Page 1

Your source for community news and sports 7 days a week.

BREAKING DOWN THE SECOND ROUND

Health care is already unnecessarily complex

PREP FOOTBALL, B2

OUT HERE, A3

TELEGRAPH

Tuesday, November 12, 2013

SERVING DIXON AND THE SURROUNDING AREA SINCE 1851

DIXON | THE CRUNDWELL AFTERMATH

Tax relief would stress city Lowering property taxes could set city back years, finance director says BY MATT MENCARINI mmencarini@saukvalley.com 800-798-4085, ext. 529

DIXON – With $40 million in settlement money, Dixon could decide to lower property taxes, as many residents have suggested, but doing so might not be best for the city’s financial future. The idea was suggested during an October town hall meet-

ing, which sought residents’ suggestions about what the city should do with money it will recover from an out-of-court settlement and sold assets from Rita Crundwell’s estate. In total, Dixon will receive about $29.7 million – after legal fees – from the settlement reached in September with its former auditors and bank. Additionally, the city expects

about $9.2 million from the sale of Crundwell’s assets. Because of the Property Tax Extension Limitation Law – also known as the tax cap – Dixon is limited in how much it can raise its tax rate each year, by the lesser of either 5 percent or the change in the Consumer Price Index, Meyer said in an interview last week. The CPI change in 2010, 2011

and 2012 was 1.6, 3.2 and 2.1 percent, respectively, meaning that Dixon could have raised property taxes by, at most, 3.2 percent in the past 3 years. Lowering the city’s property tax levy is a possibility, Finance Director Paula Meyer said, but not something she recommends. Doing so would set the city back, depending on how much rates were lowered, any-

where from 6 to 233 years in terms of revenue, she added. If the property taxes were reduced by 10, 50 or even 99 percent for just one year, the next year the city couldn’t immediately return to the previous year’s rate, Meyer said. It could increase the reduced rate by only 5 percent or the CPI change. TAX CONTINUED ON A2

VETERANS DAY IN THE SAUK VALLEY

‘Our nation will always be grateful’ WWI plaque dedicated at Dixon’s Veterans Memorial Park BY MATT MENCARINI mmencarini@saukvalley.com 800-798-4085, ext. 529

Alex T. Paschal/apaschal@saukvalley.com

Dick Herbon reads a list of 49 names of Lee County soldiers who died in service during World War I. The Lee County Genealogical Society donated a plaque to Veterans Memorial Park in Dixon that was unveiled Monday. The plaque, inscribed with the names, was dedicated during a Veterans Day ceremony. More photos from area ceremonies are on Pages A10-11.

Rock Falls speaker puts a spotlight on suicide BY DAVID GIULIANI dgiuliani@saukvalley.com 800-798-4085, ext. 525

ROCK FALLS – A Veterans Day ceremony Monday in Rock Falls had the usual features – an honor guard, flags, taps and a gun salute. But it included something new – a focus on veterans who suffer from depression. Randy Wolber, commander of American Legion Post 902, informed a crowd of about 50 people that more veterans are dying because of suicide than those killed by the enemy.

$1.00

TODAY’S EDITION: 24 PAGES 2 SECTIONS VOL. 163 ISSUE 137

In 2010, according to a Veterans Affairs report, 22 veterans died each day by suicide. Wolber urged veterans to get help from the VA or the American Legion if they’re suffering from depression or other mental illnesses. One way to combat such problems, he said, is to let veterans know they are appreciated. In an interview afterward, Wolber, a Vietnam veteran, said he was surprised by the statistic. SUICIDE CONTINUED ON A11

INDEX

BUSINESS ......... A12 COMICS ............... A9 CROSSWORD....B12

Philip Marruffo/pmarruffo@saukvalley.com

Rock Falls American Legion Post 902 Commander Randy Wolber reads a letter from Rock Falls Middle School sixthgraders Monday morning during a Veterans Day ceremony at Veterans Memorial Park. During his speech, Wolber urged veterans who are suffering from depression to get help from Veterans Affairs or the American Legion.

DEAR ABBY ......... A8 LIFESTYLE ........... A7 LOTTERY ............. A2

OBITUARIES ........ A4 OPINION .............. A6 SPORTS ...............B1

DIXON – A light rain began to fall on the nearly 100 people who gathered at Veterans Memorial Park on Monday morning, the site of Dixon’s Veterans Day observance. Like other gatherings throughout the country Monday, there was a singing of the national anthem, playing of taps and a 21-gun salute, in addition to speeches from military personnel, veterans and elected officials. State Sen. Tim Bivins, R-Dixon, told the crowd he saw a fitting tribute in the wet, cold weather, saying that those who served lived and trained in such weather. Maj. Gen. Michael Robert Smith, who is stationed at the Rock Island Arsenal, gave the Veterans Day address. He called for awareness of the nearly 50,000 American military personnel currently stationed in Afghanistan and “thousands more throughout the world.” “On this Veterans Day, let us pause to reflect the sacrifices of all who have put on the uniform to serve in the military,” he said. “From Bunker Hill, during our Revolutionary War, to the treacherous mountains of Afghanistan, there is a long, gray line – or rather a camouflaged line – of service members who have stepped into the breach, during our nation’s hour of need, and did their duty.” More than a million Americans have died while serving in the military, Smith said, and more than 1.5 million have been wounded, some with lasting disabilities. “Our nation will always be grateful for the noble sacrifice made by these veterans,” he said. DEDICATED CONTINUED ON A11

Today’s weather High 33. Low 15. More on A3.

Need work? Check out your classifieds, B6.

TO SUBSCRIBE TO THE PAPER, CALL 815-284-2224 OR 800-798-4085


!s4ELEGRAPH

WWWSAUKVALLEYCOM

COMMUNITY WATCH Were we in

ERROR? Getting it right 7ECAREABOUTACCURACY ANDWEWANTTO CORRECTERRORSPROMPTLY 0LEASECALLMISTAKESTOOUR ATTENTIONAT   OR   EXT OR Corrections 4OURSOFTHE0!$3 (OMELESS3HELTER  7&IRST3TIN$IXON ARE FROMTOPM&RIDAY DURINGTHE/NE.IGHT 7ITHOUTA(OMEEVENT 4HETIMEWASLISTEDINCORRECTLYON0AGE#OF 3ATURDAYS367EEKEND 4HEREALSOWASANERROR INTHEEMAILADDRESS FOR6ANESSA7HITEITIS WHITEVA YAHOOCOM !STORYABOUTMOTORCYCLESAFETYIN3ATURDAYSEDITIONSHOULD HAVEREPORTEDTHAT"RIAN 3CHRIMPFWASWHEN HEDIEDAFTERACARSTRUCK HISMOTORCYCLEON%AST ,INCOLNWAYIN3TERLING (ISAGEWASINCORRECTIN THESTORY 7EREGRETTHEERRORS

Fred Fargher  OF 3TERLINGPM3UNDAY INBLOCKATALLEYWAY OF%IGHTHAND.INTHAVENUESDRIVINGWHILELICENSE SUSPENDED NOSEATBELT nDRIVERGIVENNOTICETO APPEARINCOURT!RRESTED ATTHESAMETIMEWERE Faith Y. Fargher  OF 2OCK&ALLS ANDMichael A. Devore  OF3TERLING EACHWASCHARGEDWITH NOSEATBELTnPASSENGER EACHPOSTEDADRIVERS LICENSEASBOND Jordan V. Nares  OF 3TERLINGPM3UNDAY INBLOCKOF!VENUE% 7HITESIDE#OUNTYWARRANTFOR VIOLATIONOFPROBATIONPOSTED BOND Tyler S. Shaw-Sodaro  OF3TERLINGPM 3UNDAYAT3TERLING0OLICE $EPARTMENT7HITESIDE #OUNTYWARRANTFORFAILURE TOAPPEARONACHARGEOF OPERATINGUNINSUREDVEHICLE POSTEDBOND Joseph S. Lira  OF 3TERLINGPM3UNDAY AT!VENUE$AND7EST3EVENTH3TREETFAILURETOYIELD GIVENNOTICETOAPPEARIN COURT

Rock Falls Police

Joshua L. Jones  OF 0OLOAM7EDNESDAYTWOFELONYCOUNTSOF POSSESSIONOFAWEAPON BYAFELONTAKENTO/GLE #OUNTY*AIL Aimee J. Larkin  OF 3OUTH"ELOITAM 7EDNESDAYPOSSESSIONOF DRUGPARAPHERNALIATAKENTO /GLE#OUNTY*AIL Donald E. Sanders Jr.  OF0OLOPM 7EDNESDAYBATTERYISSUED ) BONDANDRELEASED Raymond A. Weil  OF $IXONPM4HURSDAY /GLE#OUNTYWARRANTFOR SPEEDINGTAKENTO/GLE #OUNTY*AIL

Ogle County Sheriff Iris I. Estrada  OF /REGON-ONDAYWARRANT FORRECKLESSDRIVINGTAKENTO /GLE#OUNTY*AILANDHELDIN LIEUOFBOND Scott J. Nuxoll  OF $E+ALBPM&RIDAYINTHEBLOCKOF 7OODLAWN2OADDRIVING WHILELICENSESUSPENDED NOINSURANCE EXPIREDSUSPENDEDREGISTRATIONTAKEN TO/GLE#OUNTY*AILANDHELD INLIEUOFBOND ANDISSUED CITATIONS Luis S. Sanchez  OF 2OCKFORDAM3ATURDAYONSTATE2OUTE DRIVINGUNDERTHEINFLUENCEOF ALCOHOL FAILURETOREPORTAN ACCIDENT FAILURETOREDUCE SPEEDTOAVOIDANACCIDENT DRIVINGONTHESHOULDER NOSEATBELTTAKENTO/GLE #OUNTY*AILANDHELDINLIEU OFBOND ANDISSUEDCITATIONS Jordan Zobal  OF $AVIS*UNCTIONAM 3UNDAYONSTATE2OUTE OUTSTANDING"OONE#OUNTY WARRANTTAKENTO/GLE #OUNTY*AILANDHELDINLIEU OFBOND

BIRTHDAYS

LOTTERY NUMBERS My 3 Midday:    My 3 Evening:    Pick Three-Midday:   &IREBALL.ONE Pick Three-Evening:   &IREBALL.ONE Pick Four-Midday:    &IREBALL.ONE

Pick Four-Evening:    &IREBALL.ONE Lucky Day Lotto Midday:      Lucky Day Lotto Evening:      Lotto:       %XTRASHOT

Estimated Lotto jackpot: MILLION Estimated Mega Millions jackpot: $MILLION Estimated Powerball jackpot: MILLION

IN BRIEF Dow average at another new high .%79/2+!0 n4HE $OW*ONESINDUSTRIALAVERAGEROSETOANOTHERALL TIME HIGH-ONDAYON7ALL3TREET 4HEMARKETEDGEDHIGHER FROM&RIDAY WHENITGOTA LIFTFROMANUNEXPECTEDLY FREE KITCHEN DESIGNS BY Jocelyn Lilly, Kitchen Design: 815-266-1354

Ask about our FREE Upgrade Special MILLEDGEVILLE DO-IT-BEST HOME CENTER

'SFF &TUJNBUFT t 'SFF .FBTVSJOH t 'SFF %FMJWFSZ

Bring the Beauty of StarMark into Your Home. 3BJMSPBE BOE $PDISBO 4USFFUT .JMMFEHFWJMMF *   UPMM GSFF

STRONG53JOBSREPORTFOR /CTOBER4HESURGEINHIRING MADEINVESTORSMOREOPTIMISTICTHATTHE53ECONOMYISGETTINGSTRONGER 3TOCKTRADINGVOLUME WASAMONGTHELOWESTOF THEYEAR ANDBONDMARKETSWERECLOSEDFOR6ETERANS$AY

MOVING?

Get FREE truck rental rate quotes at Prescott Inc.

463 s !PPLIANCES s -ATTRESSES

3610 % ,).#/,.7!9 s 34%2,).' ),

815-626-2996

RIFLE SALUTE IN OREGON

Polo Police

Douglas Buyers  OF2OCK&ALLSAM .OVDRIVINGWHILE LICENSESUSPENDED OPERATSterling Police INGUNINSUREDMOTORVEHIJose C. Hernandez Cana- CLEPOSTEDDRIVERSLICENSE les  OF2OCK&ALLS ASBOND AM3UNDAYAT%AST&OURTH Ashley Lavalley  OF 3TREETANDTH!VENUENO 4AMPICOAM3ATINSURANCE SPEEDINGGIVEN URDAYWARRANTFORFAILURETO NOTICETOAPPEARINCOURT APPEARONACHARGEOFUNINRichard A. Brauer  OF SUREDMOTORVEHICLEPOSTED 3TERLINGAM3UNDAY BONDANDWASRELEASED AT%AST&OURTH3TREETAND Alyssa Kahly  OF TH!VENUEDRIVINGWHILE $IXONPM&RIDAYNO LICENSESUSPENDED 7HIVALIDDRIVERSLICENSE SPEEDTESIDE#OUNTYWARRANTFOR INGGIVENNOTICETOAPPEAR FAILURETOAPPEARONACHARGE INCOURT OFDRIVINGWHILELICENSESUSSamantha Sliger  PENDED ,EE#OUNTYWARRANT OF2OCK&ALLSAM FORCONTEMPTTAKENTO7HI4HURSDAYPOSSESSIONOF TESIDE#OUNTY*AIL ACONTROLLEDSUBSTANCE Christina A. Crady  POSSESSIONOFPRESCRIPTION OF2OCK&ALLSPM DRUGSWITHOUTPRESCRIPTION 3UNDAYAT%AST4HIRD3TREET RESISTINGARREST DRIVINGUNDER (APPYBIRTHDAYTO4ERI ANDTH!VENUENOINSUR-C#ORMICK *ACK+ELEHER THEINFLUENCE DRIVINGWHILE ANCEGIVENNOTICETOAPEPAR REVOKEDTAKENTO7HITESIDE *USTIN(AAG AND'ENE INCOURT (ARDY ALLTODAY #OUNTY*AIL

FIRE & POLICE

4UESDAY .OVEMBER 

Chris Johnson/Shaw News Service

The American Legion and Veterans of Foreign Wars Post 8739 Firing Squad perform a rifle salute during the Veterans Day program Monday at the VFW in Oregon. Squad members are Stan Eden, Gene Frericks, Garry Myers and Ken Williams.

Where were you when you heard? !TONETIME ITWAS0EARL(ARBOR )NMORERECENTYEARS ITWAS "UTFORADIFFERENTGENERATION ITWASTHEASSASSINATIONOF0RESIDENT*OHN&+ENNEDYON.OV  IN$ALLAS 3AUK6ALLEY-EDIAWILLPUBLISHAPACKAGEOFSTORIESINLATE.OVEMBERINOBSERVANCEOFTHETHANNIVERSARYOFTHATNATIONALTRAGEDY 7EWOULDLIKETOHEARREADERSRECOLLECTIONSOFWHERETHEYWERE WHATTHEYWERE DOING ANDHOWTHEYREACTEDWHENTHEYFIRSTHEARDTHEPRESIDENTHADBEENSHOT 9OUAREINVITEDTOSHAREYOURMEMORIES INWORDSORLESS BYSENDINGANEMAIL SLUGLINE*&+ TONEWS SAUKVALLEYCOMORALETTERTO*&+-EMORIES %,INCOLNWAY 0/"OX 3TERLING ),9OUMAYALSOTAKEWHATYOUWRITETOTHE36- OFFICEIN$IXONOR3TERLING0LEASEINCLUDEYOURNAME ADDRESSANDAPHONENUMBER 3UBMISSIONDEADLINEISPM&RIDAY

Some settlement money already allocated TAX

CONTINUED FROM A1

The years it would take for the city to return to the 2012 tax rate, she said, would put the city in poor financial standing. If the city were to lower property taxes by 10 percent, based on the 2012 tax rate and equalized assessed value of Dixon homes, it would lose $706,070 and take the city 6 years to get the tax rate back to the level in 2012, Meyer said. If property taxes were lowered by 50 percent, Meyer said, the city would lose out on $22.8 million and take 36 years to return to the 2012 tax rate.

Phone and Internet Discounts Available to CenturyLink Customers The Illinois Commerce Commission designated CenturyLink as an Eligible Telecommunications Carrier within its service area for universal service purposes. CenturyLink’s basic local service rates for residential voice lines are $14.95 per month and business services are $19.00 per month. Specific rates will be provided upon request. CenturyLink participates in a government benefit program (Lifeline) to make residential telephone service more affordable to eligible low-income individuals and families. Eligible customers are those that meet eligibility standards as defined by the FCC and state commissions. Residents who live on federally recognized Tribal Lands may qualify for additional Tribal benefits if they participate in certain additional federal eligibility programs. The Lifeline discount is available for only one telephone per household, which can be either a wireline or wireless telephone. A household is defined for the purposes of the Lifeline program as any individual or group of individuals who live together at the same address and share income and expenses. Lifeline service is not transferable, and only eligible consumers may enroll in the program. Consumers who willfully make false statements in order to obtain Lifeline telephone service can be punished by fine or imprisonment and can be barred from the program. Lifeline eligible subscribers may also qualify for reliable home High-Speed Internet service up to 1.5 Mbps for $9.95* per month for the first 12 months of service. Further details are available at centurylink.com/internetbasics.

TIME FOR CHANGE?

If you live in a CenturyLink service area, please call 1-855-954-6546 or visit centurylink.com/lifeline with questions or to request an application for the Lifeline program.

Lowering the tax rate by 99 percent would amount in $418 million in lost revenue, Meyer said, and take the city 233 years to return to the 2012 rate. Instead of lowering property taxes, Meyer has suggested that the city pay down its internal and external debt, as well as setting aside some money and investing in capital projects, which could keep sewer rates, for example, lower in the future.

Chocolicious CHRISTMAS Open House Nov 15 s 5-8pm, Nov 16 s 9am-3pm, Nov 17 s 11am-3pm

SILK FLORALS, ANTIQUES & CHOCOLATE TREATS

Ramp up the Luxury with Chocolate Treats by Beth Jordan of Lindt Chocolates, 3IZMV 3VIKSÂź[ .IUW][ +PWKWTI\M Cheesecake, Gift Baskets & More!

SEE CYNTHIA TODAY! CYNTHIA ADCOCK

815-677-0934

815-285-2444 124 E. Boyd St., Dixon

20% of all proceeds go to Wounded Warriors

E 1st St, Dixon Dixon Floral, Inc. 116815-288-2246 For information on newspaper subscriptions, classified advertisements, display advertisements or billing please dial: 815-284-2222 or 1-800-798-4085 Fax 815-625-9390 www.saukvalley.com

TELEGRAPH Founded in 1851 (USPS 158-860)

The B.F. Shaw Printing Co., 113-115 Peoria Ave., Dixon, IL 61021 Ernest Appleyard .......................................................Production Coordinator Jennifer Baratta ...............................................................Advertising Director Kris Boggs ......................................................................... Human Resources Randy Jacobs ..........................................................................Press Foreman Ed Bushman ....................................................... Telegraph General Manager Joanne Doherty .................................................................... Finance Director Sheryl Gulbranson ............................................................Circulation Director Larry Lough............................................................................Executive Editor Trevis Mayfield .................................................................................. Publisher Jeff Rogers ........................................................................... Managing Editor

NOTICE TO SUBSCRIBERS Home delivery subscribers should know their carrier and keep his/her telephone number handy. Call your carrier if you are missed and he or she will bring a copy immediately. If you cannot reach your carrier call The Telegraph at (815) 284-2222 or 1-800-798-4085 from 6:00 a.m. to 5:30 p.m. Monday through Friday, and from 6:00 a.m. to noon Saturday. No service call accepted outside the above hours. Mail subscribers who fail to receive their paper regularly should notify The Telegraph office. Advertisement and legal notices are accepted for publication with the understanding that the liability of The Telegraph for failure to publish the ad or notice or making an error in the content of the ad or notice is limited to the amount paid for the advertisement or notice. POSTMASTER: Send address changes to The Telegraph, P.O. Box 498, Sterling, Illinois 61081.

Periodicals postage paid at Dixon, Illinois 61021.

*CenturyLinkŽ Internet Basics Program – Residential customers only who qualify based on meeting income level or program participation eligibility requirements, and requires remaining eligible for the entire offer period. First bill will include charges for the first full month of service billed in advance, prorated charges for service from the date of installation to bill date, and one-time charges and fees described above. Qualifying customers may keep this program for a maximum of 60 months after service activation provided customer still qualifies during that time. Listed High-Speed Internet rate of $9.95/mo. applies for first 12 months of service (after which the rate reverts to $14.95/mo. for the next 48 months of service), and requires a 12-month term agreement. Customer must either lease a modem/router from CenturyLink for an additional monthly charge or independently purchase a modem/router, and a one-time High-Speed Internet activation fee applies. A one-time professional installation charge (if selected by customer) and a one-time shipping and handling fee applies to customer’s modem/router. General – Services not available everywhere. CenturyLink may change or cancel services or substitute similar services at its sole discretion without notice. Offer, plans, and stated rates are subject to change and may vary by service area. Deposit may be required. Additional restrictions apply. Terms and Conditions – All products and services listed are governed by tariffs, terms of service, or terms and conditions posted at centurylink.com. Taxes, Fees, and Surcharges – Applicable taxes, fees, and surcharges include a carrier Universal Service charge, carrier cost recovery surcharges, state and local fees that vary by area and certain in-state surcharges. Cost recovery fees are not taxes or government-required charges for use. Taxes, fees, and surcharges apply based on standard monthly, not promotional, rates. Š2013 CenturyLink. All Rights Reserved. The name CenturyLink and the pathways logo are trademarks of CenturyLink. All other marks are property of their respective owners.

The city has received $14 million of the settlement money and expects to receive the rest by Thanksgiving, Meyer said, and could have the money from the sale of Crundwell’s property by Jan. 1. Some of the settlement money, $8.7 million, has already been allocated to pay internal debt. An additional $12.3 million will pay back three bonds early, which will ultimately save the city $3.87 million in interest.

Published daily, Monday through Friday, except for New Year’s Day, Memorial Day, July 4, Labor Day, Thanksgiving Day and Christmas Day.

By mail outside primary market area: Payable in advance - 13 weeks $72.75, 26 weeks $145.50, 52 weeks $ 291.00. Mail subscriptions must be paid in advance. Single copy $1.00/$2.00 Weekend.

SUBSCRIPTION RATES By carrier: Payable in advance - 13 weeks $56.30, 26 weeks $108.25, 52 weeks $212.15. By motor route: Payable in advance - 13 weeks $59.50, 26 weeks $114.35, 52 weeks $224.20. By mail in primary market area : Payable in advance - 13 weeks $72.75, 26 weeks $145.50, 52 weeks $291.00

This newspaper is a member of the Associated Press which is entitled to use for republication all news dispatches — local, state and national. All rights or republication of special writings are hereby reserved. Member of National Newspaper Association; Inland Press Association; Illinois Press Association and Audit Bureau of Circulation.


4UESDAY .OVEMBER 

www.saukvalley.com

VETERANS DAY

4ELEGRAPHs!

OUT HERE

Health insurance already unnecessarily complex

O

Philip Marruffo/pmarruffo@saukvalley.com

Col. Mike Durham, a retired Army chaplain at the United States Military Academy at West Point, speaks Monday morning during a Veterans Day observance at Sterling High School’s Centennial Auditorium.

Former West Point chaplain speaks at Sterling ceremony BY PAM EGGEMEIER peggemeier@saukvalley.com 800-798-4085, ext. 570

STERLING – How do you define a veteran? That was the question Col. Thomas “Mike� Durham asked about 100 people who attended a Veterans Day ceremony Monday morning at Centennial Auditorium. Durham, now retired from the Army, was head chaplain at the United States Military Academy at West Point. He proceeded to answer his own question with an oft-quoted response from an unknown author. “A veteran is someone who, at one point in his/

her life, wrote a blank check made payable to The United States of America, for an amount of up to and including my life.� Durham added that those checks also are signed by the loved ones of those who serve their country. After veterans, by branch, stood for their applause during the “Armed Forces Medley,� family members were asked to stand while the vets clapped for them. Durham left the crowd with one final message to veterans. “Thank you for your sacrifices, sense of duty, and service to the nation,� he

said. “Our country is filled with hope ... because history is shaped by heroes like our v eterans.� After Durham’s speech, Whiteside County Civil Air Patrol cadets gave a demonstration of how the U.S. flag is folded at military funerals. The flag is folded 13 times, with each fold having special symbolism. When the flag is completely folded, the stars are at the highest point as a reminder of the national motto, “In God We Trust.� The ceremony ended with a 21-gun salute outdoors that could be clearly heard inside the auditorium, the playing of taps, and a prayer.

ne of the biggest fears about Obamacare is it will make health insurance more bureaucratic. I’ll leave that debate to others, but let’s make one thing clear: Health insurance is already unnecessarily bureaucratic. Studies have shown that Americans spend billions and billions of dollars each year on health care bureaucracy. I learned about that firsthand. In July, I underwent emergency surgery to correct an intestinal problem. Before the surgery, of course, I received anesthetics. My insurance company agreed to cover the surgery, but not the anesthetics. Say what? I looked at my insurance policy, and it clearly labeled anesthetics as covered. So I called the insurance company. After some discussion with a representative, I was put on hold for a while, then was told the company stood by its decision. I called the next week, and

davidGIULIANI David Giuliani is a news editor for Sauk Valley Media. You can reach him at dgiuliani@ saukvalley. com or 800798-4085, ext. 525.

a woman told me that the anesthetics should, in fact, be covered. A couple of months later, though, I received another statement from the insurance company that itemized the $2,700 cost of the anesthetics. I had to pay it. I called the company and was told I had to pay because the person who administered the anesthetics wasn’t in network. The hospital was in network, but not this person, apparently. I should have asked the person whether she was in network, the company’s representative told me. That advice lacked logic. Getting wheeled into the surgery room is one of life’s most frightening experiences. Yet,

even though I got presurgical clearance with my insurance company, I was supposed to have had the wits about me to ask whether the person administering the anesthetics was in network. A few days later, I called the insurance company yet again. This time, I was told the anesthetics would be covered. And they were, according to a later insurance statement. The insurance company’s representatives must have spent at least a couple of hours with me on the phone. What a waste of time and money for our health care system. Many doctor’s offices have a single person whose sole job is dealing with billing issues. Is that an unnecessary expense for society? I think so. Wouldn’t you rather have the health care system focus on, you know, health care? Simplicity could save a lot of money. David Giuliani is a news editor for Sauk Valley Media. You can reach him at dgiuliani@ saukvalley or 800-7984085, ext. 525.

Help a child have

MORRISON

Golf carts coming to city streets? Council ponders change to rules

To attend

BY DAVID GIULIANI dgiuliani@saukvalley.com 800-798-4085, ext. 525

MORRISON – Morrison resident John Kuehl has a golf cart and an off-road recreational vehicle that, he says, could be used for transportation in the city. The problem: They’re not allowed under city code. For the past few months, Kuehl of Spencer’s Automotive has been trying to change that, asking the city to enact an ordinance that permits street-legal golf carts and off-road recreational vehicles. “It would be more convenient, and it’s a cheaper way to travel because of gas prices,� Kuehl said. More and more towns, he noted, are allowing such vehicles, especially because many of them are lowering their speed limits on residential streets. In response to Kuehl’s

Festival of Trees

The Morrison City Council will meet at 7 tonight in the Whiteside County Board chambers in the County Courthouse, 400 N. Cherry St. For an agenda for this meeting, minutes from past meetings, and more information, go to www.morrisonil.org or call 815-772-7657. request, the city formed a committee to consider the issue. Today, the City Council will look at a proposed ordinance to allow such vehicles as long as they meet certain requirements, such as having brake lights, turn signals and rearview mirrors. Operators must have driver’s licenses and follow child restraint laws. They can drive them only during daylight hours and on streets with speed limits of 25 mph or less. Aldermen are expected to discuss the proposal,

but no action will be taken until the next City Council meeting, Mayor Everett Pannier said. Pannier said he doesn’t see a problem with allowing such vehicles on streets. Alderman Marti Wood said she favored looking into the issue. “It doesn’t hurt to check it out. It could give people an option,� she said. “We’ll see if it is feasible.� Also at today’s council meeting, members are expected to vote on a change to the city’s sign ordinance that would allow the Planning and Zoning Board to consider requests for signage. As it is, the council votes on such proposals but cannot act on requests for variances to the city’s sign ordinance. Under the law, only the planning and zoning panel can do that, Pannier said. With planning and zoning, “it’ll make it easier to take care of requests for signage,� the mayor said.

Woodlawn Arts Academy, Sterling

November 19-24

6WD\ LQGHSHQGHQWVDIH FRPIRUWDEOH LQ \RXU RZQ KRPH

4REES s 2AFmES s %NTERTAINMENT s !UCTIONS s #OUNTRY 3TORE

Serving seniors in your home. 1- 24 hours a day, every day of the year.

“Children’s Christmas Wish Treeâ€? SVJH[LK H[ [OL ;LSLNYHWO VMĂ„JL PU +P_VU

HUK OLSW THRL H JOPSKÂťZ *OYPZ[THZ H ]LY` ZWLJPHS VUL Gifts will be distributed by the Goodfellows of Dixon

Each ornament will specify gender, age, clothing size and child’s wish list. All gifts should be unwrapped. Gifts must be returned to the Telegraph at 113 S. Peoria Ave., Dixon by December 6th

Call for a free consultation! 815.677.9223 or 1.800.397.PEAK www.peakmedicalhomecare.com

&OR MORE INFORMATION CALL

815.288.3673

"ENElTS(OSPICEOFTHE "ENElTS (OSPICE OF THE 2OCK 2IVER 6ALLEY

Choose a name from the

Medical Home Care, Inc.

Sponsored locally by:

Services performed by Personal Care Assistants, CNA’s Nurses, who are thoroughly background checked & supervised by a Registered Nurse.

The Goodfellows of Dixon & the Telegraph

Sauk Valley Weather

Stay Connected Wherever You Are!

5-Day Forecast Precipitation

Solar Table

Yesterday .................................................0.00�

Sunset tonight .........................................4:41 p.m. Sunrise tomorrow ....................................6:45 a.m.

Today

Wed.

Thu.

Fri.

Sat.

Breaking News Severe Weather School Closings Sports News & more!

33°/15°

Sunny and cold

40°/25°

Sunny, breezy

47°/31°

Partly sunny, breezy

48°/35°

Morning shower

51°/41°

Chance of shower

s txtAlerts

Sign up for FREE on saukvalley.com Brought to you by


!s4ELEGRAPH

WWWSAUKVALLEYCOM

4UESDAY .OVEMBER 

OBITUARIES Norma J. Jennings ROCK FALLS – Norma J. Jennings, 84, formerly of Rock Falls, died Sunday, Nov. 10, 2013, at Mendota Lutheran Home. She was employed at National Manufacturing for 15 years. She was born May 11, 1929, in Mill Creek, the daughter of Ira and Lena (Keller) Jordan. She married Virgil Jennings on July 25, 1943, in Jackson, Mo. He preceded her in death on May 11, 2003. She was a member of Harvest Time Bible Church in Rock Falls. Survivors include three daughters, Gloria (Pat) Marschang of Tampico, Kathy Bowers of Mendota, and Sandra (Adrian) Jiminez of Sterling; her son, Gary (Jan) Jennings of Elk City, Okla.; her sis-

ter, Mary (Bob) Cunningham of Benton, Ky.; two brothers: Darrell Jordan and Webb Jordan, both of Anna; three grandchildren; and six great-grandchildren. She also was preceded in death by her parents, two brothers, a grandson, and a granddaughter. Visitation will be from 5 to 7 p.m. today at McDonald Funeral Home, 1002 12th Ave., Rock Falls. The funeral will be at 10 a.m. Wednesday at Harvest Time Bible Church in Rock Falls, with the Rev. Dalmus Meeks officiating. Burial will be at Oak Knoll Memorial Park in Sterling. Visit www.mcdonaldfuneralhomes.com to send condolences.

