Issuu on Google+


Hotline Service


Phone: 081257225755 082150002031 SMS: 085347259955

t os

anak P nti

Berlangganan & Pengaduan




Pontianak Post pertama dan terutama di kalimantan barat

Sabtu 20 April 2013 M / 10 Jumadil Akhir 1434 H

Eceran Pontianak Rp. 3.000

Nanan Lepas Touring Lamborghini

Adityo Dwi/Radar Semarang

LAMBORGHINI : Dua puluh tiga mobil supercar merek Lamborghini melakukan Rally Wisata dari Bandara Ahmad Yani Semarang menuju Solo dan Jogjakarta, Jumat (19/4). Kegiataan tersebut untuk memperkenalkan Indonesia khususnya Provinsi Jawa Tengah dan DIY ke negara-negara di dunia.

SEMARANG—26 mobil sport Lamborghini asal Jakarta melaju di daerah Jawa Tengah. Mereka memperkenalkan wisata disana. Keraton Surakarta dan Yogyakarta juga didatangi. Peserta berasal dari Lamborghini Jakarta The Royal Heritage Experience 2013 yang akan melakukan muhibah ke sejumlah obyek cagar budaya di Jawa Tengah dan DI Yogyakarta. Mobil sport mewah berbanderol Rp 2 hingga 5 miliar per unit ini, terdiri atas 23 mobil peserta touring The Royal Heritage Ex-

perience 2013 serta tiga buah mobil safety car. Mereka mengawali perjalanan muhibah ini dari Bandara Internasional Ahmad Yani (BIAY) Semarang dan dilepas oleh Wakapolri, Komjen Polisi Nanan Sukarna, Jumat (18/4).    Menurut salah seorang panitia Choppy, ke-23 mobil ini merupakan komunitas Lamborghini Jakarta. Ada beberapa tipe mobil berlogo ‘banteng taurus’ ini antara lain Gallardo, Murcielago uKe Halaman 7 kolom 5

Akil: Patuhi Aturan KPU

Mundur karena Beretika Politik

Mochtar mengomentari peraturan KPU Pusat yang mengharuskan seorang anggota DPRD mundur akibat parpolnya tidak lolos verifikasi kemudian mencalonkan diri dalam Pemilu 2014 dari par-

PONTIANAK--Ketua Mahkamah Konstitusi (MK) Akil

tai berbeda. ”Wajib dipatuhi kalau bunyinya sudah seperti itu. Siapapun dia, tanpa terkecuali,” katanya saat bersilaturahmi ke Pontianak Post, Jumat (19/4) siang. Kenapa harus dipatuhi?

Menurut Akil, yang namanya aturan adalah produk legal hukum. Kalau nantinya tetap dipaksakan sampai akhir masa jabatan, maka produkproduk yang dihasilkan oknum dewan bersangkutan

Dolar SGD

Shando safela/Pontianak post

Barang bukti: Motor korban Edi Susanto yang tewas dan mobil yang menabrak

Ringgit MYR



hasilkan juga ikut melanggar. Begitu pula dengan peraturan KPU nomor 13 tahun 2013 tersebut,” ujarnya. Menurut dia yang namanya berpolitik perlu beretika. Sebab, itu nantinya menentu-

kan karakter politikus bersangkutan. Dengan etika, maka berpolitikan di tanah air akan menjadi kehormatan masyarakat Indonesia. uKe Halaman 7 kolom 1

MABM Ramah Tamah Bersama Ketua MK

Saya terbang dengan citilink, naik krl dan kereta ekonomi itu bukan untuk sok sederhana, melainkan bagian dari menyelami kultur di semua unit.

Dollar US

bakalan cacat. Jelas dari segi hukum itu melanggar. ”Seperti di MK misalnya, kita batalkan keputusan satu kepala daerah. Namun tahu-tahunya tetap dipaksakan dilantik. Jelas saja, produk-produk di-


Korban Tewas, Penabrak Ditahan

Kurs Rupiah 19 April 2013


PONTIANAK—Edi Susanto, korban tabrak lari di Bundaran Rahadi Usman Pontianak yang menghebohkan warga Pontianak akhirnya tewas, Jumat (19/4). Sebelumnya korban sempat kritis (baca berita

Tiap Hari Bawa 10 Gadget

halaman 16) di Rumah Sakit St. Antonius. Gerak cepat aparat kepolisian pun berhasil menangkap pengemudi mobil nopol KB 1056 HM yang melarikan diri. Informasi yang dihimpun

PONTIANAK—Hakim Konstitusi Akil Mochtar yang terpilih menjadi Ketua Mahkamah Konstitusi Republik Indonesia memenuhi undangan yang diselenggarakan oleh Majelis Adat Budaya Melayu Kalimantan Barat. Kedatang Akil tersebut disambut para kolega dan temanteman sejawat di Rumah Adat Budaya Melayu. Tamu udangan yang hadir hampir 400 perwakilan dari masyarakat Kalbar. Sejumlah pejabat pemerintah Kalbar, tokoh adat, tokoh politik, budayawan, dan pengusaha. Acara berlangsung hikmat. Terdengar lantunan dan gerak terian lagu melayu mengiringi acara silaturrahmi uKe Halaman 7 kolom 1

Pontianak Post, luka parah di sekujur tubuh korban , membuat pria anak satu ini tak bisa melewati masa kritisnya. Dia meninggal setelah beberapa uKe Halaman 7 kolom 5

Harga BBM Naik 5 Mei

ZAMAN sekarang serba digital. Masyarakat pun latah hingga ketergantungan terhadap berbagai jenis gadget. Ini termasuk Sandra Dewi. Setiap hari, artis yang meroket namanya sejak membintangi film

KEN Optimistis Inflasi Terkendali SURABAYA-Setelah tarik ulur, kenaikan BBM (bahan bakar minyak) tidak lama lagi.

uKe Halaman 7 kolom 5

Komite Ekonomi Nasional (KEN) menyebut pemerintah akan memberlakukan tarif baru pada 5 Mei mendatang. Ketua KEN Chairul Tanjung menyebut harga baru ini khusus untuk mobil pribadi. Nilainya tidak berbeda yang disebutkan

dengan yang beredar selama ini. “Rp 6.500 untuk mobil pribadi,” katanya saat berkunjung ke redaksi Jawa Pos di Graha Pena, Surabaya, kemarin. Pria yang akrab di sapa CT uKe Halaman 7 kolom 5


SILAHTURAHMI: Ketua Mahkamah Konstitusi(MK) Akil Mochtar bersilahturahmi bersama Majelis Adat Budaya Melayu di rumah Melayu kemarin(19/4).

Tasripin, Bocah 13 Tahun Berjuang Hidupi Tiga Adiknya yang Masih Kecil 11: 44




Sekolah Tak Ada Biaya, Makan Pun Seadanya




Kulit Manggis Sangat Bermanfaat untuk Kecantikan MAJALAH Trubus edisi Oktober 2011 yang lalu menulis bahwa buah manggis ternyata memiliki banyak sekali manfaat. Selain daging buahnya yang enak dan segar untuk dimakan, kulit buahnya memiliki manfaat untuk pemeliharaan kesehatan dan kecantikan. Mengapa? Karena, kandungan antioksidan dalam buah manggis termasuk yang tertinggi di antara semua buah. Akibatnya, buah manggis sangat baik untuk uKe Halaman 7 kolom 5

Online: cmyk

BERTANGGUNG JAWAB : Taspirin (kiri) bersantai bersama tiga adiknya di Hotel Wisata Niaga, Purwokerto. (kanan ) Anggota TNI membedah rumah Taspirin di Desa Gununglurah, Jawa Tengah.

