Skip to main content

Star Weekly - Melton Moorabool - 6th May 2025

Page 1


their 2-day-old son.

475083_06

Mum’s bundle of new love

While many mothers will be receiving breakfast in bed or handmade cards this Mother’s Day, Rupinder Kaur Rekhi will be spending her Mother’s Day cradling the newest addition to her family– a little baby boy.

For Ms Rehki and her husband Gagandeep Singh Rekhi, the arrival of their son has been a heartwarming and emotional experience, bringing a mix of emotions and deep reflection.

“It’s mixed feelings when you go into labour of course,” Ms Rekhi said.

“But after that it’s all well – when we see the baby, it makes it all worth it.”

While Mother’s Day might be a little more low-key this year, there will still be room for celebration.

“Grandmother is here so maybe we will go out and have dinner to celebrate,” Ms Rekhi said.

For Mr Rehki, witnessing his wife’s labour gave him renewed appreciation for the strength of mothers everywhere.

“When I see my wife giving birth, I get even more respect for motherhood. I always have more respect for my mother and for my wife, for every mother in this world,” he said.

Labor retains the west

Voters across Melton and Moorabool largely backedLaborattheballotboxattheweekend’s federal election, with the party retaining the seats of both Hawke and Gorton with swings to the government.

In Gorton, Labor’s Alice Jordon-Baird was elected as the new MP, taking the seat from retiring Labor MP Brendan O’Connor.

Gorton covers Melton and Brimbank – with the electorate including suburbs Caroline Springs, Burnside, Hillside, Fraser Rise, Taylors Hill, Albanvale, Deer Park, Kings Park, Delahey, Sydenham, Taylors Lakes and Keilor.

Mr O’Connor had held the seat since its creation in 2004.

According to the Australian Electoral Commission, Ms Jordan-Baird secured 60.40 per cent of votes on a two-party basis, over Liberal candidate John Fletcher – who received 39.60 per cent.

In a statement to Star Weekly , Ms Jordan-Baird said that it was “the greatest honour of my life to have been elected to represent the federal seat of Gorton”.

“I’m ready to get to work with the Albanese Labor Government to deliver for our community here in the west - for families, for workers and for everyone,” Ms Jordan-Baird said.

Transport was a key focus in both the Labor and Liberal campaigns this election, with Labor promising budget funding for both upgrades to the Western Freeway and Calder

Park Drive.

The Liberal Party matched the commitment to deliver both projects if elected.

Labor’s Sam Rae held on to the seat of Hawke in the electorate’s second term of existence, attracting a small swing.

On the two-party preferred count, Mr Rae drew 57.64 per cent of votes, with Liberal candidate Simmone Cottom receiving 42.36 per cent.

This represents a 0.02 per cent swing to Labor, with a margin of 12,704 votes.

Created in 2022 after a boundary distribution, Hawke covers 1986 square kilometres and includes Melton, Bacchus Marsh, Ballan, and Sunbury.

In a Facebook post, Mr Rae said that he was “honoured to continue representing our

wonderful community. “

“No matter how you voted, I’m here to fight for our community to get what we deserve,” Mr Rae said.

Liberal challenger Simmone Cottom thanked the residents of Hawke who voted for her saying “While it wasn’t the result we had hoped for, I am deeply humbled by your support.”

“To everyone I met along the campaign trail that shared their story, their local knowledge, their community spirit and their well wishesthank you. I am grateful to call this wonderful community home,” Ms Cottom posted on her Facebook page.

“I would like to extend my sincere gratitude to my entire team of volunteers. Thank you for going above and beyond, week after week. “

Rupinder Kaur Rekhi and husband Gagandeep Singh Rehkhi with
(Damjan Janevski)

Call for a Melton policing boost

To boost the number of police in the Mount Atkinson corridor, Melton council will advocate for the “urgent” delivery of a new police station in the area, encouraging the state to also consider a co-located emergency service hub.

The council will write to the ministers for police and emergency services and local MPs, requesting a new police station in Mount Atkinson, Cobblebank, or Thornhill Park.

The council will also ask the state to consider co-locating other emergency services at the site to form a hub.

It will also request information from Victoria Police on current police response

times, resourcing, and infrastructure across the municipality – focusing on new and expanding areas – and advocate for increased policestaffingatexistingpolicestationsacross Melton and Caroline Springs.

Councillor Phillip Zada raised the idea at the April 28 council meeting. He said that establishing a new police station in the Mount Atkinson growth corridor would “not only serve the immediate area but also elevate and rebalance resourcing” across existing stations in Melton and Caroline Springs.

He said co-locating emergency services in a hub would create a more “integrated and efficient response network for the west.”

Councillor Sophie Ramsey said that a justice precinct has been “identified in the Cobblebank area,” and that “everybody has been working closely to get that off the ground for a number of years.”

“We need to get those messages across. Melton City is 527 square kilometres – it’s a big area … and we need services,” Cr Ramsey said.

Melton MP Steve McGhie said that he has met with local police to discuss police resourcing and another police station in the Melton council area, also raising these issues with the police minister.

Melton Local Area Commander Pat

Join the Lions Club for charity cuppa

Raising important funds for cancer support services and research, the Lions Club of Diggers Rest is hosting a Biggest Morning Tea this month.

Open to people of all ages and from Diggers Rest and beyond, the morning tea will provide sweet and savoury breakfast options, fresh coffee and tea, cold beverages at bar prices, and a chance to socialise with others while raising money for the Cancer Council. Funds raised will go towards research and support initiatives for people diagnosed with cancer.

There will also be raffles and auctions, with

prizes generously donated from several local businesses.

