For Roger Blacksell, his family auto repair shop is the site of a lifetime of memories.
But after six decades, the doors of Blacksell’s Smash Repairs in South Geelong will close for the last time today.
Mr Blacksell, who took on the business after his father Barry retired, said he had “mixed emotions” about saying goodbye to something that had been part of his whole life.
“I’ve been working here for 45 years… so for me to walk away, it’s emotional, but it’s not the end of the world,” he said.
TheDewStreetsitewasalreadyafunctioning panel shop for Toyota dealer Greg Mitchell when young panel beater Barry Blacksell decided to strike out on his own and take on the business in 1965 - the year his son Roger was born.
‘‘ I’ve been working here for 45 years… so for me to walk away, it’s emotional, but it’s not the end of the world ’’ - Roger Blacksell
“When we were little kids we used to come down here on a Saturday morning,” Mr Blacksell said.
“I’d be sweeping the floor or polishing a car or something, so yeah, it’s been a lifetime.”
School was not young Roger’s passion, and when he decided to start working at age 15 his father suggested a two-week stint at the shop while he looked for another job.
“Then when Dad asked me what I wanted to do, I said, well, I don’t know anything else,” Mr Blacksell said.
“And there was a great community here to look after - grandkids, mums and dads, grandpas - so it was an easy choice.”
The decision allowed Mr Blacksell to spend his working life alongside his father.
“I was very lucky… I was a panel beater and Dad was a spray painter, so we made a pretty good team,” he said.
The shop became the hub of its own community, centred in the streets of South Geelong but extending to sports clubs in Belmont and Highton.
“I had three kids playing footy, so almost every night of the week we were at South
Smashing era closes
Barwon coaching kids,” Mr Blacksell said.
“WeendeduprunningtheAuskickprogram, we did junior committee, very active on the senior committee, then I became president (in 2017).
“I used to look around the workshop some days and every car was from the footy club, or
the cricket club, or the bowls club. I love the people up there, it’s a good little community.”
Despite the sadness of closing the business, Mr Blacksell said he was “absolutely” looking forward to retirement.
“The hands can’t do another winter… being an old tradie’s no fun,” he said.
“(We’ve got) lots of plans; getting more involved with the footy club, playing golf, we’ve got travelling to do. We’ve got a weatherboard house in Belmont that probably needs another coat of paint.
“I don’t need to be here. I’ve got so much to fill my life.”
Roger Blacksell closes his family business today. (Ivan Kemp) 474962_02
Safety improvements for Teesdale
Golden Plains Shire Council will explore options to improve road user safety in Teesdale following the death of a young boy early this year.
Actions to increase safety across the shire include introducing pedestrian awareness and traffic calming signage for drivers, preparingaRoadSafetyStrategyandcreating a safe pedestrian crossing for Teesdale.
Council officers will also write to the Department of Transport and Planning (DTP) and the Minister for Roads and Road Safety to request an urgent review of speed limits and safety concerns.
Acting mayor Helena Kirby said the safety of pedestrians and road users across the shire was a priority for council.
“The actions adopted by council
clearly set out how council plans to move forward and work towards improved road safety in Teesdale and throughout the shire,” she said.
“We thank all community members who have reached out to us during this difficult time and once again extend our sincere condolences to Caleb Wesley’s family and all who knew him.”
Thousands remember the fallen
Not even the rain could deter the thousands of people who came to pay their respects during Geelong’s Anzac Day march and service.
Crowds lined up along Malop Street on Friday, April 25, as veterans and their family members marched towards Johnstone Park for the 11.30am service.
Chris Woodard joined the Royal Australian Navy in 1995 at 18 years old and rose to Petty Officer during his 12 years of service.
Mr Woodard said Anzac Day was a crucial time for everyone to remember to not take life for granted.
“I wanted to move all around to Australia and see the world. I think the excitement and the adventure of it all (the Navy) led me to join,” he said.
“I’m sure there were a lot of bad times, but you tend to forget those, and you always remember the good times. I have absolutely no regrets at all.
“It’s a time to remember those that have served overseas in wars, and we enjoy the life we live today because of their service, their commitment and their sacrifice.”
Geelong Returned and Services League president Mark Lee guided everyone through the service and said it was an important day for all veterans past, present and future.
“It’s good to see such a great crowd in slightly inclement weather, but it’s really turned out to be a fantastic day,” he said.
“Being in the defence force is not an easy life; even in peaceful times, there’s removal and isolation from families.
“There will be many family members who are here for the memory of their lost ones. Some who they lost in battle, some who died as a result of their injuries, and those who have assed away with the passage of time.”
Deputy Prime Minister and Minister for Defence Richard Marles also spoke during the service and said he paid tribute to all the men and women who fought for their country.
“We commemorate the 110th anniversary of the landings at Gallipoli and the 80th anniversary of the end of the Second World War,” he said.
“The legacy that we remember is evidenced by the thousands of monuments and memorials scattered across our nation in every city, suburb, town and hamlet.
“Monuments upon which there are names of real people who lived and loved, and whose lives were tragically and dramatically cut short for us... Lest we forget.”
The service concluded with the Last Post
Caleb was six years old when he was hit and killed by a car while crossing BannockburnShelford Road with his older siblings, aged 9 and 12, to catch a bus to school on March 27.
Ms Kirby said council would continue to support any safety improvements and highlight concerns, while working in partnership with DTP, for its regional arterial roads.
Hollywood comes to Kardinia Park
Kardinia Park is coming to the big screen with a new major film production set to touchdown in the region.
The park will be transformed into a National Football League stadium for the ‘Untitled John Tuggle Project’, a film about the heartwarming story of an underdog American footballer.
Minister for Creative Industries Colin Brooks said the production wouldhelpshineaworldwidespotlight on Geelong’s sporting community.
“This project continues the winning streak for our local screen industry, showcasing both our creative capability and our world class sporting facilities,” he said.
“It’s exciting to see another major international production coming to life in Victoria, creating hundreds of jobs and delivering economic impact in Melbourne and regional Victoria.”
Skydance Sports will produce the film, which will help create 825 jobs for screen workers and extras across the state while injecting close to $29 million into the Victorian economy.
Physical production executive vice president Brad Carlson said the film would star David Corenswet (Superman), Michael Shannon (Nocturnal Animals, Shape of Water) and Isabel May (1883, Masters of Air, I Want You Back).
“We are thrilled to be making this film in Victoria with its first-class crews and screen infrastructure,” he said.
“The state’s amazing sports facilities and varied locations can double locations like New York, California and Mexico, so we knew there was no better place to bring this project to life.”
by Geelong Memorial Brass Band’s Christine Bowden, followed by a moment of silence and the Australian and New Zealand national anthems.
Jena Carr
Geelong’s Chris Woodard served in the Royal Australian Navy for 12 years. (Jena Carr) 474271_01
Cultura announces its new CEO
Geelong multicultural organisation Cultura has announced outgoing chief executive Joy Leggo’s successor.
Peter Birkett will officially step into Cultura’s top job on Monday, August 4, with Ms Leggo staying on for the first two weeks of his tenure.
Mr Birkett joins the not-for-profit organisation following a five-year tenure as chief executive of Assisi Aged Care in Melbourne’s north-east. He has served as chief executive of Winchelsea’s Hesse Rural Health and has a previous connection to Cultura through his time on the board of Multicultural Aged Care Services (MACS), which merged
with Diversitat to form Cultura in 2022.
Cultura board chair Gillian Costa said
Mr Birkett would be a great asset to the organisation,bringingawealthofexperiencein health and aged care leadership and familiarity with multicultural services.
“His familiarity with our organisation and commitment to culturally inclusive care and services makes him exceptionally well placed to lead Cultura into its next chapter,” she said.
“We are thrilled to have Peter onboard and believe he will be a great fit with our organisation.”
Mr Birkett has a professional background
It started with a tremor
Geelong will once again show its support for people living with Parkinson’s disease with the community coming together to raise awareness.
Fight Parkinson’s A Walk in the Park event will return to Geelong’s Eastern Park Circuit on Sunday, May 4, which was dedicated to improving the lives of people living with the chronic neurological condition.
Fight Parkinson’s chief executive Emma Collinsaidtheeventwasmorethanjustawalk; it was a community-driven movement helping raise awareness and funds for Parkinson’s disease.
“Together we can make sure Parkinson’s is better understood and resourced to ensure everyone gets the support they deserve,” she said.
“When the community is united, they can empower each other to make a difference. A Walk in the Park provides the perfect
opportunity for people to walk together and fight together.”
Geelong’s Sean Atkinson, 38, said he would be taking part in the event for his second time alongside his two young kids, following his own journey being diagnosed with early-onset Parkinson’s disease.
“About two and a half years ago, I noticed a tremorinmyrighthand...Itwasabitofashock to be diagnosed considering I was 36 years old with no family history,” he said.
“There’s a stigma around Parkinson’s disease and people not wanting to share their journeys, where they’re at, or whether they’ve got the disease,butIthinkthecommunityissostrong.
“I’ve got two young kids, and my biggest concern when I got diagnosed was whether it was hereditary and they would be impacted by it... but my type of Parkinson’s isn’t genetic, which is a great result.”
Jena Carr
in healthcare and banking and has held an honorary appointment as a Senior Adjunct Lecturer with La Trobe University in recognitionofhiscontributionstointernational aged care research.
Ms Costa acknowledged the appointment came with mixed emotions.
“Whilst we are thrilled to have Peter onboard, we are also bidding farewell to our esteemed friend and colleague, Joy Leggo, who has been instrumental in shaping the new entity of Cultura, leading the complex merger of Diversitat and MACS in 2021,” she said.
“For over 30 years, Joy has championed the
expansion of care and support services to the diverse, multicultural sector in Geelong. Joy has been a driving force behind supporting an inclusive, engaged and harmonious multicultural Victoria.
“It’s not every day you meet someone as extraordinary as Joy. She truly is a force to be reckoned with and we will miss her creativity, loyalty, passion and bravery as a leader.
“The Cultura Board looks forward to the new appointment and watching Peter apply his leadership experience to strengthen and expand his contribution to multicultural communities in new and diverse ways.”
Surf Coast roads reviewed
A speed limit review will help make roads across the Surf Coast Shire safer for all road users, with the community encouraged to have its say.
The speed review of residential streets in Anglesea, Aireys Inlet, Fairhaven and Moggs Creek will be conducted through a community survey and technical assessments.
Councillor Leon Walker said the survey featured a map of the area for the community to comment on individual roads across the shire.
“We want to understand how the local community use the local roads and if they feel safe on the roads at the current speed limits,” he said. “Safe streets help make places that people love... and it’s really important that, the community that uses these local roads,
‘‘ Safe streets help make places that people love ... ’’
- Leon Walker
complete this survey.
“If our streets feel safe, you’re more likely to go walking or riding and it adds to a sense of belonging and love for the neighbourhood. It’s especially important for our kids and wildlife.”
Cr Walker said the community feedback would be considered alongside a technical reportconductedbyanindependentconsultant to determine locations for making speed limit reduction recommendations.
The speed review will not include the Great Ocean Road, as it was managed by the Department of Transport and Planning and was funded through the state government’s Regional Speed Package grant. Visit surfcoast.vic.gov.au/SpeedReview2025 to access the survey, which is open until May 19.
Sean Atkinson was diagnosed with early-onset Parkinson’s disease over two years ago at age 36.
DISTRIBUTION \ 1300 656 678 distribution@fermax.com.au
CLASSIFIEDS \
Walking for memory
It’s time for the Geelong community to get active for their brain health with the return of the Memory Walk and Jog on Sunday.
DementiaAustraliawillhostitsannualevent at Eastern Beach Reserve on May 4 to raise funds and awareness for people living with dementia and their families.
Geelong’s Bernie Zeven said she would be taking part in the event for the first time in honour of her brother Michael (‘Mic’), who is livingwithDownsyndromeandyounger-onset Alzheimer’s disease at age 63.
Ms Zeven said there needed to be more awareness of the increased risk people living with Down syndrome had of also being diagnosed with dementia.
“With the dementia, Mic just started to forget people’s names... He also started getting confused and not being able to follow the football on TV as he didn’t know where the ball
was,” she said. “He’s always been really smart, and he would do 1000-piece jigsaw puzzles and long-words and follow the football. He’d write downwhichteamswereplayingeachotherand then work out the scoring.
“To see him change his personality has been hard... For the first five years, there were changes that we could manage, but then it started to go downhill. The longer it goes on, the worse it gets.”
People living with Down syndrome have a higherchanceofdevelopingAlzheimer’sdisease due to being born with a third chromosome 21, which can cause developmental and health problems, according to Dementia Australia.
Visit dementia.org.au for more information. Help is also available by calling the National Dementia Helpline on 1800 100 500.
Jena Carr
Century of Ford in Geelong
FordAustralia’slegacybeganatGeelong’s Dalgety Wool Store in 1925 before moving to a larger premises at Norlane.
To celebrate Ford’s centenary, City of Greater Geelong will host two free events at the National Wool Museum on Saturday May 24 and Sunday May 25 from 1pm to 3pm, called ‘100 Years of Ford in Geelong: The Cars, The People & The Local Legacy.’
The events will feature a short screening of archival material, followed by an engaging panel discussion. Additionally, attendees will have the opportunity to view a small collection of archival display items.
Explore the rich history and lasting legacy of Ford in Geelong from multiple perspectives, including the company’s impact, the local industry’s evolution, and the passionate community of Ford enthusiasts.
While Ford Australia no longer manufactures cars in Norlane, it is the site of their Research and Development Centre. The company still retains its 900 hectare You Yangs Proving Ground at Lara.
“The Ford factory in Geelong and then Norlane formed a significant part of our region’s identity and put Geelong on the map as a manufacturing hub with a skilled workforce, something that remains true today,” mayor Stretch Kontelj said. “Family histories ran deep at Ford, with multiple generations working at the plant and some spending their whole working lives there. Loyalty to Ford continues in our region’s mindset and collective history, and we congratulate Ford Australia on its centenary.”
Pool, hockey pitch for Surf Coast
By Jena Carr
Funding for a pool, hockey pitch and wetland project alongside a three per cent rate rise could be coming to the Surf Coast. Surf Coast Shire Council’s Draft 2025-26 BudgetandDraft2025-29RevenueandRating Plan has been placed on public exhibition following its council meeting on Tuesday, April 29. The draft budget featured an unallocated cash surplus of $2.2 million and $64.25 million or proposed total capital works funding, which would also contribute $15.11 million to new projects.
Thetotalcapitalworksbudgetalsoallocated $49.14millionforplannedmulti-yearprojects like the Wurdi Baierr Aquatic and Recreation Centre, Banyul Warri Fields hockey pitch, and the Karaaf Diversion project.
Deputy mayor Libby Stapleton said the draft budget aimed to balance financial sustainability with continued investment in important community facilities and services.
“Rates are council’s largest revenue source and lay the foundation for delivery of services and infrastructure for the community,” she said.
“It is becoming more and more difficult to absorb the impact of costs that are increasing
by more than the revenue we are able to raise through rates.
“Applying a rate rise of anything less than the rate cap would be irresponsible and inconsistent with our obligation to plan for the long-term future of our entire municipality.
“It is a responsible budget document that’s being safely crafted to balance the financial challenges of our time while still delivering important services, programs and facilities our community requires.”
Cr Adrian Schonfelder said he was disappointed that the shire was increasing revenue rates, especially in areas like
farmland, which recorded a 75 per cent rate level in the draft budget.
“Given that it’s 30 years of the Surf Coast Shire, I think it’s a very sad time in the history of council and local governments,” he said.
“I feel it’s highly unethical to have rate increases during a declared drought... and I think all governments need to rein in spending and cut back taxes and costs for people.”
Visit yoursay.surfcoast.vic.gov.au/ budget25-26 for more information and to share feedback on Surf Coast Shire Council’s draft budget alongside revenue and rating plan before 10am on May 26.
Shining the purple light on family violence
Hundreds of people from across Geelong will come together on Wednesday to honour and remember those who lost their lives to family violence.
The Geelong Candlelight Vigil Forum will be held at the Geelong Arts Centre on May 7 to allow the community to unite and share stories of strength.
Meli chief executive Grant Boyd said he was expecting close to 220 people to attend the vigil and that it was important to “highlight the invisible voices” of young people impacted by family violence.
“At Meli, we witness daily the devastating effects of family violence on children and young people,” he said.
“The Candlelight Vigil Forum is a crucial opportunity to discuss these impacts and
explore how we can break the cycle of intergenerational trauma.
“The vigil aims to educate and advocate to the Greater Geelong community about the prevalence of family violence in our communityandexplorepracticalstepstowards real change.”
Former world number four tennis champion Jelena Dokic will be the keynote speaker for the vigil’s second year and will share her story of resilience and experience with domestic violence and child abuse.
Ms Dokic will join an expert panel following her speech to discuss the impact of family violence on children and young people before the forum concludes with a vigil and a minute of silence.
Family incidents recorded in Greater
Geelonglastyearhadincreasedby13.1percent from the previous year, with 5,533 incidents attended by Victoria Police in 2024, according to Crime Statistics Agency.
Member for Lara Ella George, Member for Geelong Christine Couzens and Member for Corangamite Libby Coker will also attend the event.
Landmarks across Geelong will also light up purple to raise awareness of family and domestic violence.
Visit safesteps.org.au/candlelight-vigil to learn more about the Geelong Candlelight Vigil Forum. Help is also available through 1800Respect on 1800 737 732 or Lifeline on 13 11 14.
Geelong’s Bernie Zeven will participate in Dementia Australia’s Memory Walk and Jog for her brother Michael. (Ivan Kemp) 475074_02
Former world number four tennis champion Jelena Dokic will be the keynote speaker at the Geelong Candlelight Vigil Forum. (Supplied)
Jena Carr
Digging dirt on compost
By Matt Hewson
Geelong’s garden waste is helping to provide food for people in need around the region.
Thanks to a grant of $43,520 from Sustainability Victoria, the City of Greater Geelong has developed a new blend of high-quality compost derived from residents’ lawn clippings and shrubbery off-cuts.
The Geelong Organics facility in Anakie produces the compost from 35,000 tonnes of local green waste, supplying it to local businesses and community gardens.
The Geelong Botanic Gardens produce team also uses the compost to grow a wide range of standard and heirloom vegetables.
The team then harvests and donates to the Geelong Food Relief Centre in North Geelong.
Botanic Gardens horticulturalist Liam Kelly oversees the sizeable fresh produce garden, which supplies two to four crates of mixed produce to the centre every fortnight.