FUNERAL SERVICES FOR THE WEEK Today’s visitations: James B. PlogOF-ILLEDGEVILLE  AMAT-ILLEDGEVILLE5NITED-ETHODIST #HURCH Clifford E. BoopOF (ANOVER  PMAT,AW *ONES&UNERAL(OMEIN (ANOVER Patricia Sue TurneyOF &AIRHAVEN  PM WITHTHE

ROSARYRECITEDATPM AT&RANK ,AW *ONES&UNERAL (OMEIN-OUNT#ARROLL Norma J. Jennings,FORMERLYOF2OCK&ALLS  PM AT-C$ONALD&UNERAL(OMEIN 2OCK&ALLS Today’s funerals: James B. PlogOF-ILLEDGEVILLE AMAT-ILLEDGEVILLE 5NITED-ETHODIST#HURCH

Melanie R. Wagner POLO – Melanie R. Wagner, 21, of Albuquerque, N.M., died Saturday, Nov. 9, 2013, in Polo. Polo Family Funeral Home is handling arrangements.

James A. Zinke CHANDLER, Ariz. – James A. Zinke, 35, formerly of Dixon, died unexpectedly Tuesday, Oct. 29, 2013, in Phoenix. South Mountain Mortuary of Phoenix is handling arrangements.

GraniteWorks A Division of World Granite Inc.

Fall Monument Sale

Monuments at Wholesale Prices! For a limited time only.

1220 S. Galena Ave., Dixon 815-288-3350

Clifford E. Boop HANOVER – Clifford E. Boop, known by his close family and friends as “Punk,� loved tinkering and farming. Surrounded by his family, Clifford passed away Friday, Nov. 8, 2013, at his home. Clifford had lived and farmed at his home since 1949. He was 81 years old. Clifford was born Sept. 24, 1932, in Hanover, the son of Clifford and Alice (Paisley) Boop. He attended Hanover schools before he began farming full time. Clifford proudly served his country in the Army from 1950 to 1952. He married Jeanette Elaine Wald on Sept. 22, 1957, in Monroe, Wis. Clifford farmed his entire life, most of it on his current family farm. At a very young age, Clifford was nicknamed “Punk� by his father. He continued the tradition by giving nicknames to most of his own family. Clifford and Jeanette were blessed with four boys and five girls. Clifford treasured sitting around the kitchen table visiting and having a cup of coffee with family and friends. He enjoyed tinkering on the farm and

sitting on his lawn swing with his loyal dog, Yipper. Most of all, Clifford loved his family. Clifford will be dearly missed by his wife, Jeanette; four daughters, Laura (Shawn) Connolly of Dixon, Donna (Rob) Pearce of Elizabeth, Mary (Richard) Fowler of Goodyear, Ariz., and Darcy Boop (Paul Wasmund) of East Dubuque; four sons, James (Nancy) Boop, Edward (Gayle) Boop, and Brian (Nicolene) Boop, all of Hanover, and Michael (Krista) Boop of Elizabeth; one son in-law, Bob Weede of Elizabeth; 15 grandchildren; and six great-grandchildren. He was preceded in death by his parents; one daughter, Angela Weede; and three siblings, Jean A. Weible, Mary Ella Sauer, and Robert A. Diehl. Visitation will be from 3 to 7 p.m. today at LawJones Funeral Home in Hanover. The funeral will be at 11 a.m. Wednesday at the funeral home. Burial will be at Evergreen Cemetery in Hanover. A memorial fund has been established. Visit www.lawjonesfuneralhome.com to send condolences.

NUCLEAR DEAL

Iran, U.S. trade blame over failed agreement Kerry: Negotiations were extremely close DUBAI, United Arab Emirates (AP) – Iran and the United States on Monday blamed each other for the failure to reach agreement on a deal to limit Iran’s uranium enrichment in exchange for an easing of Western sanctions. In spite of the accusations, there was some diplomatic progress as Iran promised to offer more information and

expanded access to U.N. nuclear inspectors – including more openings at a planned reactor and uranium site. U.S. Secretary of State John Kerry said Iranian envoys had backed away from a wider deal this weekend seeking to ease Western concerns that Tehran could one day develop atomic weapons. Iran’s foreign minister, Mohammad Javad Zarif, countered by criticizing Kerry’s remarks, telling an Iranian TV talk show that the American’s

“conflicting statements� damaged confidence in the process, adding that “considerable progress was made� in Geneva. The flurry of announcements and comments showed both the complexities and urgency in trying to move ahead on an accord between Iran and world powers after the talks in Geneva failed to produce a deal. With negotiators set to resume next week, Iranian officials promoted a separate pact reached with the U.N. nuclear chief Yukiya

Amano as a “roadmap� for greater cooperation and transparency, which could move the talks ahead. But the plans do not mention some of the sites most sought by U.N. teams to probe suspicions of nuclear-related work, notably the Parchin military facility outside Tehran. “It’s an important step forward, but by no means the end of the process,� Amano told The Associated Press in Tehran. “There is still much work to be done.�

Western leaders, meanwhile, were keen to display a unified front after reports that France had broken ranks in Geneva and demanded more concessions from Iran on enrichment levels and an under-construction heavy water reactor that produced a greater amount of plutonium byproduct, which could be used in eventual weapons production. Kerry said it was Iran that put the brakes on reaching a first-phase agreement, but gave no details

SPACE JUNK

IN BRIEF

Satellite hits Atlantic – but what about next one?

Police: Shooter dumped from band

BERLIN (AP) – This time it splashed down in the Atlantic Ocean – but what about next time? The European Space Agency says one of its research satellites reentered the Earth’s atmosphere early Monday on an orbit that passed over Siberia, the western Pacific Ocean, the eastern Indian Ocean and Antarctica. The 1,100-kilogram (2,425-pound) satellite disintegrated in the atmosphere but about 25 percent of it – about 275 kilograms (600 pounds) of “space junk� – slammed into the Atlantic between Antarctica and South America, a few hundred kilometers (miles) from the Falkland Islands, ESA said. It caused no known damage. The satellite – called the GOCE, for Gravity field and Ocean Circulation Explorer – was launched in 2009 to map the Earth’s gravitational field. The information is being used to understand ocean circulation, sea levels, ice dynamics and the Earth’s interior. The satellite had been gradually descending in orbit over the last 3 weeks after running out of fuel Oct. 21. But how much space junk is out there? Here’s a look:

Space junk flying around the cosmos Some 6,600 satellites have been launched.

ric tons (110 to 165 tons) of space junk re-enters Earth’s atmosphere each year, according to Heiner Klinkrad, the head of ESA’s Space Debris Office. In 56 years of spaceflight, a total of 15,000 metric tons (16,500 tons) of humanmade space objects have re-entered the atmosphere. AP

This is a 1979 file image of Skylab at the end of its mission, when it crashed back to Earth. Skylab was the first United States manned space station, and was launched May 14, 1973. NASA’s Skylab was one of the best-known of a falling satellite, which reentered in 1979. About 74 metric tons (82 tons) hit the Earth, some of it in Australia and the rest falling into the Indian Ocean. Some 3,600 remain in said ESA Space Debris space but only about Office deputy head Hol1,000 are still opera- ger Krag. Statistically, t i o n a l , a c c o r d i n g t o he said, “roughly every ESA. Not all are still week you have a reintact, and the U.S. entry like GOCE.� Space Surveillance Network tracks some And when it 23,000 space objects, starts to fall ESA said. A lot of junk About 100 to 150 metcomes down unnoticed,

My sincere thanks for remembering my 90th Birthday.

George Mason

How fast are we talking? Space junk – mostly satellites and rocket stages or fragments – typically travels at about 28,000 km/h (17,400 mph) shortly before re-entry at about 120 kilometers (75 miles) above the earth, according to ESA. It starts to slow down and heat up in the dense atmosphere. In the last 10 minutes, it hits a travelling speed roughly equal to that of a Formula One racing car – between 200 kph to 300 kph (125 mph to 190 mph).

If you live in DIXON or surrounding vicinity Do you have a NEW NEIGHBOR or know someone new to the community??

Please Call Betsy Bulfer “THE DIXON GREETER� 815-284-3402 815-535-8019 THE DIXON GREETER

Take the opportunity to get acquainted with Dixon. Gifts and Information!!

on the Iranian concerns and suggested it was only a matter of time before a formula is found. “There was unity but Iran couldn’t take it,� Kerry said during a stop in Abu Dhabi. He added: “The French signed off on it, we signed off on it.� Kerry told the BBC on Monday that negotiators had been “very, very close ... extremely close� to reaching a deal with Iran. “I think we were separated by four or five different formulations of a particular concept,� he said.

TOCARRYTHEASSAULTRIFLE USEDINTHEATTACK 2AFIE  hWASUPSETTHAT HEWASNTINTHEBAND .%79/2+!0 n! ANYMORE vSAID.EW9ORK GUNMANWHOKILLEDTHREE 0OLICE$EPARTMENTSPOKES)RANIANINDIEROCKMUSIMAN*OHN-C#ARTHY CIANSANDINJUREDAFOURTH )NVESTIGATORSSUSPECTTHE PERSONINSIDEA"ROOKLYN SHOOTERANDHISFORMER&REE APARTMENTON-ONDAY +EYSBANDMATESMAY BEFOREKILLINGHIMSELFWAS HAVEHADANARGUMENT UPSETBECAUSEHEHAD BEENKICKEDOUTOFANOTHER OVERMONEY HEADDED 4WOOF2AFIESVICTIMS BANDLASTYEAR POLICESAID WEREBROTHERSANDMEM!LI!KBAR-AHAMMADI 2AFIEKILLEDHIMSELFONTHE BERSOFTHE9ELLOW$OGS ROOFAFTERSTRUGGLINGWITH ABANDTHATCAMETOTHE 53FROM)RANTHREEYEARS AMEMBEROFHISFORMER AGOAFTERAPPEARINGIN BAND THE&REE+EYS AFILMABOUTTHEUNDERPOLICESAID)NVESTIGATORSBELIEVEAGUITARCASE GROUNDMUSICSCENE THERE ACCORDINGTOBAND FOUNDONANADJOINING ROOFMAYHAVEBEENUSED MANAGER!LI3ALEHEZADEH

Thank You! I just wanted to take the time to thank all those thoughtful people who comforted my children and I in our darkest hour, with the passing of our wonderful loving and beautiful mother and wife. No one will ever understand just why this took place but it was overwhelming how so many people, relatives and friends from afar as well as the response from our good friends and family near us. The many hundreds of people who came to the visitation and offered to help in so many ways as well as the hundreds of cards that we received from others who just couldn’t get here but wished that they could have. The many flowers and plants were just overwhelming. Also, the food that poured into our home as well as the Eagles club in Rock Falls. In our grief, it was impossible for us to totally keep track of just what transpired in the past days. It is impossible for me to thank everyone who came to our need. I received sympathy cards with only first names and money cards with no names, for those people as well as all of you who helped console my children and I, thanks so kindly from the bottom of our hearts.

Jeff, Jeffery, Shaylyn, Mary (Val’s mother), and all of Val’s family. A special thanks to the professional staff at the McDonald Funeral Home and the Rock Falls Eagles Club.


Tuesday, November 12, 2013

www.saukvalley.com

4ELEGRAPHs!

ILLINOIS HEALTH CARE

Food stamp outreach boosting Medicaid State has received more than 44,000 applications since site launched Oct. 1 CHICAGO (AP) – Although only a few hundred middleclass Illinois residents were able to sign up for health insurance last month on the crippled federal HealthCare.gov website, the poor appear to be having an easier time enrolling in an expansion of Medicaid – and are doing so by the thousands. Illinois is among states expanding Medicaid under President Barack Obama’s health care law. It’s the state, not the federal government, that’s overseeing efforts to enroll new clients, and state officials have come up with some effective ways to do it – especially for people already getting food stamps. In late August, Illinois offered “express enrollment� to people already receiving food stamps. The state sent a letter to 123,000 food stamp recipients, and received 46,000 Medicaid applications in response.

Separately, health advocates say a new Illinois online enrollment site called ABE has been working well. Illinois has received more than 44,000 applications for Medicaid since Oct. 1 when the site launched. For unemployed construction worker Jerome Davis Jr., signing up through ABE was easy. “I made an appointment. Bada bing bada boom,� Davis said about the ease of completing an application. “Unbelievable.� The expansion of Medicaid means he’ll be able to see a doctor without fear of medical bills he can’t pay. The 36-yearold Chicago resident knows he has high blood pressure, but has been unable to afford treatment. He completed an application Friday at Westside Health Authority in Chicago after hearing about the opportunity from an outreach worker distributing pamphlets on the street. Coinciding with the launch

AP

Enrollment counselor Kenya Williams helps Jerome Davis Jr., 36, sign up for Medicaid at the Westside Health Authority in Chicago. For Davis, an unemployed construction worker, expansion of Medicaid means he’ll be able to see a doctor without fear of medical bills he can’t pay. of HealthCare.gov, Illinois unveiled its upgraded online application system for Medicaid, called ABE after the 16th president and standing for Application for Benefits Eligibility, and began actively enrolling people through the site. The $160 million upgrade is being financed mostly with

enhanced federal matching funds, which have been claimed by most states. The contrast between Illinois’ working technology and the botched rollout of the federal marketplace isn’t lost on the state’s top Medicaid official, Julie Hamos. When the health law passed

AGRICULTURE

in 2010, the federal government urged states to update their information technology “and really get ready,� Hamos said. “I wish they had told that to themselves,� she added glumly, “but never mind.� And in a third Medicaid expansion effort, Cook County received federal approval to get an early start on offering Medicaid to adults without dependent children, a year before the rest of the state. That effort has generated 115,000 applications. The state enrolled 52,000 of those applicants and is processing the rest. Obama’s health care law was originally written to expand Medicaid to people making up to 138 percent of the federal poverty line, or nearly $15,860 for an individual. It’s not clear yet how many new Illinois Medicaid recipients there will be in 2014 under the law’s expansion of the state-federal health program for the poor. State officials are still verifying the applicants’ eligibility and they say there may be some overlap in the reported numbers.

SPRINGFIELD

Farmers pull land out of conservation Quinn’s tour promotes veterans lottery ticket

Ethanol production fueling the moves COBDEN (AP) – For all its scenic splendor in a mostly pancake-flat state, southern Illinois can be a hassle for farmers. The soil isn’t as fertile as up north, and the hilly terrain lends itself to erosion. That’s why so many farmers, like others across the Corn Belt, set aside much of their land years ago to a federal program that paid them to keep it idle in the spirit of conservation. At a time when corn prices were flagging, it simply made sense, giving farmers guaranteed income that helped them cover property taxes and other farm costs. But that has changed with America’s increasing demand for ethanol, the fuel additive that since 2010 has been the nation’s top use for corn. The government’s push for green energy has changed both the economics and the land of southern Illinois. Farmers are planting more corn in this area known as “Little Egypt� for its place between the Ohio and Mississippi rivers and the town of Cairo on the state’s southernmost tip. In the 10 southern Illinois counties that lost the most conservation land since 2006, the disappearance amounts to more than 43,000 acres, a swath bigger than St. Louis. The pullback from the Conservation Reserve Program has paid off for farmers like Bill Bass, who is unapologetic about what he calls his “unbelievable, astronomical� yields of corn and soybeans on hundreds of acres he farms. Much of it is property that Bass sharecrops with retired farmer Collin Boyd, who pulled it out of

SPRINGFIELD (AP) – Gov. Pat Quinn took part Monday in a rare fly around tour to highlight a new Illinois Lottery ticket benefiting the state’s veterans. The governor announced the new $2 Veterans Cash ticket at the Hope Manor Apartments – a supportive housing project for homeless veterans – in Chicago on Monday, followed by stops in Peoria, Milan and Rockford. The ticket is the latest component of a program launched in 2006 and earmarks lottery proceeds to veterans. Quinn’s administration says more than $11 million has been AP photos

Bill Bass, 63, harvests corn on acreage near the southern Illinois town of Cobden. Bass is among scores of farmers throughout the region and the rest of the nation’s Corn Belt who in recent years have benefited from pulling millions of acres of farmland out of a federal conservation program and putting it back into corn production, partly to profit from grain prices sent higher by America’s demand for ethanol. conservation in recent years and threw it back into production. Neighbors in Union County, along the Mississippi, have done the same, returning nearly 4,200 acres of conservation land to farmland since 2006, the year before the ethanol mandate passed. Corn planting is up 33 percent over that period in a region that’s always been agriculturally eclectic, home to traditional cash crops, peach and apple orchards, vineyards and pumpkin farms. “The CRP saved a lot of people, and it had its place,� said Bass, 63. He asked, “Why shouldn’t the American farmer have more money in his pockets? Am I missing something?� It is impossible to specify how much ethanol accounts for the spike in corn prices – and how much those prices led to the Midwest land changes – as farmers enrolled in the conservation pro-

=`e[ 8 ?flj\ Kf :Xcc ?fd\%

Bass harvests near Cobden. In Wayne County, nearly 7,700 acres have been pulled out of the conservation program since 2006, and corn planting there had increased 60 percent during the same period. gram weigh whether to stick with it, tying that property up for another decade or perhaps longer. In Wayne County, nearly 7,700 acres have been pulled out of the conservation program since 2006, and corn planting

there has increased 60 percent over the same period. About 300 of those acres belong to Walt Townsend, leaving him with more than 100 still in conservation. But by 2016, he expects just 35 or so will remain in CRP.

Deck your home with brand new flooring Fa la la la la la la la la! Enter For A Chance To Win A

3 000

$ ,

+ROLGD\ 6KRSSLQJ 6SUHH

LindaSanders.com

Angie & Al Delhotal Owners

From The Sterling Merchants & Make Your Dreams Come True!

We guarantee you will love your new floor! Sauk Valley (815) 625-3722

110 E. Lynn Blvd., Sterling, IL 61081

2528 E. Lincolnway Sterling,IL    s WWWANAmOORINGCOM

awarded over the years to more than 210 veterans’ organizations statewide. “That is one of our No. 1 missions here in Illinois: to make sure we take good care of all of your veterans, especially when it comes to shelter,� Quinn said at the Hope Manor event. The Illinois Department of Veterans Affairs, which receives the ticket proceeds, provides grants that fund veterans’ job training, medical expenses, care for the homeless and long-term care. Quinn, who is seeking re-election next year, has made veterans issues a priority during his tenure as governor.

IN BRIEF Woman dies after Polo car crash

BEREPORTED3TOPBYTO SHAREORJUSTTOSAYHI -ENCARINICOVERSGOVERNMENTANDHAPPENINGSIN 0/,/n!.EW-EXICO WOMANDIED3ATURDAYAFTER $IXON(ECANBEREACHED ATMMENCARINI SAUKVALLEY ACARACCIDENTIN0OLO 4HE/GLE#OUNTY3HERIFFS COMORAT   $EPARTMENTWOULDPROVIDE EXT&OLLOWHIMON 4WITTER -ATT-ENCARINI NODETAILSOFTHEACCIDENT -ELANIE27AGNER  –SVM staff reports HADFAMILYIN0OLO!CCORDINGTOHER&ACEBOOKPAGE Facility takeover SHEWORKEDAT#RACKER "ARRELIN!LBUQUERQUEAND could net incentive WENTTOHIGHSCHOOLIN 302).'&)%,$!0 n !USTRALIAFORATIME 3OME)LLINOISLAWMAKERS !RRANGEMENTSAREPENDINGWITH0OLO&AMILY&UNER- WANTTOOFFERTAXINCENTIVES TOCOMPANIESIFTHEYAGREE al Home. TOTAKEOVERCERTAINABANDONEDSTATEFACILITIES SVM reporter at !MEASURETHATWAS APPROVEDINTHE3ENATE Books on First BUTHASYETTOBECONSID$)8/.n3AUK6ALEREDINTHE(OUSEWOULD LEY-EDIAREPORTER-ATT GIVEPRIVATEINVESTORS -ENCARINIWILLHAVEhOFFICE ANINCOMETAXCREDITIN HOURSvFROMTOPM EXCHANGEFORREFURBISHING 7EDNESDAYAT"OOKSON AFORMERSTATEFACILITY &IRST 7&IRST3T )NCENTIVESWOULDONLY &EELFREETOSTOPBYAND APPLYTOSTATEFACILITIESTHAT LETHIMKNOWWHATSON HADATLEASTEMPLOYYOURMIND)STHEREASTORY EESANDWERECLOSEDWITHIN IN$IXONYOUTHINKSHOULD THEPASTYEARS

SERVICE FEES

During the month of November, Lenhart Plumbing is offering “Free Service Fees�. Present this coupon to our technician and all work we perform during the month of November will be FREE of travel and evaluation fees. Call now and schedule YOUR appointment. 100% Satisfaction Guaranteed.. Or you Don’t Pay!

We answer our phones live 24 hours a day Sterling or Rock Falls: 815-625-3252 Dixon: 815-288-7915

Offer expires November 30, 2013 - Not valid with any other offers.


Opinion !s3AUK6ALLEY-EDIA

WWWSAUKVALLEYCOM

4UESDAY .OVEMBER 

SPRINGFIELD SPOTLIGHT

THE CARTOONIST’S VOICE

Many glad that gay marriage bill behind them Biggest loser is National Organization for Marriage

Joe Heller, Heller Syndication

EDITORIAL

Retired, but not retired T

he dictionary defines “retired� as “having left one’s job and ceased to work.� Students who learn that definition certainly must be confused when they see retired public school superintendents, while receiving their pensions, return to work and get paid hundreds of dollars a day. Adults are likewise a little confused, and with good reason. The Sauk Valley has seen several retired school superintendents reappear in their old schools or nearby schools under the title “interim superintendent.� A few months ago, Jane Eichman, who retired as Rock Falls High School superintendent this past summer, took a job as interim superintendent for the Forrestville Valley School District in Forreston. John Rosenberry, who retired earlier this year as superintendent of Montmorency School District,

What we think When public school superintendents can retire, draw inflated pensions, and then rejoin the public school work force, something’s not right. The entire system needs an overhaul to promote fairness, responsibility, and sustainability. was hired back as the interim superintendent. Greg Lutyens retired in 2009 as superintendent of the Nelson School District, but was hired back, year after year, as the interim superintendent. With the consolidation of East Coloma and Nelson school districts on July 1, Lutyens became interim superintendent of the combined district. At the Bureau Valley School District, two retired superintendents share interim duties for a second year: Dennis Thompson and James Whitmore. What they are doing is perfectly legal. Superintendents who have retired and collect pensions from the Teachers

Retirement System may work for up to 100 days without affecting those pensions. But the practice sticks in the craw of some people. That is especially the case when superintendents were granted 6 percent pay raises over their final 4 years on the job to inflate their pensions, some of which approach six figures. The incentive was designed to encourage early retirements, which were supposed to provide opportunities for younger, lower-paid administrators to move up the ladder and save districts money. But when retirees take vacant superintendent jobs on an interim basis, and pad their pension

checks with 100 days of employment at $500 a day, for example, the practice defeats its original purpose and rubs many taxpayers the wrong way. We certainly don’t begrudge fair pensions for school superintendents who are really retired. We don’t begrudge paying a decent salary to interim superintendents. But when those people are one and the same, we are troubled. Illinois’ economy is not what it should be. Too many people remain unemployed or underemployed, yet they still must contribute tax dollars to schools and the pension system. And Illinois public pension system, underfunded to the tune of nearly $100 billion, is in deep trouble. The entire system needs an overhaul to promote fairness, responsibility, and sustainability. And we don’t need to look those words up in the dictionary.

THE READER’S VOICE

It’s possible to tone down the fright factor BRAD POPEJOY SR. Sterling

For a few weeks now, this has been eating at me. A letter to the editor about haunted houses ran Oct. 30 titled “Scary haunted houses not for young children.� Before this person spoke, he should have asked those at the haunted house about how they handle people who come to their haunted house. I don’t know how they handle theirs, but I’m guessing they have the same policy that was used when I used to be a member of Sinnissippi Rod and Gun Club. When we did ours, if someone came up to one of us and told us they have a medical problem, we’d give them the laid-back tour – where one of us

would walk them through. As we’d walk them through, we made sure no one did something scary. Awhile back, after my wife started having heart problems, we went to a haunted house. I mentioned her heart problem, and we were given what I call the scaled-back tour. You see, these haunted houses aren’t there to make problems worse. They do understand when someone comes to them and says, “Hey, I’d like to go through but not get scared because ‌ .â€?

Earth Angel season marks its 10th year LINDA STRAITH Mount Morris

Earth Angel season is upon us, marking our 10th year, and Earth Angels are wanted for 2013. Drop sites for toy donations or

military mail will be starting the week of Nov. 11 at various locations. Please help bring a little joy into the life of a child in need this holiday season. Earn your Earth Angel wings by sponsoring a child for Christmas. Our goal is to reach out to families currently living in Ogle County (but with your help, no family in need will be turned away). If you know a family in need, even if it’s your own family, please come forward. All information is kept confidential. What’s most important are gender and ages so gifts can be bought and distributed accordingly. You can still earn your wings by volunteering to help wrap, pick up, or deliver when the time comes, even if it’s for an hour or two. Together, we can make Ogle County the largest group of bell-ringing Earth Angels again this year.

EDITORIAL BOARD

4(%&)234!-%.$-%.4

Jennifer Baratta Jim Dunn Sheryl Gulbranson Larry Lough Trevis Mayfield Jeff Rogers

Congress shall make no law respecting an establishment of religion, or prohibiting the free exercise thereof; or abridging the freedom of speech, or of the press; or the right of the people peaceably to assemble, and to petition the Government for a redress of grievances.

The deadline for toys is Dec. 20 at each drop site. Gifts and donations will be accepted at the Mount Morris Senior Center through Christmas. Last year, we reached out to 972 children (62 from military families), and our troops received slightly more than 2,000 pieces of mail. Monetary donations can be mailed to Earth Angel, P.O. Box 188, Forreston, IL 61030, or to Forreston State Bank, Earth Angel Fund, 200 Main St., P.O. Box 278, Forreston. Donations can be made via Pay Pal to Earth Angels Wanted-Fundraiser. Go to our website, www.earthangelsoglecounty.spaces.live.com or Facebook page Earth Angel Granny (Linda Straith), or email earth.angels.oglecounty@ hotmail.com. Questions? Call 815-2917757 and ask for Granny. I believe in Santa still, don’t you? Thank you and God bless.

Perhaps the biggest loser in last Tuesday’s historic passage of a gay marriage bill in Springfield was the National Organization for Marriage. The group, based in Washington, D.C., has been at the forefront of attempts to stop gay marriage in states throughout the country. A Maine investigation uncovered alleged internal NOM documents about the group’s strategy that included this passage: “The strategic goal of this project is to drive a wedge between gays and blacks – two key Democratic constituencies. Find, equip, energize and connect African-American spokespeople for marriage, develop a media campaign around their objections to gay marriage as a civil right; provoke the gay marriage base into responding by denouncing these spokesmen and women as bigots. No politician wants to take up and push an issue that splits the base of the party.� The organization tried all that in Illinois, spending tens of thousands of dollars on politically connected consultants and robocalls into black districts in the spring, summer, and right up until the day of the vote, and holding media-friendly events in the black community. The bill wasn’t called for a vote last spring mainly because black House members were overwhelmed by fervent local opposition. In the end, NOM lost badly. Fourteen of 20 Democratic members of the House Black Caucus voted “yes� on the gay marriage bill, while just four voted “no� (Monique Davis, Mary Flowers, Eddie Lee Jackson and Chuck Jefferson) and two voted “present� (Rita Mayfield and Derrick Smith). IRONICALLY ENOUGH, though, other than gay marriage supporters, those who probably cheered the loudest after the bill’s passage may have been the four Republican gubernatorial candidates. They’ve been hoping this issue would be safely put away, allowing them to move on to their own agendas. They may be right. These things do tend to fade away once a bill is passed. But people don’t always move on. Social conservatives could try to stir up a backlash by demanding that the Republican candidates pledge to repeal the marriage measure. Three of the four candidates are on record opposing gay marriage. The fourth, Bruce Rauner, said he would sign

“Opinion and protest are the life breath of democracy – even when it blows heavy.� Lyndon B. Johnson, 36th U.S. president, 1966

1UOTESBROUGHTTOYOUCOURTESYOF

richMILLER Rich Miller publishes Capitol Fax, a daily political newsletter. He may be reached at http://thecapitolfax.blog. com online.

a gay marriage bill into law only if the public had first voted to approve it via a non-binding referendum. It obviously wasn’t done that way, so he could be forced to answer some touchy questions. State Rep. Tom Cross, a Republican candidate for state treasurer, is undoubtedly hoping that the issue fades quickly, at least in the run-up to the spring primary. Cross voted “yes,� even State Rep. though a Tom Cross spokesman R-Oswego had recently Cross voted told the Sun“yes� for gay Times that marriage, he opposed one of the the bill. But few Illinois been Republicans i t ’ s to do so. known for weeks that Cross was truly struggling with the issue, both on philosophical and political levels. CROSS HAS A Republican primary opponent, the socially conservative DuPage County Auditor Bob Grogan. Grogan hasn’t been much of a campaigner to date, raising little money and garnering few major supporters. But he says he’s not interested in Cross’ vote. Some anti-gay marriage forces are, though, and that could cause him problems. The immediate fear among Cross’ allies is that his gay marriage vote could spark more interest among, and money from, the far right to defeat him. Cross has done a good job so far of rounding up traditional GOP supporters, however, so the calculation was that the vote won’t be fatal in the primary. Last week’s vote will, however, take an issue away from Cross’ Democratic rival, state Sen. Michael Frerichs. Cross clearly took the long view, and that could come with significant benefits, including campaign contributions from gay marriage supporters and the ability to paint himself as a moderate and “modern� Republican in the general election. And speaking of Republicans, unlike in the Senate, where the lone Republican “yes� vote was more symbolic than essential to the outcome, the three House Republicans who voted for the bill last week helped to provide the margin of victory. Without those votes, the going would have been a whole lot tougher.

3HAREYOUROPINIONS Mail: The Reader’s Voice Sauk Valley Media 3200 E. Lincolnway, P.O. Box 498 Sterling, IL 61081 Email: letters@saukvalley.com Fax: 815-625-9390 Website: Visit www.saukvalley.com Policy: Letters are to be no more than 300 words and must include the writer’s name, town and daytime telephone number, which we call to verify authorship. Individuals may write up to 12 letters a year.

OPINIONS EXPRESSED IN LETTERS AND COLUMNS ARE THOSE OF THE WRITERS AND DO NOT REPRESENT THE VIEWS OF SAUK VALLEY MEDIA.


Lifestyle Tuesday, November 12, 2013

www.saukvalley.com

3AUK6ALLEY-EDIAs!

ILLINOIS

World War II diary finds life online Vet’s son created website to share father’s writing BY TIM MITCHELL The (Champaign) News-Gazette

CHAMPAIGN (AP) – Veteran Charles F. “Chick� Bruns of Champaign wrote a “blog� during World War II. Only now is it being published. And with the help of a website created by his son, readers can follow along – 70 years later – with daily entries in his diary, as his unit served in north Africa and Europe, until the war’s end. Bruns’ son, Cissna Park farmer John Bruns, has repurposed the diary into website called http:// www.70yearsago.com “My father is blogging from the past,� John Bruns said. Chick Bruns, 94, a graduate of Holy Cross School and Champaign High School, had been selling clothing at Joseph Kuhn & Co. in downtown Champaign when he

AP Photo/The News-Gazette, John Dixon

World War II veteran Charles F. “Chick� Bruns, of Champaign, looks at the medals and patches from his years in the Army. Bruns wrote a “blog� during World War II that is only now being published with the help of a website created by his son. decided to volunteer for a year of duty with the U.S. Army. Before that year was up, the U.S. had entered World War II, and Bruns found himself among the first servicemen headed

as part of the Third Infantry Division for the invasion of Africa in the fall of 1942. Bruns and the rest of his unit hit the beaches about 20 miles from Casablanca. Since Bruns’ unit were

combat engineers who did everything from building roads to defusing enemy mines, Bruns rode a truck as the Army moved across the deserts of north Africa. “It was very different

from working at Joseph Kuhn & Co.,� he said. Bruns began a diary, where he noted his experiences and emotions each day of the war, from Africa to Sicily, Italy, France, Germany and Austria. “A lot of that diary was scribbled as I tried to keep track of what happened,� Chick Bruns said. Shortly after arriving in Africa, his ship sank, taking most of his personal possessions. But Bruns happened to keep that notebook and a camera with him when the ship sank, allowing him to document his daily thoughts and experiences until after the German surrender in 1945. Bruns also sent frequent letters back home to his family in Champaign, keeping them up to date on his experiences. “I sent back letters as many times as I could,� Chick Bruns said. Long after the war ended, Chick Bruns would frequently tell his

war tales to John and his brother, Charles Bruns Jr. John Bruns said those tales left a good impression upon him, and he thought his father’s experiences should be shared with the public. So John Bruns began transcribing Chick Bruns’ diary with the intention of converting the text into a book. Since some of the copy was written in pencil on onionskin paper, John met with his dad a couple times a month to ensure accuracy. “I sent inquiries to different publishers and never got any interest in a book, so I decided to go in another direction,� John Bruns said. When the elder Bruns took part in an Honor Flight last year to the World War II Memorial in Washington, it occurred to John Bruns that October 2012 would be 70 years from the date that his father began his diary. “I saw that the domain name 70yearsago.com was available, and off I went,� John Burns said.

