas236-237 Warragul Toyota254-255 + 324-325 Waste-Not StockfeedersB35 Waterford Rise (Baw Baw Developments P/L)BBP35 Weedwakka218-219 West Gippsland Healthcare GroupO/S TICKET BOX B Western Valley Dairy SystemsA45-46 Westpac Banking CorporationBBP23 WFI Insurance LtdBBP37 Whites Group Pty LtdB28 Whitlands Engineering542 WHM TractorsCB93-94 Whoa Steady NeddyEE10 Wide Angle Security and Technology204 Wild Rider Clothing121 William Adams P/LC33 Wimmera Hearing Society IncH&W5 Windsor Park Country FlavourBJP29 Wolf - Telstra PartnerBBP21+10C Wonthaggi Motorcycles536-539 Wood Wizz Machinery Pty Ltd543 WoodshieldEE74 Worm Smart16 Yaraandoo Park Concepts20 Yarragon Lions ClubG15 Yarragon Rural SuppliesEE15 Yesteryear Plantations Eucalyptus & Tea Tree Oils10 yourscarfs.comBJP25 YTO TractorsC12-13 Zoetis Australia Pty LtdF3


Farm World News 2017 Page 55

Farm World 2017

Strategic Partners

Welcome

YGate 4

Lake Street

CB104 - 11North South Street 4 CB115 - 12 5

CB126 - 1 36

eet

CB96 103

CB19 - 2 8

a

CB40 - 45 CB68 - 73

und

A45 - 49

A1 - 23 Road

lb Sales

Public Car Park

Daffodil Bu

701 - 708

C20 - 25

Ticket Box C

Ticket Box B

king

B1 - 20 A25 - 43

Y

ire

Avenue B

Burnt Store

North South Str

Commonweal CB46 - 5 th Bank Street 5 CB74 - 8 3

Avenue G

G9 - 15 Rot

C26 - 33

C1 - 19 B21 - 38

Avenue A

EQUESTRIAN EXPO EXHIBITORS & COMPETITORS ENTR Y ONLY DURING EVENT. FARM WORLD EXHI BITORS - NO ENTR Y AFTER EVENT COMMENCEMENT UNTIL 4.15PM SUND AY

G3 - 8

T10 - 17

T1 - 4

Timber Street

T5A - 9

Sixth Street

536 - 550

535 529 - 53

Æ

LP yards

Y

Disabled Car Par

Equestr ian & Com Expo Exhibit petito or Committee r Entrance Carpark To Drouin

Third Street

Avenue J

301 - 302

1-4

E1 - 17 D1 - 17

Avenue D

Delivery Service Office & Collection Depot

F29-31

E18 - 35

Avenue C

Street

J1

Avenue K

Lakeside & Alpaca Pavilion

Scooter H

i

Avenue L

Second

First Street

New Street

6 - 8

K1 - 2

xxxx Avenue E

Lake Site 1

F26 - 28

Eighth Street

Æ

Æ F1 - 18

yx Walkw xay

TM2

Æ

pan

F21 - 25

Avenue F

xx x x

x

Street

Totals

Æ

Y

CB1 - 7

Animal Nursery & Picnic Area

06 506 44311 - 50 x

Rotunda

Seventh Street

x

Rotunda

803 - 805

y ay wx kx kw alk Walkway W x

Walkway

Gate

Fifth Street

Fourth Street

31 315 - 318

Æ

Lardner Park Exhibition Centre

Y

Y

Ticket Box A

CFA

Baw Baw Baw Baw ilion 10a Pav Pavilion

245-246 24

208 - 219

Æ

10A + TM1-10c

10 - 17 Safety Ste

42 - 55

Optus Tower

402

CB11 - 18

1-6

rooms

el Shed

Cool

eet

Pasture, Grain & Vegetable Display Area

Ticket Box D

Loading Ramp

Str

Dairy sites

Pumps

207 - 217

et

Walkway

238 - 244 308 - 314

po

Gate

303 - 307

storage shed

233 - 237

rian Ex

202 - 204

Equest

Pavilion Stre

Judges

201 - 203 03 3

Farm W orld

First Street

-8

Pavilion

New Street

18 - 25

Ho Mar spital qu ity ee

Sites EE1

xx

Event Management

Evans BP Street eeftpos ATM

x

ÆcluPonyb

Pitstop & Health & Wellbeing Area

&

Æ

eG

nu

507 - 509

Ramp & Stairs

a

Stepped Walkway

e Av

Fifth Street F

27 - 32

Walkway

Viewing are

s

Gate

Æ

501 - 505

Arena

x

Competiti on

na

57 - 72

Cool Crusa da

Æ

426 - 430

Main Are

Viewing area

ISUZU UTE

Viewing area

Sites

EE9 46

66m (3m x 3m sites x 22 each side)

Arena

Mastercla 2 sses

103 - 107

15m between arenas

121 + 227

109 - 111

10m

Avenue N

440 - 454 514 - 528

Walkway

reeet Street Fourthh Stre

50-51

Æ

Public Car Park

DISP LAY

N11- 15

East West Street

411 - 413

49

340 - 351 414 - 425

49

EE

3 331

s

te

Si

Office Offi ce

Warm-up area

4

-7

320 - 323

52

69

Y

N1 - 10A

Pavilion

65

Second Street

53

Gate

po

228 - 232

rian Ex

34

sses

64

Equest

55

54

223 - 226

Arena 3 Mastercla

118 - 120

Farm W orld

Gate

324 - 329 Third Street

s

56

254 - 259

Ride

74

62

63

Y

57-58

Second Street 248-249 250 - 253a

Pon y

59

-4 1

for viewi Seating

E

BV5 BV6

112 - 116

a

Dr

VILLAG

BV3 BV4

+ e es g rs illa V Ho 60 ht reed g u B

104 - 108

ng

BV1 BV2

New Street

Heritage Draught Horse Club Demonst ration Area

First Street

BREED

4WD Demonstration Area

CB29 - 3 9

FARM WORLD MAJOR SPONSORS

Working Sheep Dog Trial Area

Course builder

Comonwealth Ba nk Street CB56 67 CB84 - 9 5

FARM WORLD EQUESTRIAN EXPO MAJOR SPONSORS

HIST ORIC FAR MM ACH INER Y

Gate 3

Gate 2

EXHIBITOR ENTRY FROM 7.00AM TO 9.00AM DURING THE EVENT GFD/Maps/Farm World/2017/Program and features site map at 19 Feb 2017 E & OE

No dogs allowed

Stockfeed supplier of bulk and wholegrain fodder Hay available at Field Days for sale: Vetch, oaten hay, lucerne hay plus much more all available 8x4x3ft - See bales on site.

● Competitive prices - direct from farm to farm (no middle man) ● Semi loads delivered

Your local stockfeed store since 1975. Supplying hay, whole grains and custom mixes for all your stockfeed needs.

Phone 5625 3625. 18 Weerong Rd, Drouin

F07337

Visit us at Sites A21 and A23

Representatives on site at Farm World from Thunderbird Fencing, Otway Boots and many more


Page 56 Farm World News 2017

Farm World 2017

Leading European technology on show

The Claas Disco Mower will be available for viewing at Farm World.

The Claas high performance Variant round baler.