Mr Kelly said it was “a good feeling” to help those in need.
“The best part is we’re helping to feed people that can’t afford to go down to the shop, with the cost of living and the price of groceries these days.
“Some people out there are hanging out for this, and it saves them getting takeaway or eating toast every night. Instead, they can go and get some fresh produce.“
The council’s Environment and Circular Economy chair Cr Elise Wilkinson said the project was part of the City’s intention to be a clever and creative city.
“When we establish new sustainability initiatives and projects at the City, we always look at efficiencies that can reduce our waste and find innovative ways to convert the waste we do produce into reusable materials,” Cr Wilkinson said.
Labor commits to telehealth
Labor has announced it will undertake a $200-million expansion and rebranding of Australia’s national telehealth advice service if re-elected to government.
The government pledged to improve existing Healthdirect services and expand them to every state and territory under a consistent national service.
The changes would mean free 24-hour health advice and an afterhours GP telehealth service via 1800 MEDICARE, which would be launched on January 1, 2026.
Prime Minister Anthony Albanese madetheannouncementonSunday,with Member for Corangamite Libby Coker echoing his statements on Monday.
“When illness or injury strikes in your family, 1800MEDICARE will be there, a 24/7healthadvicelineandafterhoursGP telehealth service, backed by Medicare” Ms Coker said.
“OnlyaLaborGovernmentwilldeliver stronger Medicare for local communities across our region with more bulk billing and more free urgent care.”
The funding will also be used to open 50 more Medicare Urgent Care Clinics, including one in Torquay.
The GP telehealth service is not intended to replace existing primary care, but to provide urgent assistance when a regular GP is not available, Health Minister Mark Butler said.
“With Medicare Urgent Care Clinics and 1800MEDICARE, free urgent care will be a 20-minute drive away for 4 in 5 Australians, and a phone call away for every Australian,” Mr Butler said.
START THE CONVERSATION...
Our experienced funeral directors are available to meet with you to answer your questions and provide personalized information tailored to your specific needs and circumstances.
Making conversations about funeral care options a little easier and convenient.
To start the conversation please call us on 5221 4788
To many, the works of Shakespeare can seem archaic and inaccessible, using language, references, allusions and humour too far removed from the modern experience.
Geelong’s newest theatre company is seeking to change that perception, beginning with an ambitious inaugural production this month.
Overflow Theatre, a brand-new independent company focused on presenting reimagined versions of the Bard’s plays, will launch itself with its production of The Tragedy of Macbeth at Platform Arts this May 14 to 18.
Featuring a cast of both established professional performers and emerging acting talents, the troupe is led by Josh Monaghan (Macbeth) and Emma Langridge (Lady Macbeth).
Overflow’s take on the Scottish Play is an “intimate, authentic, grungy interpretation of Macbeth that will make you feel like you
A journey back in time
Iconic Aussie band the Choirboys have seen it all in their more than 40 years in the music industry, and this weekend they will spill the beans in Geelong.
Formed in 1978 Sydney, the Choirboys rockedandrolledtheirwaythroughthewildest era of Australia’s pub rock scene, both living through and hearing about the high times. Their show Run to Paradise: Great Rock ‘n’ Roll Stories is a retrospective of those times, presenting the Choirboys’ own hit material, selected songs from other Aus-rock artists and the candid retelling of life in the fast lane. In the show, the Choirboys frontman Mark Gable recounts tales answering questions such as what happened to Iggy Pop’s pants, what
were Chuck Berry’s weird habits and which movie star met the Divinyls bass player under a table at a nightclub.
“They didn’t call it pub rock in those days, but we were there in the beginning and we’re still here now,” Gable said. “Put it down to hearsay – it’s our opinion, it’s what we saw, it’s what people told us and most of it is extremely funny and incredibly interesting.
“Some of the stories are so funny and just plain stupid because back then, we could do things that nobody else could do because it wasn’t a normal job. There were no rules.”
TheChoirboysareatGeelongArtsCentreon Saturday, May 3. Visit geelongartscentre.org.au for tickets and more information.
haven’t seen the show before”, according to director Molly England.
“People can expect to be on the edge of their seats, horrified at the way that they connect themselves to the characters they see, and hopefully leaving the show feeling really introspective and contemplative,” England said.
“A lot of the time when we think about Shakespeare, we think about how traditional it is, and that’s one of the things I simultaneously love and despise about working with Shakespeare.
“There’s this sort of idea that you have to be an academic to understand these people in medieval costumes saying all these thees and thous. I really wanted to break down that stereotype and make it really accessible.
“It’s the same text that you would have
studied at school… we’ve not translated the words themselves, but translated the context in which they are said.”
The play is set in an alternate 1940s, leaning into the supernatural sense of the work to create a kind of adjacent reality.
English said Macbeth had an enduring and ongoing significance.
“The more we sit and study it, the more relevant it is to our political situation in Australia and across the world,” she said.
“These characters, their experiences and choices, and then the subsequent consequences… We think we’re so advanced but really, Shakespeare sort of captured us 400 years ago and we haven’t changed very much since.”
Visit overflowtheatrecompany.com.au for tickets and more information.
Jane Austen’s world on stage
JaneAustenwasborn250yearsago,withanew performance celebrating the life and works of the popular novelist near Geelong.
TheatreoftheWingedUnicornwillbringThe Jane Austen Experience to Ceres Temperance Hall from Friday, May 2, transporting audiences into historic and classic settings.
Cast member Miriam Pohlenz said the performance featured scenes from five of Jane Austen’s well-known novels, including Emma, Pride and Prejudice, Sense and Sensibility, Mansfield Park and Persuasion.
“A lot of people coming, will be familiar with Jane Austen, but we’re also hoping to attract others who aren’t as familiar with her work, and this is a real taster,” she said.
“How she describes unremarkable people in everyday situations and the tensions between the characters, it’s just so funny. She’s just so
clever and crafts her work so beautifully.
“The prose are so beautifully constructed, and you see those tensions between the characters. It doesn’t matter which piece or section of a novel you’re presenting; it’s so clever, witty, and funny.”
An ensemble of 10 actors will help bring the performance to life alongside beautifully inspired consumes and set designs.
Ms Pohlenz said Jane Austen never sought fame, recognition or celebrity, with her name not appearing on her books until after her death at 41 years old in 1817.
Tickets to The Jane Austen Experience are limited. Visit trybooking.com/CYJTN to book a seat and be transported through time before the performance wraps up on May 18.
Jena Carr
The Choirboys will take you on a journey back in time. (Supplied)
Josh Monaghan and Emma Langridge star in The Tragedy of Macbeth. (Glen Barton)
Miriam Wood, Melissa Musselwhite and Jocelyn Mackay will help bring The Jane Austen Experience to life at Ceres Temperance Hall. (Ivan Kemp) 474277_07
A career built on the love of art
Lisa Sullivan is celebrating a 20-year milestone with the Geelong Gallery, where she works as the senior curator. She spoke with Jena Carr about her time in the role and the highlights of her career.
Two decades at any job is a remarkable achievement, but time has just flown by for the senior curator of one of Geelong’s favourite art galleries.
April 26 marked Lisa Sullivan’s 20th anniversary of working with Geelong Gallery, an environment she feels passionately about.
“It’s a remarkable milestone, and I’ve been reflecting on where those years have gone, and it feels like they’ve gone very quickly,” she said.
“Geelong Gallery’s collection has evolved over 125 years, so it’s a very established collection with some real gems and treasures.
“I started in 2005 as the curator and have spent 20 years of working with, researching and building the collection. I couldn’t estimate howmany exhibitionsI’vebeeninvolvedwith.”
Lisa was attracted to the gallery’s collection and reputation after completing postgraduate studies in curating and working at The University of Melbourne’s Potter Museum of Art for eight years.
“I’veworkedonsomanydifferentexhibitions (at Geelong Gallery) and one of the things I really enjoy are the thematic exhibitions where, as a curator, you really get to flex your curatorial muscle,” she said.
“A thematic exhibition is one where the curator comes up with an idea, subject, or theme, and they research that theme and what artists might have been working on that theme.
“Then they’ll bring works together that have never been brought together before to share with the audiences and get them thinking about a particular subject.”
Lisa said she loved working directly with artists and that her involvement in the gallery kept her “stimulated, active and engaged” with art.
“Working with artists is a privilege and creating opportunities, whether through exhibition opportunities and commissioning or acquiring works, have been highlights,” she said.
“We work with artists at various levels and stages of their careers. It’s really rewarding to work with emerging artists and, sometimes, see them presenting an exhibition for the first time.
“I’m constantly inspired by what they do and the way that they show us aspects of the world that we might not have thought about before.”
‘‘
I also really love to look at how a gallery is interpreting works of art, engaging their audiences and sharing the story ’’
-
Lisa Sullivan
Lisa said she loved working with collections and that they were “active and living things” that needed to evolve and grow.
“I’m not sure what lies next, but I would love to see Geelong Gallery develop and be part of that journey,” she said.
“When I’m not here, I’m quite often at other galleries. When you’re a curator, you’re always switched on and looking at things.
“I love to see the art, but I also really love to look at how a gallery is interpreting works of art, engaging their audiences and sharing the storyofeachpiecewithmembersofthepublic.”
Lisa said there were some “amazing plans” in the gallery’s future to continue to grow its collections and community engagements.
“We’d love to see a gallery that’s redeveloped and more expansive where we’re able to offer even more to our visitors and the community than we do at the moment,” she said.
“One of the most enjoyable parts of my job is when I leave my desk and walk down through the gallery spaces as I have opportunities to have encounters with visitors.
“An important thing about curating is being open to hearing different perspectives from people, whether it’s from the artists that have made the works or visitors interacting with works.”
The proposed budget includes free, two-hour parking in central Geelong.
COUNCIL’S PROPOSED BUDGET RELEASED
We have released our proposed 2025-26 to 2028-29 Budget for community feedback.
The proposed budget aims to ensure financial sustainability in a challenging economic environment and represents an important first step towards our longterm goal of reducing debt and producing consistent cash surpluses.
The budget outlines plans to reduce our projected four-year debt from $205 million to $142 million.
It identifies $15 million of property sales in the upcoming financial year to pay down this debt and proposes no new borrowing over the next four years.
This requires considered planning and discipline to maximise the effectiveness of every dollar, ensuring Council can continue to provide the infrastructure and services the community needs.
The budget invests $764 million in capital works over the next four years and increases asset renewal spend to $315 million.
It also includes free, two-hour parking in central Geelong and limits rates increases to 2.5 per cent, below the Victorian Government’s mandated 3 per cent cap.
Scan the QR code or visit geelong.link/Budget2025-26-2 to have your say by 5.00pm on Wednesday 21 May.
NEWS
2025-26 Positive Ageing Grants are open now
Grants of up to $1,000 are available to host a community activity or event that celebrates and empowers our ageing community.
Eligible activities should help people aged 55+ connect, learn, stay informed, and support their wellbeing.
Scan the QR code or visit geelong.link/ Grants2 to view the eligibility criteria and application details.
Applications close at 5.00pm on Monday 26 May. To discuss your project or ask for help with the application process, contact us at communitygrants@geelongcity. vic.gov.au or 5272 5560.
You're Invited: Community Conversation
Join our Councillors, Youth Council and City officers for the first Community Conversation of the year. Drop into The Nest Youth Hub, 17 Gheringhap Street, Geelong on Wednesday 14 May between 4.30pm - 6.30pm.
This is a great opportunity to:
›Provide your feedback on open community engagements including the proposed 2025-26 to 2028-29 Budget and the draft Community Health and Wellbeing Strategy.
›Come and meet and chat to your councillors and Youth Council members about what matters to you and have a bite to eat!
›Help shape the future of your community in a relaxed, supportive environment.
For more information, scan the QR code or visit geelong.link/ CommunityConversations2
Community Health and Wellbeing Strategy 2025-29
Our health and wellbeing are crucial resources for living full and productive lives, especially in today’s fast-paced and often stressful world. We, along with our partners, work to improve the health and wellbeing of the Greater Geelong community.
The draft Community Health and Wellbeing Strategy 2025-29 will provide us with direction for the next four years.
Scan the QR code or visit geelong.link/CHWS2 to give your feedback on the draft strategy by 5.00pm on Sunday 25 May.
NEWS
Road safety upgrades in Barwon Heads We’re delivering key road safety upgrades identified in the Barwon Heads Transport Study.
Thanks to a $735,000 investment through the Victorian Government’s Safe Local Roads and Streets Program, we’re now able to deliver many of the upgrades on council-owned roads. Construction will begin on Monday 12 May with works complete by Monday 30 June 2025. Works include:
›Permanent 40 km/h speed limit across Barwon Heads (except for Golf Links Road, Bridge Road, and Thirteenth Beach Road).
›New roundabout at the Hitchcock Avenue/ Geelong Road intersection.
›Raised intersections at Ozone/Margate Street and Ozone/Seaview Avenue.
›Speed humps on Seaview Avenue.
Scan the QR code or visit geelong.link/BHTS for more information.
Geelong Gallery’s senior curator Lisa Sullivan is celebrating 20 years.
(Pictures: Ivan Kemp) 474961
Make Mother’s Day unforgettable
As Mother’s Day approaches, it’s time to honourtheremarkablewomenwhohavefilled our lives with love, guidance, and affection.
This year, Novotel Geelong and Tempo Kitchen & Bar on the Geelong waterfront are hosting special events that promise to make Mother’s Day unforgettable including a complimentary glass of prosecco for all mums on arrival.
At Novotel Geelong, we invite families to join us for a lavish buffet lunch held in our Peninsula Room on level 2 of the hotel that promises to delight the senses and honour the extraordinary mothers in our lives.
Our team has curated a delectable spread featuring an array of gourmet dishes, from succulent roasts, plenty of seafood, cheese platters and bakers board to decadent desserts station and a kids’ corner to enjoy. All served in a family friendly setting overlooking the beautiful waters of the Geelong Waterfront. It’s a celebration fit for the queens of our hearts, where every bite is a tribute to their love and dedication.
Meanwhile, Tempo Kitchen & Bar offers a more intimate setting for adults to celebrate their mum, step-mum, grandma, mother figures, and the beautiful mothers no longer with us.
With a warm and welcoming ambiance, Tempo invites guests to indulge in a culinary journey that pays homage to the rich local produce and flavours of Victoria, showcasing the very best that the region has to offer.
A buffet style lunch with Tempo’s famous approach that celebrates the bounty of the local land and sea, Tempo’s Mother’s Day menu is bursting with a plethora of mouthwatering options, from local seafood to our carvery station and everything in between there is something for everybody to enjoy.
If you can’t make it for lunch why not join us for dinner at Tempo, we’re open for dinner bookings on our à la carte menu, providing the perfect opportunity to treat Mum to a delicious meal crafted with care and served
with love.
As families come together to honour mothers at Novotel Geelong and Tempo Kitchen & Bar, let us not only celebrate this special day with delicious food and drinks but
also show our appreciation to all the mothers, grandmothers, and mother figures out there, for all their boundless love, strength, and endless sacrifices.
Happy Mother’s Day!
Novotel Geelong and Tempo Kitchen & Bar Is the place to be on Mother’s Day. (Pictures: Supplied)
Sweet ideas to make mum feel more special
This Mother’s Day, let mum know how appreciated and loved she is.
Mother’s Day is the perfect opportunity to shower mum with gifts and show her how much she means.
But when there are little ones, even the simplest gesture speaks volumes. Kids,herearesomeeasy(andcheap!)waysto spoil mum on Mother’s Day.
A thoughtful gift such as breakfast in bed or a homemade card is sure to bring a smile to your mum’s dial.
Start out by making your mum a cup of her favourite beverage - such as tea or coffee.
Then, while she’s relaxing in bed sipping on her drink, get to work on breakfast.
Ifyou’renotawhizinthekitchen,something simple like fruit with yoghurt or porridge will do the trick.
For something with a bit more effort, whip up a batch of French toast or pancakes, or go all out and make bacon and eggs.
Make your mum a card with a heartfelt message.
If you want to continue the culinary efforts, get the family together for a special Mother’s Day meal, where your mum doesn’t have to lift a finger.
Pick some flowers from your backyard and createabouquetforasure-firewinningpresent.
Channel your inner do-it-yourselfer and make your mum a painting. Takeawalkwithmumforaheart-to-heartor simply enjoy some quiet time together. Put on her favourite movie and get her to relax.
Andifyouwanttogoall-outwithsomething more extravagant, talk to dad and see if he can chip in for a luxurious spa treatment or some jewellery.And last, but not least, don’t forget to tell your mum “I love you”. Happy Mother’s Day.
CELEBRATING SENIORS
Miles of smiles at Affordable Dentures
Gain a smile worthy of showing off by the team at Affordable Denture Clinic, now in East Geelong.
Established 10 years ago, the clinic can provide you with a mouth full of solutions including, dentures, partial dentures, custom mouth guards and denture implants.
OwneranddentalprosthetistJasonDemko has more than 30 years experience in the dental field and has just opened the doors to the clinic’s brand new location at 306 Myers Street, East Geelong.
Mr Demko and his team are able to discuss a variety of options to help you achieve your best smile yet.
Ensuring to keep up-to-date with dental prosthetist technologies, Mr Demko focuses on utilising a variety of systems to integrate new practices into his denture work at the clinic.
As part of their care and quality focused service, Affordable Denture Clinic is the only denture clinic in the Geelong and greater district area authorised to provide and manufacture Valplast, the only dentures with an unbreakable lifetime guarantee.
Metal free and with invisible clasps, they’re a great resolution to your denture needs.
Striving to find the best denture solution, Mr Demko and his team ensure the utmost care and quality of service to their patients.
“We are a family owned business committed to providing highly personalised services to each individual,” he says.
The clinic’s new location, Mr Demko says, is a reflection of hard work and commitment to provide an environment to give his clients the very best in dental prosthetics. He says it wouldn’t have been possible without the ongoing support from the community and his clients.
Jason Demko with patient Eddie Fraser (right), and inside the clinic. (Ivan Kemp)
CELEBRATING SENIORS
Treated with care and respect
No other service compares to the care and respect that Just Better Care’s staff provide to its clients.
Lyn Mulligan said she looked forward to seeinghercarerseachweekandhadbuiltsome lovely trusting relationships with the in-home aged care and disability support service’s “beautiful people”.
“Wesharestories,havealaughandeveryone I have met truly cares,” she said.
“They allow me to keep my independence, they are patient and just so helpful and caring. It means a lot to me, and I have confidence in them.