Berat nian beban hidup Tasripin. Bocah 13 tahun ini harus menjadi kepala keluarga menghidupi tiga adiknya yang masih kecilkecil. Ayah dan kakak tertuanya pergi merantau ke Kalimantan, sedangkan ibunya

sudah meninggal setahun silam. Namun kini uluran tangan mulai banyak berdatangan. AGUS MUNDANDAR, Banyumas uKe Halaman 7 kolom 1

*Mempawah, Sambas, Singkawang, Bengkayang Rp 3.000 *Landak, Sanggau, Sintang Rp 4.000 *Ketapang Rp 4.000 *Kapuas Hulu Rp 4.000

Jawa Pos Group Media


Pontianak Post

Dukungan Bulatkan Tekad David Pemilukada Kubu Raya PONTIANAK – David Maryansyah menegaskan dirinya akan maju sebagai calon Bupati Kubu Raya, bukan wakil. Keinginannya itu berangkat dari arus dukungan dari warga kabupaten itu. “Saya tidak ingin maju kalau tidak ada dukungan masyarakat. Karena ada dukungan makanya saya berani. Maju sebagai calon bupati bukan wakil,” tegasnya, Jumat (19/4). Arus dukungan yang dimaksud David datang dari berbagai kalangan, tokoh masyarakat, tokoh agama, pemuda, dan mahasiswa. Dukungan mereka itu lah yang membuatnya mematangkan diri mengikuti perhelatan lima tahunan itu. “Banyak yang datang dari meminta saya mencalonkan diri, dari banyak kalangan,” ungkapnya. Saat ini David mengaku sudah turun ke seluruh kecamatan di Kubu Raya. Hal itu dilakukannya untuk melihat respon masyarakat terhadap keinginannya mencalonkan diri. Semakin kuat tekadnya setelah menyerap aspirasi tersebut. “Di luar dugaan ternyata sambutan masyarakat begitu hangat. Aspirasi yang disampaikan bukan main-main, mereka butuh pemimpin baru,” ucapnya. Pemuda dan mahasiswa dianggap David sebagai garda terdepannya. Mereka yang banyak memberi masukan kepada David. “Mereka luar biasa, pekerja keras. Wajar saja,

Sabtu 20 April 2013

Sebastian Kenal Dekat Paryadi

PONTIANAK – Bakal calon Wakil Wali Kota Pontianak yang disebut-sebut mendampingi Paryadi, Sebastian angkat suara. Sebagai warga negara dia menyatakan siap mengikuti Pemilukada Kota Pontianak. Namun dia tidak menyebutnya secara tegas. “Kita lihat saja nanti,” ungkapnya. Menurutnya menjelang pemilukada wajar saja banyak wacanawacana yang mencuat. Termasuk

siapa yang mencalonkan diri, partai apa yang digunakan, siapa calon wali kota atau wakilnya. “Wajar menjelang pemilukada. Setiap warga negara punya hak dipilih dan memilik,” katanya. Dia mengaku kenal baik dengan Paryadi. Dia pernah bersama Paryadi duduk sebagai Anggota DPRD Kota Pontianak. Sebastian tahu betul siapa Wakil Wali Kota Pontianak itu karena pernah menjalin kerja

sama dan pertemanan. “Memang Paryadi sih teman kita juga. Kami sama-sama di dewan selama empat tahun,” ujarnya. Walau sudah bertahun-tahun tidak lagi sama-sama di dewan, Sebastian mengatakan, sampai sekarang komunikasi dengan Paryadi tetap ia lakukan. Tidak saja tentang politik atau Pemilukada Kota Pontianak. Banyak hal yang dikomunikasikannya dengan

Paryadi. “Jalinan komunikasi itu masih ada. Menyangkut segala hal,” ucapnya. Didesak lagi tentang kesiapannya maju pada Pemilukada Kota Pontianak, Sebastian akhirnya melunak. Dia menyatakan sebagai warga Pontianak dirinya siap maju. “Kalau semua warga negara punya hak berarti saya juga punya. Apalagi saya warga Pontianak,” tuturnya. (hen)

Figur Pemuda Paling Pas Dampingi Bupati Muda David Maryansyah

pemuda dan mahasiswa itu butuh perhatian pemimpin,” katanya. David adalah Anggota DPRD Kota Pontianak, dia kader PDIP. Sebagaimana diketahui PDIP memiliki kursi dominan di DPRD Kubu Raya, bisa mengusung satu pasangan tanpa koalisi. Namun hingga saat ini belum juga ada keputusan PDIP siapa yang bakal diusung. “Sebagai kader tentu kami berharap dapat diusung PDIP. Namun itu kami serahkan ke partai sesuai mekanismenya,” katanya. David mengatakan, dia tidak ingin hanya menunggu keputusan partai tanpa bekerja. Terpenting menurutnya dia terus bekerja untuk mematangkan diri maju sebagai calon bupati. “Saya terus bekerja walau belum ada keputusan partai. Karena memang tekad saya mencalonkan diri sebagai bupati,” ucapnya.(hen)

DUKUNGAN terhadap Andi Wardayanto sebagai pendamping Muda Mahendrawan, dalam pemilihan Bupati Kubu Raya 2014-2019 makin menguat. Haji Usman Adam, sesepuh di Kabupaten Kubu Raya sekaligus tokoh agama Sei Ambawang menyatakan, dukungannya terhadap Andi Wardayanto atau yang akrab disapa Way untuk mendampingi Muda Mahendrawan. “Saya merasa figur Way sangat cocok untuk bersama-sama incumbent membangun Kubu Raya ke depannya,” katanya, Jumat (19/4). Ia mengatakan, figur orang muda adalah yang paling pas dalam mendorong percepatan pertumbuhankembangan kabupaten pemekaran tersebut. Terlebih, lanjutnya, Way juga mendukung penuh langkah Muda diawal-awal pembentukan Kabupaten Kubu Raya. “Way yang juga berprofesi sebagai jurnalis, sudah pasti



Andi Wardayanto

mempunyai intelektualitas, jaringan yang kuat serta kemampuan bersosial masyarakat yang baik,” tambahnya. Hal ini terbukti, dimana Way, mampu menjadi perekat antara birokrat, pejabat publik, tokoh intelektual di Kubu Raya, dengan masyarakat di akar rumput. “Bahkan, mampu menyatukan semua golongan sehingga satu suara mendukung kebijakan Muda Mahendrawan selaku kepala daerah,”



tambahnya. Untuk itu, katanya, warga Kubu Raya, khususnya Sei Ambawang akan bermunajat, dengan berdzikir kepada Allah SWT, agar Way dapat bersanding dengan Muda Mahendrawan. Kepada khalayak Kubu Raya, Usman menyatakan, dengan majunya Way, sebagai figur calon wakil Bupati Kubu Raya, diharapkan dapat mempercepat proses perbaikan dan pembangunan sektor infrastruktur, pertanian, perkebunan guna meningkatkan kesejahteraan masyarakat Kubu Raya. Hal senada diungkapkan Usman, tokoh pemuda Sungai Malaya Ambawang. “Saya dukung penuh Way mendampingi Pak Muda. Pemikirannya bagus, orangnya juga sudah kenal dekat dengan pak bupati,” katanya. Ia yakin, dalam perjalanan membangun Kubu Raya nanti, Muda dan Way mampu menghadapi semua masalah,

