their 2-day-old son.
475083_06
Mum’s bundle of new love
While many mothers will be receiving breakfast in bed or handmade cards this Mother’s Day, Rupinder Kaur Rekhi will be spending her Mother’s Day cradling the newest addition to her family– a little baby boy.
For Ms Rehki and her husband Gagandeep Singh Rekhi, the arrival of their son has been a heartwarming and emotional experience, bringing a mix of emotions and deep reflection.
“It’s mixed feelings when you go into labour of course,” Ms Rekhi said.
“But after that it’s all well – when we see the baby, it makes it all worth it.”
While Mother’s Day might be a little more low-key this year, there will still be room for celebration.
“Grandmother is here so maybe we will go out and have dinner to celebrate,” Ms Rekhi said.
For Mr Rehki, witnessing his wife’s labour gave him renewed appreciation for the strength of mothers everywhere.
“When I see my wife giving birth, I get even more respect for motherhood. I always have more respect for my mother and for my wife, for every mother in this world,” he said.
Labor retains the west
By Oscar Parry
Voters across Melton and Moorabool largely backedLaborattheballotboxattheweekend’s federal election, with the party retaining the seats of both Hawke and Gorton with swings to the government.
In Gorton, Labor’s Alice Jordon-Baird was elected as the new MP, taking the seat from retiring Labor MP Brendan O’Connor.
Gorton covers Melton and Brimbank – with the electorate including suburbs Caroline Springs, Burnside, Hillside, Fraser Rise, Taylors Hill, Albanvale, Deer Park, Kings Park, Delahey, Sydenham, Taylors Lakes and Keilor.
Mr O’Connor had held the seat since its creation in 2004.
According to the Australian Electoral Commission, Ms Jordan-Baird secured 60.40 per cent of votes on a two-party basis, over Liberal candidate John Fletcher – who received 39.60 per cent.
In a statement to Star Weekly , Ms Jordan-Baird said that it was “the greatest honour of my life to have been elected to represent the federal seat of Gorton”.
“I’m ready to get to work with the Albanese Labor Government to deliver for our community here in the west - for families, for workers and for everyone,” Ms Jordan-Baird said.
Transport was a key focus in both the Labor and Liberal campaigns this election, with Labor promising budget funding for both upgrades to the Western Freeway and Calder
Park Drive.
The Liberal Party matched the commitment to deliver both projects if elected.
Labor’s Sam Rae held on to the seat of Hawke in the electorate’s second term of existence, attracting a small swing.
On the two-party preferred count, Mr Rae drew 57.64 per cent of votes, with Liberal candidate Simmone Cottom receiving 42.36 per cent.
This represents a 0.02 per cent swing to Labor, with a margin of 12,704 votes.
Created in 2022 after a boundary distribution, Hawke covers 1986 square kilometres and includes Melton, Bacchus Marsh, Ballan, and Sunbury.
In a Facebook post, Mr Rae said that he was “honoured to continue representing our
wonderful community. “
“No matter how you voted, I’m here to fight for our community to get what we deserve,” Mr Rae said.
Liberal challenger Simmone Cottom thanked the residents of Hawke who voted for her saying “While it wasn’t the result we had hoped for, I am deeply humbled by your support.”
“To everyone I met along the campaign trail that shared their story, their local knowledge, their community spirit and their well wishesthank you. I am grateful to call this wonderful community home,” Ms Cottom posted on her Facebook page.
“I would like to extend my sincere gratitude to my entire team of volunteers. Thank you for going above and beyond, week after week. “
Rupinder Kaur Rekhi and husband Gagandeep Singh Rehkhi with
(Damjan Janevski)
Call for a Melton policing boost
To boost the number of police in the Mount Atkinson corridor, Melton council will advocate for the “urgent” delivery of a new police station in the area, encouraging the state to also consider a co-located emergency service hub.
The council will write to the ministers for police and emergency services and local MPs, requesting a new police station in Mount Atkinson, Cobblebank, or Thornhill Park.
The council will also ask the state to consider co-locating other emergency services at the site to form a hub.
It will also request information from Victoria Police on current police response
times, resourcing, and infrastructure across the municipality – focusing on new and expanding areas – and advocate for increased policestaffingatexistingpolicestationsacross Melton and Caroline Springs.
Councillor Phillip Zada raised the idea at the April 28 council meeting. He said that establishing a new police station in the Mount Atkinson growth corridor would “not only serve the immediate area but also elevate and rebalance resourcing” across existing stations in Melton and Caroline Springs.
He said co-locating emergency services in a hub would create a more “integrated and efficient response network for the west.”
Councillor Sophie Ramsey said that a justice precinct has been “identified in the Cobblebank area,” and that “everybody has been working closely to get that off the ground for a number of years.”
“We need to get those messages across. Melton City is 527 square kilometres – it’s a big area … and we need services,” Cr Ramsey said.
Melton MP Steve McGhie said that he has met with local police to discuss police resourcing and another police station in the Melton council area, also raising these issues with the police minister.
Melton Local Area Commander Pat
Join the Lions Club for charity cuppa
Raising important funds for cancer support services and research, the Lions Club of Diggers Rest is hosting a Biggest Morning Tea this month.
Open to people of all ages and from Diggers Rest and beyond, the morning tea will provide sweet and savoury breakfast options, fresh coffee and tea, cold beverages at bar prices, and a chance to socialise with others while raising money for the Cancer Council. Funds raised will go towards research and support initiatives for people diagnosed with cancer.
There will also be raffles and auctions, with
prizes generously donated from several local businesses.
Lions Club of Diggers Rest president Kathy Skinner said the event was well-received among attendees last year.
“People just enjoyed being able to meet other people from Diggers Rest and just be social,” Ms Skinner said.
“Last year was very successful. We were lucky, we received a lot of donations from local businesses and individuals as well.
“We all know someone who has been touched by cancer in one way or another, and you want to help, but there’s not a lot you can
do – so this is a great outlet for that.”
The morning tea will run from 10am–noon on Saturday, May 17, at the Diggers Rest Bowling Club on Old Calder Highway. Entry costs $25 per head, with other prices negotiable for children who would like to attend.
To register, RSVP by May 10 by contacting the organisation.
Through last year’s Biggest Morning Tea, the club raised $4373 for the Cancer Council.
Contact: Bob, 0429 786 665 or lcdrcarols@ gmail.com
Cantone said “Melton and Caroline Springs Uniform Police are well supported” by other police units and teams.
“Melton Police continue to conduct 24/7 intelligenceledpatrols,includinginareassuch as Cobblebank and Thornhill Park. Existing police stations are located within less than [ten kilometres] of Cobblebank, Thornhill Park and Mount Atkinson,” Commander Cantone said.
“There are no current plans for new police stations to be built in any of these areas.”
A spokesperson for the state said the operational need for new and upgraded police stations is a matter for Victoria Police.
Melton council residents might hear a knock at their door from late May onwards as part of a survey covering satisfaction of council services and facilities.
Professional field researchers will randomly select homes across the municipality to ask residents about a range of topics, including their satisfaction with local planning and council programs, the sense of community in Melton council, and local issues.
A total of 800 homes will be involved in the survey.
This data will then inform the council’s ongoing services by helping to reveal where residents’ needs are being met, and where they are not.
Residents who have been selected for the survey can expect a knock on their door between Saturday, May 17 and Sunday, June 8 for the approximately 15-minute survey.
Responses are confidential.
Melton mayor Steve Abboushi said it is important that the council hears from the community to understand if itismeetingitsneedsandexpectations in terms of service delivery.
“The survey helps [Melton council] to gain insight into the community’s satisfaction with council services and identify areas that may need improvement,” Cr Abboushi said.
“We look forward to hearing what our community thinks council is doing well, and anything they’d like to see changed in the future.”
The field researchers will carry photo identification.
Fraser Rise service station approved despite objections
A new service station in Fraser Rise is on the cards after Melton council granted a planning permit for the site, despite the plan receiving 42 community objections.
The 3711-square-metre site will be developed at the intersection of Taylors Road and Plumpton Road.
The service station will include six fuel bowsers with 12 pumps, an on-site café, and will be open for business 24-hours a day throughout the week.
There will also be a food and drink premises that will be open seven days a week.
A car wash with two vacuum bays and four wash bays will also operate at the site, open between 7am and 10pm.
The planning permit for the site received 42 community objections and nine submissions of support and was approved by council at the April 28 council meeting.
According to council, objections to the plan included concerns around amenity impacts in regards to health and safety, traffic issues, noise, light, air emissions, proximity to homes, and the storage of dangerous goods.
Council city growth and development
manager Blake Angus said that while recognisingcommunityconcerns,theproposal complies with the Melton Planning Scheme, and that council officers recommended supporting the application.
Councillor Sophie Ramsay drew attention to a page of the council report that mentioned a proposal for a similar service station site that was initially rejected by Yarra Ranges council.
“Although the emotive side of me says no, the councillor side of me needs to make the assessment on planning grounds,” Cr Ramsey said. “The proposal in Yarra Ranges council,
which was refused, had 194 objections. Lots of different health concerns and other concerns were noted and tested, and yet … VCAT overruled the decision,” she said.
“There are lots of people that need petrol stations. We need petrol stations in our municipality, we need independent petrol stations in our municipality, and if there [are] any concerns, I’m hoping that there would be planning enforcement down the track.”
Residents in opposition to the decision have 28 days from Monday, April 28 to appeal it with VCAT.
The Lions Club of Diggers Rest member Stephen Hynes, president Kathy Skinner and secretary Bob Cassar are preparing to host their Biggest Morning Tea. (Damjan Janevski) 474872_01
Melton joins asylum taskforce
By Oscar Parry
As the “fastest growing city in Australia,” Melton council will be the next Australian municipality to join a mayoral taskforce that aims to support people seeking asylum.
Melton will become a general member council of the Local Government Mayoral Taskforce Supporting People Seeking Asylum, which aims to support and reduce the waiting times for applicants seeking refugee status in Australia.
The taskforce consists of more than 40
councils across Australia. It collaborates with refugees and asylum seeker organisations to advocate to the federal government to address policies and guidelines affecting humanitarian arrivals.
The taskforce’s priorities include providing all people waiting for their protection application with a valid visa and associated workrights;simplifyingtheapplicationprocess and expanding the eligibility for a government support service program for those seeking asylum,?????? and ensuring an independent and effective merits review process for all
humanitarian applications.
At the April 28 council meeting Melton mayor Steve Abboushi said joining the taskforce was important “personally, but also from a perspective of the community”.
“As the fastest growing city in Australia, and having met with a number of refugees seeking asylum in the city … I know how important it is for this cohort to be represented but also for them to feel empowered,” Cr Abboushi said.
“My father was a refugee … and this country providedtheincredibleopportunitiestomyself and my eight siblings … and I’d like to think
Festival unearths a hidden heritage
Unearthed and lesser-known stories from the Melton municipality will be shared as part of Melton’s annual Heritage Festival this month.
Opened on May 3 and running until May 17, arangeofexhibitions,activities,andworkshops will be held across Melton’s libraries, with a focus on lesser-heard and focused on stories from across the region.
This includes a cultural education event on Pakistani culture, historical board games for children, and an event sharing stories and archival material from post-World War II migrants.
An exhibition titled Healthy Country, Healthy People by Ngarrindjeri and Wirangu
visual artist Keedan Rigney – currently hosted atCSGalleryinCarolineSprings–willheadto the Caroline Springs Library on Sunday, May 11.
Rigney said this exhibition explores parallels between our mental and physical health and similarparallelsinnature,drawingattentionto the fact that “healthy people look after healthy Country better, and healthy Country in turn creates healthier people.”
“It also highlights the importance of how Country nurtures us rather than us looking at it like it’s a never-ending resource,” Rigney said.
“I think … particularly when we’ve looked
Calling young water heroes
Greater Western Water’s (GWW) National Water Week poster competition is back for 2025, with entries now open to all pre-schools and primary schools across its service region.
For the 2025 competition, students are encouraged to create a poster reflecting this year’s theme Water Heroes: Save Every Drop.
GWW spokesperson Kessia Thomson said the competition was a great opportunity for students to show their creative side and how theycarefortheenvironmentatthesametime.
“We’re encouraging all local students to get creative and enter a poster to this year’s competition. You can draw, you can paint or use some other materials including digital technology to create an A3 or A4 sized poster,” Ms Thomson said.
“Each year we are blown away not only by
the talent and creativity of our local students, but also by their ideas for water saving and caring for our water resources.“
Thepostercompetitionisopentoallprimary schools and pre-schools across Victoria, with prizes up for grabs valued up to $100 for individuals and up to $500 for schools for each of the following categories: early learning / kindergarten,prep,year1and2,year3-4??and year 5-6.??
Local winners will be announced in October. First prize winners from GWW’s localcompetitionwillautomaticallybeentered into the state competition, with winners announced during National Water Week (20-26 October).
To learn more about the categories, prizes and how to enter, visit National Water Week.
that if we can be a voice for refugees in our community and they too go on and grow older and have those opportunities as afforded to them, then that would be a blessing to them also.”