“Having the support of Just Better Care means security, and it means that I can stay in my own home.”
Lyn recently moved into a retirement village and states that she was “so happy” to be able to take her regular carers along with her to her new home.
“I wouldn’t have anyone else, I choose Just Better Care as I have grown to respect them and the wonderful care that they provide,” she said.
To start your Just Better Care journey, call 03 5222 1518, email mailge@justbettercare. com or visit the caring team at their office at Level 1 114a Mt Pleasant Road in Belmont. Visit justbettercare.com/Geelong for more information.
Understanding Parkinson’s
Parkinson’s Disease is a progressive neurological condition typically diagnosed around the age of 65, though it can affect individuals of any age.
The disease is caused by insufficient production of the neurotransmitter dopamine in the brain, which disrupts the transmission of messages within the brain.
Thisdisruptioncanaffectvariousfunctions, including speech, movement control, cognition, mood, senses, and bodily functions such as bladder and bowel control.
Early signs of Parkinson’s Disease can be subtle and may include tremors, changes in handwriting, difficulty sleeping due to uncontrollable movements, difficulty walking or moving normally, constipation, changes in voice modulation, fainting or dizziness, slouching or stooped posture, unusual rigid facialexpressions,lossofordullsenseofsmell, weight loss, and psychological changes such as anxiety and depression.
It is important to recognise these early signs
for timely diagnosis and management of the disease.
Understanding the symptoms and their impact on daily life can help individuals seek appropriate medical advice and support.
Homestyle Aged Care is a proud sponsor of Walk in the Park Geelong. This community event provides an opportunity for people to show their support and to raise awareness and funds for Fight Parkinson’s which supports those living with Parkinson’s Disease.
TheeventwilltakeplaceonSundayMay4at Eastern Park Geelong.
Visit parkinsonswalkgeelong.com.au for more information and to register for the event. If you or your loved one are looking for care in Ocean Grove, Leopold or Grovedale, our admissions team can discuss your individual situation and advise on the many options available.
Call us on 1300 104 663 or visit homestyleagedcare.com.au
Homestyle Aged Care is a proud sponsor of Walk in the Park Geelong. (Supplied)
CELEBRATING SENIORS
Nuts support a healthy lifestyle in older Australians
Regular consumption of nuts is associated with maintaining a healthy lifespan, new research from a Monash University-led team has found.
Published in the Journal Age and Ageing, the researchers said the findings may help guide older individuals and their health professionals in making dietary choices that can support health in older age, including in those whose diet quality may not be optimal.
The study involved 9,916 adults aged over 70 years, who reported on their usual diet as part of the *ASPREE Longitudinal Study of Older Persons (ALSOP) sub-study.
Those who reported frequent consumption of nuts, including every day or several times a day, regardless of the type or form of nut, lived longer without dementia or persistent
disability, compared to those who never or infrequently consumed nuts.
First author Holly Wild, a PhD candidate and lecturer from the Monash University School of Public Health and Preventive Medicine, said that nuts were a good source of protein, micronutrients, unsaturated fats, fibre and energy, but whole nuts can be difficult to eat for those with poor oral health or chewing difficulties.
“Our study was able to account for poor oral health and other foods that people usually ate, and after adjusting for these and other factors, eating nuts remained positively associated with a healthy lifespan in later life. Nuts can be a good choice for a snack or as part of a meal, even if your diet might not be optimal in other ways,” Ms Wild said.
“Ifyouarewantingtoincorporatemorenuts into your diet, nuts are available in multiple different forms in supermarkets these days, including whole nuts, chopped or crushed nuts, nuts meals, and nut butters or pastes. The latter options may be much more accessible to those with oral health issues, and chopped nuts can be added to salads, cereals and smoothies.
“However, we do recommend keeping salted nuts, and candied and chocolate covered nuts to a minimum.”
The current Australian Dietary Guidelines suggest that adults should be consuming 30 grams of nuts, which is equivalent to 1/3 of a cup or a small handful, or approximately two tablespoons of nut butter on most days of the week, though previous research has reported
that Australian adults over 65 years only average between 4-4.6 grams per day.
“What 30 grams of nuts looks like depends on the type of nut, but typically a ‘handful’ is equivalent to around 25 almonds, 10 walnuts or 40 peanuts,” Ms Wild said.
“Choosing a mixture of nuts means you get thebenefitsofthevaryingamountsofnutrients found in different types of nuts. Nuts taste best and have the highest nutritional content when fresh, so store in an airtight container in a cool, dark place to maintain freshness.
“Nuts are a great way to incorporate protein andnutrientsintoourdietinamoresustainable way. For this reason, nut consumption has been recommended by leading scientists as part of the Eat Lancet Commission report for planetary health.”
Thinking about downsizing? Now’s the time to save.
New 2 and 3-bedroom homes are now selling from $529,000** at Ingenia Lifestyle Lakeside Lara.
Secure your home before 30 June and receive $20,000 off the purchase price when you settle by 23 December 2025*
Scan to find out more
Visit our display homes at 40-60 Watt Street, Lara, or call 03 5297 2030 to book an appointment.
Ingenia Lifestyle Lakeside Lara
The Guide
GARDENING AUSTRALIA
ABC TV, Friday, 8pm
Despite what the calendar might say, it feels like autumn has only just begun –how can the deep freeze of winter only be a month away? Time to make the most of May’s sunny days and colourful leaves while we still can. Luckily, Costa Georgiadis and his team have a bounty of ways to enjoy the outdoors before the chill sets in. In Niddrie, Victoria, Georgiadis spends time with a young architect who’s transformed an empty backyard into a productive homestead. Also, Hannah Moloney (pictured) learns about a dazzling array of dahlias at a flower farm in Lower Snug, Tasmania, while a group of students share their creek restoration project with Sophie Thomson in Hahndorf, South Australia. THE PUSH: SCOTLAND’S MURDER ON THE CLIFF SBS Viceland, Saturday, 8.30pm
A harrowing documentary that unpeels the layers of grief and deception surrounding a young woman’s death, this three-part true-crime investigation (airing in full tonight) goes inside a real Edinburgh courtroom as a man stands trial for his wife’s murder. Thirty-one years old and 17 weeks pregnant, solicitor Fawziyah Javed fell 15 metres from Arthur’s Seat in September 2021, telling witnesses to her final moments that her husband Kashif Anwar (pictured with Javed) had pushed her. With no weapon or witnesses to the event, the prosecution relies on evidence from within their marriage to paint a picture of coercive control and escalating abuse as her devastated family seeks justice.
Friday, May 2
SAM PANG TONIGHT 10, Monday, 8.40pm
They said it couldn’t be done – a tonight show, on network television, in this day and age? But Sam Pang (pictured) has proved the detractors wrong, staying on air for not only all eight scheduled episodes but earning a second season to air later this year. Pang’s fresh take on the classic format offers a casual approach, with engaging yet relaxed interviews and absurd segments all peppered with the comedian’s signature wry asides. Plus, there’s regular input from a rotating roster of guest announcers who manage to both help and hinder proceedings. In tonight’s finale, Pang grills HaveYouBeen PayingAttention?host Tom Gleisner ahead of Australia’s favourite quiz show returning next Monday.
ABC TV (2) SBS (3)
SEVEN (6, 7)
6.00 News Breakfast. 9.00 ABC News Mornings. 10.00 Planet America. (R) 10.30 The Pacific. (R) 11.00 Vera, Farewell Pet. (PG, R) 12.00 ABC News At Noon. 1.00 Bay Of Fires. (Malv, R) 3.00 Claire Hooper’s House Of Games. (R) 3.25 Grand Designs: The Streets. (PG, R) 4.15 Long Lost Family. (PG, R) 5.00 A Bite To Eat With Alice. 5.30 Antiques Roadshow. (R) 6am Morning Programs. 10.05 Matched. (PG, R) 11.00 Europe’s Highlands. (PGaw) 12.00 BBC News At Ten. 12.30 ABC World News Tonight. 1.00 PBS News. 2.00 Who Do You Think You Are? (PGa, R) 3.00 Nula. 3.30 Plat Du Tour. (R) 3.40 The Cook Up. (R) 4.10 The World’s Most Beautiful Landscapes. (PG, R) 5.05 Jeopardy! 5.30 Letters And Numbers. (R) 6.00 Sunrise. 9.00 The Morning Show. (PG) 12.00 Seven’s National News At Noon. 1.00 Better Homes And Gardens. (R) 2.00 House Of Wellness. (PG, R) 3.00 The Chase. (R) 4.00 Seven News At 4. 5.00 The Chase Australia. Hosted by Larry Emdur.
6.30 Claire Hooper’s House Of Games.
7.00 ABC News.
7.30 7.30: Australia Votes. Presented by Sarah Ferguson.
8.00 Gardening Australia. Hannah Moloney visits a dahlia farm. 9.00 Sherwood. (Mdlv) The police and Sparrows must work together.
10.00 Gruen Nation. (R)
10.35 The Weekly With Charlie Pickering. (R)
11.05 Big Boys. (MA15+l, R)
11.30 ABC Late News.
11.50 Father Brown. (Mv, R) 12.35 Mayfair Witches. (Ml, R) 1.20 Rage New Music. (MA15+adhlnsv) 5.00 Rage. (PG)
ABC FAMILY (22)
6.00 Mastermind Australia.
6.30 SBS World News.
7.35 24 Hours That Changed The World: The Fall Of Nazi Germany.
8.30 The Giza Pyramid: Reaching For The Stars. (PG, R) A look at the pyramids of Giza.
9.30 Scotland’s Scenic Railways: East Fife Railway. (R) An addition to Scotland’s rail network is unveiled.
10.30 SBS World News Late.
11.00 A Body That Works. (Ma) 12.05 Between Two Worlds. (Mals, R) 2.00 Agent Hamilton. (MA15+v, R) 3.40 Barkley Manor. (R) 4.30 Bamay. (R) 5.00 NHK World English News Morning. 5.30 ANC Philippines The World Tonight.
SBS VICELAND (31) 6am Children’s Programs. 12.20pm Bananas In Pyjamas. 1.40 Ben And Holly. 2.05 Paddington. 2.45 Fizzy And Suds. 3.00 Play School. 3.40 Mecha Builders. 3.55 Andy’s Safari Adventures. 4.25 Builder Brothers Dream Factory. 5.20 Kangaroo Beach. 5.50 Paddington. 6.45 Ben And Holly. 7.05 Gardening Australia Junior. 7.35 Star Wars: Young Jedi Adventures. 8.00 Be Cool, Scooby-Doo! 8.30 MythBusters “There’s Your Problem!”. 8.55 Robot Wars. 9.55 Merlin. 10.40 Late Programs.
6.00 Seven News. 7.00 AFL: Friday Night Countdown. A lead-up to the Friday night AFL match.
7.30 Football. AFL. Round 8. St Kilda v Fremantle. 10.30 AFL Post-Game Show. Post-game discussion and interviews. 11.15 GetOn Extra. A look at the weekend’s best racing.
11.45 Motorway Patrol. (PG) A speeder will not stop.
12.15 The Black Donnellys. (Mdsv) Tommy and Jimmy reverse roles.
2.30 Home Shopping. (R)
4.00 Million Dollar Minute. (R) 5.00 NBC Today.
7TWO (62, 72)
Movies. 9.30 NBC Today. Noon Better Homes. 1.00 Escape To The Country. 2.00 The Great Australian Doorstep. 2.30 Weekender. 3.00 Animal SOS Australia. 3.30 Harry’s Practice. 4.00 Better Homes. 5.00 Escape To The Country. 6.00 Bargain Hunt. 7.00 Better Homes. 8.30 House Of Wellness. 9.30 Escape To The Country. 11.30 Bargain Hunt. 12.30am Wildlife ER. 1.30 Australia’s Best Backyards. 2.00 Harry’s Practice. 2.30 Medical Emergency. 3.00 Better Homes. 5.30 The Great Australian Doorstep.
THE PIANO
ABC TV, Sunday, 7.30pm
A piano is placed in a public location – think bustling train stations and markets – and everyday Australians are invited to sit down and play in this heartwarming new series. What they don’t know is, as they’re playing, two of the world’s most renowned pianists – Harry Connick Jr and Andrea Lam – are secretly watching. Hosted by TV stalwart Amanda Keller, ThePianogives these amateur musicians the opportunity of a lifetime as Connick Jr and Lam choose a pianist to mentor at each locale, before inviting them to play at an end-of-series concert. It all begins tonight at Sydney’s Central Station, where five-year-old Maya, centenarian Bill and stroke survivor DJ tickle the ivories.
8.30 MOVIE: The Accountant. (2016, MA15+alv, R) A maths genius works as an accountant for criminals. Ben Affleck, Anna Kendrick.
11.00 The First 48. (Mav)
12.00 Tipping Point. (PG, R) 12.50 Young Sheldon. (PGadlsv, R) 1.20 Innovation Nation. 1.30 TV Shop: Home Shopping. (R) 4.00 Skippy The Bush Kangaroo. (R) 4.30 Global Shop. (R) 5.00 TV Shop: Home Shopping. (R) 5.30 Postcards. (PG, R)
9GEM (81, 92)
6.00 Deal Or No Deal. (R) Hosted by Grant Denyer. 6.30 The Project. A look at the day’s news. 7.30 The Graham Norton Show. (Ml, R) Celebrity guests include Billy Crystal. 9.40 The List. (Mln, R) Two best friends take on The List, a collection of travel experiences most people avoid. 10.40 10’s Late News. Coverage of news, sport and weather. 11.05 The Project. (R) A look at the day’s news. 12.05 The Late Show With Stephen Colbert. (PG) 1.00 Home Shopping. (R)
5.30 Nula. 6.00 Bamay. 6.40 Guardians Of The Wild. 7.30 MOVIE: Happy Halloween, Scooby-Doo! (2020, PG) 9.05 MOVIE: Mars Attacks! (1996, M) 10.55 Nula. 11.25 Bamay. (Return) 3.25am Songlines. 4.00 Family Rules. 4.30 First Sounds. 5.00 Bamay. NITV (34)
SBS WORLD MOVIES (32) 6am Morning Programs. 7.50 Bushwhacked! 8.15 Motown Magic. 8.40 Spartakus. 10.00 Guardians Of The Wild. 11.00 Going Places. Noon MOVIE: Rumble In The Bronx. (1995, M) 1.40 Pacific Island Food Revolution. 2.30 The Cook Up. 3.00 Jarjums. 5.00 Harlem Globetrotters.
6am Morning Programs. 12.40pm The Prophecy Of The Armadillo. (2018, Mal, Italian) 2.35 The Man Who Invented Christmas. (2017, PGalv) 4.30 A Great Friend. (2023, PGalsv, French) 6.20 The Battle Of The River Plate. (1956, PGa) 8.30 We Were Soldiers. (2002, MA15+v) 11.05 Heathers. (1988, MA15+av) 1am Tori And Lokita. (2022, Madlv, French, Italian) 2.40 The Forgotten Battle. (2020, MA15+av, German, Dutch, English) 5.00 The Battle Of The River Plate. (1956, PGa)
7MATE (64, 73)
MOVIE: Couples Retreat. (2009, M) 10.55 MOVIE: The Kingdom. (2007, MA15+) 1.10am Storage Wars. 2.00 American Resto. 2.30 Mountain Men. 3.30 Highway Cops. 4.30 Blokesworld. 5.00 Counting Cars.
9GO! (82, 93)
6am Morning Programs. Noon MOVIE: Godzilla: King Of The Monsters. (2019, M) 2.30 The Nanny. 3.30 Seinfeld. 4.30 The Addams Family. 5.00 Bewitched. 5.30 I Dream Of Jeannie. 6.00 The Golden Girls. 6.30 The Nanny. 7.30 MOVIE: Priscilla Queen Of The Desert. (1994, M) 9.40 MOVIE: Death Becomes Her. (1992, M) 11.40 The O.C. 12.40am Love Island UK. 1.40 Supernatural. 3.30 The Addams Family. 4.00 Tom And Jerry. 4.30 LEGO Friends: Girls On A Mission. 4.50 Late Programs. 6am Morning Programs. 11.00 Counting Cars. Noon American Resto. 12.30 Storage Wars. 1.00 American Pickers. 2.00
6am Morning Programs. 7.30 Skippy. 8.00 TV Shop. 10.30 Pointless. 11.30 My Favorite Martian. Noon Avengers. 1.10 MOVIE: Please Turn Over. (1959, PG) 3.00 Antiques Roadshow. 3.30 MOVIE: Tender Mercies. (1983, PG) 5.30 The Travelling Auctioneers. 6.30 Antiques Roadshow. 7.30 Rugby League. NRL. Roosters v Dolphins. 9.55 Golden Point. 10.45 MOVIE: RoboCop. (2014, M) 1.05am Creflo. 1.35 MOVIE: Tender Mercies. (1983, PG) 3.30 Gideon’s Way. 4.30 Antiques Roadshow. 5.00 The Travelling Auctioneers. 10 BOLD (53, 12)
10 PEACH (52, 11)
PICK OF THE WEEK
Key players: Harry Connick Jr, Andrea Lam and Amanda Keller hit the right notes in ThePiano
Saturday, May 3
ABC TV (2) SBS (3)
SEVEN (6, 7)
NINE (8, 9) 6.00 Rage Charts. (PG) 7.00 Weekend Breakfast On Election Day. 11.00 Rage. (PG) 12.00 ABC News At Noon. 12.30 MOVIE: Sherpa. (2015, Mal, R) Russell Brice. 2.00 Extraordinary Escapes. (R) 3.00 Living With Devils. (PG, R) 3.55 Landline. (R) 4.25 Australian Story. (R) 5.00 ABC National News On Election Day. 5.30 Australia Votes.
7.00 Australia Votes. Chief elections analyst Antony Green identifies the trends that will decide the election. David Speers and Sarah Ferguson bring the sharpest and most reliable election night analysis.
12.00 Creative Types With Virginia Trioli: Tony Albert. (PG, R) Virginia Trioli meets Tony Albert, one of the most exciting visual artists of his generation, who takes everyday items that represent the most confronting aspects of colonisation to create work that is provocative and deeply moving. 12.30 Rage. (MA15+adhlnsv) Continuous music programming.
ABC FAMILY (22)
6am Children’s
Programs. 10.00 Tiddler. 10.25 Children’s Programs. 3.55pm Andy’s Safari Adventures. 4.20 Dino Dex. 4.45 Gardening Australia Junior. 5.10 PJ Masks. 5.50 Paddington. 6.45 Ben And Holly. 7.05 Rocket Club. 7.30 Kids Baking C’ship. 8.10 Chopped Jnr. 8.55 Fresh Off The Boat. 9.35 Speechless. 9.55 Officially Amazing. 10.25 Late Programs.
