Skip to main content

Star Weekly - Sunbury Macedon Ranges - 6th May 2025

Page 1


Mum’s bundle of new love

While many mothers will be receiving breakfast in bed or handmade cards this Mother’s Day, Rupinder Kaur Rekhi will be spending her Mother’s Day cradling the newest addition to her family– a little baby boy.

For Ms Rehki and her husband Gagandeep Singh Rekhi, the arrival of their son has been a heartwarming and emotional experience, bringing a mix of emotions and deep reflection.

“It’s mixed feelings when you go into labour of course,” Ms Rekhi said.

“But after that it’s all well – when we see the baby, it makes it all worth it.”

While Mother’s Day might be a little more low-key this year, there will still be room for celebration.

“Grandmother is here so maybe we will go out and have dinner to celebrate,” Ms Rekhi said.

For Mr Rehki, witnessing his wife’s labour gave him renewed appreciation for the strength of mothers everywhere.

“When I see my wife giving birth, I get even more respect for motherhood. I always have more respect for my mother and for my wife, for every mother in this world,” he said.

Mitchell holds McEwen

Rob Mitchell has retained the seat of McEwen.

Mr Mitchell has been the McEwen MP since 2010, and despite the seat being marginal at recent elections, he has managed to keep his seat.

Mr Mitchell holds 54.88 per cent of the two-candidate preferred votes, ahead of the Liberal candidate, Jason McClintock with 45.12 per cent, with a small swing towards the ALP. The seat of McEwen was called early

on election night, Saturday, May 3.

Mr Mitchell thanked his supporters on social media.

“To say we were humbled and grateful is an understatement,” Mr Mitchell said.

“We know the Liberal Party has invested a lot of money to try and take us down and we could never match them dollar for dollar but we knew we had the right message to people about the right things that are important to our community. “I’ve never ever taken this seat for granted never ever will so it was good to see the backing and the support from our community.

“They’ve (McEwen voters) given me the greatest honour of my life and to put their trust in me again, I will continue to do what I’ve always done to make sure I deliver on every promise I’ve made.”

Elsewhere, the seat of Bendigo, which takes in Kyneton, Malmsbury, Tylden, and Carlsruhe is currently too close to call.

Labor’s Lisa Chesters holds the first preference count lead, with 29,729 votes, while Nationals candidate Andrew Lethlean trails closely behind with 27,234 votes. On

the two-candidate preferred for the seat, Mr Lethlean holds a slight lead over Ms Chesters, with 52.98 per cent and 47.02 per cent respectively. The seat will come down to preferences.

In Hawke, Labor’s Sam Rae held on to the seat, attracting a small swing of votes. On the two-party preferred count, Mr Rae drew 57.64percentofvotes,withLiberalcandidate Simmone Cottom receiving 42.36 per cent. In a Facebook post, Mr Rae said he was “honoured to continue representing our wonderful community”.

toolsandevenmoresupport. Visitournewlookbranch NAB

Rupinder Kaur Rekhi and husband Gagandeep Singh Rehkhi with their 2-day-old son. (Damjan Janevski) 475083_06

Woodend road limit speeds up

A Woodend road is in the spotlight as residents fight over proposed speed limits.

At the April Macedon Ranges council meeting, councillors voted on changes to the speed limit on Spencer Road, Woodend.

In 2024, council installed 50km/h speed limit signs along the road, after community requests.

Before this, there were no prior records of speed signage on the road.

Council engaged with the Department of Transport and Planning Portal which

determined a default speed of 50km/h.

Following repeated incidents of vandalism and removal of signs, council officers, in consultation with DTP, identified an error on the portal, with the correct speed for Spencer Road being 80km/h.

In light of this, council notified residents in January 2025 of its intention to formalise the speed to 80km/h with DTP.

In March, council received a community petition on behalf of 30 residents stating their demand to have the speed limit stay at 50km/h, asking to have the signage reinstalled by the end of the month.

Later that month, council received a letter signed by 21 individuals objecting the petition request, preferring the 80km/h limit.

During the April meeting, the recommendation introduced by council’s assetsandoperationsdirectorDominicTestoni was to proceed with seeking approval with DTP to have the limit changed to 80km/h, inform residents of said change, install new speed limit signs and continue to review other potential speed limit inconsistencies.

The recommendation would bring the road in line with the Victorian Speed Zoning Guidelines, which recommends an 80km/h

New market to launch in Sunbury

A new initiative in Sunbury is helping the community access fresh and affordable produce.

The Sunbury Community Harmony Food Co-op will be a weekly market, offering an alternative to major supermarkets by providing fresh, seasonal, low mileage produce including fruit, vegetables and eggs.

The market will be open to all residents, but will also operates a referral-only membership program offering additional discounts to individualsandfamilieswhoareexperiencing

financial hardship.

The initiative is a partnership between Goonawarra Neighbourhood House, Multicultural Resource Hub and Sunbury Aboriginal Corporation. It was also supported by start-up funding from the state government, and supported by health promotion staff at Sunbury and Cobaw Community Health.

Co-op coordinator Bianca Lyndon and her dedicated team of volunteers are excited to welcome the community to the co-op for the

launch on Saturday, May 10.

On Saturday, May 10, the market will be running alongside the launch, with plenty to doandsee,includingcookingdemonstrations run by Hume council, a coffee cart, sausage sizzle, live music, face painting and games for children.

The launch event will take place between 10.30am and 12.30pm at the Sunbury Aboriginal Corporation, 43 Macedon Street, Sunbury, with the market running every Saturday from 10.30am to 12.30pm.

limit for roads of this type, a report to council said.

The motion was moved by deputy mayor Kate Kendall and seconded by Cr Janet Pearce. Cr Jennifer Anderson said it was an anomaly that the 50km/h signs went up.

“Different roads have different treatments. They have different traffic management on it and we would still hope regardless of what speed is on our roads that people drive to the conditions,” she said.

“The officers have done the research, and really it should have been at 80km/h.”

The motion was carried unopposed.

Calling young water heroes

Greater Western Water’s (GWW) National Water Week poster competition is back for 2025, with entries now open to all pre-schools and primary schools across its service region.

For the 2025 competition, students are encouraged to create a poster reflecting this year’s theme Water Heroes: Save Every Drop.

GWW spokesperson Kessia Thomson said the competition was a great opportunity for students to show their creative side and how they care for the environment at the same time.