SEE US AT FARM WORLD

Slurry Tankers 5000 l - 30,000 l plus dribble bars, tine or disc injectors

MANURE SPREADERS: 6m3 - 24m3

NEW low level spreaders with longer tub. Lower centre of gravity - great for the Gippsland hills

MIXER WAGONS 6m3 - 45m3 capacity single, double, triple auger

LARGE VOLUME WIDE BODY SPREADERS

The latest offerings from some of Europeâ&#x20AC;&#x2122;s leading farm machinery manufacturers, including CLAAS and AMAZONE, will be on show at the CLAAS Harvest Centre display at Farm World Field Days. Hosted by the CLAAS Harvest Centre dealerships in Warragul and Leongatha, the display will feature the complete range of AXION, ARION and AXOS advanced technology tractors and SCORPION telehandlers from CLAAS. CLAAS Harvest Centre, South Gippsland Dealer Principal, Anthony Blackshaw, says the iconic German manufacturer now markets more than 30 different models from 75 to 524 hp. â&#x20AC;&#x153;Each model features the same exacting levels of performance, efficiency, versatility, reliability and comfort that have made CLAAS the best in the business,â&#x20AC;? he says. A comprehensive line-up of CLAAS green harvesting equipment, including frontmounted, rear-mounted and trailed DISCO mowers; single, dual or four-rotor LINER rakes and high performance VARIANT round balers, will also be on display. The revamped DISCO series of mowers and mower-conditioners now boasts 28 new models with operating widths from 2.6 to 10.7 m. All models incorporate the new CLAAS MAX CUT cutterbar, whose innovative onepiece, wave-shaped design offers optimal cutting quality, efficiency and durability under all conditions. The CLAAS Harvest Centre site will also feature the latest spreading technology from AMAZONE, including the award-winning AMAZONE ZA-TS and the new ZA-V series. CLAAS Harvest Centre, Gippsland Branch Manager, Luke Sibson, says the ZA-TS establishes new industry benchmarks for precision, efficiency and operational ease.

â&#x20AC;&#x153;Every component has been designed to ensure fast, even and precise spreading over wide areas,â&#x20AC;? Luke says. â&#x20AC;&#x153;Productivity aside, improved accuracy has an important role to play in quality assurance, environment sustainability and risk management.â&#x20AC;? The latest models incorporate integrated weigh-cell and tilt sensor technology, electronically-controlled hydraulics, GPS automated part-width section control and headland systems and easy-to-use ISOBUS-compatible terminals. â&#x20AC;&#x153;Theyâ&#x20AC;&#x2122;re incredibly easy to operate â&#x20AC;&#x201C; you simply enter the desired spreading rate and drive off,â&#x20AC;? Luke says. â&#x20AC;&#x153;The two weighing cells detect any deviation between the desired application rate and the amount being discharged. â&#x20AC;&#x153;In addition, the on-board tilt sensor measures any deviation in the centre of gravity, both front to back and left to right. â&#x20AC;&#x153;The processor then automatically adjusts the electric metering shutter slides to ensure an even spreading pattern.â&#x20AC;? The new ZA-V linkage-mounted spreaders, available in a range of hopper sizes from 1700 litres to 4200 L, deliver the same precision and innovation, but in a more â&#x20AC;&#x2DC;everydayâ&#x20AC;&#x2122; size. All AMAZONE spreaders feature AMAZONEâ&#x20AC;&#x2122;s proven â&#x20AC;&#x2DC;soft ballistic proâ&#x20AC;&#x2122; technology, which ensures all components of the agitation, metering and spreading system are optimally matched to protect the integrity of the fertiliser granules. A range of other AMAZONE equipment, including front and rear linkage-mounted and trailed sprayers, cultivation equipment and integrated power harrows and drill combinations, will also be on display.

The Claas Harvest Centre site will feature the award-winning AMAZONE ZA-TS Spreader.

For all your industrial cleaning solutions

Cleanquip are offering a Farm World special on all Gerni Neptune 75. Cleanquip have over 25 years of experience in industrial cleaning equipment. They have passionate staff who are experts in creating industrial cleaning solutions for all your purposes. Head down to see the friendly team at the Cleanquip site at Farmworld, located at site number 235. Cleanquip are offering a Field Day special and cashback offer. Purchase a Gerni Neptune 7 to receive up to $1000 cash back. Plus, Cleanquip are giving one ticket for each $100 spent at their site over the 4 days at Farm World. Your ticket will go in to the dram to win a GoKart & Gerni Classic 100.3 valued at $1000. Need expert advice, go and meet the friendly team or contact Brett Meredith 0458 047 601 or 1300 232 456, email b.meredith@cleanquip.com.au

CLEANQUIP FIELD DAY SPECIAL Up to $1,000 Cashback + WIN a GOKART and GERNI CLASSIC 100.3

21m3 - 34m3 plus optional silage kit for extra versatility.

!-,'+& * "#,*)!-&%+!"+&) "+&)  *'%+.!+ #%(,!'+&%+)+  ).+&.!% ). +&.!% +& &)+)%!#**! -#,+ +

NEW COMPOST TURNER:

'/&,',"$&)-#(+#,,*%/'*$#$1 *%/'*$#$1 *'% % *" ,",'(*#$&$',,+#,&-%*  ,,+#,&-%*

QUALITY MIXING, COMPOSTING AND SPREADING MACHINERY

Tom 0419 851 543 F02303

www.muckrunner.com.au muckrunnerptyltd@hotmail.com

/')+-!##+ )!%# )!%#0+$+#%(,!'&% 0+$+ +#%(,!'&%    &)-!*!+,*+)$.&)#!#0 *+)$.&)#!#0

)++)!+    '*  

'*   

%*#,"$&)-#('%#('% *%+&'&#,#'&+(($1  *.#$$ *'% *" ,' -&1(*#$ '*,*&#$++#.$-, '*,*&#$++#.$-, *,  *&# $++#  .$F07941

Tractor push (use the tractor out of gear in neutral) self-propelled compost turners. Total mixing and efficient aeration of windrows.

$&)-#(".'.* 1*+' ' 0(*#&#&#&-+,*#$$ 0(*#&#&#&-+,*#$$&# #$$&#&! )-#(%&,/#,"(++#'&,('($/"'*0(*,+#&* '&,('($/"'*0(* ( *,+#&*,#&! LQGXVWULDOFOHDQLQJVROXWLRQVÂżWIRU\RXUSXUSRVH ÂżWIRU\RXUSXUSRVH


Farm World News 2017 Page 57

Warragul Renault

Renault KANGOO from $ * drive 21,990 away

Renault TRAFIC from $ * drive 34,490 away

Renault MASTER from $ * drive 43,990 away

To support the members of our local community, we want purchase at the field days.ˆ Visit us at site 340-341 and 414-415 to see the Renault range.

ˆOffer in conjunction with current drive away offers across the Renault Kangoo, Trafic and Master range. Vehicles must be ordered by April 30, 2017. *Reccommended drive away prive for non-metallic Kangoo SWB 1.6L Petrol, Trafic L1H1 SWB 1.6L Diesel and Master L1H1 SWB 2.3L Diesel. Offer exludes fleet and government buyers.

F07718

Warragul Renault 167 Queen Street, Warragul / ph: (03) 5622 0000 www.warragulrenault.com.au


Page 58 Farm World News 2017

Farm World 2017

Grow-Fresh Greenhouses their range of products, maintaining a wide selection to suit all requirements and budgets whilst

SOUTHEAST

ORGANIC FERTILIZERS

FOWL MANURE A viable and effective fertilizer for pasture and crops with naturally occurring immediate and slow release nutrients, including N.P.K. plus calcium, trace elements and significant organic carbon to aid microbe growth and soil structure. FOR FURTHER DETAILS REGARDING ANALYSIS, SPREADING RATES & QUOTATIONS

Grow-Fresh Greenhouses offer a wide range of domestic/semi commercial greenhouses and glasshouses. tastic specials for their customers to take advantage of. They currently have sizes available from 2m up to 14m in length and

beyond. Colour options include silver, green and black. With their large selection, there is a greenhouse to suit every garden. Call

them on 1300 464 769, visit their website for more information or call into Farm World and see them at Site 115-116.