NITV (34)
6am Morning Programs. 2.05pm Nula. 2.35 Stompem Ground: King Of Hearts. 3.00 Lee Fields, Faithful Man. 4.30 Tradition On A Plate. 5.00 Shepherdess. 5.30 The Barber. 6.00 The Last Land: Gespe’gewa’gi. 6.40 The Other Side. 7.30 Alone Australia. 8.30 MOVIE: Constantine. (2005, MA15+) 10.35 Bob Marley: Uprising Live. 12.40am Late Programs.
6am Morning Programs. 12.00 BBC News At Ten. 12.30 ABC World News Tonight. 1.00 PBS News. 2.00 Preparing To Give. (PG, R) 3.00 Cycling. UCI World Tour. Fleche-Wallonne Women’s Race. Highlights. 4.00 Cycling. UCI World Tour. Fleche-Wallonne Men’s Race. Highlights. 5.00 Going Places. (R) 5.30 How To Lose A War. (Premiere)
6.30 SBS World News.
7.30 Titanic In Colour. (R) Charts the history of the White Star Line’s RMS Titanic through colour images.
9.20 Stanley Tucci: Searching For Italy: Tuscany. (R) Stanley Tucci heads to Tuscany, the birthplace of the Renaissance, where he is joined by his parents. 10.10 Great Coastal Railway Journeys: Helensburgh To Connel. (R) Hosted by Michael Portillo. 11.10 Homicide: Life On The Street. (Mav, R) Felton is torn between duty and friendship.
3.40 Barkley Manor. (PG, R)
4.35 Bamay. (R) 5.15 France 24 Feature. 5.30 ANC Philippines The World Tonight.
SBS VICELAND (31)
6am Morning
Programs. Noon MOVIE: Ascension. (2021, M) 1.50 Spiraling: Crypto Special. 2.20 Beyond Oak Island. 3.15 WorldWatch. 5.10 Over The Black Dot. 5.40 Mastermind Aust. 6.40 Impossible Engineering. 8.30 The Push: Scotland’s Murder On The Cliff. 11.15 The YouTube Effect. 1.05am MOVIE: Drive. (2011, MA15+) 2.55 Late Programs.
SBS WORLD MOVIES (32)
6am Morning Programs. 2.25pm The Farewell. (2019, PGal) 4.20 Dancing Ninja. (2010, PGlsv) 6.10 The World’s Fastest Indian. (2005, PGal) 8.30 Rogue Agent. (2022, Mals) 10.40 Bang Gang (A Modern Love Story) (2015, MA15+adlns, French) 12.30am Truth. (2015, Mls) 2.50 Emma. (2017, Mlns, Italian) 5.00 Late Programs.
Sunday, May 4
ABC TV (2)
SBS (3)
TEN (5, 10)
6.00 NBC Today. 7.00 Weekend Sunrise. 10.00 The Morning Show: Weekend. (PG) 12.00 Horse Racing. Hawkesbury Cup Day, Caulfield Members Day, Guineas Day and SA Derby Day. 4.00 7NEWS: Election Day. 5.00 7NEWS: Australia Decides – Election.
6.00 Seven News. 7.00 7NEWS: Australia Decides – First Count. Hugh Whitfeld and Mark Riley take an up-to-the-minute look at the results of the federal election.
8.00 7NEWS: Australia Decides
– The Result. Hugh Whitfeld and Mark Riley, plus a panel of the country’s political heavyweights and commentators, take a comprehensive and up-to-the-minute look at the results of the federal election.
11.00 MOVIE: Life. (2017, MA15+v, R) Scientists discover a dangerous life form. Ryan Reynolds, Jake Gyllenhaal.
1.05 The Black Donnellys. (Mdsv) Kate helps Tommy get a job at an art studio.
2.00 Home Shopping. (R)
4.00 It’s Academic. (R)
5.00 House Of Wellness. (PG, R)
7TWO (62, 72)
6am Morning
6am Morning Programs. 10.00 Today Extra: Saturday. (PG) 12.00 Destination WA. (R) 12.30 Drive TV: Launch Pad. 1.00 Great Australian Detour. (R) 1.30 Young Sheldon. (PGadlsv, R) 2.00 Rugby League. NRL. Round 9. South Sydney Rabbitohs v Newcastle Knights. 5.00 Election 2025: Australia Decides –Polls Close.
6.00 9News Saturday.
7.00 Election 2025: Australia Decides – Vote Count. An analysis of election results.
8.00 Election 2025: Australia Decides – Election Night Live. A panel of experts analyse the breaking news as results come in.
10.00 Election 2025: Australia Decides – Analysis. An analysis of election results.
11.00 MOVIE: Miss Sloane. (2016, Mls) A lobbyist faces a senate inquiry. Jessica Chastain.
1.30 Destination WA. (PG, R)
2.00 The Incredible Journey Presents. (PGa)
2.30 TV Shop: Home Shopping. (R)
4.30 Global Shop. (R)
5.00 TV Shop: Home Shopping. (R) 5.30 Helping Hands. (PG, R) 6.00 10 News First: Australia Decides. Coverage of the 2025 federal election. 12.00 Home Shopping. (R) 5.00 Hour Of Power. Religious program.
9GEM (81, 92)
1pm MOVIE: Brothers In Law. (1957) 3.00
Programs. Noon Impossible Builds. 1.00 Escape To The Country. 3.00 Better Homes. 4.00 Horse Racing. Hawkesbury Cup Day, Caulfield Members Day, Guineas Day and SA Derby Day. 5.00 Escape To The Country. 6.00 Dog Patrol. 6.30 Bondi Vet. 7.30 The Yorkshire Vet. 8.30 Escape To The Country. 11.30 Late Programs. 6am Morning Programs.
7MATE (64, 73)
6am Morning
Programs. 2pm Rides Down Under: Workshop Wars. 3.00 Motor Racing. Night Thunder. Silver Cup. H’lights. 4.00 Full Custom Garage. 5.00 Counting Cars. 6.00 Pawn Stars. 7.00 Football. VFL. Box Hill v Richmond. 10.00 AFL Saturday Rewind. 10.30 When Big Things Go Wrong. 11.30 Late Programs.
MOVIE: Our Man In Marrakesh. (1966) 5.00 MOVIE: Kid Galahad. (1962, PG) 7.00 Rugby Union. Super Rugby Pacific. ACT Brumbies v NSW Waratahs. 9.30 Super Rugby Pacific Post-Match. 9.45 MOVIE: Mad Max: Fury Road. (2015, MA15+) 12.10am Late Programs.
9GO! (82, 93)
6am Morning Programs.
1.30pm Hunting Hitler. 2.25 Jeopardy! UK. 3.25 Young Sheldon. 3.55 MOVIE: Undercover Blues. (1993, PG) 5.40 MOVIE: The Croods: A New Age. (2020, PG) 7.30 MOVIE: The Hunger Games: Mockingjay – Part 2. (2015, M) 10.10 MOVIE: The Girl With The Dragon Tattoo. (2011, MA15+) 1.20am Late Programs.
7.00 ABC News. A look at the top stories of the day.
7.30 The Piano. (Premiere, PG) Hosted by Amanda Keller.
8.30 Bergerac. (Premiere, Mlv) When a member of one of Jersey’s wealthiest families is murdered, the police turn to ex-cop, Jim Bergerac.
9.20 The Split: Barcelona. (Ml, R) Lawyer Hannah Defoe and her family are reunited to attend the wedding of her daughter Liv.
10.20 MOVIE: My Brother Jack –Part 2. (2001, Mnsv, R) Matt Day.
11.55 Take 5 With Zan Rowe. (R)
12.25 Rage. (MA15+adhlnsv)
4.00 Outback Ringer. (PG, R) 4.30 Insiders. (R)
ABC FAMILY (22)
6am Morning Programs. 1pm Motorcycle Racing. Austn Superbike C’ship. 4.00 Grace Brown: Time For The Rest Of Life. (R) 4.30 Cycling. UCI World Tour. Liege-Bastogne-Liege. Women’s race. Highlights. 5.00 Cycling. UCI World Tour. Liege-Bastogne-Liege. Men’s race. Highlights. 5.30 How To Lose A War. (PGav)
6.30 SBS World News.
7.30 Macchu Picchu: City Of Stone. Looks at Macchu Pichu. 8.30 Invasion: The Normans. (Mav, R) Charts how an exiled Irish king persuaded the AngloNorman Lord Strongbow to help him recover his kingdom during Ireland’s 12th century when provincial kings vied for supremacy.
10.30 The Temple Of Hatshepsut. (R) A look at Hatshepsut’s temple. 11.30 Hell On Earth: WWII: A Dream Of Great Success. (Mav, R) 4.25 Bamay. (R) 5.00 NHK World English News Morning. 5.15 France 24 Feature. 5.30 Al Jazeera News.
6am Morning Programs. 1.45pm Paul Merson: Football, Gambling And Me. 2.45 Jeopardy! 4.50 WorldWatch. 5.20 PBS Washington Week. 5.45 Abandoned Engineering. 7.35 Science Fiction Revolution. (Premiere) 9.35 ABBA In Concert. 10.35 WWE Legends. (Return) 12.15am Late Programs.
6.00 NBC Today. 7.00 Weekend Sunrise. 10.00 The Morning Show: Weekend. (PG) 12.00 Sunday Footy Feast. 2.30 AFL Pre-Game Show. Pre-game coverage of the match. 3.00 Football. AFL. Round 8. Hawthorn v Richmond.
6.00 Seven News.
7.00 The 1% Club. (PGls) Hosted by Jim Jefferies. 8.05 7NEWS Spotlight.
9.05 24 Hours In Police Custody: The Murder Of Jane Doe. (Premiere, Mav) Detectives investigate after a woman, who called the police in distress, is found in a coma.
10.05 Menendez & Menudo: Boys Betrayed: Abuse Of Power. (MA15+av) Roy Rosselló gives his testimony.
11.15 Autopsy USA: Grace Kelly. (Ma)
12.15 Shades Of Blue. (MA15+adsv, R)
1.15 Travel Oz. (PG, R)
2.00 Home Shopping. (R) 3.30 Million Dollar Minute. (R) 4.00 NBC Today. 5.00 Sunrise Early News. 5.30 Sunrise.
7TWO (62, 72) SBS VICELAND (31) 6am Children’s Programs. 1.40pm Ben And Holly. 2.05 Paddington. 2.45 Fizzy And Suds. 3.00 Play School. 3.45 Tiddler. 4.20 Dino Dex. 4.45 Gardening Australia Junior. 5.10 Thomas. 5.50 Paddington. 7.05 Rocket Club. 7.35 Moominvalley. 8.00 Horrible Histories. 8.30 Fresh Off The Boat. 9.10 Abbott Elementary. 9.55 Speechless. 10.15 Late Programs.
6am Morning Programs. 1pm The Surgery Ship. 2.00 South Aussie With Cosi. 2.30 Animal SOS Australia. 3.00 Cities Of The Underworld. 4.00 Escape To The Country. 7.00 Vicar Of Dibley. 8.30 Vera. 10.30 Great Rail Restorations. 11.30 Vicar Of Dibley. 1am World’s Most Scenic Railway Journeys. 2.00 Vera. 4.00 Late Programs.
6am Morning Programs. Noon The Fishing Show By AFN: Best Of. 1.00 Fishing Addiction. 2.00 Motor Racing. Shannons SpeedSeries. 4.30 Deep Water Salvage. 5.30
6am Morning Programs. 10.00 AFL Sunday Footy Show. (PG) 12.00 Wide World Of Sports. (PG) 1.00 Fish Forever. (R) 1.30 Drive TV: Drive Car Of The Year. 2.00 Oz Off Road TV. (PGl, R) 3.00 Taronga: Who’s Who In The Zoo. (PGm, R) 4.00 David Attenborough’s Frozen Planet II. (PGa, R) 5.00 News. 5.30 Postcards. (PG)
6.00 9News Sunday.
7.00 Travel Guides. (PGln) 8.10 60 Minutes. Current affairs program.
9.10 The Killer Interview With Piers Morgan. (Premiere, Mlv) Piers Morgan speaks with some of the most notorious killers in the United States, starting with Karl Karlsen.
10.10 Footy Furnace. (Mlv) A look at the latest round of the AFL.
11.10 9News Late.
11.40 The First 48. (MA15+av)
12.30 Oz Off Road TV. (PGl, R) 1.30 TV Shop: Home Shopping. (R) 4.00 Believer’s Voice Of Victory. (PGa) 4.30 Drive TV: Drive Car Of The Year. (R) 5.00 Today Early News. 5.30 Today.
9GEM (81, 92)
6am Morning Programs. 1pm MOVIE: Lawman. (1971, PG) 3.00 Rugby League. NRL. Penrith Panthers v Broncos. 6.00 Dad’s Army. 6.30 M*A*S*H. 8.30 MOVIE: Gone In 60 Seconds. (2000, M) 10.50 The Closer. 11.50 MOVIE: Accident. (1967, M) 2am MOVIE: Where No Vultures Fly. (1951) 4.15 MOVIE: Blue Murder At St Trinian’s. (1957)
9GO! (82, 93) 6am Morning Programs. 1.50pm A Great Friend. (2023, PGalsv, French) 3.40 The Battle Of The River Plate. (1956, PGa) 5.50 The Movie Show. 6.20 The Personal History Of David Copperfield.
6am Morning Programs. 12.20pm Lost Gold Of World War II. 1.20 Motor Racing. FIA Formula E World C’ship. H’lights. 2.25 Jeopardy! UK. 3.25 Young Sheldon. 3.55 MOVIE: Over The Hedge. (2006) 5.35 MOVIE: Red Dog. (2011, PG) 7.30 MOVIE: Pacific Rim. (2013, M) 10.10 MOVIE: Walking Tall. (2004, M) 11.50 Gotham. 12.45am Late Programs.
(5, 10)
6am Morning Programs. 10.30 Pooches At Play. (R) 11.00 My Market Kitchen. (R) 11.30 Roads Less Travelled. (R) 12.00 MasterChef Aust. (PGa, R) 1.15 GCBC. (R) 1.30 Cook With Luke. (R) 2.00 Dog Down Under. (PGa, R) 2.30 4x4 Adventures. (R) 3.30 Expedition: Raja Ampat And Spice Islands. 4.00 All 4 Adventure. (PGl, R) 5.00 News.
6.00 The Sunday Project. Joins panellists for a look at the day’s news, events and hot topics. 7.00 MasterChef Australia. (PGal) The contestants must cook a dish that represents who they are now. 8.40 Matlock. (PGlv) Billy tries to help Sarah when her client is arrested after his business partner is found murdered. Matty and Olympia contend with a pressing confidential matter. 10.40 FBI. (Mv, R) An officer is shot dead at a pawn shop along with the store’s owner.
11.30 The Sunday Project. (R) A look at the day’s news.
12.30 Home Shopping. (R) 4.30 CBS Mornings.
Monday, May 5
ABC TV (2) SBS (3)
SEVEN (6, 7)
NINE (8, 9) 6.00 News. 9.00 News. 10.00 MOVIE: The Musical Mind: A Portrait In Process. (2023, Ml) 11.30 Creative Types. (PG, R) 12.00 News. 1.00 Landline. (R) 2.00
Restoration Australia. (PG, R) 3.00 Claire Hooper’s House Of Games. (R) 3.30 Grand Designs: The Streets. (R) 4.20 Long Lost Family. (R) 5.00 A Bite To Eat. 5.30 Antiques Roadshow. (R)
6.30 Claire Hooper’s House Of Games.
7.00 ABC News.
7.30 7.30.
8.00 Australian Story. Presented by Leigh Sales.
8.30 Four Corners. Investigative journalism program.
9.15 Media Watch. Presented by Linton Besser. 9.35 Q+A. Presented by Patricia Karvelas. 10.35 ABC Late News.
10.50 The Business. (R) 11.10 Planet America.
11.40 The Weekly With Charlie Pickering. (R) 12.10 Grand Designs: The Streets. (R) 1.00 Long Lost Family. (R) 1.45 Rage. (MA15+adhlnsv) 3.40 Parkinson In Australia. (PG, R) 4.30 Gardening Australia. (R) 5.30 7.30. (R)
6am Children’s Programs. 4pm Andy’s Safari Adventures. 4.25 Builder Brothers Dream Factory. 5.20 Kangaroo Beach. 5.50 Paddington. 7.05 Dino Dex. 7.35 Star Wars: Young Jedi Adventures. 7.50 The Inbestigators. 8.05 Operation Ouch! 8.40 The Crystal Maze. 9.30 MythBusters “There’s Your Problem!”. 9.55 Merlin. 10.40 Late Programs.
NITV (34)
6am Morning Programs. 12.30 ABC World News Tonight. 1.00 PBS News Weekend. 1.30 Al Jazeera News Hour. 2.00 Who Do You Think You Are? (PGa, R) 3.00 Travel Shooters. (PG) 3.35 Plat Du Tour. (R) 3.45 The Cook Up. (PG, R) 4.15 Greatest Train Journeys From Above. (R) 5.05 Jeopardy! 5.30 Letters And Numbers. (R)
6.00 Mastermind Australia. 6.30 SBS World News.
7.35 Prague With Michael Portillo: Prague 2. Michael Portillo uncovers a secret nuclear bunker.
8.25 Bettany Hughes: Treasures Of Oman. (R) Bettany Hughes explores the Sultanate of Oman, a land full of surprises and contrasts. 9.20 Sri Lanka With Alexander Armstrong. (PGaw, R) Alexander Armstrong takes a train ride. 10.15 SBS World News Late.
10.45 Classified. (Malv)
11.35 Don’t Leave Me. (MA15+a, R) 1.40 Son Of. (MA15+av, R) 3.25 Barkley Manor. (PG, R) 4.25 J Schwanke’s Life In Bloom. (R) 4.55 Poh & Co. Bitesize. (R) 5.00 NHK World English News Morning. 5.30 ANC Philippines The World Tonight.
SBS VICELAND (31)
6am Morning
Programs. 7.20 FBC News. 7.35 DW Global Us. 8.10 APAC Weekly. 8.40 DW Euromaxx. 9.00 Soccer. Major League. Sporting Kansas City v LA Galaxy. 11.30 France 24 English News. Noon MOVIE: The Fifth Element. (1997, PG) 2.05am The Weekly Football Wrap. 2.35 NHK World English News. 5.00 Al Jazeera.