Lions Club of Diggers Rest president Kathy Skinner said the event was well-received among attendees last year.

“People just enjoyed being able to meet other people from Diggers Rest and just be social,” Ms Skinner said.

“Last year was very successful. We were lucky, we received a lot of donations from local businesses and individuals as well.

“We all know someone who has been touched by cancer in one way or another, and you want to help, but there’s not a lot you can

do – so this is a great outlet for that.”

The morning tea will run from 10am–noon on Saturday, May 17, at the Diggers Rest Bowling Club on Old Calder Highway. Entry costs $25 per head, with other prices negotiable for children who would like to attend.

To register, RSVP by May 10 by contacting the organisation.

Through last year’s Biggest Morning Tea, the club raised $4373 for the Cancer Council.

Contact: Bob, 0429 786 665 or lcdrcarols@ gmail.com

Cantone said “Melton and Caroline Springs Uniform Police are well supported” by other police units and teams.

“Melton Police continue to conduct 24/7 intelligenceledpatrols,includinginareassuch as Cobblebank and Thornhill Park. Existing police stations are located within less than [ten kilometres] of Cobblebank, Thornhill Park and Mount Atkinson,” Commander Cantone said.

“There are no current plans for new police stations to be built in any of these areas.”

A spokesperson for the state said the operational need for new and upgraded police stations is a matter for Victoria Police.

Melton council residents might hear a knock at their door from late May onwards as part of a survey covering satisfaction of council services and facilities.

Professional field researchers will randomly select homes across the municipality to ask residents about a range of topics, including their satisfaction with local planning and council programs, the sense of community in Melton council, and local issues.

A total of 800 homes will be involved in the survey.

This data will then inform the council’s ongoing services by helping to reveal where residents’ needs are being met, and where they are not.

Residents who have been selected for the survey can expect a knock on their door between Saturday, May 17 and Sunday, June 8 for the approximately 15-minute survey.

Responses are confidential.

Melton mayor Steve Abboushi said it is important that the council hears from the community to understand if itismeetingitsneedsandexpectations in terms of service delivery.

“The survey helps [Melton council] to gain insight into the community’s satisfaction with council services and identify areas that may need improvement,” Cr Abboushi said.

“We look forward to hearing what our community thinks council is doing well, and anything they’d like to see changed in the future.”

The field researchers will carry photo identification.

Fraser Rise service station approved despite objections

A new service station in Fraser Rise is on the cards after Melton council granted a planning permit for the site, despite the plan receiving 42 community objections.

The 3711-square-metre site will be developed at the intersection of Taylors Road and Plumpton Road.

The service station will include six fuel bowsers with 12 pumps, an on-site café, and will be open for business 24-hours a day throughout the week.

There will also be a food and drink premises that will be open seven days a week.

A car wash with two vacuum bays and four wash bays will also operate at the site, open between 7am and 10pm.

The planning permit for the site received 42 community objections and nine submissions of support and was approved by council at the April 28 council meeting.

According to council, objections to the plan included concerns around amenity impacts in regards to health and safety, traffic issues, noise, light, air emissions, proximity to homes, and the storage of dangerous goods.

Council city growth and development

manager Blake Angus said that while recognisingcommunityconcerns,theproposal complies with the Melton Planning Scheme, and that council officers recommended supporting the application.

Councillor Sophie Ramsay drew attention to a page of the council report that mentioned a proposal for a similar service station site that was initially rejected by Yarra Ranges council.

“Although the emotive side of me says no, the councillor side of me needs to make the assessment on planning grounds,” Cr Ramsey said. “The proposal in Yarra Ranges council,

which was refused, had 194 objections. Lots of different health concerns and other concerns were noted and tested, and yet … VCAT overruled the decision,” she said.

“There are lots of people that need petrol stations. We need petrol stations in our municipality, we need independent petrol stations in our municipality, and if there [are] any concerns, I’m hoping that there would be planning enforcement down the track.”

Residents in opposition to the decision have 28 days from Monday, April 28 to appeal it with VCAT.

The Lions Club of Diggers Rest member Stephen Hynes, president Kathy Skinner and secretary Bob Cassar are preparing to host their Biggest Morning Tea. (Damjan Janevski) 474872_01

New kit helps with STI prevention

As a significant step in STI prevention for Australian women, the country’s first self-test kit for chlamydia and gonorrhoea is now available nationwide, offering greater privacy and fast results according to the company behind the break-through.

The first of its kind in Australia, the self-test kit detects chlamydia and gonorrhoea with one swab sample, producing a positive or negative result for both infections in 15 minutes.

STIs affect almost one in six (16 per cent) Australians in their lifetime and over the last 10 years, cases have increased at an alarming rate in Australia, with rates of chlamydia and gonorrhoea increasing by 26 per cent and 157 per cent respectively.

Chlamydia is the most reported communicable disease in Australia, with over 110,000 reported cases in 2023, but is often asymptomatic, leading to undiagnosed cases as people remain reluctant to test for the infection due to perceived stigma or lack of awareness. Gonorrhoeapresentswithpainordiscomfort in the throat, eyes, cervix and other areas but, similarly, it is often mistaken for other infections and remains undiagnosed.

Steven Quinlan, sales director at Touch Biotechnology which developed the self-test kit, says it gives “women immediate control overtheirsexualhealthinawaythattraditional clinical testing does not“.

“Touch Biotechnology’s STI self-test kit for chlamydia and gonorrhoea works similarly to the common rapid antigen tests, using a single

swab, buffer solution and test cassette to test for both infections in women, supporting early diagnosis and treatment,” he explained.