IN THE CLASSROOM

Students put memory to music at French Academy App helps students remember ‘12 powerful words’ BY VALERIE WELLS (Decatur) Herald and Review

DECATUR (AP) – Some people find it easier to remember things when they’re set to music. That’s certainly the case with Keosha Barber, a sixth-grader in Tami Roberts’ class at French Academy. “I can only do it with the song,� Keosha said with a chuckle, and then sang the song her class used to help them remember the “12

powerful words� critical to successful schoolwork: trace, analyze, infer, evaluate, formulate, describe, support, explain, compare, contrast, summarize and predict. Because the lyrics also contain the meanings of the words, Roberts said, the students now know the words and their definitions. “Those are words that will be on their standardized test,� Roberts said. “By putting them to a song and kind of playing with them, they’re becoming more comfortable, and it will hopefully relieve their testing anxiety.� Christine Edwards, an

instructional technology coach for the Decatur School District, guided the kids through the process of making a video on their iPads with their own version of the song. “This year, the staff at French Academy’s been working on upping the level of question and having the kids understand the kind of questions they’re asking and also having the kids understand the questions they’re asking of them,� Edwards said. “So if a teacher asks them to ‘analyze’ something, what does that mean?� Roberts’ class shot the

video with all of them singing the song, and used the app Garage Band to put music to it. “We’ve been singing, we’ve been taking pictures, we’ve been recording our own music, and we’re putting the final steps together,� Edwards said. The video will be available on YouTube next week, and a link to it will be available on the school’s page on the district website, dps61.org. The Garage Band app allows users to choose an instrument, record it playing a sequence of notes or chords, and layer it with other instruments.

AP

Sixth-grader Tesandra Phillips (left) searches for music as instructional technology coach Christine Edwards assists Jaquai Seaton, Quajai Seaton and Mark Sutherland in editing footage for the class’ “12 Powerful Words� film at French Academy in Decatur.

COMMUNITY EVENTS Tuesday, Nov. 12 Open pool, open cards, open Wii games, and computer lab, 8 a.m.-4 p.m., Whiteside County Senior Center, 1207 W. Ninth St., Sterling, 815-622-9230. Open pool, open cards, open Wii games, and computer lab, 8 a.m.-4 p.m., Lee County Council on Aging, 100 W. Second St., Dixon, 815-288-9236. Pool players, 8:30 a.m., Rock River Center, 810 S. 10th St., Oregon, 815-732-3252. Exercise with Cher, 9-10 a.m., Polo Senior Center, 101 E. Mason St., 815-946-3818. Bingo and doughnuts, 9-10 a.m., Hub City Senior Center, 401 Cherry Ave., Rochelle, 815-5625050. Morning Whittle, 9 a.m., Rock River Center, 810 S. 10th St., Oregon, 815-732-3252. Line dancing, 9:30 a.m., Rock River Center, 810 S. 10th St., Oregon, 815-732-3252. Wii Bowling, 313 cards and make-n-take Thanksgiving cards, 10 a.m., Hub City Senior Center, 401 Cherry Ave., Rochelle, 815-562-5050. Community coffee, 10 a.m. Oregon Healthcare Center, 811 S. 10th St. Lifescape lunch, 11:30 a.m., Lee County Council on Aging, 100 W. Second St., Dixon, 815288-9236. Sign up by 10 a.m. previous business day. Lunch, 11:30 a.m.-12:30 p.m., Whiteside County Senior Center, 1207 W. Ninth St., Sterling, 815622-9230. Dutch treat gathering, 11:30 a.m., Town and Country Family Restaurant, 1135 N. Galena

Ave., Dixon. Birthday Potluck Lunch, 11:30 a.m., Rock River Center, 810 S. 10th St., Oregon, 815-732-3252. Organized Wii Bowling games, noon, Lee County Council on Aging, 100 W. Second St., Dixon. Bingo, 12:30 p.m., Rock River Center, 810 S. 10th Ave., Oregon, 815-732-3252. Euchre, 12:30 p.m., Whiteside County Senior Center, 1207 W. Ninth St., Sterling, 815-622-9230. Pinochle, 1 p.m., Lee County Council on Aging, 100 W. Second St., Dixon. Euchre 101, 1 p.m., Robert Fulton Community Center and Transit Facility, 912 Fourth St., Fulton, 815-589-3925. Wii and Yoga, 1:30 p.m., Whiteside County Senior Center, 1207 W. Ninth St., Sterling, 815622-9230. Young Adult program, “Manly Moustaches,� 6 p.m., Sterling Public Library, 102 W. Third St., 815-625-1370. Bingo, 7 p.m., Sterling Moose Family Center, 2601 E. Lincolnway, Sterling, 815-625-0354.

Buy one, get 2nd 1/2 OFF

5HVLGHQWLDO ‡ &RPPHUFLDO

All-You-Can-Eat Fried Chicken & Spaghetti WEDNESDAY ONLY. Expires 11/30/13.

Mama Cimino’s Dine-In ~ Carry-Out ~ Delivery

104 S. Peoria Dixon 288-4448 or 288-4449

Wednesday, Nov. 13 Open pool, open cards, open Wii games, and computer lab, 8 a.m.-4 p.m., Whiteside County Senior Center, 1207 W. Ninth St., Sterling, 815-622-9230. Open pool, open cards, open Wii games, and computer lab, 8 a.m.-4 p.m., Lee County Council on Aging, 100 W. Second St., Dixon, 815-288-9236. Popcorn and quilting, 8:30 a.m., Polo Senior Center, 101 E. Mason St., 815-946-3818.

Pool players, 8:30 a.m., Rock River Center, 810 S. 10th Ave., Oregon, 815-732-3252. Crafting, 9 a.m., Rock River Center, 810 S. 10th St., Oregon, 815-732-3252. Mexican Train Dominoes, 9:30 a.m., Rock River Center, 810 S. 10th St., Oregon, 815-732-3252. 313 cards and Wii Bowling, 10 a.m., Hub City Senior Center, 401 Cherry Ave., Rochelle, 815562-5050. Sadie Hawkins Day meal, 11 a.m., Whiteside County Senior Center, 1207 W. Ninth St., Sterling, 815-622-9230. Lifescape lunch, 11:30 a.m., Lee County Council on Aging, 100 W. Second St., Dixon, 815288-9236. Sign up by 10 a.m. previous business day. Lunch, 11:30 a.m.-12:30 p.m., Whiteside County Senior Center, 1207 W. Ninth St., Sterling, 815622-9230. Organized Wii Bowling games, noon, Lee County Council on Aging, 100 W. Second St., Dixon. Fellowship dinner, noon, Ashton Bible Church, 702 Main St. Pinochle, noon, Hub City Senior Center, 401 Cherry Ave., Rochelle, 815-562-5050. Sewing after lunch, noon, Robert Fulton Community Center and Transit Facility, 912 Fourth St., Fulton, 815-589-3925. Bingo with the Beukemas, 12:15 p.m., Robert Fulton Community Center and Transit Facility, 912 Fourth St., Fulton, 815-5893925. Bridge, 12:30 p.m., Whiteside County Senior Center, 1207 W. Ninth St., Sterling, 815-622-9230.

B & D HOME SERVICES

Sterling Pavilion

201 W. 14th, Rock Falls

105 E. 23rd Street, Sterling

3OXPELQJ ‡ +HDWLQJ &RROLQJ ‡ (OHFWULFDO

815-626-0897 Lic # 058-157413

Safe State of the Art Simply Amazing

815-626-4264

Pinochle, 12:30 p.m., Big Room, Whiteside County Senior Center, 1207 W. Ninth St., Sterling, 815-622-9230. Book Club, 12:30 p.m., Rock River Center, 810 S. 10th St., Oregon, 815-732-3252. Bingo, 12:30 p.m., Whiteside County Senior Center, 1207 W. Ninth St., Sterling, 815-622-9230. Bingo, 1 p.m., Rock Falls Amer-

ican Legion Hall, 712 Fourth Ave. Wii Bowling, 1 p.m., Rock River Center, 810 S. 10th St., Oregon, 815-732-3252. Second Wind Entertainers, 1:30 p.m., Rock River Center, 810 S. 10th St., Oregon, 815732-3252. Community cards, 2 p.m., The Meadows of Franklin Grove, 510 N. State St., Frank-

lin Grove, 815-456-3000. Tampico Methodist Church ham supper and bake sale, 4:30-7 p.m., 202 Lincoln Ave. Kings Kids Club, 6 p.m., Liberty Baptist Church, 2002 Ninth Ave., Rock Falls, 815-579-1209 or 815-625-4101. Sauk Valley Chess Club, 7-9 p.m., Northland Mall, 2900 E. Lincolnway, Sterling, 815-622-8838.

Sauk Valley Media will be publishing a

“Looking Back� section December 31, 2013

and we are looking for photo submissions. This section will give you a glimpse into yesterday throughout the Sauk Valley.

Cws}p 4ciw

|ÂŻ ‡Â?Â…| ‡ ÂŒÂ—ÂŁÂ™ ¯‡Â&#x;£‡Â?Â… ”šÂ&#x;Â&#x;‡ D ‰’Œ”š

¼� m|’’ Š‡ h|¼� £Š�™¼‰Š™¼£ £

¯ ‡¯ ‡

Photos can be dropped off or mailed to: 6DXN 9DOOH\ 0HGLD $WWQ &ODVVLĂ€HGV 'HSDUWPHQW P.O. Box 498, 3200 E. Lincolnway, Sterling, IL 61081 or 7HOHJUDSK $WWQ &ODVVLĂ€HGV 'HSDUWPHQW  6 3HRULD $YH 'L[RQ ,/ 


!s3AUK6ALLEY-EDIA

WWWSAUKVALLEYCOM

4UESDAY .OVEMBER 

Gay couple might be better off not marrying Dear Abby: I have been with my partner, “Harold,� for 11 years. After gay marriage passed here in Minnesota, Harold told me he didn’t want to marry me because of my credit rating. I find this insulting and humiliating. Worse, the day marriage equality passed, we were with some friends of mine, and he bluntly told them, “I don’t want to marry him because of his FICO score!� It was very embarrassing. I have also learned that Harold has been telling anyone he knows some of my private information. What can I say to him to get him to stop revealing things about me to people we don’t know well? I have asked him plenty of

any advice you give me. old may not be the spouse – Frustrated in for you because he isn’t DEARABBY Minneapolis likely to change. !BIGAIL6AN Couples counseling could "URENS Dear Frustrated: I agree help you decide what to *EANNE that after all these years do next. Inquire at your 0HILLIPS COLUMN you have much time and nearest gay and lesbian APPEARS emotion invested in your community center about DURINGTHE relationship with Harold. any seminars it offers WEEKTHROUGH Although I’m sure he has for longtime couples on 5NIVERSAL 0RESS many virtues, sensitivthis important subject. 3YNDICATE ity and discretion do not Just because people CAN appear to be among them. marry doesn’t necessarily It would be interesting to mean they should. times not to mention my know if Harold would be private life to others, but willing to marry you if your Dear Abby: Our son he still brings up informa- FICO score improved, or if recently came to us and tion I’d prefer others not he’s using it as an excuse confessed that three years know. because he doesn’t want a ago he’d had an affair with Should I end the relalegal commitment. a married woman who tionship? I think in some Even if the two of you had two children. He ran way if I do, that I’ll be bet- did marry, you would still into her recently, and she ter off without him. But have a partner who lacks told him she now has three after 11 years and all that discretion about what children, and the most he’s done for me, I’d feel should be private. If this recent one – age 3 – is his really sad. I’d appreciate is important to you, Har- daughter. She’s still mar-

ried to the man she cheated on, and our son says he’s still in love with her. We told our son that because she says the child is his doesn’t necessarily mean it is, and if her husband didn’t question the pregnancy, it’s possible the child is her husband’s. We advised our son to get a paternity test. Our son is now so angry with us for suggesting it that he won’t speak to us. He said if we can’t support him and the woman he loves, we should stay out of his life. He said she plans to leave her husband. (It has been three weeks and she’s still there.) I think she was just trying to get our son’s attention. Was our suggestion unreasonable? We don’t

support this kind of behavior or their lack of morals. The woman’s husband is the only dad this little girl knows, and he thinks she’s his child. Our son needs to know if this is his daughter. What a mess! What do we do next? – On the Outs in California Dear On the Outs: Your suggestion to your son was not only reasonable, it was the same clearheaded advice he would have received from an attorney. What you do next is ... nothing, except letting him know you’re there for him if he needs you. This is your son’s affair, literally, and he is going to have to deal with whatever consequences are the result.

SUPPORT GROUPS, CLUBS, AND SERVICES Wednesday, Nov. 13 Sauk Valley Gold Chapter of Business Networking International,AM #ANDLELIGHT)NN 3&IRST3T 2OCK&ALLS    Childhood immunization clinic; Women, Infants and Children clinic; and Family Planning Services, ALLBYAPPOINTMENTONLY 3UITE ,EE#OUNTY(EALTH $EPARTMENT 3'ALENA!VE $IXON    Dixon Kiwanis Club meeting, AM PRIVATEDININGROOM +3" (OSPITAL %&IRST3T $IXON Whiteside County Health Department free blood pressure clinic, AM **S 2ESTAURANT .-AIN!VE -ILLEDGEVILLE    Rock River Center Board meeting,AM 2OCK2IVER #ENTER 3TH3T /REGON    Whiteside County Health Department free blood pressure clinic, AM 4HE %UREKA)NN %4HIRD3T 0ROPHETSTOWN    Whiteside County Health Department free blood pressure clinic, AM 3TERLING 2OCK&ALLS9-#! 9-#! 7AY 3TERLING Mercy Nursing Services free blood pressure clinic, AM .ORTHLAND-ALL %,INCOLN WAY 3TERLING Henry Pratt Retiree breakfast, AM 2ED!PPLE &RANKLIN 'ROVE2OAD $IXON Alcoholics Anonymous, AM WOMENSGROUPNOON PMPM "AZAAR!MERICANA 74HIRD3T 3TERLING Mercy Nursing free blood pressure checks, AM .ORTHLAND-ALL %,INCOLN WAY 3TERLING Alcoholics Anonymous, AM CLOSED #HURCHOFTHE"RETH REN .ORTH#OURT3T $IXON Mercy Nursing free blood pressure checks, AM 0OLO 3ENIOR#ENTER %-ASON3T Nurturing Program,AM 3INNISSIPPI#ENTERS)NC  7OODLAWN2OAD 3TERLING   OR   Rock River Center representative, AM PM (EARINGTESTS AM (UB#ITY 3ENIOR#ENTER #HERRY!VE 2OCHELLE    BY APPOINTMENT Narcotics Anonymous, AM OPEN TH!VE 3TER LING American Red Cross blood drive, AM PM 7 3ECOND3T 2OCK&ALLS!PPOINT MENTS  TO   Blood pressure check,  AM ,EE#OUNTY#OUNCIL

/N!GING 73ECOND3T $IXON    Mercy Nursing Services free blood pressure clinic,AM NOON $IXON&OOD#ENTERn2ED &OX #HICAGO!VE $IXON Gaffey Home Nursing blood pressure check,AM NOON 7HITESIDE#OUNTY3ENIOR#ENTER 7.INTH3T 3TERLING    Lunch and Learn,NOON (OME OF(OPE#ANCER7ELLNESS#ENTER 0LOCK2OAD $IXON    Alcoholics Anonymous,NOON CLOSED 3T0AUL,UTHERAN#HURCH 3&IFTH3T /REGON Lee County Welfare Council, NOON -R4EQUILA .'ALENA !VE $IXON Alcoholics Anonymous,NOON CLOSED "IG"OOKPM CLOSED "IG"OOK TRADITION  3(EN NEPIN!VE $IXON Alcoholics Anonymous,NOON CLOSED GRAPEVINEPM CLOSEDPM CLOSED 3PANISH PMCLOSED "AZAAR!MERICANA 74HIRD3T 3TERLING Reality Check Narcotics Anonymous,NOON PM &IRST #HRISTIAN#HURCH &IFTH!VE 2OCK&ALLS   $OWN STAIRS WESTDOOR Sauk Valley Group Alcoholics Anonymous NOON CLOSED PM CLOSED "IG"OOK BACK DOOR &IRST!VE 2OCK&ALLS American Red Cross blood drive, PM /HIO(IGH 3CHOOL -EMORIAL3T !PPOINTMENTS   Free blood pressure check,   PM !MBOY(EALTHCAREAND2EHA BILITATION#ENTER 77ASSON 2OAD !MBOY    Woodworkers, PM (UB #ITY3ENIOR#ENTER #HERRY !VE 2OCHELLE    Milledgeville Woman’s Club, PM -ILLEDGEVILLELIBRARY  7&IFTH3T Alcoholics Anonymous,  PM CLOSED 2OCHELLE#OMMU NITY(OSPITAL .3ECOND3T Women’s Support Group,  PM #HOICES$OMESTIC 6IOLENCE0ROGRAMOFFICE 7 -ARKET3T -OUNT#ARROLL Alcoholics Anonymous,  PM CLOSED STEPS TRADITION 5NITED-ETHODIST#HURCH % #HICAGO!VE $AVIS*UNCTION Pearl,ASELF ESTEEMSUPPORT GROUPOFTHE97#!$OMESTIC 6IOLENCE0ROGRAM PM    Sauk Valley Gold Wing Riders, PMDINNER PMMEETING 2OCK&ALLS#ANDLELIGHT &IRST !VE    AWANA, PM AGES YEARSTHROUGHSIXTHGRADE .ORTH SIDE"APTIST#HURCH 2IVER ,ANE $IXON   

AMVETS 123, PM 6ETER ANSOF&OREIGN7ARS0OST  &RANKLIN'ROVE2OAD $IXON Alcoholics Anonymous, PM OPEN )MMANUEL,UTHERAN#HURCH 532OUTE !MBOY Lee County Genealogical Society end-of-year meeting, PM SECOND FLOORCONFERENCE ROOM +3"(OSPITAL %&IRST !VE $IXON    Alcoholics Anonymous,PM CLOSED &IRST0RESBYTERIAN#HURCH #ALVIN2OAD 2OCHELLE Alcoholics Anonymous, 7 PM CLOSED &REEPORT2OAD 3TERLING Northern Illinois Divers Association,PM !NGELOS)) %,INCOLNWAY 3TERLING Northern Illinois Star Gazers meeting,PM 2OOM' BIOLOGYLAB 3AUK6ALLEY#OMMU NITY#OLLEGE STATE2OUTE $IXON    Rock River Grange,PM -ASONIC,ODGE .'ALENA !VE $IXON    Alcoholics Anonymous, 8 PM CLOSED 0OLO4OWN(ALL  .&RANKLIN!VE

ON!GING 73ECOND3T $IXON    CGH Medical Center blood pressure and blood sugar clinic, AM PM #'( -EDICAL#ENTER %,E&EVRE 2OAD 3TERLING First Steps and Beyond for Survivors meeting lunch,  AM#ALL3ERENITY(OSPICE (OMEIN/REGONFORLOCATIONAND RESERVATIONSDUEBYAM 7EDNESDAY    Caregiver Support and Education Group,NOON 3T*OHN %VANGELICAL,UTHERAN#HURCH  4HIRD!VE 3TERLING    EXT Alcoholics Anonymous,NOON ANDPM CLOSED "IG"OOK  3(ENNEPIN!VE $IXON Alcoholics Anonymous,NOON CLOSED 3T0AUL,UTHERAN#HURCH 3&IFTH3T /REGON Alcoholics Anonymous,NOON CLOSEDPM OPEN BEGINNERS PM CLOSED STEP "AZAAR!MERI CANA 74HIRD3T 3TERLING Reality Check Narcotics Anonymous,NOON PM &IRST #HRISTIAN#HURCH &IFTH!VE 2OCK&ALLS   $OWN Thursday, Nov. 14 STAIRS WESTDOOR Sauk Valley Group AlcoholChildhood immunization clinic; Women, Infants and Chil- ics Anonymous,NOONCLOSED dren clinic; and Family Planning PM CLOSED STEPS BACK Services, ALLBYAPPOINTMENTONLY DOOR &IRST!VE 2OCK&ALLS KSB Parkinson’s Disease 3UITE ,EE#OUNTY(EALTH $EPARTMENT 3'ALENA!VE Support Group,  PM SECONDFLOOR 4OWN3QUARE#EN $IXON    TRE 3(ENNEPIN!VE $IXON Abuse Changing Team, Alcoholics Anonymous,   PM CLOSED CLEARANCEREQUIRED Twin City Sunrise Rotary, 7 "!!BBLEONFOR,IFEPRISONGROUP AM 2YBERG!UDITORIUM #'(    -EDICAL#ENTER %,E&EVRE American Red Cross blood 2OAD 3TERLING drive, PM 4AMPICO5NITED Blood pressure checks,   AM (EARINGTESTS AM (UB #ITY3ENIOR#ENTER #HERRY !VE 2OCHELLE    BY APPOINTMENT Remote Starts, Car Audio TOPS IL 1426,  AM TVs, Surround Sound WEIGH IN MEETINGATAM #OLOMA(OMES 7TH3T Gift Certificates 2OCK&ALLS Audio Video Connection Free blood pressure clinic, Downtown Dixon 815-285-4900  AM 4HE%UREKA)NN %4HIRD3T 0ROPHETSTOWN TOPS IL 825, AMWEIGH IN MEETINGATAM #OVENTRY !CTIVITY#ENTER 3T-ARYS 2OAD 3TERLING    Foot screening, AM PM (EARINGTESTS AM (UB#ITY 3ENIOR#ENTER #HERRY!VE 2OCHELLE    BY APPOINTMENT Golden K Kiwanis, AM 9-#! 9-#!7AY 3TER LING Free blood pressure check,  AM /REGON(EALTH CARE#ENTER 3TH3T Lee County Health Department seasonal flu clinic,  AM PM ,EE#OUNTY#OUNCIL

-ETHODST#HURCH ,INCOLN!VE !PPOINTMENTS   Free Naturalization/Immigration Services  PM 2OOM % 3AUK6ALLEY#OMMU NITY#OLLEGE STATE2OUTE $IXON    Alzheimer’s Support Group, PM 4ERRACE#ONFERENCE 2OOM 0INECREST-ANOR 3 7ESLEY!VE -OUNT-ORRIS    Narcotics Anonymous,  PM 3INNISSIPPI#ENTERS  7OODLAWN2OAD 3TERLING    Alzheimer’s Support Group, PM 7HITESIDE3ENIOR#ENTER 7.INTH3T 3TERLING    Whiteside County Airport Board of Directors meeting, PM !IRPORT4ERMINAL"UILDING (OOVER2OAD 2OCK&ALLS    Thrivent Financial for Lutherans Whiteside County Chapter 31115, PM /UR3AVIOR ,UTHERAN#HURCH (AZEL 2OAD -ORRISON Overeaters Anonymous, PM ,EE#OUNTY#OUNCILON !GING 73ECOND3T $IXON    Speak Boldly Toastmasters, 6 PM 3TERLING0UBLIC,IBRARY  74HIRD3T 3TERLING Breast Cancer Networking Group, PM (OMEOF(OPE #ANCER7ELLNESS#ENTER  0LOCK2OAD $IXON    Ladies of the Elks,PM 7AGON7HEEL 7&OURTH 3T 3TERLING TOPS,PM 2OCK&ALLS 5NITED-ETHODIST#HURCH  &OURTH!VE   

Great Gift Ideas!

Ogle County Clovers 4-H Club, PMFORCHILDRENTO YEARS PMFORCHILDRENTO YEARS 2OCHELLE5NITED-ETHODIST #HURCH &OURTH!VE    Sons of American Legion Post 12,PM ,EGION0OST  7&IRST3T $IXON    Al-Anon,PM 3T*OHN ,UTHERAN#HURCH 4HIRD!VE 3TERLING PEO Sisterhood Chapter KM, PM HOMEOF#AROL3UE,ESLIE Sterling Optimist Club,PM #ANDLELIGHT)NN .,OCUST 3T 3TERLING 40&8 Promenade,PM !MER ICAN,EGION0OST 7&IRST 3T $IXON    Whiteside County Natural Area Guardians, PM /DELL 0UBLIC,IBRARY 3-ADISON 3T -ORRISON    Alcoholics Anonymous, 7 PM CLOSED AND!LA .ON  PM 5NITED-ETHODIST#HURCH &OURTH!VE 2OCHELLE Alcoholics Anonymous, 7 PM CLOSED &REEPORT2OAD 3TERLING Alcoholics Anonymous,PM OPEN "IG"OOK 2OLLING(ILLS#EN TER STATE2OUTE ,ANARK Alcoholics Anonymous, PM CLOSED 3T!NNE#HURCH .#HERRY3T -ORRISON Rock River Valley Barbershop Chorus practice, PM 2OCK&ALLS#OMMUNITY"UILDING 7TH3T    Alcoholics Anonymous, 8 PM CLOSED 5NITED3TEELWORK ERS 7OODBURN!VE 3TERLING Volunteer Care Center of Lee County,%&IRST3T $IXON !PPOINTMENT  

2014 MASTER GARDENER TRAINING web.extension.illinois.edu/clw

815-835-2070

Free Ads Free Ads Subscriber Only Free Ads Special

This coupon good for one free merchandise ad in

Sauk Valley Media will be featuring “Letters to Santa� to be printed in the Daily Gazette and Telegraph Monday, December 23, 2013 We would like to invite children of the Sauk Valley area to participate.

Letters must be received by 5 p.m. Friday, November 22, 2013 to be included in this section.

CLASSIFIEDS SAUK VALLEY dailyGAZETTE

TELEGRAPH

To place your free ad, send completed coupon or drop off to the address below*.

Please allow 3-5 business days from receipt of ad for processing.

Ads must include price. Ads not accepted by phone. Merchandise Items Priced At

$100 or less

Ad runs free for 3 days in Sauk Valley Media & saukvalley.com Write Your Ad Here Classification: ________________________________________________________________________ Price:_________________________________________________________________________________ Description: __________________________________________________________________________

Letters may be emailed to: letterstosanta@saukvalley.com 3OHDVH FRQĂ€UP WKDW \RXU HPDLOHG letters have been received

_______________________________________________________________________________________ _______________________________________________________________________________________

Write Your Information Here Name: _______________________________________________________________________________ Address: _____________________________________________________________________________

Letters can also be dropped off or mailed to: Sauk Valley Media, Attn: Letters to Santa, P.O. Box 498, 3200 E. Lincolnway, Sterling, IL 61081 or Telegraph, Attn: Letters to Santa, 113 S. Peoria Ave., Dixon, IL 61021

City & State: _______________________________________ Zip Code: _______________________ Phone Number: ______________________________________________________________________

*One item per ad, maximum 4 lines (12-15 characters per line). Limit 3 ads per month. Private parties only. For subscribers only. Excludes Rummage Sales, Employment, Rentals, Real Estate, Tickets & Travel, Wood/Fuel, and Pet Ads

Mail Or Drop Off Ad To:

Sauk Valley Media, Attn: Free Ads 3200 E. Lincolnway, P.O. Box 498 Sterling, IL 61081

Dixon Telegraph, Attn: Free Ads 113 South Peoria Avenue Dixon, IL 61021


Tuesday, November 12, 2013 Dilbert by Scott Adams

www.saukvalley.com

3AUK6ALLEY-EDIAs!

Zits® by Jerry Scott and Jim Borgman

Arlo & Janis by Jimmy Johnson Garfield by Jim Davis

Freshly Squeezed by Ed Stein Get Fuzzy by Darby Conley

Blondie by Dean Young & John Marshall

Wizard of Id by Brant Parker and Johnny Hart

Pearls Before Swine by Stephan Pastis Rose is Rose by Pat Brady and Don Wimmer

Pickles by Brian Crane Big Nate by Lincoln Peirce

Born Loser by Art and Chip Sansom

Baby Blues by Jerry Scott & Rick Kirkman

Soup To Nutz by Rick Stromoski

Family Circus by Bil Keane

The Argyle Sweater by Scott Hilburn

Alley Oop by Dave Graue and Jack Bender

Bridge Frank & Ernest by Bob Thaves

Declarer’s basic play gets tune-up

Grizzwells by Bill Schorr

If you have not been playing the game long and would like to check that you have basic declarer play down pat, buy “Declarer Play at Bridge: A Quizbook” by Barbara Seagram and David Bird (Master Point Press). The book starts with suit contracts. There are four pages of basic instruction, then 40 quiz questions in which the reader is shown the dummy and declarer’s hand (“single dummy,” as it is called) and asked to choose a line of play. Each answer also includes a useful point to remember. Next, there are six pages about no-trump contracts, followed by 20 single-dummy problems. There are fewer examples because no-trump

contracts are much less complicated than suit contracts. In this example from the book, how should South play in six hearts? West leads the spade jack.

Yes, South’s jump to slam is a tad optimistic. But the play’s the thing. South has two losers: one diamond and one club. He has only 11 winners: two spades, six hearts, two diamonds and one club. He must establish dummy’s club suit. But if it is splitting 4-2, that will require three dummy entries. Luckily, there are three: the heart king, heart 10 and diamond king. After taking the first trick, cash the club ace and play another club. Suppose East wins and shifts to the diamond queen. South wins with his ace, cashes the heart ace, plays a heart to dummy’s 10, ruffs a club, leads a heart to the king, ruffs another club, plays a diamond to dummy’s king, and happily discards a minorsuit loser on the club jack, which is now a winner. © 2013 UFS


!s3AUK6ALLEY-EDIA

WWWSAUKVALLEYCOM

4UESDAY .OVEMBER 

VETERANS DAY IN THE SAUK VALLEY

Philip Marruffo/pmarruffo@saukvalley.com

The Rock Falls American Legion Post 902 Color Guard gives a 21-gun salute Monday during a Veterans Day ceremony at Veterans Memorial Park in Rock Falls.

Philip Marruffo/pmarruffo@saukvalley.com

Alex T. Paschal/apaschal@saukvalley.com

Philip Marruffo/pmarruffo@saukvalley.com

ABOVE: Dixon Mayor Jim Burke (left), veteran Tom Whelan and state Sen. Tim Bivins, R-Dixon, read a newly dedicated plaque containing the names of Lee County soldiers who died during World War I. The plaque was unveiled Monday at Veterans Memorial Park in Dixon. TOP LEFT: Whiteside County Civil Air Patrol cadets demonstrate how to fold the U.S. flag during a Veterans Day observance Monday morning in Centennial Auditorium at Sterling HIgh School. BOTTOM LEFT: Charles Koehler of Rock Falls American Legion Post 902 stands with the American flag Monday during the Veterans Day service at Veterans Memorial Park in Rock Falls.

Custom Built Websites by Shaw Media Digital

happytailsanimalshelter.org

Ian is a beautiful one-year-old Siberian Husky. He is good with other dogs, cats, and children. He is also housetrained. The shelter recently found that he is deaf, but that doesn’t slow him down! He has a great personality. His Canine-alitiy is Wallflower: “Shy yet charming canine searching for patient owner with relaxed lifestyle. Looking for gentle guidance to help me come out of my shell. Treat me sweet and kind and I’ll blossom.�

(815)626-2994

Call today to get started!

815-625-3600 ext. 630 shawmediadigital.com


4UESDAY .OVEMBER 

www.saukvalley.com

3AUK6ALLEY-EDIAs!