“We’re encouraging all local students to get creative and enter a poster to this year’s competition. You can draw, you can paint or use some other materials including digital technology to create an A3 or A4 sized poster,” Ms Thomson said. “Each year we are blown away not only by the talent and creativity of our local students, but also by their ideas for water saving and caring for our water resources.”

The poster competition is open to all primary schools and pre-schools across Victoria, with prizes up for grabs valued up to $100 for individuals and up to $500 for schools for each of the following categories: early learning / kindergarten, prep, year 1 and 2, year 3- 4 and year 5-6.

Local winners will be announced in October. First prize winners from GWW’s local competition will automatically be entered into the state competition, with winners announced during National Water Week (20-26 October).

To learn more about the categories, prizes and how to enter, visit National Water Week.

Lauren Tyrell, Sharmmi Parekh, Bianca Lyndon, Isabella Rosinsky and Beth Smith are preparing for the market launch. (Damjan Janevski) 474641_02
‘‘ When you are feeling broken, the way to healing is through helping others ’’
- Liz Skitch

Four walls and a caring lifeline

Thomastown Neighbourhood House manger Liz Skitch runs a community hub from a room inside the local library, offering connection, creativity, and crisis support. Tom Ingleton spoke with Liza about mental health, hidden trauma, and why neighbourhood houses are crucial - but under resourced - pillars of community care.

Tucked away in a quiet room inside the Thomastown Library, you’ll find what might just be the suburb’s most essential service – though most people don’t realise it until they walk through the door.

There’s mental health slogans, and then there are mental health saviours and the latter certainly applies to the Thomastown Neighbourhood House.

“We didn’t know you were here!” is the most common thing people say when they discover the neighbourhood house, manager Liz Skitch says.

But once they do, it doesn’t take long for the truth to land.

Across Victoria, mental health services are overwhelmed and recent studies highlight this epidemic is only getting worse.

According to the Australian Bureau of Statistics, one in five Australians will experience a mental illness this year, yet in outer-metro areas like Whittlesea, access to psychologists remains critically low– just 2.2 per 1000 people.

Liz is many things to the community –actress, comedian and an award-winning performer – one thing she is not though is a psychologist.

However, she is very often the first point of contact for individuals in distress at the neighbourhood house.

“You give me a reason to leave the house,” one regular told her.

Another: “Thanks to your playgroup, I now have friends all over the neighbourhood.”

In a time marked by skyrocketing loneliness, cost-of-living stress and the long tail of the Covid-19 pandemic, places like this – warm, inclusive, and quietly revolutionary – are holding communities together.

And they’re doing it under the radar, on shoestring budgets, and with a kind of fierce love that can’t be faked.

When someone walks in clearly struggling,

Liz doesn’t offer a script.

“I listen. Then if I can help – I do,” Liz says.

“The heart-breaking thing is that more often than not, the best we can do is provide a safe space and a phone number to a better resourced organisation.”

What Liz wishes for is modest but urgent: a social worker on-site, food vouchers to give, transport for those who are stranded and can’t access services.

“Wedoourbesttopartnerwithorganisations like Foodbank and Whittlesea Community Connections but this is not enough.”

In that one sentence is the quiet frustration of countless front-line workers across Victoria, whoareholdingspaceforotherswhileburning out themselves.

One moment that stayed with Liz this year happened in a surprise setting – the Death Cafè.

It’s one of Thomastown Neighbourhood House’s more unconventional offerings, a philosophy-based program that facilitates conversations about end of life.

“One of the women shared how she lost her daughter to leukaemia, many years ago,” Liz recalls. “I was struck by her resilience and her creativity. Despite her grief, she’s committed to her community. It reminded me you never know what someone’s carrying.”

It’s a lesson that echoes across the programs the centre runs – from playgroups and craft workshops to dance classes and legal aid visits.

The weight of people’s stories isn’t always visible. But it’s there.

Since the pandemic, GPS and psychologists have increasingly referred patients to neighbourhoodhousesforwhatsomecountries call “green scripts” which directs patients to attend places doing activities that boost social cohesion and wellbeing without ever feeling like clinical intervention.

“Social cohesion is at an all-time low. Loneliness is at an all-time high,” Liz says.

“Butwhena newparticipantjoins our group, wefocusontheirstrengths.Beforelong,wecan see confidence grow and friendships flourish, “When you are feeling broken, the way to healing is through helping others.”

It’s healing through connection – and often, through creativity.

One of Liz’s highlights each week is a Monday afternoon dance party called Lets Move for young adults with disabilities.

“It’s pure joy,” Liz says. “That’s how I keep going – friendship and creativity.”

But Liz didn’t enter this role at a gentle time. She became manager mid-pandemic, when all the programs were shut down and the focus turned to emergency food relief.

Suddenly, she was running a pantry out of the library foyer five days a week, with food linesstretchingtowardthenearbysportsfields.

“I felt out of my depth every day,” Liz admits. “It was like trying to fill a bottomless well.”

Theneedhasn’teased.Ifanything,it’sgrown.

Now, with the cost-of-living crisis biting harder, the support of partners like Foodbank Victoria–whichbringsitsmobilesupermarket to Thomastown on Wednesdays – has become essential.

But so too has the advocacy for more sustainable support.

When asked what she wants politicians and mental health services to understand, Liz doesn’t hesitate.

“Neighbourhood houses provide a sense of belonging and purpose – which is often the key to overcoming mental health challenges from depression and loneliness, to stress and anxiety,” Liz says. “We provide safe spaces for people. But across Victoria, most neighbourhood house managers are working full-time hours in part-time roles. Burn-out is common. It’s not sustainable.”

Liz believes every house should have at least two staff present at all times to ensure safety and adequately support the wide range of

services they provide.

And in Thomastown, there is a desperate need for a larger space.

“We’re grateful to the City of Whittlesea and the state government for the support we do have,” Liz adds.

“But demand is surging, and our capacity hasn’t grown with it.”

It’s a confronting question – what would happen if Thomastown Neighbourhood House didn’t exist?

“There are very few spaces people can go to for free without feeling pressure to spend money,” Liz says.

“Shopping centres have become the default for when we have free time these days.”

Liz is also a passionate advocate for public outdoor spaces, encouraging locals to kick a ball around at the oval, explore local parks or visit the new Whittlesea Gardens skate park.