“By enabling women to easily test themselves when and where suits them, the self-test kit eliminates the anxiety associated with clinical settings and transforms the experience into a routine part of self-care.

“Knowing their STI status also helps women to communicate better with healthcare providers, access the right medication, and reduce the risk of antibiotic misuse, which can lead to drug resistance.

“Affordable and discreet self-test kits remove the barriers that have traditionally kept women from seeking care. When infections are caught early, swift action can be taken to prevent complications, such as infertility or chronic pelvic pain.

“In underserved communities, where access to healthcare can be limited, this type of testing is especially important. If adopted in healthcare centres, these kits could increase

The facts:

What are chlamydia and gonorrhoea?

Chlamydia and gonorrhoea are both bacterial sexually transmitted infections (STIs) that affect both men and women. Chlamydia is caused by Chlamydia trachomatis. It often doesn’t show symptoms, especially in women, but can lead to serious health issues like infertility if untreated. It can be cured with antibiotics.¹ Gonorrhoea is caused by Neisseria gonorrhoeae. It can cause symptoms like painful urination and discharge, but many people don’t experience symptoms. Like chlamydia, it can be treated with antibiotics, though some strains are becoming resistant to treatment.²

What are the risks of untreated chlamydia and gonorrhoea? If left untreated, chlamydia and gonorrhoea can lead to serious health complications for both men and women. For women, untreated chlamydia and gonorrhoea can cause pelvic inflammatory disease (PID), which can lead to chronic pain, infertility, and an increased risk of ectopic pregnancy. These infections can also increase the risk of HIV transmission.³ Additionally,

testing capacity, reduce costs, and improve overall health outcomes for women and the community.”

The Chlamydia and Gonorrhoea Rapid Test (for female) is now available for purchase at pharmacies, distributors, and online

untreated STIs can contribute to the spread of the infection to others, as well as cause more severe health issues over time. Timely treatment with antibiotics is essential to avoid these risks.

What are the symptoms of chlamydia and gonorrhoea?

Many people, particularly women, may not experience any symptoms, which is why these infections can often go undiagnosed. For women with chlamydia, common symptoms include abnormal vaginal discharge, painful urination, and pain during sex. Some may also experience lower abdominal pain or bleeding between periods or after sex.¹ Gonorrhoea, like chlamydia, may not always present clear symptoms. In women, symptoms often include increased vaginal discharge, painful urination, pelvic or abdominal pain, and bleeding between periods or after sex.

Citations: 1. https://www.health.gov.au/ topics/sexual-health/about 2. https://nindss. health.gov.au/pbi-dashboard/ 3. https://sti. guidelines.org.au/sexually-transmissibleinfections/chlamydia/ 4. https://www. healthdirect.gov.au/gonorrhoea-the-clap

nationwide,tobecompleteddiscreetlyathome. Prior to this, the only option for women to test for gonorrhoea and chlamydia was to complete an individual lab or PCR test. This invasive process could be costly and takes too long, with results typically taking one to three days.

Harness racing shocked by death

The passing of champion driver Greg Sugars, aged 40, has devastated the harness racing industry, which mourns a gifted reinsman, outstanding professional, and wonderful person.

Sugars passed in New South Wales on April 25, shattering news that was felt across the globe, having been widely regarded as one of Australia’s greatest drivers after a 25-year career that boasted more than 4000 wins.

Harness Racing Victoria chairman Bernard Saundry paid tribute to the person affectionately known as “The Candyman”.

“We have lost one of harness racing’s best,” he said. “Greg was a wonderful person and an incredible ambassador for our sport.

“Our hearts go out to Jess Tubbs and the entire Sugars family. This is a devastating loss as Greg provided so much guidance and support to others in the sport.”

Sugars was always destined for greatness. He followed his grandfather, Len, a South Australian Hall of Fame trainer, and father, Ross, a harness racing living legend, into the sport.

His first drive was as a teenager at Globe Derby on October 31, 2000, with his maiden win coming a little over a month later at the same track with Escrow.

Sugars attributed a trip to the United States in2002tosettinghimonasuccessfulpathway.

When he returned to his native South Australia, Sugars immediately packed his bags and headed to Victoria. He was duly followed by Ross, who realised that relocating

was necessary to provide more opportunities for Greg and his sister, Kylie.

Sugars credited his dad Ross and brilliant late Victorian reinsman Gavin Lang with having “massive influences” on his career, regarding the latter as “the best driver I’ve

seen”.

In his eighth year in the sulky and aged 23, Sugars cracked the barrier for 100 wins in a season for the first time, having been first past the post in 106 of his 785 starts. He would never dip below triple figures in any

season since, with 2019-20 his most prolific, recording 321 wins from 1617 starts.

In 2011-12, he won the Victorian Metropolitan Drivers Premiership, saluting in 41 of his 235 starts. He would then add the Victorian State Drivers Premiership to his mantlepiece in 2014-15,amassing253winsfrom1528starters. His achievement saw him the only driver between 2011-12 and 2021 to unseat brilliant reinsman Chris Alford for that award.

For all that he had achieved, Sugars’ career went to a new level when he and wife-trainer JessTubbsintroducedtheLarajayFarmstable. Tubbs trained more than 600 winners from 2017-18, most driven by Sugars, including a modern great in trotter Just Believe.

In a whirlwind journey that took him across the country, to New Zealand and even Sweden for the world-renowned Elitloppet, Sugars would team with Just Believe for 29 wins, including two Inter Dominion Trotting Championship grand finals, a Great Southern Star Final, and the TAB Trot, National Trot, Rowe Cup and Dominion Trot across the Tasman.