Pump out waste with Dumac

PLEASE VISIT STAND NO 514 OR CONTACT

595 283 OR 5996 1172. F07700

CRAIG ON 0418

“The Natural Alternative in Fer tilizers”

ensuring quality is matched with value-formoney. Special emphasis is put into the engineering of their designs, ensuring they will withstand anything the Australian climate throws at them. While the Dorset range is the perfect residential greenhouse, their Stately and Windsor ranges are designed for acreage and high wind areas. They don’t use any click systems and shortcuts (which will often fail in adverse weather), it’s true nuts and bolts construction only for their ranges. 2017 is shaping up as a big year with the upcoming launch of some new designs. Grow-Fresh Greenhouses are thrilled to be exhibiting at Farm World for the 4th year in a row. They have a great display of greenhouses planned and some fan-

Dumac Distributors P/L a 100% Australian owned and operated company, manufacturing and selling our own brand of waste disposal pumps since 1963. We manufacture with a maximum of Australian made materials. The first model was the “Filter-Cut” pump which is still manufactured and has been updated over the years but with the important key features retained in today’s model. Originally, it was a hori-

zontal unit with the body cast into the pit wall and the motor mounted above the pit, which had problems. These were overcome by our first vertical column waste pump, the first in Australia and possibly the world for this application. The “Filter-Cut” pump worked well, but like all other pumps it was subject to excessive wear. A decision was made to go in a different direction with the wet end, it would not have the cutting action and agitation of the “Filter-Cut” but be tough enough to handle abrasive and large solids. The “Ruffy” pump model was released September 1974 with great success and did so well it still retains the main features of the original and has only had 2 modifications in that time and they were both done within the first year after its release. The “Filter-Cut” pump comes in 2 outlet sizes, 11/2” and 2” BSP and in column lengths to suit pit depths from 2’6” (760mm) to 12’ (4.57m) all have an external agitator blade that is attached to a 75mm extended impeller nut which are both made from case hardened steel. This, together with replaceable hardened steel tips, fitted to the faces of the impellor vanes and a

hardened steel perforated plate with a clearance of approximately .020”, combine to agitate and cut up solids; it is a true cutting action not just bashing. The 11/2” model can have motors from 2Hp – 7.5Hp (1.5kW - 5.5kW) with a maximum of 28m shut off head or 680l/min open discharge. The 2” model can have motors from 5.5Hp – 25Hp (4kW – 18.5kW) with a maximum of 73m shut off head or 1450l/min open discharge. The “Ruffy” pump at present has a 2” BSP outlet with column lengths to suit pit depths from 2’6” (760mm) to 6’ (1.83m), it has a large open steel impellor with a heavy walled cast iron casing. Suction is unique, in that it is from above the casing and when in operation there is negative pressure in the column and therefore does not require any seals. Standard operation for the “Ruffy” is direct coupled with a 3Hp (2.2kW) 1440 rpm motor, depending on the distance or liquid being pumped may need a 4Hp (3kW) motor, where higher output is required it can be belt driven with a 5.5Hp – 7.5Hp (4kW – 5.5kW) motor, also becoming popular is in 3phase operation, it is direct coupled with the larger Hp and a variable speed drive.

The output is from 24m – 35m shut off head or from 980l/min – 1200/min open discharge. The “Filter – Cut” range of pumps are most suitable where there are softer solids in suspension, heavy sediment or high heads. The most common applications are in Piggeries, Abattoirs, Wineries and food processing plants or similar operations. The “Ruffy” range of pumps are most suitable where there are hard or abrasive solids or very high volumes over shorter distances with low power requirements and minimal maintenance. The most common applications are in Dairies, Abattoirs, Wineries and in recent years some mining applications. None of the pumps will pump plastic bags or bailing twine, but at the same time under normal circumstances they will not damage the pumps and both the “Filter – Cut” and “Ruffy” pumps can be run dry without damage. Dumac Pumps are also agents for the Teco range of electric motors and variable speed drives and the Ebara range of pumps which have everything from domestic systems, borehole, submersibles and mining pumps.

WASTE DISPOSAL Dumac Pumps are 100% owned and manufactured in Australia

“RUFFY” Column lengths 0.76 - 1.83m

“FILTER-CUT” Column lengths 0.76 - 3.66m

Electric Motors

DUMAC DISTRIBUTORS P/L Ph: 9761 5115 Fax: 9761 5114

(ABN 24 004 450 300) F6/13 Gatwick Rd, Bayswater North. (PO Box 262, Bayswater, Vic 3153)

SEE US AT SITE A30

F07591

domestic/semi commercial greenhouses and glasshouses. At Grow-Fresh they are very selective with

F02428

Grow-Fresh Greenhouses is a fast growing Australianowned family business offering a wide range of


Farm World News 2017 Page 59

Farm World 2017

Combi Clamp Sheep Handler The Sheep Handler that Farmers Rave about s.OPOWERs.OAIR s.O"REAKDOWNS s(ANDSFREEOPERATION s'OOD&LOW s#OMPLETE#ONTROLs0ORTABLE s7EIGH DAG DRAFT FEET VACCINATE nALLINONEPASS s4HEMOSTVERSATILE COSTEFFECTIVEAND RELIABLE3HEEP(ANDLERONTHEMARKET THATREALLYWORKS

Also available in fully road legal Trailer Unit.

Aussie Broadbandâ&#x20AC;&#x2122;s newest initiative is to expand its network to provide services over the nbn network to all areas of Australia.

We even built our own private wireless network that covers many regional areas â&#x20AC;&#x201C; and now weâ&#x20AC;&#x2122;re doing the same for our nbnâ&#x201E;¢ network across Australia. In this time of cost cutting and shifting telco support services offshore, weâ&#x20AC;&#x2122;ve invested in local jobs and services, because thatâ&#x20AC;&#x2122;s what Australia needs. Our main call centre and head of office is based in Morwell, currently supporting over 80 local jobs. Aussie Broadbandâ&#x20AC;&#x2122;s newest initiative is to expand its network to provide services over the nbn network to all areas of Australia. With a local company expanding like this we see great things on the horizon.

The Cattle do all the work.

 (- 

Heavy Duty Cattle Crush incorporating the â&#x20AC;&#x2DC;Magicâ&#x20AC;&#x2122; Head bail s3ELF CATCHINGWITHAUTORESET s3URECATCHnNEVERMISS s%ASILYADJUSTABLEWIDTH P s%FlCIENTONE PERSONOPERATION s4HREE WAYDRAFT s(OTDIPPEDGALVANIZED s"UILTTOLAST

Visit us at Site B18/19

Free phone 1800 449 561 Wayne 0488 619 747

www.combiclamp.com.au View the videos on our website

F07684

Unlike the major Australian carriers, weâ&#x20AC;&#x2122;re a smaller, privately owned provider where youâ&#x20AC;&#x2122;re the one who matters most. We donâ&#x20AC;&#x2122;t try to offer every telco service imaginable, but the ones we do offer, we do really, really well. You can get the latest in communications technology for your home, business or corporate / government needs from our friendly and knowledgeable staff, with personalised attention to make sure itâ&#x20AC;&#x2122;s right. Australia has some beautiful areas but in this time of fast internet, theyâ&#x20AC;&#x2122;re usually â&#x20AC;&#x2DC;black spotsâ&#x20AC;&#x2122; when it comes to getting good internet. Aussie Broadband was founded to solve this problem â&#x20AC;&#x201C; by going above and beyond what the big carriers are offering.

Cattle Handling Equipment

F07346

Aussie Broadband is a different sort of telco


Page 60 Farm World News 2017

Farm World 2017

Ground Level Loading Trailers

The revolutionary trailer with easy loading.

Eziloader

Ground level loading trailers

Eziloader The Revolutionary Trailer with Easy Loading – at Ground Level s Motor Bikes – Recovery - delivery. Room for four or more. s Hire Equipment. Ride On Mowers. Mini Diggers. Generators. s Palletized goods (2 pallets plus hand pallet truck). s White Goods – Double fridges, Stoves – no problem. s Farming. Animals. 1000 Ltr Tanks. Roll on hay bales. s Household Goods. Pianos. Wardrobes. Dining Tables. s Gardening. Large Trees. Pavers on pallets. Statues. s Demonstration Equipment – especially low profile & heavy.

