Page 1


Editorial Imperativos de la UQROO: mayor cobertura, mejor calidad y elevada pertinencia ................................................................. 3

D͘͘½®Äƒ½¥®Êك½ƒÝ㮽½ƒ D͘͘½®Äƒ½¥®Êك½ƒÝ㮽½ƒ Rectora Rectora Mãك. EƒÄ‘ùYç®Äヽ'ƒÙ‘°ƒ Mãك.   EƒÄ‘ùYç®Äヽ'ƒÙ‘°ƒ ^ĞĐƌĞƚĂƌŝĂ'ĞŶĞƌĂů ^ĞĐƌĞƚĂƌŝĂ'ĞŶĞƌĂů

r sa de los vientos

Mãك͘ăDƒÙ½›ÄùZ®ò›Ùʃđ« Mãك͘ăDƒÙ½›ÄùZ®ò›Ùʃđ« ŝƌĞĐƚŽƌĂdĠĐŶŝĐĂ ŝƌĞĐƚŽƌĂdĠĐŶŝĐĂ  

Excelencia y pertinencia, logros de la UQROO en sus primeros veintidos años de vida .......................................................... 6

D͘͘Ù®»ƒ>›ã®‘®ƒ½ÊÄÝÊ&½ÊٛÝ D͘͘Ù®»ƒ>›ã®‘®ƒ½ÊÄÝÊ&½ÊٛÝ ŽŽƌĚŝŶĂĚŽƌĂĚĞůĂhŶŝĚĂĚĐĂĚĠŵŝĐĂŽnjƵŵĞů ŽŽƌĚŝŶĂĚŽƌĂĚĞůĂhŶŝĚĂĚĐĂĚĠŵŝĐĂŽnjƵŵĞů

Primera generación de Medicina, Enfermería y Farmacia,

DãÙÊ͘ƒÙ½ÊÝDƒÄ盽s…þØç›þ½òƒÙ›þ DãÙÊ͘ƒÙ½ÊÝDƒÄ盽s…þØç›þ½òƒÙ›þ ŽŽƌĚŝŶĂĚŽƌĚĞůĂhŶŝĚĂĚĐĂĚĠŵŝĐĂ ŽŽƌĚŝŶĂĚŽƌĚĞůĂhŶŝĚĂĚĐĂĚĠŵŝĐĂ WůĂLJĂĚĞůĂƌŵĞŶ WůĂLJĂĚĞůĂƌŵĞŶ

culminan ciclos clínicos ..................................................................................... 14 Nueve IES de la entidad rubrican convenio para impulsar la evaluación de los municipios ............................................. 26

>®‘͘  s°‘ãÊÙî½®ÊʛãƒW®Ä›—ƒ >®‘͘    s°‘ãÊÙî½®ÊʛãƒW®Ä›—ƒ ďŽŐĂĚŽ'ĞŶĞƌĂů ďŽŐĂĚŽ'ĞŶĞƌĂů

La Universidad de Quintana Roo en tu comunidad,

Ù͘½›¹ƒÄ—ÙʽòƒÙƒ—Ê,›Ùٛك Ù͘½›¹ƒÄ—ÙʽòƒÙƒ—Ê,›Ùٛك ŝƌĞĐƚŽƌĚĞůĂŝǀŝƐŝſŶĚĞĞƐĂƌƌŽůůŽ^ƵƐƚĞŶƚĂďůĞ ŝƌĞĐƚŽƌĚĞůĂŝǀŝƐŝſŶĚĞĞƐĂƌƌŽůůŽ^ƵƐƚĞŶƚĂďůĞ

Programa de Servicio Social de la DCSEA ....................................................... 16 Intensa actividad del programa Promoción de una Vida Sana ................... 19

DÙ͘:Êݝ,›Ùąė›þZʗٰ¦ç›þ DÙ͘:Êݝ,›Ùąė›þZʗٰ¦ç›þ   ŝƌĞĐƚŽƌĚĞůĂŝǀŝƐŝſŶĚĞŝĞŶĐŝĂƐĞ/ŶŐĞŶŝĞƌşĂ ŝƌĞĐƚŽƌĚĞůĂŝǀŝƐŝſŶĚĞŝĞŶĐŝĂƐĞ/ŶŐĞŶŝĞƌşĂ

Centro Emprendedor de Negocios promueve cultura emprendedora .................................................................... 23

MãÙÊ. —¦ƒÙ^ƒÄÝÊٛÝ'ç›ÙٛÙÊ   MãÙÊ .  —¦ƒÙ^ƒÄÝÊٛÝ'ç›ÙٛÙÊ   ŝƌĞĐƚŽƌĚĞůĂŝǀŝƐŝſŶĚĞŝĞŶĐŝĂƐ^ŽĐŝĂůĞƐ ŝƌĞĐƚŽƌĚĞůĂŝǀŝƐŝſŶĚĞŝĞŶĐŝĂƐ^ŽĐŝĂůĞƐ LJĐŽŶſŵŝĐŽĚŵŝŶŝƐƚƌĂƟǀĂƐ   LJĐŽŶſŵŝĐŽĚŵŝŶŝƐƚƌĂƟǀĂƐ   Ù͘½¥Ù›—ÊDƒÙ°ÄDƒÙ°Ä     Ù͘½¥Ù›—ÊDƒÙ°ÄDƒÙ°Ä     ŝƌĞĐƚŽƌĚĞůĂŝǀŝƐŝſŶĚĞŝĞŶĐŝĂƐWŽůşƟĐĂƐ ŝƌĞĐƚŽƌĚĞůĂŝǀŝƐŝſŶĚĞŝĞŶĐŝĂƐWŽůşƟĐĂƐ LJ,ƵŵĂŶŝĚĂĚĞƐ LJ,ƵŵĂŶŝĚĂĚĞƐ

UQROO

Ù͘&كđ®Ý‘ÊDÊÄã›Ý—›K‘ƒ'ƒÙÙÊ Ù͘&كđ®Ý‘ÊDÊÄã›Ý—›K‘ƒ'ƒÙÙÊ   ŝƌĞĐƚŽƌĚĞůĂŝǀŝƐŝſŶĚĞŝĞŶĐŝĂƐĚĞůĂ^ĂůƵĚ   ŝƌĞĐƚŽƌĚĞůĂŝǀŝƐŝſŶĚĞŝĞŶĐŝĂƐĚĞůĂ^ĂůƵĚ  

“México, el Caribe y Yucatán en Quintana Roo: expresiones de herencia e identidad compartidas” ..................................... 27

D͘͘:ÊݝĦ›½Dʗ›ÝãÊ'ʗ°Ä›þ D͘͘:ÊݝĦ›½Dʗ›ÝãÊ'ʗ°Ä›þ :ĞĨĞĚĞůĞƉĂƌƚĂŵĞŶƚŽĚĞŝĨƵƐŝſŶ :ĞĨĞĚĞůĞƉĂƌƚĂŵĞŶƚŽĚĞŝĨƵƐŝſŶ LJŽŵƵŶŝĐĂĐŝſŶ^ŽĐŝĂů LJŽŵƵŶŝĐĂĐŝſŶ^ŽĐŝĂů

Reseña del VI Congreso de Gobierno y Gestión Pública .......................... 30 La primera brecha de la Universidad de Quintana Roo ............................. 33

,‘ãÊÙƒ‘ƒÙ°ƒÝƒ¦Êùƒ ,‘ãÊÙƒ‘ƒÙ°ƒÝƒ¦Êùƒ   ZĞƐƉŽŶƐĂďůĞĚĞWƌŽŵŽĐŝſŶLJsŝŶĐƵůĂĐŝſŶhŶŝĚĂĚ ZĞƐƉŽŶƐĂďůĞĚĞWƌŽŵŽĐŝſŶLJsŝŶĐƵůĂĐŝſŶhŶŝĚĂĚ ĐĂĚĠŵŝĐĂŽnjƵŵĞů ĐĂĚĠŵŝĐĂŽnjƵŵĞů >ŝĐ͘DĂŐĚĂůĞŶĂDƵůŝĂĂďƌĞƌĂ ĚŝƚŽƌĂ >ŝĐ͘>ƵnjĚĞůĂƌŵĞŶZŽĚƌşŐƵĞnj^ĄŶĐŚĞnj ŝƐĞŹŽ >ŝĐ͘ZĂĐŝĞůDĂŶƌşƋƵĞnj'ŽŶnjĄůĞnj ZĞƉŽƌƚĞƌŽ >ŝĐ͘DĂƌşĂƵŐĞŶŝĂsĂƌĞůĂĂƌůŽƐ ŽƌƌĞĐĐŝſŶ ĞƉĂƌƚĂŵĞŶƚŽĚĞ/ŵĂŐĞŶ/ŶƐƟƚƵĐŝŽŶĂů WŽƌƚĂĚĂLJĨŽƌƌŽƐ

hacia la certificación en Equidad de Género ................................. 25

“Gobernabilidad, Democracia y Seguridad en Iberoamérica”, Seminario Internacional para la vinculación académica .............................. 42

Gaceta núm. 59, junio 2013, es una publicación de la Universidad de Quintana Roo, de perioricidad trimestral y distribución gratuita / registro en trámite / uqroo Bulevar Bahía esq. I. Comonfort, Col. del Bosque, Chetumal, Quintana Roo. México. Tel.: 019838350300 / fax 019838329656

COLABORACIONES:

magmulia@uqroo.mx

http://saladeprensa.uqroo.mx/


Imperativos de la UQROO: mayor cobertura, mejor calidad y elevada pertinencia * # Nuestros indicadores son reflejo del trabajo incansable de veintidós años, afirma la rectora.

H oy nos reunimos en este modesto acto para celebrar el nacimiento, hace

veintidós años, de esta casa de estudios.

Éste es un acto muy respetuoso y trascendente para honrar aquel momento que significó fundar la primera universidad pública del estado. Y lo es no sólo por los obstáculos que tuvo que sortear un proyecto de tan alto valor moral y cultural, sino por la relevancia que ha tenido en la conformación del sistema educativo de nivel superior de Quintana Roo, y por la huella que ha dejado en el espíritu y carácter de todos aquellos jóvenes que han pasado por sus aulas.

Editorial

Porque son esas mujeres y esos hombres, cuyas vidas ha moldeado la formación universitaria, la mejor prueba para apreciar el legado de quienes trabajaron sin descanso para que los quintanarroenses tuviéramos nuestra universidad. Quiero hacer de este momento, más que un espacio para narrar los hechos que hicieron posible el surgimiento de esta universidad; hoy, haré una merecida pausa para honrar con justeza, el sentido y significado de la acción del gobierno estatal y de la federación para dar a Quintana Roo una institución cuyo cometido es estimular los talentos y promover el bienestar. En aquella época y durante la vida de nuestra casa de estudios su fundador, el Dr. Miguel Borge Martín, siempre se ha mantenido cerca y atento del andar universitario. Hoy puedo decirle con gran orgullo que preservamos la esencia universitaria. *Palabras pronunciadas por la Mtra. Elina Coral Castilla, rectora de la Universidad de Quintana Roo, con motivo de la Sesión Solemne del H. Consejo Universitario para conmemorar el XXII aniversario de la fundación de la UQROO.


Hace veintidós años los gobiernos, conscientes de las aspiraciones y de la necesidad de nuestros jóvenes de acceder a mejores condiciones de vida, coincidieron en que no había mejor instrumento para alcanzar altos niveles de desarrollo, que la educación superior. Así, nos recordaron que los logros materiales hablan de crecimiento y hay que trabajar duro para alcanzarlos, pero el verdadero progreso se obtiene al cultivar el ideal formativo del hombre. En Quintana Roo, nos ocupamos de ello desde hace veintidós años, convencidos de que sólo el ejercicio de la razón nos hace más libres y nos acerca a una auténtica felicidad. Por ello, todos los quintanarroenses, pero la comunidad univeritaria en especial, debemos decir una y otra vez: gracias Dr. Borge Martín. Los universitarios, junto con actores representativos de la sociedad quintanarroense y autoridades del gobierno del estado, hemos trabajado para que esta casa de estudios sea reconocida como una institución abierta a la comunidad y cercana a las necesidades de su entorno. La universidad se concibió como una entidad alejada de toda intención de privilegio o sinónimo de exclusividad; por el contrario, en nuestra institución la educación, la investigación y la cultura, no son un lujo o prebenda para disfrute de unos cuantos. No, son los bienes más preciados con que cuenta cualquier sociedad, cuyo valor y riqueza se pone a disposición de Quintana Roo y de la nación. En tan sólo poco más de dos décadas, la Universidad de Quintana Roo ha ido ganando presencia en la entidad y mayor reconocimiento social. Atinada fue la decisión de iniciar esta magna gesta educativa aquí, en la capital del estado y frontera sur de nuestro México. Pero el cambio acelerado en la vida económica, política y social quintanarroense, obligaba a que esta casa de estudios acompañara esa dinámica de transformación. Es así como la universidad ha acercado sus servicios a Playa del Carmen y Cozumel. Sus recursos educativos, de investigación y la difusión de la cultura, se hacen presentes en la zona norte, a través de las unidades académicas de Cozumel y Playa del Carmen, y próximamente en Cancún. Expansión que ha sido posible gracias al apoyo que hemos recibido.

4

gaceta Nº 59

junio 2013

Las autoridades de nuestro estado, en especial el señor gobernador, Lic. Roberto Borge Angulo, han reafirmado en los hechos que la educación superior es una actividad de interés público y, en consecuencia, ha respaldado la planeación de su crecimiento a fin de que se pueda responder mejor a los problemas de Quintana Roo. Señor gobernador, gracias por su solidaridad con esta casa de estudios. Es invaluable para la comunidad universitaria, y debería serlo para todo quintanarroense, su generoso compromiso con la educación, pues es un acto cuya grandeza y alcance sólo se equipara a los anhelos y aspiraciones de cada uno de esos jóvenes por tener un mejor futuro. Por eso, los universitarios asumimos el reto y nos comprometemos con Quintana Roo y con usted por mantener la calidad educativa de nuestra casa de estudios. Quien piense que ello es una tarea sencilla, permítame decirle que la Universidad de Quintana Roo enfrenta permanentemente el desafío de responder a la exigencia social porque cada día hay un mayor número de jóvenes en edad de cursar estudios de nivel superior que debe encontrar un espacio para formarse, por lo que debemos procurar a la juventud una oferta educativa de calidad, congruente con las necesidades de desarrollo del estado. Por si esto fuera poco, debe contribuir a eliminar condiciones de atraso, desigualdad e injusticia en lo económico, político, social y cultural. Visto así, nuestra institución ha de satisfacer tres imperativos de la formación universitaria del presente: mayor cobertura, mejor calidad y elevada pertinencia. No, sencillo no es. Más aún cuando se trata de la juventud de esta tierra que a muchos de nosotros nos vio nacer. Sabemos que son muchos los jóvenes que anhelan ingresar a la universidad, por ello, y respondiendo a tan justo reclamo, trabajamos en fortalecer la política gubernamental de proveer educación superior en nuevos esquemas de enseñanza aprendizaje que, como la educación a distancia, abren una oportunidad para que mujeres y hombres reciban los beneficios de la formación universitaria de altos estándares también.