Sugars also won the Inter Dominion Trotting Championship Grand Final with Maori Law in 2021, while his triumph in New Zealand’s 2011 Northern Derby with Sushi Sushi and Better Eclipse’s victory in the 2022 Chariots Of Fire were other treasured moments.

In all, he won 64 Group 1s in Australia and six more in New Zealand, and in February thisyearjoinedelitecompanywhenhesteered the mare Festinalente to victory at Bendigo to record his 4000th Australian win as a driver.

Gath claims victory as Greg Sugars honoured

Kate Gath wrestled with her emotions after steering Tango Tara to victory in the Vale Greg Sugars Free For All at Melton on Saturday night.

Saturday night’s metropolitan meeting at Melton Entertainment Park was dedicated to the memory of the late Greg Sugars, with the running of a race and special tributes to be staged in his honour throughout the evening. Sugar, a Moorabool local, passed in New South Wales the previous weekend having been widely regarded as one of Australia’s greatest drivers after a 25-year career that boasted more than 4000 wins.

Moments earlier in the home straight she had surged past Jess Tubbs-trained Rocknroll Hammer and James Herbertson in the red, white and green silks made famous by the late Sugars.

“I kind of feel bad for winning,” Gath said. “I’m pretty competitive, but I’ve got to say going past ‘Herbie’ up the straight wasn’t as good as it normally is when you win.”

Gath sensed the crowd willing Rocknroll Hammer on after that pacer straightened with a clear lead.

“It doesn’t feel great to beat his stable runners, but it’s still an honour to win his race,” she said.

Eachrunneratthemeetingworearibbonof Sugars’ driving colors in their hair.

“It’s an honour to wear the red, white and green ribbon and the massive impact that Greg had on everyone around the world,” she said.

Gath echoed the sentiments of the entire harness racing industry.

“I think we are all still pretty numb and in shock. It’s unbelievable and I can’t stop thinking about Jess and Greg’s family,” she said.

“Greg was so talented, he was gifted. Look at the horseman he was and the trainer and driver he was.

“I forget how many times Andy (Gath) would say to me ‘watch Greg in this race, watch how he does this’.

“He was so good over the short trip off the second row, which is so hard to win here, and Greg got it right every time.”

A short time earlier, all drivers, along with Sugars’ wife Jess, assembled on the track to observe a minute’s silence in a tribute to the champion horseman.

A large crowd gathered on the lawn to join in the tribute.

The winner of more than $430,000

in prizemoney, Tango Tara could find himself sunning his nine-year-old bones in Queensland in a couple of months’ time.

Outstanding trotting mare Keayang Zahara did Greg Sugars racing silks proud when she carried them to victory while adding win number 15 to her picket fence career form line in the Hertz Melton Trotters Free For All.

Glen Craven, having his first drive on the seven-time Group 1 winner, had trouble keeping his feelings in check after the race.

“That’s why we’re in the game, that’s just unbelievable. I can’t thank the whole family enough for giving me the opportunity to drive on this horse and Jess (Tubbs) for letting me wear Greg’s colours,” Craven said.

“I’ve known Greg since I started driving, he was always such a great driver to get advice off when I was learning at the start but at the end of the day, he was just a true friend to me and to so many people. He’s just going to be greatly missed,” he said.

Greg Sugars with wife Ellie Tubbs and Just Believe. (Harness Racing Victoria)
John Dunne
Tango Tara. (Stuart McCormick)

Spoil mum with her favourite treats on Mother’s Day

Mother’s Day is the perfect occasion to show your appreciation by treating your mum to something truly special – and what better way than with delicious food? Whether you opt for breakfast in bed, a luxurious brunch, an elegant afternoon tea, or a beautifully prepared dinner,theeffortandloveyouputintocreating a memorable meal will mean the world to her. Here are some ideas to inspire you:

Breakfast in Bed

Start her day with a tray full of her favourite breakfast items. Freshly baked croissants or pastries, a bowl of mixed berries, and a glass of freshly squeezed orange juice make for a light but indulgent option. If she prefers something heartier, homemade pancakes topped with whipped cream and strawberries, or a classic eggsBenedict,wouldbearealtreat.Don’tforget a good cup of coffee or a pot of her favourite tea to complete the experience.

Elegant Brunch

If a late morning meal suits your plans, an elegant brunch can be a wonderful way to celebrate. Think smoked salmon bagels with cream cheese and dill, a colourful frittata loaded with vegetables, or a fluffy quiche Lorraine. Fresh fruit salads, yogurt parfaits with granola, and freshly baked muffins can add variety and color to the table. A Mimosa or Bellini (or a non-alcoholic sparkling juice) makes a festive touch that feels extra special.

Afternoon Tea

Spoil your mum with a homemade afternoon tea. Arrange a selection of delicate finger sandwiches, such as cucumber and cream cheese, smoked salmon and dill, or egg mayonnaise. Serve alongside scones with clotted cream and jam, mini cakes, macarons, and dainty pastries. Brewing a pot of

high-quality tea and presenting everything on a pretty tiered stand will make it feel just like a luxury hotel experience at home.

Homemade Dinner

For a truly memorable evening, prepare a homemade dinner featuring her favourite dishes. Start with a light appetizer like a fresh Caprese salad or a creamy mushroom soup. For the main course, dishes like roast chicken with garlic and herbs, pan-seared salmon with

lemonbuttersauce,orarichvegetarianlasagna canbeshowstoppers.Pairthemealwithagood wine if she enjoys it. Finish with a decadent dessert such as a chocolate lava cake, lemon tart, or a classic pavlova topped with fresh fruits.