6.00 Sunrise. 9.00 The Morning Show. (PG) 12.00 Seven’s National News At Noon. 1.00 MOVIE: Playing Cupid. (2021, PGa) 3.00 Beat The Chasers UK. 4.00 Seven News At 4. 5.00 The Chase Australia.
6.00 Seven News. 7.00 Home And Away. (PG)
7.30 Farmer Wants A Wife. (PGal) Hosted by Natalie Gruzlewski. 8.50 9-1-1: Lone Star. (Mav) Carlos is determined to solve his father’s murder. Owen is offered a life-changing opportunity.
9.50 The Agenda Setters. (R) A team of trusted and respected footy voices tackles the biggest topics in the AFL world.
10.50 Suits L.A.
11.50 Autopsy USA: Tom Petty. (Mad, R) 12.50 Treadstone. (MA15+av)
2.00 Home Shopping. (R) 4.00 NBC Today. 5.00 Sunrise Early News. 5.30 Sunrise.
7TWO (62, 72)
6am Morning
Programs. 1pm The Great Australian Doorstep. 1.30 Australia’s Best Backyards. 2.00 Weekender. 2.30 World’s Most Scenic Railway Journeys. 3.30 Harry’s Practice. 4.00 Medical Emergency. 4.30 Better Homes. 5.30 Escape To The Country. 6.30 Bargain Hunt. 7.30 Doc Martin. 8.30 Shetland. 11.00 Bargain Hunt. Midnight Late Programs.
6.00 Today. 9.00 Today Extra. (PG) 11.30 9News Morning. 12.00 MOVIE: Learning To Love. (2023, G) Ina Barrón, Philip Boyd. 2.00 Pointless. (PG) 3.00 Tipping Point. (PG, R) 4.00 9News Afternoon. 4.30 Tipping Point Australia. (PG) 5.30 WIN News.
6.00 9News. 7.00 A Current Affair. 7.30 The Floor. (PG) Hosted by Rodger Corser. 8.45 Footy Classified. (Ml) A team of footy experts tackles the AFL’s big issues and controversies.
9.45 Players. (Ml) A look at all the AFL news.
10.45 9News Late.
11.15 The Prison Confessions Of Gypsy-Rose Blanchard: I Do. Or Do I? (Mal)
12.05 Tipping Point. (PG, R) 1.00 Hello SA. (PG) 1.30 TV Shop: Home Shopping. (R) 2.30 Global Shop. (R)
3.00 TV Shop: Home Shopping. (R) 4.00 Believer’s Voice Of Victory. (PGa) 4.30 A Current Affair. (R) 5.00 Today Early News. 5.30 Today.
9GEM (81, 92)
6am Morning
TEN (5, 10)
6.00 Deal Or No Deal. Hosted by Grant Denyer.
6.30 The Project. A look at the day’s news. 7.30 MasterChef Australia. Special guest is Peter Gilmore. 8.40 Sam Pang Tonight. (Final, Mals) A weekly tonight show hosted by Sam Pang, featuring a monologue roasting the news of the week. 9.40 Taskmaster Australia. (Mals, R) Comedy game show featuring comedians performing a series of tricky tasks. Hosted by Tom Gleeson. 10.50 10’s Late News. 11.15 The Project. (R) 12.10 The Late Show With Stephen Colbert. (PG) 1.00 Home Shopping. (R) 4.30 CBS Mornings.
6am Morning Programs. 1.40pm Pacific Island Food Revolution. 2.30 The Cook Up. 3.00 Jarjums. 5.00 Harlem Globetrotters. 5.30 The 77 Percent. 6.00 Bamay. 6.40 Ocean Parks. 7.30 Who Do You Think You Are? 8.30 Living Black. 9.00 Light From The Shadows. 9.35 MOVIE: Samson And Delilah. (2009, M) 11.20 Bamay. 3.20am Late Programs.
SBS WORLD MOVIES (32)
7MATE (64, 73)
6am Morning Programs. 12.25pm Truth. (2015, Mls) 2.45 The Movie Show. 3.20 The World’s Fastest Indian. (2005, PGal) 5.40 Little Nicholas’ Treasure. (2021, PGv, French) 7.35 The Idol. (2015, Ma, Arabic) 9.30 Rheingold. (2022, MA15+adlv, Turkish, Arabic, Dutch, English, French, German, Kurdish) 12.05am Late Programs.
6am Morning Programs. 2.30pm Motor Racing. Night Thunder. Austn Late Model C’ship. 3.30 Duck Dynasty. 4.00 Mountain Men. 5.00 American Resto. 5.30 Storage Wars. 6.00 American Pickers: Best Of. 7.00 The Agenda Setters. 8.00 Outback Opal Hunters. 9.00 Gem Hunters Down Under. 10.00 Appalachian Outlaws. 11.00 Late Programs.
Programs. 11.30 My Favorite Martian. Noon Midsomer Murders. 2.00 Dad’s Army. 2.45 Antiques Roadshow. 3.15 MOVIE: The Railway Children. (1970) 5.30 The Travelling Auctioneers. 6.30 Antiques Roadshow. 7.30 Death In Paradise. 8.40 The Madame Blanc Mysteries. 9.40 TBA. 10.50 The Closer. 11.50 100% Footy. 1am Late Programs.
9GO! (82, 93)
ABC FAMILY (22) 6am Morning Programs. 12.05pm MOVIE: Romantic Rewrite. (2022, PG) 2.00 The Golden Girls. 2.30 The Nanny. 3.30 Seinfeld. 5.00 Bewitched. 5.30 I Dream Of Jeannie. 6.00 The Golden Girls. 6.30 The Nanny. 7.30 Seinfeld. 8.40 MOVIE: Kong: Skull Island. (2017, M) 11.00 Seinfeld. 12.10am Love Island UK. 1.10 Supernatural. 3.00 Late Programs.
Tuesday, May 6
ABC TV (2) SBS (3)
6am Morning Programs. 11.00 If You’re Listening. (R) 11.20 Gruen Nation. (R) 12.00 News. 1.00 Call The Midwife. (Ma, R) 2.00 Restoration Australia. (R) 3.00 Claire Hooper’s House Of Games. (R) 3.25 Grand Designs: The Streets. (PG, R) 4.15 Long Lost Family. (PG, R) 5.05 A Bite To Eat. 5.30 Antiques Roadshow. (R)
6.30 Claire Hooper’s House Of Games.
7.00 ABC News.
7.30 7.30.
8.00 Foreign Correspondent. (Final)
8.30 Creative Types With Virginia Trioli: Richard Tognetti. (Final, PGv) Virginia Trioli meets Richard Tognetti. 9.00 Freddie Mercury: The Final Act. (Ml, R) The story of Freddie Mercury’s final chapter. 10.30 The ABC Of... (Final, Ml, R) 11.00 ABC Late News. 11.15 The Business. (R) 11.35 Four Corners. (R) 12.20 Media Watch. (PG, R) 12.35 Q+A. (R) 1.40 Grand Designs: The Streets. (Ml, R) 2.25 Long Lost Family. (PG, R) 3.15 Rage. (MA15+adhlnsv) 4.30 Gardening Australia. (R) 5.30 7.30. (R)
6am Morning Programs. 12.30 ABC World News Tonight. 1.00 PBS News. 2.00 Who Do You Think You Are? (PGaln, R) 3.00 The Weekly Football Wrap. (R) 3.30 Destination Flavour. (R) 3.40 Plat Du Tour. (R) 3.45 The Cook Up. (R) 4.15 Greatest Train Journeys From Above. (R) 5.05 Jeopardy! 5.30 Letters And Numbers. (R)
6.00 Mastermind Australia. 6.30 SBS World News.
7.30 Great Coastal Railway Journeys: Solent. (R) 8.30 Insight. Kumi Taguchi investigates rising premiums.
9.30 Dateline: America’s Gay Rodeo. Takes a look at the world’s longest-running gay rodeo.
10.00 SBS World News Late.
10.30 Living Black. (R) 11.00 Snow. (Ma) 11.55 Unbroken. (Malv, R) 1.35 Invisible. (PGa, R) 3.05 Welcome To My Farm. (PG, R) 4.05 Barkley Manor. (PG, R) 5.00 NHK World English News Morning. 5.30 ANC Philippines The World Tonight.
SEVEN (6, 7)
6.00 Sunrise. 9.00 The Morning Show. (PG) 12.00 Seven’s National News At Noon. 1.00 To Be Advised. 2.20 Border Security: International. (PG, R) 3.00 Beat The Chasers UK. 4.00 Seven News At 4. 5.00 The Chase Australia. 6.00 Today. 9.00 Today Extra. (PG) 11.30 9News Morning. 12.00 The Floor. (PG, R) 1.15 My Way. (R) 1.30 Young Sheldon. (PGadlsv, R) 2.00 Pointless. (PG) 3.00 Tipping Point. (PG, R) 4.00 9News Afternoon. 4.30 Tipping Point Australia. (PG) 5.30 WIN News.
6.00 Seven News.
7.00 Home And Away. (PG)
7.30 Farmer Wants A Wife. (PGa) Hosted by Natalie Gruzlewski. 9.05 Doc. (Ma) Amy teams up with TJ to treat a patient suffering from mysterious liver issues.
10.05 The Agenda Setters. (R) An expert panel tackles the biggest AFL topics.
11.05 Accused. (Return, Ma) A psychic medium helps a couple.
12.05 The Act. (MA15+ans, R) Gypsy and Nick plan to meet in person.
1.20 Harry’s Practice. (R)
2.00 Home Shopping. (R)
4.00 NBC Today.
5.00 Sunrise Early News.
5.30 Sunrise.
7TWO (62, 72) SBS VICELAND (31) 6am Children’s Programs. 4pm Andy’s Safari Adventures. 4.25 Builder Brothers Dream Factory. 5.20 Kangaroo Beach. 5.50 Paddington. 7.05 Dino Dex. 7.35 Star Wars: Young Jedi Adventures. 7.50 The Inbestigators. 8.05 Operation Ouch! 8.40 Deadly 60. 9.20 Hippo Watch With Steve Backshall. 10.05 Late Programs.
6am Morning Programs. Noon France 24 English News. 12.30 Homicide. 2.20 Cryptoland. 3.25 WorldWatch. 5.20 Craig Charles: UFO Conspiracies. 6.15 Jeopardy! 7.35 8 Out Of 10 Cats. 8.30 Guy Martin: The World’s Fastest Electric Car? 9.50 Cannes Uncut. 11.25 Alone Australia. 12.30am Taskmaster. 1.25 Late Programs. 6am Morning Programs. Noon Better Homes. 1.00 Escape To The Country. 2.00 Creek To Coast. 2.30 My Greek Odyssey. 3.30 Harry’s Practice. 4.00 Medical Emergency. 4.30 Better Homes. 5.30 Escape To The Country. 6.30 Bargain Hunt. 7.30 Ludwig. 8.45 Foyle’s War. 10.55 The Yorkshire Vet. 11.55 Bargain Hunt. 12.55am Late Programs.
6am Morning Programs. 12.30pm Pawn Stars. 1.30 Outback Opal Hunters. 2.30 Gem Hunters Down Under. 3.30 Duck Dynasty. 4.00 Mountain Men. 5.00 American Resto. 5.30 Storage Wars. 6.00 American Pickers. 7.00 The Agenda Setters. 8.00 Outback Truckers. 10.00
6.00 9News.
7.00 A Current Affair.
7.30 The Floor. (PG) Hosted by Rodger Corser.
8.45 Australian Crime Stories: The Investigators: Murders Most Wicked. (M) An elderly couple is murdered.
9.45 Footy Classified. (Ml) Footy experts tackle the AFL’s big issues.
10.45 9News Late.
11.15 The Equalizer. (Mav, R) 12.05 Young Sheldon. (PGadlsv, R)
12.35 Tipping Point. (PG, R) 1.30 TV Shop: Home Shopping. (R) 2.30 The Garden Gurus. (R) 3.00 TV Shop: Home Shopping. (R) 4.00 Believer’s Voice Of Victory. (PGa) 4.30 A Current Affair. (R) 5.00 Today Early News. 5.30 Today.
9GEM (81, 92)
6.00 Deal Or No Deal. Hosted by Grant Denyer. 6.30 The Project. A look at the day’s news.
7.30 MasterChef Australia. Special guest is chocolatier Kirsten Tibballs. 8.40 The Cheap Seats. (Mal) Presenters Melanie Bracewell and Tim McDonald take a look at the week that was.
9.40 NCIS. (Final) The team uncovers a high-stakes plot.
10.30 10’s Late News.
10.55 The Project. (R)
12.00 The Late Show With Stephen Colbert. (PG) 1.00 Home Shopping. (R) 4.30 CBS Mornings.
6am Morning Programs. 11.30 My Favorite Martian. Noon Midsomer Murders. 2.00 Death In Paradise. 3.00 Antiques Roadshow. 3.30 MOVIE: School For Scoundrels. (1960) 5.30 The Travelling Auctioneers. 6.30 Antiques Roadshow. 7.30 New Tricks. 8.40 The Chelsea Detective. 10.40 The Closer. 11.40 Footy Classified. 12.40am Late Programs.
MA15+) Midnight Late Programs.
ABC FAMILY (22) 6am Morning Programs. 12.10pm MOVIE: Cry Macho. (2021, M) 2.20 The Nanny. 3.20 Seinfeld. 4.30 The Addams Family. 5.00 Bewitched. 5.30 I Dream Of Jeannie. 6.00 The Golden Girls. 6.30 The Nanny. 7.30 Seinfeld. 8.30 MOVIE: Miss Congeniality. (2000, M) 10.40 Seinfeld. 11.40 The O.C. 12.40am Love Island UK. 1.40 Supernatural. 3.30 Late Programs.
Australia. (PG, R) 3.00 Claire Hooper’s House Of Games. (R) 3.25 Grand Designs: The Streets. (R) 4.15 Long Lost Family: What Happened Next. (PG, R) 5.00 A Bite To Eat. 5.30 Antiques Roadshow. (R)
6.30 Claire Hooper’s House Of Games.
7.00 ABC News.
7.30 7.30.
8.00 Gruen Nation. (Final) Hosted by Wil Anderson.
8.35 The Weekly With Charlie Pickering. A satirical news program. 9.05 Planet America. Hosted by Chas Licciardello and John Barron. 9.40 Big Boys. (MA15+l) Jack’s spoken-word habit winds up the gang.
10.05 Mayfair Witches. (Malv, R) 10.50 ABC Late News.
11.05 The Business. (R) 11.20 Anh’s Brush With Fame. (R) 12.20 Grand Designs: The Streets. (R) 1.10 Long Lost Family: What Happened Next. (PG, R) 2.00 Rage. (MA15+adhlnsv) 3.40 Parkinson In Australia. (PGa, R) 4.30 Gardening Australia. (R) 5.30 7.30. (R)
ABC FAMILY (22)
6am Children’s Programs. 3pm Play School: What’s Cooking? 4.00 Andy’s Safari Adventures. 4.25 Builder Brothers Dream Factory. 5.20 Kangaroo Beach. 5.50 Paddington. 7.05 Dino Dex. 7.35 Star Wars: Young Jedi Adventures. 7.50 The Inbestigators. 8.05 Operation Ouch! 8.40 Abbott Elementary. 9.25 Doctor Who. 10.10 Late Programs.
NITV (34)
6am Morning Programs. 12.30pm Unleash The Beast. 1.40 Pacific Island Food Revolution. 2.30 The Cook Up. 3.00 Jarjums. 5.00 Harlem Globetrotters. 5.30 News. 6.00 Bamay. 6.40 Ocean Parks. 7.30 Ocean Warriors: Mission Ready. 8.30 MOVIE: Blood Diamond. (2006, MA15+) 11.05 Black Angels. 12.10am Late Programs.
6am Morning Programs. 12.00 BBC News At Ten. 12.30 ABC World News Tonight. 1.00 PBS News. 2.00 Dateline. (R) 2.30 Insight. (R) 3.30 Destination Flavour. (R) 3.40 Plat Du Tour. (R) 3.45 The Cook Up. (R) 4.15 World’s Greatest Train Journeys From Above. (R) 5.05 Jeopardy! 5.30 Letters And Numbers. (R)
6.00 Mastermind Australia. 6.30 SBS World News.
7.30 Alone Australia. (Mal) Survivalists face their physical limitations.
8.40 Just One Thing With Michael Mosley. (Final) Michael Mosley shares simple tips that could transform your health with some surprising benefits.
9.15 The Handmaid’s Tale. (MA15+) June spirals after a shocking revelation. Serena plans for a prestigious future. 10.15 SBS World News Late. 10.45 My Brilliant Friend. (Ma) 11.45 The Wall: Cover Your Tracks. (Mav, R) 3.05 Welcome To My Farm. (PG, R) 4.05 Barkley Manor. (PG, R) 4.35 Bamay. (R) 5.00 NHK World English News Morning. 5.30 ANC Philippines The World Tonight.
SBS VICELAND (31)
6am Morning
Programs. 12.30pm (Re)Solved. 1.25 My Life Online. 1.55 Queer Sports. 2.50 The Weekly Football Wrap. 3.25 WorldWatch. 5.20 Craig Charles: UFO Conspiracies. 6.15 Fast And Furious Face-Off. 7.05 Jeopardy! 7.35 8 Out Of 10 Cats. 8.30 MOVIE: Contact. (1997, M) 11.15 MOVIE: Mars Attacks! (1996, M) 1.10am Late Programs.
SBS WORLD MOVIES (32)
6am Morning Programs. 12.05pm The Idol. (2015, Ma, Arabic) 2.00 Little Nicholas’ Treasure. (2021, PGv, French) 3.55 Eat Wheaties! (2020, PGals) 5.35 Goddess. (2013, PGalns) 7.30 Up In The Air. (2009, Mlns) 9.30 Dirty Dancing. (1987, Mas) 11.25 Let Them All Talk. (2020, Mls) 1.35am Late Programs.
SEVEN (6, 7)
6.00 Sunrise. 9.00 The Morning Show. (PG) 12.00 Seven’s National News At Noon. 1.00 To Be Advised. 3.00 Beat The Chasers UK. 4.00 Seven News At 4. 5.00 The Chase Australia. Hosted by Larry Emdur.