El escrutinio a la calidad es una premisa fundamental para ello. Así, por segundo año consecutivo hemos recibido el reconocimiento por tener al 100 por ciento de nuestra matrícula inscrita en programas educativos de calidad. Reconocimiento que otorga la Secretaría de Educación Pública del gobierno federal. Esto nos enorgullece, toda vez que hemos conseguido tal distinción en un tiempo muy corto. Nuestros indicadores son reflejo del trabajo incansable de veintidós años y nos colocan por encima, incluso, de lo que han alcanzado universidades de mayores magnitudes y más larga tradición. Distinguidos invitados, universitarios, la Universidad de Quintana Roo es un espacio promotor del conocimiento, es el recurso de más amplia escala y de mayores expectativas con que cuenta la sociedad y el gobierno de esta noble tierra. Para que en nuestro estado prevalezca la solidaridad, se fortalezca la competitividad económica y se conserve la gran riqueza natural, debemos continuar trabajando por su fortalecimiento. Hoy, la competencia entre las naciones es más aguda, se hace patente el deterioro del ambiente, la violencia y el des-

amparo quebrantan los ánimos, por ello reconquistemos la serenidad y el juicio objetivo, propios de la universidad. Señor gobernador, hace veintidós años inició la empresa cultural más vasta de los quintanarroenses. Sus fundadores sentaron las bases de una institución que poco a poco se ha convertido en el orgullo de los quintanarroenses, que nos mantiene firmes y convencidos de que, a diferencia de otras, tiene la virtud de moldear la condición humana de hombres y mujeres, y hacer los cuadros técnicos y científicos que requiere nuestro estado y la nación. Los universitarios somos conscientes de la identidad maya que nos es propia y aspiramos a seguir consolidando un proyecto de sociedad, en el que todos forjemos una relación armónica con la naturaleza y nuevas formas de convivencia social. Por eso, hoy y siempre, concluyo: nuestros egresados son la síntesis de la grandeza de la UQROO y nuestros estudiantes el mejor aliento. Estudiantes, docentes, egresados y administrativos: comunidad universitaria, hoy les llamo a conmemorar el veintidós aniversario de la Universidad de Quintana Roo, recordando el lema que nos es propio: “Fructificar la razón, trascender nuestra cultura”. ”

gaceta Nº 59

junio 2013

5


r sa de los vientos

Excelencia y pertinencia, logros de la UQROO en sus primeros veintidĂłs aĂąos de vida # # # #

SesiĂłn Solemne del Consejo Universitario para conmemorar el aniversario de la universidad Reciben medallas trabajadores con 20, 15, 10 y 5 aĂąos de servicio Confieren reconocimientos a docentes, egresados y estudiantes destacados Encuentros deportivos y maratĂłn familiar, parte de los festejos de aniversario

“S

eĂąor gobernador, hace veintidĂłs aĂąos se iniciĂł la empresa cultural mĂĄs vasta de los quintanarroenses. Sus fundadores sentaron las bases de una instituciĂłn que se ha convertido en el orgullo de los quintanarroenses, y que, a diferencia de otras, tiene la virtud de moldear la condiciĂłn humana de hombres y mujeres, y de hacer FXDGURVWpFQLFRV\FLHQWtĂ€FRVTXHUHTXLHUH nuestro estado y la naciĂłnâ€?, expresĂł la rectora de la Universidad de Quintana Roo, Mtra. Elina Coral Castilla, en el marco de la SesiĂłn Solemne del Consejo Universitario, en la que se conmemorĂł el vigĂŠsimo segundo aniversario de la fundaciĂłn de la Universidad de Quintana Roo, el 17 de mayo de 2013. Ante un pĂşblico integrado por estudiantes, docentes, administrativos e invitados espaciales, reunidos HQODSOD]DGHOHGLĂ€FLRGH5HFWRUtDOD0WUD&RUDO&DVWLOODUHFRUGyTXHHVWDFDVDGHHVWXGLRVVHIXQGy gracias a la visiĂłn del Dr. Borge MartĂ­n, quien tomĂł la atinada decisiĂłn de iniciar esta magna obra educativa aquĂ­, en la capital del estado y frontera sur de MĂŠxico. En este sentido, la rectora indicĂł: “Trabajamos en fortalecer la polĂ­tica gubernamental de proveer educaciĂłn superior mediante nuevos esquemas que, como la educaciĂłn a distancia, abren una RSRUWXQLGDGSDUDTXHPXMHUHV\KRPEUHVUHFLEDQORVEHQHĂ€FLRVGHODIRUPDFLyQXQLYHUVLWDULDGHDOWRV estĂĄndares. Los recursos educativos, de investigaciĂłn y la difusiĂłn de la cultura, llegan a la zona norte a travĂŠs de las unidades acadĂŠmicas de Cozumel y Playa del Carmen y prĂłximamente de CancĂşnâ€?, subrayĂł. La contribuciĂłn de la comunidad universitaria fue reconocida en el marco de esta sesiĂłn solemne, la Mtra. Coral Castilla, el Ing. AndrĂŠs Ruiz Morcillo, secretario de PlaneaciĂłn y Desarrollo Regional y representante del Gobernador del Estado; el Dr. JosĂŠ Manuel Ă vila FernĂĄndez, representante del H. Tribunal Superior de Justicia del Estado; y el Dip. Manuel Aguilar Ortega, presidente de la Gran ComisiĂłn del Honorable Congreso del Estado, hicieron entrega de los reconocimientos a trabajadores

6

gaceta NÂş 59

junio 2013

www.uqroo.mx


administrativos, a profesores y estudiantes destacados del ĂĄrea de actividades Culturales y Deportivas, y a egresados distinguidos. “Por su gran espĂ­ritu de colaboraciĂłn, sencillez y trascenGHQFLDHQODFDOLGDGGHVXVIXQFLRQHVHQEHQHĂ€FLRGHQXHVWUD instituciĂłnâ€?, se premiĂł a MarĂ­a Teresa Chan GonzĂĄlez, a RaĂşl Alberto Carrillo Medina, a Rita Areli SĂĄnchez Brito, a Yesenia Carachuri GarcĂ­a, a Luis Fernando Alcocer Medina, a la Profra. MarĂ­a del Rosario RamĂ­rez RodrĂ­guez, al Lic. en Edu-

Sustentable de Turismo, representados por la Dra.VerĂłnica Vargas Alejo, la Mtra. Lizbeth GĂłmez ArgĂźelles y el Dr. Alfonso GonzĂĄlez DamiĂĄn, respectivamente.

caciĂłn FĂ­sica Francisco Javier SolĂ­s Ongay y a la Mtra. Abril Valencia. Recibieron reconocimiento la Lic. Nallely Thania Pereyra GarcĂ­a, Lic. Candy Magdalena HernĂĄndez Meza, Danitza Moreno Mireles, Fredy CĂłrdova Pacheco, RubĂŠn Aguilando GĂłmez, Fabiola Ă vila AvilĂŠs, Alexis Viera Clarke, Alberto Cardona LĂĄzaro y Alexa Viera Clarke.

Especial menciĂłn se otorgĂł al cineasta JerĂłnimo de la Mora Campos y a la DivisiĂłn de Desarrollo Sustentable, Cozumel, por el cortometraje “Campamento fĂ­lmico: factor gĂŠminisâ€?. Un cortometraje que apoyĂł la integraciĂłn de estudiantes, profesores y personal administrativo de la universidad, y que fue aceptado para competir en el Festival de Cannes 2013, y ha sido sometido a otros concursos

Asimismo, la UQROO reconociĂł al Dr. Juan Carlos Angulo GonzĂĄlez, representante de la FundaciĂłn Universitaria, por contribuir al ĂŠxito de un proyecto de la dimensiĂłn de la Universidad de Quintana Roo; asĂ­ como a Mario RendĂłn Monforte, al Mtro. Luis GermĂĄn SĂĄnchez y Luis GarcĂ­a Silva, por su apoyo indispensable dentro del Patronato, organismo TXHDGPLQLVWUDGHPDQHUDHĂ€FD]\WUDQVSDUHQWHORVELHQHV institucionales, con el propĂłsito no sĂłlo de conservarlos VLQRGHKDFHUORVFUHFHUHQEHQHĂ€FLRGHOSUR\HFWRLQWHJUDO universitario. Las academias de profesores-investigadores destacadas fueron reconocidas por obtener altos estĂĄndares de calidad, gracias al esfuerzo de sus profesores y a la pertinencia de sus programas acadĂŠmicos; en particular la academia de la carrera de IngenierĂ­a en Redes, representada por Laura DĂĄvalos Castilla y los comitĂŠ acadĂŠmicos de las maestrĂ­as EnseĂąanza de las MatemĂĄticas, EducaciĂłn, y GestiĂłn

nacionales e internacionales de cine, contribuyendo asĂ­ a proyectar la imagen de nuestra instituciĂłn en el mundo. Merecieron un reconocimiento especial los acadĂŠmicos que han obtenido un premio nacional o internacional, y que han destacado por su trayectoria acadĂŠmica y colaboraciĂłn en esta casa de estudios: Dr. Francisco Javier GĂźemes

gaceta NÂş 59

junio 2013

7


Ricalde, Lic. Sergio Gloedi Bravo Arana, Dr. Alfonso GonzĂĄlez DamiĂĄn y Dr. Carlos Alberto NiĂąo Torres. El Dr. Fernando Cabrera fue distinguido por su invaluable apoyo y destacada trayectoria como integrante y presidente de la H. Junta Directiva de nuestra instituciĂłn durante el periodo 2011-2012. Medallas por 20, 15, 10 y 5 aĂąos de servicio

CĂĄrdenas Cahuich, Samuel MorfĂ­n GĂłmez, AdĂĄn Yam Ă vila, Gabriel del Ă ngel Delgado RodrĂ­guez, Roberto DelfĂ­n Sosa, Julia Manzanares GarcĂ­a, Julio Rangel Chulin MarĂ­n, Elda Teresa de JesĂşs Pacheco Fabro, Gabriel Alvarado Chan, Rosa MarĂ­a Salas MartĂ­nez, MarĂ­a de Guadalupe CuĂŠllar Espadas, Ana Beatriz GarcĂ­a Chan, Lila GarcĂ­a Ă lvarez, Miguel Hugo Panting TreviĂąo, Nidelvia NoemĂ­ Shultz Villanueva y Jorge Enrique Canul Uh.

Para cerrar con broche de oro, por su valiosa labor ininterrumpida se entregaron medallas de reconocimiento a las y los trabajadores docentes y administrativos que en esta fecha cumplieron 20, 15, 10 y 5 aĂąos de prestar su esfuerzo profesional cotidiano a la instituciĂłn.

Por 15 aĂąos de servicio: Daniela PĂŠrez NĂĄjera, BĂĄrbara Angely Villalobos Bautista, Roberto Javier EscĂĄrcega Ojeda, Blanca Aurora Alonzo Ruiz, Israel Cruz RodrĂ­guez, JosĂŠ Armando Rovelo PeĂąalver y Saydi Selene Coob Canto.

Por 20 aĂąos de servicio: David VelĂĄzquez Torres, MarĂ­a /RXUGHV &DVWLOOR 9LOODQXHYD $QWRQLR +LJXHUD %RQĂ€O Francisco Javier GĂźemes Ricalde, RaĂşl ArĂ­stides PĂŠrez Aguilar, Roberta Castillo MartĂ­nez, Ana Laura Ucan Yeladaqui, CĂŠsar Guadalupe LeĂłn HernĂĄndez, Edwin Patricio Torres Fritz, JosĂŠ Manuel RodrĂ­guez Casanova, Luis GonzĂĄlez Pacheco RodrĂ­guez, Norma Aracely

8

gaceta NÂş 59

junio 2013

Por 10 aĂąos: Rosymar Illescas Rivero, Gustavo Adolfo MagaĂąa Salazar, MarĂ­a del Consuelo YĂĄĂąez YĂĄĂąez, Roberto Acosta Olea, Amparo Reyes VelĂĄzquez, VĂ­ctor Manuel SĂĄnchez Huerta, Elvira RodrĂ­guez Paniagua, Ana Bertha JimĂŠnez Castro, Sandra ValdĂŠs HernĂĄndez, Felipe HernĂĄndez GonzĂĄlez, Yesenia FernĂĄndez HernĂĄndez, MarĂ­a Vetzabet Dzul, Argelia PeĂąa Aguilar, Fernando (GVRQ 0RQWDOYR 3pUH] -RVHĂ€QD %DxR] 2UWL] 0DUWKD Irene Mcliberty Pacheco, LĂĄzaro MarĂ­n MarĂ­n, XĂłchitl Ballesteros PĂŠrez, Ever Marcelino Canul GĂłngora, Daniel Haran Carballo Cahuich, JosĂŠ Manuel CarriĂłn JimĂŠnez, IzcĂłatl BuendĂ­a Cabrera, CristĂłbal Arcos MĂŠndez, Sergio Emiliano Panting GutiĂŠrrez. Por cinco aĂąos: Isela Marisol Mena BriceĂąo, Francisco Montes De Oca Garro, Mercedes Minerva MarĂ­n Montes, Eduardo Rafael ChalĂŠ Sifuentes, Ă ngel Fernando Carrillo Barbudo, Lidia Maribel Esquivel Chan y William Enrique Paredes Benavides.


Encuentro deportivo de Aniversario Como cada aĂąo, la celebraciĂłn del veintidĂłs aniversario de la fundaciĂłn de la universidad se llevĂł a las canchas. AhĂ­, equipos mixtos en el basquetbol y varoniles en el futbol,

de los administrativos. En la banca no habĂ­a dualidad, todos compaĂąeros. En la cancha las mentes trabajaban para organizar el mejor ataque y la feroz defensa. conformados por trabajadores acadĂŠmicos y administrativos, sostuvieron reĂąidos encuentros. El partido de basquetbol estuvo lleno de emociones. Dos equipos mixtos fueron con todo, en la porra lideraba la Dra. Bonnie Campos; en la cancha, Rosario Escalante, Chary, dirigĂ­a el equipo de los administrativos con casaca verde, y Melissa Blanqueto a los docentes, de camisa color naranja. 6XGRU\JDUUDGHĂ€QLHURQORVSULPHURVFXDUWRVODGLIHUHQFLD se empezĂł a marcar luego del tercer cuarto, pues la certeza \WLQRIDYRUHFLyDOHTXLSRFRORUYHUGH$OĂ€QDOHOQ~PHURGH FDQDVWDV GHĂ€QLy DO HTXLSR GH FRPSDxHUDV \ FRPSDxHURV administrativos como los campeones, 49 contra 34 fue el PDUFDGRUGHĂ€QLWLYR

El balĂłn girĂł, advirtiendo del inicio tan esperando encuentro. Muy temprano sonĂł el silbato del juez de cancha anunciando el primer gol, los administrativo se ponĂ­an a la cabeza; no obstante, el partido seguĂ­a parejo en cuanto a posesiĂłn de balĂłn y llegadas con peligro de gol. Entre los 10 y 15 minutos del segundo tiempo, la luna llena adornĂł el cielo y algunos compaĂąeros, de ambos EDQGRV DGRUQDEDQ OD FDQFKD HO FDQVDQFLR VH UHĂ HMDED en el rostro de los jugadores, el juego perdĂ­a ritmo, las piernas coordinaciĂłn. Sin embargo, tres goles caerĂ­an para sepultar toda aspiraciĂłn docente a la gran copa de la victoria.

Paralelamente, en la cancha de fĂştbol la tarde dejaba ver el color de dos camisetas: verdes de los docentes y naranjas

El segundo tanto para la banda administrativa estuvo a cargo de Rafa (compaĂąero que anotĂł tambiĂŠn el primer gol y estĂĄ adscrito al ĂĄrea de inventarios); para entonces los docentes presionaron e imprimiendo orgullo, JosĂŠ Luis Esparza, ariete creativo, realizĂł varias jugadas que

gaceta NÂş 59

junio 2013

9


prometían; asimismo, el empuje de Omar Yam y Benito Prezas (de la División de Ciencias e Ingeniería) puso en peligro más de cinco veces a la portería, bien cuidada por el compañero Iván Euan Kantún, de la División de Ciencias Sociales Económico Administrativas. El tercer gol vino de una serie de rebotes e imprecisiones, así, el balón cayó como del cielo hacia el compañero Heriberto López Platas, quien no dudó en descargar un certero tiro hacia el fondo de la red. Terminaba el partido, vino un centro desde media cancha que Heriberto apechugó y, como con la mano, puso un pase para Raciel quien disparó de pierna derecha techando al portero, gol y cuarto tanto. Así las cosas, un año más en que los administrativos levantaron la copa, que fue entregada por la rectora de la UQROO, Mtra. Elina Coral Castilla. En suma, buenos partidos, ningún lesionado, excelente convivencia, deliciosos tacos y un feliz cumpleaños para la Universidad de Quintana Roo. Primer Maratón Familiar Universitario Viento fresco, cielo nublado y un sol esporádico, pobló la mañana del 1 de junio de 2013. En las inmediaciones de la Universidad de Quintana Roo, el equipo de Deportes de Bienestar Estudiantil realizaba los preparativos para lo que fue el Primer Maratón Familiar Universitario, como parte de las actividades conmemorativas del veintidós aniversario de la fundación de la UQROO. Las familias reunidas lucían su camisa con el logo de la Universidad de Quintana Roo y su respectivo número de competición, las aguas ya en las neveras, los jueces de pista

10

gaceta Nº 59

junio 2013

en sus lugares, todo listo. Previamente, la compañera Bárbara Clark indicó los ejercicios de calentamiento. La carrera pedestre representaba todo un reto, pues los deportistas correrían alrededor de cuatro kilómetros. El contingente de familias arrancó justo al disparo de salida, la rectora de la Universidad de Quintana Roo, Mtra. Elina Coral Castilla, fue la encargada de encabezar el contingente integrado por directivos, administrativos y docentes universitarios, cada uno de ellos acompañados por sus parejas, sus hijas e hijos, por sus hermanas y hermanos, o por sus nietos, todos con una sola idea en mente: terminar con el mejor de los tiempos. Sin embargo la ruta no fue nada fácil: partiendo frente al muelle de la UQROO, los deportistas tuvieron que rodear hasta el segundo retorno (rumbo a Calderitas) para volver y seguir por la avenida Ignacio Comonfort, retornar justo en la avenida Universidad y de regreso pasar frente al Centro Internacional de Negocios y Convenciones, rodear la glorieta de los manatíes y llegar a la meta. Los ganadores de la carrera en las categorías individual, varonil y femenil, fueron: Jairo Almaraz, Josue Luna y Guillermo Hernández; así como, Arandy Rivas Romero, Marieli Miss y Guadalupe Atilano González. Así, esa mañana se vistió de alegría y convivencia, nadie se salvó de sudar la gota gorda, sin excepción, todos formaron parte de la actividad ya sea corriendo u organizando; incluso los más pequeños (dentro de carriolas y carritos empujados por sus padres) se integraron a éste, que fue el primero de muchos maratones familiares de la comunidad universitaria. ”


r sa de los vientos

Primera generaciĂłn de Medicina, EnfermerĂ­a y Farmacia culminan ciclos clĂ­nicos*

M

# No termina aquĂ­ su camino, advierte la rectora

uy buenas noches a todos los que hoy nos acompaĂąan en este acto, que constituye un capĂ­tulo importante en la vida de nuestra joven universidad.