Sweet Treats and Extras Don’t forget the power of homemade sweet treats.Bakingabatchofherfavouritecookies,a moist carrot cake, or a luscious cheesecake can

be the icing on the cake (literally). You could also create a small box of homemade truffles or chocolate-dipped strawberries as a gift.

No matter what you cook or bake, the key is totailorthemealtowhatyourmumlovesmost. Add thoughtful touches like a handwritten menu,avaseoffreshflowers,oraheartfeltcard to make the meal even more special. When it comes to spoiling mum, it’s the love, time, and effort that truly count.

Mum’s the word and so is “yum”! Lock in your Mother’s Day plans with us for a lunch or dinner she’ll love, complete with mouthwatering specials and $3 oysters all day long. Tables are booking up fast, so don’t leave Mum hanging reserve your spot now!

Book Now!

Desperate plea for Congo peace

Imagine building a new life in Australia, only to wake up each day to heartbreaking news — families displaced, loved ones in danger, and war tearing through your homeland.

For many Congolese Australians, this is not just a distant tragedy but a personal and painful reality.

PastorWillyMudiayiwasseparatedfromhis family due to war. His mother and youngest brother,whowereforcedtofleetheirhomeland in search of safety, now live in a refugee camp in Malawi, while his other siblings escaped to South Africa.

‘‘ How can you sleep and be at peace when your tribe is being killed day and night ’’ - Pastor Willy

Unfortunately he has never met his youngest brother in person, only seeing him for the first time on Facebook, and staying in contact with his family has been a constant struggle.

“We have the longest cemetery that exists, they are burying people along the railway,” he said. “How can you sleep and be at peace when your tribe is being killed day and night?”

Pastor Willy tried to apply for a visa during Covid-19 to bring his family and brother to Australia, but now that the war has broken out, theprocesshasbecomeevenmorechallenging.

Tarneit resident Nick Cshibala, who is the chair of DRC Community Association of Victoria (DRCCAV), highlighted that the majorityofCongolesepeoplelivinginAustralia are originally from the eastern region of the DRC, where the war is currently unfolding.

“People in the west, east or in the city, have just similar stories. They still have a family memberintheeasternpartofCongowherethe action is taking place,” he said.

“Since the war started in Goma and Bukavu, our children have not been going to school for more than a month now.

“Some of their families have already been killed because of this war. It’s affecting them emotionally and financially. They are struggling to help their families that are still alive.”

Congolese Australians have been actively advocating, fundraising, and engaging with MPs and community groups for many years.

Games beckon mum

Mother of two and athletic star Karley Crommie is showing that motherhood can be an opportunity to rediscover new skills and achieve personal bests.

The west mum is celebrating a story of self-discovery and strength after realising she needed to do something for herself and her health.

Realising fitness was better on the athletics track than in the gym, Crommie refocused on doing what she loved and is set to compete at this year’s Australian Masters Games.

Having always been passionate about track and field, Crommie re-joined athletics a few months after her first child was born.

Crommie is now coaching Little Athletics at Keilor and continues to run personal bests on the athletics track, recently breaking national indoorrecordsinthe60mand200m(Women’s 35s) at the Australian Masters Indoor Championships.

“After I had my firstborn, I remember walking up a big flight of stairs and being so out of breath,” she recalled.

“I knew I needed to do something for my health.

“As a teenager, it was all about winning. I always compared myself to others. Now, it’s about getting a personal best – just improving, season by season.”

Crommie’s son, Jesse,10, , and daughter, Violet, 8, have always been supportive, recording her races and cheering her on from the sidelines.

At the Australian Masters Nationals, held from April 18-21, Ms Crommie ran her personal best for the 60m, which was recorded as a Victorian Masters record.

“IfeellikeI’matmypeak,butattheupcoming games, I hope I can execute a perfect race, get a personal best, and beat it,” she said.

CrommiewillbecompetingattheAustralian Masters Games in Canberra from October 18-25.

A key achievement was their meeting with former Tarneit MP Telmo Ramon Languiller who had also served as shadow parliamentary secretary for multicultural affairs. The meeting was attended by a dozen Congolese leaders and described as “the first of its kind in the history of the Congolese community.”

“We have to stand up for our rights. We have tofightforourrightsbecauseCongolesepeople deserve human rights and they deserve peace,” Mr Cshibala said.

“We are trying to knock on all the doors, diplomacy, trying to lobby, trying to do everything that we can to support our family back home. We want our country to be happy

THISAUCTIONSATURDAY AT12.30PM

and free like people living here in Australia.”

As a good citizen, Pastor Willy has made significant contributions to Australian society, particularly in the areas of disability support, counseling, community service, and finance.

HequestionswhyAustralia,acountryhehas served with love and kindness, is not helping his community in return?

“Britain and German spoke against Rwanda. Australia is just quiet as if there is nothing going on,” he said.

“Australia is closing its eyes to the killings in the Congo. The human rights and all the good policytheyalwayspraisehere,Ibegintodoubt.

“Wecontributetothiscountry.Wework.We pay taxes. But when we need Australia to stand for us, it is silent.”

Manor Lakes College teacher Irene Bakulikira agrees saying “the double standards are exhausting and it’s heartbreaking to feel invisible in our own suffering.”

“Is our pain not worthy of attention? Are our lives not valuable enough to be grieved and fought for?

“We are not invisible, our pain is real. Our lives matter. The world just chooses not to see us.

“When other countries are under attack, social media was filled with posts, stories, hashtags and outcries. And that was right! People spoke up, stood in solitary and demanded justice. But why is it that when it’s Congo, a country that has suffered for decades under conflict, exploitation and violence, the silence is so loud?”