Ron Mileham Tel: (03) 9720 0425 F02258

Come and visit us at Site G12

$111,999

less power, less fuel, faster pickup

GIGA VITESSE CFS

HIGH PERFORMANCE LOADER WAGON

- 32m3 DIN - 1.8m pickup - Auto floor control

- 2.0m pickup - Strongest chopping rotor on the market - High strength floor scraper with steel floor - Heavy duty rear door Patented Accelerator Rotor for: reduced power requirements • improved fuel efficiency more even loading into wagon • faster forage flow

1.99

%

FORWARD ORDER FOR SPRING

The Strautmann Continuous Flow System (CFS) gives increased forage flow through the pickup and chopping rotor with less power requirements. *Terms and Conditions: Promotion ends 20th February 2016 or whilst stocks last. Finance available to approved applicants only. 1.99% finance rate requires maximum 24 month term with minimum 30% deposit. GST repaid month 4. ABN holders only. Finance by Newcastle Commercial Finance Pty Ltd T/AS Inlon Finance ABN 96 109 035 074 Australian Credit Licence 387241. Fees, charges, terms & conditions apply.

F02304

1.99% finance on ex-stock units

TRAILER

GREAT VALUE

MANURE

FEED OUT

SUPER VITESSE 3401 DO

All construction conforms to or exceeds all applicable standards. What makes Eziloader unique? 1. The lowering to floor level for ease and safety of loading and unloading. 2. The raising and locking of the deck to the chassis, using sensors as a safety check. 3. The amazing ‘jump stump’ tandem wheels, independent suspension. 4. Special phasing hydraulic cylinders and heavy duty industrial power pack. What’s standard on the Eziloader? * 6 x removable eyebolts at lower deck level, with upper tie rails on front and sides. * Aluminium chequer plate floor and sides and external cladding. * Red and silver distinctive finish with Eziloader signage. * Key lockable front console housin hydraulics, electrics and spare wheel. * Trailer wind down fifth wheel for ease of vehicle connection to tow ball. * Brakes to each rear wheel, activate from / by the towing vehicle. * Hand brake with lock-on tow bar. * Heavy duty deep cycle battery. Inbuilt charger, solar panel charging option. * LED lights: Industrial style electrics Lockable Isolating Switch. * Special phasing hydraulic cylinders with industrial hydraulic power pack. Eziloader, is the safest way to load and unload any trailer. No strains, aches and pains when you switch to Eziloader.

MIXER

high performance loader wagons

The Revolutionary Trailer with Easy Loading – at Ground Level. ● Motor Bikes: Recovery - delivery. Room for four or more. ● Hire Equipment: Ride-on mowers, mini diggers, generators. ● Palletised goods (two pallets plus hand pallet truck). ● White Goods: Double fridges, stoves – no problem. ● Farming: Animals, 1000 litre tanks, roll on hay bales. ● Household Goods: Pianos. wardrobes. dining tables. ● Gardening: Large trees, pavers on pallets, statues. ● Demonstration Equipment: especially low profile and heavy. How easy is it to use? Push buttons, lower the 1500mm wide x 3 metre long deck, with one tonne load capacity to the ground. The ramp provides easy access, using just a hand pallet truck or trolley if you wish. Is it safe? Eziloader has been designed with your safety in mind. It is fitted with manual locking pins, along with sensors to ensure the pins are either fully in or fully out. Only then can the deck be raised or lowered. Pinch points have been designed out. The operator also faces the rear, meaning they see all potential hazards before lowering or lifting. Controls only usable by operator with key or lock code. All materials used are of the highest quality.

1800 772 407 For your nearest dealer

strautmann.com.au


Farm World News 2017 Page 61

F07902

Offers available while stocks last.


Page 62 Farm World News 2017

Farm World News 2017 Page 7

Farm World 2017

The BIG Gippsland Jersey Milk OFF So much fun and positivity has been milked out of the dairy industry in the past year, itâ&#x20AC;&#x2122;s time to put a little back â&#x20AC;&#x201C; introducing the BIG Gippsland Jersey Milk OFF at Farm World 2017. The concept is simpleâ&#x20AC;Ś Itâ&#x20AC;&#x2122;s a Hand Milking competition - One hand - One teat One minute. The contestant who can extract the most milk within one minute wins the â&#x20AC;&#x2DC;Milk OFFâ&#x20AC;&#x2122; trophy. The hook lies with the contestants, as these are not your run-of-the-mill dairy farmersâ&#x20AC;Ś weâ&#x20AC;&#x2122;re going to see everyone from Councillors and media to baristas and school children fighting it out against their contempo-

raries for the glory of the Milk OFF trophy. The BIG Gippsland Jersey Milk OFF will kick off at 12:00pm on Thursday 30th March in the historic Rotunda with plenty of colour and interactive displays including Sallie Jones and Steve Ronaldâ&#x20AC;&#x2122;s from Gippsland Jersey in some very eye-catching costumes. First cab off the rank will be some representatives of the next generation of dairy farmers, who will fight it out in a School Childrenâ&#x20AC;&#x2122;s MilkOff at 12:00pm on Thursday. This will be closely followed by some of the Agricultural Industryâ&#x20AC;&#x2122;s most proactive female representa-

NEW SEASONâ&#x20AC;&#x2122;S HAY FOR SALE Barrel Clover, Vetch Wheat, Barley, Oats & Balansa Clover 4x3x8 Bales all top quality, large lines. Shedded all weather access.

SITE CB 19 - 20

F07968

On show at Lardner Park Field Days

Phone Evan 0428 504 465 or Luke 0428 596 280

tives in the Women in Agriculture Milk Off at 2:30pm. The fun will continue on Friday 31st March with a political stand-off at 10:30am as Gippsland MPs and Councillors test their skill in the second day of the BIG Gippsland Jersey Milk OFF. While the local politicians may have a good understanding of the dairy industry, there are few occupations with more passion for milk than your local barista â&#x20AC;&#x201C; but can they extract it themselves? Some of Gippslandâ&#x20AC;&#x2122;s best baristas will take the challenge in the Barista Milk Off at 12:00pm on Friday. There will be two opportunities to see some of your favourite media personalities test whether the gift-ofthe-gab translates to talent in the milk shed in the Media Milk Offs at 1:30pm on Friday and 12:00pm on Saturday. There will also be plenty of opportunities for Farm World visitors to walk away with a Milk Off trophy, in the weeks leading up to Farm World we will be giving away 12 general public tickets through local media, which include entry to Farm World and the opportunity to compete in the BIG Gippsland Jersey Milk OFF. Alongside the crowdpleasing hilarity of the BIG Gippsland Jersey Milk OFF, there will also be displays educating the crowd on the history of the dairy industry, and the contribution it makes to both the local economy and the Victorian milk supplies.

)URP WKH EHJLQQLQJV RIWKLVGLVSOD\XQWLOWKHSUHVHQW

Flashmate heat detector lights up AI program for South Gippsland dairy farmer Craig and Deb Allott are third-generation dairy farmers who sharefarm with their daughter and son-inlaw on the family property at Hazel Park in South Gippsland. During this autumnâ&#x20AC;&#x2122;s joining program, they used the Flashmate electronic heat detector from Gallagher for the first time and havenâ&#x20AC;&#x2122;t looked back yet. First off - What is Flashmate? Flashmate is an electronic heat detection device that monitors riding activity in dairy cows to work out when an animal is in standing heat. It looks for specific patterns of riding/mounting by other cows - such as frequency, amount and duration of activity â&#x20AC;&#x201C; and flashes red to indicate when a cow is ready for AI. If the cow doesnâ&#x20AC;&#x2122;t come back into heat within 25 days of being AIâ&#x20AC;&#x2122;d, the Flashmate will flash green to indicate a possible conception. Previous heat detection experience: Craig has used traditional methods for detecting heats before but with mixed results. â&#x20AC;&#x153;In the past weâ&#x20AC;&#x2122;ve used tail-paint and tried scratchies too, which have not been really successful.