tanpa terjadi perpecahan diantara mereka. “Semua problem dapat diselesaikan dengan baik,” ujarnya. Sarjono, kepala Desa Kampung Jawa menegaskan hal serupa. Sebagai orang muda, Bupati Muda Mahendrawan sangat cocok didampingi pemuda juga, seperti Andy Wardayanto. “Kami ingin proses pembangunan di Kubu Raya berjalan cepat dan tepat. Jangan timpang lagi, karena perpecahan antara bupati dan wakil bupati. Dampak perpecahan itu sangat besar. Ada ketimpangan dalam pembangunan,” katanya. Ia yakin, pasangan Muda Mahendrawan dan Andy Wardayanto bisa memberikan akselerasi pembangunan di Kubu Raya. “Potensi di Kubu Raya ini masih sangat banyak, butuh tangan pemuda untuk mengelolanya secara maksimal. Tapi tentunya yang bisa bersinergi dengan bupati,” pungkasnya. (d1)


pontianak bisnis

Pontianak Post Sabtu 20 April 2013

Lokomotif kemajuan ekonomi kalbar


ASUS FONEPAD: Model menampilkan Fonepad, tablet terbaru dari perusahaan raksasa komputer asal Taiwan, ASUS. Tablet ini memiliki prosesor Intel Atom dan OS Android 4.1 dan layar LCD 7-inci. Tablet PC baru dengan fungsi telepon 3G ini mulai dijual pada tanggal 25 April.


Jerat Ratusan Aparat Pajak Nakal Berkat Sistem Whistle Blowing JAKARTA - Direktorat Jenderal Pajak menebar peringatan bagi aparat pajak dan wajib pajak, terutama pelaku usaha. Ini terkait mulai efektifnya whistle blowing system yang berhasil menjerat pelaku pelanggaran pajak. Kepala Subdit Kepatuhan Internal dan Sumber Daya Aparatur (Kitsda) Direktorat Jenderal Pajak Kementerian Keuangan Nany Nur Aini menyatakan, sepanjang 2011 - 2012, pihaknya sudah menerima ratusan aduan dugaan pelanggaran pajak. ’’Ini imbas penerapan whistle blowing system,’’ ujarnya, kemarin






(19/4). Menurut Nany, penerapan whistle blowing system membuat seluruh aparat pajak maupun masyarakat bisa berpartisipasi untuk melaporkan indikasi penyelewengan pajak. Sejak itu, angka aduan pun meningkat. ’’Periode 2011 - 2012, ada 205 kasus laporan pelanggaran pajak,’’ katanya. Dari kasus-kasus tersebut, lanjut dia, 151 di antaranya sudah diproses dan diselesaikan. Hasilnya, banyak aparat pajak yang terbukti melakukan pelanggaran ringan hingga berat dan dijatuhi sanksi. ’’Sanksinya mulai dari teguran hingga pemecatan,’’ ucapnya. Bagaimana 94 kasus lainnya? Nany menyebut, kasuskasus hasil laporan aparat pajak dan masyarakat itu

masih sedang dalam proses investigasi. Menurut dia, investigasi dugaan pelanggaran pajak memang tidak mudah. Sebab, harus mendapatkan bukti-bukti kuat untuk menjerat pelaku. ’’Jadi, kadang butuh waktu lama,’’ ujarnya. Tahun ini pun aduan dugaan pelanggaran pajak juga terus mengalir. Nany mengatakan, periode Januari - Februari 2013 saja, Ditjen Pajak sudah menerima 55 aduan terkait dugaan pelanggaran di kantor pajak pusat maupun daerah. ’’Karena itu, kami akan berupaya mempercepat penyelesaian kasus agar tidak menumpuk,’’ katanya. Sementara itu, untuk memberi efek jera, Ditjen Pajak juga mengambil tindakan tegas terhadap aparat pajak

yang terindikasi kuat melakukan pelanggaran. Kasus terbaru adalah pemerasan yang dilakukan oleh pegawai pajak Pargono Riyadi (PR). Kasus ini pun sudah diproses di Komisi Pemberantasan Korupsi (KPK). “PR sedang dalam proses pemecatan,” ucapnya. Sebelumnya, Dirjen Pajak Fuad Rahmany mengatakan, reformasi perpajakan di Indonesia harus didukung oleh dua pihak, yakni aparat pajak dan wajib pajak, baik perorangan maupun pelaku usaha. “Kasusnya bisa saja pemerasan, tapi bisa juga penyuapan. Jadi, wajib pajak juga harus taat, jangan ingin bayar pajak murah lalu menyuap petugas pajak. Mari kita sama-sama berbenah,” tegasnya. (owi/dos)



Pontianak Post


Sabtu 20 April 2013

Gagal Bentrok Lawan Bandung PONTIANAK—Pertandingan divisi utama 2013 antara Tim Persipon Elang Khatulistiwa versus Persikab Bandung tidak dapat bertanding sesuai yang dijadwalkan. Hal tersebut dikarenakan ketidaksiapan dari pihak manajemen tim Persikab Bandung. “Jadwal pertandingan tang-

gal 24 Mei 2013 dinyatakan gagal. Yakni, Tim Persipon Vs Persikab Bandung diundur pertandingannya. Informasi yang di dapat Tim Persikab Bandung tidak bisa datang alasannya tidak ada sponsor untuk pendanaan pertandingan,” kata Heri Halidi, Eksekutif PT Persipon Elang Khatulistiwa,

Kamis (18/4), usai menyaksikan pertandingan uji coba Tim Persipon melawan Tim Pontura. Untuk itu dia menyampaikan pertandingan tetap dilanjutkan pada tanggal 28 Mei 2013. Yakni pertandingan antara Tim Persipon melawan Tim PSIS Semarang. Kemudian untuk

lokasi pertandingan dia mengatakan tetap di Stadion Sultan Syarif Abdurahman Pontianak. Heri mengungkapkan, tim PSIS Semarang diperkirakan tampil bersama tiga orang pemain asing. Yakni, salah satunya jebolan akademi Manchester United (MU) Amancio Fortes, pemain berpaspor Angola ber-

darah Portugal. Untuk itu dia berharap banyak penonton dapat menyaksikan pertandingan tersebut di Stadion Sultan Syarif Abdurahman Pontianak. Amirudin, Sekretaris Suporter Elang Khatulistiwa berharap supoter tidak perlu kecewa terkait kegagalan tersebut. Mengingatpertandingantanggal

28 Mei 2013 siap dilaksanakan. “Kita berharap pertandingan nanti benar-benar terjadi. Untuk suporter sudah kita siapkan untuk menyaksikan pertandingan nantinya. Selain itu juga fasilitas atribut suporter juga sudah ada. Tinggal menunggu pertandingan dimulai,” ungkap Amirudin. (irn)