In a community where many women are migrants, caregivers, or survivors of trauma – including family violence – the role of Thomastown Neighbourhood House is bigger than just activity programs.

“We see people rebuild confidence here,” Liz says. “We see healing. Sometimes people come in quiet and withdrawn and a few months later, they’re running art class.”

Asked if she ever worries about her own mental health and carrying the emotional toll of caring for others, Liz is candid: “Stress and anxiety – it’s a big one for me. But I try to remember to breathe“.

And perhaps that’s the greatest power of neighbourhood houses like this one, they don’t just help others find stability –they model what compassion looks like in action, and yet community organisations like Liz’s are chronically underfunded and under-recognised.

As Liz states in a simple yet poignant truth “Neighbourhood houses are more important than ever.”

Thomastown Neighbourhood House manager Liz Skitch. (Damjan Janevski) 475040_02

Macedon Tea Rooms to reopen

The Macedon Tea Rooms is set to be upgraded in a major refurbishment deal.

The Benito Family Pty Ltd has been awarded the new lease for the tea rooms, with plans to transformitintospectaculardiningexperience on top of a Mt Macedon.

The tea rooms has been closed since March after the previous operator’s lease ended.

The state government put the lease for the tea rooms out to tender in June last year, and in March this year, the tea rooms closed after the current lease expired.

Northern Metropolitan MP Wendy Lovell raised the issue in state parliament on March

18, questioning the delay.

Thisweek,MacedonMPMary-AnneThomas welcomed the new deal with the family-owned company.

“The Mount Macedon Tea Rooms are an incredible economic and tourism asset for this community and the wider region – this will attract even more visitors to our beautiful region,” she said.

The tea rooms, which sit inside the Macedon Regional Park, are a popular spot for the over 300,000 visitors who come to the park to hike the summit and visit the Memorial Cross.

Works will begin within the coming weeks, with the building due to reopen later this year.

The family plans to add outdoor seating to take in the scenic views, evening dining, and space for events and functions.

New VIEW Club launched in Kyneton

Kyneton is the latest spot to gain a VIEW Club.

VIEW (Voice, Interests, Education of Women) is a national women’s organisation which gives local women the chance to make friends while supporting the education of children and young people experiencing disadvantage.

The Kyneton club is also one of 54 VIEW Clubs throughout the state which support and work with The Smith Family charity.

The Smith Family provides long-term learning support for Australian children and young people in need, and so far Australian

VIEW Clubs have raised over $1.3 million for the charity.

The clubs collectively also sponsor over 1800 students on the Learning for Life program.

Outside of fundraising, members also volunteertheirtimethroughreadingwithlocal children, helping with homework at Smith Family Learning Clubs and mentor students.

Kyenton VIEW Club president-elect Susan Doyle said the club will attract a broad range of women.

“Each VIEW Club is unique and plans its monthly meetings and events to suit the

interestsandlifestyleofitscommunity-minded members,” she said.

“If you are looking for an opportunity to meet new friends and make connections while supporting Australian children’s education enabling them to create a better future for themselves, then VIEW is an ideal club for you.”

The Kyneton club meets every third Monday of the month at 10.30am for an 11am start.

The club meets at The Kyneton Hotel, 98-100 Mollison Street, Kyneton.

Details: view.org.au or 1800 805 366

While works take place, visitors can still enjoy a coffee at a mobile coffee van that will be available at the site.

Environment Minister Steve Dimopoulos called the historic park a “special place”. The tearooms opened to customers in 2000, replacing a building destroyed in the 1983 Ash Wednesday fires.

Alongside the tea rooms, the state government has invested $810,000 into upgrading the Mount Macedon Memorial Cross Reserve.

Details: parks.vic.gov.au/places-to-see/ sites/macedon-tea-rooms

Shade motion welcomed I was heartened to read your recent article, ‘Hot playgrounds, cold truths,’ reporting Hume City Council has carried a motion to investigate and improve the city’s approach to UV protection and shaded play spaces.

Australia has one of the highest skin cancer rates in the world, with more than 95 per cent of cases caused by UV exposure.

The good news is skin cancer is also largely preventable.

Personal sun protection such as wide brimmed hats, covering clothing, sunscreen and sunglasses is essential but only part of the solution.

Increasing access to quality shade in public spaces is a simple, evidence-based and effective step local governments like Hume can take to reduce UV exposure and protect our community.

On behalf of Cancer Council

Victoria’s SunSmart program, I’d like to commend all councillors supporting Hume City Council’s recent motion. Considering all local councils are currently identifying their climate and health priorities for the next four years, now’s a critical time to recognise the importance of UV protective shade. We encourage all councils to follow Hume’s lead and take this step.

More information about SunSmart’s recommendations for local councils is available at: sunsmart.com.au/ advice-for/local-government/municipalpublic-health-and-wellbeing-plans

The founding members of the new Kyneton VIEW Club. (Supplied)
The Macedon tea rooms. (Supplied)

As part of Victoria’s Big Build, we’re building the Metro Tunnel and its five new underground stations, with three stations now complete. Work is continuing on two stations, and we’re testing trains through the tunnel to make sure they operate smoothly and safely.

While we work, disruptions could affect your travel

Train disruptions: Buses replace trains in both directions

Sunbury Line 10 to 11 May 17 to 18 May 24 to 25 May 7 to 8 June

you

Arden Station

Discovering cardiac rehabilitation in the Macedon Ranges

Cardiac rehabilitation (cardiac rehab) plays a crucial role in helping individuals recover from heart-related events, such as heart attacks or surgeries, and in managing chronic heart conditions.

The Macedon Ranges Health (MRH) Cardiac Rehab program is designed to provide comprehensive support that empowers participants to lead healthier, more active lives while reducing the risk of future heart problems.

The program at MRH combines expert-led

exercise routines, personalised education, and ongoing support tailored to each individual’s needs. The focus is on fostering long-term lifestyle changes that not only enhance physical health but also improve overall well-being. Cardiac rehab helps to support individuals to lower their chances of hospital readmission and can also reduce their risk of death from heart conditions.

Cardiac Rehab at MRH typically begins during the transition to outpatient care, whether at home or within the community,

ensuring continuity in the rehabilitation process. MRH offers flexible options, including face-to-face sessions in a group setting or one-on-one appointments, based on the patient’s preference and comfort level.