â&#x20AC;&#x153;The cows will find trees across the property that they can have a scratch against â&#x20AC;&#x201C; and thatâ&#x20AC;&#x2122;s given us false readings. Likewise tailpaint is ok but sometimes you canâ&#x20AC;&#x2122;t really tell if the cow is definitely â&#x20AC;&#x2DC;onâ&#x20AC;&#x2122; and ready for AI.â&#x20AC;? This has meant that someone with Craigâ&#x20AC;&#x2122;s skill and expertise has always had to be present during milking times â&#x20AC;&#x201C; to be able to recognise the patterns of when a cow is in standing heat. â&#x20AC;&#x153;A problem we had before was that cows brought in for milking might have been let go from the shed and put back out into the paddock before weâ&#x20AC;&#x2122;ve had the chance to properly ID which ones are in heat. â&#x20AC;&#x153;Even then, if someone with the right experience is there to keep an eye on things, an autumn joining period often means that youâ&#x20AC;&#x2122;re milking in near-darkness â&#x20AC;&#x201C; so itâ&#x20AC;&#x2122;s very hard to accurately pick out the cows that are ready for AI sometimesâ&#x20AC;?. Why try Flashmate then? The main reason Craig says they chose Flashmate was greater ease and efficiency in correctly identifying cows that are in heat. â&#x20AC;&#x153;I did consider theyâ&#x20AC;&#x2122;re a bit more expensive than other options out there but

if youâ&#x20AC;&#x2122;re picking out more cows â&#x20AC;&#x201C; and more accurately, more easily and faster too â&#x20AC;&#x201C; then that helps to balance the cost out I think.â&#x20AC;? Another reason lay in the application of the Flashmates. According to Craig, applying them was also pretty easy. â&#x20AC;&#x153;We just did it during milking while the cows were on the platform. So I just went along and sprayed them with the glue while his wife, daughter and sonin-law were milking. And by the time Iâ&#x20AC;&#x2122;d sprayed them Iâ&#x20AC;&#x2122;d just go back to the start again and pop them on â&#x20AC;&#x201C; it was pretty good to apply them and less mess than paint.â&#x20AC;? What happened next? Having applied Flashmates to 150 of his herd, two or three days passed before the first one was activated. â&#x20AC;&#x153;As soon as the Flashmate was on though, it was very easy to see and that made it a bit exciting! Within about a month, you could look across the farm at a certain paddock at night and there were green and red flashes flickering all over the place â&#x20AC;&#x201C; it was like a light show â&#x20AC;&#x201C; quite interesting to see.â&#x20AC;? Easier and more accurate That same light show enabled Craig and other

Want to see the latest in Electric Fencing and Animal Management? Problem solved.

WLPH ZH KDYH JURZQ DOO WKH FRPPRQ PDQ\ RI WKH LQWHUHVWLQJ VHYHUDORIWKH XQXVXDODQGHYHQMXVWIRUIXQDFOXVWHURIWKHZHLUGLQFURSVDQGSDVWXUHV

dairy workers to see exactly which cows were responding to the AI program: â&#x20AC;&#x153;The milkers can actually identify the cows without needing someone whoâ&#x20AC;&#x2122;s got a lot of expertise in knowing the cycle patterns to watch out for. â&#x20AC;&#x153;The Flashmate allows anybody to tell whatâ&#x20AC;&#x2122;s going on, so itâ&#x20AC;&#x2122;s saving us time and effort and cutting out the guesswork from other methods weâ&#x20AC;&#x2122;ve used in the pastâ&#x20AC;?. Craig notes that Flashmate accurately identified one particularly quiet cow that had never shown any signs of mounting activity in the past seven years. â&#x20AC;&#x153;Weâ&#x20AC;&#x2122;d never seen her bulling, never picked up on a cycle before and actually selected her for AI for the first time ever because of Flashmate. In the past weâ&#x20AC;&#x2122;d normally have the bull pick her up later on, so that was a big bonus to see happen this time around. â&#x20AC;&#x153;Overall, Iâ&#x20AC;&#x2122;d say Flashmate has definitely made life a lot simpler. Picking up more cattle the way itâ&#x20AC;&#x2122;s allowed us to, more accurately and quicker â&#x20AC;&#x201C; thatâ&#x20AC;&#x2122;s why Iâ&#x20AC;&#x2122;m looking forward to using it again this spring joining period too.â&#x20AC;?

7KLVOHDYHVRQHODVWIURQWLHUtractor friendly, grazeable wind breaks. <HS-7,0%(5

3LFWXUHWKLVÂŤ $VWDQGDUGWKUHH-URZZLQGEUHDNRQDORFDOIDUP,PDJLQHLIWKDWZLQGEUHDNFRXOGEHWUDQVIRUPHGWRSURYLGHWKH XVXDOEHQHILWVSOXVDVXLWHRIQHZSURGXFWLRQDQGSURILWDGYDQWDJHVLQFOXGLQJ i i i i i i

*UD]HDEOHLQWHU-URZVLQDVKHOWHUHGDQGVKDG\HQYLURQPHQWZLWKLQPRQWKVRIHVWDEOLVKPHQW 7UDFWRUIULHQGO\WUHHVURZVVSDFHGWRVXLW\RXUQHHGV HJWRPHWUHVDSDUW  +D\DQGVLODJHSURGXFWLRQZLWKLQPRQWKVRIHVWDEOLVKPHQW 6XPPHUDFWLYHSDVWXUHVXQGHUKLJKSUXQHGWUHHVSURYLGLQJDSURGXFWLYHILUHEUHDN 3URGXFWLRQRIVRXJKWDIWHUGXUDEOHZRRGWKDWFRXOGEHXVHGRQIDUPWRUHGXFHFRVWVRUVROGLQWR GRPHVWLFDQGH[SRUWPDUNHWVWRSURYLGHQHZUHYHQXH (QKDQFHGFDUERQIDUPLQJFUHGHQWLDOVDQGVXEVHTXHQWUHYHQXHRSWLRQV

7KHDSSOLFDWLRQRI 0XOWL6WRUH\)DUPLQJ 06) WHFKQLTXHVLQFRPELQDWLRQZLWKQDYLJDWLQJVRLO IHUWLOLW\FDQFUHDWHVXFKDWUDQVIRUPDWLRQ 06)WDNHVWKHLQWHJUDWLRQRIWUHHVRQIDUPVWRDFRPSOHWHO\QHZ OHYHORIIHULQJDQHZGLPHQVLRQRI EHQHILWVWRWKHIDUPHU,WWUXO\LQWHJUDWHVGLIIHUHQW ³VWRUH\V´RIVRLOSDVWXUHDQGFURSVOLYHVWRFNDQG WUHHVRQRQHODQGXQLWWRFUHDWHDGLYHUVHV\VWHPZLWKDPRVDLF RISURGXFWLRQRSSRUWXQLWLHVRYHUWKH VKRUWPHGLXPDQGORQJWHUP

Visit our N EW Farm Wor ld Site

2SHUDWLRQDOO\ 06) LQYROYHV WKH SODQWLQJ RI WUHHV DW ZLGH VSDFLQJVWKDWIDFLOLWDWHWKH GHYHORSPHQWRIFURSSLQJSDVWXUHDQGRUOLYHVWRFNEHWZHHQWUHHV,WLVDIOH[LEOHRSWLRQ WKDWFDQEHWDLORUHGWRWKHQHHGVRIDQ\IDUPV7UHHVSHFLHV SODQWLQJGHVLJQSDVWXUH DQGFURSW\SHVFDQEHPRGLILHGWRVXLWGLIIHUHQWVLWHVDQGIDUPLQJV\VWHPV

#701-703

%(/7(& Introducing Westonfence

Introducing FlashMateâ&#x201E;˘

A strong, reliable permanent electric fencing solution suitable for internal subdivision, boundary fencing and feral exclusion.