MK Bayu Siap Pertahankan Gelar PONTIANAK— Juara di tunggal dewasa dan ganda dewasa putra, Muhammad Khutami Bayu siap mempertahankan gelar juara yang direbutnya pada Turnamen Bulutangkis Pemkot Open akhir Maret lalu. Bayu akan kembali turun di ajang Polnep Badminton Open To u r n a m e n t yang merupakan seri kedua dari agenda PBSI Kota Pontianak. Pemain kidal tersebut akan Muhammad Khutami Bayu kembali tampil di nomor tunggal dewasa dan ganda dewasa. Di ganda dewasa dia akan kembali berpasangan dengan Ismail. “Di ajang ini persaingan mungkin akan lebih berat. Jika pada Pemkot Open kemarin digulirkan hanya se-Kota Pontianak, tapi di Polnep nanti digelar se-Kalimantan Barat. Mudahmudahan saya bisa tembus final dan mampu mempertahankan gelar juara,” kata pegawai Bank Kalbar tersebut. Diketahui, saat ini MK Bayu berada di peringkat pertama rangking point pebulutangkis Kota Pontianak. Dia meraih poin 300 disusul Roy Firmansyah dengan nilai 255 yang dikalahkannya di final Pemkot Open lalu. Di posisi ketiga ditempati Dony Permana (210) dan posisi keempat Ismail (210). Kemudian ditempat kelima ditempati masing-masing Suhandry, Kharisma Rizky, Edward, Rony Al-Kusairi dengan nilai yang sama 165. Sementara di kategori ganda dewasa, Bayu yang berpasangan dengan Ismail juga berada di rangking point teratas dengan nilai 300. Di posisi kedua ditempati Dicky Alamsyah/Febry (255). Posisi ketiga, Donny/Andre (210). Posisi keempat, Kharisma/Suhandri (210). Posisi kelima, Faisal/Dede Subekti, Muhafi/Hendra, Cakra/Wahyudi, Marwanto/Rony dengan poin sama 165. Kategori Tunggal Taruna, tempat pertama ditempati Fayi Akram (200), kedua Kurniaji (170), ketiga Riko (140), keempat Robi (140). Posisi kelima Sy Ibnu, Sy Lutfi, Gusti Doni dan Raka dengan perolehan poin masing-masing 110. Kategori Tunggal Remaja, Raka Subekti (100), Fayi Akram (85), Falahudin, Max D (70). Dimas, Aditya, Dwiki, Khairani di posisi kelima dengan masing-masing poin 55. Kategori Pemula Putra rangking poin pertama direbut Rahmad dengan nilai 60. Kedua, Rian Septian (51). Ketiga Sy Mahdi (42). Keempat Aditya (42). Kelima Dwiki, Mirza, Syahri, Faturozi dengan nilai yang sama masing-masing 33 poin. Kemudian di kategori Pemula Putri, rangking poin pertama direbut Alivia (60), kedua Sofia (51), ketiga Nadia (42), keempat Rika Putri (42) dan kelima Mutiara, Gania, Tri Septi, Mutiara dengan perolehan poin yang sama 33. Sementara itu, Ketua Umum PBSI Kota Pontianak Ismail mengatakan, digulirkannya rangking point atlet tersebut guna mencari pemain muda berbakat dengan konsep sirkuit daerah. Setelah digelar Kejuaraan Bulutangkis Pemkot Open akhir Maret lalu, selanjutnya ada tujuh even lanjutan yang siap bergulir. Pada 22-26 April Polnep Badminton Open Tournament. Di bulan Mei digelar PDAM Open Tournament. Pada 4 Juni 2013 digulirkan Walikota Cup. Oktober 2013, PATIRO Open Tournament. Pemkot Open II berlangsung Nopember 2013 dan terakhir Desember 2013 CKP Badminton Open III. “Dari delapan even ini kita akan menentukan rangking point pe-bulutangkis tersebut. Di akhir tahun yang terbaik akan kita berikan apresiasi. Rencannya kita akan menyekolahkan mereka untuk berlatih di klub bulutangkis terbaik di Jawa,” ungkap Ismail. (bdi)

JAPFA CHESS FESTIVAL Pecatur Internasional sedang bertanding dalam Japfa Chess Festival di Gedung Serbaguna, Jakarta, Jumat (19/4). Japfa Chess Festifal diikuti 488 peserta dari 23 provinsi di Indonesia untuk kelas nasional. Sedangkan untuk kelas internasional diikuti enam peserta dari empat negara yaitu dua dari Indonesia, dua Prancis, satu Slovakia, dan satu Romania. KHAIRIZAL ANWAR / RAKYAT MERDEKA

Polnep Badminton Digelar se-Kalbar 22-26 April GOR PBSI Kota Pontianak PONTIANAK—Memeriahkan Dies Natalis Politeknik Negeri Pontianak ke-26, UKM Badminton Polnep bekerjasama dengan Pengcab PBSI Kota Pontianak menggelar Polnep Badminton Open Tournament. Jika tidak ada aral melintang even ini akan digelar pada 22-26 April, di GOR PBSI Kota Pontianak, Jalan Tabrani Ahmad. “Ini merupakan seri kedua dari kalender Pengcab PBSI Kota Pontianak. Sebelumnya juga digelar Kejuaraan Bulutangkis Pemkot Kota Pontianak,” ungkap Yasir Arafat, Sekum PBSI Kota Pontianak. Menurutnya, ada enam nomor pertandingan yang akan digelar pada perhelatan kali

ini. Yaitu, tunggal untuk usia dini putra putri (11 tahun ke bawah). Tunggal pemula putra putri (umur 11 s/d 13 tahun). Kemudian tunggal remaja putra (umur 13 s/d 15 tahun). Tunggal taruna putra (umur 15 s/d 19 tahun). Ganda dewasa putra dan ganda veteran putra (umur 40 tahun keatas). Khusus kategori ganda dewasa dan veteran maksimal 32 pasang peserta. Untuk pendaftaran, jelas dia, akan ditutup pada 20 April di Kampus Politkenik Negeri Pontianak, tepatnya di Gedung ETU lantai 2 Jalan Jenderal Ahmad Yani Pontianak. Atau bisa langsung mendaftar di GOR PBSI Kota Pontianak, Jalan Tabrani Ahmad. “Technical meeting akan kita laksanakan pada 21 April di Gedung Auditorium Polnep,” terang dia. Dijelaskan Yasir Arafat, syarat untuk mengikuti turnamen ini adalah pemain yang berdomisili

di Provinsi Kalimantan Barat. Pada saat pendaftaran seluruh peserta dewasa wajib menunjukkan KTP, SIM atau tanda pengenal lain yang masih berlaku. Khusus untuk kategori kelompok umur diwajibkan menunjukkan raport terakhir dan akta kelahiran asli serta menyerahkan foto copi satu rangkap. “Pendaff taran tidak diperkenankan melalui telepon,” ujar dia seraya mengatakan untuk informasi pendaftaran bisa menghubungi Edi (089693650607) dan Indra Yusri (081352010166). Sementara itu, dita- EVEN BERGENGSI: Kejuaraan Bulutangkis Pemkot Open yang digelar mbahkan ketua pani- akhir Maret lalu, Pengcab PBSI Kota Pontianak bekerjasama dengan Polnep tia pelaksana yang juga kembali menggulirkan even serupa di GOR PBSI, 22-26 April. selaku Pembina UKM diperkenankan untuk ikut kota di luar Kota Pontianak Badminton Polnep Indra Yusri, atas permintaan ban- serta.“Melalui media ini kami untuk ikut serta, bertanding yak pihak diputuskan atlet- mengundang dan memperke- dalam memeriahkan turnaatlet Kalimantan Barat juga nankan atlet dari kabupaten men ini,” ungkap dia. (bdi) FINAL LIGA PRIMER PONTIANAK




Laga yang Tak Dapat Diprediksi PONTIANAK—Kejuaraan Sepakbola Liga Primer Pontianak Walikota Cup II antar pelajar se-Kota Pontianak telah memasuki babak final. Laga puncak tersebut akan dihelat hari ini (Sabtu), antara SMA Negeri 4 Pontianak versus SMA Mujahidin. “Untuk formasi pertandingan di babak final tim sepakbola kita masih tetap memakai 4-23-1,” kata Wuriyanto, Pelatih

SMA Negeri 4 Pontianak, di Lapangan Keboen Sajoek Pontianak. Dia berharap di babak final nanti tim SMAN 4 bermain lebih tenang. Selain itu juga dia meminta anak-anak asuhnya dapat menjalin komunikasi baik saat bertanding. ”Saya menginstrukk sikan permainan lawan juga harus dicermati dengan baik. Agar kita menguasai jalannya pertandingan,” ungkap dia.