A key component of the MRH program is the initial assessment with an exercise physiologist. This assessment ensures that each participant is ready to engage in group exercise sessions safely and effectively. The program is designed not just to restore heart

function but also to equip participants with the knowledge and skills to maintain a heart-healthy lifestyle.

For those seeking a structured and supportive environment to aid their recovery, the Heartsmart Cardiac Rehab Program at MRH is an excellent resource.

To learn more, call (03) 5428 0300 and ask for Louise Beer, the program coordinator. She can provide additional details and help you take the first step toward a healthier heart.

Choir ready to perform

The talent of the Ranges will be on show in Castlemaine this month, as The Gisborne Singers performs its first concert of 2025.

Set for Sunday, May 18, the concert program includes Purcell’s Come, Ye Sons of Art Away, and Vivaldi’s choral masterpiece Gloria in D Major – which is considered by many as one of sacred music’s most uplifting choral works.

Featuring renowned soloists Meryln Quaife and Kristen Leich, the choir will be accompaniedbytheMacedonRangesChamber Orchestra and conducted by Luke Severn.

Formed in 1980, The Gisborne Singers is a choral ensemble that has evolved over time and is currently focused on performing large-scale

classical works.

Funds raised by ticket sales at its concerts and events all go towards the choir’s further activities, for example, performing alongside professional singers and orchestral players.

The May 18 concert will begin at 2.30pm at the Castlemaine Town Hall, with tickets able to be purchased online and costing $55 for full pricing, $45 for concession – along with free entry for those aged under 12.

The Gisborne Singers are a community choir and new members are always welcome, with no auditions required and rehearsals on Wednesdays at the Gisborne Uniting Church.

Details: gisbornesingers.org.au

Briefs

Measles exposure sites

There is currently an increased risk of measles in the Macedon Ranges. There are four exposure sites in the Macedon Ranges, all from Saturday, April 19. They are: Holgate Brewhouse, Woodend, from 12.30pm to 1.20pm; Paysanne Cafe, Woodend, from noon to 1.55pm; Woolworths, Kyneton, from 3.30pm to 4.30pm; and Musk Lane Wine, Kyneton, from 4.30pm to 6.15pm. Chief health officer Dr Evelyn Wong recommends anyone who has attended an exposure site during the specified times should monitor for symptoms and seek medical care if symptoms develop for up to 18 days after the exposure, until Wednesday, May 7. Symptoms of measles include fever, cough, sore or red eyes, runny nose, and feeling generally unwell, followed by a red maculopapular rash.

Steam rally

The Annual Steam and Vintage Machinery Family Fun Day is on Sunday, May 18, from 9.30am-4pm. There will be children’s activities, live steam and vintage machinery on display, as well as the ever popular Tractor pull competition with entrants coming from across Victoria. It’s at the Gisborne Steam Park, Webb Crescent, New Gisborne. Entry is $15 for adults. Children can attend for free. Details: www.gisbornevmrs.com/#rally

FOR BREAKING NEWS, VISIT

Web: starweekly.com.au

Sunbury & Macedon Ranges Star Weekly @starweeklynews @star_weekly

A group of members from The Gisborne Singers. (Supplied)

PUZZLES

To solve a Sudoku puzzle, every number from 1 to 9 must appear in: each of the nine vertical columns, each of the nine horizontal rows and each of the nine 3 x 3 boxes. Remember, no number can occur more than once in any row, column or box.

ACROSS

1 Also known as (1,1,1)

3 Sacrilegious (11)

9 Difficult to understand (7)

10 Captivate (7)

11 Somewhat (8)

12 Smear, often with oil (6)

14 Spawn, similar to caviar (3)

15 Without aim (11)

17 Restrictions (11)

19 For this, ad – (Lat) (3)

20 Cease (6)

21 Plastic unit containing audio or visual tape (8)

24 High-protein pulse (7)

25 Middle Eastern national (7)

26 Impediment (11)

27 Televisions (abbr) (3)

DOWN

1 Inherited from one’s family (9)

2 Whenever you like (7)

3 Stereotypically masculine (5)

4 Speed up (10)

5 Bars (4)

6 Designer of goods and structures (9)

7 Opening (7)

8 Separate metal from ore (5)

13 Crowning ceremony (10)

15 Metallic element (9)

16 People living together in communities (9)

18 Of the Freemasons (7)

19 Highest in temperature (7)

20 Rummage (5)

22 Wait on (5)

23 Operator (4)

can you list? The centre letter must be included and each letter may only be used once. No colloquial or foreign words. No capitalised nouns, apostrophes or plural nouns ending in “s”.

1 What was the first successful contact lens made of?

2 ‘Herbst’ is German for which season?

3 What astrological term is used to describe the apparent backwards movement of a planet through the sky?

4 The legal drama series The GoodFight starring Christine Baranski (pictured) is a spin-off of which show?

5 What is the name of Taylor Swift’s 2023–2024 concert tour?

6 In which decade were the first Grammys awarded?

7 In which ocean would you find The Bahamas?

8 JojoRabbit, Hunt for the Wilderpeople and Boy were all directed by which filmmaker?

9 What are homonyms?

10 True or false: chickens can recognise up to 100 faces?

COMMUNITY CALENDAR

WANT YOUR EVENT LISTED? Community Calendar is made available free of charge to not-for-profit organisations to keep the public informed of special events and activities. Send item details to Star Weekly Community Calendar, Corner Thomsons Road and Keilor Park Drive, Keilor Park, 3042, or email to westeditorial@starweekly.com.au by 9am Wednesday the week prior to publication

Sunbury Ladies Badminton Club

Sunbury Ladies Badminton Club invites women to be part of Sunbury Ladies Badminton Club and enjoy the benefits of physical activity combined with socialisation. Social games are held every Thursday morning, excluding public and school holidays, from 10am–12pm at the Eric Boardman Stadium in Wilsons Lane, Sunbury. You are also welcome to sign up to be part of a team, also playing each Thursday morning. Equipment and coaching is provided.

 sunburylbc@gmail.com

Friends of Woodlands Historic Park

Help preserve Woodlands Historic Park and learn about its history by joining the Friends of Woodlands Historic Park. The group consists of volunteers, working one day each month in the park, on projects including plant propagation and revegetation, weed removal, litter control and other activities. Some members may also work in the park on projects at other times. Becoming a member of the group is easy and free, and is open to like-minded people who want to take positive action to maintain our environment. You must be 18 or older and enjoy outdoor activities. The Friends group meets on the first Saturday of each month at the Parks Victoria depot off Somerton Rd, Greenvale.