PHQWHFDOLĂ€FDGRHVXQRGHORVHOHPHQWRVGHPD\RUUHOHYDQcia, objetivo que nuestro gobernador, el Lic. Roberto Borge $QJXORKDFRQĂ€DGRDODVLQVWLWXFLRQHVGHHGXFDFLyQVXSHULRU

Hoy nos hemos dado cita para ser testigos de un momento crucial en la vida de los profesionales de la salud formados en nuestras aulas y cuyos conocimientos se nutrieron en los laboratorios y en los hospitales de nuestro HVWDGR0HUHĂ€HURDODWHUPLQDFLyQGHORVFLFORVFOtQLFRV de 64 estudiantes de la DivisiĂłn de Ciencias de la Salud.

Comprometidos con esta encomienda, hemos trabajado arduamente para garantizar servicios educativos de calidad HQOD8QLYHUVLGDGGH4XLQWDQD5RRFRQODĂ€QDOLGDGGHTXH los jĂłvenes encuentren las opo rtunidades educativas acordes a las demandas sociales de nuestros quintanarroenses. Por un mejor futuro para Quintana Roo, esta casa de estudios ha conjuntado voluntades y tendencias para propiciar la formaciĂłn de profesionales de la salud en Medicina, EnfermerĂ­a y Farmacia.

Hoy, cinco alumnos de Enfermería, siete de Farmacia y 52 de Medicina concluyen una de sus primeras incursiones en la realidad profesional que serå parte de su quehacer en un futuro muy cercano. A todos los felicito y reconozco porque al enriquecer su formación como profesionales de la salud contribuyen activamente al desarrollo de nuestro estado, para bien de los quintanarroenses. 4XLQWDQD5RRKDVLGR\VHJXLUiVLHQGRHODUWtÀFHGHVX propio desarrollo. La formación de capital humano alta-

La División de Ciencias de la Salud fue creada para brindar atención a los problemas de salud de la población, pero tambiÊn para desarrollar acciones que en el futuro inmediato y mediato abran nuevas posibilidades para el desarrollo FLHQWtÀFR\WHFQROyJLFRYLQFXODQGRODIRUPDFLyQGHORVUHcursos humanos con líneas de generación y desarrollo del conocimiento.

4EPEFVEWHIPE1XVE)PMRE)P½'SVEP'EWXMPPEVIGXSVEHIPE9RMZIVWMHEHHI5YMRXERE6SSIRPEGIVIQSRMES½GMEPHIXIVQMREGMzR HIGMGPSWGPuRMGSWHIPETVMQIVEKIRIVEGMzRHI1IHMGMRE)RJIVQIVuE]*EVQEGMEHIPE9RMZIVWMHEHHI5YMRXERE6SSVIEPM^EHEIP HIQE]SHIP *

www.uqroo.mx

gaceta NÂş 59

junio 2013

11


Desde que asumimos el reto de emprender acciones para incursionar en los esfuerzos por mejorar la salud de los quintanarroenses, la formación de los recursos humanos para la salud ha sido tomada, en la universidad, como una responsabilidad que va mås allå de formar solamente mÊdicos. Estamos conscientes de la gran necesidad de replantear y formar a otros actores que colaboran de manera importante en el campo de la salud, como el personal de enfermería y farmacia en una primera etapa, y ya trabajamos para que en un IXWXUR VXUMDQ RWUDV ÀJXUDV SURIHsionales en el pregrado y posgrado, que nos permitirån atender múltiples aspectos de la vida humana en lo individual y lo colectivo. Estimados estudiantes, es importante seùalar que el día de hoy en el campo de los hechos deberån demostrar las capacidades y competencias adquiridas en estos aùos

12

gaceta NÂş 59

junio 2013

en los laboratorios y en las aulas; en sus manos estarå la salud de los quintanarroenses y el futuro de los servicios de salud; la propuesta acadÊmica diseùada para ustedes WXYRFRPRREMHWLYRPHMRUDUHQORWpFQLFR\FLHQWtÀFRDVt como darles una formación integral como profesionales de la salud, pero aquí no se acaba su preparación acadÊmica, tienen toda una vida para continuar preparåndose, ya que los avances en la medicina son permanentes e inacabados; la investigación día a día nos reporta nuevos conocimientos. SÊ de antemano que sabrån poner en alto el nombre de su alma måter con Êtica, con buena actitud y buenas pråcticas profesionales. ¥Adelante, jóvenes!, les deseo el mejor de los Êxitos en sus internados de pregrado y estaremos pendientes de su desempeùo en las instituciones que los reciben como primera generación de la División de Ciencias de la Salud de la Universidad de Quintana Roo. Antes de concluir, quiero hacer extensiva esta felicitación a los padres de familia, que con su apoyo y aliento han


motivado a sus hijos para que formen parte de este gran logro universitario. A las autoridades que dirigieron los campos clínicos de los Hospitales Generales Regionales 17 y 18 de Solidaridad, Cancún y Cozumel, del Hospital General Jesús Kumate de Cancún, del Hospital Materno Infantil, Hospital Naval, Enfermería Militar, Hospital de Medicina Familiar del IMSS, nuestro sincero agradecimiento. Asimismo reconozco la valiosa participación de los integrantes del Comité de Diseño Curricular por su gran labor y dedicación en la elaboración de los planes de estudios de la carrera de Medicina: Dr. Manuel Aguilar Ortega y Dr. Saúl Badillo Perry, de la Secretaría Estatal de Salud Dr. Marco Romano Quintanilla, de la Asociación Médica de Chetumal Dra. Lourdes Rojas Armadillo, del Instituto Mexicano del Seguro Social Dr. Lucio Lastra Lastra, del ISSSTE Dr. Francisco Montes de Oca Garro y la Dra. Addy Rodríguez Betanzos, de la Universidad de Quintana Roo Dr. José Eduardo San Esteban Sosa, de la UNAM

También agradecemos el invaluable apoyo a la Asociación Mexicana de Facultades y Escuelas de Medicina (AMFEM), en especial a su presidente el Dr. Juan Víctor Manuel Lara Vélez y al Dr. José Manuel Álvarez Manilla y de la Peña, por sus comentarios al plan de estudios. De la licenciatura en Farmacia: A la Dra. Carmen Giral Barnez, de la Facultad de Química de la UNAM

Dr. Alejandro Nieto Rodríguez, de la Facultad de Farmacia de la Universidad Autónoma Estado de Morelos y la Facultad de Estudios Superiores de Zaragoza de la UNAM De la licenciatura en Enfermería: A la Lic. en Enfermería Graciela Castro Rodríguez, exprofesora de la Facultad de Estudios Superiores de Zaragoza de la UNAM

Asimismo es de gran relevancia reconocer la entrega y profesionalismo de los docentes, que han compartido generosamente sus conocimientos con nuestros estudiantes que culminan su ciclo clínico. El día de hoy, con esta ceremonia realizaremos el paso de la luz, renovando una tradición, y hago propicia la oportunidad de reiterar el compromiso con nuestra tierra. Con gran orgullo universitario, por el progreso de Quintana Roo. )UXFWLÀFDUODUD]yQWUDVFHQGHUQXHVWUDFXOWXUD Muchas gracias ”

gaceta Nº 59

junio 2013

13

13


r sa de los vientos

Nueve IES de la entidad rubrican convenio para impulsar la evaluación de los municipios

# La firma, para participar en la “Agenda Desde lo local” # La UQROO, pionera; participa desde 2005

E n el marco del programa Agenda desde lo Local se sus-

cribió, el 7 de mayo del 2103, un convenio entre el Gobierno de Quintana Roo y nueve instituciones de educación superior, la UQROO entre ellas, con la Secretaría de Gobernación a través del Instituto Nacional para el Federalismo y el Desarrollo Municipal (Inafed). Cabe hacer mención que la Universidad de Quintana Roo ha participado en este programa desde 2005, y en 2007

se sumó la Universidad del Caribe. A partir de este año serán nueve las IES participantes al integrarse las siguientes: la Universidad Intercultural Maya, el Instituto Tecnológico de Chetumal, el Instituto Tecnológico de Estudios Superiores de Felipe Carrillo Puerto, las Universidades Tecnológicas de Chetumal, de Cancún y de la Riviera Maya así como la Universidad Politécnica de Bacalar Este programa se origina en los compromisos contraídos en la denominada Agenda XXI de la Organización de Naciones Unidas, cuyo objetivo es contribuir a mejorar las capacidades técnicas y administrativas de los gobiernos locales y asegurar un mejor desempeño en la atención a la ciudadanía. El Inafed, por su parte, busca establecer los procedimientos de planeación, enlace, comunicación y acuerdo, que permitan la coordinación

14

gaceta Nº 59

junio 2013

www.uqroo.mx


adecuada de las políticas públicas, estrategias y acciones en el åmbito del federalismo. En la entidad corresponde a la Secretaría TÊcnica del Gabinete la función de capacitación y seguimiento a los compromisos de los ayuntamientos y al proceso de veULÀFDFLyQ SDUD OR FXDO FRODERUD HVWUHFKDPHQWH FRQ ODV instituciones de educación superior. En entrevista, la Mtra. Pilar Barradas Miranda, responsable de la operación del programa por parte de la Universidad de Quintana Roo, explicó que en el FRQYHQLR PDUFR ÀUPDGR VH FRQVLGHUDQ ODV DFFLRQHV necesarias para que las instituciones de educación VXSHULRU UHDOLFHQ ORV WUDEDMRV GH YHULÀFDFLyQ HQ ORV ayuntamientos, con el objetivo de asegurar que cumplan con una serie de lineamientos båsicos, similares en todo el territorio nacional.

www.uqroo.mx

La revisiĂłn de la llamada Agenda Municipal incluye cuatro grandes apartados que consideran la totalidad de la gestiĂłn del ayuntamiento: 1.Desarrollo Institucional para un Buen Gobierno, 2. Desarrollo EconĂłmico Sostenible, 3. Desarrollo Social Incluyente, 4. Desarrollo Ambiental Sustentable. /RV D\XQWDPLHQWRV UHFLEHQ XQD FHUWLĂ€FDFLyQ SRU FDGD XQRGHORVLQGLFDGRUHVTXHFDOLĂ€TXHQHQYHUGH\DTXHOORV TXHORJUDQFDOLĂ€FDUHQWRGRVUHFLEHQDGHPiVXQUHFRQRcimiento nacional denominado “Premio al Buen Gobierno Municipalâ€?, en el marco del Congreso Internacional sobre temas municipales que se efectĂşa cada aĂąo en nuestro paĂ­s. Las IES garantizan que los autodiagnĂłsticos de los ayuntamientos tengan las bases necesarias a travĂŠs de la revisiĂłn de evidencia documental que reĂşne para tal efecto cada uno de los municipios. ”

gaceta NÂş 59

junio 2013

15


r sa de los vientos

La Universidad de Quintana Roo en tu comunidad, Programa de Servicio Social de la DCSEA # # # #

Desarrolla acciones académicas el Cenei Taller: Desarrollo de Jóvenes Investigadores Curso de Fotografía Taller para aprender inglés

L as comunidades mayas Uh-May y X-Hazil, en Felipe

Carrillo Puerto, recibieron a estudiantes de la Universidad de Quintana Roo que les prestaron diversos servicios del 11 de mayo al 8 de junio de 2013, como parte del Programa de Servicios Social Voluntario de la División de Ciencias Sociales Económico Administrativas (DCSEA) en el que participaron también docentes y trabajadores del Bufete Jurídico, del Centro de Estudios Interculturales y del Laboratorio Universitario de Publicidad. Este programa fue coordinado por el M. C. Edgar Sansores Guerrero, director de la DCSEA y tuvo como objetivo sensibilizar a los jóvenes universitarios en la prestación del servicio social comunitario.

Entre las acciones que desarrollaron en las comunidades, el Centro de Estudios Interculturales organizó actividades de integración, como danza, deporte, cultura y música, así como de concientización del cuidado del medioambiente; el Bufete Jurídico, adscrito al Departamento de Ciencias Jurídicas, ofreció un curso-taller sobre Derecho y

16

gaceta Nº 59

junio 2013

obligaciones ejidales y dio asesorías sobre controversias en materia civil; y el Laboratorio de Publicidad impartió un curso de capacitación sobre Estudios de mercadotecnia y marketing social en comunidades marginales. Las autoridades de las comunidades Uh-May y X-Hazil Sur, ambas del municipio Felipe Carrillo Puerto, en coordinación con la DCSEA presidieron la clausura del programa universitario Servicio Social Voluntario el 8 de junio en el parque principal de Uh-May, en un evento que incluyó velada cultural, exposiciones de los trabajos realizados durante los talleres y un encuentro deportivo. El cierre se llevó a cabo en el marco de las jornadas de limpieza realizada en la comunidad. Participaron en este programa los siguientes alumnos vinculados con el Centro de Estudios Interculturales: Rebeca Tamayo Miss, Ruby Puc Tamayo, Oscar Yeh Chan, Sergio Yeh Chan, Luis Ángel Fernández Domínguez, Andrea Rivas de Ocampo, Maribel Tamay Cahum, Rocío Poot Cruz y Bonnie Damaris Tun Cruz; y con el Laboratorio de Publicidad: Omar Bladimir Yeh Ku, Perla Chin Alamilla, Jorge Raúl Chan Hau, Ana Mayra Cohuo Cohuo, Sanjuana Ivonne Rodríguez Martínez e Ilka Esmeralda May Herrera. El Bufete Jurídico estuvo representado por las alumnas Andrea Yamili Rivas de Ocampo, Maurilia Abigail Góngora Sánchez, Ilse Dilian Tuyub Tzuc, Cinthia Lizeth Melgarejo Osorio, Larisa Noemí Medina Llanes, Irsel Herrera Cauich, y Selene del

www.uqroo.mx


Valle Huerta. También participaron los maestros Ever Canul Góngora, Wilberth Ucan Yeh y la Mtra. María Elena Cruz Cáceres; las licenciadas Yesenia Fernández Hernández, Gloria García García, Areli Sánchez Brito, María José Medina Novelo, Karen Cervantes Colli y el Lic. Heriberto López Platas; el Dr. Enrique Coraza de los Santos y la Dra. Erika Coria, la Mtra. Patricia Beltrán y el Mtro. Carlos Moisés Herrera Mejía. También colaboraron la Lic. Bárbara Villalobos Bautista, el Lic. Merino Ureña Huerta y Ricardo Adolfo Jesús Rivas, del Bufete Jurídico Universitario.

universitario y le dio la oportunidad de poner en práctica los conocimientos adquiridos en el aula; considera que esta actividad fortaleció el trabajo entre el equipo que participó en el proyecto. Taller Desarrollo de Jóvenes Investigadores

Para dotar de las herramientas metodológicas a los jóvenes investigadores que necesitan elaborar sus anteproyectos de investigaEstas actividades fortalecen la formación integral de los ción, el Centro de Estudios estudiantes y contribuye a la vinculación de la universidad Interculturales (Cenei) orgacon las comunidades indígenas de nuestro estado. Omar nizó el taller Desarrollo de Yeh Ku, estudiante de la carrera de Sistemas Comerciales, Jóvenes Investigadores el 31 de mayo del 2013, en la Sala expresó que fue una experiencia que le permitió a él de Juntas de la División de Ciencias Sociales y Económico y a sus compañeros ver la realidad fuera del contexto Administrativas (DCSEA).

gaceta Nº 59

junio 2013

17


El taller fue impartido por las profesoras adscritas a la DCSEA, Dra. María de Jesús Pérez Hervert, M.C. Jacqueline Ganzo Olivares, Dra. Itzel Arriaga Hurtado y Dra. Erika Coria. Cabe destacar que este taller forma parte de los cursos de capacitación que el Centro de Estudios Interculturales tiene programado para los estudiantes adscritos a la Unidad de Apoyo Académico para Estudiantes Indígenas. Curso de Fotografía Con el objetivo de proporcionar elementos básicos de fotografía digital con aplicaciones en diferentes ámbitos, a través del Centro de Estudios Interculturales (Cenei) de la Universidad de Quintana Roo, se llevó a cabo el curso de Fotografía Digital, impartido por el Lic. Heriberto López Platas, responsable del Laboratorio Universitario de Publicidad, de la UQROO. El titular del Cenei, Mtro. Ever Canul Góngora, explicó TXHHVWHFXUVRWLHQHFRPRÀQDOLGDGIRUWDOHFHUODFDSDFL-

Curso-taller Estrategias para aprender Inglés Estudiantes adscritos al Centro de Estudios Interculturales (Cenei) recibieron el curso-taller Estrategias para Aprender Inglés, impartido por la Mtra. Sandra Valdés Hernández, profesora adscrita al Departamento de Lengua y Educación de la División de Ciencias Políticas y Humanidades, del 20 al 24 de mayo de 2013. En la apertura del curso, el Mtro. Ever Canul Góngora, jefe del Cenei, recordó el importante avance de la universidad en materia intercultural, así como la evolución y el renombre que ha ganado este proyecto dirigido a estudiantes indígenas, todo gracias al trabajo y a la suma de voluntades, en este caso de profesores que creen en el proyecto y contribuyen con su conocimiento.

tación de los estudiantes que forman parte de la Unidad de Apoyo Académico para Estudiantes Indígenas: “Nos preocupamos por llevar cursos de capacitación, con el apoyo de los académicos y personas especializadas que coadyuven en la formación integral de los estudiantes”, expresó. Cabe hacer mención que este curso se dividió en sesiones de dos a tres horas diarias, con prácticas en lugares aledaños; una sesión fue por la noche para la toma de fotografías nocturnas y uso del tripié.