Dia menilai permainan lawan dibabak final SMA Mujahidin kemungkinan akan memainkan bola-bola atas. Namun, dirinya yakin, anak-anak asuhnya tersebut mampu meredam kekuatan tim lawan, asalkan koodinasi para pemain baik. Mustamsil Idris, Pengawas Pertandingan Liga Primer Pontianak (LPP) menyampaikan laga antara SMA Mujahidin dan SMA 4 Pontianak adalah final

ideal. Sebab, dia memprediksi pola permainan mereka nanti akan berimbang. Namun, untuk siapa yang menjadi kampium dia tidak bisa memprediksi. “Kita lihat saja, tim mana yang menguasai permainan di area lapangan nanti. Yang pastinya permainan akan berlangsung seru. Untuk itu kita berharap dibabak final nanti penonton yang menyaksikannya membludak,” harap Mustamsil.

Dia juga mengungkapkan top skor sementara di Liga Primer Pontianak diperoleh, Noval Fatih Hanif. Siswa SMAN 4 tersebut berhasil mencetak 12 gol selama pertandingan berlangsung. “Peserta maupun penonton tetap menjaga sportifitas jalannya pertandingan. Harapan saya di babak final nanti bisa berlangsung seru dan menarik,” imbuhnya. (irn)

Pontianak Post


Sabtu 20 April 2013




ANTV 07.30 12.00 18.00 19.00 19.30 21.00 23.00

Ulasan berita menarik yang disajikan oleh tim redaksi PON TV serta koran-koran yang tergabung dalam Pontianak Post Group dikupas tuntas pada acara ini. Dikemas santai dan diiringi musik akustik band. (*)

09.30 13.00 17.35 21.00 23.00

Hati Ke Hati Bersama Mamah Dedeh Kaki 5 Mantap Pesbukers Like This Sinema Spesial: Silver Hawk Mata Lensa

Tinkerbell Tinkerbell berpikir bahwa bakat peri yang dimilikinya bukan suatu hal yang spesial atau penting seperti peri lainnya. Tetapi, ketika berusaha berubah, Tinkerbell malah menarik bahaya. (*)


PON TV Pukul 07.30 WIB

Pontianak Pagi


Pontianak Pagi Berite Kite Siang Video Clip Religi Berite Kite Malam Jungle N’ Run King of Dynasty Han Musik Manca

08.30 Tinju Legendaris: Amir Khan v Marcos Maidana 10.30 Prediksi 13.00 Damai Indonesiaku

16.30 Khazanah Islam 20.00 Live News: Apa Kabar Indonesia Malam 23.00 Kabar Arena Akhir Pekan



Suka Casual dan Simple JAKARTA—Bagi model, pemain sinetron dan presenter ayu ini, fashion adalah untuk menunjukkan kepribadian. Mode boleh datang dan pergi, tetapi untuk dirinya dia selalu memilih gaya busana yang sesuai dan nyaman, yakni casual dan simple. Perempuan bernama lengkap Ersa Mayori Aurora Yatim ini menilai, sehelai gaun dapat tampil istimewa meski hanya dengan tambahan hiasan aksesori dari bebatuan warna-warni nan cantik. Seperti ketika dia memandu acara Fashion Week, belum lama ini. Untuk acara itu, Ersa mengenakan gaun panjang tanpa lengan warna ungu. “Mungkin yang lain menganggap gaun malam mewah harus berpayet, manik-manik, renda-renda, atau lengkap dengan hiasan bulu-bulu. Akan tetapi, bagi saya, cukup gaun berpotongan sederhana dengan hiasan ikat pinggang yang menarik,” kata Ersa. Ibu dua anak, Aiska Fairana dan Talula Malaika, ini juga senang terhadap perkembangan mode di Tanah Air. Desainer muda terus bermunculan dan ide-ide baru mencuat silih berganti. ”Acara seperti fashion week ada di banyak mal dan ini bagus karena menjadi wadah bagi desainer baru menampilkan karyanya,” ujar Ersa. Bagi yang sering melihat gaya Ersa di TV, pastinya akan setuju mengakui, bahwa tampilan presenter cantik ini sangat chic. Tubuhnya yang mungil, tampak begitu menarik dengan balutan gaun warna warni plus heels yang anggun. Namun dibalik semua itu, Ersa ternyata amat alergi dengan heels. “Sangat menyiksa dan jujur saja jika melihat heels dengan ukuran tingginya lebih dari 10 cm, rasanya saya ingin menangis,” kata Ersa. Dalam pikiran pesinetron Tuyul dan Mbak Yul ini, tinggi heels yang membuatnya cantik di depan kamera, adalah sebuah bencana bagi tubuhnya. “Saya tidak terbiasa pakai heels, heels saya gunakan untuk kepentingan syuting depan kamera, tapi sesudah itu, saya pasti pakai sandal atau flat shoes,” akunya. Ersa pun selalu melakukan perawatan tubuh secara serius, bahkan setelah dirinya memiliki dua anak. Perempuan berlesung pipit ini tetap nampak cantik dengan bentuk tubuh ideal. “Olahraga harus jadi kebiasaan, bukan karena mau kurus saja. Saya ikut pilates, dua sampai tiga kali dalam seminggu. Kalaupun lagi sibuk dan nggak sempet latihan sama trainer, saya latihan sendiri di rumah,” tutupnya. (MER)



08.05 10.05 14.30 17.05 20.05 22.30

06.00 09.30 13.30 16.30 19.00 23.30

Indonesia Now Menu & Venue Autozone Metro Hari Ini Dua Tamu Stand Up Comedy: Show On The Weekend

Selamat Pagi Spotlite One Stop Football Redaksi Sore OVJ Roadshow Cimahi (Masih) Dunia Lain

INDOSIAR 07.00 Kiss Pagi 11.00 Football Headliner 14.30 Live Fokus

Global TV Pukul 07.30 WIB

16.00 The Voice Indonesia: The Battle 3 20.00 Diva Dangdut 23.00 Bundesliga

Trans TV Pukul 20.30 WIB

The Spiderwick Chronicles Jared dan Simon Grace harus mengikuti ibunya pindah ke Spiderwick Estate. Bersama adiknya, Malorry, saudara kembar tersebut terseret ke dunia lain yang dipenuhi makhluk aneh. (*)