 Bevan, 0468 469 514 or bevan@keepemail.com

Sunbury Art Society

The Sunbury Art Society meets every Friday and Saturday, from 10am- 3pm, at the Boilerhouse, Jacksons Hill, to paint or draw over a cuppa with other like minded people. New members welcome.

 Ken, 0407 062 568, or Yvonne, 0429 994 828

Art group

The Woodend Art Group holds classes and workshops in the studios in the Woodend railway station complex. It also has a social Tuesday where members and interested people can come along in the morning, have a coffee and paint together in a social environment.

 Colin Robinson, 0407 426 252

Shuttles and pickleballs

Macedon Ranges Badminton Club is inviting residents to come and play badminton, or pickleball, or both at Macedon Community Centre. Badminton is played on Tuesdays from 7.30pm and Thursdays at 9.30am. Pickleball is played on Mondays at 6.30pm, Wednesdays at 10.15am and on Tuesday from 10am at the Romsey Recreation Centre.

 David, 0419 589 425, or macedonrangesbadminton@gmail.com

Scottish country dancing

The Macedon Ranges Scottish Country Dancing Group meets every Thursday,1-3pm, at Buffalo Stadium, Woodend. The dancing involves social country dancing, and no special clothes needed, just soft flat shoes.

 Meg, 0409 166 783, or Linda, 0408 476 317

Amateur radio club

The Macedon Ranges Amateur Radio Club meets on the third Saturday of the month at the Woodend RSL Hall, 32 Anslow Street, Woodend, at 10am. If you are interested in amateur radio or already have a call sign, this could be for you.

 http://www.mrarc.org.au

Take off weight naturally

Struggling to lose weight? Struggling to get motivated? Want to try and do it in a friendly

This week’s photographer’s choice picture is of Werribeeks members Carmel Gerdsen, Debbie Conway and John Tulloch. (Ljubica Vrankovic) 475439_01

and less stressful atmosphere? Come and join TOWN (Take Off Weight Naturally) every Thursday at 9am at the Sunbury Neighbourhood House, 531 Elizabeth Drive, Sunbury.

 Rhonda, 0409 740 924

Community. Connect. Create. If you are needing support or looking for a social group to join, you can visit Community. Connect. Create, which is an online resource listing support and community groups in the Macedon Ranges. if you would like your group listed or would like to work to help this project grow please email: fiona@communityconnectcreate. com.au

 Communityconnectcreate.com.au

Kyneton Badminton Club

Kyneton Badminton Club is a welcoming, fun and social group that plays on Mondays, at 7pm at the Kyneton Toyota Sports and Aquatic Centre, Victoria Street. All skill levels are welcome.

 kynetonbc@gmail.com

Masonic Lodge

The Sunbury Macedon Ranges Masonic Lodge meets monthly on the second Wednesday of the month at 7pm, 73 Main Street, Romsey. New members welcome.

 Paul, 0479 127 476, or Rob, 0428 260 647

Sunbury Combined Probus Club

The Sunbury Combined Probus Club meets every fourth Thursday of the month at the Sunbury Bowling Club at 10am.

 Jo, 0410 834 272

Ladies probus

The Woodlands Ladies Probus Club of Sunbury meets on the fourth Monday of each month at the Sunbury Bowling Club at 9.45am.

 Leonie, 0401 764 182

Sunbury Ladies Probus Club

The Sunbury Ladies Probus Club meets at 9.30am on the fourth Wednesday of each month at the Sunbury Football Social Club rooms.

 Pat, 0433 789 754, or Sylvia, 0417 170 142

Probus Club Of Sunbury

Join the Probus Club of Sunbury on the first Wednesday of the month at the Sunbury Bowling club at 9.30am. It’s a friendly men’s group open to visitors and new members, with a number of great events held each month.

 Greg, 0417 593 035

Breast cancer support group

On the first and third Tuesday of the month

breast cancer survivors are invited to head along to the Gisborne Golf Club at 10.30am to take part in a breast cancer support group.

 Lesley, 0484 691 226

HarmoniX Vocal Company

All-male singing group happening on Thursday, 7-9.30pm, in Sunbury, with a mixed choir, DynamiX Vocal Company, rehearsing Tuesday, 7-9.30pm. Rehearse at Dulap Wilim Hub, Leichardt Street, Sunbury. No auditions required.

 harmonixvcinc@gmail.com

Rotary club

The Sunbury Rotary Club meets every Tuesday at the Ball Court Hotel, 60 Macedon Street, Sunbury, from 7pm.

 sunburyrotary@gmail.com

Village connect

Enjoy free coffee and cake while connecting with fellow Macedon Ranges residents 55 years old and older. Happening on Tuesdays and Thursday at cafes across the municipality.

 https://bit.ly/3AMUrxm, or 5422 0262

Arts and games night

Get creative at the Sunbury Youth Centre each Wednesday, from 3.30-5.30pm. The free program is for people aged 12 to 18 years old, at 51-53 Evans Street, Sunbury. VIEW Club

Sunbury-Macedon Ranges VIEW Club is a friendly women’s organisation and a valued part of The Smith Family. It meets on the third Friday of each month at 11am at Club Sunbury, Riddell Road, Sunbury. New members warmly welcome  Lee-anne, 0403 047 909

Sunbury Woodworkers Club

Join the Sunbury Woodworkers Club to learn woodturning. No experience or tools required. The club is a welcoming environment open to men and women who wish to learn. Meetings for new guests are held on the third Wednesday of every month at 7.30pm. Circular drive, Jackson’s Hill, Sunbury. Facebook: Sunbury Woodworkers Club.

 Anita, 0417 402 795

The Dress is more that it seams

‘The Dress’ might just epitomise the notion that things aren’t always what they seem –especially in Melbourne at the end of the 19th century.

While widow Hannah may live in a grand mansion and not want for anything, loneliness is an unspoken curse.

For her flamboyant tailor Bertin, the advent of department stores and retail therapy is a hit to the pocket and prominence alike.

Essence Theatre Productions chairperson Alaine Beek, who wrote the play, quite literally puts herself in Hannah’s shoes by playing the character herself.