VETERANS DAY IN THE SAUK VALLEY

General calls on employers to hire returning veterans DEDICATED

CONTINUED FROM A1

“We can never adequately repay them, but we can honor and respect them for their service.� Smith called on Americans to hire veterans who are coming home from active military duty. They developed valuable skills while in the military, he said, and their contributions can be seen in things like Veterans Memorial Park, which was built by veterans. According to a 2011 report from the Pew Research Center, fewer Americans have served in active military duty in the past decade – less than 1 percent – than at any time since the peacetime era between World War I and World War II. “It’s not the same as it was in World War II, where in every neighborhood there was somebody that served,� Smith said after the ceremony. “You knew someone,

either a family member or a friend whose family member had passed away. Today, when soldiers come back, you have 99 percent that have not served, so the veteran coming back, they’ve sacrificed, they’ve committed themselves to a cause greater than themselves, which, when you think about it, is pretty remarkable today.� After the ceremony, when most of the crowd had left, Jim James, chairman of the Dixon Veterans Memorial Park Commission, led the unveiling and dedication of a new World War I plaque. The Lee County Genealogical Society donated the plaque, which includes the names of 49 Lee County residents who lost their lives fighting that war. From in front of a F-105 fighter jet at the eastern edge of the park, Dick Herbon read the names. “... Albert Johnson ... Conrad Miller,� he said. “... William Patton ... William Powell ...�

Alex T. Paschal/apaschal@saukvalley.com

Members of American Legion Post 12 in Dixon stand at attention Monday morning during recognition of Veterans Day at Veterans Memorial Park in Dixon.

‘‘

It’s not the same as it was in World War II, where in every neighborhood there was somebody that served. You knew someone, either a family member or a friend whose family member had passed away. Today, when soldiers come back, you have 99 percent that have not served, so the veteran coming back, they’ve sacrificed, they’ve committed themselves to a cause greater than themselves, which, when you think about it, is pretty remarkable today. Maj. Gen. Michael Robert Smith, during his speech Monday at Veterans Memorial Park in Dixon

7% !2% 9/52 ,/#!, %80%243 Philip Marruffo/pmarruffo@saukvalley.com

Rock Falls Mayor Bill Wescott speaks during a Veterans Day ceremony Monday at Veterans Memorial Park in Rock Falls.

Smiddy, Joyce also attended ceremony SUICIDE

CONTINUED FROM A1

He said he was reading a speech supplied by the American Legion and that he had not seen a focus on suicides before. “I’ve been talking about this for years,� he said. “[Service members] are going on tours two or

three times. That’s more than we should ask of them. We haven’t seen all of the negative effects from this. It really scares me.� During the ceremony at the band shell in Veterans Memorial Park, Mayor Bill Wescott, who served in the Air Force, praised veterans. “We have a simple

heartfelt message: Thank you,� he said. State Rep. Mike Smiddy, D-Hillsdale, who represents Whiteside County, and Whiteside County State’s Attorney Trish Joyce also attended. Later, veterans visited 10 nursing homes in Sterling and Rock Falls to honor those who couldn’t make it to the ceremony.

 

     Storm & Bullet Shelters

!.4%..! s 3!4%,,)4% s 3526%),,!.#% s ).4%2.%4

815-625-4492

’’

&' ()' ' &        !"#  $%


!s3AUK6ALLEY-EDIA

MONEY & MARKETS

WWWSAUKVALLEYCOM

4UESDAY .OVEMBER 

TYPHOON HAIYAN

Desperate survivors seek to flee area Millions without shelter or food

The following stock quotations, as of 5 p.m., are provided as a community service by Robert Kim Pettygrove and Chad Weigle of Edward Jones, Dixon and Raymond James and Associates, Sterling. Abbott...................................37.90 Alcoa.......................................9.02 AltriaCorp.............................37.44 Autonation...........................48.10 American Express................81.38 Arris-Group..........................17.22 Apple..................................519.29 ADM.....................................41.14 AT&T....................................35.03 Bank of America...................14.40 Boeing.................................132.49 BorgWarner........................101.08 BP.........................................46.09 Casey’s..................................76.34 Caterpillar............................84.15 CenturyLink.........................31.50 Chevron..............................121.07 Cisco.....................................23.44 Citigroup...............................50.16 CNW.....................................40.83 CocaCola..............................39.84 ConAgra................................32.41 Dean.....................................19.71 Deere & Co...........................81.85 Disney...................................68.34 Donaldson............................39.79 DuPont.................................62.08 Exxon....................................92.95 Ford......................................16.09 Exelon...................................28.84 GE.........................................27.01 FifthThird.............................19.77 HawaiianElectric.................26.54 Hewlett Packard..................21.75 HomeDepot.........................75.36 Intel Corp.............................24.17 IBM.....................................182.88 IntlPaper...............................44.52 JCPenney................................8.55 JohnsonControls..................47.50 Johnson&Johnson...............94.29 JPMorgan Chase..................54.10 Kraft......................................52.38 Kroger...................................41.51 Leggett&Platt.......................29.39 Manpower............................80.68 McDonald’s..........................97.07 Merck&Co............................46.99 Microsoft..............................37.59 3M.......................................127.96 Monsanto...........................106.50 Newell...................................29.19 AGL.......................................48.24 Nike......................................77.14 Parker-Han.........................116.52 Pfizer.....................................31.24 Pepsico.................................85.45 Procter&Gamble..................82.25 RaymondJames....................46.20 Republic...............................34.09 Sears Hldg............................59.98 SensientTech........................50.91 Sprint......................................6.98 Staples...................................15.88 TheTravelers........................87.95 UnitedContinental..............35.31 UnitedTech........................108.06 USBancorp...........................37.93 USSteel.................................27.22 Verizon..................................49.96 Walgreen...............................59.45 WalMartStores.....................79.01 WalMartMexico...................24.36 WasteMgt.............................44.12 Wendy’s..................................8.34

Commodities The following quotations are provided as a community service by Sterling Futures: Corn: Dec. 4.34 1â „2; March 4.46 1â „2; July 4.55 1â „2 Soybeans: Nov. 13.08; Jan. 13.01; May 12.62 1â „2 Soybean oil: Dec. 40.42; March 41.16 Soybean meal: Dec. 422.10; March 403.60 Wheat: Dec. 6.46 1â „ 4; July 6.64 3â „4 Oats: Dec. 3.40 1 â „ 4 ; July 3.11 1â „2 Live cattle: Dec. 132.75; Feb. 134.37; April 135.27 Feeder cattle: Nov. 164.20; May 165.55 Lean hogs: Dec. 88.05; Feb. 92.22; April 94.05 Sugar: March 17.97 Cotton: Dec. 76.97 T-Bonds: Dec. 131 13â „32 Silver: Dec. 21.36 Gold: Dec. 1282.80 Copper: Dec. 3.2555 Crude: Dec. 95.13 Dollar Index: Dec. 81.16

TACLOBAN, Philippines (AP) – Thousands of typhoon survivors swarmed the airport here on Tuesday seeking a flight out, but only a few hundred made it, leaving behind a shattered, rainlashed city short of food and water and littered with countless bodies. Four days after the typhoon struck, only a trickle of assistance has made it to affected communities along the eastern seaboard, which bore the brunt of Typhoon Haiyan. Authorities estimate it killed 10,000 or more. Millions are without shelter or food. Tacloban, a city of about 400,000 people on Leyte island, is among the hardest hit. Two Philippine Air Force C-130s arrived at its destroyed airport just after dawn, along with several commercial and private flights. The planes were greeted by scenes of chaos as more than 3,000 people who camped out at the building surged onto the tarmac past a broken iron fence to get on the aircraft. Just a dozen soldiers and several police held them back. Mothers raised their babies high above their heads in the rain, in hopes of being priori-

AP

Survivors look at a military C-130 plane which arrives Monday at typhoon-ravaged Tacloban, in Leyte province in central Philippines. Stunned survivors of one of the most powerful typhoons ever to make landfall picked through the remains of their homes Monday and pleaded for food and medicine as the Philippines struggled to deal with what is likely its deadliest natural disaster. tized. One lady in her thirties lay on a stretcher, shaking uncontrollably. Only a small number managed to board. “I was pleading with the soldiers. I was kneeling and begging because I have diabetes,� said Helen Cordial, whose house was destroyed in the storm. “Do they want me to die in this airport? They are stone hearted.� Most residents spent

Monday night under pouring rain wherever they could – in the ruins of destroyed houses, in the open along roadsides and shredded trees. Some slept under tents brought in by the government or relief groups. Local doctors said they were desperate for medicines. Beside the ruined airport tower, at a small makeshift clinic with shattered windows an,

army and air force medics said they had treated around 1,000 people since the typhoon for cuts, bruises, lacerations, deep wounds. “It’s overwhelming,� said Air Force Capt. Antonio Tamayo. “We need more medicine. We cannot give anti-tetanus vaccine shots because we have none.� International aid groups and militaries are rushing

assistance to the region, but little has arrived yet. The USS George Washington was expected to arrive off the coast in about 2 days, according to the Pentagon. A similar sized U.S. ship, and its fleet of helicopters capable of dropping tons of water daily and evacuating wounded, was credited with saving scores of lives after the 2004 Asian tsunami.

BLACK FRIDAY PRICES TODAY

AT CLOVER HILLS

$399

TOP LOAD LAUNDRY DEALS

.99 ea.

(*$798.99 PAIR)

Model # GTWN4250DWS Ĺ˜  '2( FX IW &DSDFLW\ Ĺ˜  :DVK &\FOHV Ĺ˜  530 6SLQ 6SHHG

$499

SAVE $500 ON PAIR PURCHASE

Model # GTDP490EDWS Ĺ˜  FX IW &DSDFLW\ Ĺ˜ +( 6HQVRU 'U\ Ĺ˜ :ULQNOH &DUH

.99 ea.

(*$998.99 PAIR) Model # WA400PJHDWR Ĺ˜  FX IW &DSDFLW\ Ĺ˜ (QHUJ\ 6WDU &(( 7LHU  Ĺ˜ %HGGLQJ &\FOH

Model # DV400EWHDWR Ĺ˜  FX IW &DSDFLW\ Ĺ˜ :ULQNOH 3UHYHQW Ĺ˜ 6HQVRU 'U\

FRONT LOAD LAUNDRY DEAL

SAVE $600 ON PAIR PURCHASE Model # WF365BTBGWR Ĺ˜ 6WHDP :DVK Ĺ˜ ,QWHUQDO :DWHU +HDWHU Ĺ˜ 957 7HFKQRORJ\ (Vibration Reduction)

Model # DV365ETBGWR Ĺ˜ 6WHDP 'U\HU Ĺ˜ 6HQVRU 'U\ Ĺ˜ .LQJ6L]H &DSDFLW\

$599

*AVAILABLE WITH ELECTRIC DRYER ONLY

.99

ea. (*$1198.99 PAIR)

UP TO 12 MONTHS NO INTEREST FINANCING AVAILABLE (WITH APPROVED CREDIT)

2%.4 4/ /7. !6!),!",%

2400 N. Locust St. Sterling, IL

815.625.8529 s !PPLIANCES s 46S s -ATTRESSES s (OT 4UBS

Mon - Fri 9am - 5pm Sat 9am - 3pm

Sondra Mills, Wayne Walker & Terry Miller


PICK A NUMBER: SVM TAKES DEEPER LOOK AT ROUND 2. HIGH SCHOOL FOOTBALL, B2.

TELEGRAPH SPORTS

GET CONNECTED

Section B

e-mail: sports@saukvalley.com

Tuesday, November 12, 2013

Back with Pack

Now playing

Former backup and failed starter in Seattle and Oakland, Matt Flynn, signs with Packers after a workout Monday. Green Bay is down to third QB after injuries to Aaron Rodgers and Seneca Wallace.

Sports editor Dan Woessner uses four downs to recap the second round of the high school football playoffs in latest video at saukvalleysports.com.

‘Like’ us! Sauk Valley Sports

Sports for the Sauk Valley fan!

NFL | BEARS

Injuries piling up for Bears Cutler out for Ravens’ game; Tillman placed on IR BY GENE CHAMBERLAIN Associated Press

LAKE FOREST – If the Chicago Bears are going to make a playoff run, it will be without cornerback Charles Tillman and possibly quarterback Jay Cutler. Cutler, who left Sunday’s 21-19 loss to the Detroit Lions, has a Endangered list high left ankle sprain and will miss Sunday’s game against the BaltiJay Cutler Ankle/Groin more Ravens. He is listed as week Lance Briggs Shoulder to week by the team, and Josh Charles Tillman Triceps tear McCown will start. Henry Melton ACL tear “This is a week to week [injuD.J. Williams Pectoral tear ry], and it certainly won’t be this week,” coach Marc Trestman said ceps muscle in the second half Monday about Cutler’s return. Tillman suffered a torn right tri- Sunday, and has been placed on

injured reserve/designated to return. He can return to practice in 6 weeks and is eligible to play again in 8 weeks. The Bears (5-4) have seven games remaining. “The fact that I’m no longer a part of that to help this team further succeed, that’s the part that hurts,” said Tillman. “My role right now is to be the biggest cheerleader and supporter on the sideline.” The Bears defense already was without three starters in linebacker Lance Briggs (shoulder fracture), defensive tackle Henry Melton (ACL tear) and linebacker D.J. Williams (torn pectoral muscle). INJURIES CONTINUED ON B4

AP

Bears quarterback Jay Cutler kneels on the field after a play during the second half of Sunday’s game against the Lions. Cutler was removed late in the game with a high-ankle sprain.

COLLEGE FOOTBALL | BCS NATIONAL CHAMPIONSHIP

1.

2.

3.

Associated Press

Alabama, Florida State and Ohio State are all undefeated as the college football season hits the home streatch. Ohio State receiver Evan Spencer said on Monday that the Buckeyes would “wipe the field” with either Alabama or Florida State.

Three’s a crowd

Ohio State believes it belongs in BCS Championship picture Spencer, added, “That’s just my bias speaking.” COLUMBUS, Ohio – Bring on ‘Bama. Actually, Spencer didn’t menFlorida State, too. tion Florida State. Asked if he was Ohio State wide receiver Evan Spenreferring to the Seminoles, he said, cer made it clear Monday that he “Whoever.” believes the Buckeyes are better than Urban Meyer took a very different No. 3. Spencer had a chance to watch approach to making it known that he two-time defending national chamthinks the Buckeyes deserve a chance pion Alabama and second-ranked to play for the national title. Florida State last weekend while the Meyer said he voted the Buckeyes Buckeyes had an open date. (9-0, 5-0 Big Ten) No. 2 on his USA “I guess I’m a little biased but I think Today coaches’ poll ballot – behind we’d wipe the field with both of them,” Alabama but ahead of Florida State. said Spencer with a chuckle. The “I believe we have Alabama, Ohio junior, who is the son of former Ohio State, Florida State,” Meyer said of State and NFL player and coach Tim his ballot. He couldn’t remember the BY RUSTY MILLER AP Sports Writer

SPORTS inside

order of the next two teams, between Stanford and Baylor. Asked for his rationale in voting that way, Meyer said, “I had us [No.] 2 all year. I just think we’re playing like one of the top teams in the country right now.” The coaches’ poll is used in the BCS standings formula. The Buckeyes are clearly a confident group, going into a game at Illinois on Saturday. The Illini (3-6, 0-5) have lost 19 consecutive Big Ten games, while Ohio State owns the nation’s longest winning streak at 21 in a row. CROWD CONTINUED ON B3

Undefeated teams BCS Rank Record Conference 1. Alabama 9-0 SEC 2. Florida St. 9-0 ACC 3. Ohio St. 9-0 Big Ten 5. Baylor 8-0 Big 12 14. Fresno St. 9-0 Mountain West 15. N. Illinois 9-0 MAC

MLB

NBA

Plans for new home of the Braves, B3.

Bulls take Cavs’ best shot, B4.

Suggestion box Comment or story tip? Contact Sports Editor Dan Woessner at dwoessner@saukvalley.com or 800-798-4085, ext. 555


TOP OF 2

Take a seat Venric Mark .ORTHWESTERNCOACHPat FitzgeraldSAYSTHATSTAR RUNNINGBACKAND!LL !MERICANPUNTRETURNERWILLSIT OUTSEASONWITHLEGINJURY

!FTERSTRUGGLINGWITHCONCUSSIONSANDOTHERINJURIES 4WINSALL STARCATCHERWILL TRANSITIONTOFIRSTBASENEXT SEASONTOREDUCERISK

Your guide to what’s going on in sports

"s3AUK6ALLEY-EDIA

sportShorts

Taking off mask Joe Mauer

WWWSAUKVALLEYCOM

4UESDAY .OVEMBER 

HIGH SCHOOL FOOTBALL | BY THE NUMBERS | PLAYOFFS

SVM staff, wire services CROSS COUNTRY

On the calendar Local events

Johnson competes at nationals Aubree Johnson A GRADUATEOF2OCK&ALLS (IGH3CHOOL COMPETEDAT THE.*#!!MEETON3ATURDAYIN&ORT$ODGE )OWA *OHNSON AFRESHMANAT 3AUK6ALLEY RANAPERSONAL BESTMINUTES SECONDSTOPLACETHOUTOF RUNNERS

Today Boys bowling 4 p.m.

s/TTAWAAT$IXON

Wednesday Men’s basketball 7:30 p.m.

s-ADISON4ECHAT3AUK 6ALLEY Women’s basketball

MLB

Leagues name top rookies for 2013 Jose FernandezOFTHE -IAMI-ARLINSANDWil MyersOFTHE4AMPA"AY 2AYSHAVEBEENSELECTED BASEBALLS2OOKIESOFTHE 9EAR &ERNANDEZ  WENT  WITH%2!IN INNINGS(EHADSTRIKEOUTSANDWALKS -YERS  YEAR OLDRIGHT FIELDER HITWITHAN /"0AND3,' (EHADHOMERUNSAND 2")S NFL

Cowboys’ Lee out 3-4 weeks $ALLAS#OWBOYSLINEBACKERSean LeeISOUTFOR THREEORFOURWEEKSWITHA HAMSTRINGPULL ,EEWASINJUREDIN THESECONDQUARTEROF 3UNDAYS LOSSTO THE.EW/RLEANS3AINTS ,EEHADAN-2)ON -ONDAY(ESAIDAFTERTHE GAMETHATTHEINJURYWAS hNOTGOODv

Manning aggravates ankle injury $ENVER"RONCOSQUARTERBACKPeyton ManningAGGRAVATEDANANKLE INJURYDURING3UNDAYSWIN OVERTHE3AN$IEGO#HARGERS BUTWILLNOTMISSANY GAMES !N-2)ON-ANNINGS INJUREDRIGHTANKLEREVEALED NONEWDAMAGE ACCORDING TOTHEREPORT COLLEGE FOOTBALL

Martinez’s college career could be over )NJURED.EBRASKAQUARTERBACKTaylor Martinez MIGHTNEVERPLAYANOTHER GAMEFORTHE#ORNHUSKERS -ARTINEZ ASENIOR HAS MISSEDTHELASTTWOGAMES ANDFIVEOFTHELASTSIXWITH AVARIETYOFINJURIES ANDAN INJURYTO-ARTINEZSFOOTIS THECURRENTPROBLEMTHAT MAYNOTALLOWHIMTORETURN THISSEASON %30.REPORTED-ARTINEZ MIGHTNEEDTOMONTHS TORECOVERFROMTHEINJURY LOCATEDBETWEEN-ARTINEZS SECONDANDTHIRDTOES

Illini lose left tackle for OSU game 7HEN)LLINOISFACES/HIO 3TATEANDTHE"UCKEYES THIRD RANKEDDEFENSEINTHE "IG4EN ITWILLBEWITHOUTA KEYCOGONTHEOFFENSIVELINE ,EFTTACKLESimon CvijanovicWILLMISSTHEGAME BECAUSEOFAHIGHLEFT ANKLESPRAINHESUFFEREDIN 3ATURDAYSLOSSTO)NDIANA COACHTim BeckmanSAID MEN’S TENNIS

Djokovic dominates Nadal at ATP Finals 4HEMESSAGEFROM Novak DjokovicCOULDNOT HAVEBEENMOREEMPHATIC ASHERETAINEDHISTITLEAT THE!407ORLD4OUR&INALS ON-ONDAYWITHACRUSHING VICTORYOVERRafa Nadal. .ADALDESERVEDLYENDS THEYEARASTHEWORLD .OAFTERANINCREDIBLE COMEBACKFROMINJURY BUT THEWAYTHE3ERBRANHIM RAGGEDINA  VICTORYATTHE/!RENAWAS ANOMINOUSSMOKESIGNAL AHEADOFNEXTYEAR

5:30 p.m.

s-ADISON4ECHAT3AUK 6ALLEY Boys bowling 4 p.m.

s$IXONAT3TREATOR

Philip Marruffo/pmarruffo@saukvalley.com

Erie-Prophetstown’s Jack Heflin (51) and Noah Eads celebrate a tackle that forced a turnover on downs against Stillman Valley in the teams’ second-round game on Saturday at Wayne Hein Field. Here are some numbers that help explain the second round of the 2013 high school football playoffs.

On the tube TV listings

22

That’s how points that area teams scored combined in the first drive of games on Saturday. The Newman Comets needed one offensive play to reach pay dirt. Jake Snow went untouched for 79 yards against EastlandPearl City at Roscoe Eades Stadium. Brandon Ahlgrim’s extra-point gave Newman (101) a 7-0 lead. The Comets went on to win 35-12. The Erie-Prophetstown Panthers worked the ball to midfield on seven plays before needing 7 yards on fourth down. Chris Bauer did better than that, going 47 yards to the end zone. Nick Williams powered across the goal line for the 2-point conversion to put the Panthers up 8-0 on Stillman Valley. The Oregon Hawks executed a perfect game plan against Aurora Christian, going 73 yards on 18 plays to eat up 9 minutes, 16 seconds clock to start the game against a high-powered team. The drive ended with a 2-yard TD pass from Tyler Blume to Pierce Dhaese. Sawyer Reynolds booted the extra point to put Oregon up 7-0.

5

That’s how many times Aurora Christian had the ball in the first half against Oregon, and that’s how many touchdowns the Eagles scored in the first half. The Eagles took a 35-7 lead into the break en route to a 49-20 win. Aurora Christian is looking for its third straight state championship in 3A.

7-1

That is Aurora Christian’s all-time record against teams from the Sauk Valley in the playoffs. The Eagles lost their first meeting with an area team, 22-0 to AFC in the 2003 playoffs. Aurora Christian avenged that loss the very next season. Since then, Aurora Christian has knocked West Carroll, Amboy and Newman out of the playoffs each one time. Oregon has been a favorite target, as the Eagles have ended the Hawks’ season 3 of the last 4 years.

23

That’s how many tackles that safeties Walter Ollie and Cody Kluck combined for during Eastland-Pearl City’s loss to Newman. Ollie had 12 tackles and Kluck had 11, as Newman running backs continually burst through the Wildcatz’s first two levels of defense.

Today Men’s basketball 6 a.m.

s(ARTFORDAT&LORIDA'ULF #OAST %30. 10 a.m.

s,35AT5-ASS %30. Noon

s76IRGINIAAT6IRGINIA 4ECH %30. 2 p.m.

Chris Johnson/Shaw Media

Nick Newman (24) tries to find a hole in the Aurora Christian defense during Saturday’s second-round game in Aurora. The Hawks drove 73 yards for a touchdown on the opening drive but lost 49-20. The EPC defense was on the field a long time, as the Comets ran 63 offensive plays. The Wildcatz ran 47 offensive plays. Linebacker Michael Ely led Newman with 12 tackles.

106

That’s how many yards that Newman’s Jake Snow had after two rushes against EastlandPearl City. After his 79-yard touchdown, he broke a tackle near the sideline on Newman’s next possession, then changed direction and ran to the opposite hash before going upfield for 27 yards. If you add the 29-yard touchdown he had on his last carry of the game, he had 135 of his 199 yards on three carries. He rushed the ball a total of 20 times.

13

That’s how times Newman has advanced to the quarterfinal round of the playoffs. The Comets are 2-2 the last 4 years in the quarterfinals. In 2009, they lost a heartbreaker to Stillman Valley, 21-20 in the Class 3A playoffs. The next season, they edged Morrison 22-19 in a classic game at Roscoe Eades Stadium. In 2011, the Comets and Mustangs met again. This time the Mustangs won 15-12. Last fall, Newman edged Wilmington, 28-26.

2,094

That’s how many rushing yards that Erie-Prophetstown senior Nick Williams finished with after 135 yards in the loss to Stillman Valley. The fullback is the second back since 2005 to reach the 2,000-yard mark. Morrison’s Josh Vos went for 2,115 in the Mustangs’ championship run in 2009. Newman’s Jake Snow is at 1,419 yards. He would need to average nearly 200 yards a game if the Comets advance all the way to the state title game to reach the 2,000-yard mark. Snow had 199 on Saturday.

10-0

That’s Stillman Valley’s record against current Three Rivers North teams in the playoffs after Saturday’s win over ErieProphetstown. The Cardinals – out of the Big Northern West – have had a series of close, classic games with Three Rivers North teams. The most recent was a one-point win over Newman in 2009. They also beat Newman 21-14 in 1997. The Cardinals have beat Fulton four times. They won in blowout fashion 45-6 in 1999. After that the games were much closer. The Cardinals won 20-19 in 2000 and 14-0 in 2001. In 2003, Stillman beat the Steamers 27-20 in the first round. Two rounds later, the Cardinals beat Amboy 21-0. They beat Erie-Prophetstown in 2002, 18-14, in the Panthers’ second season as a co-op.

4

That’s how many four-loss teams remain in the playoffs after two rounds. In Class 2A, Staunton beat top-seed Fairfield 8-0 in the first round, and followed that up with a 19-14 win over Carlyle (8-2) on Saturday. In 4A, Belleville Althoff has playoff wins over Columbia (9-1) and Herrin (7-3), and now will face three-time defending state champ Rochester. There are two four-loss teams in 6A. Prairie Ridge beat Lakes (8-2) 21-14 in the first round, and followed that with a 21-20 win over Marmion. It draws Boylan in the quarterfinals. Providence beat Crete-Monee (8-2) 25-14 in the first round and clobbered Quincy (8-3) 55-27 in the second round. It will host East St. Louis.

18

That’s how many state championships that Joliet Catholic and Montini have combined to win. The teams will play in the 5A quarterfinals at 1 p.m. Saturday at Joliet Catholic.

s-ORGAN3TAT/HIO3T DELAY "4. s3#AROLINAAT"AYLOR %30. 4 p.m.

s.#3TATEAT#INCINNATI %30. 5 p.m.

s,)5 "ROOKLYNAT)NDIANA "4. 6 p.m.

s6#5AT6IRGINIA %30. s'RAMBLING3TAT-ARQUETTE &OX3PORTS s&RESNO3TAT0ITT &3. 6:30 p.m.

s-ICHIGAN3TVS+ENTUCKY AT#HICAGO %30. 7 p.m.

s/HIOAT/HIO3T "4. s$REXELAT)LLINOIS3T #3. 8 p.m.

s&LORIDAAT7ISCONSIN %30. s3)LLINOISAT-ISSOURI &3. s4ENNESSEEAT8AVIER &OX3PORTS 8:30 p.m.

s+ANSASVS$UKE AT#HICAGO %30.

NBA 9 a.m.

s'RIZZLIESAT0ACERS &3.

NHL 7 p.m.

s#OYOTESAT"LUES ."#30

Let us hear it s'AMERESULTS STORY TIPS ATHLETEOFTHEWEEK NOMINATIONS TEAM ANDINDIVIDUALSTATS CANBEFAXEDTO   CALLEDINTO    EXT OREMAILEDTOSPORTS SAUKVALLEYCOM

Contact us at 800-798-4085 Sports Editor Dan Woessner EXT DWOESSNER SAUKVALLEYCOM Asst. Sports Editor Christopher Heimerman EXT CHEIMERMAN SAUKVALLEYCOM Sports Reporters Larry Brennan EXT LBRENNAN SAUKVALLEYCOM Ty Reynolds EXT TREYNOLDS SAUKVALLEYCOM Brian Weidman EXT BWEIDMAN SAUKVALLEYCOM


4UESDAY .OVEMBER 

www.saukvalley.com

MLB

3AUK6ALLEY-EDIAs"

COLLEGE FOOTBALL

Huskies face bigger test One-loss Ball State latest obstacle for unbeaten NIU BY SHANNON RYAN Chicago Tribune

AP

In this April 8, 2005 file photo, the Atlanta Braves (right) and New York Mets stand on the baselines at Turner Field in Atlanta during opening-day ceremonies. The Braves are leaving Turner Field and moving into a new 42,000-seat, $672 million stadium complex in Cobb County in 2017.

Money drives impending move Braves to move to suburbs by 2017 BY PAUL NEWBERRY !03PORTS7RITER

A T L A N T A – T u rn e r Field had a signature event right at the start – a trembling Muhammad Ali emerging from the shadows to ignite the flame that opened the 1996 Summer Olympics. In the years that followed, the Atlanta Braves hosted many memorable moments of their own, from a World Series and All-Star Game to the farewells of Bobby Cox and Chipper Jones. Now, just 17 years after it opened, it looks as though the stadium affectionately known as “the Ted� is headed for extinction, like so many sports facilities in this city. In a stunning announcement, the Braves said Monday they are moving to a new 42,000-seat, $672 million stadium about 10 miles from downtown in suburban Cobb County, apparently swayed by a lucrative financial package that was just too good to pass up. Mayor Kasim Reed said the city couldn’t match a $450 million offer from one of Atlanta’s sprawling northern suburbs, though it wasn’t immediately clear how the county of some 700,000 people plans to raise the money, or whether it will require a vote of the taxpayers. Mike Plant, the Braves’ executive vice president of business operations, said the team has not signed a contract with Cobb County, but he’s “100 percent certain it will happen.� Until now, Cobb County was perhaps best-known nationally as the base of former House speaker Newt Gingrich and for passing an anti-gay ordinance in the 1990s that led the Olympic organizing committee to abandon plans to hold events there during the Atlanta Games.

Stadiums newer than Turner Field s#HASE&IELD 0HOENIX  s3AFECO&IELD 3EATTLE  s!440ARK 3AN&RAN cisco, 2000 s#OMERICA0ARK $ETROIT  s-INUTE-AID0ARK (OUSTON  s-ILLER0ARK -ILWAUKEE 2001 s0.#0ARK 0ITTSBURGH 2001 s'REAT!MERICAN"ALL 0ARK #INCINNATI  s#ITIZENS"ANK0ARK 0HILADELPHIA  s0ETCO0ARK 3AN $IEGO  s"USCH3TADIUM 3T ,OUIS  s.ATIONALS0ARK 7ASH INGTON $#  s#ITI&IELD 1UEENS .EW9ORK  s9ANKEE3TADIUM "RONX .EW9ORK  s4ARGET&IELD -INNE APOLIS  s-ARLINS0ARK -IAMI 2012 In 2017, it will become the home of the Braves. “It was with mixed emotions that we made this decision,� team president John Schuerholz said. “The new stadium, we believe, will be one of the most magnificent ever built.� Cobb Commission Chairman Tim Lee said the team is working to finalize a memorandum of understanding that would be presented to the full commission at its Nov. 26 meeting. He said his fellow commissioners have already been briefed on the deal. “The response has been very positive, very enthusiastic and supportive of this investment, which will bring significant economic growth to Cobb County and the region,� Lee said. He declined to answer any questions about public financing.