Hamil Besar Tetap Kuliah JAKARTA—Raut muka Dian Sastrowardoyo selalu berseri-seri. Rasanya tak terlihat kelelahan meski dirinya sedang hamil enam bulan, anak yang kedua. Bagi istri pengusaha Indra Guna Sutowo ini, kehamilan tidak menghalangi dirinya beraktivitas. “Saya aja baru dari Medan,” ujarnya ketika ditemui, baru-baru ini. “Saya akui kehamilan kali ini lebih santai karena saya sudah memiliki pengalaman sebelumnya saat kehamilan anak pertama,” imbuh Dian. Kepergiannya ke Medan untuk sebuah acara yang terkait masalah kehamilan. Di kota yang terkenal dengan duriannya itu, Dian menyemangati ibu-ibu hamil yang hadir di acara. “Selain ibu-ibu rumah tangga yang cerdas, anakanak yang akan dilahirkan ibu-ibu itu nanti juga jadi anak yang cerdas,” cetus bintang film Ada Apa Dengan Cinta ini. Lantas kapan stop hamil nih? Dian geleng kepala. Dia bilang suaminya menginginkan empat anak. “Insya Allah kalau bayi yang lahir ini nanti perempuan berarti anak saya sudah sepasang. Itu saja dulu,” jawab pemain film Bintang Jatuh ini. Untungnya, sang suami tak melarang dirinya untuk terus berkegiatan. Profesi Dian sebagai artis mendapat atensi dari suami. “Aktivitas sehari-hari saya isi dengan kuliah, masuk kelas pagi hari di UI dan siangnya saya bermain dengan anak. Setelah itu saya bekerja di rumah dan belajar,” terang wanita kelahiran Jakarta, 16 Maret 1982 ini. Sekadar info, sebelumnya kabar kehamilan anak kedua Dian membuat jagat Twitter heboh. Komentar lucu-lucu dan fans berat berseliweran. “Hamil lagi mantan gua?” kicau @raism23. “Astaga... Dian Sastro udah hamil anak kedua aja nih...yayang buru2 amat nih pengen banyak anak..,” tulis @qiemarqie. Ada juga fan yang cemburu. “Pemberitaan Dian Sastro hamil lagi melukai banyak pria, tetapi tenang ada Maudy Ayunda yg nampaknya punya kecantikan yg ultimate jg,” kicau fan bernama Demonic Lover. Komentar yang paling banyak bermunculan adalah pujian terhadap kecantikan Dian. Mereka bilang, Dian tetap saja memesona parasnya meski dalam kondisi hamil enam bulan. “Ga ngerti lagi gua sama Dian Sastro. Hamil anak kedua tetep aja cantik. Ga keliatan kek emak2 gitu,” kicau @han_alyasa. Dan banyak komentar-komentar senada yang intinya menilai Dian awet muda dan tetap cantik meski tak lama lagi melahirkan anak kedua. (MER) KAPANLAGI

Khawatir Raja Ampat WILAYAH Indonesia yang dikelilingi lautan membuat pemandangan bawah lautnya menjadi salah satu wisata yang menakjubkan. Hal ini pulalah yang dirasakan aktor Saputra

jatuh hati. Sejak tiga tahun yang lalu, pemeran Rangga dalam film Ada Apa Dengan Cinta ini mulai tertarik dengan diving. ’’Sebenarnya saya dari dulu memang suka flora dan

fauna. Tapi dulu zaman kuliah cuma suka naik gunung karena nggak punya cukup waktu buat diving trip, ya sibuk kerjaan, kuliah dan lain-lain,’’ ujarnya di Grand Indonesia Kempinski,

Jakarta. Karena kegemarannya tersebut, pria berambut ikal ini sudah menjajal beberapa spot diving baik didalam maupun di luar negeri. ’’Di Indonesia

juga banyak yang lebih bagus. Raja Ampat misalnya,’’ kata pemilik nama lengkap Nicholas Schubring Saputra itu. pria kelahiran Jakarta, 24 Februari 1984 itu menceritakan, dirinya telah menjajal beragam dive spot di Indonesia seperti Raja Ampat, Pulau Komodo, Aceh, Wakatobi, Bali, Ambon, dan Halmahera. ’’Ke Raja Ampat sudah tiga kali, pertama kali ke sana tahun 2008 sama temanteman,’’ tandasnya. Sudah beberapa kali kesana, dia pun menceritakan perubahan yang terjadi di Raja Ampat selama empat tahun belakangan. ’’Sekarang sih sudah makin ramai yang ke Raja Ampat. Sebenarnya sih masih enak diving di sana, cuma takutnya ke depan makin ramai dan ekosistemnya malah terganggu dan nggak terawat,’’ ungkapnya. Jika bicara tentang karang, Misool, pulau yang berada di gugusan kepulauan Raja Ampat ini adalah destinasi diving favoritnya untuk menyaksikan hamparan terumbu karang yang menyegarkan mata. (dew)

Nicholas Saputra








Pontianak Post


Sabtu 20 April 2013

APMI Sweeping Empat TV Kabel Batam dan Serui JAKARTA – Langkah penertiban hukum redistribusi siaran secara ilegal oleh perusahaan televisi (TV) kabel di daerah terus digencarkan oleh Asosiasi Penyelenggara Multimedia Indonesia (APMI). Belum lama ini Kepulauan Riau dan Papua menjadi target wilayah aksi law enforcement melawan aksi pembajakan siaran yang dilakukan empat tv kabel, satu untuk daerah Batam dan tiga lainnya di wilayah Serui. Operasi penertiban ini dilakukan APMI bekerjasama dengan aparat penegak hukum yaitu Kepolisian dari kedua wilayah tersebut di atas. Legal Coordinator APMI Handiomono mengatakan

upaya hukum ini ditempuh APMI secara serius untuk memberantas praktik pembajakan siaran oleh operatoroperator TV kabel di berbagai daerah. “APMI tidak pernah berhenti melakukan langkah penertiban hukum bagi perusahaan tv kabel yang melakukan redistribusi siaran tanpa izin resmi pemegang hak siar. Sudah ada empat tv kabel diantaranya, satu di Batam dan tiga di Serui. Keempatnya secara jelas dan terbukti melakukan pelanggaran pembajakan pada saat APMI dan kepolisian melakukan sweeping. APMI pun akan mengawal proses pelanggaran hukum dari keempatnya sampai proses persidangan

nanti,” ungkap Handiomono kepada wartawan, Kamis (18/4) Lebih lanjut dikatakan Handiomono, setelah berkordinasi dengan Polres Barelang, Batam pada awal April lalu berhasil melakukan sweeping terhadap PT. Mackianos Network di dua lokasi berbeda yaitu kawasan Apartemen Nagoya Mansion dan sekitar Komplek Mall Jodoh Marina, Batam. Hasil penulusuran dari dua kantor operasional Mackianos Network disinyalir telah melakukan redistribusi channel olah raga Barclays Premier League (BPL) atau liga utama sepak bola Inggris ke 5.000 pelanggannya. Berbeda dengan Batam,





MINGGU, 28 APRIL 2013 PUKUL 14.00


V RABU, 1 MEI 2013

RABU, 1 MEI 2013



SENIN, 29 APRIL 2013 PUKUL 17.00


MINGGU, 28 APRIL 2013 PUKUL 17.00










MINGGU, 28 APRIL 2013- PUKUL 15.00





V KAMIS, 2 MEI 2013


SABTU, 4 MEI 2013




KAMIS, 2 MEI 2013

JUMAT, 26 APRIL 2013






RABU, 1 MEI 2013

SENIN, 29 APRIL 2013 - PUKUL 16.00

V RABU, 1 MEI 2013

MINGGU, 28 APRIL 2013- PUKUL 18.00





SENIN, 29 APRIL 2013-PUKUL 15.00 VV




MINGGU, 28 APRIL 2013 - PUKUL 16.00



SENIN, 29 APRIL 2013 PUKUL 15.00


Inilah para peserta Honda DBL 2013 West Kalimantan Series. Sebanyak 23 tim putra dan 16 tim putri dari 23 sekolah, akan bertanding dengan ketat untuk menjadi juara Honda DBL 2013 West Kalimantan Series. Saksikan lagalaga seru Honda DBL 2013 West Kalimantan Series, pada 26 April - 4 Mei 2013 di GOR Pangsuma Pontianak.