“In those days when you were a widow, you

were often just given tenancy and you didn’t really own much,” Ms Beek said.

“We presume wealthy people had this happy, exciting life, but it wasn’t necessarily the case.

“Women had very limited power, and it could actually be quite boring.”

Hannah loves Bertin for the light he brings to her overcast life, but his escapades are something she desperately tries to evade.

The dynamic duo will embark on a tale of insistence and resistance when he tries to drag her along to a masquerade ball, where he will try and showcase his work.

On top of facing the loss of his livelihood, Bertin must also walk a fine line as a gay man

in a society that can be both ambivalent and persecutory.

“Bertin’s sexuality– it’s revered, but it’s never spoken about, but if he gets in the wrong circle he could be in trouble,” Ms Beek said.

The show will be staged at Werribee Park Mansion on Friday, May 9 at 8pm.

Tickets: https://www.essencetheatre. productions/the-dress-booking-page

Alaine Beek and Scott Middleton will depict the friendship of Hannah and Bertin in The Dress. (Supplied)

Artists share their creative journey

Altona’s Louis Goel Gallery has another exhibition that art lovers from the inner-west and beyond can enjoy.

Three Artists, One Journey features the work of Amanda Neville, Ilona Herreiner and and Juan Vasquez who are all based at the Altona Artisans ceramic studio at the Louis Joel Arts and Community (LJAC) centre.

Opened on April 26, the exhibition will run through until May 14 and features ceramics, mosaics, wood, and clay sculptures that explore the shared creative journey of three artists shaping raw materials into expressive forms.

Neville’s intricate mosaics piece together colour and texture, telling stories through fragments, while Vasquez’s ceramics celebrate the fluidity and strength of clay, capturing both tradition and innovation.

Herreiner’s sculptures, crafted from wood and clay, speak of transformation and organic movement.

Though working in different mediums, each artist shares a deep connection to process, material, and storytelling.

Their hands shape, carve, and construct, bridging past and present, form and emotion.

The exhibition allows patrons to experience

this dialogue, where art becomes a reflection of touch, time, and vision.

The Louis Joel Gallery is located within the LJACcentreandisopenfrom 9.30am-4.30pm Tuesday - Friday, and from 11am - 2pm on Saturday and Sunday. Three Artists, One Journey closes at 3pm on Thursday, May 14.

For more information: https://www.ljac. com.au/about-louis-joel-gallery/ Those wanting to learn from the three artists as well as viewing their work, can do so at a range of courses offered at the Altona Artisans ceramic studio.

Details: //www.ljac.com.au/altonaartisans/

An optimistic art exhibition for the times

Brimbank Gallery in Sunshine is proud to present Onward & Upward, a solo exhibition by acclaimed Australian artist Patrick Francis, running until May 30.

This vibrant and emotionally resonant exhibition showcases a compelling new body of work that continues Francis’ unique exploration of humanity, movement, and transformation through bold colour and expressive form.

Known for his distinct style of figurative abstraction and powerful visual storytelling, Patrick Francis brings an intuitive energy to his work, celebrating both individual identity and shared experience.

Onward & Upward is a reflection on perseverance, joy, and the pursuit of personal growth, all deeply embedded in his signature style—vivid, direct, and deeply human.

Francis, a Melbourne-based artist, has exhibited widely across Australia and internationally. His work is held in major public and private collections, including the National Gallery of Victoria, Artbank, and the Art Gallery of New South Wales. Recognised not only for his artistic achievements but also his advocacy for artists with disabilities, Francis’ practice continues to redefine expectations and expand conversations around contemporary Australian art.

Brimbank Gallery invites the community to experience Onward & Upward, where each work resonates with energy, optimism, and a bold sense of momentum.

The gallery is located onthe first floor of the Brimbank Community & Civic Centre. It is open Monday to Friday, 9am to 5pm. Entry is free.

There are about 900 species of eucalypts in Australia, and an upcoming workshop at the Melton Botanic Garden will give you the opportunity to sketch and appreciate just some of these incredible trees.

Friends of Melton Botanic Garden and environmental psychology doctor

Kathleen Bagot are partnering to host a two-hour nature sketching and journaling workshop this month, providing sketching skills and an opportunity to practise mindfulness in an outdoor setting with like-minded nature enthusiasts.

The event coincides with Botanic Gardens Week.

The workshop starts with a guided nature-based mindfulness practice, followed by a warm up with some different sketching techniques and discussion of template options.

There will then be a discussion about eucalypts, and the session will end with a chance to share your thoughts and sketching pages with other attendees.

All supplies will be provided to participants new to nature sketching or journaling, and no experience or art skills are required.

Experienced sketchers are welcome to bring their own favourite journal and supplies, or use those provided.

Ms Bagot said the event is aimed at being accessible and inclusive to all who would like to attend.

“You don’t have to be an artist or a scientist to do nature journaling … it really is about slowing down [and] noticingwhat’sinnature,”MsBagotsaid.

She said that a previous workshop held on March 23 for National Eucalypt Day sold out.

Theworkshopwillbeheldfrom10am–noon on Sunday, May 25 at the Melton Botanic Garden.

Tickets can be purchased online. Details: events.humanitix.com/naturesketching-eucalypts-in-melton-botanicgarden-25-may

The work of artists Juan Vasquez, Ilona Herreiner, and Amanda Neville is on display in the Three Artists, One Journey exhibition at the Louis Joel Gallery in Altona until May 14. (Ljubica Vrankovic) 472730_01
Artist Patrick Francis and exhibition curator Richard Orjis. (Supplied)
Environmental psychology doctor Kathleen Bagot at the Melton Botanic Garden. (Damjan Janevski 475273_01

Still keeping ahead of the game

It’s amazing how the Toyota Corolla has evolved over the years.

Back in the day it was basic, vanilla transport and that’s the way it stayed for years.

Then someone, somewhere flipped a switch and things began to change dramatically, starting with the 11th gen Corolla in 2012.

But it was just a warm up for the current model which arrived in early 2018, with its complex, unrepentant, multi-faceted design.

Sittinglowerthanbeforewithasteeplyraked windscreen, it presents a predatory nose, with a designthatisasgoodasanythingfromEurope.

The long and short of it is that the company has been able to transform the image of the car from staid and conservative into something much more sporty with younger buyer appeal - and Corolla remains the best-selling cars in the world.