Advocates say Australians can make a meaningful impact by amplifying the message, educating themselves, and engaging with local lawmakers to push for policies that will help bring attention to Congo’s crisis. Funds can also be raised at gofund. me/43faad76

Magnificent family home

Stunning Family Home at 18 Corfu Street, Fraser Rise

Welcome to your dream home! Nestled in the heart of Fraser Rise, this exquisite 4-bedroom, 2-bathroom house at 18 Corfu Street is a perfect blend of modern elegance and comfortable living.

**Key Features:**

Four generously sized bedrooms, this home offers ample space for families of all sizes. Each room is designed to maximize comfort and privacy, ensuring everyone has their own sanctuary.-

Stylish Bathrooms: Enjoy the convenience of two well-appointed bathrooms, featuring contemporary fixtures and finishes that elevate your daily routine.

This property boasts a unique layout that enhances both privacy and outdoor space, perfect for family gatherings or quiet evenings.

Elegant Interior Design: Step inside to discover a beautifully designed interior that combines functionality with style. The open-plan living areas are perfect for entertaining, with natural light flooding through large windows.-

Gourmet Kitchen: The heart of the home, the kitchen is a chef’s delight, featuring laminated wood cabinetry and ample counter space for meal preparation. Whether you’re hosting a dinner party or enjoying a casual family meal, this kitchen will inspire your culinary creativity.

This property is perfect for families looking for a peaceful yet vibrant community. With local parks, schools, and shopping centers just a stone’s throw away, you’ll enjoy the convenience of suburban living without sacrificing access to city amenities.

18 Corfu Street Fraser Rise

Raine & Horne: 289 High Street Melton 9743 6866 | rh.com.au/https://www.raineandhorne.com.au/melton  12762125-RV19-25

Mother of two, Karley Crommie is rediscovering her speed as a Masters athlete. (Supplied)
Pastor Willy. (Stewart Chambers) 464258

PUZZLES

To solve a Sudoku puzzle, every number from 1 to 9 must appear in: each of the nine vertical columns, each of the nine horizontal rows and each of the nine 3 x 3 boxes. Remember, no number can occur more than once in any row, column or box.

ACROSS

1 Also known as (1,1,1)

3 Sacrilegious (11)

9 Difficult to understand (7)

10 Captivate (7)

11 Somewhat (8)

12 Smear, often with oil (6)

14 Spawn, similar to caviar (3)

15 Without aim (11)

17 Restrictions (11)

19 For this, ad – (Lat) (3)

20 Cease (6)

21 Plastic unit containing audio or visual tape (8)

24 High-protein pulse (7)

25 Middle Eastern national (7)

26 Impediment (11)

27 Televisions (abbr) (3)

DOWN

1 Inherited from one’s family (9)

2 Whenever you like (7)

3 Stereotypically masculine (5)

4 Speed up (10)

5 Bars (4)

6 Designer of goods and structures (9)

7 Opening (7)

8 Separate metal from ore (5)

13 Crowning ceremony (10)

15 Metallic element (9)

16 People living together in communities (9)

18 Of the Freemasons (7)

19 Highest in temperature (7)

20 Rummage (5)

22 Wait on (5)

23 Operator (4)

can you list? The centre letter must be included and each letter may only be used once. No colloquial or foreign words. No capitalised nouns, apostrophes or plural nouns ending in “s”.

1 What was the first successful contact lens made of?

2 ‘Herbst’ is German for which season?

3 What astrological term is used to describe the apparent backwards movement of a planet through the sky?

4 The legal drama series The GoodFight starring Christine Baranski (pictured) is a spin-off of which show?

5 What is the name of Taylor Swift’s 2023–2024 concert tour?

6 In which decade were the first Grammys awarded?

7 In which ocean would you find The Bahamas?

8 JojoRabbit, Hunt for the Wilderpeople and Boy were all directed by which filmmaker?

9 What are homonyms?

10 True or false: chickens can recognise up to 100 faces?

Still keeping ahead of the game

It’s amazing how the Toyota Corolla has evolved over the years.

Back in the day it was basic, vanilla transport and that’s the way it stayed for years.

Then someone, somewhere flipped a switch and things began to change dramatically, starting with the 11th gen Corolla in 2012.

But it was just a warm up for the current model which arrived in early 2018, with its complex, unrepentant, multi-faceted design.

Sittinglowerthanbeforewithasteeplyraked windscreen, it presents a predatory nose, with a designthatisasgoodasanythingfromEurope.

The long and short of it is that the company has been able to transform the image of the car from staid and conservative into something much more sporty with younger buyer appeal - and Corolla remains the best-selling cars in the world.

Styling Corolla hatch starts from $30,630 for the AscentSport,$33,780fortheSX,$37,620forthe ZR - all with a 1.8-litre hybrid petrol-electric drivetrain and CVT automatic.

And, if the sporty ZR doesn’t float your boat, there’s also the high performance, all-wheel drive GR Corolla to consider.

But bring your money with you, because it’s a big hike in price: $67,990 in manual form or $70,490 with an automatic (before on-road costs). Two-tone paint adds $775 and is offered in combination with white, grey, red, silver and blue.

Our test vehicle, the ZR Hybrid hatch, is priced from $43,280 by the time you put it on the road in Sydney. The price varies a little depending on your address.

Finished in black over silver, the ZR looks stunning.

Standard kit includes 18-inch alloys, dual zone climate air and a combination of real and artificial suede trim, with heated sports seats up front with red accents and an eight-way, power-adjust driver seat with lumbar support.