18

gaceta Nº 59

junio 2013

Curso Técnicas de Estudio y Aprendizaje Acelerado En la Sala de Juntas de la División de Ciencias Sociales y Económico Administrativas (DCSEA), se llevó a cabo el curso Técnicas de Estudio y Aprendizaje Acelerado, impartido por la Dra. Itzel Arriaga Huerta, del 22 de abril al 3 de mayo de 2013. Este curso forma parte de los cursos de capacitación que el Cenei impartirá para los estudiantes de la Unidad de Apoyo Académico para Estudiantes Indígenas (UAAEI) y personas interesadas.”


r sa de los vientos

Intensa actividad del programa PromociĂłn de una Vida Sana

# ANUIES impartiĂł curso sobre inteligencia emocional # Escuela para Padres propicia exitoso diĂĄlogo entre padres e hijos # Promotores de salud reciben curso # Participa la universidad en marcha antitabaco

E

n el marco del programa institucional PromociĂłn de una Vida Sana entre la comunidad de la Universidad de Quintana Roo, como una estrategia para la prevenciĂłn de adicciones y los problemas que conlleva, la Unidad de Salud, adscrita a la DirecciĂłn General de Bienestar Estudiantil, realizĂł diversas actividades dirigidas tanto a estudiantes como a madres y padres de familia.

ciertas habilidades para la vida que son necesarias para un desarrollo profesional exitoso en el contexto social y econĂłmico actual. Los participantes aprendieron algunas tĂŠcnicas para ejercitar esas habilidades y reconocieron la importancia de la docencia en su desarrollo.

Cabe destacar que estas actividades son permanentes y que su incidencia en la vida cotidiana de los estudiantes es cada vez mayor, toda vez que la participaciĂłn universitaria es cada vez mĂĄs numerosa en charlas y conferencias, asĂ­ como en el involucramiento de los jĂłvenes en programas de acciĂłn ciudadana, como es el de Promotores de Salud. Curso sobre inteligencia emocional “La inteligencia emocional y las habilidades para la vida en el ĂŠxito profesionalâ€? fue el tĂ­tulo del curso impartido por el Dr. Miguel Quiroga Plaza, de la AsociaciĂłn Nacional de Universidades e Instituciones de EducaciĂłn Superior (ANUIES), a travĂŠs de la Unidad de Salud de la DGBE, los dĂ­as 15, 16 y 17 de mayo de 2013, en la Sala de Rectores de la Universidad de Quintana Roo.

Se entiende por inteligencia emocional a una serie de actividades que sirven para apreciar y expresar de manera justa nuestras propias emociones y las de otros, y para HPSOHDUQXHVWUDVHQVLELOLGDGDĂ€QGHPRWLYDUQRVSODQLĂ€FDU y realizar de manera cabal nuestra vida.

La presentaciĂłn estuvo a cargo de la Mtra. Guadalupe CuĂŠllar Espadas, directora general de Bienestar Estudiantil. El curso tuvo por objetivo ofrecer una visiĂłn amplia y clara de las competencias en inteligencia emocional y

Cabe destacar que esta actividad mereciĂł comentarios laudatorios de los participantes, tanto por la calidad del curso como por la organizaciĂłn y atenciĂłn que recibieron de los organizadores.

www.uqroo.mx

gaceta NÂş 59

junio 2013

19


Escuela para Padres analizĂł temas fundamentales Con el tema “CĂłmo contribuyo a la autoestima, autoconcepto y autonomĂ­a de mis hijos universitariosâ€?, el 26 de abril del 2013 se realizĂł en el Aula Magna I, la plĂĄtica con los padres de familia de los estudiantes de la UQROO calendarizada dentro del programa Escuela para Padres. De acuerdo con lo expresado por los numerosos participantes, el tema fue de gran interĂŠs. La psicĂłloga Flor Camelia MartĂ­nez, conductora de la sesiĂłn, propiciĂł una retroalimentaciĂłn entre hijos y padres, dado que se contĂł con la asistencia de jĂłvenes alumnos, lo que generĂł un clima familiar, emotivo y sobre todo de intenso diĂĄlogo y anĂĄlisis sobre las formas, estilos y comportamientos que se tienen en el ĂĄmbito familiar y de sus efectos positivos y negativos. Como en cada sesiĂłn, las madres y los padres de familia manifestaron su reconocimiento y satisfacciĂłn por este tipo de actividades que no sĂłlo les retroalimentan en la experiencia de ser padres, sino les facilitan herramientas prĂĄcticas para mejorar la comunicaciĂłn, las relaciones y dinĂĄmica familiar de la vida diaria.

Cabe seĂąalar que el propĂłsito de estas reuniones es proporcionar un espacio para que los padres de familia puedan expresar su inquietud sobre los temas que les preocupan, como las conductas de riesgo, los intereses vocacionales de los jĂłvenes, la falta de comunicaciĂłn en la familia, la falta de vivencia de valores en los jĂłvenes. Estos temas son tomados en cuenta para el desarrollo del programa Escuela para Padres. Es importante mencionar que se ha contado con la asistencia y participaciĂłn de acadĂŠmicos de la universidad, quienes han visto con agrado el programa y consi-

20

gaceta NÂş 59

junio 2013

deran de gran utilidad los temas y recomendaciones que surgen del trabajo de la psicĂłloga Flor Camelia MartĂ­nez, adscrita a la Unidad de Salud Integral. (OEDODQFHDOĂ€QDOGHODVVHVLRQHVHVVLHPSUHVDWLVIDFWRULR tanto para quienes hacen posible que este programa se desarrolle como para los padres de familia, la expectativa es que se pueda llegar cada vez a mĂĄs padres de familia y promover mĂĄs y mejores entornos familiares saludables. De igual manera, el 31 de mayo del 2013, se realizĂł la quinta charla titulada “Autoridad o lĂ­mites, ÂżcĂłmo se viven en casa?â€?. Durante dos horas los padres de familia intercambiaron opiniones y despejaron dudas sobre la forma de cĂłmo educar a sus hijos en la ĂŠpoca actual, con la asesorĂ­a de la psicĂłloga Flor Camelia MartĂ­nez y la coordinaciĂłn de la Mtra. Gloria del Carmen Bocarando Lobato, ambas adscritas a la Unidad de Salud de la DirecciĂłn General de Bienestar Estudiantil. La plĂĄtica versĂł sobre cĂłmo ha cambiado la forma como se educa a los hijos, que el tipo de educaciĂłn no es el mismo ahora que hace 40 aĂąos, en lo cual hay balances positivos y negativos. Se abundĂł sobre el pensamiento latente que prevalece en los padres de acuerdo con sus historias de vida, su entorno, su ĂŠpoca y de cĂłmo es necesario en RFDVLRQHV UHDSUHQGHU R PRGLĂ€FDU SHQVDPLHQWRV SHUR OR primero es reconocernos en nuestro estilo y formaciĂłn. La psicĂłloga enfatizĂł la diferencia entre la autoridad y el poder, donde la primera se gana a travĂŠs del trato y el ejemplo de vida, mientras que el otro es impuesto. Se manejaron premisas fundamentales que es importante tener presentes como padres tales como: los hijos necesitan un lĂ­der, un guĂ­a en casa para encontrar rumbo y direcciĂłn en su existencia. Los hijos tienen vida propia y como tal debe

www.uqroo.mx


ser respetada y atendida. La autoridad es una posiciĂłn que se obtiene desde el respeto y el acompaĂąamiento que se le da al hijo y no atribuible por imposiciĂłn, por tanto debe haber normas claras en la familia que sean del entendimiento de todos los miembros. Se dijo que debe haber consecuencias cuando se falta a las normas, acuerdos o a los lĂ­mites establecidos; que en el ejercicio de la autoridad es importante no afectar la autoestima del hijo imponiendo o minimizando sus intereses y necesidades. Asimismo, se hablĂł de la trascendencia de coartar la expresiĂłn de las emociones y cĂłmo esto impacta en el sentimiento de valĂ­a de los hijos; en la medida en que estos aspectos se atiendan se crearĂĄ un ambiente armĂłnico y se desarrollarĂĄn fuertes vĂ­nculos en la familia.

comunes, así como la creatividad como habilidades y actitudes deseables y necesarias en nuestra vida diaria. Se hizo hincapiÊ en la necesidad de hacer conciencia de que el desempeùo de la profesión supone el compromiso de transformar problemåticas del propio entorno y RUJDQL]DUDFFLRQHVHQEHQHÀFLRGHODFRPXQLGDG\TXH una manera de asumir este compromiso, prepararse para ello y ganar experiencia es participar en diferentes actividades y escenarios que ofrece la universidad; en JHQHUDOORJUDULQà XLUHQODRSLQLyQGHRWURVFRQHOÀQ GHGHVDUUROODUXQDDFWLYLGDGRFDXVDHVSHFtÀFD\GHHVWD manera constituirse en líderes universitarios.

La Unidad de Salud Integral se congratula de contar con una mayor audiencia y de mantener al grupo de madres y padres con el que iniciĂł el programa, los participantes han PRVWUDGRVXFRQĂ€DQ]DGHVGHODSULPHUDVHVLyQGH(VFXHOD SDUD 3DGUHV GRQGH OD SDUWLFLSDFLyQ ODV UHĂ H[LRQHV \ sugerencias son la constante en la dinĂĄmica de las charlas.

Fue una plåtica con un enfoque motivacional y ese fue HO HIHFWR FDXVDGR HQWUH ORV DVLVWHQWHV TXLHQHV DO ÀQDO seùalaron sentirse interesados y con expectativas. Esta plåtica estuvo a cargo de la Mtra. Gloria Bocarando, adscrita a la Unidad de Salud Integral, y del Lic. Javier Campos, responsable de la gestión del Seguro Facultativo.

Liderazgo universitario, charla para estudiantes Con el propĂłsito de ofrecer a los jĂłvenes universitarios herramientas para una participaciĂłn mĂĄs activa en su propia formaciĂłn y los elementos constitutivos del liderazgo, la Unidad de Salud ofreciĂł una plĂĄtica sobre Liderazgo universitario el 29 de mayo de 2013. En la plĂĄtica se resaltaron las cualidades y habilidades que distinguen al lĂ­der y se enfatizaron conceptos como el trabajo colaborativo, el espĂ­ritu de grupo y los objetivos

www.uqroo.mx

Las dinĂĄmicas y recursos didĂĄcticos resultaron ilustrativos y cumplieron con el cometido de informar a los jĂłvenes, quienes se mostraron activos y con apertura para realizar las actividades propuestas. Asimismo se compartieron experiencias de compaĂąeros universitarios que han dado muestra de su liderazgo, y cuya actitud es un referente que debemos dar a conocer y promover como modelo entre los alumnos. Este tipo de charlas son posibles gracias a las facilidades que los profesores otorgan a la Unidad de Salud al ceder una de sus clases para el taller de valores, promociĂłn de la salud, plĂĄticas sobre relaciones interpersonales, entre otros.

gaceta NÂş 59

junio 2013

21


La UQROO presente en la marcha del DĂ­a Mundial sin Tabaco La Universidad de Quintana Roo participĂł en la marcha conmemorativa del DĂ­a Mundial sin Tabaco, convocada por el Centro de IntegraciĂłn Juvenil, en la que concurrieron diversas instituciones educativas y de salud, el 31 de mayo del 2013, para difundir y apoyar la campaĂąa nacional dedicada a la “ProhibiciĂłn de la publicidad, promociĂłn y patrocinio del tabacoâ€?.

Promotores de salud asisten a talleres de PrevenciĂłn y ValoraciĂłn

Un contingente de alumnos participĂł en la marcha y el grupo de Bailes CaribeĂąos a cargo del Mtro. Marco Rossetti hizo su presentaciĂłn en el evento cultural. En el mĂłdulo de la UQROO se repartieron folletos informativos

sobre las consecuencias del tabaquismo para fomentar un estilo de vida saludable; tambiĂŠn se realizĂł un intercambio de dulces por cigarros entre la poblaciĂłn asistente.

22

gaceta NÂş 59

junio 2013

La Dirección General de Bienestar Estudiantil, a travÊs de la Unidad de Salud Integral, realizó los talleres de Prevención y Valoración los días 3 y 15 de PD\R UHVSHFWLYDPHQWH FRQ OD ÀQDOLGDG GH FDSDFLWDU a los promotores de la salud universitaria en la LGHQWLÀFDFLyQGHIDFWRUHVGHULHVJR\SURWHFFLyQSDUD una vida saludable. En los talleres se expusieron los daùos que puede ocasionar a corto, mediano y largo plazo el consumo de las drogas lícitas como el alcohol y el tabaco. Con esta capacitación los promotores de salud realizaron el programa de trabajo, el cual pretende abarcar a largo plazo a todos los estudiantes de la Unidad Chetumal y a las madres y padres de familia que han acudido al Programa Escuela para Padres. Con el apoyo de Centro de Integración Juvenil se continuarå reclutando a mås estudiantes para el grupo de promotores de salud. Cabe recordar que los promotores universitarios de salud son un grupo conformado a raíz de los apoyos que se recibieron del Fondo para Elevar la Calidad de la Educación Superior de las Universidades Públicas Estatales (UPE) en el 2012; con la impartición de talleres como los que en esta ocasión se les dieron, se EXVFDEHQHÀFLDUDODFRPXQLGDGXQLYHUVLWDULDPHGLDQWH la promoción efectiva de håbitos de vida saludable, enfatizando la prevención de adicciones.”


r sa de los vientos

Centro Emprendedor de Negocios promueve cultura emprendedora # Participa UQROO en III DĂ­a del Emprendedor FESE-ANUIES # PlĂĄtica y cursos en instituciones hermanas # Estudiantes de la Universidad TecnolĂłgica de Chetumal realizan estadĂ­a profesional en el Centro Emprendedor de Negocios

L a Universidad de Quintana Roo, a travĂŠs del Centro

Emprendor de Negocios, participĂł en el Tercer DĂ­a del Emprendedor 2013, organizado por la FundaciĂłn EducaciĂłn Superior Empresa (FESE) y la AsociaciĂłn Nacional de Universidades e Instituciones de EducaciĂłn Superior (ANUIES) en el World Trade Center, los dĂ­as 2 y 3 de mayo del 2013.

Estuvieron presentes el secretario general de la ANUIES, Dr. Rafael LĂłpez CastaĂąares; el Dr. Fernando Serrano MigallĂłn, subsecretario de EducaciĂłn Superior de la SEP; Mtro. Enrique Jacob Rocha; director general del Instituto Nacional del Emprendedor; Lic. Salvador Villalobos, presidente ejecutivo del Consejo de la ComunicaciĂłn; Lic. Lourdes Ruiz Lugo, directora de Fomento a la ExtensiĂłn y VinculaciĂłn de la ANUIES y Dr. Eduardo Carrillo Hoyo, director general de la FundaciĂłn EducaciĂłn Superior Empresa.