As a general member council, Melton’s role will include assisting the executive in selecting and implementing the taskforce’s priorities and providing resources where needed to help achieve these priorities.
InFebruary2025,Dandenongcouncilmayor Jim Memeti wrote to Melton, inviting it to join the taskforce.
Four bins coming to Melton
A four-bin system is set to roll out in the Melton municipality, with the introduction of a dedicated glass recycling bin and an organics bin at each home in 2027.
As mandated by the state government, all councils across Victoria are required to introduce a standard four-stream waste and recycling system by July 1, 2027.
This means that two new bins will be introduced to your home in July 2027 –a purple glass recycling bin and a green food organics and garden organics (FOGO) bin.
Since 2021, Melton residents can opt in to use a green FOGO bin at their home at no additional cost to other waste collection services.
The new glass bin set to be introduced will complement the Container Deposit Scheme (CDS) by offering another alternative for residents to recycle glass – including types which are not yet accepted by the CDS.
at heritage in Australia, we separate Australian heritage with Aboriginal heritage, and I think that’s not a great way of working together as both First Nations and non-First Nations people moving forward,” he said.
“Aboriginal heritage is essentially Australia’s heritageintheprior99percentofthecountry’s existence.It’salong-standingculture,andwhat we look at as heritage, I think, as Australian heritage,iskindoffocusedonpost-settlement.”
A list of locations and times for the events within the program is available on Melton’s website.
Details: melton.vic.gov.au/Heritage-Festival
Melton mayor Steve Abboushi said the council has “undertaken research to help determine what the new service model will look like and to ensure it best fits the needs of residents while meeting our requirements as mandated by the Victorian Government“.
Residents will receive information from the council closer to the roll-out outlining what the changes are and when they will take effect.
The council also aims to support the community with the transition through a comprehensive education campaign to inform what items should go in each bin.
FAMILY LAWYER
Natasha Papaelia
Senior Family Lawyer
Bachelor of Law with a focus on family law and dispute resolution. Member of the Law Institute of Victoria. Natasha is committed to delivering effective legal solutions, support, and advice with compassionate consideration of family law matters.
33 Bakery Square, Melton • Phone: 5332 1584 www.saineslucas.com.au
Visual artist Keedan Rigney’s exhibition titled Healthy Country, Healthy People is coming to Caroline Springs Library as part of the festival. (Damjan Janevski: 475035)
Call to name and shame dumpers
By Oscar Parry
Illegally dumped rubbish is again in the sights of Melton council, with a ‘name and shame’ approach and incentive program being investigated.
Councillor Phillip Zada said he was “absolutely sick and tired“ of talking about of discussing illegal rubbish and was seeking the council to find more ways to hold people accountable.
He raised a notice of motion at the April 28 council meeting calling for officers to investigate the possibility of introducing a name and shame approach to preventing illegal rubbish dumping.
This would include publicising the names of individuals and businesses found guilty of illegally dumping rubbish in accordance with relevant legislation and privacy protections.
CrZadaalsocalledforofficerstoinvestigate an incentive program for residents to provide substantiated reports of illegal rubbish dumping, with potential incentives including coffee or meal vouchers or credits applied to rates notices.
Melton council deals with 3500 tonnes of illegally dumped waste annually, at a cost of more than $5 million.
“Illegal rubbish dumping continues to be one of the most visible and frustrating issues
across our municipality,” Cr Zada said.
“Despite repeated warnings, educational campaigns, and enforcement efforts, the problempersists–affectingourenvironment, streetscapes, and sense of community pride.
“These measures aim to foster community vigilance, increase enforcement outcomes, and send a strong message that illegal dumping is not tolerated.”
CrBobTurnersaidillegalrubbishdumping is a “big, important problem” in Melton and “has been for many years,“ with the issue “just getting worse“.
This is the latest measure the council is seeking to halt the impact of illegal rubbish dumping.
New nets are a ‘game-changer’
Bacchus Marsh sports enthusiasts will rejoice with the completion of a new oval and mutli-purpose cricket practice nets at Bacchus Marsh Racecourse and Recreation Reserve.
Officially opened on Tuesday, April 22, the nets will allow for additional cricket training sessions and a new space for futsal, with the Bacchus Marsh Soccer Club set to also use the facility for training during winter.
A new oval was also unveiled, set to be shared by cricket and AFL players.
These projects form the second stage of the site’s master plan.
Moorabool mayor Paul Tatchell said the new facilities are “a fantastic asset for Aussie Rules, cricket and soccer in our community.”
“The clubs will now have access to a purpose-built space that supports their growth, players and their future,” Cr Tatchell said.
“The newly constructed cricket practice nets will also be a game-changer – allowing for more flexible training times and expanding capacity for our cricket and soccer community. This is a true example of smart, multi-purpose design serving the needs of multiple sporting codes,” he said.
The two projects were funded by part of a $2.01 million state program that also funded the netball and tennis courts, oval lighting, all-abilities adventure playground and civil works – with Moorabool funding $5.45 million to these works.
Thestatealsocontributed$300,000towards the practice nets, with council contributing $262,500 – $30,000 of which was received from Cricket Victoria.
Upcoming works at the reserve include a new multipurpose sports and community pavilion and an off-leash dog park, with both projects set to begin in the next year.
The council at its February council meeting agreed to write to Environment Minister Steve Dimopoulos calling on the state government to help local councils with the costs.
The council was to request the state government release funding from the sustainability fund that is collected from the waste levy, for increased financial support of local councils to manage illegal rubbish dumping.
A government spokesperson said at the time it knows the impact waste has in its communities, which is why it’s strengthening laws for the Environment Protection Authority to crack down on illegal dumping.
Sod turned on school
The first sod was turned on a kindergarten and primary school development in Mount Atkinson, offering 178 kindergarten places and a new school on the same site.
With works beginning on Thursday, May 1, the kindergarten will include consulting rooms and out-of-school-hours care, with construction expected to be completed at the end of the year.
It will receive up to $6.75 million in funding as part of a partnership between the state and the Melbourne Archdiocese Catholic Schools Early Years Education.
Works on the new St Marianne Cope Primary School also began on the same day, with the state funding $6 million to this project.
According to the state, the positioning of the kindergarten and primary school at the same site is aimed at making drop-off more convenient for busy parents and carers and easing the transition to primary school among children.
The kindergarten will be managed by MACSEYE, which is a subsidiary of Melbourne Archdiocese Catholic Schools.
MACSEYE managing director Heather Finlayson said that through the co-located space, “we’re providing morefamiliesandchildrenwithaccess to a strong foundation for lifelong learning, fostering exploration, growth, and thriving connections between early years education, St Marianne Cope Primary School, and the parish community.”
The St Marianne Cope Catholic Primary School is set to open to new students in January 2026.
Gather your used drink containers to win a million cents
Victorians are in with the chance to win a million – a million cents that is – as the prize of a recycling competition from Victoria’s Container Deposit Scheme (CDS Vic).
TheWinAMillion!Centscompetitionoffers five lucky recyclers a $10,000 cash prize each for returning their empty drink containers through the scheme.
CDS Vic is a recycling program that gives back to Victorians, the environment and the community by providing a 10-cent refund for each eligible drink container returned.
Running from May 5 to June 15, the competition automatically rewards customers with one entry for every 50 eligible containers they return in a single transaction – regardless of whether they keep the refund amount or donate it to one of the registered donation partners.
The competition was launched launched last week at Melbourne’s North and West Melbourne Neighbourhood Centre in Errol Street, North Melbourne. Scheme coordinator VicReturn chief
executive Jim Round said since Victoria’s Container Deposit Scheme launched in November 2023, participation has been overwhelming.
To date, 1.7 billion drink containers have beenreturnedthroughthescheme,equatingto $170 million back to Victorians.
This includes $1.7 million donated to local charities, schools and community groups.
“I’m so proud of how Victorians have embraced the scheme and the positive impact it is making on sustainability and community
fundraising.
“The Win A Million! Cents competition is a fun way to thank Victorians for their support and to encourage even more participation,“ Mr Round said.
One of the five winners will score a bonus $10,000 to donate to a registered CDS Vic charity, school, or community group of their choice.
The competition is open to Victorian residents only. There are deposit points across Melbourne’snorth-west.
Details:cdsvic.org.au
Bacchus Marsh Cricket Club women’s representative Symone Whiteway, Moorabool mayor Paul Tatchell, Bacchus Marsh Cricket Club’s Jacob Micallef, Moorabool councillors Jarrod Bingham, Sheila Freeman and Moira Berry, Bacchus Marsh Football Netball Club football manager Shannon Nixon, junior club president Darren Smith, and Eureka MP Michaela Settle (Supplied).
New kit helps with STI prevention
As a significant step in STI prevention for Australian women, the country’s first self-test kit for chlamydia and gonorrhoea is now available nationwide, offering greater privacy and fast results according to the company behind the break-through.
The first of its kind in Australia, the self-test kit detects chlamydia and gonorrhoea with one swab sample, producing a positive or negative result for both infections in 15 minutes.
STIs affect almost one in six (16 per cent) Australians in their lifetime and over the last 10 years, cases have increased at an alarming rate in Australia, with rates of chlamydia and gonorrhoea increasing by 26 per cent and 157 per cent respectively.
Chlamydia is the most reported communicable disease in Australia, with over 110,000 reported cases in 2023, but is often asymptomatic, leading to undiagnosed cases as people remain reluctant to test for the infection due to perceived stigma or lack of awareness. Gonorrhoeapresentswithpainordiscomfort in the throat, eyes, cervix and other areas but, similarly, it is often mistaken for other infections and remains undiagnosed.
Steven Quinlan, sales director at Touch Biotechnology which developed the self-test kit, says it gives “women immediate control overtheirsexualhealthinawaythattraditional clinical testing does not“.
“Touch Biotechnology’s STI self-test kit for chlamydia and gonorrhoea works similarly to the common rapid antigen tests, using a single
swab, buffer solution and test cassette to test for both infections in women, supporting early diagnosis and treatment,” he explained.
“By enabling women to easily test themselves when and where suits them, the self-test kit eliminates the anxiety associated with clinical settings and transforms the experience into a routine part of self-care.
“Knowing their STI status also helps women to communicate better with healthcare providers, access the right medication, and reduce the risk of antibiotic misuse, which can lead to drug resistance.
“Affordable and discreet self-test kits remove the barriers that have traditionally kept women from seeking care. When infections are caught early, swift action can be taken to prevent complications, such as infertility or chronic pelvic pain.
“In underserved communities, where access to healthcare can be limited, this type of testing is especially important. If adopted in healthcare centres, these kits could increase
The facts:
What are chlamydia and gonorrhoea?
Chlamydia and gonorrhoea are both bacterial sexually transmitted infections (STIs) that affect both men and women. Chlamydia is caused by Chlamydia trachomatis. It often doesn’t show symptoms, especially in women, but can lead to serious health issues like infertility if untreated. It can be cured with antibiotics.¹ Gonorrhoea is caused by Neisseria gonorrhoeae. It can cause symptoms like painful urination and discharge, but many people don’t experience symptoms. Like chlamydia, it can be treated with antibiotics, though some strains are becoming resistant to treatment.²
What are the risks of untreated chlamydia and gonorrhoea? If left untreated, chlamydia and gonorrhoea can lead to serious health complications for both men and women. For women, untreated chlamydia and gonorrhoea can cause pelvic inflammatory disease (PID), which can lead to chronic pain, infertility, and an increased risk of ectopic pregnancy. These infections can also increase the risk of HIV transmission.³ Additionally,
testing capacity, reduce costs, and improve overall health outcomes for women and the community.”
The Chlamydia and Gonorrhoea Rapid Test (for female) is now available for purchase at pharmacies, distributors, and online
untreated STIs can contribute to the spread of the infection to others, as well as cause more severe health issues over time. Timely treatment with antibiotics is essential to avoid these risks.
What are the symptoms of chlamydia and gonorrhoea?
Many people, particularly women, may not experience any symptoms, which is why these infections can often go undiagnosed. For women with chlamydia, common symptoms include abnormal vaginal discharge, painful urination, and pain during sex. Some may also experience lower abdominal pain or bleeding between periods or after sex.¹ Gonorrhoea, like chlamydia, may not always present clear symptoms. In women, symptoms often include increased vaginal discharge, painful urination, pelvic or abdominal pain, and bleeding between periods or after sex.
Citations: 1. https://www.health.gov.au/ topics/sexual-health/about 2. https://nindss. health.gov.au/pbi-dashboard/ 3. https://sti. guidelines.org.au/sexually-transmissibleinfections/chlamydia/ 4. https://www. healthdirect.gov.au/gonorrhoea-the-clap
nationwide,tobecompleteddiscreetlyathome. Prior to this, the only option for women to test for gonorrhoea and chlamydia was to complete an individual lab or PCR test. This invasive process could be costly and takes too long, with results typically taking one to three days.
‘‘ When you are feeling broken, the way to healing is through helping others ’’
- Liz Skitch
Four walls and a caring lifeline
Thomastown Neighbourhood House manger Liz Skitch runs a community hub from a room inside the local library, offering connection, creativity, and crisis support. Tom Ingleton spoke with Liza about mental health, hidden trauma, and why neighbourhood houses are crucial - but under resourced - pillars of community care.