RABU, 1 MEI 2013




KAMIS, 2 MEI 2013



JUMAT, 26 APRIL 2013




SABTU, 27 APRIL 2013 - PUKUL 13.00


SABTU, 27 APRIL 2013 - PUKUL 18.00

SABTU, 27 APRIL 2013 - PUKUL 15.00

SABTU, 4 MEI 2013 KAMIS, 2 MEI 2013

SABTU, 27 APRIL 2013 - PUKUL 14.00

MINGGU, 28 APRIL 2013- PUKUL 13.00


berikan efek jera bagi mereka yang coba-coba bertindak ilegal melakukan redistribusi siaran tanpa izin dari pemilik hak siar dan hak cipta yang sah,” tegasnya. Dia menegaskan upaya hukum semacam ini juga dilakukan APMI di berbagai wilayah lainnya. APMI akan melakukan penegakan hukum di semua daerah yang memiliki potensi tinggi untuk kasus pembajakan siaran oleh TV kabel ilegal. “Seperti sering saya katakana, APMI tidak akan pernag berhenti melakukan penertiban hukum pembajakan siaran ini, secara kontinu APMI akan terus bergerak ke berbagai wilayah di Indonesia,” tandasnya. (r/*)



JUMAT, 26 APRIL 2013 V

gaimana diatur dalam Pasal 49 dan 72 Undang-undang Nomor 19 Tahun 2002 tentang Hak Cipta dan atau Pasal 25 dan 33 Undang-undang Nomor 32 Tahun 2002 tentang Hak Siar junto Pasal 55 dan 56 KUHP. Handiomono menjelaskan kalau sekarang ini ada beberapa TV kabel yang telah menjalani proses pemeriksaan di kantor kepolisian masing-masing tempat kejadian perkara. “Semua sudah diperiksa dan dibuatkan BAP. Bahkan telah ada beberapa yang sudah di pengadilan. Supaya ini juga membawa dampak positif penegakan hukum yang peduli pada hak cipta dan hak kekayaan intelektual. Sekaligus mem-

JUMAT, 26 APRIL 2013

SABTU, 27 APRIL 2013 - PUKUL 17.00


Melalui bukti-bukti tersebut diketahui bahwa operator-operator tersebut secara jelas telah melakukan redistribusi siaran pertandingan BPL tanpa izin pemilik hak siar yang sah dalam hal ini PT. MNC Sky Vision Tbk selaku pemegang merek televisi berlangganan Indovision. Handiomono mengatakan, tidak hanya BPL, operatoroperator itu juga meredistribusikan tanpa izin sejumlah channel-channel premium seperti HBO, ESPN, Star Sports, dan sebagainya. Atas perbuatannya meredistribusikan siaran tanpa izin tersebut, pelaku dapat dijerat dengan perbuatan tindak pidana di bidang Hak Cipta dan atau Hak Siar seba-



SABTU, 27 APRIL 2013 - PUKUL 16.00


aksi sweeping dari tim APMI dengan Kepolisian Sektor Kepulauan Yapen, Papua menjaring tiga operator tv kabel yang telah melakukan perbuatan melawan hukum dengan menyiarkan sejumlah konten siaran tanpa memiliki izin atau pun kontrak kerjasama dengan pemilik hak siar yang sah. Ketiganya terdiri atas KPR Vision dengan pemilik bernama Yusran, Abadi Vision dibawah kepemilikan Sugito serta Langgeng Vision dengan tersangka Warjono. Melalui tiga kantor operasional tv kabel tadi telah ditemukan sejumlah barang bukti berupa peralatan yang dipakai operator untuk melakukan redistribusi siaran.

Media Partner





Supported By


Presented By

Pontianak Post

Pontianak Post


Sabtu 20 April 2013

Eyang Subur Lapor ke Bareskrim JAKARTA-Konflik antara Adi Bing Slamet dengan mantan penasihat spiritualnya, Eyang Subur, makin seru. Setelah Adi melapor ke Komisi III DPR pekan lalu, giliran Subur yang lapor polisi. Subur datang didampingi pengacaranya Ramdan Alamsyah. Mengenakan baju hitam, peci dan terus merokok Subur tak mau melayani pertanyaan wartawan. Usai melapor, Subur

juga terus bungkam. Pria yang menurut Adi Bing Slamet beristri delapan itu langsung menuju mobilnya yang terparkir di depan Gedung Bareskrim, Mazda dengan nomor polisi B 1404 BOU. “Ke pengacara saja ya, itu ke pengacara,” katanya. Dia berada di dalam ruang Sentra Pelayanan Kepolisian Bareskrim selama sekitar tiga jam. Ramdan Alamsyah menjelas-

kan bahwa pihaknya sudah melaporkan peristiwa yang dialami kliennya ke Komnas HAM dan Mabes Polri. “Dua laporan kita diterima, kedatangan kita hari ini dalam rangka melakukan upaya penegakan hukum mencari kebenaran dan mencari keadilan,” katanya. Menurut Ramdan ada empat orang yang dilaporkan, yakni Adi Bing Slamet, Nurjanah (istri Adi Bing Slamet), Novi Oktora,

dan Arya Wiguna. Dua nama terakhir adalah mantan murid Subur. Laporan Subur diterima dengan nomor TBL/ 169/ IV/ 2013/ Bareskrim tertanggal 19 April 2013. “Mereka merupakan pihak yang dengan bebasnya memberikan pernyataan-pernyataan di media cetak, online, yang akhirnya membentuk sebuah opini terhadap klien kami yang sangat merugikan,” katanya.

Akil: Patuhi Aturan KPU Sambungan dari halaman 1

Hanya, lanjutnya, kerap proses menuju politik beretika problemnya justru berada di kelembagaan. Tidak jarang banyak hal-hal tidak senonoh ditampilkan hingga menjadi santapan masyarakat. Itu kalau yang baik, namun kalau kejelekan ditampilkan siapa lagi harus dipercaya. ”Bagaimana mau percaya sama anggota dewan, aparat seperti hakim, polisi dan jaksa kalau kita sendiri tidak mematuhi aturan. Yang namanya aturan ya harus dipatuhi,” kata dia. PeratutanKPUNomor Nomor 7Tahun2013tentangpencalonan anggota DPR, DPRD dan DPD, menjadi Peraturan KPU Nomor 13 Tahun 2013. Dalam peraturan yang baru diatur bahwa anggota legislatif yang ingin nyaleg dari partai berbeda tak perlu surat persetujuan parpol asal, hanya surat pengunduran diri. Ketentuan itu tertuang dalam pasal 19 yang menyebutkan surat pencalonan dan daftar bakal calon yang disertai dengan dokumen persyaratan masing-masing

bakal calon anggota DPR, DPRD Provinsi dan DPRD Kabupaten/ Kota dibuktikan dengan: (i) surat pernyataan pengunduran diri yang tidak dapat ditarik kembali bagi: (Angka 2) anggota partai politik yang dicalonkan oleh partai politik yang berbeda dengan partai politik asal, baik partai politik peserta Pemilu maupun bukan peserta Pemilu melampirkan surat pernyataan pengunduran diri sebagai anggota partai politik asal (Model BB-5). Anggota partai politik dimaksud adalah anggota DPR/DPRD. Surat pernyataan pengunduran diri itu dilengkapi dengan surat pernyataan pengunduran diri sebagai anggota DPR/DPRD dan surat keputusan pemberhentian sebagai anggota DPR/DPRD (huruf j pasal 19). Jika belum dapat melampirkan surat pemberhentian maka dapat digantikan surat keterangan pimpinan atau sekretaris DPR/DPRD bahwa pemberhentian sebagai anggota DPR/DPRD sedang diproses, yang harus diserahkan paling lambat pada masa perbaikan DCS atau pen-