An electronic heat detection device that monitors riding activity and works out when a cow is in standing heat.



)22767(3 3$571(56 :D\QH -R\)RRW 

6RXWKHUQ$XVWUDOLD

*LSSVODQG

%HOLQGD&XQQLQJKDP Be in with a chance to WIN a S10 Solar Energizer

$*5,&8/785$/ 6&,(17,67 %ULJLG:DWVRQ 

F07949

7DVPDQLD)OLQGHUV .LQJ ,VODQGV

www.gallagher.com

%$6,; 7UDFH3DFNV 5HWDLO7HDP

-867$''75((6 &OLQWRQ7HSSHU  *UD]HDEOH:LQGEUHDNV

06)LVDG\QDPLFV\VWHPWKDW FKDQJHVZLWKWKHJURZWKRIWKH WUHHV'XULQJHDUO\\HDUVFURSVFDQ EHJURZQEHWZHHQWKHWUHHVDQG ODWHUEHUHSODFHGE\PRUHVKDGH WROHUDQWSHUHQQLDOSDVWXUHV\VWHPV WKDWFRQWLQXHWRSURYLGHSURGXFWLYH OLYHVWRFNPDQDJHPHQWRSWLRQV DGMDFHQW DGMDFHQWWRODUJHWUHHV

(/,7()2''(5 -RVK*UHHQH  :HVWHUQ9LFWRULD

68132:(5 %UXFH&XWWV  (QYLURQPHQWDO)DUPLQJ

&RPHDQGVHH0XOWL 6WRUH\)DUPLQJLQDFWLRQ DWRXU)DUPZRUOGVLWHDQG GLVFXVVKRZLWFDQ HQKDQFH\RXUIDUPLQJ H[SHULHQFH


Farm World News 2017 Page 63

Page 6 Farm World News 2017

$OOJRRGWKLQJV« )DUP:RUOGLVWKHSUHPLXPDJULFXOWXUDOWUDGHHYHQWDQGKDVIRUWKHSDVW\HDUV KRVWHGWKH3DVWXUH*UDLQVDQG9HJHWDEOH'LVSOD\RQWKHODUJHVWVLWHRILWVNLQGLQ 6RXWKHUQ$XVWUDOLDDQGLVFRQFOXGLQJZLWKWKLV\HDU¶VGLVSOD\$YDVWUDQJHRISODQWVKDV EHHQJURZQRYHUWKLVWLPHVWDUWLQJZLWKPDLQVWUHDPSDVWXUHVSHFLHVIHDWXULQJ VHHGIURPWKHPDMRUVHHGEUHHGHUV7KLVKDV JLYHQIDUPHUVDQXQSDUDOOHOHGERWDQLFGLVSOD\ JURZQRQDOHYHOSOD\LQJILHOG*UDQXODU IHUWLOLVHUEOHQGVDQG7UDFH(OHPHQW3DFNV KDYHEHHQDSSOLHGDFFRUGLQJWRWKHVDPH UXOHVZHXVHRQIDUP,QODWHU\HDUVWKHGLVSOD\KDVDOVR HQFRPSDVVHGDZLGHUDQJHRIIRRGJUDLQVDQGYHJHWDEOHV 7KLVWUDGHGLVSOD\KDVSURYLGHGIDUPHUVZLWKWKHNQRZOHGJHRI KRZWRIHUWLOLVHWKHYDULRXVVSHFLHVWRRSWLPLVHWKHLUQXWULHQW  FRPSRVLWLRQPDQDJHGLQWKHVDPHZD\WKDWZRUNVRQWKHLURZQ IDUP $VLPSOHFRQFOXVLRQKDVFRPHIURPWKHGLVSOD\RYHUWKHVH \HDUV±WKHUXOHERRNIRUJURZLQJDOOSODQWVLVWKHVDPHDQG VHWLQVWRQHZKHUHYHU\RXDUHDQGZKDWHYHU\RXJURZ :KLOHDOOSODQWVDEVRUEPLQHUDOVLQGLIIHUHQWFRQFHQWUDWLRQV FRPPHUFLDOO\WKHUDQJHEHWZHHQKLJKDQGORZVRLOIHUWLOLW\LV QDUURZ 7KHILUVWORJLFDODQGPRVWFRVWHIIHFWLYHVWHSLVWRLPSURYHWKHVRLOIHUWLOLW\RI WKHZRUVWSDGGRFNVRQWKHIDUP,I\RXDUHJRLQJWRVSHQGPRQH\\RXUJUHDWHVW UHWXUQLVDOZD\VLQEULQJLQJ\RXUZRUVWSDGGRFNVXSWRVSHHG 

7KH5HWDLO7HDPDW%DVL[7UDFH(OHPHQWVFDQKHOS\RX WRQDYLJDWHWKHVWHSVLQWKHVRLOIHUWLOLW\SX]]OHE\SXWWLQJ WRJHWKHUDFRPSOHWHIHUWLOLVHUSURJUDPXVLQJWKHPRVW UHVSRQVLYHJUDQXODUIHUWLOLVHUDQG7UDFH(OHPHQW3DFNV WRDGGUHVVRQO\ZKDW\RXQHHG 6HH\RXDW)DUP:RUOG

6WHS

$VLQJOH67VRLOWHVWFRVWLQJLQF LVWKHVWDUWLQJSRLQWWRQDYLJDWHWKHVRLO IHUWLOLW\SX]]OH:HFDQKHOS\RX RUJDQLVHWKDW

6WHS

:H ZLOO KDYH D FKDW DERXW WKH UHVXOWV DQG RXWOLQH D ZD\ IRUZDUG WKHQ WKH GHFLVLRQLV\RXUV

See us at Farm World site A29

F07730

6WHS


Page 64 Farm World News 2017

Farm World 2017

One stop shop for all Western and Country living needs Pakenham Western Wear and Saddlery is a fresh new business catering to the Western riding and Country markets both locally, through their shop front down the end of Hogan Court in Pakenham, one hour east of Melbourne, and nationally, through their recently launched online store at pakenhamwestern.com.au Pakenham Western Wear and Saddlery offer a one stop shop for all your Western and country living needs, including saddlery, apparel, boots, clothing, hats, homewares, jewellery and gifts. Pakenham Western Wear and Saddlery is frequented by many professional horse

trainers, who see that only the best quality products will do when it comes to getting the best results from themselves and their horses, both in training and competition. They are proud to be suppliers of quality brands including Ariat, Akubra, Cinch, Gidgee Eyes, Myler USA, Cowgirl Tuff, Grace In LA, Sunbody Hats, Diamond Wool Pads, WonPad, Iconoclast, Classic Equine, Professional’s Choice, Outback Trading Co and many more. Pakenham Western Wear and Saddlery pride themselves on their friendly and efficient customer service along with the ability to sup-

Pakenham Western Wear and Saddlery offer a one-stop-shop for all your western and country needs. ply a huge range of quality Western products, all at competitive prices.

Pakenham Western Wear and Saddlery look forward to meeting you at their trade

stand number EE49, at the Equestrian Expo Farmworld 2017.