Tucked away in a quiet room inside the Thomastown Library, you’ll find what might just be the suburb’s most essential service – though most people don’t realise it until they walk through the door.
There’s mental health slogans, and then there are mental health saviours and the latter certainly applies to the Thomastown Neighbourhood House.
“We didn’t know you were here!” is the most common thing people say when they discover the neighbourhood house, manager Liz Skitch says.
But once they do, it doesn’t take long for the truth to land.
Across Victoria, mental health services are overwhelmed and recent studies highlight this epidemic is only getting worse.
According to the Australian Bureau of Statistics, one in five Australians will experience a mental illness this year, yet in outer-metro areas like Whittlesea, access to psychologists remains critically low– just 2.2 per 1000 people.
Liz is many things to the community –actress, comedian and an award-winning performer – one thing she is not though is a psychologist.
However, she is very often the first point of contact for individuals in distress at the neighbourhood house.
“You give me a reason to leave the house,” one regular told her.
Another: “Thanks to your playgroup, I now have friends all over the neighbourhood.”
Inatimemarkedbyskyrocketingloneliness, cost-of-living stress and the long tail of the Covid-19 pandemic, places like this – warm, inclusive, and quietly revolutionary – are holding communities together.
And they’re doing it under the radar, on shoestring budgets, and with a kind of fierce love that can’t be faked.
When someone walks in clearly struggling,
Liz doesn’t offer a script.
“I listen. Then if I can help – I do,” Liz says.
“The heart-breaking thing is that more often than not, the best we can do is provide a safe space and a phone number to a better resourced organisation.”
What Liz wishes for is modest but urgent: a social worker on-site, food vouchers to give, transport for those who are stranded and can’t access services.
“Wedoourbesttopartnerwithorganisations like Foodbank and Whittlesea Community Connections but this is not enough.”
In that one sentence is the quiet frustration of countless front-line workers across Victoria, whoareholdingspaceforotherswhileburning out themselves.
One moment that stayed with Liz this year happened in a surprise setting – the Death Cafè.
It’s one of Thomastown Neighbourhood House’s more unconventional offerings, a philosophy-based program that facilitates conversations about end of life.
“One of the women shared how she lost her daughter to leukaemia, many years ago,” Liz recalls. “I was struck by her resilience and her creativity. Despite her grief, she’s committed to her community. It reminded me you never know what someone’s carrying.”
It’s a lesson that echoes across the programs the centre runs – from playgroups and craft workshops to dance classes and legal aid visits.
The weight of people’s stories isn’t always visible. But it’s there.
Since the pandemic, GPS and psychologists have increasingly referred patients to neighbourhoodhousesforwhatsomecountries call “green scripts” which directs patients to attend places doing activities that boost social cohesion and wellbeing without ever feeling like clinical intervention.
“Social cohesion is at an all-time low. Loneliness is at an all-time high,” Liz says.
“Butwhenanewparticipantjoinsourgroup, wefocusontheirstrengths.Beforelong,wecan see confidence grow and friendships flourish, “When you are feeling broken, the way to healing is through helping others.”
It’s healing through connection – and often, through creativity.
One of Liz’s highlights each week is a Monday afternoon dance party called Lets Move for young adults with disabilities.
“It’s pure joy,” Liz says. “That’s how I keep going – friendship and creativity.”
But Liz didn’t enter this role at a gentle time.
She became manager mid-pandemic, when all the programs were shut down and the focus turned to emergency food relief.
Suddenly, she was running a pantry out of the library foyer five days a week, with food linesstretchingtowardthenearbysportsfields.
“Ifeltoutofmydeptheveryday,”Lizadmits. “It was like trying to fill a bottomless well.”
Theneedhasn’teased.Ifanything,it’sgrown.
Now, with the cost-of-living crisis biting harder, the support of partners like Foodbank Victoria–whichbringsitsmobilesupermarket to Thomastown on Wednesdays – has become essential.
But so too has the advocacy for more sustainable support.
When asked what she wants politicians and mental health services to understand, Liz doesn’t hesitate.
“Neighbourhood houses provide a sense of belonging and purpose – which is often the key to overcoming mental health challenges from depression and loneliness, to stress and anxiety,” Liz says. “We provide safe spaces for people. But across Victoria, most neighbourhood house managers are working full-time hours in part-time roles. Burn-out is common. It’s not sustainable.”
Liz believes every house should have at least two staff present at all times to ensure safety and adequately support the wide range of
services they provide.
And in Thomastown, there is a desperate need for a larger space.
“We’re grateful to the City of Whittlesea and the state government for the support we do have,” Liz adds.
“But demand is surging, and our capacity hasn’t grown with it.”
It’s a confronting question – what would happen if Thomastown Neighbourhood House didn’t exist?
“There are very few spaces people can go to for free without feeling pressure to spend money,” Liz says.
“Shopping centres have become the default for when we have free time these days.”
Liz is also a passionate advocate for public outdoor spaces, encouraging locals to kick a ball around at the oval, explore local parks or visit the new Whittlesea Gardens skate park.
In a community where many women are migrants, caregivers, or survivors of trauma – including family violence – the role of Thomastown Neighbourhood House is bigger than just activity programs.
“We see people rebuild confidence here,” Liz says. “We see healing. Sometimes people come inquietandwithdrawnandafewmonthslater, they’re running art class.”
Asked if she ever worries about her own mental health and carrying the emotional toll of caring for others, Liz is candid: “Stress and anxiety – it’s a big one for me. But I try to remember to breathe“.
And perhaps that’s the greatest power of neighbourhood houses like this one, they don’t just help others find stability –they model what compassion looks like in action, and yet community organisations like Liz’s are chronically underfunded and under-recognised.
As Liz states in a simple yet poignant truth “Neighbourhood houses are more important than ever.”
Thomastown Neighbourhood House manager Liz Skitch. (Damjan Janevski) 475040_02
Church hosts mercy talk
Melton Grace Community Church is excited to welcome guest speakers from Mercy Ships Internationalandisextendinganinvitationto the public to attend.
The church’s Adult Fellowship Group, Graceful Fellowship, will be enlightened on a variety of topics, including cybersecurity, the experiences of local refugees, and the valuable work of charity organisations as part of this visit.
The Mercy Ships International talk will take place at 11am on Wednesday, May 7, at 15-17 Yuille Street, Melton.
MercyShipsisaninternationaldevelopment organisation that deploys hospital ships and volunteers to developing nations.
Their mission is to improve the quality of life for people affected by the diseases of poverty,disfigurement,anddisabilitythrough
direct medical services and by building the capacity of healthcare systems to meet future needs.
Elaine Radford, a member of Grace Community Church said that everyone is welcome to attend the event, regardless of whether they are members of the church.
“Our goal is to enjoy a happy and uplifting time of fellowship. The guest speakers are always a highlight, followed by lunch and a good chat.”
Attendees are asked to bring their own lunch. Tea and coffee will be provided.
In 2020, Melton Uniting Church adopted the name Grace Community, an outreach of Melton Uniting Church.
TheFellowshipmeetsonthefirstWednesday of each month (excluding January), and meetings are open to everyone.
Briefs
Cat desexing in Melton Cat-owning residents of Melton council can get their cats desexed for $75 next week, with a maximum of two cats per household. Hosted on Thursday, May 15, and Friday, May 16, the $75 desexing includes a free microchip and a free 12 months of council pet registration – with available add-ons including $40 vaccination or flea and worm treatment for $25. Bookings and payment up front are required, with the council advising residents to book now as spots are filling up. The event will be hosted by the Vet Project in conjunction with Melton council.
IDAHOBIT Rainbow Flag raising
Marking IDAHOBIT, Moorabool council is hosting a Rainbow Flag Raising ceremony followed by a morning tea. Starting at 10am on Saturday, May 17, Moorabool is inviting community members to attend the ceremony to help mark IDAHOBIT – the International Day Against LGBTQIA+ Discrimination. The ceremony will be followed by morning tea, allowing attendees to connect with others in a welcoming setting. All members of the community are welcome. Entry is free and the event will take place at Moorabool’s Ballan council office at 15 Stead Street, Ballan.
FOR BREAKING NEWS, VISIT Web: starweekly.com.au
Melton & Moorabool Star Weekly @starweeklynews @star_weekly
Grace Community Church members Lyn Samson and Elaine Radford.
Harness racing shocked by death
By John Dunne, Michael Howard and Tim O’Connor
The passing of champion driver Greg Sugars, aged 40, has devastated the harness racing industry, which mourns a gifted reinsman, outstanding professional, and wonderful person.
Sugars passed in New South Wales on April 25, shattering news that was felt across the globe, having been widely regarded as one of Australia’s greatest drivers after a 25-year career that boasted more than 4000 wins.
Harness Racing Victoria chairman Bernard Saundry paid tribute to the person affectionately known as “The Candyman”.
“We have lost one of harness racing’s best,” he said. “Greg was a wonderful person and an incredible ambassador for our sport.
“Our hearts go out to Jess Tubbs and the entire Sugars family. This is a devastating loss as Greg provided so much guidance and support to others in the sport.”
Sugars was always destined for greatness. He followed his grandfather, Len, a South Australian Hall of Fame trainer, and father, Ross, a harness racing living legend, into the sport.
His first drive was as a teenager at Globe Derby on October 31, 2000, with his maiden win coming a little over a month later at the same track with Escrow.
Sugars attributed a trip to the United States in2002tosettinghimonasuccessfulpathway.
When he returned to his native South Australia, Sugars immediately packed his bags and headed to Victoria. He was duly followed by Ross, who realised that relocating
was necessary to provide more opportunities for Greg and his sister, Kylie.
Sugars credited his dad Ross and brilliant late Victorian reinsman Gavin Lang with having “massive influences” on his career, regarding the latter as “the best driver I’ve
seen”.
In his eighth year in the sulky and aged 23, Sugars cracked the barrier for 100 wins in a season for the first time, having been first past the post in 106 of his 785 starts. He would never dip below triple figures in any
season since, with 2019-20 his most prolific, recording 321 wins from 1617 starts.
In 2011-12, he won the Victorian Metropolitan Drivers Premiership, saluting in 41 of his 235 starts. He would then add the Victorian State Drivers Premiership to his mantlepiece in 2014-15,amassing253winsfrom1528starters. His achievement saw him the only driver between 2011-12 and 2021 to unseat brilliant reinsman Chris Alford for that award.
For all that he had achieved, Sugars’ career went to a new level when he and wife-trainer JessTubbsintroducedtheLarajayFarmstable. Tubbs trained more than 600 winners from 2017-18, most driven by Sugars, including a modern great in trotter Just Believe.
In a whirlwind journey that took him across the country, to New Zealand and even Sweden for the world-renowned Elitloppet, Sugars would team with Just Believe for 29 wins, including two Inter Dominion Trotting Championship grand finals, a Great Southern Star Final, and the TAB Trot, National Trot, Rowe Cup and Dominion Trot across the Tasman.
Sugars also won the Inter Dominion Trotting Championship Grand Final with Maori Law in 2021, while his triumph in New Zealand’s 2011 Northern Derby with Sushi Sushi and Better Eclipse’s victory in the 2022 Chariots Of Fire were other treasured moments.
In all, he won 64 Group 1s in Australia and six more in New Zealand, and in February thisyearjoinedelitecompanywhenhesteered the mare Festinalente to victory at Bendigo to record his 4000th Australian win as a driver.
Gath claims victory as Greg Sugars honoured
Kate Gath wrestled with her emotions after steering Tango Tara to victory in the Vale Greg Sugars Free For All at Melton on Saturday night.
Saturday night’s metropolitan meeting at Melton Entertainment Park was dedicated to the memory of the late Greg Sugars, with the running of a race and special tributes to be staged in his honour throughout the evening. Sugar, a Moorabool local, passed in New South Wales the previous weekend having been widely regarded as one of Australia’s greatest drivers after a 25-year career that boasted more than 4000 wins.
Moments earlier in the home straight she had surged past Jess Tubbs-trained Rocknroll Hammer and James Herbertson in the red, white and green silks made famous by the late Sugars.
“I kind of feel bad for winning,” Gath said. “I’m pretty competitive, but I’ve got to say going past ‘Herbie’ up the straight wasn’t as good as it normally is when you win.”
Gath sensed the crowd willing Rocknroll Hammer on after that pacer straightened with a clear lead.
“It doesn’t feel great to beat his stable runners, but it’s still an honour to win his race,” she said.
Eachrunneratthemeetingworearibbonof Sugars’ driving colors in their hair.
“It’s an honour to wear the red, white and green ribbon and the massive impact that Greg had on everyone around the world,” she said.
Gath echoed the sentiments of the entire harness racing industry.
“I think we are all still pretty numb and in shock. It’s unbelievable and I can’t stop thinking about Jess and Greg’s family,” she said.
“Greg was so talented, he was gifted. Look at the horseman he was and the trainer and driver he was.
“I forget how many times Andy (Gath) would say to me ‘watch Greg in this race, watch how he does this’.
“He was so good over the short trip off the second row, which is so hard to win here, and Greg got it right every time.”