DEKALB – The air is a little chillier, the schedule is a little shorter and Ball State is the next game up. For Northern Illinois that means one thing: The stakes are rising. The No. 18 Huskies (9-0, 5-0 Mid-American Conference) have beaten their last three opponents by 21, 39 and 44 points, but they know Wednesday’s home game against the more formidable Cardinals (9-1, 6-0) could decide the MAC race. They’ve been waiting for this time of year. “You try to take it one game at a time, but everybody takes a peek a little further,� quarterback Jordan Lynch said. “I saw we had Ball State and knew it was going to come down to this.� Ball State ranks second to NIU in the MAC in scoring (39.9 points per game to NIU’s 44.2) and total offense (475.7 yards to 545.4), while leading the league with 323 passing yards per game. “It’s the best that I’ve seen on film right now, just on how they execute their game plan overall,� coach Rod Carey said of the Cardinals’ offense. The teams’ quarterbacks also are in a tight race statistically as Keith Wenning leads the conference and ranks second nationally at 316.4 passing yards a game. Lynch leads the confer-

AP

Northern Illinois quarterback Jordan Lynch (6) and company could get a test Wednesday when the unbeaten Huskies host one-loss Ball State. spot this week in the BCS). sVS"ALL3TATE   -!# PM7EDNESDAY The Huskies could do %30. more to enhance their profile Wednesday with sAT4OLEDO    PM.OV%30. the game airing on sVS7-ICHIGAN    PM.OV ESPN2. %30. “It’s good for Norths-!##HAMPIONSHIP PM$EC%30. ern Illinois and the Mids"OWLGAME 4"$ American Conference,� Note: .)5HASNOTQUALIFIEDFORTHE-!##HAMPION Lynch said. “Some SHIPGAMEYET people don’t necessarence and ranks 11th put him as a long shot to ily have the chance to nationally with 335.7 win. Carey was emphatic watch [MAC] football. So that’s good for us and it yards of total offense Thursday when he said per game. Lynch also Lynch should be a legiti- gives us great exposure.� Carey said running ranks second nationally mate contender. by being responsible for “I haven’t been around back Cameron Stingily (turf toe) is not 100 192 points on 32 touchanybody, and I haven’t percent but will play downs. personally seen anyagainst Ball State. He “He’s one of the best body, that means more returned from a onequarterbacks in the MAC to their team,� Carey and overall in the coun- said. “I think he certainly game absence Saturday against Massachusetts. try,� Lynch said of Wen- absolutely should be in Cornerback Sean Evans ning. the conversation.� NIU launched a HeisThe Huskies could also (knee) is considered man campaign for perceive a snub in their day-to-day after missing Lynch, but oddsmakers drop in the polls (one the last three games.

Between NIU and perfection

Illini have chance to ruin Buckeyes’ plans CROWD

their kids stack up against your kids.� Coombs declined to say if he felt Ohio State could Ohio State has domihold its own against the nated the Big Ten over likes of the Crimson Tide the past 2 years, winning and Seminoles. close games and winning “I’m not in a place to blow-outs alike. That has evaluate that,� he said. worked against the Buck“I’d like to think we could eyes, since many voters – hold our own against both in media and among anybody. We’re looking the coaches – believe the forward to playing anyBig Ten has fallen on hard body and everybody that times in terms of talent. shows up.� For much of this season, The Buckeyes’ remainthe Buckeyes have been ing schedule after Illinois AP the only Big Ten team Ohio State might be No. 3 in the polls, but receiver is home against Indiana ranked among the top 15 Evan Spencer (6) thinks the Buckeyes are better (4-5, 2-3) and then the annual late-November in the polls. than No. 1 Alabama and No. 2 Florida State. feud with rival MichiThe Southeastern Conwatch most of the other take a convincing 38-17 gan (6-3, 2-3) at The Big ference, meanwhile, top teams in action. On win over No. 10 LSU, and House. has won the last seven Florida State, which is After that will likely national championships, Thursday night, they watched then-No. 2 second in the BCS stand- come the Big Ten chamwith Alabama winning ings behind Alabama, roll pionship game – the three of the last four. The Oregon lose to No. 5 over Wake Forest, 59-3. Buckeyes have the inside Crimson Tide and Florida Stanford, 26-20, and “We’re football junktrack at winning the State, which has powered undefeated and fifthranked Baylor pound No. ies,� Ohio State assistant Leaders Division title and its way back to national 12 Oklahoma, 41-12. coach Kerry Coombs the same goes for Michiprominence this season, On Saturday, most of said. “That was enjoyable. gan State in the Legends are both unbeaten. the Buckeyes were watch- You do watch those guys. – before the final BCS The top two teams in ing as Alabama broke You want to watch good rankings come out along the Bowl Championship free in the second half to teams play, and see how with the bowl bids. Series rankings will play in the national championship game at the Rose Bowl on Jan. 6. The off week enabled Ohio State’s playLimited amount available ers and coaches to CONTINUED FROM B1

Don’t forget to order your

2012 CHEVY IMPALA LS

2014 Pet Idol 13-month calendar

#U750

0LEASERESERVE??????OFCALENDARSFOR Calendars will be ready for pick up November 1st.

Pete’s Price!

$

.AME????????????????????????????????????????? !DDRESS???????????????????????????????????????

15,788

#ITY???????????????????????3T?????:IP????????

*

$

0

0HONE????????????????????????????????????????

228

$ DOWN

ŔŞżĹ&#x;Ĺ˜Ĺ‘Ĺž R Ĺ›Ĺ?Ĺ“Ĺ‘ R Ĺ‘Ĺ‘Ĺœ R Ĺ?Ĺ™

815-625-2290 . jf 6 .,&#(!

0AYMENT-ETHOD???#ASH???#HECK#REDIT#ARD???6ISA???-ASTER#ARD???$ISCOVER ++

/mo

WWW.PETEHARKNESS.COM ++With approved credit. Plus tax, title, license & doc fees. 3.9% x 78 months. *Plus tax, title, license & doc fees. Photo for illustration only. Dealer not liable for errors.

#REDIT#ARD????????????????????????????????????%XP$ATE???????????? 3IGNATUREFOR#REDIT#ARDORDERSONLY????????????????????????????????????????????????

Fill out the order form and drop it off or mail it in with your payment: Sauk Valley Media %,INCOLNWAYs0/"OX 3TERLING ),

Telegraph 30EORIA!VENUE $IXON ),


"s3AUK6ALLEY-EDIA

WWWSAUKVALLEYCOM

MONDAY’S SCOREBOARD

NBA | BULLS 96, CAVALIERS 81

Thorny issue for Bulls Rose injures hammy in victory over Cavs BY JAY COHEN !03PORTS7RITER

CHICAGO – Derrick Rose had 16 points before leaving in the fourth quarter with a right hamstring injury, and the Chicago Bulls pulled away from the Cleveland Cavaliers for a 96-81 victory on Monday night. Rose grimaced after he drove down the lane for a twisting layup with 3:39 left. He remained in the game for a short time before he was pulled for Kirk Hinrich, and a trainer then attended to the 2011 NBA MVP at the end of the bench. “It’s just a minor sprain,� Rose said. “Nothing bad.� Rose will be re-evaluated today, and he said he thought he would be able to play Friday night at Toronto. Carlos Boozer scored 17 points, and reserve Mike Dunleavy Jr. added a season-high 16 for Chicago, which went 24 for 26 at the free-throw line. Luol Deng finished with 12 points. Kyrie Irving had 16 points for Cleveland, but was 5 for 19 from the field in his first game against Rose. The Cavaliers committed 20 turnovers, leading to 29 points for the Bulls. “When we hit adversity tonight, we didn’t handle it well,� Cleveland coach Mike Brown said. “They took us out of what we wanted to do.� Chicago opened a 13-point lead on Booz-

CONTINUED FROM B1

“It just so happened, the injury bug, it has a hold of our team for some reason,� Tillman said. Trestman said Cutler’s injury occurred almost 3 minutes into the second quarter when a defender rolled up his ankle. Cutler continued to play, but left before the game’s final drive. Trestman said he never thought Cutler reached the point where his play was hindering the team until his final pass, one made on the run that went into the ground in front of wide receiver Alshon Jeffery. “It’s very tough to pull your starting quarterback out when he’s throwing the ball with velocity, when he’s hitting his receivers, and he’s able to move in the pocket and complete a throwing motion,� Trestman said. “All those three indications confirmed with me that I should keep him in there. I know we sacrificed his ability to move around and run [by keeping him in], but that

Football Playoff Pairings Quarterfinals

CLASS 1A s.O,ENA 7INSLOW  AT.O3TOCK TON  3ATURDAY s.O/TTAWA-ARQUETTE  AT.O ,EO  3ATURDAY s.O#ASEY 7ESTFIELD  AT.O4RI 6ALLEY  3ATURDAY s.O#AMP0OINT#ENTRAL  AT.O -AROA &ORSYTH  3ATURDAY

CLASS 2A s.O.EWMAN  AT.O-OMENCE   3ATURDAY s.O&ARMINGTON  AT.O-ERCER #OUNTY  3ATURDAY s.O!UBURN  AT.O#ERRO'ORDO   3ATURDAY s .O  3TAUNTON   AT .O  'ILLESPIE   3ATURDAY

CLASS 3A s.O7INNEBAGO  AT.O3TILLMAN 6ALLEY  3ATURDAY s .O  !URORA #HRISTIAN   AT .O  3ENECA  3ATURDAY s .O  7ILLIAMSVILLE   AT .O  3T *OSEPH /GDEN  3ATURDAY s.O'REENVILLE  AT.O-T#AR MEL  3ATURDAY

CLASS 4A s .O  'ENESEO   AT .O  0HILLIPS   3ATURDAY s.O(ARVARD  AT.O2OCKFORD ,UTHERAN  3ATURDAY s.O2OCHESTER  AT.O"ELLEVILLE !LTHOFF  3ATURDAY s.O1UINCY.OTRE$AME  AT.O !LLEMAN  3ATURDAY

W    

South L T        

Pct PF        

PA    

W    

North L T        

Pct PF        

PA    

W 3EATTLE  3AN&RANCISCO !RIZONA  3T,OUIS 

West L T        

Pct PF        

PA    

.EW/RLEANS #AROLINA !TLANTA 4AMPA"AY

$ETROIT #HICAGO 'REEN"AY -INNESOTA

Monday’s result 4AMPA"AY -IAMI Thursday’s game )NDIANAPOLISAT4ENNESSEE PM Sunday’s games "ALTIMOREAT#HICAGO NOON /AKLANDAT(OUSTON NOON .9*ETSAT"UFFALO NOON !TLANTAAT4AMPA"AY NOON $ETROITAT0ITTSBURGH NOON 7ASHINGTONAT0HILADELPHIA NOON #LEVELANDAT#INCINNATI NOON !RIZONAAT*ACKSONVILLE NOON 3AN$IEGOAT-IAMI PM -INNESOTAAT3EATTLE PM 3AN&RANCISCOAT.EW/RLEANS PM 'REEN"AYAT.9'IANTS PM +ANSAS#ITYAT$ENVER PM Open:$ALLAS 3T,OUIS Monday, Nov. 18 .EW%NGLANDAT#AROLINA PM

NBA

CLASS 5A

AP

Bulls center Joakim Noah (13) dunks the ball over Cavaliers small forward Alonzo Gee during the first half of Monday’s game in Chicago. The Bulls won 96-81. Star of the game: $ERRICK2OSE "ULLS  POINTS ASSISTS Up next:"ULLSAT 2APTORS PM&RIDAY TV/Radio:7#)5 !er’s fadeaway jumper with 8:08 left in the third, but Cleveland slowly whittled away at the advantage. Irving made a jumper for his first field goal, and Tyler Zeller had a rebound basket in his first action of the game, trimming the Bulls’ lead to 64-60 entering the final period.

It was a one-point game early in the fourth before the Bulls started to take control. Dunleavy had seven points during a 9-1 run that made it 87-76 with 2:10 remaining. Dunleavy then had a steal and a pass ahead to Deng for a fast-break dunk that extended the lead to 91-77 lead with 1:07 left. “We had some chances to break it open, early on, each quarter,� Dunleavy said. “They just hung in there. Fortunately in the fourth, we were able to pull away.�

Bowman set to replace Tillman INJURIES

4UESDAY .OVEMBER 

was the case after 2 minutes and 53 seconds of the second quarter. So I feel good about what we decided to do with him.� After the game, Cutler called the decision to pull him an on-going evaluation throughout the game. “I knew Josh was ready to go and I just didn’t want to get to the point where I was hurting us more than I was helping us,� Cutler said. Cutler had missed the previous game against Green Bay with a torn groin muscle. He played Sunday following only 3 weeks away after the team originally said he’d miss 4 weeks or longer. Trestman again repeated Sunday’s statement that Cutler’s groin injury has nothing to do with the ankle injury. “I asked [doctors] if the groin was an issue at all,� Trestman said. “They told me even today that if he hadn’t rolled up the ankle he would have been able to play today.� McCown, who started and played throughout the 27-20 win at Green Bay on Nov. 4, played the final series against the Lions and led the Bears

on a touchdown drive. A tying two-point conversion run by Matt Forte failed after McCown threw a TD pass to Brandon Marshall. With McCown taking Cutler’s place against the Ravens, Zack Bowman will replace Tillman. He has started 17 NFL games, including 12 in 2009 prior to the signing of free agent cornerback Tim Jennings. “He’s a veteran,� Tillman said of Bowman. “He’s been in this defense a while. He’s been a starter on this defense before Tim got here. So I think Zack Bowman is a good fit. He’s the next man up, and I have nothing but confidence and faith in Zack.� Tillman, like Cutler, is in the final year of his contract, and it’s often been suggested the 33-year-old corner should be converted to free safety as he ages. “I think my athleticism is still there to play corner in this league, whether it be for the Bears or somebody else,� Tillman said. “But I still think I have some corner left in me.�

s.O*OLIET#ATHOLIC  AT.O-ON TINI  3ATURDAY s.O,INCOLN 7AY7EST  AT.O 3YCAMORE  3ATURDAY s .O  (IGHLAND   AT .O  3ACRED (EART 'RIFFIN  3ATURDAY s .O  .ORMAL 5 (IGH   AT .O  7ASHINGTON  3ATURDAY

CLASS 6A s.O0RAIRIE2IDGE  AT.O"OYLAN   3ATURDAY s.O,AKE&OREST  AT.O"ATAVIA   3ATURDAY s.O,INCOLN 7AY.ORTH  AT.O 2ICHARDS  3ATURDAY s.O%AST3T,OUIS  AT.O0ROVI DENCE  3ATURDAY

CLASS 7A s.O,AKE:URICH  AT.O7HEA TON.ORTH  3ATURDAY s .O  'LENBARD 7EST   AT .O  3CHAUMBURG  3ATURDAY s.O#HICAGO-T#ARMEL  AT.O $OWNERS'ROVE.ORTH  3ATURDAY s .O  ,INCOLN 7AY %AST   AT .O  %DWARDSVILLE  3ATURDAY

CLASS 8A s.O-AINE3OUTH  AT.O,OYOLA   NOON3ATURDAY s.O3TEVENSON  AT.O"ARRINGTON   3ATURDAY s.O/SWEGO  AT.O-ARIST  3ATURDAY s .O  .EUQUA 6ALLEY   AT .O  .APERVILLE#ENTRAL  3ATURDAY

Volleyball IHSA State Tournament

at Redbird Arena, Normal Friday’s games Class 1A Semifinals s+EITH#OUNTRY$AYVS7EST0RAIRIE AM s.EW!THENSVS3TEWARDSON 3TRASBURG AM Class 2A Semifinals s$EER#REEK -ACKINAWVS)##ATHOLIC NOON s&IELDCRESTVS%DWARDS#OUNTY PM Class 3A Semifinals s #HICAGO 0AYTON VS ,A3ALLE 0ERU  PM s"REESE#ENTRALVS7HEATON3T&RANCIS PM Class 4A Semifinals s#RYSTAL,AKE3OUTHVS"ENET!CADEMY PM s-OTHER-AC!ULEYVS.EW4RIER PM Saturday’s games Class 1A s4HIRDPLACE AM s#HAMPIONSHIP AM Class 2A s4HIRDPLACE PM s#HAMPIONSHIP PM Class 3A s4HIRDPLACE PM s#HAMPIONSHIP PM

NFL East L T        

Pct PF        

PA    

Pct PF        

PA    

)NDIANAPOLIS 4ENNESSEE (OUSTON *ACKSONVILLE

W    

South L T        

#INCINNATI #LEVELAND "ALTIMORE 0ITTSBURGH

W    

North L T        

Pct PF        

PA    

+ANSAS#ITY $ENVER 3AN$IEGO /AKLAND

W    

West L T        

Pct PF        

PA    

NATIONAL CONFERENCE $ALLAS 0HILADELPHIA .9'IANTS 7ASHINGTON

East L T        

Pct PF        

GB ˆ ˆ ž  

Southeast Division W L Pct !TLANTA    -IAMI    #HARLOTTE    /RLANDO    7ASHINGTON   

GB ˆ ˆ  ž ž

Central Division W L Pct               

GB ˆ  ž ž 

)NDIANA #HICAGO -ILWAUKEE $ETROIT #LEVELAND

WESTERN CONFERENCE 3AN!NTONIO (OUSTON $ALLAS .EW/RLEANS -EMPHIS

Southwest Division W L Pct               

GB ˆ ž ž ž ž

Northwest Division W L Pct /KLAHOMA#ITY    -INNESOTA    0ORTLAND    $ENVER    5TAH   

GB ˆ ž   

Pacific Division W L Pct 0HOENIX    ,!#LIPPERS    'OLDEN3TATE    ,!,AKERS    3ACRAMENTO   

GB ˆ   ž ž

Monday’s results 3AN!NTONIO 0HILADELPHIA )NDIANA -EMPHIS !TLANTA #HARLOTTE "OSTON /RLANDO #HICAGO #LEVELAND 4ORONTOAT(OUSTON PM $ENVER 5TAH $ETROITAT0ORTLAND LATE -INNESOTAAT,!#LIPPERS LATE Today’s games -ILWAUKEEAT-IAMI PM 7ASHINGTONAT$ALLAS PM $ETROITAT'OLDEN3TATE PM .EW/RLEANSAT,!,AKERS PM Wednesday’s games -ILWAUKEEAT/RLANDO PM (OUSTONAT0HILADELPHIA PM #HARLOTTEAT"OSTON PM #LEVELANDAT-INNESOTA PM 4ORONTOAT-EMPHIS PM .EW9ORKAT!TLANTA PM 7ASHINGTONAT3AN!NTONIO PM ,!,AKERSAT$ENVER PM .EW/RLEANSAT5TAH PM 0HOENIXAT0ORTLAND PM "ROOKLYNAT3ACRAMENTO PM /KLAHOMA#ITYAT,!#LIPPERS PM

BULLS 96, CAVALIERS 81

AMERICAN CONFERENCE

W    

Atlantic Division W L Pct               

0HILADELPHIA "OSTON 4ORONTO .EW9ORK "ROOKLYN

Monday’s box score

Class 4A s4HIRDPLACE PM s#HAMPIONSHIP PM

W .EW%NGLAND  .9*ETS  -IAMI  "UFFALO 

EASTERN CONFERENCE

PA    

CLEVELAND (81) 'EE      4HOMPSON      "YNUM      )RVING      7AITERS   *ACK   6ARE JAO   -ILES   $ELLAVE DOVA   3IMS   :ELLER   Totals 31-75 14-20 81. CHICAGO (96) $ENG      "OOZER      .OAH   2OSE   "UTLER    $UNLEAVY   'IBSON    (INRICH   -OHAMMED    3NELL  Totals 34-83 24-26 96. #LEVELAND   ˆ #HICAGO   ˆ 3-Point Goals–#LEVELAND )RVING  'EE  7AITERS  -ILES  *ACK  #HICAGO $UNLEAVY  (INRICH  "UTLER  2OSE  $ENG  Fouled Out–.ONE Rebounds–#LEVELAND  4HOMPSON  #HICAGO  'IBSON   Assists–#LEVELAND)RVING #HICAGO (INRICH 2OSE Total Fouls–#LEVE LAND #HICAGOA–   

Men’s basketball Big Ten schedule Today’s games ,)5 "ROOKLYNAT)NDIANA PM 3#AROLINA3TAT-ICHIGAN PM -ICHIGAN 3T VS +ENTUCKY AT #HICAGO PM -ONTANAAT-INNESOTA PM /HIOAT/HIO3T PM &LORIDAAT7ISCONSIN PM 7)LLINOISAT.EBRASKA PM

NHL EASTERN CONFERENCE Atlantic Division W L OT Pts                                

GF        

GA        

Metropolitan Division W L OT Pts GF 0ITTSBURGH      7ASHINGTON      .92ANGERS      #AROLINA      .EW*ERSEY      .9)SLANDERS      #OLUMBUS      0HILADELPHIA     

GA        

4AMPA"AY "OSTON 4ORONTO $ETROIT -ONTREAL /TTAWA &LORIDA "UFFALO

WESTERN CONFERENCE #OLORADO #HICAGO 3T,OUIS -INNESOTA .ASHVILLE $ALLAS 7INNIPEG

Central W L              

Division OT Pts              

GF       

GA       

Pacific Division W L OT Pts GF GA !NAHEIM       0HOENIX       3AN*OSE       6ANCOUVER       ,OS!NGELES       #ALGARY       %DMONTON       NOTE:4WOPOINTSFORAWIN ONEPOINTFOR OVERTIMELOSS Monday’s result "OSTON 4AMPA"AY Today’s games ,OS!NGELESAT"UFFALO PM .ASHVILLEAT.9)SLANDERS PM .EW*ERSEYAT.92ANGERS PM #OLUMBUSAT7ASHINGTON PM #OLORADOAT#AROLINA PM 4AMPA"AYAT-ONTREAL PM 0HILADELPHIAAT/TTAWA PM 7INNIPEGAT$ETROIT PM !NAHEIMAT&LORIDA PM 0HOENIXAT3T,OUIS PM 3AN*OSEAT#ALGARY PM Wednesday’s games 4ORONTOAT-INNESOTA PM 0HILADELPHIAAT0ITTSBURGH PM $ALLASAT%DMONTON PM

Auto racing NASCAR Sprint Cup Leaders

Through Nov. 10 Points  *IMMIE*OHNSON   -ATT+ENS ETH   +EVIN(ARVICK   +YLE "USCH   $ALE%ARNHARDT*R    *EFF'ORDON   'REG"IFFLE    #LINT "OWYER    *OEY ,OGANO    +URT "USCH    2YAN .EWMAN   +ASEY+AHNE    #ARL%DWARDS   "RAD+ESEL OWSKI    *AMIE -C-URRAY   -ARTIN4RUEX*R  0AUL-ENARD  2ICKY3TENHOUSE*R  *EFF "URTON  !RIC!LMIROLA  Money  *IMMIE *OHNSON     +YLE "USCH     -ATT +ENSETH    +EVIN(ARVICK     "RAD +ESELOWSKI     *EFF 'ORDON     #ARL %DWARDS     $ALE %ARNHARDT *R    *OEY,OGANO     2YAN .EWMAN     #LINT "OWYER     -ARTIN 4RUEX *R     2ICKY 3TEN HOUSE*R    +ASEY+AHNE    +URT"USCH     !RIC !LMIROLA     *AMIE -C-URRAY     'REG "IFFLE     *UAN 0ABLO -ONTOYA    0AUL-ENARD   

College football Big Ten Conference Overall W-L Pct. W-L Pct. Legends Division -ICHIGAN3T       .EBRASKA       -INNESOTA       )OWA       -ICHIGAN       .ORTHWESTERN       Leaders Division /HIO3T       7ISCONSIN       0ENN3T       )NDIANA       )LLINOIS       0URDUE       Saturday, Nov. 16 /HIO3TAT)LLINOIS AM )NDIANAAT7ISCONSIN AM 0URDUEAT0ENN3T AM -ICHIGANAT.ORTHWESTERN PM -ICHIGAN3TAT.EBRASKA PM

Top 25 schedule

Wednesday’s game .O  .ORTHERN )LLINOIS VS "ALL 3TATE  PM Thursday’s game .O#LEMSONVS'EORGIA4ECH PM Friday’s game .O5#,!VS7ASHINGTON PM Saturday’s games .O!LABAMAAT-ISSISSIPPI3TATE  PM .O&LORIDA3TATEVS3YRACUSE PM .O/HIO3TATEAT)LLINOIS AM .O"AYLORVS4EXAS4ECHAT!RLINGTON 4EXAS PM .O3TANFORDAT3OUTHERN#AL PM .O/REGONVS5TAH PM .O  !UBURN VS .O  'EORGIA  PM .O3OUTH#AROLINAVS&LORIDA PM .O/KLAHOMA3TATEAT.O4EXAS PM .O-ICHIGAN3TATEAT.EBRASKA  PM .O5#&AT4EMPLE AM .O7ISCONSINVS)NDIANA AM .O,OUISVILLEVS(OUSTON PM .O  !RIZONA 3TATE VS /REGON 3TATE PM .O/KLAHOMAVS)OWA3TATE AM .O-IAMIAT$UKE PM


Tuesday, November 12, 2013

www.saukvalley.com

3AUK6ALLEY-EDIAs"

Finding the right person for the job can feel like a never-ending task. Through our partnership with Monster, VDXNYDOOH\FRPPRQVWHU FDQ KHOS \RX GR PRUH WKDQ ¿QG FDQGLGDWHV :H FDQ KHOS \RX ¿QG WKH ULJKW FDQGLGDWHV LQ OHVV WLPH ,W¶V MXVW RQH SLHFH RI WKH FRPSUHKHQVLYH UHFUXLWLQJ VROXWLRQ \RX¶OO ¿QG ZLWK VDXNYDOOH\FRP DQG 0RQVWHU %HFDXVH LI \RX ZDQW WR KDYH D OLWWOH WLPH IRU \RX \RX KDYH WR ¿QG D OLWWOH KHOS

saukvalley.com )LQG WKH ULJKW ¿W IRU \RXU QH[W MRE DW VDXNYDOOH\FRPPRQVWHU


place ads online www.saukvalley.com

CLASSIFIED SAUK VALLEY Tuesday, November 12, 2013

Dixon

F13010549 IN THE CIRCUIT COURT OF THE 15TH JUDICIAL CIRCUIT LEE COUNTY- DIXON, ILLINOIS Wells Fargo Bank, N.A. as Trustee for WaMu Mortgage Pass-Through Certificates, Series 2005-PR4 Trust Plaintiff, vs. Lenore A. Stevenson aka Lenore Stevenson; Unknown Owners and Non-Record Claimants Defendants. 13 CH 14 Property Address: 301 South Jefferson Avenue, Amboy, Illinois 61310 NOTICE OF SHERIFF SALE Public notice is hereby given that in pursuance of a judgment of said Court entered in the above-entitled cause on September 3, 2013, I, Sheriff, John R. Varga of Lee County, Illinois, will hold a sale on December 19, 2013 , commencing at 10AM, at the Lee County Courthouse, 112 E. 2nd Street, Dixon, IL 61021, to sell to the highest bidder or bidders the following described real estate, or so much thereof as may be sufficient to satisfy said decree, to-wit: Commonly known as: 301 South Jefferson Avenue, Amboy, Illinois 61310 P.I.N.: 02-15-22-235-003 First Lien Position; Single-Family Residence; Judgment Amount $139,420.44 IN ACCORDANCE WITH 735 ILCS 5/15-1507 (c)(1)(H-1) AND (H-2), 765 ILCS 605/9(g)(5), AND 765 ILCS 605/18.5(g-1), YOU ARE HEREBY NOTIFIED THAT THE PURCHASER OF THE PROPERTY, OTHER THAN A MORTGAGEE, SHALL PAY THE ASSESSMENTS AND LEGAL FEES REQUIRED BY SUBSECTIONS (g)(1) AND (g)(4) OF SECTION 9 AND THE ASSESSMENTS REQUIRED BY SUBSECTION (g-1) OF SECTION 18.5 OF THE ILLINOIS CONDOMINIUM PROPERTY ACT. The property will not be open for inspection. Terms of Sale: CASH - 10% down at the time of sale and the balance due within 24 hours of the sale. All payments for the amount bid shall be in certified funds payable to the Sheriff of Lee County. The person to contact for information regarding this property is: Steven J. Lindberg at FREEDMAN ANSELMO LINDBERG LLC 1807 West Diehl Road, Naperville, IL (866)402-8661. For bidding instructions, visit www.fal-illinois.com 24 hours prior to sale. This communication is an attempt to collect a debt and any information obtained will be used for that purpose. FREEDMAN ANSELMO LINDBERG LLC 1771 W. Diehl Rd., Ste 150 Naperville, IL 60563-4947 630-453-6960 866-402-8661 630-428-4620 (fax) Nov. 5, 12, 19, 2013

Visit Sauk Valley Classifieds at saukvalley.com

Find your dream home!

Read Sauk Valley Classifieds real estate section and Real Estate Weekly on Thursdays.

F13040058 IN THE CIRCUIT COURT OF THE 15TH JUDICIAL CIRCUIT LEE COUNTY- DIXON, ILLINOIS Wells Fargo Bank, NA Plaintiff, vs. Robert Morath; Susan Morath; Unknown Owners and Non-Record Claimants Defendants. 13 CH 46 Property Address: 1168 Corregidor Road, Amboy, Illinois 61310 NOTICE OF SHERIFF SALE Public notice is hereby given that in pursuance of a judgment of said Court entered in the above-entitled cause on September 3, 2013, I, Sheriff, John R. Varga of Lee County, Illinois, will hold a sale on December 19, 2013 , commencing at 10:00 am, at the Lee County Courthouse, 112 E. 2nd Street, Dixon, IL 61021, to sell to the highest bidder or bidders the following described real estate, or so much thereof as may be sufficient to satisfy said decree, to-wit:

Northland Park Apartments Apartments Studio, 1 & 2 Bedroom Washer & Dryer Units Fitness Center Beautiful, Private Setting Balconies / Patios Open House Daily

1st 3 Months 1/2 OFF! Call Me 2-Rent (815)632-7368

(Located Behind Northland Mall)

FIND

Your next New or Used Car in

LOST

IS YOUR PET MISSING? Read our found section in todays paper. Just in case it is not there, call one of your area animal shelters listed below: Lee County Animal Control (815)284-3833 Granny Rose Animal Shelter (815)288-7387 Whiteside County Animal Control (815)625-3507 Happy Tails Humane Society (815)626-2994 A public service of Sauk Valley Media

FOUND

IN ACCORDANCE WITH 735 ILCS 5/15-1507 (c)(1)(H-1) AND (H-2), 765 ILCS 605/9(g)(5), AND 765 ILCS 605/18.5(g-1), YOU ARE HEREBY NOTIFIED THAT THE PURCHASER OF THE PROPERTY, OTHER THAN A MORTGAGEE, SHALL PAY THE ASSESSMENTS AND LEGAL FEES REQUIRED BY SUBSECTIONS (g)(1) AND (g)(4) OF SECTION 9 AND THE ASSESSMENTS REQUIRED BY SUBSECTION (g-1) OF SECTION 18.5 OF THE ILLINOIS CONDOMINIUM PROPERTY ACT. The property will not be open for inspection. Terms of Sale: CASH - 10% down at the time of sale and the balance due within 24 hours of the sale. All payments for the amount bid shall be in certified funds payable to the Sheriff of Lee County. The person to contact for information regarding this property is: Steven J. Lindberg at FREEDMAN ANSELMO LINDBERG LLC 1807 West Diehl Road, Naperville, IL (866)402-8661. For bidding instructions, visit www.fal-illinois.com 24 hours prior to sale. This communication is an attempt to collect a debt and any information obtained will be used for that purpose.

FREEDMAN ANSELMO LINDBERG LLC 1771 W. Diehl Rd., Ste 150 Naperville, IL 60563-4947 630-453-6960 866-402-8661 630-428-4620 (fax) Nov. 5, 12, 19, 2013

SAUK VALLEY SAUK VALLEY

LASSIFIEDS dailyGAZETTE

dailyGAZETTE 815-625-3600

TELEGRAPH

TELEGRAPH

Step Ladder on County Line Rd in Rock Falls Wednesday afternoon. Call 815-625-8488

ANNOUNCEMENTS

124

815-284-2222

WONDERFUL

APARTMENTS! EXCELLENT RENTS!

Sterling Towers Apts.