6.00 Seven News. 7.00 Home And Away. (PG)
7.30 Clarkson’s Who Wants To Be A Millionaire UK. (PG) Hosted by Jeremy Clarkson.
8.30 The Front Bar. (Ml) Hosts Sam Pang, Mick Molloy and Andy Maher take a lighter look at all things AFL.
9.30 Unfiltered. (PGa) Hamish McLachlan sits down with key football stars and personalities to reveal their stories.
10.00 Nurse Georgie Carroll Sista Flow 2.0. (Mls) Stand-up by Nurse Georgie Carroll.
11.45 St. Denis Medical. (M)
12.15 Midnight Texas. (MA15+hv, R) 1.15 Travel Oz. (PG, R) 2.00 Home Shopping. (R) 4.00 NBC Today. 5.00 Sunrise Early News. 5.30 Sunrise.
7TWO (62, 72)
6am Morning
Programs. Noon Better Homes. 1.00 Escape To The Country. 2.00 Weekender. 2.30 The Yorkshire Vet. 3.30 Harry’s Practice. 4.00 Medical Emergency. 4.30 Better Homes. 5.30 Escape To The Country. 6.30 Bargain Hunt. 7.30 Heartbeat. 8.45 Lewis. 10.45 Law & Order: UK. 11.45 Bargain Hunt. 12.45am My Greek Odyssey. 2.00 Late Programs.
7MATE (64, 73)
6am Morning
Programs. 12.30pm Pawn Stars. 1.30 Outback Truckers. 3.30 Duck Dynasty. 4.00 Mountain Men. 5.00 American Resto. 5.30 Storage Wars. 6.00 American Pickers: Best Of. 7.00 Pawn Stars. 7.30 Highway Patrol. 8.30 The Force: BTL. 9.30 World’s Wildest Police Videos. 11.30 Police Strike Force. 12.30am Late Programs.
7.30 The Hundred With Andy Lee. (Mls) Comedy panel show.
8.30 The Grand Tour. (MA15+l)
The boys compare cars of the past, present and future, bringing in a Lamborghini Aventador S.
10.00 Wild Cards. (Mv) Max is taken hostage during a bank robbery.
11.00 9News Late.
11.30 The Equalizer. (MA15+av, R)
12.15 Young Sheldon. (PGadlsv, R)
12.40 Tipping Point. (PG, R)
1.30 TV Shop: Home Shopping. (R)
2.30 Global Shop. (R)
3.00 TV Shop: Home Shopping. (R)
4.00 Believer’s Voice Of Victory. (PGa)
4.30 A Current Affair. (R) 5.00 Today Early News. 5.30 Today.
9GEM (81, 92)
6am Morning
Programs. 11.30 My Favorite Martian. Noon Midsomer Murders. 2.00 New Tricks. 3.00 Antiques Roadshow. 3.30 MOVIE: Sands Of The Desert. (1960) 5.30 The Travelling Auctioneers. 6.30 Antiques Roadshow. 7.30 Yes, Prime Minister. 8.40 Midsomer Murders. 10.40 The Closer. 11.40 See No Evil. 12.40am Late Programs.
9GO! (82, 93)
6am Morning Programs. 3pm The Nanny. 3.30 Seinfeld. 4.30 The Addams Family. 5.00 Bewitched. 5.30 I Dream Of Jeannie. 6.00 Basketball. Women’s Trans-Tasman Throwdown. Aust v NZ. 8.00 Basketball. Men’s Trans-Tasman Throwdown. Aust v NZ. 10.20 MOVIE: The Infiltrator. (2016, MA15+) 12.50am Late Programs.
TEN (5, 10)
6.00 Deal Or No Deal. Hosted by Grant Denyer.
6.30 The Project. A look at the day’s news.
7.30 MasterChef Australia. (PGal) Guest chef is Shannon Bennett. 8.40 Elsbeth. (PGv) Elsbeth begins to suspect a wife is behind the death of her husband after a Celebrity Christmas curator is killed in a freak accident.
9.40 NCIS: Origins. (Mav) A military sergeant is found burned in her car. 10.30 10’s Late News. 10.55 The Project. (R) 12.00 The Late Show With Stephen Colbert. (PG) 1.00 Home Shopping. (R) 4.30 CBS Mornings.
ABC TV (2)
Thursday, May 8
6am Morning Programs. 10.30 The Weekly. (R) 11.00 Restoration Australia. (R) 12.00 News. 1.00 Sherwood. (Mdlv, R) 2.00 Restoration Australia. (R) 3.00 Claire Hooper’s House Of Games. (R) 3.30 Grand Designs: The Streets. (R) 4.15 Long Lost Family: What Happened Next. (PG, R) 5.00 A Bite To Eat. 5.30 Antiques Roadshow. (R)
6.30 Claire Hooper’s House Of Games.
7.00 ABC News.
7.30 7.30.
8.00 Restoration Australia: Lenna House. (Final, PG) Anthony Burke heads to Tasmania.
9.00 Grand Designs Australia: Benowa. (PG, R) Hosted by Anthony Burke.
9.55 Bill Bailey’s Wild West Australia: Broome. (Final, R)
10.45 ABC Late News.
11.00 The Business. (R) 11.15 Grand Designs: The Streets. (R) 12.05 Long Lost Family: What Happened Next. (PG, R) 12.55 Rage. (MA15+adhlnsv) 3.40 Parkinson In Australia. (PG, R) 4.30 Gardening Australia. (R) 5.30 7.30. (R)
GRUFFALO PLUSH & BOOKS
SBS (3)
6am Morning Programs. 12.00 BBC News At Ten. 12.30 ABC World News Tonight. 12.55 PBS News. 1.55 Alone Australia. (Mal, R) 3.00 Living Black. (R) 3.30 Destination Flavour. (R) 3.35 Plat Du Tour. (R) 3.40 The Cook Up. (PG, R) 4.15 Greatest Train Journeys From Above. (R) 5.05 Jeopardy! 5.30 Letters And Numbers. (R)
6.00 Mastermind Australia. 6.30 SBS World News.
7.30 The Secret DNA Of Us: Bathurst. (Final, PGa) Marc and his team unravel the DNA of Bathurst.
8.35 Liberation: D-Day To Berlin: Belgium And The Netherlands. Looks at the cost of freeing Belgium and the Netherlands.
9.30 Sherlock & Daughter. (Premiere) Sherlock Holmes faces a sinister case. 10.25 SBS World News Late. 10.55 The Hollow. (Malv) 12.55 Departure. (Mav, R) 2.35 Welcome To My Farm. (R) 3.35 Barkley Manor. (PG, R) 4.30 J Schwanke’s Life In Bloom. (R) 5.00 NHK World English News Morning. 5.30 ANC Philippines The World Tonight.
SEVEN (6, 7)
6.00 Sunrise. 9.00 The Morning Show. (PG) 12.00 Seven’s National News At Noon. 1.00 MOVIE: Carrot Cake Murder: A Hannah Swensen Mystery. (2023, Mav) 3.00 The Chase. (R) 4.00 Seven News At 4. 5.00 The Chase Australia.
6.00 Seven News. 7.00 AFL Pre-Game Show. Pre-game coverage of the match.
7.30 Football. AFL. Round 9. Fremantle v Collingwood. 11.00 AFL Post-Game Show. Post-game discussion and interviews. 11.30 Kick Ons. A preview of the upcoming AFL matches. 12.00 Raines. (Premiere, Mahv) A detective investigates a woman’s murder.
1.00 The Black Donnellys. (Mdsv) 2.00 Home Shopping. (R) 4.00 NBC Today. 5.00 Sunrise Early News. 5.30 Sunrise.
NINE (8,
TEN (5, 10)
6.00 Today. 9.00 Today Extra. (PG) 11.30 9News Morning. 12.00 The Hundred With Andy Lee. (Mls, R) 1.00 Drive TV: Drive Car Of The Year. (R) 1.30 Young Sheldon. (PGadlsv, R) 2.00 Pointless. (PG) 3.00 Tipping Point. (PG, R) 4.00 9News Afternoon. 4.30 Tipping Point Australia. (PG) 5.30 WIN News. 6am Morning Programs. 8.00 Bold. (PGa, R) 8.30 Deal Or No Deal. (R) 9.00 Lingo. (R) 10.00 Ent. Tonight. (R) 10.20 MasterChef Aust. (PGal, R) 11.30 Judge Judy. (PG, R) 12.00 GCBC. 12.30 Family Feud. (PG, R) 1.00 News. 2.00 Wheel Of Fortune. 2.30 Lingo. 3.30 News. 4.00 Neighbours. (PGa) 4.30 Bold. (PGa) 5.00 News.
6.00 9News.
7.00 A Current Affair.
7.30 RBT. (Madl, R) 8.30 Emergency. (Mlm, R) A mechanic is crushed under a ute.
9.30 A+E Crash Scene Emergency. (Mm) Teen Rick injures himself after hitting a roadblock.
10.30 My Feet Are Killing Me. (Mam) 11.20 9News Late.
11.50 Tipping Point. (PG, R) 12.40 Pointless. (PG, R) 1.30 TV Shop: Home Shopping. (R) 2.30 Global Shop. (R) 3.00 TV Shop: Home Shopping. (R) 4.00 Believer’s Voice Of Victory. (PGa) 4.30 A Current Affair. (R) 5.00 Today Early News. 5.30 Today.
6.00 Deal Or No Deal. 6.30 The Project. A look at the day’s news. 7.30 The List. (PGal) The boys hit the local market in India. 8.30 Taskmaster Australia. (Mls) Comedy game show featuring comedians performing a series of tricky tasks. Hosted by Tom Gleeson. 9.40 The Cheap Seats. (Mal, R) Presented by Melanie Bracewell and Tim McDonald. 10.40 10’s Late News. 11.05 The Project. (R) 12.05 The Late Show With Stephen Colbert. (PG) 1.00 Home Shopping. (R) 4.30 CBS Mornings.
6am Morning Programs. 12.35pm Super Maximum Retro Show. 1.35 Fanatics: The Deep End. 2.05 Insight. 3.10 WorldWatch. 5.10 Craig Charles: UFO Conspiracies. 6.05 Over The Black Dot. 6.35 Travel Man. 7.05 Jeopardy! 7.35 8 Out Of 10 Cats. 8.30 History’s Greatest Mysteries. 9.20 The UnXplained. 11.00 Homicide. 11.55 Late Programs.
7TWO (62, 72) SBS VICELAND (31) 6am Children’s Programs. 4pm Andy’s Safari Adventures. 4.25 Builder Brothers Dream Factory. 5.20 Kangaroo Beach. 5.50 Paddington. 7.05 Dino Dex. 7.35 Star Wars: Young Jedi Adventures. 7.50 The Inbestigators. 8.05 Operation Ouch! 8.40 Secrets Of The Zoo. 9.25 Saved By The Barn. 10.05 Late Programs.
9GEM (81, 92)
6am Morning Programs. Noon Better Homes. 1.00 Escape To The Country. 2.00 South Aussie With Cosi. 2.30 My Impossible House. 3.30 Harry’s Practice. 4.00 Better Homes. 5.00 Escape To The Country. 6.00 Bargain Hunt. 7.00 Home And Away. 7.30 Father Brown. 8.30 Murdoch Mysteries. 11.30 Father Brown. 12.30am Late Programs. 6am Morning Programs. Noon Midsomer Murders. 2.00 Yes, Prime Minister. 3.00 Explore. 3.15 MOVIE: Summer Holiday. (1963) 5.30 The Travelling Auctioneers. 6.30 Antiques Roadshow. 7.30 Rugby League. NRL. Eels v Dolphins. 9.45 Thursday Night Knock Off. 10.30 Outback Opal Hunters. 11.30 Late Programs.
7MATE (64, 73) SBS WORLD MOVIES (32) 6am Morning Programs. 11.55 Audrey Napanangka. 1.25pm Harold. 2.30 The Cook Up. 3.00 Jarjums. 5.00 Harlem Globetrotters. 5.30 Te Ao With Moana. 6.00 Bamay. 6.40 Ocean Parks. 7.30 Going Places. 8.30 Tribal. 9.25 MOVIE: Coach Carter. (2005, M) 11.50 Yothu Yindi Tribute Concert. 1am It Takes A Village. 2.00 Late Programs. NITV (34)
ABC FAMILY (22) 6am Morning Programs. Noon MOVIE: Death Becomes Her. (1992, M) 2.00 The Golden Girls. 2.30 The Nanny. 3.30 Seinfeld. 4.30 The Addams Family. 5.00 Bewitched. 5.30 I Dream Of Jeannie. 6.00 The Golden Girls. 6.30 The Nanny. 7.30 Survivor 48. 9.00 MOVIE: Horrible Bosses. (2011, MA15+) 11.00 Made In Korea: The K-Pop Experience. Midnight Late Programs. 6am Morning Programs. Noon American Pickers: Best Of. 1.00
(1994, Mls) 11.25 Taking Lives. (2004, MA15+asv) 1.20am Late Programs.
Making the best of a bad day
One of the appeals of an Asian holiday is an almostobligatorydaytriptoanisland,even if the place you are staying at is actually on an island.
Such is the case in Bali where the islands of Nusa Penida, Lembongan and the Gillies are only a relatively short distance away.
Our holiday resort in Candidasa offered a great view of Nusa Penida so after several days of fine weather, we decide to book a day trip which would incorporate transfers from our resort to the boat, passage to the island, swimming with manta rays, lunch and some sight-seeing on the island – it sounded wonderful.
However, the best laid plans do often go astray and if there is one thing you should realise, never bank on the weather.
The day we booked, the weather was fine and hot, and our anticipation for the following day was high.
However, waking up on our trip day, we were confronted by rain and winds and rather than letting common sense prevail, we decided that “things might be better on the island” and went ahead.
Right from the outset, we should have realised this wasn’t going to be our day.
The man we booked with, Smiley, rang to apologise that he wouldn’t be able to be our guide as the winds had brought down trees near his house and he was sending his son, Putu along instead.
It rained the entire trip to the boat, a howling gale greeted us at the port and Putu was nowhere to be found at first but once located he and his girlfriend, who had never been to Penida, ushered us onto the boat and to our covered seats. This was Putu’s first time as a tour guide.
Despite the weather and choppy seas, the journey to Penida wasn’t too bad and things improved slightly when we arrived - but not for long. After we were transferred to the dive centre/resort for the mantra ray boat we were told the seas were too rough but we could go snorkelling near Nusa Lembongan.
Not ideal but we thought “OK let’s go” –that was until we saw the boat.
It was about seven metres long, only had a cover over the driver and about 20 people were being crammed on board. Add to that choppy water, driving rain and no shelter.
One look at my wife and I said “we’re not going on this”.
While disembarking, a wave lifted the back of the boat and I immediately lost my
footing and fell backways into the water, only just managing to keep our backpack with our phones and wallets out of the briny.
I was drenched.
Fortunately, I had packed another T-shirt and after scrounging around the dive centre/resort, I found a towel and proceeded to dry myself as best I could, having to suffer the indignity of wearing wet shorts.
A phone call to Putu, via his dad, saw them return to pick us up – totally not on the planned schedule.
However, all was not lost and they suggested we head to some of the more famed tourist locations on Penida.
This is where our day started to come good.
Not only did we get to appreciate the skill of our driver negotiating roads that were essentially single lane being shared by multiple vehicles in both directions, but we saw a lot of the island’s interior, passing small villages, seeing agape farms providing the basic ingredient for tequila, and the eastern coastline featuring some fantastic scenery.
One of the stops was Broken Beach, where boats normally take people to see the manta rays off the coastline.
The seas were boiling and we completely understood why they had cancelled the trip.
It was fascinating to see so many tourists queuinguptohavetheirguidestakephotos of them in key vantage spots.
The next stop was even more spectacular – Kelingking Beach – where a virtual goat tracktakesyoufromacliffhundredsofmetres abovethebeachtothewater,ifyouaregame or fit enough.
What made this more challenging was quasi-cyclonic winds (actually the tail end of a cyclone that was near Australia) driving people to seek shelter wherever. However, the sky cleared, allowing us to get some great shots of the headline and coast.
Having seen these attractions and feeling a little drier, we stopped for lunch (part of the package) before heading back to the port.
Arriving ahead of schedule, we had time to talk to Putu and his girlfriend over a few decent cocktails.
AnotherchoppyboattripbacktoBaliand then onto Smiley’s restaurant to sort things out. He apologised profusely about the day and how it didn’t work out as planned and reduced the price while offering us free drinks.
The food at his restaurant (Wayung) was excellent and his hospitality and company was great way to end a mixed bag of a day. Making the best of bad situation adds to the challenges of travelling and turning a negative into a positive makes it even more rewarding.
Just check the weather before you book anything.
BOB ANTHONY
The spectacular east coast of Nusa Penida near Kelingking Beach.
Broken Beach at Nusa Penida.
Kelingking Beach.
Not a great day for a boat trip.
Boarding the boat to Nusa Penida in a howling wind. (Bob Anthony)
The Angel Billabong near Broken Beach on Nusa Penida off Bali.
Cairo and the call of the Nile
The newest Nile River ship in the Viking family is almost ready to take its place in the fleet looking after guests who seek adventure on the magnificent Nile River in 2025.
The Viking Amun was ‘floated out’ earlier this month, marking a major construction milestone and the first time the ship has touched water.
It is due to sail in September 2025 and will join the company’s growing fleet of state-ofthe-art ships for the Nile River and will sail the cruise lines iconic 12-day Pharaohs and Pyramids itinerary.
Viking CEO and chairman, Torstein Hagen said they were “very proud of our growing fleet in Egypt, which we consider to be by far the most elegant vessels on the Nile”.
“Egypt is one of the world’s most captivating destinations, and we look forward to introducing even more curious travelers to this extraordinary region in the coming years,” he said.
It has been said of Egypt’s exhilarating capital, “he who has not seen Cairo has not seen the world”.
During the 12-day Pharaohs and Pyramids itinerary, guests begin with a three-night stay at a first-class hotel in Cairo, where they can visit iconic sites including the Great Pyramids of Giza, the necropolis of Sakkara, the Mosque of Muhammad Ali, or the Grand Egyptian Museum. Guests then fly to Luxor, where they visit the Temples of Luxor and Karnak before boarding a river ship for an eight-day roundtrip cruise on the Nile River, featuring visits to the tomb of Nefertari in the Valley of the Queens and the tomb of Tutankhamen in the Valley of the Kings.
Also included are excursions to the Temple of Khnum in Esna, the Dendera Temple complex in Qena, the temples at Abu Simbel and the High Dam in Aswan, and a visit to a colourful Nubian village, where guests can experience a traditional elementary school.
The journey concludes with a flight back to Cairo for a final night in the ancient city.