A short time earlier, all drivers, along with Sugars’ wife Jess, assembled on the track to observe a minute’s silence in a tribute to the champion horseman.
A large crowd gathered on the lawn to join in the tribute.
The winner of more than $430,000
in prizemoney, Tango Tara could find himself sunning his nine-year-old bones in Queensland in a couple of months’ time.
Outstanding trotting mare Keayang Zahara did Greg Sugars racing silks proud when she carried them to victory while adding win number 15 to her picket fence career form line in the Hertz Melton Trotters Free For All.
Glen Craven, having his first drive on the seven-time Group 1 winner, had trouble keeping his feelings in check after the race.
“That’s why we’re in the game, that’s just unbelievable. I can’t thank the whole family enough for giving me the opportunity to drive on this horse and Jess (Tubbs) for letting me wear Greg’s colours,” Craven said.
“I’ve known Greg since I started driving, he was always such a great driver to get advice off when I was learning at the start but at the end of the day, he was just a true friend to me and to so many people. He’s just going to be greatly missed,” he said.
Greg Sugars with wife Ellie Tubbs and Just Believe. (Harness Racing Victoria)
John Dunne
Tango Tara. (Stuart McCormick)
Walk, run with meaning
By Gladys Barreta
The vibrant colours of pink and teal will blend beautifully with the backdrop of Caroline Springs Lake for the fourth edition of the Mother’s Day Classic (MDC).
This national fundraising event is held on Mother’s Day each year to raise money and honor those who have fought or are currently fighting breast and ovarian cancer.
The Caroline Springs event will be held on May 11, from 7.30am, where participants are encouraged to join in the walks and runs throughout the day.
Participants from running clubs, those on wheels, and dog walkers are all invited to take part in a variety of events, including a four kilometre walk of honour and an eight kilometre run.
The walk will begin with a minute’s silence, followed by tribute cards being handed out for participants to fill out and carry with them during the walk.
Mother’s Day Classic Foundation director Nicole Oborne said there will be 85 events across the nation this year, making it especially meaningful to have a local one for residents to call their own.
“This event is incredibly important because it gives purpose and meaning to Mother’s Day and, while we all need to look after our own well-being, this event brings a sense of hope and meaning to our community,” she said.
“Ontheday,largefamilieswillcometogether in honour of mothers, aunties, grandmothers, and also male participants doing it for their female loved ones and themselves.
“Seeing the community come together like thisissomethingweneedtodomoreoften,and having a lake to embrace makes it even more special.”
Every participant will receive a medal at the
finish line, and local Herbalife providers will offer Hydralyte drinks.
Ms Oborne anticipates about 300 registered participants this year, with many more spectators.
“The event and who turns up is all weather permitting, but either way, we will walk and run because cancer doesn’t stop in the rain,” she said.
The past four years, the Caroline Springs event has raised more than $120,000, and this year, it’s expected to raise at least $30,000.
“This is the fourth time we’ve hosted the
Fresh food garden flourishes
A new community garden in Aintree is flourishing and is now offering monthly food production and sustainability workshops.
The expansive Aintree Community Garden includes 55 self-watering and water efficient wicking beds; a 10-tree espalier fruit orchard of apples, pears, apricots, peaches, plums; a composting system; and native plants.
The garden, located in Woodlea estate, received a $75,000 grant from the state and contributionsfromWoodleaandthemanaging organisation of the garden We Love Aintree, raising its value to $106,000.
We Love Aintree founding director Jono Ingramsaidtheprimarypurposeofthegarden is to offer educational sustainability and food production workshops, with the organisation offering monthly community workshops and to local schools, kindergartens, and childcare centres.
“Backin2018,Ibuiltanexperimentalpop-up communitygarden,whichwasonsomeprivate landthatwasallgoingtobeashort-termthing, and it turned out to be fairly successful,” Mr Ingram said.
“There was some real interest in people learning how to grow food, gardening together and gathering socially.“
The community can take part in maintenancedaysandworkingbeedays,where participants can garden with one another and learn horticultural and food production skills.
The next workshop hosted at the garden will be the Growing Food From Kitchen Scraps workshop on Saturday, June 7, from 9.30am.
Visitors are permitted to harvest produce as directed by signage, as long as they are respectful in the amount taken.
Details: weloveaintree.org/aintreecommunity-garden
event at Caroline Springs, and every year it just gets bigger and better,” Ms Osborne said.
“It’s incredible seeing family and friends come together for the cause—honoring their loved ones, those who have fought, and those who are still fighting. It’s so moving to see everyone embracing each other at the finish line.
“These events have made a huge difference over the years, contributing to the increase in the five-year survival rate. We need to be more aware of the research, and we must come together as a community to make a real impact.”
Nominate a volunteer
The state government is calling on Victorians to celebrate the everyday heroes who give their time to make our statestronger,fairerandmoreconnected.
Minister for Carers and Volunteers Ros Spence announced that nominations are now open for the Victorian Volunteer Awards 2025 – recognising the individuals and organisations who go above and beyond to support their communities.
Lastyearsawarecord499nominations, and this year’s awards aim to highlight even more of the powerful stories that reflect Victoria’s proud culture of volunteering.
Run in partnership with Volunteering Victoria,theAwardshonouroutstanding volunteersandorganisationsacrosseight categories.
Individual categories include the Young Volunteer Award, Volunteer Commitment Award, Volunteer Leadership Award and Volunteer Impact Award. One of the individual winners will also receive the Dame Elisabeth Murdoch Award for Volunteer of the Year, including a $10,000 donation to a not-for-profit of their choice.
Organisation categories include the Inclusive Volunteering Award, Grassroots Volunteering Award, Volunteering Innovation Award and Volunteering Partnerships Award. The Volunteering Excellence Award will be presented to one of the four winning organisations for their outstanding impact and leadership.
We Love Aintree founding director Jono Ingram in the community garden. (Damjan Janevski) 474982_01
Caroline Springs Mother’s Day Classic event 2024, participants warming up for the walk and run.
‘‘ The inhuman beast, impervious to her cries, had held her under the water until she drowned ’’
- Barb O’Neill
A Footscray farce one February
Williamstown amateur historian Barb McNeill is Star Weekly’s history columnist. This week she tells the tale of marital antics on the Maribyrnong River that could have caused an innocent man to hang.
On Friday, 24 February 1893, Mr and Mrs Horner of Yarraville decided that a moonlit summer night called for a gentle boat trip. They hired a craft fitted with oars, and, for some unfathomable reason, chose the malodorous Saltwater River (now called the Maribyrnong) for the evening’s romantic voyage.
As Mr Horner rowed through the detritus of the boiling down works, they noticed a fire on Coode Island sending a sinister red gleam onto the murky waters of the Saltwater. His attention thus diverted, he ran the boat into a sandbank, and his wife screamed in mock terror, “Jack! Are you trying to kill me?”
An equally impish soul, Mr Horner shouted at her, “If you don’t mind your mouth, I’ll throw you into the river!”
Getting well and truly into her stride, his wife screamed even louder, at which her husband lost his balance and toppled towards her, sending both into the hellish waters. Mrs Horner, thoroughly enjoying this impromptu acting performance, spat the mud from her teeth and, unaware that they had an audience, screeched, “Don’t, Jack! Don’t kill me! Please, don’t do it!”
On the opposite bank, under the railway bridge and in the shadows of the abattoir, John Ralston and his mate Tommy Sheehan, aged 13 and 11 respectively, were angling. The only adult nearby was an elderly fisherman, who
being completely deaf and intently focused on catching eels, had heard and seen nothing. The lads decided that it was their job to inform the authorities and rushed off to find a policeman.
TheyfoundSeniorConstableMcGrathwalking his beat in Hopkins Street and gasped out their dreadful story.
They were taken to Footscray Police Station where Sergeant Routledge spoke to them separately. Vividly they described the murderer’s brutal threats and the desperate screams for mercy from the terrified woman as she begged for her life. The inhuman beast, impervious to her cries, had held her under the water until she drowned.
Police raced to the spot and spent the entire weekend dragging the waters with grappling irons. Crowds gathered to gawk and amongst the ghouls was Andrew Young a 28-year-old groom who worked for Kirk’s Bazaar, horse sellers. Shortly before the excitement in Footscray, he had had his fingers badly bitten by a horse and, ever an opportunist, charged intotheApolloHotel,wavinghisinjureddigits and claiming to have fought with the killer. In florid terms, he informed his audience how he had tried but failed to affect a citizen’s arrest and save the victim. The saga of his desperate struggle went on and on as he chugged down glass after glass, regaling the boozers with his amazing bravery. Nobody noticed that he wasn’t wet.
Police, meanwhile, visited the Ralston and Sheehan homes for further questioning of the only eyewitnesses. John Ralston, overwhelmed by the whole business, said it was all made up, and he didn’t know why they had done it. Sheehan was contemptuous of his sissy older mate and stuck to his story. Nothing would shake his testimony.
Then word reached police that a brave fellow
was in the Apollo, and had not only witnessed the murder, but had actually fought with the killer. In the muck and stench of the river, attempting to affect a citizen’s arrest, he had sustained badly bitten fingers.
The Apollo Hotel, formerly on the corner of Dynon and Kensington roads, had earned itself a fearsome reputation over the years for cock-fighting, landlords who bashed payment-evading patrons, Sunday trading and other heinous crimes.
There in the notorious bar, the police found AndrewYoung,regalinghispop-eyedaudience with tales of his heroic fight with the murderer. Every time he paused for breath, his glass was refilled, and his story promptly expanded with fresh exaggerations. The licensee, Bridget Murphy, shrewdly thought that he was laying it on a bit thick, describing the vile oaths of the ruffian, and the last, pitiful shrieks for mercy from the dying victim. He continued, relating how he and the killer had engaged in desperate combat, until the cowardly crook plunged his fangs into Andrew’s fingers, thereby escaping the hero’s grasp. Mrs Kelly said nothing, however. As long as money changed hands, she wasn’t voicing any doubts about his yarn.
Andrew Young was lugged off to Footscray Police Station and subjected to a frightful grilling. His description of the murderer was vague, he couldn’t describe the woman, he had no idea where he had gone after watching the draggingoftheriver,wherehe’dbeendrinking or how he’d got home to South Yarra. Maybe by train, maybe by cab, or perhaps by walking. He really didn’t know.
Accustomed to interrogating dodgy characters, the police knew a guilty person when they had him in their clutches .This they happily demonstrated by charging him with wilful murder of an unknown woman.
Andrew Young nearly had a fit.
“Arrest those two boys,” he screamed at the detectives.
“You’ve got the wrong man. They’re the ones who did it!”
The detectives laughed rudely in his face and informed him that he’d soon be swinging on the gallows. In vain did Andrew Young protest that he had been bitten by a horse, not a murderer, but the police just repeated their remarks about capital crimes and what happened to those who committed them.
Meanwhile, Mr and Mrs Horner, dry and comfortable in their Yarraville home, read about the murder in the papers.
“How strange, “said Mrs Horner to her toast-munching spouse.
“This happened when we were there. At the same time, too. How dreadful!”.
Then they stared at each other in consternation, realising that the boys on the opposite bank had witnessed their tomfoolery. Greatly embarrassed, they popped into Footscray police station to explain that their marital antics had caused all the drama, and they didn’t want an innocent man to hang. Their statements were taken, signed and witnessed, and Sergeant Routledge squashed down his laughter until they were well on their way home. He then summoned the detectives and went to the cells. Andrew Young’s fingers were again examined; his injuries were found to be consistent with the choppers of a nag’s bite and the murder charge was quietly dropped.
Vowing never again to tell lies, Andrew Young skipped off, a free man.
Knowing that the Apollo’s tough patrons who had shouted him dozens of beers would soonbeonthewarpathforarefund,heavoided that pub for the rest of his life.
Barb McNeill. (Damjan Janevski) 432421_03
Spoil mum with her favourite treats on Mother’s Day
Mother’s Day is the perfect occasion to show your appreciation by treating your mum to something truly special – and what better way than with delicious food? Whether you opt for breakfast in bed, a luxurious brunch, an elegant afternoon tea, or a beautifully prepared dinner,theeffortandloveyouputintocreating a memorable meal will mean the world to her. Here are some ideas to inspire you:
Breakfast in Bed
Start her day with a tray full of her favourite breakfast items. Freshly baked croissants or pastries, a bowl of mixed berries, and a glass of freshly squeezed orange juice make for a light but indulgent option. If she prefers something heartier, homemade pancakes topped with whipped cream and strawberries, or a classic eggsBenedict,wouldbearealtreat.Don’tforget a good cup of coffee or a pot of her favourite tea to complete the experience.
Elegant Brunch
If a late morning meal suits your plans, an elegant brunch can be a wonderful way to celebrate. Think smoked salmon bagels with cream cheese and dill, a colourful frittata loaded with vegetables, or a fluffy quiche Lorraine. Fresh fruit salads, yogurt parfaits with granola, and freshly baked muffins can add variety and color to the table. A Mimosa or Bellini (or a non-alcoholic sparkling juice) makes a festive touch that feels extra special.