126

CASA 15th Judicial Circuit (Lee/ Carroll/Ogle Counties) is seeking volunteers to advocate for children in the court system involved in abuse and neglect cases. Your involvement can impact a child’s future. Contact Vanessa White, Director of Advocate Services (815) 288-1901 www.casalee carroll.com

JUST A click away from your Dixon Telegraph/ Daily Gazette Newspaper Subscription. Done Online at: www.sauk valley.com

Home of Hope is looking for dedicated volunteers to help in their mission to help those touched by cancer. Areas of need: reception/ office, events, massage therapist, reflexologist, maintenance etc. If you have a couple hours a week/ month, please call 815 288-4673 to schedule an appointment. Contact Connie or Joan. Hours of operation are M-TH. 8-4, Fri. 8-3

Call

Classified

THE GOOD LIFE FOR 62+ PRIVATELY OWNED RENT SUBSIDIZED FOR QUALIFIED APPLICANTS

VOLUNTEERS

126

LOVELAND MUSEUM... Are you interested in Dixon and local history, Civil War, Blackhawk War? Are you a people person? We are looking for people like you to help host our Museum one or more days a month. The Museum is open Thurs. & Fri. 9-2, Sat. 103. Interested? Please stop at the main office at the Loveland Community House between 8-4 Mon. thru Fri. to pick up an application and learn more. 513 W. Second St. 815-284 2741 lovelandcommunity house.org.

115

C CLASSIFIEDS

Commonly known as: 1168 Corregidor Road, Amboy, Illinois 61310 P.I.N.: 02-15-06-151-002 First Lien Position; Single-Family Residence; Judgment Amount $117,249.58

VOLUNTEERS

110

To sell those extra items easily and economically!

ADOPTION NOTICES

128

ADOPTION is a loving choice. You created a precious life- we cannot. We could be the answer to each other's prayers. We're KEITH and JAIME; a loving, secure, childless couple, ready to adopt. Contact us or our caring attorney Sara 773-509-0099 or 800-509-0097

♼ ADOPTION: ♼ A Creative Financially Secure Home, Art, Music, LOVE, Laughter, Family awaits 1st baby. Expenses paid. Beth ♼1-800-990-7667♼

CLASSIFIEDS C SAUK VALLEY SAUK VALLEY

(815)626-6873 TTY (800)526-0844

PERSONS WITH DISABILITIES EQUALLY WELCOME

LASSIFIEDS TELEGRAPH

dailyGAZETTE dailyGAZETTE

TELEGRAPH

815-625-3600

815-284-2222

EQUAL HOUSING

OPPORTUNITY

Earn Cash! Advertise your items with these special deals! $7.50 Deal

Advertise 1 item for under $300 4 3 3 Lines Days Days in Sauk Valley Classifieds Online Special must be mentioned at time of ad placement. Item must be priced under $300. 1 Item per ad. Private Party ads only. No Commercial Advertising, Pets, Rummage Sales, Wood/Fuel, Tickets/Travel or Real Estate. SAUK VALLEY /FFER%XPIRES LASSIFIEDS

C

dailyGAZETTE

TELEGRAPH

$15 Deal

Advertise 1 item for under $300 4 7 7 Lines Days Days in Sauk Valley Classifieds Online Special must be mentioned at time of ad placement. Item must be priced under $300. 1 Item per ad. Private Party ads only. No Commercial Advertising, Pets, Rummage Sales, Wood/Fuel, Tickets/Travel or Real Estate. SAUK VALLEY /FFER%XPIRES LASSIFIEDS dailyGAZETTE

TELEGRAPH

$26 Deal

Advertise 1 item for under $300 5 14 14 Lines Days Days in Sauk Valley Classifieds Online Special must be mentioned at time of ad placement. Item must be priced under $300. 1 Item per ad. Private Party ads only. No Commercial Advertising, Pets, Rummage Sales, Wood/Fuel, Tickets/Travel or Real Estate. /FFER%XPIRES LASSIFIEDS

C

dailyGAZETTE

TELEGRAPH

Real Deal

5 LINES FOR 30 DAYS - $38 for items over $300 Includes: Telegraph, Gazette, The Review, 4 Ogle County Papers and Sauk Valley.com Advertise 1 item over $300 for 30 days! saukvalley.com & Sauk Valley Classifieds

Item must be priced over $300. 1 Item per ad. Private Party ads only. No Commercial Advertising, Pets, Rummage Sales, Wood/Fuel, Tickets/Travel or Real Estate.

/FFER%XPIRES$ECEMBER  Special must be mentioned at time of ad placement.

CLASSIFIEDS SAUK VALLEY dailyGAZETTE

TELEGRAPH

s4OPLACEANYLINEADINTHENEXTDAYSCLASSIlEDS PLEASECALLBEFOREPM-ONDAY &RIDAY s4OPLACEANYLINEADINTHE367EEKENDSCLASSIlEDS PLEASECALLBEFORE.OONON&RIDAY s4OPLACEANYLINEADIN-ONDAYSCLASSIlEDS PLEASECALLBEFOREPMON&RIDAY

3AUK6ALLEY#LASSIlEDS 3TERLING/FlCE 3/,$ $IXON/FlCE 3/,$


SAUK VALLEY MEDIA s Tuesday, November 12, 2013 s PAGE B7

EY

C NOTICES Notice of Public Hearing Concerning the Intent of the Board of Park Commissioners of the Prophetstown Park District, ,Whiteside and Henry Counties, Illinois to Sell $125,000 General Obligation Park Bonds

Public Notice is Hereby Given that the Prophetstown Park District, Whiteside and Henry Counties, Illinois (the ÒDistrictÓ), will hold a public hearing on the 20th day of November, 2013, at 7:00ÊoÕclock P.M. The hearing will be held at the Prophetstown Park District Offices, 410 Riverside Drive, Prophetstown, Illinois. The purpose of the hearing will be to receive public comments on the proposal to sell bonds of the District in the amount of $125,000 for the payment of land condemned or purchased for parks, for the building, maintaining, improving and protecting of the same and the existing land and facilities of the District and for the payment of the expenses incident thereto. By order of the President of the Board of Park Commissioners of the Prophetstown Park District, Whiteside and Henry Counties, Illinois. Dated the 21st day of October, 2013.

November 12, 2013

/s/ Karyn Sommers-Buck Secretary, Board of Park Commissioners, Prophetstown Park District, Whiteside and Henry Counties, Illinois

IN THE CIRCUIT COURT FOR THE FIFTEENTH JUDICIAL CIRCUIT LEE COUNTY - DIXON, ILLINOIS CitiMortgage, Inc. PLAINTIFF

Vs.

Martin Vaile a/k/a Martin E. Vaile a/k/a Martin Eugene Vaile; et. al. DEFENDANTS 12 CH 00103 NOTICE OF SHERIFF'S SALE OF REAL ESTATE PUBLIC NOTICE IS HEREBY GIVEN that pursuant to a Judgment of Foreclosure and Sale entered in the above cause on 11/6/2012, the Sheriff of Lee County, Illinois will on 12/19/13 at the hour of 10:00AM at Lee County Courthouse 112 East Second Street Dixon, IL 61021, or in a place otherwise designated at the time of sale, County of Lee and State of Illinois, sell at public auction to the highest bidder for cash, as set forth below, the following described real estate: ALL OF TRACT NUMBER FIFTY-ONE (51) IN THE SURVEY AND RESUBDIVISION CALLED LOVELAND PLACE TRACTS, ACCORDING TO THE PLAT THEREOF RECORDED IN THE RECORDER'S OFFICE OF LEE COUNTY, ILLINOIS, IN BOOK 'C' OF PLATS, ON PAGE 4, ALL IN LEE COUNTY, ILLINOIS. PIN 07-02-31-428-016 Improved with Single Family Home COMMONLY KNOWN AS: 617 4th Avenue Dixon, IL 61021 Sale terms: 10% down of the highest bid by certified funds at the close of the auction; The balance, including the Judicial sale fee for Abandoned Residential Property Municipality Relief Fund, which is calculated at the rate of $1 for each $1,000 or fraction thereof of the amount paid by the purchaser not to exceed $300, in certified funds, is due within twenty-four (24) hours. The subject property is subject to general real estate taxes, special assessments, or special taxes levied against said real estate and is offered for sale without any representation as to quality or quantity of title and without recourse to Plaintiff and in "AS IS" condition. The sale is further subject to confirmation by the court. If the property is a condominium and the foreclosure takes place after 1/1/2007, purchasers other than the mortgagees will be required to pay any assessment and legal fees due under The Condominium Property Act, 765 ILCS 605/9(g)(1) and (g)(4). If the property is located in a common interest community, purchasers other than mortgagees will be required to pay any assessment and legal fees due under the Condominium Property Act, 765 ILCS 605/18.5(g-1). If the sale is set aside for any reason, the Purchaser at the sale shall be entitled only to a return of the deposit paid. The Purchaser shall have no further recourse against the Mortgagor, the Mortgagee or the Mortgagee's attorney. Upon payment in full of the amount bid, the purchaser shall receive a Certificate of Sale, which will entitle the purchaser to a Deed to the real estate after Confirmation of the sale. The successful purchaser has the sole responsibility/expense of evicting any tenants or other individuals presently in possession of the subject premises.

F13040058 IN THE CIRCUIT COURT OF THE 15TH JUDICIAL CIRCUIT LEE COUNTY- DIXON, ILLINOIS Wells Fargo Bank, NA Plaintiff, vs. Robert Morath; Susan Morath; Unknown Owners and Non-Record Claimants Defendants. 13 CH 46 Property Address: 1168 Corregidor Road, Amboy, Illinois 61310 NOTICE OF SHERIFF SALE Public notice is hereby given that in pursuance of a judgment of said Court entered in the above-entitled cause on September 3, 2013, I, Sheriff, John R. Varga of Lee County, Illinois, will hold a sale on December 19, 2013 , commencing at 10:00 am, at the Lee County Courthouse, 112 E. 2nd Street, Dixon, IL 61021, to sell to the highest bidder or bidders the following described real estate, or so much thereof as may be sufficient to satisfy said decree, to-wit: A TRACT OF LAND LOCATED IN THE WEST ONE-HALF OF THE NORTHWEST ONE-QUARTER OF SECTION 6, TOWNSHIP 20 NORTH, RANGE 10 EAST, OF THE 4TH PRINCIPAL MERIDIAN DESCRIBED AS FOLLOWS: BEGINNING AT A POINT ON THE WEST LINE OF SAID SECTION 6, 1402.6 FEET SOUTH OF THE NORTHWEST CORNER THEREOF; THENCE SOUTH 147.55 FEET ON THE SAID WEST LINE; THENCE SOUTH 89 DEGREES 37 FEET EAST 480.0 FEET; THENCE NORTH 00 DEGREES 53 FEET 147.55 FEET; THENCE NORTH 89 DEGREES 37 FEET WEST 479.98 FEET TO THE POINT OF BEGINNING, SAID PREMISES BEING SITUATED IN LEE COUNTY, ILLINOIS. Commonly known as: 1168 Corregidor Road, Amboy, Illinois 61310 P.I.N.: 02-15-06-151-002 First Lien Position; Single-Family Residence; Judgment Amount $117,249.58 IN ACCORDANCE WITH 735 ILCS 5/15-1507(c) (1)(H-1) AND (H-2), 765 ILCS 605/9(g)(5), AND 765 ILCS 605/18.5(g-1), YOU ARE HEREBY NOTIFIED THAT THE PURCHASER OF THE PROPERTY, OTHER THAN A MORTGAGEE, SHALL PAY THE ASSESSMENTS AND LEGAL FEES REQUIRED BY SUBSECTIONS (g)(1) AND (g)(4) OF SECTION 9 AND THE ASSESSMENTS REQUIRED BY SUBSECTION (g-1) OF SECTION 18.5 OF THE ILLINOIS CONDOMINIUM PROPERTY ACT. The property will not be open for inspection. Terms of Sale: CASH - 10% down at the time of sale and the balance due within 24 hours of the sale. All payments for the amount bid shall be in certified funds payable to the Sheriff of Lee County. The person to contact for information regarding this property is: Steven J. Lindberg at FREEDMAN ANSELMO LINDBERG LLC 1807 West Diehl Road, Naperville, IL (866)402-8661. For bidding instructions, visit www.fal-illinois.com 24 hours prior to sale. This communication is an attempt to collect a debt and any information obtained will be used for that purpose. FREEDMAN ANSELMO LINDBERG LLC 1771 W. Diehl Rd., Ste 150 Naperville, IL 60563-4947 630-453-6960 866-402-8661 630-428-4620 (fax) Nov. 5, 12, 19, 2013

Call

Classified

To sell those extra items easily and economically!

ADOPTION NOTICES

128

Loving Couple Wanting to Adopt We will provide a loving, happy home where your baby will thrive and grow, with a mom and dad who are very eager to become parents. We will provide unconditional love, security and support for your baby. All approved expenses paid. To learn more about us, Call 708-9576849 or email us at: seanandjennifer adopt@gmail.com LCFS#012998

SELL

those unwanted items with the help of a Sauk Valley Classified Ad

REAL ESTATE 202 SERVICES PUBLISHER'S NOTICE All real estate advertising in this newspaper subject to the Fair Housing Act which makes it illegal to advertise “any preference , limitation or discrimination based on race, color,religion, sex, handicap, familial status or national origin, or an intention, to make any such preference, limitation or discrimination.” Familial status includes children under the age of 18 living with parents or legal custodians pregnant women and people securing custody of children under 18. This newspaper will not knowingly accept any advertising for real estate which is in violation of the law. Our readers are hereby informed that all dwellings advertised in this newspaper are available on an equal opportunity basis. To complain of discrimination call HUD toll-free at 1-800-669-9777. The toll-free telephone number for the hearing impaired is 1-800-279275.

A1 FOR SALE BY OWNER

STERLING 3 BR., 1304 Griswold Ave. As is, needs work, newer vinyl windows. $18,000. OBO 815718-3481.

DIXON Newly Remodeled N.E., Corner Lot. 2BR, 1½BA, New appl. 2 Car Garage. 1102 Steinman Like new! $88,500 815-440-7521

MILLEDGEVILLE Country Home 2885 Grandview Rd., Milledgeville, on 2 ½ acres, 1,680 sq. ft., 3 BR, 3 car garage, great hunting, deer, turkey, plenty of wildlife. $92,500. Serious pre-approved inquires only. 815-6311407.

CEMETERY LOTS

226

2 LOTS in Chapel Hill “Garden of Faith” $800 OBO 815-646-4741

MOBILE HOMES 230

MOBILE HOMES

625-3600 284-2222

209

230

Advertise your mobile homes for sale here!!

IN THE CIRCUIT COURT OF THE 14TH JUDICIAL CIRCUIT WHITESIDE COUNTY- MORRISON, ILLINOIS JPMorgan Chase Bank, N.A. S/B/M to Bank One N.A. Plaintiff, vs. James H. Denman aka James Denman; Unknown Owners and Non-Record Claimants Defendants. 13CH 115 Property Address: 7777 Hurd Road, Erie, Illinois 61250 NOTICE FOR PUBLICATION The requisite affidavit for publication having been filed, notice is hereby given you, James H. Denman aka James Denmanand UNKNOWN OWNERS and NON-RECORD CLAIMANTS, defendants in the above entitled cause, that suit has been commenced against you and other defendants in the Circuit Court for the Judicial Circuit by said plaintiff praying for the foreclosure of a certain mortgage conveying the premises described as follows, to wit: P.I.N.: 19-36-200-002 Said property is commonly known as: 7777 Hurd Road, Erie, Illinois 61250,

CLASSIFIEDS C

The property will NOT be open for inspection and Plaintiff makes no representation as to the condition of the property. Prospective bidders are admonished to check the Court file to verify all information.

IF YOU ARE THE MORTGAGOR (HOMEOWNER), YOU HAVE THE RIGHT TO REMAIN IN POSSESSION FOR 30 DAYS AFTER ENTRY OF AN ORDER OF POSSESSION, IN ACCORDANCE WITH SECTION 15-1701(C) OF THE ILLINOIS MORTGAGE FORECLOSURE LAW.

For information: Examine the court file or contact Plaintiff's attorney: Codilis & Associates, P.C., 15W030 North Frontage Road, Suite 100, Burr Ridge, IL 60527, (630) 794-9876. Please refer to file number 14-12-12562 Nov. 5, 12, 19, 2013.

IN THE CIRCUIT COURT OF THE 14TH JUDICIAL CIRCUIT WHITESIDE COUNTY- MORRISON, ILLINOIS JPMorgan Chase Bank, N.A. S/B/M to Bank One N.A. Plaintiff, vs. James H. Denman aka James Denman; Unknown Owners and Non-Record Claimants Defendants. 13CH 115 Property Address: 7777 Hurd Road, Erie, Illinois 61250 NOTICE FOR PUBLICATION The requisite affidavit for publication having been filed, notice is hereby given you, James H. Denman aka James Denmanand UNKNOWN OWNERS and NON-RECORD CLAIMANTS, defendants in the above entitled cause, that suit has been commenced against you and other defendants in the Circuit Court for the Judicial Circuit by said plaintiff praying for the foreclosure of a certain mortgage conveying the premises described as follows, to wit: A PART OF THE NORTHEAST QUARTER OF SECTION 36 AND PART OF THE SOUTHEAST QUARTER OF SECTION 23, ALL IN TOWNSHIP 19 NORTH, RANGE 3 EAST OF THE FOURTH PRINCIPAL MERIDIAN, IN WHITESIDE COUNTY, ILLINOIS, MORE PARTICULARLY DESCRIBED AS FOLLOWS: BEGINNING AT A POINT ON THE NORTH LINE OF SAID SECTION 36 WHICH IS SOUTH 49 DEGREES 30'59" WEST (PRESUMED BEARINGS), 1191.84 FEET FROM THE NORTHEAST CORNER OF SAID SECTION 36; THENCE SOUTH 09 DEGREES 12'20" WEST, 117.34 FEET; THENCE SOUTH 40 DEGREES 53'26" WEST, 117.67 FEET; THENCE NORTH 85 DEGREES 53'01" WEST, 327.23 FEET; THENCE NORTH 04 DEGREES 59'48" EAST 244.07 FEET TO THE CENTERLINE OF HURD ROAD; THENCE NORTH 74 DEGREES 20'40" EAST, ALONG THE SAID CENTERLINE, 279.81 FEET; THENCE NORTH 83 DEGREES 56'15" EAST, ALONG THE SAID CENTERLINE, 95.77 FEET; THENCE SOUTH 83?28'31" EAST, ALONG THE SAID CENTERLINE, 75.08 FEET THENCE SOUTH 09 DEGREES 12'20" WEST, 154.12 FEET TO THE POINT OF BEGINNING, SUBJECT, HOWEVER, TO THE RIGHTS OF THE PUBLIC IN THAT PART OF HURD ROAD ON THE NORTHERLY SIDE THEREOF, SITUATED IN THE COUNTY OF WHITESIDE, IN THE STATE OF ILLINOIS. P.I.N.: 19-36-200-002 Said property is commonly known as: 7777 Hurd Road, Erie, Illinois 61250, and which said mortgage(s) was/were made by James H. Denman and Mabel J. Denman and recorded in the Office of the Recorder of Deeds as Document Number 3043-2004 and for other relief; that Summons was duly issued out of the above Court against you as provided by law and that said suit is now pending. NOW THEREFORE, unless you, the said above named defendants, file your answer to the complaint in the said suit or otherwise make your appearance therein, in the Office of the Clerk of the Court at Whiteside County on or before December 5, 2013, a default may be taken against you at any time after that date and a Judgment entered in accordance with the prayer of said complaint. This communication is an attempt to collect a debt and any information obtained will be used for that purpose. Steven C. Lindberg FREEDMAN ANSELMO LINDBERG LLC 1771 W. Diehl Rd., Ste 150 Naperville, IL 60563-4947 866-402-8661 630-453-6960 630-428-4620 (fax)

November 5, 12, 19, 2013

SAUK VALLEY SAUK VALLEY

LASSIFIEDS TELEGRAPH

dailyGAZETTE dailyGAZETTE

815-625-3600

TELEGRAPH

815-284-2222

F13010549 IN THE CIRCUIT COURT OF THE 15TH JUDICIAL CIRCUIT LEE COUNTY- DIXON, ILLINOIS Wells Fargo Bank, N.A. as Trustee for WaMu Mortgage Pass-Through Certificates, Series 2005-PR4 Trust Plaintiff, vs.

and which said mortgage(s) was/were made by James H. Denman and Mabel J. Denman and recorded in the Office of the Recorder of Deeds as Document Number 3043-2004 and for other relief; that Summons was duly issued out of the above Court against you as provided by law and that said suit is now pending. NOW THEREFORE, unless you, the said above named defendants, file your answer to the complaint in the said suit or otherwise make your appearance therein, in the Office of the Clerk of the Court at Whiteside County on or before December 5, 2013, a default may be taken against you at any time after that date and a Judgment entered in accordance with the prayer of said complaint. This communication is an attempt to collect a debt and any information obtained will be used for that purpose.

Lenore A. Stevenson aka Lenore Stevenson; Unknown Owners and Non-Record Claimants Defendants. 13 CH 14 Property Address: 301 South Jefferson Avenue, Amboy, Illinois 61310 NOTICE OF SHERIFF SALE

Steven C. Lindberg FREEDMAN ANSELMO LINDBERG LLC 1771 W. Diehl Rd., Ste 150 Naperville, IL 60563-4947 630-453-6960 866-402-8661 630-428-4620 (fax)

Public notice is hereby given that in pursuance of a judgment of said Court entered in the above-entitled cause on September 3, 2013, I, Sheriff, John R. Varga of Lee County, Illinois, will hold a sale on December 19, 2013 , commencing at 10AM, at the Lee County Courthouse, 112 E. 2nd Street, Dixon, IL 61021, to sell to the highest bidder or bidders the following described real estate, or so much thereof as may be sufficient to satisfy said decree, to-wit:

IN THE CIRCUIT COURT FOR THE FIFTEENTH JUDICIAL CIRCUIT LEE COUNTY - DIXON, ILLINOIS

THE NORTHERLY THREE-FOURTHS OF LOT THREE (3) IN BLOCK 28 IN THE ORIGINAL TOWN (NOW CITY) OF AMBOY, DESCRIBED AS FOLLOWS, TO-WIT; COMMENCING AT THE NORTHWEST CORNER OF SAID LOT THREE (3) AT THE JUNCTION OF BLUFF STREET AND JEFFERSON AVENUE, THENCE SOUTHEASTERLY ALONG JEFFERSON AVENUE 60 FEET; THENCE ON A LINE PARALLEL WITH THE SOUTH LINE OF SAID LOT 160 FEET TO THE EAST LINE OF SAID LOT; THENCE NORTHWESTERLY ON THE EASTERLY LINE OF SAID LOT 60 FEET TO THE NORTHEAST CORNER OF SAID LOT AND THENCE ALONG THE NORTH LINE OF SAID LOT 160 FEET TO THE PLACE OF BEGINNING, ALL SITUATED IN LEE COUNTY, ILLINOIS. Commonly known as: 301 South Jefferson Avenue, Amboy, Illinois 61310 P.I.N.: 02-15-22-235-003 First Lien Position; Single-Family Residence; Judgment Amount $139,420.44 IN ACCORDANCE WITH 735 ILCS 5/15-1507(c) (1)(H-1) AND (H-2), 765 ILCS 605/9(g)(5), AND 765 ILCS 605/18.5(g-1), YOU ARE HEREBY NOTIFIED THAT THE PURCHASER OF THE PROPERTY, OTHER THAN A MORTGAGEE, SHALL PAY THE ASSESSMENTS AND LEGAL FEES REQUIRED BY SUBSECTIONS (g)(1) AND (g)(4) OF SECTION 9 AND THE ASSESSMENTS REQUIRED BY SUBSECTION (g-1) OF SECTION 18.5 OF THE ILLINOIS CONDOMINIUM PROPERTY ACT. The property will not be open for inspection. Terms of Sale: CASH - 10% down at the time of sale and the balance due within 24 hours of the sale. All payments for the amount bid shall be in certified funds payable to the Sheriff of Lee County. The person to contact for information regarding this property is: Steven J. Lindberg at FREEDMAN ANSELMO LINDBERG LLC 1807 West Diehl Road, Naperville, IL (866)402-8661. For bidding instructions, visit www.fal-illinois.com 24 hours prior to sale.

November 5, 12, 19, 2013

CitiMortgage, Inc. PLAINTIFF

Vs.

Martin Vaile a/k/a Martin E. Vaile a/k/a Martin Eugene Vaile; et. al. DEFENDANTS 12 CH 00103 NOTICE OF SHERIFF'S SALE OF REAL ESTATE PUBLIC NOTICE IS HEREBY GIVEN that pursuant to a Judgment of Foreclosure and Sale entered in the above cause on 11/6/2012, the Sheriff of Lee County, Illinois will on 12/19/13 at the hour of 10:00AM at Lee County Courthouse 112 East Second Street Dixon, IL 61021, or in a place otherwise designated at the time of sale, County of Lee and State of Illinois, sell at public auction to the highest bidder for cash, as set forth below, the following described real estate: PIN 07-02-31-428-016 Improved with Single Family Home COMMONLY KNOWN AS: 617 4th Avenue Dixon, IL 61021 Sale terms: 10% down of the highest bid by certified funds at the close of the auction; The balance, including the Judicial sale fee for Abandoned Residential Property Municipality Relief Fund, which is calculated at the rate of $1 for each $1,000 or fraction thereof of the amount paid by the purchaser not to exceed $300, in certified funds, is due within twenty-four (24) hours. The subject property is subject to general real estate taxes, special assessments, or special taxes levied against said real estate and is offered for sale without any representation as to quality or quantity of title and without recourse to Plaintiff and in "AS IS" condition. The sale is further subject to confirmation by the court. If the property is a condominium and the foreclosure takes place after 1/1/2007, purchasers other than the mortgagees will be required to pay any assessment and legal fees due under The Condominium Property Act, 765 ILCS 605/9(g)(1) and (g)(4). If the property is located in a common interest community, purchasers other than mortgagees will be required to pay any assessment and legal fees due under the Condominium Property Act, 765 ILCS 605/18.5 (g-1). If the sale is set aside for any reason, the Purchaser at the sale shall be entitled only to a return of the deposit paid. The Purchaser shall have no further recourse against the Mortgagor, the Mortgagee or the Mortgagee's attorney. Upon payment in full of the amount bid, the purchaser shall receive a Certificate of Sale, which will entitle the purchaser to a Deed to the real estate after Confirmation of the sale. The successful purchaser has the sole responsibility/expense of evicting any tenants or other individuals presently in possession of the subject premises. The property will NOT be open for inspection and Plaintiff makes no representation as to the condition of the property. Prospective bidders are admonished to check the Court file to verify all information.

This communication is an attempt to collect a debt and any information obtained will be used for that purpose.

IF YOU ARE THE MORTGAGOR (HOMEOWNER), YOU HAVE THE RIGHT TO REMAIN IN POSSESSION FOR 30 DAYS AFTER ENTRY OF AN ORDER OF POSSESSION, IN ACCORDANCE WITH SECTION 151701(C) OF THE ILLINOIS MORTGAGE FORECLOSURE LAW.

FREEDMAN ANSELMO LINDBERG LLC 1771 W. Diehl Rd., Ste 150 Naperville, IL 60563-4947 630-453-6960 866-402-8661 630-428-4620 (fax) Nov. 5, 12, 19, 2013

For information: Examine the court file or contact Plaintiff's attorney: Codilis & Associates, P.C., 15W030 North Frontage Road, Suite 100, Burr Ridge, IL 60527, (630) 794-9876. Please refer to file number 1412-12562 Nov. 5, 12, 19, 2013.

AMBOY Mobile homes for sale. $600 down. Owner financed. 815-716-6565.

DIXON

CHATEAU ESTATES Homes for sale and rent call our office for details

815-284-2000 3 bed 2 bath $24,900 2 bed 2 bath $17,900

ROCK RIVER ESTATES Homes for sale and rent call our office for details

815-284-2000 2 bed 1 bath on the river $27,900 2 bed 1 bath $9,900

3 BR, 2 bath, new deck, new A/C & plumbing, applcs., storage shed, $19,500. 815-9735601

FARMS / ACREAGE

235

Lee County Farm for sale 160 Acres m/l – Dixon Township *Nearly all tillable Available to farm in 2014. $9,750/Acre. Broker Monte Van Kooten 815 7182244. www.Sterling LandCompany.com

APARTMENTSFURNISHED 305 STERLING Efficiencies, 1 & 2 BR. Apts. (563) 243-0383, Sterling/R.F.

APARTMENTS UNFURNISHED 306 Attractive 1 & 2 BR. apts. with some utilities. Sterling & Rock Falls. No pets, no parties. Refs. req. 815-336-2305. HAVING TROUBLE wording your ad? Call our Classified Department today. We'll be glad to help you. 626-SOLD or 284-SOLD

AMBOY 1 & 2BR Apts. Reasonable. Dep/ refs. 815-440-8116 200 S. Boyd Ave. 2BR, good cond. $425/mo. Available immediately. Call Ed Reagan 312337-7384

ASHTON 1&2 BR., Ashton/ F.G. 815-5626828/562-5075.

DIXON 2BR laundry, appl. garage. No pets. 815-499-3753. 2BR Upper, No pets. $500 + dep & ref. 815-288-5445 2BR, lower apt., very spacious, pets allowed w/ dep., $475/mo., all utilities pd. but electric. 815-994-0755 2BR, Northside, w/appls. & laundry hookups. 815-4405604. 3BR Upper in downtown Dixon. Heat & garbage incl. $600/mo. + dep. Pick up application at 210 W. 1st St. Condo Style, 2BR apt. w/private entrance and deck. Appliances included plus W/D. Water, sewer, garbage provided. Tenant pays elec. Off road parking. No pets. Lease & dep. req. $650/mo. Call 815378-2151 Large upper apt. stove, refrig, garbage, near shopping center, NO PETS, $500/mo. + $500 dep. 815-284-3862 Modern clean, 2BR. Stove, refrig., D/W. No smoking or pets. $500. 815652-3365. Nice 2BR garage & fireplace, garbage & water inc. $575 + dep. 815-973-5886

HARMON 1st Month Free! 2BR, appl. incl. Pet friendly. $475/mo. 815-562-7368

MILLEDGEVILLE 2 bedroom apt in Milledgeville. Washer, dryer hookups, off street parking. Immediate Occupancy. $375 per mo. Dep. and refs. required. Call 815-222-3705


SAUK VALLEY MEDIA s Tuesday, November 12, 2013 s PAGE B8

MILLEDGEVILLE

ROCK FALLS

STERLING

2 BR, stove & refrig, W/D C/A 1 car garage. No pets. $400/mo. + Dep. & Ref. 815-946-3330 or 815-751-3377

NICE 1BR, 304 Ave. B, $375 mo.+ dep. No Pets. (815) 626-8647.

★ NEW TODAY ★ Nice clean 1BR on the river. Appliances. No pets. $450/mo. + dep. 815-622-4344.

MT. MORRIS 1 Br. All utilities, plus cable/internet incl., $500/mo. Call Todd 815-994-2050

STERLING

1BR, Mt. Morris. $310/mo. + dep., 815-508-2345

POLO 2BR upper, completely remodeled. Applcs. Garage, AC. No pets, no smoking. Dep/ refs. req.$595/mo. 815946-3191 after 5p. Large 2BR, C/A appli., sound proof. Gar. $585/mo. + dep. Avil. Dec 1st. 847-738-2334

RIVER RIDGE APARTMENTS 2 Bedroom

Great Location Garages Available

$

495

PER MONTH

1st Month’s Rent

$

1.00

*

*with 1 year lease

Next to

ALDI in Sterling

1-815-414-2288

PROPHETSTOWN 3BR, 3 BA Luxury Apt., w/2 stall attached garage. Utilities negotiable. Call Kophamer & Blean Realty 815772-2728.

ROCK FALLS 1 & 2BR, Hampton Apts. 815-625-7043 1 BR. $400 815718-5278 1BR, $425 mo, includes util. East Rt. 30. 815-508-2345 2BR upper, $695 / mo. Utilities included. 630-414-1031 2BR, stove, refrig. furn. heat, water & sewer included, $525/mo. + dep. 563-880-8622 Edon Apts. 2BR, $480 mo., $400 dep. Refs. req. No 815-537dogs. 9190, 815-4413999. Lg. 1BR. + appl. No pets. $425 + dep. 815-625-4701

1 & 2BR apts. $380-$420. 815562-7368 Rochelle Realty. W#527849

Sterling Rentals Newer 2 Bedroom $599.00 & Up Applcs., Fireplaces 2002 3rd Ave. 1836 First Ave. 606 W. Lefevre 2 BR $535.00 1 BR $465.00 1 Studio $390.00 Partial Heat, Water, Sewer, Refuse Removal, Laundry Facilities, Satellite

(815)626-1431 2BR $450 + dep. No pets/smoking. 815-590-3004. 2BR Duplex, $675/ mo. Call 815-9736768. Apts. No pets. Call 815-716-0367.