There’s also a premium gear lever and steering wheel, smart entry and start, electric parking brake, adaptive cruise control, road sign recognition, auto lights and wipers, auto-dimming rear view mirror, front and rear parking sensors and rear privacy glass. In the lights department, it has auto high beam, bi-LED headlights, along with LED daytime, tail and front/rear fog lights.

ZR steps up to a full 12.3-inch digital instrument cluster along with windscreen head-up display.

Corolla comes with a five-year unlimited kilometre warranty.

Infotainment

Infotainment consists of an 8.0-inch touchscreen with premium JBL 8-speaker audio, plus Bluetooth, satellite navigation, AM/ FMandDAB+digitalradio,andwirelessApple CarPlay and wired Android Auto.

You also get 12 months of complimentary access with remote connect to Toyota Connect Services which automatically notifies emergency services in the event of an accident as well as provides remote access to the car.

There’s also a wireless charge pad, two USB-C ports and a 12 volt outlet in the front (but nothing for rear seat passengers).

Safety

Corolla has been awarded a full five stars for safety by ANCAP. It comes with a rear view camera, seven airbags including a driver knee airbag and autonomous emergency braking (City, Interurban & Vulnerable Road User) as well as lane keep assist (LKA) with lane departure warning (LDW).

An upgraded Toyota Safety Sense suite starts with the pre-collision safety system which adds motorcycle detection, intersection collision

avoidance support for crossing vehicles and left/right turn, emergency steering assist and acceleration suppression at low speeds.

Cameras and radar sensors have also been improved offering a wider range for detection of obstacles or vehicles.

Blind spot monitor has been added across thehatchrange,whilelanetraceassisthasbeen expanded to include the emergency driving stop system feature that has been designed to bring the vehicle to a gradual stop if it detects the driver is no longer making vehicle inputs.

The active cruise control system has also been enhanced and now offers four distance settings, the ability to detect other vehicles earlier, and the addition of deceleration assist when changing lanes.

But it misses out on auto reverse braking.

Isofix child restraint anchorage points are provided for the rear outboard seats.

Engines/transmissions

With the introduction of the upgraded fifth-generation hybrid powertrain, performance has been boosted with a 13kW increase in power to deliver a combined output of 103kW.

The upgraded hybrid teams a 1.8-litre petrol engine with a newly developed high-output motor generator, power control unit and downsized hybrid transaxle.

The front, axle-mounted drive motor has been enhanced by doubling the number of magnets per pole inside the rotor, while the newly developed lithium-ion battery reduces weight by 14 per cent while increasing both input and output power.

Thehybriddrivesthefrontwheelsexclusively via a continuously variable transmission (CVT).

Driving Corolla’s low stance and wind-cheating profile places the car quite close to the ground. As a result,itcanmakegettinginandoutdifficultat timesanditmeansdrivewaysandspeedhumps also need to be approached with caution, as the low front apron is prone to scraping.

Sports seats with bolstered sides add to the difficulty. The sloping rear roof line also makes entry to the back seat more difficult than it probably should be and you might find it a little cramped once you’re in.

The boot gains some extra space, with a puncture kit instead of a spare tyre to make room for the hybrid battery pack.

Of note Corolla’s cousin the Lexus UX scores a larger 2.0-litre engine as the basis for its hybrid that produces a combined 146kW.

Putting the transmission of the hybrid in Power mode delivers more satisfying throttle response, with a turn of speed thanks to the boost from the electric motor. But make sure you don’t pull the transmission lever back all the way or you’ll find yourself in B instead of D, which is regenerative braking mode.

Traffic sign monitor recognises physical speed signs only.

It doesn’t recognise electronic speed signs, nor does it differentiate between standard signs, timed school zones or bus and truck advisory speed - so until it encounters a real speed sign it could be telling you fibs.

Steering is sharp and the hatch corners flat and hard, but the ride is overly harsh and the cabincanbecomequitenoisydependingonthe surface.

Toyota does not permit operation of the satellite navigation system while the car is in motion.

It’s super annoying, but you have to be in park with the handbrake activated. And that means pulling over and spending precious minutes on the task.

Sluggish response from the touchscreen makes the task that much more difficult. You can bang in the name of a street only to look up and discover it failed to recognise the first letter and that means starting over.

Of course, you could try appealing to the car’s voice activation system, but that’s an even more frustrating experience.

At the end of the day the hybrid is all about economy and this is where the Corolla excels. Rated at 4.0L/100km, we were getting 5.2L after almost 400km of mixed driving.

Summing up

You can’t really go wrong with the Corolla ZR hybrid hatch, but it commands a steeper price these days at more than $43K on the road.

There’s no longer a petrol model to distract buyers, but the hybrid powertrain provides immediate, accessible, no frills fuel savings to the average motorist, with no need for user intervention.

Beware the low ride height however which makes entry and exit more difficult than you might think.

You can’t really go wrong with the Corolla ZR hybrid hatch. (Pictures: Supplied)

Warriors unable to put all the elements together

A lack of polish proved costly for the Western Warriors in the Victorian Netball League on Monday night as their winning streak came to an end.

It was a shorter break for the Warriors, who faced the Boroondara Express, two days earlier than the usual Wednesday time slot.

The Express, which was coming off its first loss of the season in the previous round, took control of Monday’s game in the second quarter.

After leading by two goals at quarter time, the Express won the second quarter 17-8 to open up what would be a match winning lead.

There wasn’t much difference between the sides in the second half, with the Express winning 61-43.

Warriors assistant coach Courtney McLean said they didn’t do the basics right for long enough.

McLean coached the side with coach Kim Bailey away on work commitments.

“The second quarter wasn’t good,” she said. “We lacked in the basics consistently and having two options at the ball.