MERUNGLE ALPACA STUD

Commercial & Stud Stock Alpaca Products Jen & Peter McDavitt, Maffra Ph (03) 5147 2444 M: 0412 383 655

An animal with a wide appeal Aesthetically alpacas are an ideal animal for a lifestyle block as they are

TA L K TO U S AT LA K E S ID E PAV IL IO N OPEN FARM Sunday May 7

or by appointment

Enter our competition for a chance to w in an Alpaca prod uct

www.merungle.com.au YON ND EAST GIPPSLAND BREEDER SERVICING AUSTRALIA & BEY BEYOND

F02416

easily managed, learn routine quickly, not too big, generally easy on fencing, inquisitive and alert, bond with other livestock and require minimal infrastructure. A Farming Tool Alpacas are used for protection in sheep flocks, free range poultry enterprises and goat herds to name a few areas. Most alpacas naturally have a protective instinct and bond well with other livestock. Their ‘alarm call’ - a high pitched squeal - is one of their big assets. The other animals soon learn to recognise this, look up and around and cluster together with the alpaca or head for where they know it is safe. Alpacas have been regularly seen chasing predators, herding animals to safety

and protecting young animals. At Merungle they have observed the reaction to their dog to pick the most suitable ‘herd protectors’. A Commercial Enterprise The end product is developing into a viable fleece industry with side lines being developed with meat and hide. A lot is happening in this area. In Victoria we have AFN (Australian Fleece Network) which is breeders pooling fleece so there are marketable quantities within narrow parameters to suit manufacturers’ requirements in Australia and internationally. AAFL (Australian Alpaca Fleece Ltd) buys the fleece and a lot of that fleece goes to Peru and comes back to Australia as ‘Australian Alpaca - made in Peru’.

Weenlings from the Merungle Alpaca Stud. The Peruvians have a lot of expertise with alpaca fleece. Some fleece is also processed in Australia and some in New Zealand. Lakeside Pavilion will once again be bustling with alpacas and some fabulous products. There will be felting demonstrations each day and the Alpaca Paraders will demostrate alpaca handling skills.

The ‘free entry’ raffle, with numerous chances to win some alpaca products will again be available to everyone who visits Lakeside Pavilion. We look forward to welcoming you and answering your questions and providng you with alpaca experience and information.

F02383

F02253

Alpaca Industry - it just gets better


Farm World News 2017 Page 65

HAVE A FIELD DAY AT

Plentey mor ls speciare! insto

METALCORP!

Calf Crush

HOBBYMASTER® Vet Crush

Cutting edge vertical design

CATTLEMASTER® CRUSH U

CATTLEMASTER® Classic Crush with Baulk Gate

Genuine all-rounder. Heavy duty construction

Infinite lock on bail. Great for dairy farmers

t abou Ask eld day our fipecial! s

2,950ea

$

3,900ea

$

STOCKMASTER® 3m Ramp

4,450ea

$

CATTLE KING® 5.2m Ramp

Head Bail

with walkway and extension

Classic head bail with chin lift bar. Includes rear closure

Adjustable. Heavy duty. Hardwood timber floor. Lightweight for easy relocating

2,650ea

$

4,800ea

$

Float Panels

2025mm x 1280mm high Gal pipe

$55

$1,550

ea

ea

Fence Posts

Heavy weight, sling buys Blk 1650 HVY.......min Qty 400......$4.25 Blk 1650 HVY.......min Qty 10........$4.85 Gal 1650 HVY.....min Qty 400......$5.75 $ Gal 1650 HVY.....min Qtyy 10........$6.50

Plain Wire

from

Horse Panels Gal Oval Rail

2.5mm x 1500m H/T......$133 2.5mm x 1500m M/T.....$135

$185

ea

Oval rail 53mm x 35mm 6-bar Gal. 1790mm x 2100mm long

from

133ea

$

from

110ea

$

$ .25

4

ea

®

Fencing

6-70-30-2.5mm 200m..................$185 7-90-30-2.5mm 200m..................$220 8-90-30-2.5mm 200m..................$250

STOCKSAFE Farm Access Grid

2m x 4m "UNRATED" Heavy Duty. Optional grid wings (not included) 3m Rated heavy duty and Highway duty also available

$2,450

ea

CATTLEMASTER® SAFE T FORCE YARD P-Gate

Double Gate

As Di at Far splayed m 30 M World arc 2 Apr h il RAMP

CATTLEMASTER® Rotary Force Yard

3m radius. Sheeted for safety. Easy to erect. Anti-backing locking mechanism on gate for operator safety

Horse Round Yards

Gal Oval Rail. 1 high gate in frame and joining pins Example below; 16m diameter. Includes high gate in frame

RED ! HOT

No-1 GATE

No-2 GATE

from

2,800ea

$

76m2

$3,990

CRUSH

ea

SHEEPMASTER® 450B Sheep Yard

Includes adjustable 3-way draft and Blind panels in bugle. gle. No N holes to dig and no overhead bracing

Post Lifter

10,500ea

$

1 x Race Bow

No-3 GATE

Mangate Panel

RED HOT!

199ea

$

44m2 SLIDING GATE Mangate Panel

Hay Feeder

2 Piece Hexagon Feeder. 10 head

RED HOT!

FORCE

No-5 GATE

14m2

3399ea

$

1300 306 204 METALCORP.COM.AU Metalcorp Dandenong 503 Hammond Road, Dandenong Ph: (03) 9768 1200

Metalcorp Morwell Lot 4 Jones Road, Morwell Ph: (03) 5134 6266

US FIND ITE AT S 18! 7CB1

meet the team at lardner’s farm world field nddays th March 30 - APRIL 2 2017

Terms & Conditions: All prices unless otherwise stated are inclusive of GST. All products subject to prior sale. E&OE. Freight extra to branches and distributors. Some items not stocked at all outlets. No Rainchecks. Images for illustration purposes only. Only while stocks last. Price valid to 30/06/17. Metalcorp is a registered trademark of BlueScope Distribution Pty Ltd. ABN 88 096 380 068. ADV REF 069

F01894

10.6m 10 6m


Page 66 Farm World News 2017

Farm World 2017

CONCRETE GROOVING Permanent and proven method for prevention of slippery concrete surfaces in ...

DAIRIES - RAMPS - HOLDING PENS

An aerial view of the Farm World site at Lardner Park in 1986.

For further details phone us Toll Free on

Farming has changed dramatically over the past century

NOW WITH WIDE GROOVES

Dairy farmers are thrilled with the results

F01900

1800 335 151

See us at Site No. B17

The agricultural sector has overcome many challenges, including drought, flood, fire, salinity and changing commodity prices. What hasn’t changed is the importance of agriculture as a $58 billion driver of Australia’s economy. Nor have our farmers

changed: they remain resilient, innovative and committed to the land. Nationals’ Federal Member for Gippsland Darren Chester said The Nationals were champions of regional Australia. “As part of the Federal Coalition, we are imple-

menting policies and practical actions, and investing to ensure the agricultural sector prospers,” Mr Chester said. “Dairy farmers were in turmoil last year when two processors announced retrospective cuts to milk prices. “The Federal Coalition announced a $579 dairy

FARM WORLD 2017

assistance package and held a national inquiry to examine the industry’s competitiveness, trading practices, milk prices and supply chain. One hearing was held in Traralgon for Gippsland farmers.” The Federal Coalition also committed $20 million to upgrade the Macalister Irrigation District. With matching funding from the State Government and Southern Rural Water, the $60 million Phase 1B Southern Tinamba Pipeline upgrade will improve productivity and reduce water loss. The $4 billion Agricultural Competitiveness White Paper has also benefitted the industry. “The white paper foreshadowed changes to farm management deposits to allow farmers to reduce interest on their debt; and delivered sweeping changes to country of origin food labelling to give consumers clearer, more meaningful information about the products they buy,” Mr Chester said. “While we can’t predict the future, The Nationals are working to ensure the agricultural sector and our communities can weather whatever challenges lie ahead.” Member for Eastern Victoria Melina Bath said that access to water will always be crucial for Gippsland’s agricultural sector. “Next to people and land, water is the most important commodity in our state,” Ms Bath said. “Not only will the MID project provide stability and water security for dairy farmers in the region, but the long awaited upgrade will also generate jobs for the region.” The $60 million MID upgrade will provide water efficiencies and ongoing reliable water supply. The project will enable best practice in the region through the conversion of 85 kilometres of open channels to HDPE pipeline with an added benefit of reduced network flow into Gippsland waterways. “This all leads to increased productivity and much needed security within our farming communities.” Ms Bath said. Member for Gippsland South Danny O’Brien said water and better infrastructure, such as roads, were critical to the success of local farmers, especially the dairy industry. “It’s been a tough year for the region’s dairy farmers, especially those coming off a record dry 2015/16 season - price cuts last year rocked the industry and The Nationals were active in lobbying the State Government for better support for affected dairy farmers,” Mr O’Brien said.