Hosting only 82 guests in 41 staterooms, Viking Amun is inspired by the company’s award-winning river and ocean ships, with the signature Scandinavian design for which the ships are known. An identical sister ship to the Viking Osiris, Aton, Sobek and the Hathor, the Amun features several aspects familiar to Viking guests, such as a distinctive square bow and an indoor/outdoor Aquavit Terrace. Other ships in Viking’s Egypt fleet include the Viking Ra and the MS Antares.
In addition to the Amun, the company plans to welcome five new ships in Egypt in the next two years, which will bring the fleet to 12 vessels on the Nile River by 2027.
The traditional float-out ceremony took place at Massara shipyard in Cairo and is significant because it marks the ship moving into its final stage of construction.
She will now be moved to a nearby outfitting dock for final construction and interior buildout. For more information, please visit www. viking.com or call 138 747.
The Viking Amun will join the company’s growing fleet of state-of-the-art ships for the Nile River.
Staff readying the Viking Amun to join its sister ships on the Nile.
Discover More of Asia FOR LESS IN 2025
Are you planning your next 2025 ocean voyage? Explore Asia’s magnificent temples, immerse yourself in ancient cultural traditions and enjoy authentic regional cuisine. Sail with us and gain insights from knowledgeable local guides as you discover iconic cities and breathtaking natural wonders.Wherever it is that sparks your curiosity, you can enjoy savings of up to $15,800 per couple on selected 2025 Asia Viking voyages. Hurry, these offers are available on new bookings from 1 April 2025 until 30 June 2025
HORIZONS
Hong Kong to Tokyo
15 DAYS | 2 COUNTRIES | 9 GUIDED TOURS From $10,795pp in Veranda Stateroom
Hong Kong (Shenzhen) to Beijing
22 DAYS | 1 COUNTRY
From $12,795pp in Veranda Stateroom
JEWELS OF JAPAN & CHINA
Beijing (Tianjin) to Tokyo or vice versa
15 DAYS | 3 COUNTRIES | 9 GUIDED TOURS From $7,195pp in Deluxe Veranda
Surrounded by UNESCO-listed wonders such as the Great Barrier Reef and the Daintree Rainforest, Cairns is a haven for divers and explorers. Teeming with exotic fish and indigenous marine life, visiting the Great Barrier Reef whilst in port in Cairns is an unforgettable experience.
Your holiday includes
All-Inclusive Cruise
21 night all-inclusive luxury cruise on board Azamara Onward
Azamara Onward’s intimate atmosphere welcomes you with open arms, exquisite personal service, divine cuisine, and unparalleled amenities, so all you have to do is sit back and relax.
21 Nights | 3 March 2026 | Prices fr $8,299pp
Experience Sydney’s views and embrace the warm Filipino hospitality with this Australasia and Pacific Islands voyage.
Your journey begins in Sydney, where you’ll embark Azamara’s newest ship, Azamara Onward. During an overnight in port, explore Sydney’s iconic landmarks, such as the Harbour Bridge and Opera House, before cruising around Australasia and the Pacific Islands. Highlights of your voyage include the UNESCO sites of Cairns and the breathtaking scenery of Palau.
Calling at both Alotau and Madang, you’ll have the opportunity to explore the lush rainforests, turquoise waters, and picturesque islands that Papua New Guinea is famous for. During an overnight in port in the bustling capital of the Philippines, explore the walled city of Intramuros, the San Agustin church and the bustling Divisoria markets. You’ll finish your holiday in Hong Kong, where you will disembark ready for your flight home.
Visiting: Sydney (overnight in port), Mooloolaba, Airlie Beach, Cairns (overnight in port), Alotau, Madang, Koror, Manila (overnight in port), Hong Kong (overnight in port)
Complimentary alcoholic and nonalcoholic beverages including house spirits, wine and international beers
Pre-paid gratuities and complimentary AzAmazing Evenings® event
Concierge services for personal guidance and reservations
Complimentary Inbound Flight, Taxes & Transfers
Sydney (overnight in port), Mooloolaba, Airlie Beach, Cairns (overnight in port), Alotau, Madang, Koror, Manila (overnight in port), Hong Kong (overnight in port)
Mooloolaba
Airlie Beach
Alotau
Cairns
ACROSS
1 Scholarly (8)
5 Practices (6)
10 Breakfast favourite (5)
11 Divide into parts (9)
12 Jolly (6)
13 Squirm (7)
14 Ways of speaking (8)
15 Capital of Czech Republic (6)
18 Bring into being (6)
20 Haughty (8)
21 Sloping type (7)
24 Unfold (6) 27 Bewitch (9)
28 Whinny (5) 29 Lengthy list (6) 30 LAN network (8)
1 French abbot (4) 2 Alaska’s largest city (9) 3 Boredom or lethargy (5) 4 Rude (8)
6 More irridescent (7) 7 Current (5) 8 Most heartfelt (9) 9 Sketch (4) 14 Dishonest (9)
4 The kina is the national currency of which nation?
5 Who provides the voice for Smaug in The Hobbit: The DesolationofSmaug?
6 What does the Kelvin scale measure?
7 Which was the first Mr Men book: MrHappy Mr Tickle or MrMessy?
8 True or false: bream is a species of bird?
9 What character did Alan Rickman (pictured) play in RobinHood:PrinceofThieves?
10 Jørn Utzon designed which iconic Australian building?
COMMUNITY CALENDAR
WANT YOUR EVENT LISTED? Community Calendar is made available free of charge to not-for-profit organisations to keep the public informed of special events and activities. Send item details to Geelong Independent Community Calendar, 1/47 Pakington Street, Geelong West, 3218, or email to editorial@geelongindependent.com.au. Deadline for copy and announcements is 5pm Tuesday.
Market
Ukrainian Women’s Association Mama’s market, Saturday May 10, 10am-3pm, Ukrainian Community Centre, 57 Pakington Street, Geelong West. Gold coin entry, Ukrainian food, flowers, cake stall, crafts, silent auction, bric-a-brac.
Valya, 0400 069 181
Lectures
Australian Decorative & Fine Arts Society
Geelong Inc. welcomes members and guests to illustrated lectures monthly, Newcomb Hall, May 14, 10.15am. Geelong West Town Hall, 5.45pm. Guest speaker Jamie Hayes from UK, graduate Royal Academy of Dramatic Arts.
Ballroom dance
Leopold Hall, Leopold Hall, 805-809 Bellarine Highway, Saturday May 3, 7.30-11pm, $10 includes supper, music Ben.
0419 463 306
Ocean Grove Senior Citizens
101 The Terrace, Ocean Grove
Weekly
Tuesday: snooker 1pm, chess, indoor bowls 1.15pm. Wednesday: bingo 1.15pm, ukulele class 2pm, guitar jam session 4pm. Thursday: snooker 1pm, cards 500, social afternoons 1.15pm. Friday: art classes 9am.
Fortnightly
CWA 1st & 3rd Monday 2.30pm
Kareen, 0419 246 346, or Janis, 5255 4585
Monthly
Inhouse Movies 3rd Wednesday 1.30pm.
Dianne, 5255 1372
Hamlyn Heights Probus
Second Thursday of the month, 10am, Geelong Cement Bowls Club, 200 McCurdy Road, Herne Hill.
Noel, 0425 706 339
Geelong Central Probus
Third Friday of the month, 9.45am, Geelong RSL.
geelcentprob@gmail.com
Newcomb Probus
Third Wednesday of each month, 10am, East Geelong Uniting Church, corner Boundary and Ormond Roads.
Gary, 0407 320 735
Polish language for kids
Fortnightly Polish language classes for kids aged 7-11 at one of Geelong’s libraries.
Dorota, 5224 1105
Music for preschoolers
Mainly Music is a music and movement program for babies to preschoolers at St Albans-St Andrews Uniting Church, 276 Wilsons Road, Whittington, Tuesdays 10am during school terms.
Rhonda, 0437 241 345
Rostrum meets
Geelong Rostrum Public Speaking Club Inc meets each Monday.
Andrew, 0408 369 446, or Jan, 0407 296 958
Highton Seniors
Carpet bowls, bingo, cards, taichi, line dancing, mahjong. Community Centre, 84 Barrabool Road, Highton.
Elma, 0411 065 524
Adfas Geelong Art lectures each month, morning and evening, Newcomb Hall, Wilsons Road.
adfas.org.au, or geelong@adfas.org.au
Cards
Wanted: card sharp partners to play the
Mr Perfect Monthly free bbq for men of all ages to get together over a BBQ for a chat. Norlane Community Centre first Sunday each month except January, 10.30am-12.30pm. Next meeting May 4. 0430 022 446, or michaeldg999@gmail.com
game of Bolivia on Thursday evenings. For venue email Ingrid.
griddlepop@hotmail.com
Geelong Historical Society Inc.
Guest speaker first Wednesday of each month, 7.30pm, Virginia Todd Hall, 9 Clarence Street, Geelong West.
Harry, 0473 807 944, or geelonghistoricalsociety.org.au
Stamps
Geelong Philatelic Society Inc meets 7pm first Saturday of the month at Virginia Todd Community Hall, 9-15 Clarence Street, Geelong West and 1pm third Monday of the month at Belmont Library, 163 High Street, Belmont.
Julie, 0438 270 549
Scrabble club
Christ Church hall, corner Moorabool and McKillop Streets, 1pm Saturdays. Beginners to experts welcome.
Pauline, 0429 829 773, or John, 0434 142 282
Games
Scrabble, chess, board games or cards. Thursdays 2-4.30pm, All Saints’ Parish Hall, Newtown. Afternoon tea provided.
Dinah, 0418 547 753
Book club
Leopold CAE book club meets second Tuesday of each month 6.30pm.
Shirley, 0488 055 969
Sing Australia Geelong Choir Wednesdays 7.30-9.30pm at Senior Citizens Centre, 52 Thomson Street, Belmont. No auditions needed.
Mary, 0419 278 456
Mindfulness & meditation U3A
9.30am and 12.30pm Wednesdays, Cobbin Farm, Grove Road, Grovedale.
Jean, 5264 7484
Geelong Breakfast Lions
Morning club for those who want to help others, first Tuesday of each month at 8am, Eastern Hub (formerly Karingal) in East Geelong. Dinner somewhere in Geelong each month to suit members.
ajd53m@yahoo.com
Ocean Grove Seniors
Play 500 every Thursday at 1.15pm. Cost $20 annually and coffee included. 102 The
Corio Bay Lions Club Meetings
First and third Thursday of each month at 6.30pm.
geelongcoriobay.vic@lions.org.au
Belmont Seniors
Players wanted to play 500 each Monday 12.30pm. Belmont Senior Centre, 52 Thomson Street, Belmont.
5241 1776
Geelong Vietnam Veterans
Coffee and a chat at 31 Mt Pleasant Road, Belmont. Open Monday, Wednesday and Friday 10am-3pm. Fortnightly lunch at various locations. Meetings second Monday of each month.
Gary, 0400 862 727
Welcome mat
Belmont Uniting Church every Friday 10am-1pm. Games, lunch and friendship.
Fay, 0409 361 414
OMNI
Older Men New Ideas men’s friendly informal chat group, South Barwon Community Centre, 33 Mt Pleasant Road, Belmont, 2nd and 4th Wednesday of the month, 10.30am.
Terrace, Ocean Grove.
Lyn, 5256 2540
Scribes Writers Group
South Barwon Community Centre, Mondays 9.30am-noon. Welcoming new members who wish to refine their skills.
geelongscribeswriters@gmail.com, or 5243 8388
Ballroom dancing Belmont Park Pavilion, Thursdays 2-4 pm.
Val, 5251 3529
Kids’ church Group lessons for children aged three to six years; 7-10 years; and 10+ years at St Paul’s Anglican Church Hall, 171a Latrobe Terrace, Geelong, first Sunday of the month during school term, 10.30-11.30am.
Suzie, 0402 963 855, or Althea, 0403 005 449
Geelong Dragon Boat Club Paddle at Barwon River. Training Wednesdays 5pm, Saturdays 9am. Free one-month trial.
revolutionise.com.au/geelongdragons
Zonta Club of Geelong Meets monthly for dinner first Wednesday of the month between February and December at 6.30pm for a 6.45pm start. RSVP essential.
zontageelong.org.au or zontaclubgeelong@yahoo.com.au
Geelong Prostate Support Group Meets last Friday of the month (except December), 10am-noon, Belmont Park Pavilion, 162 Barrabool Road, Belmont. Bill, 0414 524 155, or info@geelongpsg.net
Geelong ballroom dancing Saturdays 7.30-10.15pm, corner Bayview Parade and Carey Street, Hamlyn Heights. Entry: $10. BYO drinks and a plate. Afternoon tea dance, Wednesdays 2-4pm. Teaching segment for a new dance 1.30-2pm
5278 9740, or geelongballroomdc.com.au
Alcoholics (and other addicts) For Christ 12 Steps Group Meets Thursdays 7.30pm at Belmont-Highton Baptist Church, 43 Mt Pleasant Road, Belmont.
0420 910 763
Allan, 0409 665 608
Lara Community Market Run by Rotary Club of Lara District every second Sunday of the month at Lara RSL 9am-1pm.
Geelong Amateur Radio Club
Storrer Street Clubhouse, Geelong, Wednesdays 1.30- 4pm and Fridays at 6.30pm.
Robert, 0438 409 979, or vk3atl.org
Choir
St Paul’s Choir rehearses Wednesdays 7.45-8.45pm and 9.30am Sunday for 10.30am service. Choral scholarships available. Occasional choir for those unable to make commitment to main choir.
Tom Healey, 0451 960 768, or healeytf@gmail.com
Bellydance classes
Beginner level, new term commencing. New students welcome. Tuesdays 1.30pm, Life Activities Club, Belmont Park Pavillion, Belmont.
Glenys, 0400 214 897
Austrian Club
Dance and Hahndorf music by Heidi and Herman, Sunday May 4, noon-5pm, free entry, Austrian Club, Sutcliffe Reserve, 240 Plantation Road, Corio.
Bookings: Karl, 0412 205 714
Geelong’s Soroptimist International Service club for women and girls, every second Tuesday of the month from 6pm at Belmont RSL.
0455 835 691, or geelong@siswp.com
Geelong Sports & Game Fishing Meets first and third Monday of the month at Belmont Park Pavilion, 7.30pm.
John, 0409 234 307
Combined Probus Belmont Central The Combined Probus Club of Belmont Central meets at 10am on the second Wednesday of each month at Waurn Ponds Hotel. Visitors welcome.
Secretary, 0417 555 547
Geelong Anglers Club Meets fourth Wednesday of the month at 7.30pm, 9 Yuille Street, Geelong West. Monthly fishing competitions.
Brian, 0417 190 092, or Ian, 0470 114 787
Thousands pay their respects
Independent photographer Ivan Kemp went to the mid-morning march and service in Geelong on Anzac Day when thousands turned out to pay their respects.
Air Force cadets. (Pictures: Ivan Kemp) 473073
Kelly and Samantha Cameron have been marching in honour of their late grandfather Col Cameron, a veteran of the Korean War for 30 years. They are joined this year by Jonah.
Members of the 8th/7th Battalion, Royal Victoria Regiment, Lieutenant Trent Timmers, Major Nick Arundell, Major Alex Ralton and Lieutenant Trelawney Dewe.
Jason Mears leading the Geelong West Brass Band.
Naval cadets from TS Barwon.
Still keeping ahead of the game
By Chris Riley, Marque Motoring
It’s amazing how the Toyota Corolla has evolved over the years.
Back in the day it was basic, vanilla transport and that’s the way it stayed for years.
Then someone, somewhere flipped a switch and things began to change dramatically, starting with the 11th gen Corolla in 2012.
But it was just a warm up for the current model which arrived in early 2018, with its complex, unrepentant, multi-faceted design.
Sittinglowerthanbeforewithasteeplyraked windscreen, it presents a predatory nose, with a designthatisasgoodasanythingfromEurope.
The long and short of it is that the company has been able to transform the image of the car from staid and conservative into something much more sporty with younger buyer appeal - and Corolla remains the best-selling cars in the world.
Styling
Corolla hatch starts from $30,630 for the AscentSport,$33,780fortheSX,$37,620forthe ZR - all with a 1.8-litre hybrid petrol-electric drivetrain and CVT automatic.
And, if the sporty ZR doesn’t float your boat, there’s also the high performance, all-wheel drive GR Corolla to consider.
But bring your money with you, because it’s a big hike in price: $67,990 in manual form or $70,490 with an automatic (before on-road costs). Two-tone paint adds $775 and is offered in combination with white, grey, red, silver and blue.
Our test vehicle, the ZR Hybrid hatch, is priced from $43,280 by the time you put it on the road in Sydney. The price varies a little depending on your address.
Finished in black over silver, the ZR looks stunning.
Standard kit includes 18-inch alloys, dual zone climate air and a combination of real and artificial suede trim, with heated sports seats up front with red accents and an eight-way, power-adjust driver seat with lumbar support.
There’s also a premium gear lever and steering wheel, smart entry and start, electric parking brake, adaptive cruise control, road sign recognition, auto lights and wipers, auto-dimming rear view mirror, front and rear parking sensors and rear privacy glass. In the lights department, it has auto high beam, bi-LED headlights, along with LED daytime, tail and front/rear fog lights.
ZR steps up to a full 12.3-inch digital instrument cluster along with windscreen head-up display.
Corolla comes with a five-year unlimited kilometre warranty.
Infotainment
Infotainment consists of an 8.0-inch touchscreen with premium JBL 8-speaker audio, plus Bluetooth, satellite navigation, AM/ FMandDAB+digitalradio,andwirelessApple CarPlay and wired Android Auto.
You also get 12 months of complimentary access with remote connect to Toyota Connect Services which automatically notifies emergency services in the event of an accident as well as provides remote access to the car.
There’s also a wireless charge pad, two USB-C ports and a 12 volt outlet in the front (but nothing for rear seat passengers).
Safety
Corolla has been awarded a full five stars for safety by ANCAP. It comes with a rear view camera, seven airbags including a driver knee airbag and autonomous emergency braking (City, Interurban & Vulnerable Road User) as well as lane keep assist (LKA) with lane departure warning (LDW).
An upgraded Toyota Safety Sense suite starts with the pre-collision safety system which adds motorcycle detection, intersection collision avoidance support for crossing vehicles and left/right turn, emergency steering assist and acceleration suppression at low speeds.
Cameras and radar sensors have also been
improved offering a wider range for detection of obstacles or vehicles.