New & Improved 2BR $500. No pets. 630-3277046. Park Setting, newer 2BR, L/R, garage, NS, 1 floor, near CGH, energy efficient, 1832 2nd Avenue $585/mo. 815-499-0199. Sinnissippi Townhomes First Mo. Free! Spacious 2 BR. 2 story townhomes. Central air, good location. Laundry hookup. (815)6261130.

WOOSUNG 604 Griswold Ave. 2 BR, 1BA, Ground level Unit, Newly Remodeled. $525/ mo. Requires sec. deposit. Call Matt @ 310-750-5663

HOMES FOR RENT

MOBILE HOMES

DIXON

310

AMBOY 3BR home, 2ba. $700/mo. Call 815973-6768.

DIXON 1BR, Stove & frig. incl. Basement. No Pets. Tenants pay utilities + deposit. $475 month Available now! 815-440-2613 2BR Duplex w/gar. New E-windows, Appl., util., snowplowing incl. $550/ mo. 815-973-2831 3BR, Spacious. 1 ba. $475/mo. + dep 815-895-3463. 7410 Rock Nation Rd. Sm. 2 story home near Lost Nation Golf Course. Appls., 2 baths, 2 car garage, heat furn. Available Now! 815-761-2435 or 815-562-7854.

FOR RENT

For Rent Condominium On the River Boat Dock Incl. 2 BR 2BA Upper 1400 sq. ft. 1 Car garage Snow removal Lawn care $925/mo. + util. Lease-opt to buy 815-378-2151 Nice 2BR. No Pets. $485 + dep. 815-535-6731.

MORRISON 3BR, 2 BA country home on 16 acres, hunting rights included. $900 per month. Call Kophamer & Blean Realty 815-772-2728.

ROCK FALLS 1BR, applcs. Bsmt. No pets. $425+ dep. 815-625-4701 2 BR, 1 car Gar. W&D hookups, no pets, $475+$475 Dep. 815-625-1900 3 BR., 1ž ba., 2 car gar. No pets. 815-625-0624. House for Rent: 1 bed, kitchen appliances, basement, main floor laundry room with w/d hook up, $525/mo. Avail. immed. Call 815-622-2725. SNLrentals. com Large 2BR Townhouse, all ground level. Excellent area. 800 Dixon Ave. No pets. Refs. req. 815-336-2305.

★ NEW TODAY ★ Small 1BR, W/D hookups. $440/mo. + dep. Call 815499-3187. Small 2BR 1 car garage $495/mo. + dep. & ref. 815632-7111. Why Rent? You CAN Own! Totally Remodeled, 3BR Home. $650/ mo. 815-878-6356.

STERLING

Senior Warehouse Data Steward Coordinator As the world’s largest food producer, Nestle know success

well. As an industry leader, we offer a competitive wage and EHQHÀWVSDFNDJH:HFXUUHQWO\KDYHDQRSSRUWXQLW\IRUD6HQLRU :DUHKRXVH 'DWD 6WHZDUG &RRUGLQDWRU DW RXU 1HVWOH¡ 3XULQD )DFLOLW\LQ&OLQWRQ,$

Job Duties:

‡3URYLGHVWUDLQLQJDQGWHFKQLFDOJXLGDQFHWRZDUHKRXVH team members. ‡$GPLQLVWHUV&OLQWRQ3ODQW:DUHKRXVH0DQDJHPHQW6\VWHPDQG /RDG&RQÀJXUDWRUDSSOLFDWLRQV ‡5HYLHZVDQGXSGDWHV:06ELQDQGSURGXFWFRGLQJWRRSWLPL]H VSDFHXWLOL]HUDQGRSHUDWHSURGXFWLYHO\ ‡(QVXUHVQHZ83&¡VDUHVHWXSSURSHUO\ ‡3UHIHUVÀOHVPDLQWHQDQFHWRV\VWHPWDEOHV ‡7URXEOHVKRRWVV\VWHPDQG5)SUREOHPVDQGUHSRUWVDSSOLFDWRU problems. ‡&RRUGLQDWHVSK\VLFDOLQYHQWRU\RIÀQLVKHGJRRGV ‡5HVHDUFKHVLQYHQWRU\YDULDQFHV ‡(QVXUHVGDWDLQWHJULW\EHWZHHQ:06&3,&DQG 6$36\VWHPV

%DVLF4XDOLĂ€FDWLRQV ‡+LJK6FKRRO'LSORPDRU*('$$'HJUHHSUHIHUUHG ‡*HQHUDOFRPSXWHUNQRZOHGJHZRUNVWDWLRQH[SHULHQFH  UHTXLUHG SURJUDPPLQJ H[SHULHQFH 64/  SUHIHUUHG $PLQLPXPRI\HDUVJHQHUDORIĂ€FHHOHFWULFDOH[SHULHQFH UHTXLUHG%DFNJURXQGLQ$FFRXQWLQJ:DUHKRXVHRIĂ€FH clerical operations or inventory management desirable.  +DQGV RQ H[SHULHQFH ZLWK D FRPSXWHUL]HG ZDUHKRXVH management system highly desirable. ‡([SHULHQFHLQ:066$3([FHOSUHIHUUHG ‡0XVWEHDEOHWRSULRULWL]HZRUNHIIHFWLYHO\XQGHUSUHVVXUHDQG KDQGOHPXOWLSOHWDVNV([FHOOHQWRUJDQL]DWLRQFRPPXQLFDWLRQV NH\ERDUGDQGPDWKHPDWLFVVNLOOVDUHUHTXLUHG0XVWEHDVHOI starter who can work with minimal guidance. ‡$EOHWRZRUNDPSPDQGRYHUWLPHDVQHHGHG +RXUVVXEMHFWWRFKDQJH0D\UHTXLUHZRUNLQJUHPRWHO\

All interested candidates must apply online at www.nestlepurinacareers.com no later than Monday, November 18, 2013 under job number 13005152 no phone calls please

Physical, drug screen & alcohol screen may be required. EOE

1403 E. 18th St. 3BR, 1.5ba. 2.5 car garage. Beautiful woodwork. $925/ mo. + dep. Call 815-632-3234. Photos @ villow.com 2 BR., 1 car garage. $675 mo., lease, dep. req. H&H Rental Properties, LLC, call or text 815-625-7995. 2BR home, 1 ba. $650/mo. Call 815973-6768. 3BR home, across from park, close to school. $700/mo. + dep. No pets. 815-508-7534.

★ NEW TODAY ★ Nice, Clean large 4 BR home, 1.5 BA. Responsible pet owners welcome. $700/mo. + dep. 815-625-5273 Rent to own. 2BR 815-622-9665. Realtor Owned. Sec. 8 approved, 3 BR, on East side. Avail. Dec. 1st No garage. No pets. Call 815-499-0306

315

WAREHOUSE / 330 STORAGE Henson Storage. RV, Boat, Car, Motorcycle storage. 815-590-2181. Sterling Logistix is offering indoor or outdoor Boat & Camper storage. For info. Call Scott 815626-0217 or s.bailey@sterling logistix.com

GARAGE SPACE

331

10x20 $50/mo. + $35 dep. 815-5909478.

LOANS

402

THE CLASSIFIED Advertising Department of Sauk Valley Media does not have the opportunity to fully investigate the credibility of each advertiser appearing within these columns. If an offer sounds “too good to be true� it probably is. Proceed with caution if you are asked to send money or to give a credit card number. Proceed with caution in calling 900 phone numbers. All phone numbers prefixed by “900� are charged to the CALLER. Charges may be assessed on a “per minute� basis rather than a “per call� basis. Sauk Valley Classified makes every effort to qualify these charges for the reader. If you have a concern about an advertiser, please contact the Better Business Bureau 330 N. Wabash, Chicago, IL 60611. 312-832-0500

BUSINESS OPPORTUNITIES 501 NOTICEPURSUANT to the Business Opportunity Sales Law of 1995, every business opportunity must be registered with the Illinois Securities Department. Protect yourself and get the facts before you hand over your hard earned money by contacting the Illinois Secretary of State's Securities Department at 1800-628-7937. This notice provided as a public service by Sauk Valley Classifieds.

EDUCATION

503

AIRLINE CAREERS begin here Become an Aviation Maintenance Tech. FAA approved training. Financial aid if qualified Housing available. Job placement assistance. CALL AIM 800-481-8312

HEALTH / MEDICAL

504

★ NEW TODAY ★ Avonlea Cottage Assisted Living seeking Nurses, full and part time, 2nd & 3rd shifts. No calls. Apply to Tiffani Heintzelman DON at 2201 E. LeFevre, Sterling. IF YOU USED THE MIRENA IUD between 2001present and suffered perforation or embedment in the uterus requiring surgical removal, or had a child born with birth defects, you may be entitled to compensation. Call Johnson Law and speak with female staff members 1-800-535-5727

EMPLOYMENT

505

Welder Fabricator

Full time. $30/hr. Must have 15 yrs experience.Please No phone calls or walk ins. Mail resume to:

Brechon Farm Services, Inc. 1270 IL. State Route 26 South Dixon, IL. 61021

Full time. $30/hr. Must have 15 yrs experience. Please No phone calls or walk ins. Mail resume to:

Brechon Farm Services, Inc. 1270 IL. State Route 26 South Dixon, IL. 61021

Class A CDL Driver Hauling Grain & Fertilizer $20.00 per Hour plus overtime. Hauling NH3 with a Hazmat endorsement $25.00 per Hour plus overtime. Must have 5 \HDUV YHULĂ€DEOH H[SHrience. Please mail resume to:

Brechon Farm Services, Inc. 1270 IL. State Route 26 South 'L[RQ ,/ 

Combination Waitress/kitchen help, PT. Apply in person at Joe's Pizza, 119 S. Peoria Ave., Dixon. No phone calls please Drivers HIRING EXPERIENCED/ INEXPERIENCED TANKER DRIVERS! Earn up to $.51 per Mile! New Fleet Volvo Tractors! 1 Year OTR Exp. Req. - Tanker Training Available. Call Today: 877-882-6537 www.Oakley Transport.com

Floor Tech needed immediately in Dixon. No exp. needed. Call 630903-4013

CREDIT ANALYST

Minimize risk for customers & company by establishing terms & limits, communicating payment requirements, determining release of holds, & presenting recommendations for complex situations.

OVER-THE-ROAD SEMI DRIVER

Schedule rotates weekly 8-5, 9-6, 10-7

7KH TXDOLĂ€HG FDQGLGDWHPXVW SRVVHVV D YDOLG &'/ ZLWK DW OHDVW WZR \HDUV RI YHULĂ€DEOH UHFHQW RYHU WKH URDG GULYLQJ H[SHULHQFH 0XVW KDYH JRRG FRPPXQLFDWLRQVNLOOVDQGDOVRKDYHDJRRGGULYLQJUHFRUG &DQGLGDWHPXVWPHHWDOOIHGHUDO'27UHTXLUHPHQWV LQFOXGLQJ 'UXJ DQG$OFRKRO VFUHHQLQJ DQG PXVW EH DWOHDVW\HDUVROG&DQGLGDWHVPXVWSRVVHVDSDVVSRUW RU REWDLQ RQH ZLWKLQ  GD\V RI HPSOR\PHQW +HDY\OLIWLQJLVUHTXLUHG We are also accepting applications for our Production department RQ VHFRQG VKLIW 4XDOLĂ€HG candidates must possess a high school diploma or HTXLYDOHQW EH DEOH WR UHDG DQG FRUUHFWO\ LQWHUSUHW RUGHUVDQGEHDKDQGVRQWHDPSOD\HU+HDY\OLIWLQJ is required. 5D\QRURIIHUVDFRPSHWLWLYHFRPSHQVDWLRQSDFNDJH DQG EHQHĂ€WV LQFOXGLQJ PHGLFDO GHQWDO OLIH DQG  N  ,I \RX DUH LQWHUHVWHG LQ DQ H[FLWLQJ FDUHHU with a solid organization, please send your resume DQGFRYHUOHWWHUZLWKVDODU\UHTXLUHPHQWVWR

Raynor Garage Doors $WWQ +XPDQ 5HVRXUFHV  ( 5LYHU 5RDG 'L[RQ ,/  )D[ ²  (PDLO ² HPSOR\PHQW#UD\QRUFRP (2(

505

GORDON TRUCKING CDL-A Truck Drivers Up to $5,000 Sign-on Bonus & $.56 CPM! Solo & Teams Dedicated/Home Weekly Available! Call 7 days/wk! EOE 888-653-3304

GordonTrucking.com

Legal Assistant Seeking an experienced, self-motivated Legal Secretary to join our team. Duties include project management, client interaction, scheduling, document production, filing, and answering phones. Computer skills required; dictation skills preferred. The successful candidate will be diligent, pleasant, able to communicate well, and adept at multitasking. Legal assistant experience required. To apply please send your cover letter and resume to either saukvalleylaw@ gmail.com Please send replies to Box #:1192, c/o Sauk Valley Classifieds, P.O. Box 498, Sterling, IL 61081

Diesel Mechanic

Â˜Ă‡ÂşÂšÂžĂ‰Â„Ä˛ĂƒÂśĂƒÂ¸Âş ÂşĂ?Ă… Ă…Ă‡ÂşÂťÂşĂ‡Ă‡ÂşÂšÂƒ –¡Ä˺ œËºÇœŸº šœÉœ ÂşĂƒĂ‰Ă‡ĂŽÂ Â¤ÂťÄ˛Â¸ÂşÂ Â¸Ă„Ă‚Ă‚ĂŠĂƒÂžÂ¸ÂśĂ‰ÂžĂ„Ăƒ { ÂśĂƒÂśĂ ĂŽĂ‰ÂžÂ¸ÂśĂ ĂˆĂ€ÂžĂ Ă Ăˆ Ă‡ÂşĂ†ĂŠÂžĂ‡ÂşÂšÂƒ

Raynor Garage Doors, a leading supplier of residential and commercial garage doors and openers has an immediate opening for an over-the-road semi driver.

EMPLOYMENT

ECOMMERCE MERCHANDISING & SALES SPECIALIST

Maintain large online product catalog, manage merchandising projects & coordinate work of other ECom employees, Ă‡ÂşĂˆĂ„Ă Ă‹Âş ÂžĂˆĂˆĂŠÂşĂˆ ĂŒÂžĂ‰Â˝ Â¸ĂŠĂˆĂ‰Ă„Ă‚ÂşĂ‡Ăˆ { ÂśÂ¸Â¸Ă„ĂŠĂƒĂ‰ ÂşĂ?ÂşÂ¸ĂŠĂ‰ÂžĂ‹ÂşĂˆÂƒ Â˘ĂŠĂˆĂ‰ ÂšÂşĂ‚Ă„ĂƒĂˆĂ‰Ă‡ÂśĂ‰Âş ºº¸ÉžËº ÅÇÄ¿º¸É Ă‚ÂśĂƒÂśÂźÂşĂ‚ÂşĂƒĂ‰Â Â¸Ă„Ă‚Ă‚ĂŠÂ‚ ĂƒÂžÂ¸ÂśĂ‰ÂžĂ„ĂƒÂ Â¸ĂŠĂˆĂ‰Ă„Ă‚ÂşĂ‡ ĂˆÂşĂ‡Ă‹ÂžÂ¸ÂşÂ Â¸Ă„Ă‚Ă…ĂŠĂ‰ÂşĂ‡Â Ă…Ă‡Ă„ÂˇĂ ÂşĂ‚ Ă‡ÂşĂˆĂ„Ă ĂŠĂ‰ÂžĂ„ĂƒÂ { leadership skills.

CSR (Sales Support/Order Management) Â§ÂşĂ‹ÂžÂşĂŒ ÄǚºÇ ǺÅÄÇɠǺ¸ºžËº Ă…Ă‡Ă„Ă„ÂťĂˆÂ Â¸Ă„Ă‚Ă‚ĂŠĂƒÂžÂ¸ÂśĂ‰Âş ĂŒÂžĂ‰Â˝ { act as liaison for Sales/Suppliers, track shipments & enter status updates in computer. Must be able to comprehend & retain complex processes, Â¸Ă„Ă‚Ă‚ĂŠĂƒÂžÂ¸ÂśĂ‰Âş ÂşÂťÂťÂşÂ¸Ă‰ÂžĂ‹ÂşĂ ĂŽÂ ĂˆĂ„Ă Ă‹Âş Ă…Ă‡Ă„ÂˇĂ ÂşĂ‚Ăˆ { ĂŒĂ„Ă‡Ă€ ĂŒÂžĂ‰Â˝ Âś ˜‚ ǞºÉÎ Ă„Âť Ă…ÂşĂ‡ĂˆĂ„ĂƒÂśĂ ÂžĂ‰ÂžÂşĂˆ Ă„Ăƒ Ă‹ÂśĂ‡ÂžĂ„ĂŠĂˆ Ă‰ÂśĂˆĂ€Ăˆ ÂžĂƒ Âś ÂťÂśĂˆĂ‰Â‚Ă…ÂśÂ¸ÂşÂš šºœš‚ Ă ÂžĂƒÂşÂ‚ÂšĂ‡ÂžĂ‹ÂşĂƒ ÂşĂƒĂ‹ÂžĂ‡Ă„ĂƒĂ‚ÂşĂƒĂ‰Âƒ –¡Ä˺ œËºÇœŸº ¸ÄÂÅÊɺÇ { Ă‰ĂŽĂ…ÂžĂƒÂź ĂˆĂ€ÂžĂ Ă Ăˆ Ă‡ÂşĂ†ĂŠÂžĂ‡ÂşÂšÂƒ ÂĽĂ‡ÂşĂ‹ÂžĂ„ĂŠĂˆ ĂˆÂśĂ ÂşĂˆ ĂˆĂŠĂ…Ă…Ă„Ă‡Ă‰ ÄÇ ÄɽºÇ Çºà œÉºš ÂśÂšĂ‚ÂžĂƒ ÂşĂ?Ă… Ă…Ă‡ÂşÂťÂşĂ‡Ă‡ÂşÂšÂƒ šº¸ÉžËº Ă„Ă‡ÂźÂśĂƒÂžĂ?ÂśĂ‰ÂžĂ„ĂƒÂ Â¸Ă„Ă‚Ă‚ĂŠĂƒÂžÂ¸ÂśĂ‰ÂžĂ„Ăƒ { ¸ÄÂÅÊɺÇ ĂˆĂ€ÂžĂ Ă Ăˆ Ǻ‚ quired.

HALO offers a fun environment, generous ÂˇÂşĂƒÂşÄ˛Ă‰Ăˆ Ŝ¸ÀœŸº { Â¸ÂśĂˆĂŠÂśĂ ÂšĂ‡ÂşĂˆĂˆ Â¸Ă„ÂšÂşÂƒ ÂŤÂžÂşĂŒ Êà à ¿Ä¡ ÂšÂşĂˆÂ¸Ă‡ÂžĂ…Ă‰ÂžĂ„ĂƒĂˆ { œÅÅà Î Ă„ĂƒĂ ÂžĂƒÂş σ ĂŒĂŒĂŒÂƒÂ˝ÂśĂ Ă„ÂƒÂ¸Ă„Ă‚Â„Â¸ÂśĂ‡ÂşÂşĂ‡ĂˆÂƒ Â?–¥¤ ÂžĂˆ ÂśĂƒ ÂšĂ†ĂŠÂśĂ Â¤Ă…Ă…Ă„Ă‡Ă‰ĂŠĂƒÂžĂ‰ĂŽ šÂÅà ÄκÇ }¢„›„„™~

Northern Grain Marketing is seeking Experienced CDL drivers. Immediate openings for temporary local grain hauling. Hours may vary. To inquire call Tom Wilson @ 815-973-3016.

NOW HIRING! Truck Driving School Instructors. JOIN CRST's brand new training school in Cedar Rapids, Iowa! Relocation assistance provided. Call: 866-504-4035; email: mknoot@crst.com

Part Time Night Custodian Milledgeville School is accepting applications for the position of Part Time Night Custodian. Position to start December 2, 2013. Wages negotiable based on experience and skills. Submit letter of interest and resume by November 18th, 2013 to: Paula Rademacher, Principal Milledgeville Elementary School 100 E. 8th St. Milledgeville IL 61051 Phone 815-225-7141, Ext. 224 Email: prademacher@di st399.net

SEASONAL TRUCK DRIVERS Needed from 12/112/20 Class A And/Or Class B CDL & Medical Card Required Apply At: Blue Freedom 1829 Locust, Sterling 305 Cartwright Ave, Ashton M-F 9-4

The Polo School District #222 announces the following vacancy beginning De16, cember 2013: The Polo High School Night Custodian position. Wages are negotiable based on experience and skills. Please apply at http://www.polo222 .org/dist/newem ploy.html by

November 2013.

29,

TO OUR

READERS:

Sauk Valley Media does not knowingly accept advertising which is in violation of the law. Likewise, we do not knowingly accept advertising which is fraudulent or has malicious intent. While we attempt to screen advertising with potential fraud, it is impossible to screen all potential problems. We strongly encourage our readers to exercise caution and common sense, particularly when dealing with companies with which you are not familiar.

EMPLOYMENT

505

Warehouse/ Driver: Wausau Supply Company, Rochelle, IL seeks warehouse/ material handler(s) with Class A CDL. Warehouse material handling & Forklift exp. preferred. CDL-A w/100K mile experience required. Great Pay & Comprehensive Benefits. Email resume to: humanresources@wausaus upply.com or Fax to: 877-879-4150

CHILD CARE

512

Little Blessings Childcare has immediate daycare openings for infant-school age. 1st & 2nd shifts. 815-285-3811 Lic# 48927502 NO INDIVIDUAL, unless licensed or holding a permit as a childcare facility, may cause to be published any advertisement soliciting a child care service.* A childcare facility that is licensed or operating under a permit issued by the Illinois Department of Children and Family Services may publish advertisements of the services for which it is specifically licensed or issued a permit. Sauk Valley Media strongly urges any parent or guardian to verify the validity of the license of any facility before placing a child in it's care. *Family homes that care for no more than three (3) children under the age of twelve or which receive only children from a single household, for less than 24 hours per day, are exempt from licensure as day care homes. The three children to whom this exemption applies includes the family's natural or adopted children and any other persons under the age of 12 whether related or unrelated to the operator of the day care home. (DCFS Rule, Part 377.3 (c))

POSITION WANTED

515

★ NEW TODAY ★ CNA w/ references looking for extra work. Call Rhonda 815-632-9376.

AREA GARAGE SALES 624 ANTIQUES & COLLECTIBLES 705 I Buy: Antique furniture, fishing tackle, toys, post cards junk. 815-445-6151

APPLIANCES

710

CLOVER HILLS

RENT TO OWN APPLIANCES TV’S MATTRESSES

815.625.8529

★ NEW TODAY ★ Frigidaire Gallery gas stove, 2 yrs. old, like new, $400 815-238-2960. Reliable, LIKE NEW used appliances, cmsappliance.net (815)626-1003

BUILDING SUPPLIES

720

D-face Tongue & groove pine siding from True North log homes, 116 boards most 16' by 11Ÿ� wide by 2� thick. Worth $20,000. Selling for $10,000 815-652-6803

COMPUTERS

735

Mac Pro Quad Core/2.66 Ghz, equipped for the graphic designer or photographer, 13 GB RAM, 3 hard drives, 2 DVD burners, options available. $725. 815-626-7125.

FURNITURE

755

Danish Modern Dining or Kitchen table, 1 leaf & chairs. Great cond. $135 815-2885892 Ethan Allen maple double 4 poster canopy bed. $450. Maple drop leaf table, $275. Antique: Mr. & Mrs. Chairs $375 and spinning wheel $40. Call 815-652-8726. Twin mattress & box spring, like new. $100. 815284-6504 lv. msg.

FURNITURE

755

Mattress sets: Twin $99, Full $129, Queen $159, King $199. Will deliver! Kern Mattress Outlet 309-4527477.

MUSICAL INSTRUMENTS 765 Starck Upright Paino. Free for the hauling. Call 815772-4632

PETS & PET SUPPLIES 775 2 Red-Eared Sliders & algae eating fish w/ 40 gal. tank & ALL accessories, valued at $500, will sell for $250obo 815-652-0256 4 Long haired black kittens & 2 calico. Free 815677-8948 WARNING ADS FOR FREE PETS Your beloved pet deserves a loving, caring home. The ad for your free pet may draw response from individuals who will sell your animal for research or breeding purposes. Please screen respondents carefully when giving an animal away. Your pet will thank you! Yellow Lab puppies. $350. Call 815-876-0705

LAWN MOWERS

779

1971 110 JD lawn tractor w/mower deck & extras. Exc. cond. $1500 OBO. 815-857-4282

SNOWBLOWERS 782 Craftsman Snowblower 21� clearing width. 179CC 4 cycle OHV. Electric start. Like New! $300 OBO 815718-5199

TICKETS / TRAVEL 787 & EVENTS No person or business, unless properly licensed by the Illinois Secretary of State, may sell ticket(s) for any sporting event or otherwise, for more than the price printed upon the face of the said ticket(s). Only licensed ticket brokers may legally advertise, negotiate and execute the sale of ticket(s) for any amount over what is printed upon the face of ticket.

TOOLS & MACHINERY

792

Crystal Lake O.D. Precision Grinder, bench top model, approx. 5� center, 2 1/2� swing, will grind to tenths, tenths indicator incl., $450 815-9733223.

KRINGLE'S KORNER

794

New In Boxes, Rudolph's Xmas Town Village, by Hawthorne Village. 9 houses & 20 figurines. $350 815535-3963

MISCELLANEOUS 796 FOR SALE 2 ladies 2 pc. party dresses, sz. 16, $30, Men's Haggar black suit, sz. 42 coat, sz. 40 pants, $35, Ronco Showtime rotisserie w/ pd. manual, $120/now $35, & 3 crock pots in 1 unit, used once, $25. Call 815-6263142. 2 Morgan Silver Dollars (1878S/1879) F to XF cond. $78/obo 815-626-6053 9' Artificial Christmas Tree, very full. Storage bins Inc. $100. Call 815625-4502 Custom corn hole boards & bags made to order. Deposit required. Call 815-440-8659 Desk, $30, 815590-9594. Dining room table & chairs, $40, 815590-9594. Festival of Trees Country Store at Woodlawn Arts Academy Opens Sun. Nov. 17 Icicle lights, 16 strands $20. 815625-0355 Lighted Santa w/ sleigh/reindeer & pkgs. Outdoors. $40. 815-625-0355

★ NEW TODAY ★ Must Sell! Refrigerator, $250, Call 815-590-9594.


SAUK VALLEY MEDIA s Tuesday, November 12, 2013 s PAGE B9

NURSES

Long term care facility is accepting applications for PT QXUVHV6WRSLQDQGĂ€OORXWDQDSSOLFDWLRQRUDSSO\RQOLQH at www.good-sam.com. AA/EOE, M/F/Vet/Handicap, Drug Free Workplace. Good Samaritan Center - Prophets Riverview 310 Mosher Dr. Prophetstown, IL 61277 815-537-5175

Winning Wheels Inc. is opening a new wing and has opportunities for Nurse Aides! Every other weekend and some holidays required If you are looking for a chance to make a real difference and become part of a dynamic team dedicated to helping others reach their fullest potential – Apply Today!

Apply in person: 701 E. 3rd St. Prophetstown, IL 61277 Or online at: www.winningwheels.com

Applicants must complete pre-employment physical, drug screen and background check.

EOE

Social Services Services our Social Services department with primary responsibilities including individual and group counseling, case management and community integration. This is an excellent opportunity for an enthusiastic human services professional to join our growing team in one of the nation’s leading residential rehabilita-

tion centers for young adults with neurological impairments. 4XDOLÀHG FDQGLGDWHV PXVW KDYH D FROOHJH GHJUHH DQG H[SHULHQFH LQ WKH 6RFLDO 6HUYLFHV ÀHOG :H RIIHU D XQLTXH DQG UHwarding career opportunity, with a competitive salary and EHQHÀW SDFNDJH For consideration please fax or mail resume to: Amie Topp Winning Wheels 701 E 3rd St. Prophetstown, Il 61277 Applicants must complete pre-employment physical, drug screen and background check. Phone 815-537-5168 EOE Fax 815-537-5268 Apply online at: www.winningwheels.com

REVIEW ROUTES AVAILABLE! EARN EXTRA $$$$ BY WORKING ONLY 1 DAY PER WEEK! Pick Up Papers on Tuesday and Deliver by Thursday! Extremely Flexible ~ Between 150-300 Papers

Call for Availability 815-625-3600 ext. 301

Streets

Sterling Sterling

E. LeFevre, 17th-19th Ave. W. LeFevre, Ave. I-K

Telegraph 113 S. Peoria Dixon, IL 61021

★ NEW TODAY ★

Pre-mixed paint (10 gallons) & sheet rock mud. $20. 815-677-0896

See More Online Photos, Commerce, Expanded Text

Items for Sale: Ricon wheelchair lift for van, $500; Ariens GT12 riding mower w/ snow blower, $125; Valley bolt on receiver hitch for full size truck, $50; Century fiberglass 7 ft. 2001 topper, Chevy, $300, Call 815-441-5656 or 815-438-2119.

Redhead Hiking Boots, sz. 10, brn. Ladies, like new, $40 815-881-8117

Sears Craftsman elec. lawn/yard blower. $25. 815625-4268.

Full time Delivery/Warehouse Position available. Must be neat, organized, enjoy working with people and have a good driving record. This position involves delivery of furniture and/or appliances and electronics; therefore, heavy lifting may be required. Benefits package included.

Apply in person to: Ashley Furniture HomeStore/ Knie Appliance & TV Inc. 3614 E. Lincolnway Sterling, IL. EOE

Sterling Schools Washington Wa shington School (1) Opening: Elementary Nurse RN or LPN 6DODU\ %HQHÀWVDVDUH &XVWRPDU\ZLWKWKLV (63SRVLWLRQ -REGHVFULSWLRQDYDLODEOH DWWKHGLVWULFWRIÀFH ,QWHUHVWHGDQGTXDOLÀHG $SSOLFDQWVVKRXOG ÀOORXWDQRQOLQH DSSOLFDWLRQDW ZZZVWHUOLQJSXEOLFVFKRROVRUJ *RWR'LVWULFW6HUYLFHV +XPDQ5HVRXUFHV -RE2SHQLQJV (PSOR\PHQW Application Apply by Nov 14th

➛Look for WEB ID ➛Log on to: www.saukvalley. com classifieds ➛Enter the WEB ID in the WEB ID Box ➛View Photos, Expanded Text BUY ONLINE!! saukvalley.com CLASSIFIEDS

Route

Customers

60 57

71 58

Twin, full, queen, king beds $90. Recliner, dryer, reclining sofa, twin size sofa sleeper, upright chest. 815718-4385.

FARM LAND WANTED

815

Farmland wanted to rent or custom farm in 2014 & beyond. 815-9702695

FARM EQUIPMENT

855

8N Ford, 4 speed, 3 pt., 12v, grill guard, exc. cond., $2250 w/ 2 bottom plow, $2350 w/ new 6 ft. blade, obo 815-379-2541. Cub Cadet 5234D 3 cyl. diesel hydro. 24 hp 4X4, 60� deck, loader, 3 pt., 700 hrs., looks and runs great! $6900/obo 815379-2541.

CLASSIC CARS

904

1967 Ford Mustang, project car. Runs. $6,000/obo. Call 815-622-8176.

Sauk Valley

Auction Calendar

Complete sale bills are published in 6DXN 9DOOH\ &ODVVLĂ€HGV

November 17 - 1:30PM -  6 6SULQJ 6W )UDQNOLQ *URYH  :LOOLDU 7UXVW  /HQQ\ %U\VRQ $XFWLRQHHU   November 22 - 9:00AM - 1703 State 6W 'H.DOE  FRPPHUFLDO FRQWUDFWRU  Public Auction - Cantel Communication //& RZQHUV  -RH :HJHQHU $XFWLRQHHU - 815-766-0756 To place your auction in the newspaper or the Auction Calendar contact: Jennifer Diehl Inside Sales Executive Sauk Valley Media 815-284-2222 or  H[W

AUTOMOBILES

1995 Plymouth Neon, 161k, 4 cyl., auto, 35 mpg., w/many new parts, $1500 obo 815-973-1207

NEW REAL DEAL

FOR ALL READERS!