“Thankfully, we’ve had a good wet year and the conditions have meant farmers could focus on doing what Gippslanders do best – growing good grass for their herds. We’ve had great silage and hay harvests and that has made life a lot easier for many farmers. Cash flow is still a problem for many, but hopefully we are now over the worst and will see some price step-ups in coming months. “We’ll continue to fight for the infrastructure and policy settings local farmers need to thrive.” Dairy hasn’t been the only industry facing tough times recently. In the Latrobe Valley, Labor’s increase in taxes on energy generators has forced Hazelwood Power Station to close. “Victorian household electricity bills have skyrocketed this year as Daniel Andrews steers our state on the path to an energy security crisis,” Member for Morwell Russell Northe said. “From 1 January, many Victorian households have been hit by a 10 per cent rise in their power bills because of Daniel Andrews’ policy to increase the tax on coal which forced Hazelwood to close. “It will also cost a lot more for businesses which will pay up to 16.6 per cent more for electricity, an increase that will ultimately be passed onto consumers.” Meanwhile, timber mills in East Gippsland and the Latrobe Valley were not guaranteed adequate timber supply by the Andrews Government in early 2017, threatening hundreds of local jobs at a time when unemployment in LatrobeGippsland was the highest in country Victoria. Member for Gippsland East Tim Bull said it was devastating to watch the uncertainty and stress on our East Gippsland communities in recent months. “Daniel Andrews has refused to support East Gippsland’s forestry industry for two years,” Mr Bull Said. “It put a huge amount of stress on local families that rely on employment opportunities at Heyfield and other mills to pay the bills. “Although we still have some challenges ahead in parts of our region, there are also plenty of things for us to be proud of. “Gippsland is a great place to live, work and raise a family and we have important industries that really kick the tin when it comes to our national economy, including horticulture, livestock, dairy, timber, mining, tourism, fishing and others. “These are all industries we need as a nation and should be proud to have here.”


Farm World News 2017 Page 67

Farm World 2017

Study and recreation combine at Scotch College Melbourne There are up to 160 Year 7 to 12 boarders, mostly from country Victoria and southern New South Wales, resident in the three boarding houses at Scotch College Melbourne. Boarding at Scotch places boys close to the heart of Melbourne, with the campus a short train or tram ride from the city and some of Melbourne’s major landmarks. In any one day, boys can go from rowing training on the Yarra River at the rear of the school, or playing tennis on one of the

Supervised study sessions are conducted every weeknight in the boarding school.

college’s 26 courts, or playing music in the James Forbes Academy (a purpose-built centre for music and drama, with a theatre, auditorium and dozens of rehearsal and practice spaces), or investigating biology, chemistry, physics or psychology in the recently opened Sir Zelman Cowen Centre for Science. With construction of a new facility for Design and Technology due for completion at the end of 2017, boys have access to electives across a broad range of academic and co-curricular programs. Supervised by school staff, study sessions are conducted every weeknight in the boarding school, as well as twice-weekly tutorial sessions in English and mathematics. Each year boys participate in dozens of different extension activities with the school always strongly represented amongst the high achievers in the VCE results and internationally recognised competitions. Boys can also choose from many competitive and recreational activities having access to seven sports fields and an indoor sports centre. An extensive co-curricular program develops confidence and leadership skills through courses that include cadets, cycling, kayaking, hiking, sailing, scuba diving and fly fishing, to name but a few. Parents wishing to obtain further details about boarding at Scotch College should contact the Admissions Office (Tel. 9810 4203).

Jetmaster Heat and Glo at Farm World 2017

Boarding at Scotch College Visit Us at the Farm World Field Days Meet the friendly team and members of Scotch Families.

The Australian made Kemlan C900 slow combustion fireplace from Jetmaster Heat and Glo. fireplace on the market means you burn less wood and heat more area,” he said. “If you live on a farm and you’re chopping wood, it means you’re attending to the fire less. It’s good for your hip pocket but it is good for the environment because there’s less smoke and you’re burning less fuel.” Mr Stride said the business strived to achieve the best warranty and the most efficient product on the market with its clean burning fireplaces. The business stocks three brands of wood fires from

the largest fireplace companies in the world, including Australia’s most efficient slow combustion wood fire, which boasts up to 86 per cent efficiency. Mr Stride said the business had taken on knowledge and expertise from the brands it sells, including Kemlan, which has a range of modern Australian-made wood fires. To get your house winter ready visit the Jetmaster Heat and Glo team at site number 208 at the Farm World exhibition.

Boarders at Scotch enjoy high quality accommodation in a caring ‘home away from home’ environment, with emphasis on sound study skills. For school tours, please contact Guy Mason, Director of Admissions: Phone 1800 622 912 Email admissions@scotch.vic.edu.au

F02353

There’s no better way to warm up this winter than with a wood burning fireplace, and Jetmaster Heat & Glo’s impressive range is a great place to start when looking for a fireplace. Operating in Australia for nearly 40 years, Jetmaster Heat & Glo offers a wide variety of gas and wood heaters to suit the needs of any household. Sales director Ashley Stride said he expected the company’s wood fires to be popular among regional consumers at the Warragul Farm World. “If they’re off-the-grid, no availability of gas they (wood fires) are certainly the cheaper way to heat the home,” he said. Jetmaster Heat and Glo will have staff on hand to assist consumers with their search for the perfect wood heater to suit their needs. Mr Stride said the business would have about 15 models of wood fires from its wood fire brands on display during the event. “Being the most efficient

There are 160 year 7-12 boarders at Scotch College Melbourne.

www.scotch.vic.edu.au

Scotch College 1 Morrison Street, Hawthorn VIC 3122 Phone 03 9810 4203 / Fax: 03 9810 4333 Email admissions@scotch.vic.edu.au

Australia’s most efficient wood heaters! SAVE UP TO

BURN TIME

Look out for us at WARRAGUL FARM WORLD 30 March-2 April GET A FREE3.6m FLUE KIT WITH EVERY UNIT SOLD DURING FARMWORLD* CALL US ON 1300 219 875 OR VISIT OUR WEBSITES: quadrafire.com.au or jetmastervic.com.au

QUAD BURN

AUTOMATIC COMBUSTION CONTROL

*excludes C900, Curve, Radius and WINS18

F07650

SAVING

Most extensive WARRANTY including baffle and air tubes • CLEAN BURNING UNITS • Exclusive patents on Quad Burn System & Automatic Combustion Control • Fully Tested to Australian Conditions


Page 68 Farm World News 2017

Power, Strength & Reliability Since 1837...John Deere has been a leading brand of machinery for the farming community. From Ride Ons to agricultural muscle... Legendary Power, Strength & reliability. Thereâ&#x20AC;&#x2122;s bound to be a John Deere Machine to suit your needs. Want to own a legend? Call your John Deere dealer today!

6R Series Tractors

Glenmac Sales & Service Pakenham: 85 Bald Hill Road ...Leongatha p 5941 South 5966: Sth f ... Gippsland 5945 5555 Hwy, Leongatha ... p 5667 6600 f ... 5667 6633 F07903

Cervus Equipment

Leongatha South: 2 Hogans Road ... p 5667 6600 f ... 5667 6633 Maffra: 16-18 Johnson Street ... p 5147 1122 f ... 5147 3203

Farm World News 2017  

A preview of Farm World 2017

Read more
Read more
Similar to
Popular now
Just for you