Blind spot monitor has been added across the hatch range, while lane trace assist has been expanded to include the emergency driving stop system feature that has been designed to bring the vehicle to a gradual stop if it detects the driver is no longer making vehicle inputs.
The active cruise control system has also been enhanced and now offers four distance settings, the ability to detect other vehicles earlier, and the addition of deceleration assist when changing lanes.
But it misses out on auto reverse braking.
Isofix child restraint anchorage points are provided for the rear outboard seats.
Engines/transmissions
With the introduction of the upgraded fifth-generation hybrid powertrain, performance has been boosted with a 13kW increase in power to deliver a combined output of 103kW.
The upgraded hybrid teams a 1.8-litre petrol engine with a newly developed high-output motor generator, power control unit and downsized hybrid transaxle.
The front, axle-mounted drive motor has been enhanced by doubling the number of magnets per pole inside the rotor, while the newly developed lithium-ion battery reduces weight by 14 per cent while increasing both input and output power.
Thehybriddrivesthefrontwheelsexclusively via a continuously variable transmission (CVT).
Driving Corolla’s low stance and wind-cheating profile places the car quite close to the ground. As a result,itcanmakegettinginandoutdifficultat timesanditmeansdrivewaysandspeedhumps also need to be approached with caution, as the low front apron is prone to scraping.
Sports seats with bolstered sides add to the difficulty. The sloping rear roof line also makes entry to the back seat more difficult than it probably should be and you might find it a little cramped once you’re in.
The boot gains some extra space, with a puncture kit instead of a spare tyre to make room for the hybrid battery pack.
Of note Corolla’s cousin the Lexus UX scores a larger 2.0-litre engine as the basis for its hybrid that produces a combined 146kW.
Putting the transmission of the hybrid in Power mode delivers more satisfying throttle response, with a turn of speed thanks to the boost from the electric motor. But make sure you don’t pull the transmission lever back all the way or you’ll find yourself in B instead of D, which is regenerative braking mode.
It doesn’t recognise electronic speed signs, nordoesitdifferentiatebetweenstandardsigns, timed school zones or bus and truck advisory
speed - so until it encounters a real speed sign it could be telling you fibs.
RATINGS
Looks: 8.5
Performance: 7
Safety: 7.5
Thirst: 8
Practicality: 7.5
Comfort: 7
Tech: 8
Value: 7.5
Overall: 7.6
Steering is sharp and the hatch corners flat and hard, but the ride is overly harsh and the cabin can become quite noisy depending on the surface.
Toyota does not permit operation of the satellite navigation system while the car is in motion.
It’s super annoying, but you have to be in park with the handbrake activated. And that means pulling over and spending precious minutes on the task.
Sluggish response from the touchscreen makes the task that much more difficult.
You can bang in the name of a street only to look up and discover it failed to recognise the first letter and that means starting over.
Of course, you could try appealing to the car’s voice activation system, but that’s an even more frustrating experience.
At the end of the day the hybrid is all about economy and this is where the Corolla excels.
Rated at 4.0L/100km, we were getting 5.2L after almost 400km of mixed driving.
Summing up
You can’t really go wrong with the Corolla ZR hybrid hatch, but it commands a steeper price these days at more than $43K on the road. There’s no longer a petrol model to distract buyers, but the hybrid powertrain provides immediate, accessible, no frills fuel savings to the average motorist, with no need for user intervention.
Beware the low ride height however which makes entry and exit more difficult than you might think.
You can’t really go wrong with the Corolla ZR hybrid hatch. (Pictures: Supplied)
Anzac Day footy in Geelong
Independent photographer Ivan Kemp was at McDonald Reserve, Belmont on Anzac Day to see St Joseph’s and South Barwon play a titanic game in the rain.
South Barwon skipper Matt Caldow flies high in a marking contest, and below, James Hose kicks under pressure.
Jack Driver puts a solid tackle on Joel Edwards.
Eddy McCoy and Ben Kellett compete in the ruck.
James Hickey gathers the ball. (Pictures: Ivan Kemp) 473877
Keelin Betson gets a handball away.
Joel O’Dwyer handballs under pressure from Matt Caldow.
James Gow marks.
Lewis Antonac strides forward.
Paddy Bourke takes a chest mark mark, and right, Jack Driver receives some attention from Cooper Ward after taking a mark.
Joeys win on Anzac Day
It was a wet Anzac Day clash between South Barwon and St Joseph’s at McDonald Reserve, Belmont, but Independent photographer Ivan Kemp braved the conditions to get these photos. Joeys won the game 39 to 27.
Left to right: Georgette Paatsch was one of Joeys’ best; Monique Parker gains control; Ella Closter shoots one of her 31 goals; Eloise Maddox passes out of defence for South Barwon. (Pictures: Ivan Kemp) 473880
Olivia Cameron takes a possession, and right, Georgia Corbett throws a long pass.
Ashleigh Berman with the ball.
Tori Honner was best for St Joseph’s.
Georgia Corbett races through the centre.
Emily Post jumps for the ball.
Maddison McKiernan in front position.
Elli Leydon in midcourt.
Chris Fowler wins Australian title
By Dean Thompson
Geelong’s Chris Fowler has been crowned Australian Grand Prix Midget Racing Association champion for the first time in his career.
Qualifying in pole position for the title at Wahgunyah was Alex Myers with Fowler, Gary Bowyer, Gavin Black, Adam Buckley, Matt Kamolins, Daniel Meredith, Locky Robotham, Paul Perry, Travis Florrimell, Riley Bowyer, Johnny Rouse, Shawn Ward, Dylan Lees, Terry Brown, Wayne Harrison-Watt and Mark Cecil completing the lineup for the 20-lap title distance.
Myers was the first to lead a lap with Fowler, Black, Bowyer, Buckley and Paul Perry the top six. Black would pass Fowler on lap two into second spot and Perry would be the first to come a cropper on lap four when he spun whilst in his six spot, sending him way back to 13th the next time he passed around.
On lap four Black would move to the lead of the race and Kamolins moved into the sixth spot vacated by Perry.
At the half way point of the race Black,
Myers, Bowyer, Fowler and Buckley was the race order whilst Bowyer would spin on lap 10 and Meredith a lap later would start to have temperature issues when the water hose let go and he exited infield, whilst Bowyer also suffered a spin.
Robotham’s clutch gave up and his car exited the race on lap 12 with Fowler now back in third,Buckleyfourth,andRileyBowyerinfifth despite his spin.
On lap 13 Fowler moved to the second spot behind Black with Myers back to third before dropping another spot-on lap 14 to fourth and then three more positions on lap 15 settling into seventh spot.
Buckley moved into third with dramas plaguing the Myers car, and at the chequered flag Black crossed the line ahead of Fowler.
Post-race scrutineering found that Black’s rear wing was sitting too high and outside the rules and was disqualified.
Victorian champion Fowler became the new Australia one driver with Buckley second and Kamolins third.
“I would like to take this opportunity firstly and foremost to thank my father John for all
the work, time, and effort he has done to get the car to where it is now so very consistent in its performance,” Fowler said. “Also to Danny Stainer for building the car and his help and
Three rounds to go before the finals
LOCAL TENNIS
Donna Schoenmaekers
Despite doubts about whether play would go ahead even up to an hour before start time, TuesdayWomen’sRound11wentaheadinwhat turned out to be beautiful autumn conditions.
In Section 2 there is still plenty to play for, with just three rounds to go before finals, and all teams still with the possibility of making finals.
Aireys Inlet (3rd) and Moolap (4th) were only separated on percentage going into this week’s match and Moolap travelled down the coast on a wet and miserable looking morning to find the courts damp but playable. Moolap secured a 5-1 win at home in the round 4 clash, but Aireys turned the tables, comfortably at home winning five sets to one, maintaining their position on Surfcoast Torquay Yellow, only two points ahead.
Torquay Yellow made the trip to Highton to face seventh placed Gold team and maintained their place on the ladder, with a 5-1 win. Gold challengedYellowwithclose7-6and6-4losses, but Torquay were too strong on the day.
Ladder leaders Point Lonsdale were the third team to win 5-1, in their away match to Surfcoast Torquay White, with the scoreline matchingtheround4encounteralmostexactly.
The Ladies from Lonny put on a consistent performance, ensuring they maintained top spot and placing them well with two of the top four to play in the final three rounds.
The closest match of the day was fifth placed Barwon Heads hosting eighth placed Highton Blue, on the blue courts under blue skies. In their round 4 meeting, Highton managed to
scrape through by one game, so this week’s meeting was also expected to be close.
The teams split the first two sets with Julie Toner and Emma Webb winning the first for the home team 6-2, while Sue Pickering and Belinda Murphy battled though in a tie-break for Highton.
Highton took the lead winning the third and fourth sets 6-2, 7-6, before Pickering hurt her knee in the first game of the sixth set and was unable to continue. Highton battled in the fifth set, but the Heads’ Toner with Shelley Sutton proved too strong winning 7-5, taking the win
by six games.
Sutton and Murphy had an enduring match up across the morning with all three of their sets going to seven. Despite the loss, the three sets pushed Blue from eighth to sixth, with a slim but possible chance of still making finals with Torquay White, Aireys Inlet and Moolap left to play.
With many of the top four still left to play each other, there is still plenty of opportunity for position changes within and from outside the four. All teams will need to earn their finals positions and time will tell who will.
Come and try day at Belmont Croquet Club
Belmont Croquet Club is gearing up for World Croquet Day on Saturday May 3. Belmont Croquet Club always organises an eventandthisyeartheyareagainopeningtheir courts to the public and it is being supported by a City of Greater Geelong Healthy and Connected Community Grant which provided funds for purchase of signage and light refreshments.
The club punches above its weight with life member Stephen Forster, Croquet Australia 2025 Hall of Fame inductee and International Player who is ranked No 30 in the world.
For more than 119 years, croquet has been played in Geelong with many local identities
adding to its rich history.
Upon arrival you will be greeted by club promotions office Janelle Morris, who will guide you through the basic rules.
Croquet is a low impact sport for all ages, relying on precision, skill and strategy –sometimes referred to as ‘billiards on grass’.
Historically, croquet was one of the first sports where men and women competed together – this was reflected in the 1900 Paris Olympic where croquet was first included.
World Croquet Day was established by the World Croquet Federation to celebrate the sport globally with a variety of engaging activities that aim to bring people together and
promote the sport.
The exact year of the WCF inception is not clearly documented, but it has been instrumentalinorganisingeventsandfostering international participation in croquet since its formation in 1985, although the game was originally commercialised in the 1850s.
Belmont Croquet Club’s event is at Francis Street Reserve, Belmont on Saturday May 3 from 10am to 2pm. Equipment and light refreshments supplied.
advice ever since we got the car from Danny and Ross. I am disappointed for Gavin and believe he made an honest set up error and look forward to racing with him again soon.”
Cats claw way back to Div 1
Lara’s demotion to Geelong Cricket Association’s second division lasted just one season with the club granted promotion back to the competition’s top flight in 2025/26.
The Cats won four flags after being relegated last season and will replace Highton in Division despite the Heat playing finals this season.
A GCA committee assesses all clubs’ performance on and off the field at the conclusion of each season. Factors are taken into account over a rolling two-year average.
Points are given for wins, wicket maintenance and gender equality on committees. Clubs can also lose points for noncompliance, penalised players and slow over rates.
Murgheboluc has been demoted from Division 2 despite playing in the first grade grand final, which is lost to Lara. Taking the Frogs’ place is Alexander Thomson.
Murgheboluc’s three other senior teams finished on the bottom of their respective ladders.
Lethbridge will play in Division 3 next season while Manifold Heights was relegated to Division 4. North Geelong had the highest rolling average of 82.55 points with Teesdale the lowest on 29.96.
Chris Fowler on the dias after his Australian Grand Prix Midget Racing Association title.
(Noah Thorley Images)
Janelle Morris will welcome you to Belmont Croquet Club’s big event. (Ivan Kemp) 404148_01
TW2 Highton Blue: Sarah Hall, Belinda Murphy, Lisa Dowling, Sue Pickering.
Joeys outlast Swans in the wet
By Justin Flynn
St Joseph’s emerged triumphant after an absorbing contest against South Barwon at McDonald Reserve, Belmont on Anzac Day.
Joeys’ forward line handled the wet conditions brilliantly with Oscar Morrison booting four goals and Hunter Lewis three in a low-scoring game.
St Joseph’s booted three goals to one in the finaltermtorunout9.8(62)to6.15(51)winners.
Joeys coach Ron Watt was pleased with the way his side ran out the game after leading by just two points at the final change.
“Extremely proud of the contest that they brought, just being able to stick to a pretty simple formula across the day,” Watt told krockfootball.live after the match.
“Compete hard but set themselves into the right spots especially when challenged (to) be able to stand up.”
The versatility of Watt’s team was on show.
“Probably the three years I’ve been coaching we’vealwaysmadesurepeoplecanplayacouple ofdifferentpositionsbecauseifsomething’snot working for them, they’ve got to be able to go to something else and you don’t want to have a terrible day if you start with a bad day,” he said.
“It’s important to have flexibility and we probably had Liam Betson who could have played in the ruck today and we could have put Morrison down back or (Zac) Knights could have played full back.
“Knights finished up playing as a defender but came onto the ground as a midfielder at the start of the game.
“We’re lucky that we can throw things around but we have to be careful that we don’t try to get too creative and inventive and just let players settle a bit.”
It wasn’t all good news for St Joseph’s,
however. Jack Mullen tore a hamstring and will miss several weeks.
“That was the worst hamstring injury I’ve seen for a long time,” Watt said.
“He’s been our best forward this year and he really developed into that running forward role over the last 18 months.
“We’ll find it hard to replace him but it gives some other guys an opportunity to play.”
WattsaidOliverHanneysee“probablywould have been next cab off the rank” to replace Mullen, but he too suffered a hamstring injury in the reserves match.
Joeys’ skipper Alex Hickey was his usual consistent self while Josh Nurnaitas played well. Watt said Nurnaitas is a “hard little unit”.
South Barwon will take a lot of positives
from the game.
Fraser Fort booted two goals and loomed as a danger man all day while ruckman Ben Kellett and star midfielder Doyle Madigan were superb.
Geelong West won an absorbing contest against St Albans, 11.14(80) to 10.13(73).
Both sides can look forward to the rest of the season and look to be in good positions going forward. But it was the Giants, through Lachie Horniblow’s five goals, that prevailed. Tom Higgins kicked four for the Supersaints.
Bell Park got onto the winner’s list with a 25.24(174) to 2.2(14) win against North Shore.
North Warrnambool recruit Jett Birmingham was brilliant for the Dragons while skipper Jacob Sammut-Milijevic was best for the
Seagulls, who despite the scoreboard, had their moments.
StMary’smadeastatementwithan18.16(124) to 8.8(56) win against Newtown & Chilwell. Michael Rudd booted three majors and was bestforStMary’swhileformerKyabramyoung gun Mitchell Dodos was best for the Eagles. Leopold showed that it will be thereabouts again with a 21.8(134) to 8.10(58) win against Colac. Midfielders Tate Porter and Marcus Thompson ran riot while Billy Ritchie and Will Howard each booted four goals. Grovedale ran right over the top of Lara to win 24.13(157) to 6.1(37). Joe McCarthy was best for the Tigers and Leigh Ellis booted five goals while Darby Henderson starred through the midfield for the Cats.
Redemption not a factor for St Joseph’s says coach
St Joseph’s coach Riley Richardson said redemption for last year’s Geelong Netball League grand final loss was not in the forefront of his players’ minds.
Joeys lost a tight grand final to Newtown & Chilwell last year, but put four good quarters together to defeat South Barwon, 39 to 27, on Anzac Day.
“We’re really eager to make sure that we stick to our process during the year and we’re confident that if we work on our game and we trytoimprovethingswithinourownstrategies like combinations and different styles of play, we’re confident that we will get the outcome.”
Still, Richardson was not shying away that the ultimate goal was a flag, even though the process was perhaps more important.
“I think the ultimate success is obviously a premiership, but for us it truly is about process,” he said.
“It’s about creating a culture where you can really foster an environment where players feel confident within themselves. Coaching with Tracy Howard this year, we really share that philosophy that we want our players to feel really empowered to make decisions on court.
“Sowewantthemtofeelthatonanindividual level, that we trust everyone within our team to come out on court and play their role, whether theystartonthebenchorwhethertheystarton court and we want them learning new things as well. Those are the things that are really important to us and we’re confident that if we can uphold that then each week we will play well and hopefully get our outcome.”
Co-captain Tori Honner was again instrumentalagainsttheSwansatgoaldefence.
“She’s an incredible leader on and off the court,” Richardson said.
“But you do particularly notice that she
really coordinates that defensive line up and then leads by example in bringing that ball out of attack.”
Last season Joeys shifted Georgette Paatsch to attack, but the recruitment of Ella Closter from Darley has enabled Paatsch to move back to defence.
Richardson said his team adjusted well to Friday’s wet conditions.
“Adaptingtotheconditionswasprobablythe biggest thing,” he said.
“And continuing to play our style of game. South always play a really physical game. They challenge the ball really fiercely.
“And I think we made a point if there were
penalties to just take them and get on with it.
And we managed to put together a really solid lead as a result of that.”
St Joseph’s takes on Bell Park this weekend. TheDragonshavewontwogamesandarefresh from a bye.
“We take each week as a new challenge and we’re always eager to put our best netball out there,” Richardson said.
“Bell Park have recruited really well and they’resortofperenniallywithinreachoffinals. So they’re certainly not to be underestimated.”
Geelong West racked up a mammoth 104 goals against St Albans to win by 80. Charlie Hoey was superb in defence for the Giants.
Leopold defeated Colac
Newtown
while Isabelle Grapsas was lively for the Saints. Grovedale came away from Lara with a 58 to 45 victory. Wing attack Taylar Borg played well and Morgan Byrne was solid in defence. Caitlin Hendricksen was excellent in defence for the Cats.
68 to 53 with midcourter Darcy Wilson in form while wing attack Amelia Holland and Natalie Heagney (46 goals) were also prominent.
& Chilwell goalers Mikaela Vaughan and Julia Woolley spearheaded their side’s 62 to 33 win against St Mary’s
Justin Flynn
Left: Larni Howard looks to pass out of defence. Right: Tori Honner races through the centre. (Pictures: Ivan Kemp) 473880
Left: Oscar Morrison marks and kicks one of his four goals for St Joseph’s. Right: Josh Nurnaitis gets his kick away. (Pictures Ivan Kemp) 473877