Afternoon Tea
Spoil your mum with a homemade afternoon tea. Arrange a selection of delicate finger sandwiches, such as cucumber and cream cheese, smoked salmon and dill, or egg mayonnaise. Serve alongside scones with clotted cream and jam, mini cakes, macarons, and dainty pastries. Brewing a pot of
high-quality tea and presenting everything on a pretty tiered stand will make it feel just like a luxury hotel experience at home.
Homemade Dinner
For a truly memorable evening, prepare a homemade dinner featuring her favourite dishes. Start with a light appetizer like a fresh Caprese salad or a creamy mushroom soup. For the main course, dishes like roast chicken with garlic and herbs, pan-seared salmon with
lemonbuttersauce,orarichvegetarianlasagna canbeshowstoppers.Pairthemealwithagood wine if she enjoys it. Finish with a decadent dessert such as a chocolate lava cake, lemon tart, or a classic pavlova topped with fresh fruits.
Sweet Treats and Extras Don’t forget the power of homemade sweet treats.Bakingabatchofherfavouritecookies,a moist carrot cake, or a luscious cheesecake can
be the icing on the cake (literally). You could also create a small box of homemade truffles or chocolate-dipped strawberries as a gift.
No matter what you cook or bake, the key is totailorthemealtowhatyourmumlovesmost. Add thoughtful touches like a handwritten menu,avaseoffreshflowers,oraheartfeltcard to make the meal even more special. When it comes to spoiling mum, it’s the love, time, and effort that truly count.
Mum’s the word and so is “yum”! Lock in your Mother’s Day plans with us for a lunch or dinner she’ll love, complete with mouthwatering specials and $3 oysters all day long. Tables are booking up fast, so don’t leave Mum hanging reserve your spot now!
Book Now!
Waterfowl release fears
Edgar’s Mission is aiming to shine a light on a troubling trend - the dumping of domestic birds in public spaces.
The illegal and unethical release of domesticated waterfowl into public environments is at the forefront of growing concerns among rescurers. Domestic ducks and geese lack the necessary skills for survival. Most cannot fly to escape danger, are easy targets for predators, and often suffer from malnutrition when fed inappropriate food like bread.
Rescuers from Edgar’s Mission animal sanctuary recently came to the aid of Nautilus, a gentle pilgrim goose found with a barbed hook lodged dangerously in his neck at Navan Park.
Nautilis’ rescue came just weeks after the rescue of Neil Diamond, a domestic Cayuga duck discovered with a fishhook embedded in his bill at Caroline Springs.
Abandoned birds, discarded fishing hooks, poor diets, predation, and human cruelty are the root causes behind some of the most distressing rescues.
Nautilus’s rescue was swift—thanks to his trusting nature. He seemed to instinctively understand the rescuers meant him no harm. Buthewasn’talone.Hislifelongmate,Neptune, and an unexpected companion — Nathan, a crossbred muscovy duck—were also taken to safety.
ThetriowastransportedinEdgar’sMission’s ’Kindness Van’ to a local veterinarian, where thehookwascarefullyremovedfromNautilus’s neck.
Pam Ahern, founder of Edgar’s Mission, explained that Pilgrim geese form lifelong bonds, often remaining with the same mate for up to 20 years.
“To leave Neptune behind would have been heartbreaking. These animals are not just
ornamental lake residents—they are living, feeling beings,” she said.
TheEdgar’sMissionteamhasconfirmedthat none of the rescued birds will be returned to Navan Park Lake, where they would continue to face threats—not just from discarded fishing hooks, but also from predators, inadequate diets, and human mistreatment.
“The fishhooks removed from Neil Diamond and Nautilus, and the many more scattered around local waterways, are painful reminders of the silent suffering caused by careless recreation,” Ms Ahern said.
In response, Edgar’s Mission is encouraging the public to connect with wildlife in safer, more compassionate ways:
• Photograph local wildlife rather than capturing or feeding them
• Sketch or paint native species to appreciate their beauty
• Participate in community clean-ups around lakes and wetlands
• Support wildlife sanctuaries and habitat conservation
• Educate others, especially children, about empathy and coexistence
Rule change welcomed
RACV has welcomed the Victorian government’s announcement that Road Rule 79A will be expanded to protect emergency roadside workers, tow truck drivers, and their customers.
RACV general manager of automotive services Makarla Cole said the amendment aligns Victoria with other Australian states.
“Since 2017, drivers on Victorian roads have had to slow down to 40 kms per hour when passing emergency services vehicles at the side of the road,” said Ms Cole. “For the past two years, RACV has called on the government to include roadside assistance vans, such as RACV patrol vans, and tow trucks in this rule.
“From July 1, 2025, Road Rule 79A will be extended to include accident towing, breakdown towing, roadside assistance, Peninsula Link Incident Response, Eastlink Incident Response and Transurban Incident Response vehicles.
“Currently,RoadRule79Aonlyapplies to police vehicles, emergency vehicles, enforcement vehicles, and VicRoads Incident Response Service vehicles.
“RACV is pleased with Minister Melissa Horne’s announcement that Victorians will soon slow down when passing any incident response vehicle, including RACV patrol vans.
“Iamsureeverydriverwhohasneeded the help of an emergency roadside assistanceworkerortowtruckdriverwill be pleased to know that the Victorian government is now protecting these essential responders in their workplace, and their customers.”
Edgar’s Mission: rescue in progress. (Supplied)
Desperate plea for Congo peace
By Afraa Kori
Imagine building a new life in Australia, only to wake up each day to heartbreaking news — families displaced, loved ones in danger, and war tearing through your homeland.
For many Congolese Australians, this is not just a distant tragedy but a personal and painful reality.
PastorWillyMudiayiwasseparatedfromhis family due to war. His mother and youngest brother,whowereforcedtofleetheirhomeland in search of safety, now live in a refugee camp in Malawi, while his other siblings escaped to South Africa.
‘‘ How can you sleep and be at peace when your tribe is being killed day and night ’’ - Pastor Willy
Unfortunately he has never met his youngest brother in person, only seeing him for the first time on Facebook, and staying in contact with his family has been a constant struggle.
“We have the longest cemetery that exists, they are burying people along the railway,” he said. “How can you sleep and be at peace when your tribe is being killed day and night?”
Pastor Willy tried to apply for a visa during Covid-19 to bring his family and brother to Australia, but now that the war has broken out, theprocesshasbecomeevenmorechallenging.
Tarneit resident Nick Cshibala, who is the chair of DRC Community Association of Victoria (DRCCAV), highlighted that the majorityofCongolesepeoplelivinginAustralia are originally from the eastern region of the DRC, where the war is currently unfolding.
“People in the west, east or in the city, have just similar stories. They still have a family memberintheeasternpartofCongowherethe action is taking place,” he said.
“Since the war started in Goma and Bukavu, our children have not been going to school for more than a month now.
“Some of their families have already been killed because of this war. It’s affecting them emotionally and financially. They are struggling to help their families that are still alive.”
Congolese Australians have been actively advocating, fundraising, and engaging with MPs and community groups for many years.
Games beckon mum
Mother of two and athletic star Karley Crommie is showing that motherhood can be an opportunity to rediscover new skills and achieve personal bests.
The west mum is celebrating a story of self-discovery and strength after realising she needed to do something for herself and her health.
Realising fitness was better on the athletics track than in the gym, Crommie refocused on doing what she loved and is set to compete at this year’s Australian Masters Games.
Having always been passionate about track and field, Crommie re-joined athletics a few months after her first child was born.
Crommie is now coaching Little Athletics at Keilor and continues to run personal bests on the athletics track, recently breaking national indoorrecordsinthe60mand200m(Women’s 35s) at the Australian Masters Indoor Championships.
“After I had my firstborn, I remember walking up a big flight of stairs and being so out of breath,” she recalled.
“I knew I needed to do something for my health.
“As a teenager, it was all about winning. I always compared myself to others. Now, it’s about getting a personal best – just improving, season by season.”
Crommie’s son, Jesse,10, , and daughter, Violet, 8, have always been supportive, recording her races and cheering her on from the sidelines.
At the Australian Masters Nationals, held from April 18-21, Ms Crommie ran her personal best for the 60m, which was recorded as a Victorian Masters record.
“IfeellikeI’matmypeak,butattheupcoming games, I hope I can execute a perfect race, get a personal best, and beat it,” she said.
CrommiewillbecompetingattheAustralian Masters Games in Canberra from October 18-25.
A key achievement was their meeting with former Tarneit MP Telmo Ramon Languiller who had also served as shadow parliamentary secretary for multicultural affairs. The meeting was attended by a dozen Congolese leaders and described as “the first of its kind in the history of the Congolese community.”
“We have to stand up for our rights. We have tofightforourrightsbecauseCongolesepeople deserve human rights and they deserve peace,” Mr Cshibala said.
“We are trying to knock on all the doors, diplomacy, trying to lobby, trying to do everything that we can to support our family back home. We want our country to be happy
THISAUCTIONSATURDAY AT12.30PM
and free like people living here in Australia.”
As a good citizen, Pastor Willy has made significant contributions to Australian society, particularly in the areas of disability support, counseling, community service, and finance.
HequestionswhyAustralia,acountryhehas served with love and kindness, is not helping his community in return?
“Britain and German spoke against Rwanda. Australia is just quiet as if there is nothing going on,” he said.
“Australia is closing its eyes to the killings in the Congo. The human rights and all the good policytheyalwayspraisehere,Ibegintodoubt.
“Wecontributetothiscountry.Wework.We pay taxes. But when we need Australia to stand for us, it is silent.”
Manor Lakes College teacher Irene Bakulikira agrees saying “the double standards are exhausting and it’s heartbreaking to feel invisible in our own suffering.”
“Is our pain not worthy of attention? Are our lives not valuable enough to be grieved and fought for?
“We are not invisible, our pain is real. Our lives matter. The world just chooses not to see us.
“When other countries are under attack, social media was filled with posts, stories, hashtags and outcries. And that was right! People spoke up, stood in solitary and demanded justice. But why is it that when it’s Congo, a country that has suffered for decades under conflict, exploitation and violence, the silence is so loud?”
Advocates say Australians can make a meaningful impact by amplifying the message, educating themselves, and engaging with local lawmakers to push for policies that will help bring attention to Congo’s crisis. Funds can also be raised at gofund. me/43faad76
Magnificent family home
Stunning Family Home at 18 Corfu Street, Fraser Rise
Welcome to your dream home! Nestled in the heart of Fraser Rise, this exquisite 4-bedroom, 2-bathroom house at 18 Corfu Street is a perfect blend of modern elegance and comfortable living.
**Key Features:**
Four generously sized bedrooms, this home offers ample space for families of all sizes. Each room is designed to maximize comfort and privacy, ensuring everyone has their own sanctuary.-
Stylish Bathrooms: Enjoy the convenience of two well-appointed bathrooms, featuring contemporary fixtures and finishes that elevate your daily routine.
This property boasts a unique layout that enhances both privacy and outdoor space, perfect for family gatherings or quiet evenings.
Elegant Interior Design: Step inside to discover a beautifully designed interior that combines functionality with style. The open-plan living areas are perfect for entertaining, with natural light flooding through large windows.-
Gourmet Kitchen: The heart of the home, the kitchen is a chef’s delight, featuring laminated wood cabinetry and ample counter space for meal preparation. Whether you’re hosting a dinner party or enjoying a casual family meal, this kitchen will inspire your culinary creativity.
This property is perfect for families looking for a peaceful yet vibrant community. With local parks, schools, and shopping centers just a stone’s throw away, you’ll enjoy the convenience of suburban living without sacrificing access to city amenities.
18 Corfu Street Fraser Rise
Raine & Horne: 289 High Street Melton 9743 6866 | rh.com.au/https://www.raineandhorne.com.au/melton 12762125-RV19-25
Mother of two, Karley Crommie is rediscovering her speed as a Masters athlete. (Supplied)
Pastor Willy. (Stewart Chambers) 464258
COMMUNITY CALENDAR
WANT YOUR EVENT LISTED? Community Calendar is made available free of charge to not-for-profit organisations to keep the public informed of special events and activities. Send item details to Star Weekly Community Calendar, Corner Thomsons Road and Keilor Park Drive, Keilor Park, 3042, or email to westeditorial@starweekly.com.au by 9am Wednesday the week prior to publication
Women Working Together
A program connecting women aged 50 above in need of assistance, with mentors and mentees. Open to women across the western suburbs, including Melton.
9655 2131, or EmploymentSupport@ cotavic.org.au
Over-50s Sunday games
Life Activities Club Melton is running a games and cards afternoon every Sunday from 2-4pm at Kurunjang Community Hub, 35 Mowbray Crescent, Kurunjang. A newly-created friendly group which enjoys sharing a laugh and making new friends. Everyone is welcome because “life is better together”.
Denise, 0403 840 241
Darley Neighbourhood House
The Darley Neighbourhood House and Learning Centre is at 33-35 Jonathan Drive, Darley. It offers free and low-cost activities for all. There is a monthly repair cafe, a community pantry, a fortnightly chatty cafe and venue hire is available.
www.bit.ly/DNHnow, or 53674390
National seniors meeting
On the first Wednesday of every month at 1.30pm, the metro west branch of national seniors meets at the Deer Park Club, with meals available to purchase. The group also holds lunches on different Fridays each month, as well as activities such as theatre visits, bus trips and more.