Se tratĂł de un encuentro de emprendedores de todo el paĂ­s, donde se ofrecieron conferencias, talleres y la oportunidad de tener un acercamiento con diversas instituciones de educaciĂłn superior que apoyan los emprendimientos. Se contĂł con la asistencia de mĂĄs de siete mil personas, entre Taller Simulador de Negocios alumnos, docentes, empresarios y pĂşblico en general; y se Estudiantes del segundo semestre de la licenciatura en llevaron a cabo conferencias, talleres, eventos culturales y Turismo participaron en el taller denominado Simulador seminarios, entre otras actividades. de Negocios, el 14 de mayo del 2013, impartido por el Centro Emprendedor de Negocios. Cabe mencionar que en el marco de este Tercer DĂ­a del EmprenLos estudiantes tuvieron la oportunidad dedor 2013, se llevĂł a cabo de experimentar la creaciĂłn y gestiĂłn la premiaciĂłn del Cerde una empresa, y se percataron de tamen Emprendedores la necesidad de tomar decisiones 2013, donde participaron acertadas y tener conocimientos para alumnos de diversas instiXQDDGHFXDGDSODQHDFLyQĂ€QDQFLHUDHO tuciones de educaciĂłn sudiseĂąo de un plan de mercadotecnia, perior en los rubros: Ideas organizar la producciĂłn, el manejo de de negocios, Proyectos de recursos humanos y de la competencia, emprendimiento y EmpreasĂ­ como valores ĂŠticos y morales con los sas graduadas, que respondieque debe contar un empresario. ron a problemas, necesidades y oportunidades de la sociedad. El obEl taller fue impartido por la M.A.N.F. Flor Elena jetivo del certamen fue impulsar y reconoUc Ibarra, consultora del CEN, quien cuenta con diversas cer la cultura emprendedora y la capacidad innovadora de acreditaciones por parte de instituciones de gobierno para los jĂłvenes de las instituciones de educaciĂłn superior. HOGHVDUUROORGHSUR\HFWRV\JHVWLyQGHDSR\RVĂ€QDQFLHURV

www.uqroo.mx

gaceta NÂş 59

junio 2013

23


y amplia experiencia en la elaboraciĂłn de planes de negocios, a solicitud de la M.C. Jaqueline Ganzo, profesora del ĂĄrea empresarial de la licenciatura. Es importante destacar que el Simulador de Negocios, instrumento desarrollado por la SecretarĂ­a de EconomĂ­a, es una herramienta de aprendizaje y modelizaciĂłn que permite al emprendedor experimentar la creaciĂłn y ges-

tienen la tarea de desarrollar un proyecto con repercusiĂłn favorable en las empresas que se encuentran en proceso de incubaciĂłn dentro del CEN, por lo que estarĂĄn trabajando en forma coordinada con los consultores y las empresas. En este proceso las alumnas lograrĂĄn mĂĄs que un documento acadĂŠmico, conocerĂĄn la realidad de los negocios de la regiĂłn y se capacitarĂĄn como futuras consultares que apoyaran al desarrollo de las pymes del estado. PlĂĄtica a alumnos del Instituto TecnolĂłgico de la Zona Maya “Financiamiento para emprendedoresâ€? fue el tĂ­tulo de la conferencia impartida a estudiantes del Instituto TecnolĂłgico de la Zona Maya por el Centro Emprendedor de Negocios el 18 de mayo del 2013.

tiĂłn de su propio proyecto empresarial en un entorno en el que no arriesga dinero. Esto le ayudarĂĄ a adquirir la experiencia necesaria para aprender a distinguir lo importante de lo accesorio cuando se trata de desarrollar una empresa. Cabe recordar que el Centro Emprendedor de Negocios estĂĄ adscrito al Departamento de EducaciĂłn Continua y Proyectos de la DirecciĂłn General de VinculaciĂłn y ExtensiĂłn de la Universidad. Su objetivo es vincular a la universidad con la sociedad mediante el desarrollo de una cultura emprendedora que promueva la generaciĂłn y crecimiento de nuevas empresas que basen su competitividad en la innovaciĂłn tecnolĂłgica y administrativa, y que los estudiantes universitarios participen en proyectos de desarrollo social y productivo. Estudiantes de la Universidad TecnolĂłgica de Chetumal realizan estadĂ­a profesional en el Centro Emprendedor de Negocios El Centro Emprendedor de Negocios (CEN) recibiĂł a tres estudiantes para que realicen su estadĂ­a profesional durante el cuatrimestre mayo-agosto del 2013. Las estudiantes cursan la carrera de TĂŠcnico Superior Universitario en Desarrollo de Negocios, ĂĄrea Mercadotecnia,

24

gaceta NÂş 59

junio 2013

La conferencia estuvo a cargo del M.A. Rogelio Yåùez Espadas, responsable del Centro Emprendedor de Negocios (CEN), ante una audiencia de aproximadamente 50 alumnos de la carrera de Ingeniería en Gestión (PSUHVDULDO(QODFRQIHUHQFLDVHH[SXVRHOÀQDQFLDPLHQWR de pymes en MÊxico y fueron presentados diversos UHFXUVRV GH ÀQDQFLDFLyQ SDUD LQLFLDU XQ QHJRFLR R capitalizar uno en funcionamiento. De igual manera, se dio a conocer al Instituto Nacional del Emprendedor (Inadem) y los programas que maneja, que como parte medular del gobierno federal apoya al desarrollo de las pymes. Generaron especial interÊs los programas del Inadem, así como el Crowdfunding y las estrategias para implementar este sistema en proyectos que requieren pequeùos montos de capitalización. 3DUD ÀQDOL]DU VH SUHVHQWy HO 3URJUDPD GH ,QFXEDFLyQ de Empresas y los apoyos que se brindan en asesoría y consultoría en desarrollo de planes de negocios, cursos de capacitación y orientación para la vinculación con IXHQWHVGHÀQDQFLDPLHQWR Cabe mencionar que las conferencias, cursos y talleres, forman parte de los servicios que presta el CEN a la FRPXQLGDG XQLYHUVLWDULD \ S~EOLFR HQ JHQHUDO FRQ HO ÀQ de promover la cultura emprendedora.” 4SV0MG+PSVME3PMZIVE>EZEPIXE


www.uqroo.mx

UQROOKDFLDODFHUWLÀFDFLyQHQ(TXLGDGGH*pQHUR # Inició la aplicación del Modelo en noviembre del 2012 # Se proyecta obtener la certificación a finales del 2013

4SV1'%RKIPMRE=EL8SVVIW 'SSVHMREHSVEHIP'SQMXq-RWXMXYGMSREPHI)UYMHEHHI+qRIVS

C

on la instalación del Comité de Equidad de Género y la implementación del Modelo de Equidad de Género en la Universidad de Quintana Roo se iniciaron las acciones para prevenir y erradicar toda forma de discriminación, violencia, acoso y hostigamiento, así como promover la igualdad de derechos y oportunidades entre hombres y mujeres que laboran en la Universidad de Quintana Roo, como una política de esta institución educativa.

y erradicando toda forma de discriminación, violencia, acoso y hostigamiento; promoviendo la igualdad de oportunidades entre mujeres y hombres, asegurando el equilibrio entre la vida personal y familiar de quienes integran la organización para el fortalecimiento del clima organizacional y la responsabilidad social universitaria. El Comité de Equidad de Género se instaló en el mes de noviembre de 2012 y se iniciaron los trabajos para la implementación del Modelo de Equidad de Género en la Universidad de Quintana Roo; a partir de entonces se han desarrollado acciones en ese sentido, por principio de cuentas se plasmó la Política de Equidad de Género de esta institución, que textualmente dice: en la Universidad de Quintana Roo nos comprometemos a garantizar el respeto de los derechos humanos de nuestro personal, previniendo

Asimismo, se visitaron todas las áreas administrativas y docentes de la Universidad con el objeto de dar a conocer ORV EHQHÀFLRV GHO 0RGHOR GH (TXLGDG GH *pQHUR HQ VX versión 2012 (MEG:2012) y difundir el sitio web http:// www.uqroo.mx/equidad-de-genero/ en el que se encuentra plasmada toda la información relevante de este modelo para conocimiento de la planta laboral. El Comité de Equidad de Género de la UQROO está formado por representantes de las unidades académicas de la

gaceta Nº 59

junio 2013

25


instituciĂłn y es encabezado por la rectora, Mtra. Elina Coral Castilla. EstĂĄ integrado por trece personas que laboran en esta instituciĂłn. El ComitĂŠ tiene como meta la adopciĂłn de este modelo, cuyas repercusiones son todas positivas para mejorar el clima de trabajo, las relaciones interpersonales y el respeto a los derechos humanos.

de trabajo programadas antes de la AuditorĂ­a Externa para ODFHUWLĂ€FDFLyQSURJUDPDGDSDUDĂ€QDOHVGHODxR

Siguiendo con el modelo promovido por Inmujeres, la siguiente actividad que el ComitÊ realizó para la implementación del MEG:2012 fue la aplicación de las encuestas de Clima laboral y hostigamiento sexual, a 33% de la poblaEn el mes de junio del presente aùo, el Instituto Nacio- ción administrativa y docente que labora en esta institución, nal de las Mujeres, Inmujeres, convocó a todas las insti- desagregada por sexo, con el único objeto de detectar las WXFLRQHVS~EOLFDV\SULYDGDVFRQPLUDVDODFHUWLÀFDFLyQR pråcticas que producen desigualdades o discriminación; su HQSURFHVRGHUHFHUWLÀFDFLyQHQHOPRGHORGHHTXLGDGGH objeto principal es analizar la realidad de las mujeres y los gÊnero, para dar inicio al Plan de Apoyo que otorga dicha hombres en la organización. institución federal. Esta primera mesa de trabajo se realizó Por último, es importante destacar que la Universidad de en las instalaciones de la Universidad del Caribe, a la que asistieron su propio personal, de la Universidad Tecnológi- Quintana Roo busca la incorporación de políticas de equica de la Riviera Maya, representantes de los Hoteles Cata- dad de gÊnero dirigidas a promover la no discriminación, lonia, de la empresa Dolphin Discovery, del municipio de la equidad y una mayor responsabilidad hacia todos los Cozumel y, por supuesto, de la Universidad de Quintana posibles impactos sociales que pueden de alguna manera Roo, representados por los miembros del ComitÊ de Equi- FRQWURODURLQà XHQFLDUEXVFDQGRVLWXDFLRQHVGHJDQDUJDQDU dad de GÊnero la Mtra. Ana Marleny Rivero CanchÊ, el Lic. con todos los miembros internos y externos de la organiHeyden RubÊn Herrera Medina y la Mtra. Angelina del C. zación. Labor que sin duda dependerå de cada una de las Yah Torres. Cabe destacar que fue la primera de seis mesas personas que integran esta institución educativa. ”

26

gaceta NÂş 59

junio 2013


www.uqroo.mx )PHIEFVMPHIPIP(V6EP%VuWXMHIW4qVI^%KYMPEVTVSJIWSVMRZIWXMKEHSV]HMVIGXSVHI-RZIWXMKEGMzR]4SWKVEHSHIPE9RMZIVWMHEHHI5YMRXERE6SSI\TYWS ERXIPSWQMIQFVSWHIPE%GEHIQME1I\MGEREHIPE0IRKYEIPHMWGYVWSHIVMKSVEPEWYQMVWYWMXMSGSQS1MIQFVS'SVVIWTSRHMIRXIHIPE%GEHIQMEIR5YMRXERE6SS )PWMKYMIRXIXI\XSIWYRJVEKQIRXSHIIWIHMWGYVWS4EVEUYMIRHIWIIGSRSGIVHMWJVYXEV]GSRWYPXEVIPXI\XSuRXIKVSTYIHILEGIVPSIRIPWMKYMIRXIWMXMShttp://www. academia.org.mx/sesion-publica-solemne-ingreso-de-Raul_Aristides_Perez_ Aguilar_2013-04-11.php

“MĂŠxico, el Caribe y YucatĂĄn en Quintana Roo: expresiones de herencia e identidad compartidasâ€? DISCURSO DE INGRESO A LA ACADEMIA MEXICANA DE LA LENGUA

%QMLIVQERS+YMPPIVQS  .

SeĂąoras y seĂąores acadĂŠmicos. Amigos e invitados especiales. Gran familia que me acompaĂąa. Comunidad quintanarroense.

S irva esta ocasiĂłn de contento para expresar a los miembros de la Academia

Mexicana de la Lengua mi sincera gratitud por permitirme formar parte de esta FRUSRUDFLyQHVSHFtÀFDPHQWHHQODUHGGHPLHPEURVFRUUHVSRQGLHQWHVTXHGHVGH hace varios aùos, ella ha extendido en nuestro MÊxico con objetivos y propuestas acordes con su misión y visión institucionales.

6EP%VuWXMHIW4qVI^%KYMPEV VEYTIVI^$YUVSSQ\

Sirva tambiĂŠn para agradecer a la Universidad de Quintana Roo, mi casa por mĂĄs de dos dĂŠcadas, los apoyos y encomiendas que he recibido de ella y que he podido cristalizar en las aulas y en los diversos terrenos en los que la sociedad me ha dejado aposentar y poner en prĂĄctica, con objeto de contribuir al estudio y desarrollo de nuestra identidad, mis proyectos y los productos de los mismos. Y mi familia no puede estar ajena a estos agradecimientos, pues ella toda ha contribuido de manera directa en todos mis quehaceres y ha sido, desde siempre, mi estĂ­mulo y serena motivaciĂłn para encauzar mis pasos cuando me he llegado a desubicar. No estarĂ­a completo este panorama sin hacer menciĂłn a los quintanarroenses quienes, desde sus nichos y conocimientos, han encaminado mis tareas y orientado, con sus sabias explicaciones, gran parte de lo que he escrito e investigado sobre nuestro pueblo amigo de toda esta frontera caribeĂąa, gran receptor de migrantes, gente trabajadora y heredero de una enorme tradiciĂłn indĂ­gena. Del mismo modo, extiendo estas palabras de gratitud a la Dra. ConcepciĂłn

gaceta NÂş 59

junio 2013

27


www.uqroo.mx &RPSDQ\ TXLHQ FRQ VXV VDELDV UHĂ H[LRQHV KDUi PiV gratos estos momentos al darme la bienvenida a esta magna instituciĂłn. Muchas gracias, estimada amiga y colega. [‌] Yo, como ellos, profeso idĂŠnticos sentimientos. Y por eso regresĂŠ a esta costa llana, y me prometĂ­ llevar a cabo un registro del habla de mis paisanos. Para lograrlo, hube de retomar el pequeĂąo bosquejo que un dĂ­a de 1982 le presentara al maestro Antonio AlcalĂĄ Alba (†) como proyecto de tesis de licenciatura y cuyo tĂ­tulo era mĂĄs o menos asĂ­: “El habla de Chetumal: fonĂŠtica, gramĂĄtica y lĂŠxicoâ€?. Recuerdo que, despuĂŠs de leerlo, me dijo: “EstĂĄ bien, pero dĂŠjelo para su tesis doctoralâ€?. Ese augurio o deseo feliz se cumpliĂł, pues la misma idea original y proyecto, un poco transformado y ya concluido, fue defendido por mĂ­ en el aĂąo 2000 frente al sĂ­nodo conformado por Juan M. Lope Blanch (†) quien fue mi director, RamĂłn ArzĂĄpalo, Sergio Bogard, Juan LĂłpez ChĂĄvez (mi profesor de fonĂŠtica y fonologĂ­a en 1978) y Beatriz Arias. La promesa, que fraguĂŠ HQHVWHWHUULWRULRSRFRGHVSXpVGHPLUHJUHVRDĂ€QDOHVGH 1992, parecĂ­a cumplida, el reto alcanzado.Y, si ustedes me lo permiten, quisiera desmenuzar algunas de mis conclusiones en las pĂĄginas que siguen. [‌]

beliceĂąa llamada Consejo a visitarlo en la esquina de las calles 5 de Mayo y Carmen Ochoa de Merino, de acercarme a mi adolescencia con la mirada de un adulto reciĂŠn desempacado de la tierra del pulque y del smog, de treparme de nuevo en el trajĂ­n de la lengua con sus bien cimentadas palabras y su alcahueterĂ­a Ă­ntima ante los extraĂąos. Y entonces volvĂ­ a ser yo. Y lo lleguĂŠ a ser de tal modo que pude dar a la prensa una novela que no es otra cosa que segmentos de la vida de mi abuelo paterno nacido en Belice de padres yucatecos, novela que me devolviĂł a mis raĂ­ces y con ellas a la tierra de donde salieron mis padres para asentar su futuro en esta ciudad mexicana que mira al mar y que la selva recuerda.

 /D YXHOWD DO WHUUXxR WXYR XQ VLJQLĂ€FDGR LQpGLWR pues no sĂłlo era el hecho de haber regresado, sino que a esa nueva visiĂłn del retorno se adherĂ­a con fuerza una plaza obtenida en la Ciudad de MĂŠxico y que, a la postre, hizo unirme a nuevos amigos, a los fundadores de la Universidad de Quintana Roo, en ese entonces (1992) instalada en la avenida LĂĄzaro CĂĄrdenas y desde donde iban asentĂĄndose innovadoras directrices en la enseĂąanza de las ciencias y las artes en nuestro estado.

He tratado de asomarme al mundo de palabras de los quintanarroenses para estudiarlas, para hallarles un origen y un asidero en la comunicación de todos los días y saber así cómo hablan, quÊ quieren decir, de quÊ manera expresan su molestia y su regocijo, quÊ comen, cómo planean su futuro y valoran su pasado. Mi estancia en la ciudad de MÊxico me dio las herramientas para poder diferenciar, en su habla, la articulación de una /b/ oclusiva de una /b/ fricativa, de encontrar ciertos sonidos vocålicos Esta universidad con una exigua biblioteca, conta- epentÊticos en determinados segmentos enfåticos del dos alumnos y profesores, pero tierra fÊrtil abonada con discurso, de discriminar el buen o mal uso de un gerundio, esperanzas, planes y programas de estudio y fugaces rec- entre otras cosas. Ellos amablemente han cooperado, han torías, me arropó con una sinceridad particular y me hizo hablado conmigo, y al hacerlo, no sólo me han dado la miembro de su Junta Directiva durante seis aùos en los oportunidad de analizar los matices de su habla sino de FXDOHV SXGH YLYLU FHUFDQDPHQWH ODV UHYROXFLRQHV SDFtÀFDV conocer sus planes y su pasado, su presente y sus sueùos. que suele tener una institución que poco a poco va dejando Mi agradecimiento es poco si se compara con lo que me los paùales y los pantalones cortos para enfundarse en el KDQHQWUHJDGRHQHVDVFKDUODVHQVXVFDVDVSDWLRV\RÀFLQDV traje de adultez que le quede a la medida. Esos pormenores lingßísticos son muchos, como han En ese sitio, pude respirar de nuevo el aire de la bahía, recordar al viejo Jesús quien solía platicar con las estrellas que de cuando en cuando venían desde esa punta

28

gaceta NÂş 59

junio 2013

podido apreciar en esta pequeĂąa muestra lexical, y todos producen una mezcla singular en la que se entrelazan las culturas mexicana, beliceĂąa, yucateca y caribeĂąa. Y aunque


www.uqroo.mx

en esta mezcla separe a YucatĂĄn del resto de MĂŠxico, no HVPLSUHWHQVLyQPRVWUDUTXHHVDMHQDDpOSHURVtDĂ€UPDU que los rasgos de la cultura yucateca son Ăşnicos, y a ella le debemos los quintanarroenses gran parte de la nuestra. Eso lo sabemos todos, y al que no le plazca estarĂĄ pecando de altanero o de ignorante.