Styling Corolla hatch starts from $30,630 for the AscentSport,$33,780fortheSX,$37,620forthe ZR - all with a 1.8-litre hybrid petrol-electric drivetrain and CVT automatic.

And, if the sporty ZR doesn’t float your boat, there’s also the high performance, all-wheel drive GR Corolla to consider.

But bring your money with you, because it’s a big hike in price: $67,990 in manual form or $70,490 with an automatic (before on-road costs). Two-tone paint adds $775 and is offered in combination with white, grey, red, silver and blue.

Our test vehicle, the ZR Hybrid hatch, is priced from $43,280 by the time you put it on the road in Sydney. The price varies a little depending on your address.

Finished in black over silver, the ZR looks stunning.

Standard kit includes 18-inch alloys, dual zone climate air and a combination of real and artificial suede trim, with heated sports seats up front with red accents and an eight-way, power-adjust driver seat with lumbar support.

There’s also a premium gear lever and steering wheel, smart entry and start, electric parking brake, adaptive cruise control, road sign recognition, auto lights and wipers, auto-dimming rear view mirror, front and rear parking sensors and rear privacy glass. In the lights department, it has auto high beam, bi-LED headlights, along with LED daytime, tail and front/rear fog lights.

ZR steps up to a full 12.3-inch digital instrument cluster along with windscreen head-up display.

Corolla comes with a five-year unlimited kilometre warranty.

Infotainment

Infotainment consists of an 8.0-inch touchscreen with premium JBL 8-speaker audio, plus Bluetooth, satellite navigation, AM/ FMandDAB+digitalradio,andwirelessApple CarPlay and wired Android Auto.

You also get 12 months of complimentary access with remote connect to Toyota Connect Services which automatically notifies emergency services in the event of an accident as well as provides remote access to the car.

There’s also a wireless charge pad, two USB-C ports and a 12 volt outlet in the front (but nothing for rear seat passengers).

Safety

Corolla has been awarded a full five stars for safety by ANCAP. It comes with a rear view camera, seven airbags including a driver knee airbag and autonomous emergency braking (City, Interurban & Vulnerable Road User) as well as lane keep assist (LKA) with lane departure warning (LDW).

An upgraded Toyota Safety Sense suite starts with the pre-collision safety system which adds motorcycle detection, intersection collision

avoidance support for crossing vehicles and left/right turn, emergency steering assist and acceleration suppression at low speeds.

Cameras and radar sensors have also been improved offering a wider range for detection of obstacles or vehicles.

Blind spot monitor has been added across thehatchrange,whilelanetraceassisthasbeen expanded to include the emergency driving stop system feature that has been designed to bring the vehicle to a gradual stop if it detects the driver is no longer making vehicle inputs.

The active cruise control system has also been enhanced and now offers four distance settings, the ability to detect other vehicles earlier, and the addition of deceleration assist when changing lanes.

But it misses out on auto reverse braking.

Isofix child restraint anchorage points are provided for the rear outboard seats.

Engines/transmissions

With the introduction of the upgraded fifth-generation hybrid powertrain, performance has been boosted with a 13kW increase in power to deliver a combined output of 103kW.

The upgraded hybrid teams a 1.8-litre petrol engine with a newly developed high-output motor generator, power control unit and downsized hybrid transaxle.

The front, axle-mounted drive motor has been enhanced by doubling the number of magnets per pole inside the rotor, while the newly developed lithium-ion battery reduces weight by 14 per cent while increasing both input and output power.

Thehybriddrivesthefrontwheelsexclusively via a continuously variable transmission (CVT).

Driving Corolla’s low stance and wind-cheating profile places the car quite close to the ground. As a result,itcanmakegettinginandoutdifficultat timesanditmeansdrivewaysandspeedhumps also need to be approached with caution, as the low front apron is prone to scraping.

Sports seats with bolstered sides add to the difficulty. The sloping rear roof line also makes entry to the back seat more difficult than it probably should be and you might find it a little cramped once you’re in.

The boot gains some extra space, with a puncture kit instead of a spare tyre to make room for the hybrid battery pack.

Of note Corolla’s cousin the Lexus UX scores a larger 2.0-litre engine as the basis for its hybrid that produces a combined 146kW.

Putting the transmission of the hybrid in Power mode delivers more satisfying throttle response, with a turn of speed thanks to the boost from the electric motor. But make sure you don’t pull the transmission lever back all the way or you’ll find yourself in B instead of D, which is regenerative braking mode.

Traffic sign monitor recognises physical speed signs only.

It doesn’t recognise electronic speed signs, nor does it differentiate between standard signs, timed school zones or bus and truck advisory speed - so until it encounters a real speed sign it could be telling you fibs.

Steering is sharp and the hatch corners flat and hard, but the ride is overly harsh and the cabincanbecomequitenoisydependingonthe surface.

Toyota does not permit operation of the satellite navigation system while the car is in motion.

It’s super annoying, but you have to be in park with the handbrake activated. And that means pulling over and spending precious minutes on the task.

Sluggish response from the touchscreen makes the task that much more difficult. You can bang in the name of a street only to look up and discover it failed to recognise the first letter and that means starting over.

Of course, you could try appealing to the car’s voice activation system, but that’s an even more frustrating experience.

At the end of the day the hybrid is all about economy and this is where the Corolla excels. Rated at 4.0L/100km, we were getting 5.2L after almost 400km of mixed driving.

Summing up

You can’t really go wrong with the Corolla ZR hybrid hatch, but it commands a steeper price these days at more than $43K on the road.

There’s no longer a petrol model to distract buyers, but the hybrid powertrain provides immediate, accessible, no frills fuel savings to the average motorist, with no need for user intervention.

Beware the low ride height however which makes entry and exit more difficult than you might think.

You can’t really go wrong with the Corolla ZR hybrid hatch. (Pictures: Supplied)

Bulldogs find a way to get the win over Hawks

Gisborne showed plenty of resolve to sneak home against Eaglehawk in the Bendigo Football League on Saturday.

After a five point win against Strathfieldsaye the previous week, the Bulldogs were again made to fight hard, this time against the Hawks.

With composure late in the final quarter, the Bulldogs were able to come away with a 13.6 (84)-12.10 (2) win.

Bulldogs skipper Jack Reaper said they were relieved to get the win.