0425 713 004, or lesley1.collins@ outlook.com
Zonta club
Zonta is an international organisation bringing women together to support other women. The Zonta Club of Melton meets on the first Monday of each month at Melton Country Club, Reserve Road, Melton. Meetings include guest speakers.
Janet, 0421 080 923, info@ zontaclubofmelton.org.au
Melton Over 50s Social Group
Join a friendly group of people aged over 50 who enjoy each other’s company while attending events such as dinners, shows, dancing, cinemas and more. If you live in the Melton area and would like to meet new friends, in a welcoming group environment, this is for you.
Marlene, 0498 329 290
Rose carers of Maddingley Park
The group meets every Wednesday from 10am-noon at the Commemorative Rose Garden, Maddingley Park on the corner of Taverner Street and Grant Streets, Bacchus Marsh.
They maintain the two rose gardens at the park. Volunteers are welcome and no experience is necessary to join .
Elaine, 0400 052 857 or Judy, 0428 463 538
Bacchus Marsh Ladies Probus Club
Meets on the first Thursday of every month from 10am to noon at the Avenue Bowling Club on 254 Main Street, Bacchus Marsh
Krystyna, bacchusmarshladiesprobus@ gmail.com
Community band
The Greater Western Community Band meets Thursdays from 7.30 – 9.30pm. Rehearsal venue is the Bridge Road Community Centre, Strathtulloh (Melton South). The band is available for events.
This week’s photographer’s choice picture is of Werribeeks members Carmel Gerdsen, Debbie Conway and John Tulloch. (Ljubica Vrankovic) 475439_01
Brass, woodwind and percussion players are always welcome.
Sally Hamond, 0401474582
Melton Valley Ladies Probus
Melton Valley Ladies Probus Club meets on the second Friday each month at 10am at Melton Country Club. New members welcome.
Ann, 0425705150
Fishing club
Didyabringyarodalong Angling Club of Melton and Bacchus Marsh is a fishing club that welcomes and encourages people of all ages, genders and fishing abilities to partake in enjoying the outdoors in a relaxing and friendly environment. The club holds monthly fishing competitions at various locations, fresh and saltwater. New members are most welcome. Upcoming events will be listed on this page.
Andrew, 0407 303 438, or Wayne, 0414 785 366
Melton Concert Band
Rehearsals are on Thursdays from 7.30pm to 9.30pm at the Bridge Road Community Centre, Bridge Road, Melton South. Musicians of any age who able to read Music are welcome to come along with their instrument (oboe, bassoon, flute, clarinet, saxophone, trumpet, trombone, tuba, percussion). Please contact the number provided if you are intending to visit.
0401 474 582
Cancer Support Group
MelMarsh Prostate Cancer Support Group is for prostate cancer patients and their carers and meets on the first Thursday of the month, from 12.30-2pm, at Melton South Community Centre. Attendees are encouraged as members share their journeys through what could be a very traumatic time of their lives. Explanations of medical terminology used in the treatment of this cancer are given in this group.
Grenville, 0412 741 865
Chatty Cafe Melton
Are you feeling lonely, isolated or just wanting to make some new friends? If so, Chatty Cafe is for you. The group meets on Friday mornings at 10am for delicious free coffee from Latin foods and wines at 10 Wallace Square, Melton.
https://www.facebook.com/ groups/352071857283331
Melton Men’s Group
Melton Men’s Group meets every Thursday from 5-8 pm at Arnolds Creek Children’s and Community Centre at 19 Claret Ash Boulevarde, Harkness. Focusing on senior men’s mental and physical wellbeing. Join them for a cuppa and a chat, listen to guest speakers and participate in activities including, carpet bowls, pool, table tennis, cards and chess.
Trevor 0404 494 649 or https:// meltonmensgroup.home.blog/ Lights of wisdom
The Bahá’ís of Moorabool invites people to the Lights of Wisdom, a monthly event providing an opportunity to relax in a tranquil environment and reflect on inspiring themes. It’s held the first Friday of every month, 7.30-8.30pm at Lerderderg Library, Bacchus Marsh. It’s a free community event open to all.
Women’s Support Group
Women’s Support Group Melton is for any women who feel they would like to attend a peer support group which is relaxed, friendly and non-judgemental. The group meets weekly at 1pm on Mondays (except for public holidays) at Djerriwarrh Neighbourhood House, 239 Station Road, Melton. The group can discuss most subjects that may be of help https://ow.ly/QVwJ50Q5g42
Melton South Community Centre
Learn how to create and customise your own WordPress website in Melton South Community Centre’s term two Build Your Own Website course (Thurs 15/5-3/7, 6-8:30pm). Create your own site for personal or professional use and modify it to suit your preferences and purpose. $40/$20 concession.
For enquiries and enrolments, call 9747 8576.
The Dress is more that it seams
‘The Dress’ might just epitomise the notion that things aren’t always what they seem –especially in Melbourne at the end of the 19th century.
While widow Hannah may live in a grand mansion and not want for anything, loneliness is an unspoken curse.
For her flamboyant tailor Bertin, the advent of department stores and retail therapy is a hit to the pocket and prominence alike.
Essence Theatre Productions chairperson Alaine Beek, who wrote the play, quite literally puts herself in Hannah’s shoes by playing the character herself.
“In those days when you were a widow, you
were often just given tenancy and you didn’t really own much,” Ms Beek said.
“Wepresumewealthypeoplehadthishappy, exciting life, but it wasn’t necessarily the case.
“Women had very limited power, and it could actually be quite boring.”
Hannah loves Bertin for the light he brings to her overcast life, but his escapades are something she desperately tries to evade.
The dynamic duo will embark on a tale of insistence and resistance when he tries to drag her along to a masquerade ball, where he will try and showcase his work.
On top of facing the loss of his livelihood, Bertin must also walk a fine line as a gay man
in a society that can be both ambivalent and persecutory.
“Bertin’ssexuality–it’srevered,butit’snever spoken about, but if he gets in the wrong circle he could be in trouble,” Ms Beek said.
The show will be staged at Werribee Park Mansion on Friday, May 9 at 8pm.
Tickets: https://www.essencetheatre. productions/the-dress-booking-page
Alaine Beek and Scott Middleton will depict the friendship of Hannah and Bertin in The Dress. (Supplied)
Artists share their creative journey
Altona’s Louis Goel Gallery has another exhibition that art lovers from the inner-west and beyond can enjoy.
ThreeArtists,OneJourneyfeaturesthework of Amanda Neville, Ilona Herreiner and and Juan Vasquez who are all based at the Altona Artisans ceramic studio at the Louis Joel Arts and Community (LJAC) centre.
Opened on April 26, the exhibition will run through until May 14 and features ceramics, mosaics, wood, and clay sculptures that explore the shared creative journey of three artists shaping raw materials into expressive forms.
Neville’s intricate mosaics piece together colour and texture, telling stories through fragments, while Vasquez’s ceramics celebrate thefluidityandstrengthofclay,capturingboth tradition and innovation.
Herreiner’s sculptures, crafted from wood and clay, speak of transformation and organic movement.
Though working in different mediums, each artist shares a deep connection to process, material, and storytelling.
Their hands shape, carve, and construct, bridging past and present, form and emotion.
The exhibition allows patrons to experience
this dialogue, where art becomes a reflection of touch, time, and vision.
The Louis Joel Gallery is located within the LJACcentreandisopenfrom 9.30am-4.30pm Tuesday - Friday, and from 11am - 2pm on Saturday and Sunday. Three Artists, One Journey closes at 3pm on Thursday, May 14.
For more information: https://www.ljac. com.au/about-louis-joel-gallery/ Those wanting to learn from the three artists as well as viewing their work, can do so at a range of courses offered at the Altona Artisans ceramic studio.
Details: //www.ljac.com.au/altonaartisans/
An optimistic art exhibition for the times
Brimbank Gallery in Sunshine is proud to present Onward & Upward, a solo exhibition byacclaimedAustralianartistPatrickFrancis, running until May 30.
This vibrant and emotionally resonant exhibition showcases a compelling new body of work that continues Francis’ unique exploration of humanity, movement, and transformation through bold colour and expressive form.
Known for his distinct style of figurative abstraction and powerful visual storytelling, Patrick Francis brings an intuitive energy to his work, celebrating both individual identity and shared experience.
Onward & Upward is a reflection on perseverance, joy, and the pursuit of personal growth, all deeply embedded in his signature style—vivid, direct, and deeply human.
Francis, a Melbourne-based artist, has exhibited widely across Australia and internationally. His work is held in major public and private collections, including the NationalGalleryofVictoria,Artbank,andthe Art Gallery of New South Wales. Recognised not only for his artistic achievements but also his advocacy for artists with disabilities, Francis’ practice continues to redefine expectations and expand conversations around contemporary Australian art.
Brimbank Gallery invites the community to experience Onward & Upward, where each work resonates with energy, optimism, and a bold sense of momentum.
The gallery is located onthe first floor of the Brimbank Community & Civic Centre. It is open Monday to Friday, 9am to 5pm. Entry is free.
There are about 900 species of eucalypts inAustralia,andanupcomingworkshop at the Melton Botanic Garden will give you the opportunity to sketch and appreciate just some of these incredible trees.
Friends of Melton Botanic Garden and environmental psychology doctor
Kathleen Bagot are partnering to host a two-hour nature sketching and journaling workshop this month, providing sketching skills and an opportunity to practise mindfulness in an outdoor setting with like-minded nature enthusiasts.
The event coincides with Botanic Gardens Week.
The workshop starts with a guided nature-based mindfulness practice, followed by a warm up with some different sketching techniques and discussion of template options.
There will then be a discussion about eucalypts, and the session will end with a chance to share your thoughts and sketching pages with other attendees.
All supplies will be provided to participants new to nature sketching or journaling, and no experience or art skills are required.
Experienced sketchers are welcome to bring their own favourite journal and supplies, or use those provided.
Ms Bagot said the event is aimed at being accessible and inclusive to all who would like to attend.
“You don’t have to be an artist or a scientist to do nature journaling … it really is about slowing down [and] noticingwhat’sinnature,”MsBagotsaid.
She said that a previous workshop held on March 23 for National Eucalypt Day sold out.
Theworkshopwillbeheldfrom10am–noon on Sunday, May 25 at the Melton Botanic Garden.
Tickets can be purchased online. Details: events.humanitix.com/naturesketching-eucalypts-in-melton-botanicgarden-25-may
The work of artists Juan Vasquez, Ilona Herreiner, and Amanda Neville is on display in the Three Artists, One Journey exhibition at the Louis Joel Gallery in Altona until May 14. (Ljubica Vrankovic) 472730_01
Artist Patrick Francis and exhibition curator Richard Orjis. (Supplied)
Environmental psychology doctor Kathleen Bagot at the Melton Botanic Garden. (Damjan Janevski 475273_01
PUZZLES
To solve a Sudoku puzzle, every number from 1 to 9 must appear in: each of the nine vertical columns, each of the nine horizontal rows and each of the nine 3 x 3 boxes. Remember, no number can occur more than once in any row, column or box.
ACROSS
1 Also known as (1,1,1)
3 Sacrilegious (11)
9 Difficult to understand (7)
10 Captivate (7)
11 Somewhat (8)
12 Smear, often with oil (6)
14 Spawn, similar to caviar (3)
15 Without aim (11)
17 Restrictions (11)
19 For this, ad – (Lat) (3)
20 Cease (6)
21 Plastic unit containing audio or visual tape (8)
24 High-protein pulse (7)
25 Middle Eastern national (7)
26 Impediment (11)
27 Televisions (abbr) (3)
DOWN
1 Inherited from one’s family (9)
2 Whenever you like (7)
3 Stereotypically masculine (5)
4 Speed up (10)
5 Bars (4)
6 Designer of goods and structures (9)
7 Opening (7)
8 Separate metal from ore (5)
13 Crowning ceremony (10)
15 Metallic element (9)
16 People living together in communities (9)
18 Of the Freemasons (7)
19 Highest in temperature (7)
20 Rummage (5)
22 Wait on (5)
23 Operator (4)
can you list? The centre letter must be included and each letter may only be used once. No colloquial or foreign words. No capitalised nouns, apostrophes or plural nouns ending in “s”.
1 What was the first successful contact lens made of?
2 ‘Herbst’ is German for which season?
3 What astrological term is used to describe the apparent backwards movement of a planet through the sky?
4 The legal drama series The GoodFight starring Christine Baranski (pictured) is a spin-off of which show?
5 What is the name of Taylor Swift’s 2023–2024 concert tour?
6 In which decade were the first Grammys awarded?
7 In which ocean would you find The Bahamas?
8 JojoRabbit, Hunt for the Wilderpeople and Boy were all directed by which filmmaker?
9 What are homonyms?
10 True or false: chickens can recognise up to 100 faces?
Still keeping ahead of the game
By Chris Riley, Marque Motoring
It’s amazing how the Toyota Corolla has evolved over the years.