Palabras finales [‌] Dicen que las palabras se las lleva el viento, pero tal vez no suceda del mismo modo en todas partes. Y permítaseme la metåfora. Los descomunales ciclones que han azotado las costas quintanarroenses no se las han llevado, y permanecen incólumes ante la realidad que nombran. Se necesitarían varios huracanes de turistas para que el habla de los cancunenses, cozumeleùos y playenses, chetumaleùos y carrilloportenses sufriera algún deterioro estructural. Aun si esto ocurriera, el espaùol volvería a LPSRQHUVH FRQ XQ UHà XMR GH PDQR GH REUD OLQJ tVWLFD \ SUR\HFWRVGHSODQLÀFDFLyQGHODVOHQJXDVPD\D\HVSDxROD que las asentarían de nuevo en los territorios ocupados. Tal vez, si esta situación aparece, sucedería algo muy semejante a la que ocurrió en Toledo en 1085 durante la Reconquista cuando el habla castellana fue imponiÊndose poco a poco a los dialectos mozårabes que ahí tenían vida corriente. Creo que los ciclones naturales seguirån azotåndonos,

los culturales tambiÊn, pero nunca pasarån de ser vientos arrachados que siempre se estrellarån con las montaùas ÀUPHVGHQXHVWUDOHQJXDHVSDxROD\GHMDUiQWDOYH]VyORVX eco. De nosotros depende. Existe un lÊxico que, irremediablemente, he perdido por la edad y las circunstancias que me ha impuesto la vida. Ya no juego canicas, tampoco le doy al trompo ni a la timbomba, y sus aderezos lexicales: con subidas y bajadas, agßita, altas, bajas, picsito rellenado, lips, bongolona, korox y plumita se han ido diluyendo hasta hacerse casi nada. Sin embargo, espero que los niùos los sigan utilizando despuÊs de un divertido entrenamiento y posterior y mås feliz pråctica. Pero lo que sí puedo asegurar es que aquel acervo lexical que estuvo en desuso en la Ciudad de MÊxico ha vuelto pleno y enriquecido, tal vez, con nuevos sesgos semånticos, producto de su actualización cotidiana. La naturaleza, las estructuras sociales, los defectos y las gracias, los planes y los recuerdos, los afectos y desdenes, todo lo que nos rodea lo he podido re-nombrar de nuevo con esas mismas palabras que dejÊ de utilizar a los 17 o 18 aùos. Y eso es ganancia. Una ganancia que no tiene precio, un sendero lingßístico por el que transito todos los días con quien desee acompaùarme a recorrerlo. Muchas gracias. ” 11 de abril de 2013.

gaceta NÂş 59

junio 2013

29


www.uqroo.mx

VI Congreso de Gobierno y Gestión Pública

4SV1XVE8ERME'EQEP'LIPYNE

'SSVHMREHSVEHIP'SQMXq3VKERM^EHSV HIP:-'SRKVIWSHI+SFMIVRS]+IWXMzR 4FPMGEXERMEGGL$YUVSSQ\

M ás de 120 investigadores de Colombia, España, Italia y México se

dieron cita en la Universidad de Quintana Roo con motivo del VI Congreso de Gobierno y Gestión Pública que se celebró los días 13 y 14 de junio de 2013, organizado por el Departamento de Estudios Políticos e Internacionales de la División de Ciencias Políticas y Humanidades. Los especialistas analizaron temas relacionados con la alternancia partidista y la administración pública, especialmente los retos a los que México se enfrenta a nivel federal y local; también se discutió acerca del desarrollo municipal, el diseño e instrumentación de las políticas públicas para el desarrollo y la consolidación de la democracia, entre otros temas que se abordaron en 17 mesas de trabajo, en algunas de las cuales también participaron funcionarios de la administración pública. El congreso dio inicio con la conferencia magistral La alternancia de partidos en la Presidencia de la República, impartida por el Dr. Ricardo Espinoza Toledo, de la Universidad Autónoma Metropolitana-Iztapalapa. El reconocido investigador habló sobre lo tardío de la alternancia partidista en México y sus condiciones políticas y jurídicas, en tanto reglas que reconocen derechos políticos. 'H LJXDO PDQHUD UHÁH[LRQy FRQ HO S~EOLFR DFHUFD GH FXiQGR OD GHPRFUDFLD no conduce a un ejercicio real de los derechos legalmente reconocidos. Concluyó que, ante dos gobiernos presidenciales que no fueron capaces de

30

gaceta Nº 59

junio 2013


paliar los problemas del paĂ­s, el Pacto por MĂŠxico, del 2 de diciembre de 2012, podrĂ­a ser un correctivo a dos sexenios sin mejorĂ­a ni desarrollo, que la alternancia democrĂĄtica cumplirĂĄ sus funciones cuando este Pacto trascienda el papel y se convierta en una realidad social. Para la clausura el Dr. VĂ­ctor AlarcĂłn OlguĂ­n, profesor investigador del ĂĄrea de procesos polĂ­ticos en la Universidad AutĂłnoma Metropolitana-Iztapalapa, dictĂł la conferencia magistral Gobernanza electoral en MĂŠxico. ÂżHacia dĂłnde vamos?, en la cual seĂąalĂł que uno de los factores que retrasa y amenaza la consolidaciĂłn de las instituciones democrĂĄticas es la falta de legitimidad y FRQĂ€DQ]DHQORVSURFHVRVHOHFWRUDOHV\ODVLQVWDQFLDVTXH las organizan. DestacĂł que los pendientes de la gobernanza electoral en MĂŠxico se relacionan con el escaso poder de convocatoria para incentivar la participaciĂłn ciudadana; con el papel del IFE y el TEPJF (asĂ­ como las instancias locales equivalentes) que no son capaces de regular HĂ€FD]PHQWHORVSURFHVRV\FDPSDxDVLQWHUQDVSXHVVyOR se supervisa a los partidos polĂ­ticos al tĂŠrmino de los procesos, cualquiera que sea su modalidad; se presenta una baja alternancia efectiva en los espacios locales.

Las conclusiones de esta disertaciĂłn fueron que las posibilidades de generar una nueva institucionalidad democrĂĄtica en MĂŠxico dependerĂĄ de que los organismos electorales y legislativos permitan el paso a una realidad plural, competitiva y transparente dentro de los partidos polĂ­ticos; mientras no existan tales circunstancias, resultarĂĄ muy difĂ­cil revertir el desinterĂŠs actual respecto a fomentar la participaciĂłn ciudadana no sĂłlo en los partidos polĂ­ticos y los procesos electorales, sino en las diversas arenas de la vida pĂşblica. El congreso fue coordinado por la maestra Tania Camal Cheluja y el maestro JosĂŠ Antonio Olivares Mendoza, adscritos al Departamento de Estudios PolĂ­ticos e Internacionales de la DivisiĂłn de Ciencias PolĂ­ticas y Humanidades. DestacĂł la presencia de expositores provenientes de las siguientes instituciones de educaciĂłn superior: Universidad Nacional AutĂłnoma de MĂŠxico; Universidad AutĂłnoma Metropolitana (unidades Iztapalapa, Azcapotzalco y Xochimilco), Universidad AutĂłnoma de Chihuahua, Universidad AutĂłnoma de Baja California, Universidad de Guadalajara, Universidad AutĂłnoma de Aguascalientes, Universidad JuĂĄrez del Estado de

gaceta NÂş 59

junio 2013

31


ComisiĂłn de Derechos Humanos del Estado de QuinWDQD 5RR HQWUH RWURV (VWR QRV SHUPLWH DĂ€UPDU TXH HO Congreso se ha convertido en un espacio en el que la academia y los funcionarios convergen para intercambiar experiencias y fortalecer sus ĂĄmbitos de trabajo.

Durango, Universidad Intercultural del Estado de Guerrero, BenemĂŠrita Universidad AutĂłnoma de Puebla, Universidad AutĂłnoma de San Luis PotosĂ­, Universidad del Valle de MĂŠxico, Universidad AutĂłnoma de QuerĂŠtaro, Universidad AutĂłnoma del Estado de Morelos, Universidad Intercultural Maya de Quintana Roo, y por supuesto, de la sede, la Universidad de Quintana Roo. Del extranjero asistieron estudiantes e investigadores de la Universidad Complutense de Madrid, del Centre for Economic and International Studies, de la Universidad de Tor Vergata, de Roma, y de las universidades colombianas Universidad Juan de Castellanos (Tunja), Universidad de Antioquia y Escuela Superior de AdministraciĂłn PĂşblica (MedellĂ­n). Con respecto a la participaciĂłn de funcionarios e instituciones del servicio pĂşblico, el Instituto de AdministraciĂłn PĂşblica de Quintana Roo coordinĂł la mesa “Los retos de la AdministraciĂłn PĂşblica Localâ€?, y se contĂł con la participaciĂłn de funcionarios del Consejo Quintanarroense de Ciencia y TecnologĂ­a, de la SecretarĂ­a de Salud, de la SecretarĂ­a de EcologĂ­a y Medio, del Instituto Nacional de Salud PĂşblica de MĂŠxico Ambiente, de la

32

gaceta NÂş 59

junio 2013

Es importante destacar que tambiÊn se realizaron actividades de divulgación y difusión del conocimiento, como la presentación del libro Procesos sociales en el noroeste de MÊxico: Migración, trabajo y gestión de territorio, a cargo de investigadores de la Red de Estudios Sociales Transfronterizos del Norte de MÊxico, integrada por cuatro cuerpos acadÊmicos de las universidades Autónoma de Baja California, Autónoma de Ciudad Juårez y el Colegio de Sonora. Los presentadores, Dr. Alberto Pereira Corona y Dr. Juan Carlos Arriaga Rodríguez, resaltaron que es una obra que compila nueve estudios de fenómenos de migración, precariedad laboral, marginación y crecimiento urbano descontrolado en ciudades de cuatro estados fronterizos (Baja California, Sonora, Chihuahua y Nuevo /HyQ  $ÀUPDURQ TXH HV XQD REUD TXH UHSRUWD ORV avances de investigación, en los que se hacen propuestas FRQFHSWXDOHV SURYRFDGRUDV TXH GDQ SLH D OD UHà H[LyQ Con el cierre de actividades del VI Congreso de Gobierno y Gestión Pública la División de Ciencias Políticas y Humanidades, así como las profesoras y profesores de la licenciatura en Gobierno y Gestión Pública, refrendan el compromiso de mantener o incrementar la calidad de sus eventos acadÊmicos.”


www.uqroo.mx

La primera brecha de la Universidad de Quintana Roo1 De los proyectos al decreto del 24 de Mayo de 1991

Dr. Gustavo Rafael Alfaro Ramírez *SXS%VGLMZS(MJYWMzR]GSQYRMGEGMzRWSGMEP

A los universitarios que comparten lo que la UQROO les entregó. Un estado sin educación superior La historia de Quintana Roo en el siglo XX se divide en dos períodos enlazados por un acontecimiento crucial: la erección del Estado Libre y Soberano de Quintana Roo el 8 de Octubre de 1974. La primera parte del siglo XX quintanarroense da principio en la primera década del siglo con un doble VLJQLÀFDGRFURQROyJLFR6RQORVSULPHURVDxRVGHXQDJLWDGRVLJORXX y al mismo tiempo son los años en los que nace una nueva sociedad en la frontera sur. Es la nueva sociedad que unida a los reductos insulares de Isla Mujeres y Cozumel servirá para construir una nueva región: el Caribe Mexicano (César y Arnaiz, 1998). La erección del territorio federal es el desenlace de la guerra social comúnmente conocida como guerra de castas; 1902 es un año en el que nace una sociedad decidida a lograr una mayor integración económica y cultural con la república y con el resto del mundo. Y en 1902 se partía de ODQDGD7RGRHVWDEDSRUKDFHUVH3RUHVRORVKLVWRULDGRUHVKDQDÀUPDGRURWXQGDPHQWH´4XLQWDQD Roo existe como tal tan sólo a partir del siglo XX” (Careaga e Higuera, 2012, 11). Había selva y mar,

)WXIXI\XSJSVQETEVXIHIPPMFVSWSFVIPELMWXSVMEHIPTVMQIVOEXRHIPE9RMZIVWMHEHHI5YMRXERE6SS)PPMFVSRSI\MWXMVuEWMRPEE]YHEHIXSHSW PSWTVSXEKSRMWXEWHIPELMWXSVMEYRMZIVWMXEVMEUYIQILERGSRGIHMHSIRXVIZMWXEW]IRXVIKEHSGSTMEWHIZEPMSWSWHSGYQIRXSWMRHMWTIRWEFPIWTEVE GSQTVIRHIVIWXIGSQTPINSXIQE8EQFMqREKVEHI^GSIPETS]SHIP1XVS.SWqÅRKIP1SHIWXSUYMIRLEJSVQEHSYREZEPMSWEGSPIGGMzRJSXSKVj½GE IRIP(ITEVXEQIRXSHI(MJYWMzR]'SQYRMGEGMzR)RqWXEZIVWMzRLIVIHYGMHSEPQuRMQSPEWGMXEW]EP½REPWISJVIGIPEVIJIVIRGMEWzPSHIEUYIPPEW JYIRXIWIRPEWUYIWIFEWEqWXIEVXuGYPS7MHIWIEGSQIRXEVSGSQTEVXMVEPKYREJSXSSHSGYQIRXSGSRZEPSVLMWXzVMGSTSHIQSWGSRXEGXEVRSWE XVEZqWHIPGSVVISEPJEVSLYUVSS$KQEMPGSQ 1

gaceta Nº 59

junio 2013

33


la puerta de los estudios superiores. Ese pero sin las condiciones propicias para desarrollar una agricultura productiva, sin fue el gran proyecto con el que celebró ningún tipo de industria manufacturera el primer aniversario del joven estado. El y con una población dispersa. Ademås, 8 de octubre de 1975, el Lic. Jesús Maren el caso de los descendientes de los tínez Ross inauguró el Instituto Tecnolómayas cruzoob, una población perseguida gico Regional en Chetumal. Aunque sólo de pueblos originarios sobrevivía ofrecía dos carreras, la licenciatura aislada y no había ninguna voluntad en Administración de Empresas Tude integrarla. Los nuevos pueblos rísticas y la carrera de Ingeniería Cifundados bajo la protección de Fue el primer gobernador electo por vil en Desarrollo de la Comunidad, las fuerzas armadas mexicanas: HO VLJQLÀFDGR GH HVWH HVIXHU]R IXH Payo Obispo, Xcalac, Santa Cruz los quintanarroenses quien abrió la sumamente valorado. Quintana Roo de Bravo, Campamento Vega, Vigía comenzaba su camino en la educaChico, Bacalar y Petcacab, eran puerta de los estudios superiores. Ese ción superior. asentamientos tan pequeùos que fue el gran proyecto con el que celebró Esa primera fundación fue el inicio nadie podía asegurar que existirían de la amplia campaùa educativa del muchos aùos (Macías, 1997). el primer aniversario del joven estado. gobernador Martínez Ross en la que Por otra parte, el aùo El 8 de Octubre de 1975, el Lic. Jesús se atendió el reto educativo en todos 1974 tambiÊn fue de un segundo los niveles. Durante su gobierno se nacimiento. En la sÊptima dÊcada Martínez Ross inauguró el Instituto fundaron 180 escuelas, la mayoría del siglo XX, Quintana Roo era fueron jardines de niùos, primarias y muy diferente. Muchas cosas habían Tecnológico Regional en Chetumal. centros para la educación de adultos. cambiado. Ya se había construido Aunque sólo ofrecía dos carreras: la Ademås se amplió la oferta de los y consolidado una infraestructura estudios de nivel medio superior båsica que resolvía los retos del licenciatura en Administración de con la fundación de un bachillerato DLVODPLHQWR JHRJUiÀFR$ 4XLQWDQD en el propio Tecnológico Regional, Roo se podía llegar y salir por mar, Empresas Turísticas y la carrera de con la fundación del Colegio de tierra y aire. Sin embargo, sólo Ingeniería Civil en Desarrollo de la Bachilleres (plantel 1), un plantel de cuando el territorio se convirtió en Conalep, y un Centro Tecnológico Estado libre y soberano crecieron Comunidad, el significado de Êste del Mar (Cetmar).Todos en la capital las posibilidades y los recursos para del estado. que los propios quintanarroenses esfuerzo fue sumamente valorado. A pesar de estos esfuerzos, resolvieran sus problemas con sus Quintana Roo comenzaba su camino durante el sexenio del Lic. Jesús propios gobernantes, legisladores y Martínez Ross el problema educativo administradores. Dos claros ejemplo en la Educación Superior. se complicó aún mås. Sencillamente del nuevo dinamismo mostrado por no era posible satisfacer la demanda Quintana Roo en su nueva etapa educativa. Había una brecha muy como Estado libre y soberano lo difícil de subsanar. El nacimiento encontramos en los programas del territorio federal y el crecimiento del sector salud y en la educación DOFDQ]DGR HUD LQVXÀFLHQWH SDUD VXSHUDU (Alpuche, 2010). A continuación veremos el evidente subdesarrollo y atraso en el panorama educativo y cómo la materia educativa. Universidad de Quintana Roo contribuye a abrir la brecha desarrollando un sector Durante los aùos setenta, Quinde importancia estratÊgica. tana Roo vivió un vertiginoso crecimiento GHPRJUiÀFRGHDQXDOORTXHVLJQLÀFy Fue el primer gobernador elecque en diez aùos la población creció de to por los quintanarroenses quien abrió