“It was really nice to head up there and face Eaglehawk on their home ground,” he said.

“We were able to manage the minutes and produced the result in the end.”

Reapersaiditwasabackandforthgamewith bothsideshavingtheirtimetoshineinthesun.

He said it was a really competitive game with the Hawks having some big bodies.

The Bulldogs kicked the first couple of goals in the last quarter to open up a bit of a lead, before the two sides went goal for goal later in the quarter.

Reaper said early in the season they’ve had to play hard final quarter football, which will be important later in the season.

“We had our chance against South Bendigo and were five goals down and had to chase them,” he said.

“Thistimetheyweretheoneschasingandwe wereabletoputguysbehindtheball.That’stwo games we have won under two goals.

“It’s good to get the result and move to 3-1.”

Matthew Merrett, Pat McKenna and Shane Clough were named the Bulldogs best.

McKenna and Clough both returned to the side, from injury and Victorian Football League respectively.

Reaper said the pair make a huge difference

to the squad. He said it was pleasing to see Jacob Floreani come into the side on the wing and play a good role after starting the season in the reserves.

The Bulldogs face Castlemaine this Saturday before a break the following week.

Reaper said they were hoping to enter the week off with a 4-1 record, happy with where it was sitting so far.

“We know that Eaglehawk and South Bendigo are better teams than last season,” he said.

“We have two tough games to come and we have a few players go away in the middle of the year.

“We face Castlemaine at home. It would be nice to beat them and have a good win at home and be 4-1 at the bye.”

In netball, Gisborne beat Eaglehawk, 48-32. Tara

A shooting masterclass

Shooting 94 goals in a game was all in a day’s work for Sunbury Lions star Rebecca Hicks on Saturday in the Ballarat Netball League.

The star shooter put up a massive 94 goals as her side beat Ballarat 96-26 in one of the best shooting performances ever seen in the league.

Hicks had 98 shots for the game, missing just four, as she averaged more than a one and half goals a minute.

“It wasn’t my plan,” said a sore Hicks the following day. “I just show up every Saturday and all I want to do is just shoot to the best of my ability.

“To hit 94, I don’t think anyone has ever done that in a game. Pretty proud moment for myself and I think for the club as well.”

Hicks said she had no idea she was getting close to that 100 goal mark until the Lions footballers on the side started screaming at her about getting 100 goals.

Hicks’ previous best in the league was 84 goals when she was playing for Darley in 2023. She also scored 82 goals in a game that same season.

The performance came despite a back niggle and having played the night before.

“We’ve got a few players out with injury and some are away on holidays, so I’ve had to step in and play on Friday,” Hicks said.

“I shot atrociously on Friday, I didn’t play well. I knew on Saturday I had to back it up.”

Hicks said to score 96 goals as a team for the game was a massive result in itself.

The reigning premiers are undefeated after four rounds.

“We don’t expect to score that much,” she said. “We did have fill-ins, we had a B-grade goaler playing alongside myself.

“We then had to put Simmy [Simona Di Filippo] into goals to give her a break. I think for us, we just needed to win that game to keep ticking along.

“For me, I just had a good ball supply from our defenders and our middies. For us to score that much was to the credit of them.”

Chelsea Amor put up two goals from five attempts, while Di Filippo missed her three shots.

Hicks said Amor is an awesome goaler who listens, making it easy for Hicks to adapt to her.

“I don’t ask a lot of my goal attacks, just get the ball to me as fast as you can,” she said. “I’ll do the rest.”

For Hicks, much of her week is consumed by netball.

As well as playing for the Sunbury Lions, she coaches and plays at Glen Orden in the

Western Netball League.

She’s taken on playing when she can for Woodend-Hesket in the Riddell District Netball League, while playing in the state’s top competition, the Victorian Netball League with the Western Warriors.

Hicks said she had always wanted to play VNL and something that she had thought about the past few years.

“I have a family, I have three kids and it makes it hard to juggle,” she said. “They’re all playing netball as well.

“For me, it’s about having a good support system and my partner and our families to help out with the kids.

“That’s the only way it’s been made possible. If I didn’t have that support system, I wouldn’t be able to play as much netball and give VNL a good crack, I’m blessed to have that system behind me.”

Hicks said having the chance to match it with the best netballerS in the state in the VNL was a good challenge that she loved.

“The difference between VNL and footy-netball was so big,” she said. “The level of netball you play is unreal.

“It’s a bit of a reality check. Yes, I’m good at football-netball leagues but playing VNL has been a humbling experience.”

Sports shorts

VNL

The Western Warriors paid for lacking some polish against the Boroondara Express in the Victorian Netball League on Monday night. Coming off two straight wins, the Warriors never looked likely as they lost 61-43. Most of the damage was done in the second quarter, which the Warriors lost 17-8.

Ballarat NL

The Sunbury Lions had a day out against Ballarat in the Ballarat Netball League on Saturday afternoon. Undefeated, the Lions put out a dominant 96-26 win, shooting more than 20 goals in each quarter. Shooter Rebecca Hicks put up a massive 94 goals with just four misses in one of the biggest shooting totals the league has seen. The Lions are the only team to win its opening four matches.

EDFL

The Sunbury Kangaroos made it two wins in a row, as Rupertswood and East Sunbury both suffered losses in the Essendon District Football League division 2 competition. The Kangaroos led all day against the Northern Saints and were able to hold off a third quarter comeback to win 16.14 (110)-14.11 (95). Rupertswood suffered its first loss of the season, losing to Westmeadows as East Sunbury was thrashed by Glenroy. In the women’s division 2 competition, the Sunbury Lions beat East Sunbury, which as mutually parted ways with its coach, and the Kangaroos lost to Roxburgh Park.

Big V

It was a tough night for the Sunbury Jets in the Big V women’s championship on Saturday. The Jets were on the road against the Sherbrooke Suns and managed to get back into the game in the third quarter after a slow start. The comeback caught up with them as the Suns finished strongly to claim an 87-67 win. Emmonnie Henderson top scored with 18 points. The Jets sit in seventh spot.

Murray Pat McKenna returned to the side. (Ljubica Vrankovic) 420265_04
Rebecca Hicks. (Ljubica Vrankovic) 413382_15

Turn static files into dynamic content formats.

Create a flipbook
Star Weekly - Sunbury Macedon Ranges - 6th May 2025 by Star Weekly - Issuu