Back in the day it was basic, vanilla transport and that’s the way it stayed for years.
Then someone, somewhere flipped a switch and things began to change dramatically, starting with the 11th gen Corolla in 2012.
But it was just a warm up for the current model which arrived in early 2018, with its complex, unrepentant, multi-faceted design.
Sittinglowerthanbeforewithasteeplyraked windscreen, it presents a predatory nose, with a designthatisasgoodasanythingfromEurope.
The long and short of it is that the company has been able to transform the image of the car from staid and conservative into something much more sporty with younger buyer appeal - and Corolla remains the best-selling cars in the world.
Styling Corolla hatch starts from $30,630 for the AscentSport,$33,780fortheSX,$37,620forthe ZR - all with a 1.8-litre hybrid petrol-electric drivetrain and CVT automatic.
And, if the sporty ZR doesn’t float your boat, there’s also the high performance, all-wheel drive GR Corolla to consider.
But bring your money with you, because it’s a big hike in price: $67,990 in manual form or $70,490 with an automatic (before on-road costs). Two-tone paint adds $775 and is offered in combination with white, grey, red, silver and blue.
Our test vehicle, the ZR Hybrid hatch, is priced from $43,280 by the time you put it on the road in Sydney. The price varies a little depending on your address.
Finished in black over silver, the ZR looks stunning.
Standard kit includes 18-inch alloys, dual zone climate air and a combination of real and artificial suede trim, with heated sports seats up front with red accents and an eight-way, power-adjust driver seat with lumbar support.
There’s also a premium gear lever and steering wheel, smart entry and start, electric parking brake, adaptive cruise control, road sign recognition, auto lights and wipers, auto-dimming rear view mirror, front and rear parking sensors and rear privacy glass. In the lights department, it has auto high beam, bi-LED headlights, along with LED daytime, tail and front/rear fog lights.
ZR steps up to a full 12.3-inch digital instrument cluster along with windscreen head-up display.
Corolla comes with a five-year unlimited kilometre warranty.
Infotainment
Infotainment consists of an 8.0-inch touchscreen with premium JBL 8-speaker audio, plus Bluetooth, satellite navigation, AM/ FMandDAB+digitalradio,andwirelessApple CarPlay and wired Android Auto.
You also get 12 months of complimentary access with remote connect to Toyota Connect Services which automatically notifies emergency services in the event of an accident as well as provides remote access to the car.
There’s also a wireless charge pad, two USB-C ports and a 12 volt outlet in the front (but nothing for rear seat passengers).
Safety
Corolla has been awarded a full five stars for safety by ANCAP. It comes with a rear view camera, seven airbags including a driver knee airbag and autonomous emergency braking (City, Interurban & Vulnerable Road User) as well as lane keep assist (LKA) with lane departure warning (LDW).
An upgraded Toyota Safety Sense suite starts with the pre-collision safety system which adds motorcycle detection, intersection collision
avoidance support for crossing vehicles and left/right turn, emergency steering assist and acceleration suppression at low speeds.
Cameras and radar sensors have also been improved offering a wider range for detection of obstacles or vehicles.
Blind spot monitor has been added across thehatchrange,whilelanetraceassisthasbeen expanded to include the emergency driving stop system feature that has been designed to bring the vehicle to a gradual stop if it detects the driver is no longer making vehicle inputs.
The active cruise control system has also been enhanced and now offers four distance settings, the ability to detect other vehicles earlier, and the addition of deceleration assist when changing lanes.
But it misses out on auto reverse braking.
Isofix child restraint anchorage points are provided for the rear outboard seats.
Engines/transmissions
With the introduction of the upgraded fifth-generation hybrid powertrain, performance has been boosted with a 13kW increase in power to deliver a combined output of 103kW.
The upgraded hybrid teams a 1.8-litre petrol engine with a newly developed high-output motor generator, power control unit and downsized hybrid transaxle.
The front, axle-mounted drive motor has been enhanced by doubling the number of magnets per pole inside the rotor, while the newly developed lithium-ion battery reduces weight by 14 per cent while increasing both input and output power.
Thehybriddrivesthefrontwheelsexclusively via a continuously variable transmission (CVT).
Driving Corolla’s low stance and wind-cheating profile places the car quite close to the ground. As a result,itcanmakegettinginandoutdifficultat timesanditmeansdrivewaysandspeedhumps also need to be approached with caution, as the low front apron is prone to scraping.
Sports seats with bolstered sides add to the difficulty. The sloping rear roof line also makes entry to the back seat more difficult than it probably should be and you might find it a little cramped once you’re in.
The boot gains some extra space, with a puncture kit instead of a spare tyre to make room for the hybrid battery pack.
Of note Corolla’s cousin the Lexus UX scores a larger 2.0-litre engine as the basis for its hybrid that produces a combined 146kW.
Putting the transmission of the hybrid in Power mode delivers more satisfying throttle response, with a turn of speed thanks to the boost from the electric motor. But make sure you don’t pull the transmission lever back all the way or you’ll find yourself in B instead of D, which is regenerative braking mode.
Traffic sign monitor recognises physical speed signs only.
It doesn’t recognise electronic speed signs, nor does it differentiate between standard signs, timed school zones or bus and truck advisory speed - so until it encounters a real speed sign it could be telling you fibs.
Steering is sharp and the hatch corners flat and hard, but the ride is overly harsh and the cabincanbecomequitenoisydependingonthe surface.
Toyota does not permit operation of the satellite navigation system while the car is in motion.
It’s super annoying, but you have to be in park with the handbrake activated. And that means pulling over and spending precious minutes on the task.
Sluggish response from the touchscreen makes the task that much more difficult. You can bang in the name of a street only to look up and discover it failed to recognise the first letter and that means starting over.
Of course, you could try appealing to the car’s voice activation system, but that’s an even more frustrating experience.
At the end of the day the hybrid is all about economy and this is where the Corolla excels. Rated at 4.0L/100km, we were getting 5.2L after almost 400km of mixed driving.
Summing up
You can’t really go wrong with the Corolla ZR hybrid hatch, but it commands a steeper price these days at more than $43K on the road.
There’s no longer a petrol model to distract buyers, but the hybrid powertrain provides immediate, accessible, no frills fuel savings to the average motorist, with no need for user intervention.
Beware the low ride height however which makes entry and exit more difficult than you might think.
You can’t really go wrong with the Corolla ZR hybrid hatch. (Pictures: Supplied)
Competition heats up in the sun
There was plenty of sporting action around the grounds and courts on Saturday. StarWeeklyphotographer
out shooting the skills on display in the autumn sunshine.
Williamstown’s Tom Downie. 475540_01
Keilor Park’s Caitlyn Crameri. 475729_09
Spotswood’s Lachlan Heriot and Yarraville Seddon’s Wil Baker. 475545_14
Werribee Centrals’ Michael Culliver. 475479_01
Werribee Centrals’ Olivia Edwards. 475482_23
Keilor Park’s Isabella Arvanitis and Burnside Heights’ Krissy Trang. 475729_13
Yarraville Seddon’s Corey Hitchcock. 475545_02
Werribee Centrals’ Kai Gomes Pattiyage and Inverleigh’s Jarvis Miles. 475479_08
Williamstown’s Justin Plapp. 475540_22
Williamstown’s Toby Triffett. 475540_09
Werribee Centrals’ Ellie Tubbs. 475482_09
Ljubica Vrankovic was
United seals home final with win over Auckland
Auckland’s 14-game A-League Men’s undefeated streak is over with Western United pulling off a confidence-boosting 4-2 win.
Michael Ruhs punished the premiers from a poorturnovertoopenthescoringonSaturday at Ironbark Fields in the 18th minute before Noah Botic and Angus Thurgate hit the scoresheet.
Auckland substitutes Neyder Moreno and Jesse Randall scored in the 62nd minute and five minutes into added time respectively to keep the home side alert.
ButagoalbyWesternUnited’sOliverLavale in the final minute settled the matter.
The result was not enough for Western to realise their Asian Champions League Elite aspirations after Melbourne City defeated Sydney FC 5-1 earlier in the day to seal second place in the final regular-season round.
John Aloisi’s side at least sealed third and a home elimination final next week against Adelaide United.
Auckland and City will enjoy a week off before hosting the first of a two-legged semi-final.
It was the first time the Black Knights had suffered a defeat since their 1-0 loss to Perth Glory in January this year.
“Sometimes it happens after you win the premiership. It happened to me before at Sydney (FC),” Auckland coach Steve Corica said.
“The boys just switched off for a little bit, but we’ve got the finals to start thinking about and that’s our main focus right now.
“Johnny said, ‘See you in the final’. I said, ‘I hope not’.”
Aloisi chipped in: “I said, ‘I hope we see you in the grand final’. We’ve got a lot of games to play before we get there.
“He did say he hopes not because we’re the teamthatbeatthemtwicethisyearandmaybe
Alleyne claims top gong
By Tara Murray
Sydenham-Hillside all-rounder Anthony Alleyne has claimed the Victorian Turf Cricket Association’s highest honour, the Roy Paxino Medal.
The new Storm coach claimed the medal as the best player in the senior division on Friday night at the association’s awards night. AlleyneclaimedthemedalaheadofAirport West St Christophers Ben Walkden, with Deer Park’s Aaron Ayre and Fawad Ahmed along with St Albans’ Akila Isanka finishing equal third.
Alleyne said it was nice recognition to claim the Paxino Medal.
“It is a great honour,” he said. “I think over the past few seasons I’ve done well and I’ve been rewarded for consistency.
“I’m just thrilled. It’s reward for my teammates and club members as well.”
Alleyne said he wasn’t expecting to come home with the top honour.
He said once he looked at the stats it showed that contributed with both the bat and ball.
Alleyne made 690 runs at nearly 50 for the season, while also taking 31 wickets across all formats.
“I performed with both the bat and ball,” he said. “It was disappointing that we didn’t go on this season and finish it off.”
Alleyne was also named captain for the senior division team of the year.
He said it was such a great honour to be in the team with the likes of Ayre, Michael Hill, Ahmed and Isanka.
Storm teammate Cam West was also named in the team of the year.
“Cam had a great season in terms of coming into the team and setting us up at the top of the order” Alleyne said.
“We hope he continues to do that for us.”
It’s been a big off season for Alleyne, who has signed on as the Storm’s coach for the next three seasons. He’ll step down as skipper with Dylan Knight taking on that role.
Alleyne said he was looking forward to the challenge of next season. The Storm finished third this season.
“Hopefully I can be consistent again and
he’s feeling we’re a bit of a bad omen for them.” Ruhs found the back of the net when opposition midfielder Marles Francois, receiving the ball from Nando Pijnaker, gave up possession under hot pressure from Western United’s Tomoki Imai.
With the Auckland defence rattled, Ruhs easily slotted for the opener in injured striker Hiroshi Ibusuki’s absence.
Ibusuki is expected to make his return from a calf injury next week.
Botic slotted his 12th goal of the season with a header in the 23rd minute following a corner kick.
A superb pass from Riku Danzaki looped over defender Pijnaker before Thurgate buried forthehomeside’sthirdgoalinthe49thminute. Western United’s win comes after welcome news of KAM Melbourne, a subsidiary of real estate moguls KAM Sports, taking a majority stake in the club and parent company Western Melbourne Group.
The club, whose finances have been under a microscope in recent months, also received a three-window ban from FIFA on registering new players earlier in the week.
Joanne Guelas, AAP
Wins for the Bloods, Devils
Melton kept its winning start to the Ballarat Football League season alive, but it didn’t come without a fright on Saturday.
The Bloods were at home to North Ballarat in the round four match that could have gone either way.
North Ballarat led by three points at quarter time and increased to four points at the main break.
The Bloods kicked three goals to one in the third quarter to open up a nine point lead heading into the final change. It opened a bit more in the final quarter.
Both teams kicked an early goal, before North Ballarat kicked two in a row to hit the front midway through the final quarter.
The Bloods were able to kick the next two goals to take the lead back.
There was one last goal for North Ballarat, but it wasn’t enough with the Bloods winning 10.11 (71)-9.14 (68).
Skipper Braedan Kight kicked three goals for the Bloods.
Harrison Hanley, Adrian Monitto and Jaycob Hickey were named the best for the Bloods.
Darley was also on the winners list on Saturday, beating Lake Wendouree.
have those numbers again,” he said. “We’re planning to go to work and work on the basics.”
In other results at the VTCA awards night, Caroline Springs’ Caitlin Pretty claimed the women’sbestandfairestaward.Shepreviously claimedthesameawardinthe2022-23season.
She was named in the team of the year alongside teammates’ Alisha Fowler and Miriam Hussain and Sydenham-Hillside’s Amber Andrews.
Burnside Springs United’s Shohan Rangier claimed the Russell Pollock Shield player of the year.
Skipper Mathew Sanders and Melton Centrals’ Steve Robertson were also named in the team of the year.
In the Evans-Clark Shield, Melton South’s Praveen De Silva capped off a premiership season as the division 4 player of the season.
He was named in the team of the year alongside teammate Saman Muthuwdige
In the Roy Picone Shield, Caroline Springs’ Farrukh Shahzad and Rukshan Fernando were named in the team of the year.