34

gaceta NÂş 59

junio 2013


*SXS%VGLMZS(MJYWMzR]GSQYRMGEGMzRWSGMEP

88 150 habitantes en 1970 a 225 985 habitantes en 1980, un aumento neto de 257.8 %. De acuerdo con las cifras proporcionadas por el X Censo de Población y Vivienda, las UD]RQHV GH HVWD H[SORVLyQ GHPRJUiÀFD VH HQFXHQWUDQ HQ las masivas llegadas de migrantes traídos por los programas de colonización dirigida en el municipio de Othón P. Blanco. Al mismo tiempo el norte de Quintana Roo atraía enormes contingentes de inmigrantes para la construcción del proyecto turístico de Cancún.Y las cifras indicaban claramente lo que pasaba aunque se presentaban atrasadas frente a la realidad cotidiana. Durante la década de 1970 llegaban familias completas con niños de todas las edades que apenas encontraban lugar en las 59 escuelas de nivel preescolar y en alguna de las 310 escuelas primarias. El cuello de botella era más estrecho en las 24 secundarias del estado. El siguiente límite se encontraba en el nivel medio superior pues sólo existían ocho preparatorias al concluir el sexenio de Martínez Ross: cuatro en el municipio de Othón P. Blanco, dos en Felipe Carrillo Puerto y dos en Benito Juárez. (Escobar, 1981, 127).

Al terminar el sexenio del primer gobernador quintanarroense fue evidente que la educación seguía siendo un enorme reto, y al mismo tiempo, podía convertirse en una de las palancas que apoyara el desarrollo económico después de la caída de la producción chiclera y las decrecientes utilidades de la actividad forestal. El turismo internacional y los servicios asociados a la construcción de infraestructura ofrecían enormes posibilidades si la sociedad quintanarroense se lanzaba de lleno a la modernización productiva y comercial. Así lo entendió el gobernador Pedro Joaquín Coldwell, quien estuvo a punto de fundar la Universidad de Quintana Roo con un proyecto sustentado en un detallado análisis de la realidad socioeconómica de los tres estados de la península yucateca. Al comparar los LQGLFDGRUHV GHPRJUiÀFRV \ HGXFDWLYRV GHO MRYHQ HVWDGR de Quintana Roo con sus vecinos cercanos aparecían dos hechos evidentes. Primero, la península de Yucatán se transformaba siguiendo las pautas de desarrollo propias, como el auge petrolero de la sonda de Campeche o la acelerada consolidación del proyecto Cancún. Segundo, Quintana Roo era el estado más atrasado en materia

gaceta Nº 59

junio 2013

35


habĂ­an marginado por varias dĂŠcadas. La pobreza, la lejanĂ­a de las escuelas y la necesidad de que los niĂąos auxiliaran en A mediados de la dĂŠcada de el trabajo cotidiano para la sobrevivencia, los ochenta la respuesta inmediata daba pocas esperanzas de abatir las tasas al crecimiento de oportunidades de deserciĂłn escolar y analfabetismo. econĂłmicas era la llegada de mano de Los albergues para niĂąos indĂ­genas y los REUD FDOLĂ€FDGD \ WDPELpQ GH DPSOLRV centros de educaciĂłn para adultos contingentes con escasa IXHURQHĂ€FDFHVSUR\HFWRVGHDFFLyQ FDOLĂ€FDFLyQ OR TXH VLJQLĂ€Fy XQ para reducir el rezago educativo. FUHFLPLHQWRGHPRJUiĂ€FRDQXDOGH Sin embargo, aĂşn en el aĂąo de 6.4 % para toda la penĂ­nsula y de Pasaron doce aĂąos y el ingeniero 1983 sĂłlo se atendĂ­a a 70 % de la 10.9 % sĂłlo para Quintana Roo. La demanda de educaciĂłn primaria de Miguel Borge se convirtiĂł en el tercer poblaciĂłn de la penĂ­nsula crecĂ­a, Quintana Roo. pero con mayor rapidez crecĂ­a la gobernador de Quintana Roo. DespuĂŠs En el ĂĄrea de capacitaciĂłn para poblaciĂłn joven que tenĂ­a entre el trabajo, los datos mostraban con 15 y 24 aĂąos. En Quintana Roo de meditar el asunto decidiĂł hacer mayor crudeza el atraso de Quintana esta fracciĂłn juvenil representaba 20 % de la poblaciĂłn de 1985, y realidad la demanda que le expresaran Roo. El estado sĂłlo contaba con un centro educativo de este tipo para si se mantenĂ­a la misma tendencia en 1973 y fundar la Universidad de atender a 406 alumnos, mientras de crecimiento, Quintana Roo que en Campeche 3 200 alumnos tendrĂ­a 140 000 jĂłvenes que Quintana Roo con tal cuidado que se gozaban de esta educaciĂłn en 23 demandarĂ­an educaciĂłn y empleo escuelas, y YucatĂĄn tenĂ­a la matrĂ­cula en la dĂŠcada de 1990. (Proyecto convirtiera en “la obra de las obras de mĂĄs elevada: 14 022 alumnos en 85 de creaciĂłn 1985, 1-31). mi gobiernoâ€?. Pero el proyecto no era escuelas de capacitaciĂłn para el Era el momento de trabajo. sencillo. Cuando sus colaboradores se preparar al estado para el Todos los indicadores educativos desarrollo de los prĂłximos 20 aĂąos y el equipo del gobernador enteraron de los planes del gobernador mostraban la misma tendencia. Comparando el nĂşmero de Pedro JoaquĂ­n Coldwell entendiĂł algunos manifestaron su entusiasmo escuelas secundarias y de alumnos que el rezago educativo era otro registrados en los tres estados de problema que debĂ­a atenderse y otros su escepticismo. Era evidente la penĂ­nsula, YucatĂĄn mantenĂ­a la de inmediato. De acuerdo que la creaciĂłn de la universidad se ventaja con 150 secundarias y 55 con el censo de poblaciĂłn y 532 alumnos; seguĂ­a Campeche vivienda de 1980, en Quintana habĂ­a retrasado demasiado, otros no con 55 secundarias y 21 677 Roo habĂ­a 20 780 analfabetas mayores de 14 aĂąos. La falta de creĂ­an que fuera necesaria, sobre todo alumnos; y Quintana Roo quedaba en tercer lugar en nĂşmero de estudios era agravada por los alumnos, pues sĂłlo tenĂ­a 14 171 al considerar que podrĂ­a provocar IDFWRUHV GH tQGROH JHRJUiĂ€FD matriculados en las 60 secundarias ĂŠtnica y lingßística. HabĂ­a muchas problemas polĂ­ticos en el Estado. del estado. Finalmente, en el rubro comunidades dispersas que de educaciĂłn PROFESIONAL MEDIA tenĂ­an una poblaciĂłn menor Y BACHILLERATOS, Quintana Roo a los 2 500 habitantes, lo que quedaba tambiĂŠn en tercer lugar impedĂ­a que tuvieran educaciĂłn con 13 planteles que atendĂ­an a 4 632 preescolar o primaria; ademĂĄs muchas alumnos, mientras que YucatĂĄn disponĂ­a de estas pequeĂąas comunidades estaban de 57 centros educativos en los que habitadas por indĂ­genas mayas que formaba a 21 447 alumnos en 1983. las barreras lingßísticas y culturales educativa y el estado de la penĂ­nsula con PD\RUFUHFLPLHQWRGHPRJUiĂ€FR

36

gaceta NÂş 59

junio 2013


*SXS%VGLMZS(MJYWMzR]GSQYRMGEGMzRWSGMEP

La punta del iceberg era la educaciĂłn superior. Incluyendo a la educaciĂłn de los tecnolĂłgicos, las normales para profesores de educaciĂłn primaria, la normal superior y las universidades; Campeche tenĂ­a 21 centros de enseĂąanza superior,YucatĂĄn 32 y Quintana Roo sĂłlo cuatro. El estado mĂĄs joven de la penĂ­nsula sĂłlo tenĂ­a dos escuelas de formaciĂłn de profesores (la Universidad PedagĂłgica Nacional y la Normal de Bacalar) a las que se agregaban los dos institutos tecnolĂłgicos: el regional y el agropecuario. Y las cuatro instituciones se encontraban en el municipio de OthĂłn P. Blanco.

sismo del 19 de septiembre de 1985 asolĂł la ciudad de MĂŠxico, imponiendo al gobierno federal otras prioridades en el presupuesto. De esa forma terminĂł el proyecto pero no la idea de quienes se propusieron realizar el anhelo de fundar la Universidad de Quintana Roo. (entrevista al Lic. EfraĂ­n Villanueva).

El licenciado Pedro JoaquĂ­n Coldwell tenĂ­a los datos para demostrar que la fundaciĂłn de la universidad era una necesidad urgente para fomentar el desarrollo educativo y formar los recursos humanos del estado mĂĄs joven de la repĂşblica; que para entonces era el Ăşnico que todavĂ­a no contaba con universidad. Las razones y las cifras expuestas por el gobernador eran irrefutables, mĂĄs una imprevista contingencia natural frenĂł el proyecto de creaciĂłn tan cuidadosamente planeado. Precisamente en los dĂ­as en los que el proyecto estaba en estudio en la SEP federal, el

Al comenzar la dÊcada de 1990 la sociedad mexicana todavía resentía los efectos de la crisis económica de 1982. Durante ocho aùos fueron aplicadas las mås rigurosas políticas neoliberales combinadas con un acertado plan de concertación política conocido como Pacto de Solidaridad (FRQyPLFD $O ÀQDO GH OD GpFDGD SHUGLGD 0p[LFR KDEtD UHFXSHUDGR OD FRQÀDQ]D GH ORV LQYHUVLRQLVWDV \ SDUHFtD WRPDUHOUXPERGHOFUHFLPLHQWRDXQTXHODLQà DFLyQGH % anual todavía ensombrecía el panorama.

Las universidades mexicanas y la nueva universidad mexicana

gaceta NÂş 59

junio 2013

37


*SXS%VGLMZS(MJYWMzR]'SQYRMGEGMzR7SGMEP

La crisis del endeudamiento pĂşblico externo estaba superada hasta cierto punto, mĂĄs los efectos colaterales de la crisis se manifestaban todavĂ­a en la caĂ­da del PIB, el desempleo, y la pĂŠrdida del poder adquisitivo. Desde los primeros aĂąos del gobierno de Carlos Salinas de Gortari los efectos mĂĄs graves eran resultado de la medicina econĂłmica y menos de la enfermedad. Para resolver el dilema presupuestal, el plan de choque del gobierno mexicano incluyĂł la reducciĂłn de los gastos en programas sociales. Durante estos aĂąos fueron tristemente cĂŠlebres los recortes al presupuesto destinado al abasto popular de alimentos bĂĄsicos, la salud y la educaciĂłn. De la misma forma en la que las familias administraban su presupuesto, el gobierno procuraba reducir el gasto corriente y evitar los gastos extraordinarios que no fueran estrictamente necesarios. Las universidades pĂşblicas enfrentaban la crisis con menos recursos econĂłmicos y con severas presiones por el constante aumento de su matrĂ­cula. La UNAM, la Universidad Veracruzana y la Universidad AutĂłnoma de Puebla tenĂ­an graves problemas por los recortes al presupuesto y tambiĂŠn porque en estas universidades existĂ­an grupos estudiantiles radicales que exigĂ­an el paso automĂĄtico a la universidad y con frecuencia habĂ­a manifestantes que salĂ­an a las calles para exigir mĂĄs presupuesto del gobierno estatal y federal.

38

gaceta NÂş 59

junio 2013

 $GHPiV GH ORV SRWHQFLDOHV FRQĂ LFWRV SROtWLFRV con estudiantes, varios especialistas recibĂ­an con preocupaciĂłn los indicadores en materia de calidad educativa y HĂ€FLHQFLDDGPLQLVWUDWLYD$OLQWHULRUGHODSEP los expertos diseĂąaban planes de intervenciĂłn y diagnĂłstico. El equipo integrado por los doctores VĂ­ctor Arredondo, Ernest Vargas, Raquel Glassman, Mario Miranda Pacheco, Jorge del Valle y Arturo White realizĂł una propuesta a la que denominaron “Nuevas Universidades Mexicanasâ€? con el propĂłsito de superar las fallas percibidas en el ĂĄmbito institucional y educativo (Kent, 1998). Este nuevo modelo fue aplicado primero en el Instituto de Ensenada y despuĂŠs en Quintana Roo, aunque con adaptaciones importantes para hacer coincidir el proyecto con las expectativas y propuestas que ya existĂ­an en el Gobierno del Estado (Carrillo, 2003. Entrevista con el Dr. Miguel Borge). Al plantear la propuesta de creaciĂłn de la universidad, el Secretario de EducaciĂłn y Cultura Popular del Estado de Quintana Roo, Dr. Enrique Carrillo BarriosGĂłmez tenĂ­a ideas muy claras sobre la universidad que se necesitaba. De hecho, en el proyecto de creaciĂłn HODERUDGRHQVHGHĂ€QtDODHVWUXFWXUDLQVWLWXFLRQDOHO Ă€QDQFLDPLHQWR\ODRIHUWDGHFDUUHUDVFRQJUDQSUHFLVLyQ El proyecto habĂ­a sido archivado cuando el sismo del 19 de


septiembre convenció a los funcionarios quintanarroenses de que debían esperar un momento más oportuno para realizar el proyecto. Hacia 1989 el Dr. Enrique Carrillo Barrios Gómez encontró una amable disposición de parte del Dr. Luis Eugenio Todd, subsecretario de Educación 6XSHULRUH,QYHVWLJDFLyQ&LHQWtÀFD(SESIC) de la SEP, quien le facilitó los medios para contar con asesoría internacional y trabajar directamente con el Dr. Víctor Arredondo para ajustar una versión ad hoc del proyecto Nuevas Universidades para el Estado de Quintana Roo. El doctor Enrique Carrillo ha descrito las tareas desempeñadas por un amplio equipo de 31 colaboradores, entre los que destacaron el Dr. Saúl Álvarez Borrego, Director General GHO &HQWUR GH ,QYHVWLJDFLyQ &LHQWtÀFD \ GH (GXFDFLyQ Superior de Ensenada (CICESE), y el Lic. Carlos de Buen Uma para diseñar el concepto de la Universidad de Quintana Roo y proponer las primeras versiones de su ley orgánica en 1989 y en 1991 (Carrillo, 2003).  (VWRV GRFXPHQWRV SHUPLWHQ DÀUPDU TXH HO SURyecto “Nuevas Universidades Mexicanas” fue el modelo fundamental, pero fue adaptado a las circunstancias siguiendo las visiones de los responsables de la fundación de la Universidad de Quintana Roo. Del proyecto Nuevas Universidades y de las iniciativas del gobierno del estado, dirigido por el Dr. Miguel Borge Martí, y coordinado por el Dr. Enrique Carrillo se fue decantando un programa esSHFtÀFRSDUDIXQGDUOD8QLYHUVLGDGHQ4XLQWDQD5RR'H acuerdo con los documentos ejecutivos, el proyecto Nuevas Universidades establecía con claridad las razones por ODVTXHGHEtDFDPELDUHOPRGHORXQLYHUVLWDULRUHDÀUPDQGR condiciones positivas de la universidad. Por eso, en el documento que fundamenta las características de la futura Universidad de Quintana Roo se estableció: La nueva universidad sería autónoma y con libertad de enseñanza e investigación. Además, incluiría cambios profundos en su naturaleza y misión social, enfoque y proyecto educativo, organización académica, y estructura administrativa de gobierno y de ÀQDQFLDPLHQWR Proyecto de creación de la Universidad de Quintana Roo, 1990, 6). El proyecto para Quintana Roo tuvo tres características básicas: la primera fue su naturaleza social expresada en una vigorosa vinculación universidadsociedad, la segunda era diseñar un proyecto educativo innovador orientado a la formación integral del estudiante y al logro académico individual; y en tercer lugar, construir