A 5 Line REAL DEAL

ad runs for 30 days in Sauk Valley Classifieds, 4 Ogle County Papers, The Review and saukvalley.com all for only $38! Special must be mentioned at time of ad placement. Offer expires 12/31/13 No Commercial Advertising, Pets, Garage Sales, Wood/ Fuel, Tickets/ Travel or Real Estate

2003 Volkswagen Beetle GLS, loaded, blue, 5spd. 117K mi. $5,000 obo 815-857-3739 2005 Chrysler Sebring Touring Conv., exc. cond., 86.5K mi., $7,500 815-440-2145. 2006 Honda CRV, 1 owner. Exc. cond. Loaded, 121,000 mi. $8800 OBO. 815-7723555. 2008 Nissan Rogue, AWD, 105K mi., well maintained, $8,800 obo 608-515-6330. 2009 Pontiac Vibe, good tires, new brakes. Cherry red. 4dr. Interior great cond. $10,000/obo 815-994-0977. creditautosales dixon.com Always over 100+ vehicles to choose from.

Sensient Flavors, a leading manufacturer of dairy ingredient products, is seeking a Maintenance Mechanic. Minimum requirements include a High School diploma, and 3-5 years of industrial maintenance experience. College/ technical training with a background of PLCs a plus. Experience with boilers, waste water treatment, and food/ beverage background preferred. Must have excellent mechanical and troubleshooting skills; Competitive comSHQVDWLRQ H[FHOOHQW EHQHÂżWV . ESOP. Equal Opportunity Employer.

905

Credit Problems? Bad Credit? No Credit? We might be able to help! If you're looking to buy a vehicle we have many financing options available through qualified lenders. Call Brett Simpson today at 815-2855313. Ken Nelson Auto Plaza. HAVING TROUBLE wording your ad? Call our classified department today. We'll be glad to help you. 626SOLD or 284SOLD. PHOTOS ONLINE!!

When you see the above logo in a classified ad in the paper you'll find a whole lot more online. Just go to www.saukvalley. com Classifieds, and enter the Web ID included in the ad.

S.U.V.S

909

2002 Yukon XL, dark gray, ½ ton 1500, 4 wheel dr,. 188K mi. Firestone tires and cattle guard. 5.3 Liter $5,500. Call 815622-8055 2005 Ford Explorer, 4 Wh. Dr. V6, Leather, 3rd row seats, sunroof. Great Con. $5,900 815-499-9902

Motor Route Drivers

Motor Routes Available Inquire in person at:

Sauk Valley Media 3200 E. Lincolnway Sterling, IL 61081

Telegraph 113 S. Peoria Dixon, IL 61021

or call: 625-3600 or 284-2222, ext. 301

Custom Built Websites by Shaw Shaw Media Media Digital Digital

815-625-3600 ext. 301

Earn Holiday CASH!

Part-Time Independent Living Specialist

Send application, resume, and cover letter to: NICIL Michele Miller – Executive Director 412 Locust Street, Sterling, IL 61081 EOE No Email Resume! * No Phone Call!

AUTOMOBILES

Sauk Valley Media is looking for

Telegraph 113 S. Peoria Dixon, IL 61021

Northwestern Illinois Center for Independent Living seeks an enthusiastic, self-motivated team player for A part-time/35 hour a week position as an Independent Living Specialist. 7UDYHO WR ÀYHFRXQW\ DUHD UHTXLUHG ² PLOHDJH UHLPEXUVHG $ SUHVHQWDWLRQWHDFKLQJ GHPR ZLOO EH UHTXLUHG 3HRSOH ZLWK GLVDELOLWLHV HQFRXUDJHG WR DSSO\ $VVRFLDWH 'HJUHH RU +LJKHU SUHIHUUHG &KHFN RXW RXU ZHEVLWH ZZZQLFLORUJ WR OHDUQ KRZ \RX FDQ DSSO\ 3RVLWLRQ PD\ EHFRPH IXOO WLPH ZLWK EHQHÀWV LQ  'HDGOLQH WR DSSO\ IRU WKLV SRVLWLRQ November 19, 2013

905

Maintenance Mechanic

Or mail resume to: 6HQVLHQW )ODYRUV Attn: HR Department  ( 0DLQ 6W $PER\ ,/  12 3+21( &$//6 25 :$/.,16 3/($6(

Call for Available Routes in Morrison & Milledgeville Call For Available Routes in Rock Falls

Sauk Valley Media 3200 E. Lincolnway Sterling, IL 61081

MISCELLANEOUS 796 FOR SALE

Email resume to: ÀDYRUBLQG\UHFUXLWLQJ#VHQVLHQWWHFKFRP

ROUTES AVAILABLE! Towns

MISCELLANEOUS 796 FOR SALE

Delivery/Warehouse Position

Shifts: 2nd (2pm-10pm) or 3rd (10pm-6am) )XOO WLPH RU SDUW WLPH ‡ KU

Sauk Valley Media 3200 E. Lincolnway Sterling, IL 61081

MISCELLANEOUS 796 FOR SALE

Call today to get started!

815-625-3600 ext. 630 shawmediadigital.com


A1

SAUK VALLEY MEDIA s Tuesday, November 12, 2013 s PAGE B10

SERVICE DIRECTORY SAUK VALLEY

Air Cond./Heating

Brick & Masonry

Computer Repair

Genl. Contracting

Eikenberry Sheet Metal 412 E. 3rd, Sterling Service work heating & cooling; gas, electric. Free estimates Accept Visa & MC on all new installations.

LAUTS MASONRY & GENERAL CONTRACTING   Stone &ed Wo   Po     Over 35 Years Experience Quality work for a reasonable price. ndedd 815-718-4885

G & H PC REPAIR Virus Removal & Data Recovery$50. We also do: ( grades (#Reto$ (# Restoratio ( !  Desig Hardware/Software Certified. 815-499-4871

Gilbertson Construction Residential & Commercial. Remodeling, house additions, windows, siding & doors. Also mobile home repairs. Licensed, Bonded, Insured. No Job Too Small. 30 yrs exp. (815)6220087.

MASONRY PRO'S %Stone %$ d !t % w $    !  Get $     one  "  Fe   te $ e# I!d nded 815-564-8754

RAM CONSTRUCTION eny  te  extu ng 



Licensed, Insured & Bonded 815-285-8148

CALL 815-625-0955

FARLEY'S APPLIANCE Heating & Cooling Sale & Service Free Estimates New & Replacement Units We service all brands! Call Today (815)284-2052

Appliances

TELEVISION IN HOME REPAIR All Types Brands & Models Over 25 yrs. Exp. Call Ron for a free quote at 815-561-0011

Auto Detailing GENE'S AUTO DETAILING  fenal Results le Rates Call 815-973-3104    

Automotive

Cabinets Anselmo's Inc. Beautiful Kitchens Great Prices! Visit Our Showrooms! Cabinets, Countertops, Sinks, Faucets & More. We install. Estimates by appointment. 1235 W. LeFevre Sterling 815-625-3519

www.HotRods Choppers.com

Basement Waterproofing

Cleaning Service

Complete Automotive Detailing & Accessories

Window Tinting *LIW &HUWLĂ€FDWHV Hot Rods & Choppers Consignment / Sales 1807 Locust St. Sterling IL

(815) 625-2500

Prater Paint & Waterproofing We Dry Up Basements & Crawl Spaces, Remediate Mold & Install E-Z Breathe™ Ventilation Systems 815-626-5165

www.praterpaintand waterproofing.com

Bicycles

By Appointment 201 13th Ave. Sterling, IL (815)622-8180

Drywall DIEHL'S DRYWALL, INC. Also wallboard hanging & Interior Painting Over 20 yrs experience. Call Jamie at 815-499-3047 or 815-225-9927

Dumpster Rental

Carpentry KRIS’ KARPENTRY (815)564-9576 For all your building needs incl. kitchens, baths, basements, siding, replacement windows, additions & trim carpentry. It's time to replace those old windows to save money on heating. Call for a free estimate. No job too large or too small. Kris is a craftsman with 30 yrs. exp. Licensed, Bonded, Insured.

Car Audio/Video/Starters LOW PRICE GUARANTEE

Construction

âœąCarpet/ Upholstery âœąMaid/Janitorial Residential & Commercial Available Now 815-632-3822 www.advanced cleaners.biz

M&M Cleaning Service (Matt & Mandy) No job too small Home or Office Bonded & Insured Serving Lee & Ogle, Whiteside & LaSalle Counties 815-440-9121 or 815-677-6266 ★Professional ★ ★Cleaning ★ âœ˝$20/ hr. flat rates available âœ˝Weekly/ bi-weekly/ monthly 815-590-9426 or 815-564-7345

Dumpster Rental for Clean-ups & Construction Small & Large containers avail. Tidy Bug Inc. Dixon, IL tidybuginc.com 815-456-3001

Electricians C.P. ELECTRIC For Your Electrical Needs. New Homes, 100 amp. Service Updates, Rewires 25 Yrs. Experience ™Licensed ™Bonded ™Insured Musky & Bass Fishing Consultant Leave Message 815-626-6219

RR&D

Remodeling of All Sizes Kitchens, Bathrooms, Basements, Family Rooms all inishing   loor Finishing Commercial & Residential Call 815-535-8488

Handyman A Families Handyman Huge Winter Discounts for all your home improvement needs. Make us your Families Handyman. 815-994-0075 HANDYMAN/ GENERAL Contracting, siding, drywall, concrete work, decks, flooring (tile, linoleum, carpet, wood), bathroom and kitchen, complete remodels, additions all types of home repairs. Free Estimates and Insured-Bonded 815-564-7428 LawnCare Service    val     up &  val        . Fr Esta  815-590-6336

Home Improvement LONG CONSTRUCTION General Contractor

815-973-3023 815-732-4408

Lewis Plumbing 815-288-0028 Serving All of the Sauk Valley Area Lic.#058-173956

Landscaping

Power Washing

DREAMSCAPES BY DENNIS, INC Complete Landscape Services & Designs www.dreamscapes bydennis.com

(815) 857-3281

Lawn Care Blosser's Lawn Service Mowing & Trimming spring & fall Cleanup and More Call now for a FREE estimate! Brenton Blosser 815-716-3428 bdb@emypeople.net

Fall Clean Up & More Also, Snowplowing Free Estimates 815-625-8972

Painting BALAYTI PAINTING

Interior & Exterior Light Carpentry Pressure Washing 35 Years Experience Insured - References Cell #815-440-2202

www.mullerslane farm. com

Hauling

www.d she repair.or

Fireplace Safety Inspections Liners, damper replacement, screens, glass doors, chimney caps, log sets, inserts, wood, gas, electric, mantles, grates & more. Anselmo's, Inc. 1235 W. LeFevre Sterling 815-625-3519

A-1 HAULING Small or Large Truck Rentals Estate Clean-ups Garage & Building Demolition Construction Complete Septic Skid Loader & Back Hoe Work Materials Hauled Firewood 815-626-1956

Plumbing

Furniture Repair

Haul/Clean Service

KRATZNER'S PLUMBING

Days Furniture Repair Expert repairs on recliners, sofas, chairs, tables, beds, regluing. 815-626-5136

JOHN'S CLEANUP & REMOVAL Anything goes!! Estate Cleanups PHONE 815-622-0240

Fireplaces

Mobil Pressure Wash Service Commercial, esidential emis Yo me we  ant! Call Ben 815-590-2694

Property Maint.

JR's Janitorial

and Property Maintenance

. %mmercial .sidential .i'tes .Reduced'!al Rates .Reliable '!ndlyervice .Insured enior Discounts .Available7 rvinWhiteside %unty lloruote    Local Cell#

Don's Painting Holiday Special! Two 12x12 rooms for $150 Fully Insured. 779-348-5190

SPECIALIZING IN erior Pa od r Cle   sured d Boed, S k Falls area. Now Accepting Credit & Debit Card Payments Free Estimates

PAUL’S HANDYMAN SERVICE “Anything Your Husband Won’t Do!�  xperience On All Manner of Home Repairs & Maintenance since 1986 (815)625-2607

Plumbing

815-739-2089

24 HOUR SERVICE Now Offering Sewer Camera Service Visa, MC, Discover 815-285-7999 Lic# 058-172719

Roofing

“Area's #1 Roofing Contractor IL Lic# 104-015191 Licensed, Bonded & Insured CALL NOW FOR End of Summer Specials on Steel Roofing, Windows & Siding $oofing$Siding $# $ ecks $ tions $es & More Residential & Commercial Call now to schedule your FREE Estimate! Will beat any leading competitor price 815-590-2677

Illinois License #104.016127 Bonded/Insured &oofing&Siding &indo$!& oors & tion!& Garages& %$& cks and more Free Estimates 815-213-0556

Roofing/Siding

“Area's #1 Roofing Contractor IL Lic# 104-015191 Licensed, Bonded & Insured CALL NOW FOR End of Summer Specials on Steel Roofing, Windows & Siding $oofing$Siding $# $ ecks $ tions $es & More Residential & Commercial Call now to schedule your FREE Estimate! Will beat any leading competitor price 815-590-2677

Storage STERLING CENTERS, INC. 301 W. Third St. Sterling Warehousing & Storage Solutions 490,000 sq.ft. Avail Dedicated areas for Vehicles, Boats Rvs, Trailers & Motorcycles 1.815.441.3916 Email: info@ sterling-centers .com

re-roof, re-side, or build your garage or addition!

Randy L. Moore

815-626-1333

IL State Roofing Licensed 104-002247(1986) Bonded-Insured

Specializing in:

ss Gutters

ing Roofing s/Winws General Contracting & Construction 815-625-6142 Free Estimates

  

Snowplowing MIKE'S SNOW PLOWING ommercial   ways  xon Sterling R.F. Starting at $15 Free Estimates 815-590-6570

Storage

✰CORNER✰ STORAGE

Dixon near Walmart Sterling near Menards Various Sizes

GREAT RATES

815-973-3613 Franklin Storage Sizes 10x10 thru 10x40 2011 N. Brinton Ave. Dixon (815)285-0201 or (815)440-9563 Sterling Logistix is offering indoor or outdoor Boat & Camper storage. For info. Call Scott 815626-0217 or s.bailey@sterling logistix.com

A&M TREE SERVICE WE'LL BEAT ALL WRITTEN BIDS! Free estimates 25 yrs Experience Fully Licensed/ Insured Serving Sterling / Rock Falls/ Whiteside County Area 815-590-1677 ✤✤✤✤✤✤✤✤✤✤✤✤

BRAD'S TREE SERVICE Tree & Limb Removal Stump Removal Storm Clean-up Mulch & Firewood       Ins d 815-857-3674 Amboy, IL TIMBER TREE SERVICE www.allsafe center.com

âœśSince 1981âœś â—†Home Improvement â—†New Construction Fall is time to

Tree Service

High-Security Storage Solutions and Much More! Climate Controlled Storage Low-Cost Moving Truck Rental Confidential Document Shredding We Ship FedEx & UPS! Expert Packaging Services Value Boxes & Packaging Supplies EBAY and EMOTORS Internet Auction Sales Over 15,000 Sales Office Hours: Mon-Fri. ☛ 8:306, Sat. ☛ 8:30noon 690 Timber Creek Rd. Dixon, (815)285-2212

Tree & Limb Removal Stump Removal Storm Clean-up Free Estimates Fully Insured Tom May 815-238-7277 Dixon, Illinois

Water Softeners The Softener Man Repair on all makes & models Service Call Special $19.95 Over 30 years experience 815-323-1622

Welding WELDING & FABRICATION N-SITE   LUMINUM STAINLESS STEEL 815-973-9110

$$$$$$$$$$$$$$$$$$$$$$$

815-441-0246 ABSOLUTELY THE BEST CASH PAID FOR JUNK VEHICLES

$150-$2000 We Pay the BEST! Guaranteed! Fastest Pickup All calls answered 7 days a week. with any other number in the paper.)

815-441-0246

$$$$$$$$$$$$$$$$$$$$$$$

It’s easy to find what you want...

www.saukvalley.com

www.saukvalley.com www.saukvalley.com

www.saukvalley.com www.saukvalley.com

www.saukvalley.com www.saukvalley.com www.saukvalley.com www.saukvalley.com www.saukvalley.com

www.saukvalley.com www.saukvalley.com www.saukvalley.com www.saukvalley.com www.saukvalley.com


SAUK VALLEY MEDIA s Tuesday, November 12, 2013 s PAGE B11

Sudoku for 11/09/13

Free Ads Free Ads Subscriber Only Free Ads Special

This coupon good for one free merchandise ad in

CLASSIFIEDS SAUK VALLEY

TELEGRAPH

To place your free ad, send completed coupon or drop off to the address below*.

Please allow 3-5 business days from receipt of ad for processing.

Ads must include price. Ads not accepted by phone. Merchandise Items Priced At

Sud oku! Answer on B12

$100 or less

Ad runs free for 3 days in Sauk Valley Media & saukvalley.com Write Your Ad Here Classification: ________________________________________________________________________ Price:_________________________________________________________________________________

Call 815-625-3600 or 815-284-2222

Published Every Other Tuesday!

C E L E B R A T I O N S

dailyGAZETTE

Description: __________________________________________________________________________ _______________________________________________________________________________________ _______________________________________________________________________________________

Use Sauk Valley Media

CLASSIFIEDS Sell Your Unwanted Items!

Write Your Information Here Name: _______________________________________________________________________________ Address: _____________________________________________________________________________

Sudoku for 11/12/13

City & State: _______________________________________ Zip Code: _______________________ Phone Number: ______________________________________________________________________

*One item per ad, maximum 4 lines (12-15 characters per line). Limit 3 ads per month. Private parties only. For subscribers only. Excludes Rummage Sales, Employment, Rentals, Real Estate, Tickets & Travel, Wood/Fuel, and Pet Ads

Mail Or Drop Off Ad To:

Sauk Valley Media, Attn: Free Ads 3200 E. Lincolnway, P.O. Box 498 Sterling, IL 61081

Dixon Telegraph, Attn: Free Ads 113 South Peoria Avenue Dixon, IL 61021

FIND

C CLASSIFIEDS Your next automobile in the

SAUK VALLEY SAUK VALLEY

LASSIFIEDS dailyGAZETTE

dailyGAZETTE

TELEGRAPH

815-625-3600

815-284-2222

by Luis Campos Celebrity Cipher cryptograms are created from quotations by famous people, past and present. Each letter in the cipher stands for another.

TODAY’S CLUE: S equals K “ D B K LV M P S N W H G M F D T M N W F L R L D Y F G D P H L Z J R , D , M Y M Z F D P F, H D J J M Y P H W Z K LV: D M N G W Z W F L J D AW LV F J LV R . ” - - W N D J W U L J M Previous Solution: “I’m not scared of very much. I’ve been hit by lightning and been in the Marine Corps for four years.” -- Lee Trevino

(c) 2013 by NEA, Inc., dist. by Universal Uclick

11-12

Astrograph Success is within reach. Tuesday, November 12, 2013

SCORPIO (Oct. 24-Nov. 22) -- A secret connection will open your eyes to all sorts of interesting ideas and opportunities. Follow your heart and engage in activities that bring you pleasure. SAGITTARIUS (Nov. 23-Dec. 21) -- Spice up your living space, but don’t go overboard. Move things around or add a couple of affordable items that could add to your entertainment and comfort. CAPRICORN (Dec. 22-Jan. 19) -- Talk about your plans with others and let people see how passionate you are about whatever you pursue. A physical change must not be made on a whim. Impulse is your enemy today. AQUARIUS (Jan. 20-Feb. 19) -You’ll have a lot of information to deal with. Take a moment to digest it all before you make a decision. Don’t feel obligated to do what everyone else wants.

Answer to Previous Puzzle 42 Orchestra member 1 Groupie 45 Cream puff 4 Vacuum 49 Auto feature amenities 8 Night flier 53 Concerning 11 Fierce (2 wds.) whale 13 By word of 54 Service charge mouth 14 Give — — 55 Handel contempobreak rary 15 “Who’s 56 Little kid Who” 57 — Andreas entries Fault 16 Figured 58 “Phooey!” 18 Talked 59 Question 17 Flamenco back bright 20 Covers shouts 38 Transvaal DOWN 21 Vane dir. 19 Conclude settler 22 Part of a 22 Made tracks 39 Pen brand 1 Watch giggle 23 Sixth 41 Thumbs-up chains 24 Got wind of 2 Diva’s tune sense votes 27 Whispered 3 Mil. 24 Elev. 42 Clumsy loudly personnel 25 Joie de ones 30 Oversupply 4 Huge vivre 43 La — 31 Off-road 26 Emanation crowd Tar Pits vehicle 5 Mine find 27 Maintained 44 Portent 32 Oktoberfest 6 Cul-de- — 28 Scrapes by 46 Ms. Seton need 47 Vexes 7 Large deer 29 Bug 34 Asphalt repellent 8 All, in 48 Smell bad 35 Pleat 31 “Uptown 50 Bunny combos 36 Plant-to-be 9 Pull Girl” singer feature 37 Snagged dandelions 33 Mdse. 51 Mexican 39 Sculptures 10 Young 35 “Most Mrs. 40 Lubricate Wanted” 52 Explosive fellows 41 Yang org. inits. 12 State complement confidently 36 Naturally

ACROSS

CELEBRITY CIPHER

Home is where the heart is, and by making your place more comfortable you will enjoy your downtime this year. Inspiration could lead to philosophic changes that are conducive to self-expression. Focus on love, workmanship and getting what you want. Success is within reach.

Sud oku! Answer on B12

TELEGRAPH

PISCES (Feb. 20-March 20) -Speak your mind. Bring financial, legal, medical or personal issues out in the open to find a solution. Romance will ease your stress and help you get back on track emotionally.

LEO (July 23-Aug. 22) -- Get out and do things that you enjoy. Don’t let anyone dump added responsibilities in your lap. Be on the lookout for new ways to improve or shake up your routine.

ARIES (March 21-April 19) -Don’t be fooled by what you hear. Draw your own conclusions and don’t assume anything. You can avoid making a poor choice if you are realistic and cautious.

VIRGO (Aug. 23-Sept. 22) -Listen to what others have to say and you will be able to offer valuable solutions. Your insight will gain you many valuable allies.

TAURUS (April 20-May 20) -Take pride in the way you look, and do things that will boost your ego and make you feel good. Love is on the rise, and social activities should brighten your day.

LIBRA (Sept. 23-Oct. 23) -Problems at home could get out of control. Don’t overreact, or you will end up in a no-win situation. Make personal alterations, but don’t try to change others.

PUZZLE ENTHUSIASTS: Get more puzzles in “Random House Crossword MegaOmnious” Vols. 1 & 2

GEMINI (May 21-June 20) -Look at every situation you face carefully. You mustn’t let your emotions cause you to disregard information because you don’t like what you’re seeing. Honesty is the best policy. CANCER (June 21-July 22) -Have faith in what you do and how you express yourself. You will get the support you need if you are heartfelt. A romantic liaison will improve your personal life. ©2013 UFS

11-12

© 2013 UFS, Dist. by Universal Uclick for UFS


SAUK VALLEY MEDIA s Tuesday, November 12, 2013 s PAGE B12

TRUCKS

910

2003 F350 11' flat bed dually. 68K mi. Good cond. $7500/ obo. 815-499-7195

RELAX WE USE CARFAX

2007 CHEVROLETColorado Pickup New Low Price $7999 38K mi. 815-284-1135 For Sale: 1996 Ford Ranger 4x4, asking $3500/obo Call 815-626-1779 between 5 & 7 or leave message.

815-625-9600 5-9600 Call 815-62 1701 East 4th St., Sterling

Hours: Mon.-Thur. 9-7, Friday 9-6, Sat. 8:30-4

VANS

THEY ALL MUST GO!!!

2005 Dodge Grand Caravan SXT, 115K New motor w/90K, new brakes. Just serviced. $6500/ obo. 815-718-0840

SAVE THOUSANDS OFF N.A.D.A. RETAIL ON

2006 Sienna XLE DVD, moonroof, heated leather $11,900/OBO 815-406-2226 284-3711 Nights

SELECT MODELS WHILE THEY LAST! WHY BUY NEW? SAVE THOUSANDS!

2013 FORD TAURUS LIMITED

29+ MPG!

NAVIGATION, BACK-UP CAMERA, SUNROOF, DIAMOND WHITE, LIKE NEW!

349/MO

$

26,999* OR

$

**

2012 NISSAN SENTRA SR

ONLY 4,000 MILES!

6 SENTRAS IN STOCK

ONLY 4,000 MILES! 2012 FORD ESCAPE LIMITED

2013 NISSAN MAXIMA

2013 NISSAN ALTIMA 3.5 SL

28 MPG!

29 MPG!

SUNROOF, ONLY 14,000 MILES! LIKE NEW!

ALL THE TOYS! ONLY 15,000 MILES!!! LIKE NEW...

6 MAXIMAS IN STOCK

2 ALTIMAS TO CHOOSE

FROM $319/MO FROM $339/MO **

2011-2013 FORD EDGES!

**

2013CHRYSLER TOWN & COUNTRY

THE AREA’S BEST SELECTION! SAVE THOUSANDS OFF NEW! 10 TO CHOOSE FROM

COMPARE TO LEXUS RX350

% O.A.C.

2013 CHEVY TRAVERSE LT

FROM 9,000 MILES! TOURING, DVD, LEATHER HEATED SEATS! LOW MILES! SAVE THOUSANDS OFF NEW!

AWD, DVD, LEATHER, SUNROOF!

2012 CHEVY EQUINOX

2013 CHEVY IMPALA

925

960

$$$

815-441-0246 ABSOLUTELY

THE BEST CASH PAID FOR JUNK or

Unwanted (running or not)

VEHICLES $150-$2000

We Pay the BEST! Guaranteed! Fastest Pickup All calls answered 7 days a week. Licensed Dealer

815-441-0246

(Don't be lied to this number is not affliated with anyother number in paper}

$$$$$$$$$$$$$ 815-499-3543

CASH 4-CARS

We are licensed & insured to buy vehicles. Running or non running, scrap, Ect. 7 days a week. All Calls Answered!

LEER fiberglass topper, black, fits Dodge Dakota, $250/obo/trade, 815-772-2694 after 4 pm.

(815)499-3543 $$$$$$$$$$$$$

One 1990 Dodge Dakota Parts truck, $1.00, 815-7722694 after 4 pm.

We Buy Used cars & trucks. Call Dixon ATV 815-288-2146

Go BOLD

Get SOLD Bold type draws readers to your ad.

Get your ad noticed!

GO BOLD CALL

815-625-3600 815-284-2222

To place your AD TODAY!

CLASSIFIEDS SAUK VALLEY dailyGAZETTE

TELEGRAPH

BEWARE OF INTERNET PUPPY SCAMS!

ONLY 13,000 MILES!

JUST IN!

2 TO CHOOSE FROM

2012 CHEVY CAPTIVA LTZ

PARTS & ACC.

RATES FROM

1.9

911

AUTOS WANTED

OR 2 TO CHOOSE

1 LEFT!

19,999* OR

$

263/MO

$

**

2013 CHEVY CRUZE RS

AWD, LOADED UP & READY FOR SNOW!

LOW MILES!

22,999

$

*

ALL WITH MILES IN THE 20,000’S

SPECIAL!!! 3 TO CHOOSE FROM

18,999* OR

259/MO

$

**

18,999* OR

$

LOADED & LOW MILES! GREAT ECONOMY & A GREAT SIZE PACKAGE! 2 TO CHOOSE FROM

ONLY 289/MO

**

249/MO

$

**

ZERO DOWN! $ $ 15,999* OR 225/MO** 2013 FORD FLEX

2012 FORD FUSIONS

18,999* OR

**

$

2012 LINCOLN MKS

249/MO

$

**

24,999* OR

$

3 TO CHOOSE FROM

26,999

$

*

17,999* OR

$

**

2 TO CHOOSE FROM! SAVE THOUSANDS!

249/MO ONLY $289/MO

$

**

**

2010 FORD F-150 XLT

2011 FORD EXPLORER XLT

2011 GMC TERRAIN SLT

2012 CHEVY IMPALA LT

S-CAB, 4X4, 1-OWNER, LOW MILES! NON-SMOKER

4X4, NICELY EQUIPPED, LOCAL TRADE, NON-SMOKER, WITH ONLY 34,000 MILES!

LEATHER, SUNROOF, V-6, BACK-UP CAMERA, 1-OWNER, LOW MILES!

ONLY 11,000 1-OWNER MILES!

D L O S LIKE NEW!

25,999* OR

$

339/MO

$

**

27,999* OR

$

379/MO

$

**

2010 BUICK LACROSSE CXL 2008 DODGE GRAND CARAVAN SXT

263/MO

$

**

14,999* OR

$

$

17,999* OR

$

235/MO

$

**

2003 PONTIAC MONTANA

D L O S

LEATHER, DVD, ONLY 80,000 ACTUAL MILES! 3400 V-6, VERY CLEAN!

99MO

$

5,999* OR

**

7,999* OR

$

**

132/MO

$

**

2008 PONTIAC G-6 GT

2007 CHEVY IMPALA LT

1996 CHEVY S-10 BLAZER

LOADED, LOCAL TRADE!

LEATHER, SUNROOF, HEATED SEATS!

NEW TIRES!

VERY CLEAN! 4X4, 4.3 V-6, LOCAL TRADE! NEW TIRES! READY FOR SNOW!

14,999* OR

$

239/MO

$

**

REMOTE START!

10,999* OR

$

179/MO

$

**

2007 CHEVY AVEO

2000 CHEVY SILVERADO 1500

5 SPEED

AUTOMATIC, A/C, 4.8 V-8, LONG BOX, REG CAB

D L O S40+ MPG! 7,999* OR

132/MO

$

**

RUNS GREAT!

4,999* OR

$

89/MO

$

**

7,999* OR

$

147/MO

$

2001 FORD FOCUS

Sudoku Answer for 11/09/13

SUNROOF, SPOILER, BOSE

2006 CADILLAC DTS

LIKE NEW!

$

249/MO

$

**

2005 FORD FREESTAR SE

LOW MILES!

LOW MILES!

19,999* OR

303/MO

$

LEATHER, DUAL DVD’S

DIAMOND WHITE, 1-OWNER

$

22,999* OR

$

If you have been the victim of a scam, report it to your local authorities and your local BBB (www.bbb.org)

339/MO

$

NAVIGATION, LEATHER HEATED SEATS, LOW MILES!

LOW MILES!

“PEACE OF MIND”

Visit the American Kennel Club website (www.akc.org) for tips on how to avoid getting scammed and

2011 NISSAN ROGUES

2012 NISSAN ROGUE AWD

LOADED, NAVIGATION! SAVE $20,000 OFF NEW!!!

SALE FROM

299/mo

$

SEL’S & SPORTS, REVERSE CAMERA, SUNROOFS 7 PASSENGER, DUAL SUNROOFS, REVERSE CAMERA, LANE ASSISTANCE SYSTEM, WHAT A CAR! ONLY 18,000 MILES!

3 TO CHOOSE FROM

 /,1&2/1 0.=·6

$

OR

 &+(9< ,03$/$ /7=·6

LOW MILES! LEATHER, SUNROOF SHARP!

$

YOU CHOOSE!!

NICELY EQUIPPED

ONLY 18,000 MILES!

4,999*

$

**

2003 DODGE NEON

2,999*

$

3,999*

$

Plus tax, title, license, & doc fee. **$2,000 Down, 72 months @ 1.9% With approved credit, plus tax, title, license + doc fee. Photos for illustration use only.

*

SHOP 24/7 ONLINE www.majeskimotors.com

Sudoku Answer for 11/12/13

TEL-11-12-2013  

TEL-11-12-2013

Read more
Read more
Similar to
Popular now
Just for you