Scores were level at quarter time with no sign of things to come.
After quarter time it was one way traffic in the way of the Devils. They kicked seven goals in the second quarter to lead by 38 points at half time. It was much of the same in the second half, with the Devils winning 23.12 (150)-4.9 (33).
Will Johnson kicked six goals for the Devils, while Michael Edwards kicked four goals.
Billy Myers was named their best alongside Mitchell Gardiner and Nick Hind.
After four rounds, the Bloods sit on top and the Devils in third.
Bacchus Marsh, which had a bye, sits in sixth spot.
This week the Bloods face Redan, the Devils are at home to Ballarat and the CobraswilltraveltofaceNorthBallarat.
Noah Botic. (AAP Image/Will Murray)
Anthony Alleyne. (Ljubica Vrankovic) 463997_20
Warriors unable to put all the elements together
A lack of polish proved costly for the Western Warriors in the Victorian Netball League on Monday night as their winning streak came to an end.
It was a shorter break for the Warriors, who faced the Boroondara Express, two days earlier than the usual Wednesday time slot.
The Express, which was coming off its first loss of the season in the previous round, took control of Monday’s game in the second quarter.
After leading by two goals at quarter time, the Express won the second quarter 17-8 to open up what would be a match winning lead.
There wasn’t much difference between the sides in the second half, with the Express winning 61-43.
Warriors assistant coach Courtney McLean said they didn’t do the basics right for long enough.
McLean coached the side with coach Kim Bailey away on work commitments.
“The second quarter wasn’t good,” she said. “We lacked in the basics consistently and having two options at the ball.
“I still think we are good enough to beat them and in patches we did what we wanted to do in the chat pre-game.
“WewantedtoslowdownRubyBarkmeyer’s useinattack.Wedidn’tdoitforlongenough.”.
Kim Borger shot 27 goals for the Warriors,
switchingbetweenthetwoshootingpositions.
While disappointed to have conceded a big lead like that early, McLean said the group did fight hard in the second half.
“I’m proud of the girls,” she said. “In the past we would have let that go and they would
Sharks find a way to win
By Tara Murray
Hillside is on the board in the Essendon District Football League division 1 competition, after a tough few weeks to start the season.
Missing eight of their best 12 players, the Sharks have been tested early on against three fellow finalists from last season.
On Saturday, it was another challenge against an Avondale Heights side that had been more than competitive after dropping down into division 1.
The Sharks were able to put out their best four quarter performance of the season to get the job done, 10.16 (76)-6.12 (48).
Sharks coach Mo Kaakour was a relieved man to get some reward for effort.
“It’s nice to finally get the win, the boys have worked hard,” he said. ‘“We stuck to the game plan and we got rewarded.
“The boys have worked hard and had a big pre-season. We’ve played four of the better sides in the first four rounds.
“We hadn’t been blown out of the water. It
was nice to get one.”
The Sharks led by 19 points at quarter time and then trailed by a point at the main break.
After half time, the Sharks kicked six goals to two to seal the win.
Kaakour said the difference was playing four quarters of good football. He said the focus this week had been to bring the energy and intent defensively.
“Defensively to keep Avondale Heights to just six goals when they had been hitting the scoreboard was really good,” he said.
“Our defensive pressure was good. The boys brought into the defensive structure.”
JamesMcNaughtonkickedfourgoalswhile Robbie Castello and Josh Covelli kicked two goals each.
Kaakour said Castello put his hand up to run through the middle of the ground to provide some leadership.
“He had 35 possessions,” he said. “At 39 years of age and still playing his part like that is pretty inspiring.”
Khalil Kaakour, who is coming off two league under-18 best and fairests, also moved
have really run over the top of us.
“We didn’t do that but you don’t want to give away a lead like that at this level, it’s hard to get back.”
McLean said they were hoping with a bit of routine returning following two long weekends, they would be able to get some more consistency with their training.
She said due to the holidays they had missed a couple of main training sessions and it had shown in the result.
Going back to basics will be part of the focus before their next match.
McLean said getting Ruby Shannon and Eliza Gollant back into the side would help as well, with both out with injury.
The Warriors 23 and unders had a draw with the Express 41-41.
McLean wasn’t at the game but said she was told they were great for most of the game but needed to be a bit cleaner after throwing plenty of ball away.
TheWarriorsnextmatchisonMay7against the Peninsula Waves.
Tara Murray
Sports shorts
Western FL
Caroline Springs fell just short against Werribee Districts in the Western Football League division 1 competition. Coming off their first win of the season, the Lakers were in trouble early, down by 27 points. The Lakers managed to make it a game and were down by less than a goal at the next two breaks. The Tigers finished the quarter with two goals to one to seal a 13.14 (92)-11.11 (77). Steven Kyriazis, Lachlan Mellon and Ben Caluzzi were named their best. In division 2, the Western Rams lost to North Footscray, 19.14 (128)-3.4 (22).
EDFL
Hillside is the only undefeated team in the Essendon District Football League women’s premier division. The Sharks faced Aberfeldie in a top of the table clash, with the Sharks coming out on top. Two goals to none in the third quarter was the difference, with the Sharks winning, 4.8 (32)-3.3 (21). Yara Taylor was the Sharks best. In division 1, Burnside Heights lost to Keilor Park.
Big V
into the middle as they tried to mix it up.
Mo Kaakour said they had given jobs to Noah Asciak, Nick Fluke and Milad Almatrah and all three stood up strongly defensively.
For the Sharks, they’re hoping it will kick start their season. Kakkour said the focus for them was to make sure that they are competitive in every game.
Kakkour said Jackson Mcmenamin and Riley Miksa would hopefully return in the next couple of weeks after long term injuries, while they would get more guys back in the next three to four weeks.
“We have been struggling in terms of soldiers,” Kaakour said. “The guys that have been coming in have been playing a role.”
The Sharks face Tullamarine this Saturday. The Demons are coming off their first win of the season.
In division 2, Burnside Heights lost to Keilor Park, 15.10 (100)-12.10 (82) after scores were level at three quarter time.
Jordan Hughes, Antonio Vitalone and Dylan Payne were named the Bears best.
The Melton Thoroughbreds lost a thriller against the Wallan Panthers in the Big V men’s division 2 competition on Saturday night. The Thoroughbreds were on the road and trailed by 11 points at the main break. They managed to turn it around in the third quarter to lead by two points at the last change. The Panthers did just enough to sneak home with a 73-72 win.
VPL
Caroline Springs George Cross made it two wins in a row in the Victorian Premier League 1 competition on Saturday night. The Georgies were at home to Melbourne SRBIJA and were able to take the lead in the 59thminute through Luke Jonathan Lofts. That would be the only goal of the game, with the Georgies winning, 1-0. The Georgies sit sixth on the adder after 12 games.
FOR MORE SPORT, VISIT Web: starweekly.com.au
Melton & Moorabool Star Weekly @starweeklynews @star_weekly
Western Warriors’ Kim Borger. (Grant Treeby/Netball Victoria)
Ryan Lojko. (Ljubica Vrankovic) 427096_04
Bloods building new connections and having fun
Melton is learning on the go in the Ballarat Netball League but excited for the challenge ahead of it.
It’s a brand new team for the Bloods this season so it was always going to take some time to get going.
Throw in a late coaching change and it’s been a hectic few weeks as the season has gotten underway.
ReneeFitzgeraldhascomeonascoach,with Tracey Wallace and Darren Abela no longer able to take on the role after being appointed late last year.
Fitzgerald said it had been a crazy few weeks stepping into the role.
“I’ve only just come in,” she said. “The original coaches couldn’t coach any more.
“I missed the first two games, so it was nice to come in and get that first win.”
Fitzgerald, who coaches at the Heat Netball
Club in the Northern Netball League, was preparing just to be a parent on the sidelines with her daughter Emily Fitzgerald in the
A-grade side.
When they needed a coach, Fitzgerald stepped up into the role.
“I watched the live stream in round one and someone videoed round two so I could semi watch it,” she said.
“But nothing beats watching it. This is my first year in the league and I wanted to help them out.”
Fitzgerald was very excited by the side that she gets to coach this year.
City West Falcons duo Lucia and Lani Fauonuku have come across. Lucia has represented Tonga on the international stage while Lani is part of the Australian under-17 team.
Akira McCormack is another while significant VNL experience,
“It’s really exciting,” Fitzgerald said. “I had to pinch myself seeing how fantastic they are.
Centrals hungry to win
By Tara Murray
Melton Centrals are banking on some young talent to help it shine in the Riddell District Netball League season.
After making the semi finals last season, the Centrals have a new coach and new look squad.
Remy Pirihi has taken over the A-grade coaching reins by himself after sharing the load with Randy Pereira the past couple of years.
Pirihi, who coaches one of the City West Falcons under-19s teams, said he was excited by the opportunity to take on the role.
“I really like it,” he said. “It’s the first time I’ve ever been a proper head coach.
“It’s been a fun journey and I’ve enjoyed it .
“I’ve been under [Falcons coach] Marg [Lind] and I’m taking her coaching and putting my own spin on it.
“I’m taking a club in the direction I want to take it.”
Pereira, the longtime Centrals coach, is still involvedincoachingsomeofthelowergrades.
Pirihi said that Pereira was still always
there and good to bounce ideas off.
Centrals have a different looking line up this season with several new inclusions.
Pirihi said that each season they have to keep on building.
“We have a bunch of new players,” he said.
“We’ve a new looking side and it’s exciting to see how it goes.
“It’s a fresh look. There’s a different vibe and a new faces mixed in with some old faces to steady the ship.
PirihisaidImogenSextonandManonMuir, whobothplayforhimattheFalcons,weretwo of the exciting youngsters in their side.
He said it was a good opportunity for them to test themselves against VNL championship players at a young age.
Centrals face Diggers Rest on the weekend. Both sides entered the game with no points.
Centrals had claimed a win in round two but had it stripped after a player points issue.
“We know that is unfortunate but now we have to bounce back,” Pirihi said.
“We’ll look to have a good hit out on the weekend. It’s always a tough match up with
“We’ve hit the ground running and it is full steam ahead.
“There’s some very talented girls in the team and it’s an exciting time as a club and coach.”
TheBloodsonSaturdaypushedpowerhouse North Ballarat as they searched for a second straight win.
There was not much between the sides at each of the breaks with the Bloods leading by one at quarter time and half time and North Ballarat in front by two goals at the last break.
North Ballarat was able to do just enough to win, 55-54.
Malia Seumanutafa scored 23 goals for the Bloods, who were missing a couple of players. Elsewhere, Darley drew with Lake Wendouree, 35-35.
OliviaCawthrayshot25goalsfortheDevils.
Bacchus Marsh had a bye.
Diggers Rest.”
The two teams on Saturday couldn’t be separated as they drew 41-all.
Diggers Rest led by three goals at quarter time before Centrals controlled the middle two quarters to lead by seven goals at three quarter time.
The Burras came home strongly to seal the win.
Pirihi said the focus for the club this season was to get all sides in finals and would love to finish in the top three in the A-grade competition.
Melton South had the bye.
Meanwhile in the football, Diggers Rest had a big win against Melton Centrals.
The Burras jumped out to an early lead and increased to 50 points at the main break.
They continued the momentum in the secondhalfandwentontowin,19.19(133)-8.6 (54).
Marcus Calvaresi, Jesse Varsamakis and Logan Carroll were named their best, with the former two kicking four goals each.
Jake Armistead, Jonny Ferri and Fabian Brancatisano were named Centrals’ best.
Tara Murray
Ma continues on winning
Melton rising squash star Tina Ma has added another Oceania title to her growing cabinet of trophies.
The teenager late last month won the under-17 title having previously won the under-13 title and then having twice claimed the under-15 total.
“I didn’t have any expectations since anything could happen, but my coaches said that they didn’t care what the result was as long as I tried my best,“ she said.
“So I was determined to give it my all on court and hopefully get the win, which I did.”
Ma said all the wins are equally as important as each other and they’re all motivation to keep training and push hard.
She backed up her title by being part of Australia’s Trans Tasman Cup side.
ShewonbothhermatchesasAustralia won the event for the first time.
“It felt great winning both of my matches knowing it helped contribute to Australia taking the win over NZ,” she said.
“I’m super proud of the Australians as we had never won the Trans-Tasman in New Zealand before, and I had such a great time with the team, it was so fun seeing the spirit and energy of everyone cheering each other on.”
Ma said she wouldn’t be where she couldn’t have achieved her results without the help of coaches Richard Cagliarini, Anthony Hill, her practice partner Cameron Richardson and the clubs she plays for MCC, Squash Logic and Western Squash and Racquetball Centre, along with her sponsors.
The hard work doesn’t stop for Ma now with plenty more competition ahead of her.
“I’ve got a few state titles to chase around Australia in the next couple of months, also looking forward to playing more senior events and join PSA but other than that the next big tournament for me would be the Australian Junior Championships in September.
“I’m going to keep training and pushing hard these next 5 months for that title too.”
Tara Murray
Akira McCormack has crossed to Melton.
(Ljubica Vrankovic)
Mariah Vankerkvoot. (Ljubica Vrankovic) 420262_03