*SXS%VGLMZS(MJYWMzR]'SQYRMGEGMzR7SGMEP

una estructura administrativa con una gobernanza y ÀQDQFLDPLHQWRGHVFHQWUDOL]DGRSDUDTXHHQWRGRPRPHQWR sus directivos y personal consideraran que la universidad estaría sujeta a evaluación permanente, tanto en el aspecto administrativo como en el académico. Esta tercera condición establece una de las características más innovadoras del proyecto Nueva Universidad Mexicana: [...] el autogobierno universitario estable basado en la legitimidad de sus órganos y autoridad, en el régimen de derecho y en la participación especializada (según la materia que se trate) colegiada y ponderada de personal académico y de los estudiantes. Régimen de gobierno que además fortalece la participación de la sociedad en la universidad, su grado de respuesta social y la autonomía institucional. (Proyecto de creación de la Universidad de Quintana Roo, 1990, 11). Estas fueron las bases institucionales, académicas y políticas sobre las que se discutió la fundación de la Universidad de Quintana Roo. Se estableció como fecha probable para su creación el año 1991, sin embargo, el arduo trabajo de la comisión organizadora terminó antes de lo previsto los estudios. El gobernador Miguel Borge fue el líder moral y dirigió personalmente el proyecto. Además gestionó los acuerdos necesarios para alcanzar la DSUREDFLyQ GHÀQLWLYD \ JDUDQWL]DU HO ÀQDQFLDPLHQWR SDUD construir y operar la Nueva Universidad Mexicana en Quintana Roo (Carrillo, 2003).

gaceta Nº 59

junio 2013

39


www.uqroo.mx El 24 de mayo de 1991 en la agenda del presidente de la RepĂşblica A mĂĄs de veinte aĂąos de distancia, el Dr. Miguel Borge recuerda muy bien los dĂ­as en los que la universidad era una demanda de los quintanarroenses que esperaban del primer candidato a gobernador acciones decisivas. En aquel lejano aĂąo de 1975, el joven ingeniero Miguel Borge trabajaba en la campaĂąa del Lic. JesĂşs MartĂ­nez Ross. En las noches revisaba su cuaderno de anotaciones para preparar VXLQIRUPH\VHGLRFXHQWDGHOKRQGRVLJQLĂ€FDGRTXHSDUD muchos quintanarroenses, especialmente de Chetumal y Cozumel, tenĂ­a la fundaciĂłn de una universidad en su propia tierra. En esos momentos no sabĂ­a que en el futuro podrĂ­a dirigir ese proyecto, pero fue entonces cuando el joven ingeniero decidiĂł ayudar a la fundaciĂłn de una universidad para su estado.

*SXS%VGLMZS(MJYWMzR]'SQYRMGEGMzR7SGMEP

Pasaron doce aĂąos y el ingeniero Miguel Borge se convirtiĂł en el tercer gobernador de Quintana Roo. DespuĂŠs de meditar el asunto decidiĂł hacer realidad la demanda que le expresaran en 1973 y fundar la Universidad de Quintana Roo con tal cuidado que se convirtiera en “la obra de las obras de mi gobiernoâ€? (sic). Pero el proyecto no era sencillo. Cuando sus colaboradores se enteraron de los planes del gobernador, algunos manifestaron su entusiasmo y otros su escepticismo. Era evidente que la creaciĂłn de la universidad se habĂ­a retrasado demasiado, otros no creĂ­an que fuera necesaria, sobre todo al considerar que podrĂ­a provocar problemas polĂ­ticos en el estado. Otros se entusiasmaban pero pensaban que todo dependerĂ­a de la buena voluntad del gobernador o del presidente de la repĂşblica. El Dr. Borge sabĂ­a que la decisiĂłn debĂ­a ser aprobada por diferentes secretarĂ­as federales, entre ellas, la SEP, que en esos aĂąos era dirigida por el ex-

40

gaceta NÂş 59

junio 2013

perimentado político Manuel Bartlett Díaz. Otro problema HUD HO ÀQDQFLDPLHQWR /RV JDVWRV GH OD QXHYD XQLYHUVLGDG serían muy elevados y crecerían a medida que aumentara la oferta de carreras y el número de estudiantes. Y tan importante como la autorización y el presupuesto era el proyecto universitario que sería puesto sobre la mesa para lograr la aprobación. Esa sería la llave maestra que debía abrir todas las puertas. Eso era lo que creía el gobernador 0LJXHO%RUJH\FRQÀDEDHQWHQHUWRGRVORVHOHPHQWRVSDUD lograrlo, convocando de manera amplia a todas las fuerzas sociales del Estado (entrevista con el Dr. Miguel Borge). El proyecto de creación de la universidad fue desaUUROODGRFRQGLVFUHFLyQ\HÀFDFLDGHVGHPHGLDGRVGH hasta octubre de 1990, cuando fue concluido el proyecto ejecutivo. Los próximos meses fueron de gran actividad y OOHJyHOPRPHQWRGHSUHSDUDUODÀUPDGHOGHFUHWRGHFUHDción. El Secretario de Educación y Cultura Popular, Dr. Enrique Carrillo Barrios-Gómez había logrado ajustar las agendas para que cuando llegara el presidente Carlos Salinas GH*RUWDULHVWDPSDUDVXÀUPDHQHOGHFUHWRGHFUHDFLyQ en el mes de mayo. (Comunicación escrita del Dr. Enrique Carrillo). Todo estaba dispuesto para que el presidente de la República fuera el testigo de honor del magno acontecimiento, pero cuando todo estaba listo comenzaron las diÀFXOWDGHV3ULPHURORVUHVSRQVDEOHVGHO(VWDGR0D\RU3UHsidencial advirtieron que el acto no había sido considerado en la agenda, y despuÊs, desde otra secretaría de estado le informó al gobernador Miguel Borge que el presidente QRWHQGUtDWLHPSRSDUDSDUWLFLSDUHQODÀUPDGHOGHFUHWR de creación. El gobernador interpretó la negativa como un velado rechazo al proyecto de creación de la Universidad de Quintana Roo que se había preparado durante tantos meses. Entonces el doctor Borge tomó el telÊfono y le manifestó al presidente que su presencia como testigo GH KRQRU HQ OD ÀUPD GHO GHFUHWR GH FUHDFLyQ GH OD universidad sería el evento mås importante de toda la gira. El presidente Salinas escuchó con atención los argumentos del gobernador y respondió que si era tan importante su presencia en el acto protocolario con gusto asistiría.Ademås GHODSUHVHQFLDGH&DUORV6DOLQDVORTXHVHGHÀQLyHVHGtD


www.uqroo.mx fue el proyecto Nueva Universidad aplicado a la Universidad de Quintana Roo. Quizås si el presidente Salinas no hubiera ÀUPDGRHOGHFUHWRGHFUHDFLyQODSULPHUDXQLYHUVLGDGGHO estado hubiera sido una universidad tecnológica. Diferencia aparentemente menor pero que para el gobernador Miguel Borge y su equipo era de primera importancia. (Entrevista al Dr. Miguel Borge).  (OSUHVLGHQWHFXPSOLyVXSDODEUD\DQWHVGHÀUPDU el decreto de creación dedicó unas emotivas palabras como testimonio de la voluntad del gobernador Miguel Borge de cumplir el viejo anhelo de los quintanarroenses de tener su universidad: Debo decirles con apertura y honestidad, compatriotas de Quintana Roo, que esta universidad se vuelve hoy realidad gracias a la tenacidad, a la constancia y a la lucha de un hijo del estado que quiso para su tierra lo mejor, que trabajó para que aquí, hoy, se volviera realidad el sueùo de los jóvenes de tantas generaciones [‌] ese quintanarroense a quien yo le expreso mi mås grande reconocimiento por haber hecho realidad esta universidad, no es otro que mi amigo, el gobernador del estado Miguel Borge Martín.

BibliografĂ­a - Alpuche Peraza, Ă ngel 2010 La Medicina en Quintana Roo, 1902-2010. Chetumal: SecretarĂ­a de Salud de Quintana Roo. 336 p.

- Propuesta para la creación ‌ 1990, Propuesta para la creación de una Universidad en Quintana Roo Chetumal, Quintana Roo, Octubre de 1990. 82 p.

- AnĂłnimo 1990 Proyecto para la creaciĂłn de la Universidad de Quintana Roo. Propuesta sometida por el Dr. Miguel Borge MartĂ­n, gobernador constitucional del estado de Quintana Roo. Chetumal, octubre 1990. 12 p.

“CreaciĂłn de la Universidad de Quintana Rooâ€? 1990 en Proyecto para la creaciĂłn de la Universidad de Quintana Roo. 44 p.

Fuentes - Borge MartĂ­n, Miguel Entrevistas Entrevista al Dr. Miguel Borge MartĂ­n por Gustavo Alfaro en Chetumal, 12 de febrero y 26 de Marzo de 2011. Entrevista a Lic. EfraĂ­n Villanueva Arcos por Gustavo Alfaro en Chetumal, 2 de Febrero de 2011. Entrevista al Lic. Luis GonzĂĄlez Pacheco por Gustavo Alfaro en Chetumal, 15 de junio de 2011 y 22 de febrero de 2012. ComunicaciĂłn escrita del Dr. Enrique Carrillo Barrios GĂłmez. Marzo de 2011.

2010 CĂĄtedra que dicta al recibir el doctorado honoris causa. Chetumal: UQROO.

&DUHDJD9LOLHVLG/RUHQD\$QWRQLR+LJXHUD%RQĂ€O 2012 Quintana Roo. Historia breve, 2a ed. MĂŠxico: Fondo de Cultura EconĂłmica / El Colegio de MĂŠxico.

- Carrillo Barrios-GĂłmez, Enrique 1993 Discurso de la ceremonia de inauguraciĂłn de instalaciones y abanderamiento de la Universidad de Quintana Roo. 2 de abril de 1990. 5 p.

gaceta NÂş 59

junio 2013

41


www.uqroo.mx

“Gobernabilidad, Democracia y Seguridad en IberoamĂŠricaâ€?, Seminario Internacional para la vinculaciĂłn acadĂŠmica Por: Mtro. Jorge Alberto Chan Cob

E

n el marco del vigĂŠsimo segundo aniversario de la Universidad de Quintana Roo (UQROO  \ FRQ HO Ă€Q GH impulsar la vinculaciĂłn internacional, los dĂ­as 9 y 10 de mayo de 2013, esta casa de estudios fue sede del Seminario Internacional “Gobernabilidad, Democracia y Seguridad en IberoamĂŠricaâ€?, en el que participaron dirigentes de las Asociaciones de Ciencia PolĂ­tica de Brasil, Chile, Uruguay, Colombia, EspaĂąa y MĂŠxico. El seminario fue inaugurado por la rectora de la UQROO, Mtra. Elina E. Coral Castilla, quien destacĂł el compromiso de la Universidad por asegurar que los investigadores y estudiantes de la instituciĂłn se vinculen con especialistas de la regiĂłn en asuntos de su materia. El director general de Servicios AcadĂŠmicos de la UQROO y coordinador del Seminario, Mtro. Jorge Alberto Chan Cob, expresĂł que la primera ediciĂłn del Seminario Internacional se realizĂł en la ciudad de CancĂşn en noviembre de 2012, con la participaciĂłn de los presidentes de las asociaciones de Chile y MĂŠxico, ademĂĄs del presidente de la Sociedad Mexicana de Estudios Electorales A.C. (SOMEE); y que

42

gaceta NÂş 59

junio 2013

habĂ­a sido dirigida a la vinculaciĂłn internacional de los investigadores y estudiantes de la unidad acadĂŠmica Playa del Carmen. En esta ediciĂłn 2013, se logrĂł la vinculaciĂłn de los universitarios y docentes de la unidad acadĂŠmica Chetumal con organizaciones acadĂŠmicas internacionales de seis SDtVHV WRGDV DĂ€QHV D VX FDPSR GH HVWXGLR \ JUDFLDV DO apoyo recibido de la DivisiĂłn de Ciencias PolĂ­ticas y Humanidades de la UQROO, de la AsociaciĂłn Mexicana de Ciencias PolĂ­ticas A.C. (Amecip) y del Centro de InvestigaciĂłn Interdisciplinaria en Ciencias Sociales de la Universidad AutĂłnoma del Estado de MĂŠxico (Uaemex). El evento abordĂł temas de debate actual para las democracias de IberoamĂŠrica, desde una perspectiva multidisciplinaria. El programa acadĂŠmico incluyĂł las siguientes ponencias: Partidos y sistema de partidos en Colombia ante la coyuntura de los diĂĄlogos de paz y las elecciones presidenciales en 2014, a cargo de la Dra. Patricia MuĂąoz Yi, presidenta de


www.uqroo.mx

la Asociación Colombiana de Ciencia Política; Violencia, elecciones y democracia en México, dictada por el Dr. José Manuel Luque Rojas, presidente de la Asociación Mexicana de Ciencias Políticas; ¢/DVWUDQVLFLRQHVWLHQHQXQÀQ"'HVDItRV

actuales de la democracia en América Latina, presentada por el Dr. Rodrigo Stumpf González, secretario de Relaciones Internacionales de la Asociación Brasileña de Ciencia Política; y coordinador de la Red Iberoamericana de Ciencias Políticas Iberpol; Estado de excepción y régimen presidencial

en Chile, a cargo de la Dra. Claudia Sylvia Heiss Bendersky, presidenta de la Asociación Chilena de Ciencia Política; Situación económica y sensación de inseguridad en Uruguay. ¿Un caso de disonancia?, pronunciada por el Dr. Federico Luis Irazábal Ávila, secretario general de la Asociación Uruguaya de Ciencia Política; y 'LPHQVLRQHVGHOD FULVLVSROtWLFDHLQVWLWXFLRQDOHQ(VSDxD, dictada por el Dr. Juan Luis Paniagua Soto, presidente de la Asociación Española de Ciencia Política y de la Administración. Al seminario también acudieron directivos académicos como el Dr. Alfredo Marín Marín. Director de la División de Ciencias Políticas y Humanidades de la UQROO; el Dr. Ernesto Hernández Norzagaray, secretario de la Sociedad Mexicana de Estudios Electorales A.C. y secretario de Relaciones Internacionales de la Amecip A.C; y el Dr. Jesús Tovar Mendoza, Secretario de Vinculación de la Amecip y coordinador nacional de la Red de Investigación sobre Calidad de la Democracia en México (Red Conacyt). ”

gaceta Nº 59

junio 2013

43


Difusión y  Comunicación  Social www.uqroo.mx/intranet/ intranet

saladeprensa.uqroo.mx Solicitud de servicios

http://issuu.com/uqroo/docs/revista-gaceta-univesitaria-num-58

Información para los colaboradores Gaceta Universitaria La Gaceta Universitaria es una revista que difunde el quehacer académico, estudiantil e institucional de la Universidad de Quintana Roo. Con ese propósito, La Gaceta invita a profesores, estudiantes y personal administrativo a colaborar en la difusión de las actividades, programas y proyectos de sus respectivas áreas o disciplinas; a compartir sus ideas, análisis o exposición de temas que contribuyan a una mejor comprensión de la realidad nacional e internacional, así como experiencias profesionales que nos permitan un mayor conocimiento de la disciplina de que se trate. z Las colaboraciones comprenden los géneros de crónica, reseña, ensayo y reportaje, con una extensión mínima de tres cuartillas y máxima de diez; los textos deberán escribirse justificados a la izquierda y con fuente Times New Roman a 12 puntos, estilo normal, con interlineado de espacio y medio, en formato con extensión .doc o .txt. z Para imágenes éstas deberán ser en formato .jpg en 200 dpi de resolución y en tamaño mediano (120 cm de ancho, cuando menos). No se aceptarán materiales en formatos distintos.

z En todos los casos, los editores se reservan el derecho a cambiar o elaborar cabezas, cabezas intermedias, recuadros y sumarios a los artículos, así como realizar la corrección de estilo correspondiente. z Las colaboraciones de estudiantes deberán incluir la aprobación, por escrito, de un dictaminador / responsable del área académica que corresponda. z Los cuadros, gráficas, diagramas o esquemas, deberán ir numerados, con título y fuente de la información. z Las colaboraciones podrán ser enviadas por correo electrónico a: magmulia@uqroo.mx, o entregadas personalmente en el cubículo de La Gaceta ubicado en la planta baja del edificio de Rectoría, a un lado de Comunicación Social.

z Para la difusión de actividades académicas tales como simposios, congresos, seminarios, encuentros, etcétera, en la Gaceta, la solicitud deberá hacerse con mínimo un mes de anticipación utilizando la liga “Sala de Prensa” de la página web de la Universidad, con el propósito de acordar, conjuntamente con el solicitante, los detalles de la cobertura periodística.

www.uqroo.mx www.uqroo.mx 44

gaceta Nº 59

junio 2013

www.uqroo.mx

gace

ta v e r

sión d

igital

Revista gaceta univesitaria num 59  
Revista gaceta univesitaria num 59  

Revista Gaceta Universitaria, número 59. Universidad de Quintana Roo. UQROO 2013.

Advertisement