“I still think we are good enough to beat them and in patches we did what we wanted to do in the chat pre-game.

“WewantedtoslowdownRubyBarkmeyer’s useinattack.Wedidn’tdoitforlongenough.”.

Kim Borger shot 27 goals for the Warriors,

switchingbetweenthetwoshootingpositions.

While disappointed to have conceded a big lead like that early, McLean said the group did fight hard in the second half.

“I’m proud of the girls,” she said. “In the past we would have let that go and they would

Sharks find a way to win

Hillside is on the board in the Essendon District Football League division 1 competition, after a tough few weeks to start the season.

Missing eight of their best 12 players, the Sharks have been tested early on against three fellow finalists from last season.

On Saturday, it was another challenge against an Avondale Heights side that had been more than competitive after dropping down into division 1.

The Sharks were able to put out their best four quarter performance of the season to get the job done, 10.16 (76)-6.12 (48).

Sharks coach Mo Kaakour was a relieved man to get some reward for effort.

“It’s nice to finally get the win, the boys have worked hard,” he said. ‘“We stuck to the game plan and we got rewarded.

“The boys have worked hard and had a big pre-season. We’ve played four of the better sides in the first four rounds.

“We hadn’t been blown out of the water. It

was nice to get one.”

The Sharks led by 19 points at quarter time and then trailed by a point at the main break.

After half time, the Sharks kicked six goals to two to seal the win.

Kaakour said the difference was playing four quarters of good football. He said the focus this week had been to bring the energy and intent defensively.

“Defensively to keep Avondale Heights to just six goals when they had been hitting the scoreboard was really good,” he said.

“Our defensive pressure was good. The boys brought into the defensive structure.”

JamesMcNaughtonkickedfourgoalswhile Robbie Castello and Josh Covelli kicked two goals each.

Kaakour said Castello put his hand up to run through the middle of the ground to provide some leadership.

“He had 35 possessions,” he said. “At 39 years of age and still playing his part like that is pretty inspiring.”

Khalil Kaakour, who is coming off two league under-18 best and fairests, also moved

have really run over the top of us.

“We didn’t do that but you don’t want to give away a lead like that at this level, it’s hard to get back.”

McLean said they were hoping with a bit of routine returning following two long weekends, they would be able to get some more consistency with their training.

She said due to the holidays they had missed a couple of main training sessions and it had shown in the result.

Going back to basics will be part of the focus before their next match.

McLean said getting Ruby Shannon and Eliza Gollant back into the side would help as well, with both out with injury.

The Warriors 23 and unders had a draw with the Express 41-41.

McLean wasn’t at the game but said she was told they were great for most of the game but needed to be a bit cleaner after throwing plenty of ball away.

TheWarriorsnextmatchisonMay7against the Peninsula Waves.

Sports shorts

Western FL

Caroline Springs fell just short against Werribee Districts in the Western Football League division 1 competition. Coming off their first win of the season, the Lakers were in trouble early, down by 27 points. The Lakers managed to make it a game and were down by less than a goal at the next two breaks. The Tigers finished the quarter with two goals to one to seal a 13.14 (92)-11.11 (77). Steven Kyriazis, Lachlan Mellon and Ben Caluzzi were named their best. In division 2, the Western Rams lost to North Footscray, 19.14 (128)-3.4 (22).

EDFL

Hillside is the only undefeated team in the Essendon District Football League women’s premier division. The Sharks faced Aberfeldie in a top of the table clash, with the Sharks coming out on top. Two goals to none in the third quarter was the difference, with the Sharks winning, 4.8 (32)-3.3 (21). Yara Taylor was the Sharks best. In division 1, Burnside Heights lost to Keilor Park.

Big V

into the middle as they tried to mix it up.

Mo Kaakour said they had given jobs to Noah Asciak, Nick Fluke and Milad Almatrah and all three stood up strongly defensively.

For the Sharks, they’re hoping it will kick start their season. Kakkour said the focus for them was to make sure that they are competitive in every game.

Kakkour said Jackson Mcmenamin and Riley Miksa would hopefully return in the next couple of weeks after long term injuries, while they would get more guys back in the next three to four weeks.

“We have been struggling in terms of soldiers,” Kaakour said. “The guys that have been coming in have been playing a role.”

The Sharks face Tullamarine this Saturday. The Demons are coming off their first win of the season.

In division 2, Burnside Heights lost to Keilor Park, 15.10 (100)-12.10 (82) after scores were level at three quarter time.

Jordan Hughes, Antonio Vitalone and Dylan Payne were named the Bears best.

The Melton Thoroughbreds lost a thriller against the Wallan Panthers in the Big V men’s division 2 competition on Saturday night. The Thoroughbreds were on the road and trailed by 11 points at the main break. They managed to turn it around in the third quarter to lead by two points at the last change. The Panthers did just enough to sneak home with a 73-72 win.

VPL

Caroline Springs George Cross made it two wins in a row in the Victorian Premier League 1 competition on Saturday night. The Georgies were at home to Melbourne SRBIJA and were able to take the lead in the 59thminute through Luke Jonathan Lofts. That would be the only goal of the game, with the Georgies winning, 1-0. The Georgies sit sixth on the adder after 12 games.

FOR MORE SPORT, VISIT Web: starweekly.com.au

Melton & Moorabool Star Weekly @starweeklynews @star_weekly

Western Warriors’ Kim Borger. (Grant Treeby/Netball Victoria)
Ryan Lojko. (Ljubica Vrankovic) 427096_04

Turn static files into dynamic content formats.

Create a flipbook
Star Weekly - Melton Moorabool - 6th May 2025 by Star Weekly - Issuu