gajuan penggantian calon anggota DPR/DPRD(huruf k pasal 19). Padahal dalam ketentuan sebelumnya, menyebutkan anggota legislatif yang ingin menjadi caleg dari partai berbeda harus menyertakan surat persetujuan dari partai politik asal dan tanpa ketengan ada surat pemberhentian dari pimpinan DPR/ DPRD. Berikut bunyi ketentuan sebelumnya (PKPU 7 Tahun 2013): (Angka 2) anggota DPR, DPRD Provinsi dan DPRD Kabupaten/Kota yang dicalonkan oleh partai politik yang berbeda dengan melampirkan surat persetujuan pimpinan partai politik asal (Model BB-5). Ketentuan ini sebelumnya pernah dikupas Badan Kehormatan DPRD Kalbar. Ali Akbar, Ketua BK DPRD Kalbar menuturkan aturan tersebut harus dipertegas namun tidak mempersulit anggota legislatif yang ingin jadi caleg dari partai berbeda. “Memang ada “kutu loncat” alias pindah partai, kalau gara-gara tak terpenuhi SK (persetujuan) maka hak poli-

tiknya hilang (untuk jadi caleg). Menurut saya mungkin sampai pengunduran diri kepada partai saja sudah cukup,” ucapnya. Kata Ali kembali persoalan pengunduran diri bukan saja dirasakan DPRD Kalbar, namun juga dirasakan seluruh anggota DPRD dari partai  tidak lolos Pemilu 2014 di Indonesia. Kemudian mereka berniat kembali maju menjadi caleg. Dan kalau tidak salah mengacu jadwal KPU. “Yang dikhawatirkan juga bisa jadi gagal ikut caleg sampai masa perbaikan DCS, ternyata SK pemberhentian dari Gubernur belum keluar. Ini juga harus dikawal. Kepala Daerah harus pahami ini. Sementara di satu sisi sudah mengundurkan diri dan tidak bisa dicabut lagi,” katanya. Data KPU Kalbar, sedikitnya ada lima nama anggota dewan tetapi parpolnya tidak lolos ke pemilu legislatif 2014. Sementara di DPRD Kota Pontianak dan Kubu Raya juga ada beberapa nama. Peraturan KPU nomor 13 tahun 2013 harus dipatuhi. (den)

MABM Ramah Tamah Bersama Ketua MK Sambungan dari halaman 1

tersebut. Terucap utaian pidato sambutan dari perwakilan para pemuka tokoh masyarakat Kalbar. “Mk menjadi tempat mengadu masyarakat Indonesia terutama Pilkada. Sebagai warga Kalbar yang menyayangi Akil Mochtar, mari kita doakan supaya beliau dan keluarga dalam keadaan sehat. Supaya bisa menjalankan tugas dengan baik,” ucap Chairil Effendy, Ketua MABM Kalbar, Jumat (19/4) saat memberikan sambutan. Mantan Rektor Universitas Tanjungpura ini mengatakan, tujuan ramah-tamah mempereratkan persaudaraan antar sesama warga Kalbar. Hal tersebut dikatakannya, karena tidak mudah untuk berkumpul seperti ini mengingat intensitas kesibukan. Namun berkat adanya rasa saling memiliki dan satu

perjuangan untuk membangun Kalbar akhirnya acara dapat terselenggara dengan baik. Dia mengungkapkan agenda ini juga merupakan acara ulang tahun MABM Kalbar yang ke 16 tahun. Kemudian kehadiran MABM untuk masyarakat di Kalbar sangat sadar akan multikultur budaya yang bercorak ragam. “Untuk itu perlu dikembangkan bahasa dan budayanya masing-masing. Sehingga muncul mozaik kebudayaan kalbar. Sesuai dengan visi dan misi gubernur kita,” ujarnya Chairil. Tokoh Nasional asal Kalbar Oesman Sapta Odang juga hadir dan memberikan sambutan diacara malam ramah tamah bersama Ketua Mahkamah Konstitusi RI. Dia mengatakan persahabatan dengan Akil Mochtar sudah sejak lama terajut. “Persahabatan terjalin ketika masih sama-sama merangkak

berjuang. Satu kebangaan saya yang tidak bisa ditahan-tahan. Sebagai putra daerah harus bangga atas hasil perjuangan dari putra daerah Kalbar,” ungkap dia. Oesman mengatakan untuk membangun Kalbar harus bersatu. Tidak peduli dia berasal dari agama mana, suku apa, dari golongan mana, partai apa. Masyarakat Kalbar harus bangkit dan bersatu. ”Jangan sampai bumi Khatulistiwa dijadikan tempat untuk mengambil keuntungan, tanpa ada kemakmuran yang ditinggalkan. Rakyat Kalbar memerlukan ideologi atau suatu faham ajaran sebagai kehidupan berbangsa dan bernegara,” katanya. “Ini hanya CPO (Crude Palm Oil) yang diekspor, tidak ada yang jadi finishing produk atau semi finishing. Itu artinya masyarakat kita masih

jadi kuli,” pungkas Oesman sembari mengajak tamu yang hadir untuk mengatakan bersama-sama Kalimatan Barat bangkit dan bersatu bersama para hadirin yang hadir. Sambutan gubernur Kalbar yang dibacakan Sekda Kalbar, M Zeet Hamdy Assovie menyampaikan ungkapan minta maaf dan ucapan rasa bangga terhadap putra Kalbar terpilih sebagai Ketua Mahkamah Konstitusi RI, Akil Mochtar. Masyarakat Kalbar harus menjunjung tinggi dasar filosofi ideologi dasar negara Indonesia yakni Pancasila dan UndangUndang Dasar 1945. Setelah itu diikat dengan persaudaran dalam bingkai Bhineka Tunggal Ika. “Kewajiban kita untuk bersatu dalam keberagaman tanpa melihat asal dan usul. Kita harus mengutamakan dasar Pancasila dalam Bhineka Tungga Ika,” Zeet. (irn)

Sekolah Tak Ada Biaya, Makan Pun Seadanya Sambungan dari halaman 1

Kisah duka Tasripin bermula saat ibunya, Sutinah, 39, meninggal dunia setahun silam. Saat itu Sutinah tengah bekerja mencari pasir di Sungai Mengaji. Tiba-tiba ada batu longsor menimpa tubuhnya. Jiwanya tak tertolong saat menjalani perawatan. Sutinah meninggalkan lima buah hatinya yang empat di antaranya masih kecil. Yakni Nartim, 21; Tasripin, 13; Dandi, 7; Riyanti, 6; dan Daryo, 4. Suami Sutinah, Kuswito, 41, berada di Cilacap saat istrinya mengalami kecelakaan. Bahkan, sampai Sutinah meninggal, Kuswito tetap di Cilacap hingga akhirnya bekerja ke Kalimantan sejak delapan bulan silam. Anak sulung mereka, Nartim sebenarnya menjadi sandaran Tasripin dan adik-adiknya. Namun, tiga bulan lalu Nartim justru memilih mengikuti jejak ayahnya merantau ke Kalimantan. Empat anak Kuswito pun kini tinggal sebatang kara di rumah berukuran sekitar 5 x 6 m di Grumbul Pesawahan, Desa Gununglurah, Kecamatan Cilongok, Kabupaten Banyumas, Jateng. Rumah mereka pun terbilang sederhana. Berbeda dengan tetangganya yang sudah berkeramik dan bertembok, dinding rumah Kuswito terbuat dari papan dan lantainya semen yang pecah di sana-sini. Ruangan dalam pun terasa pengab lantaran sirkulasi udara tidak sempurna. Beruntung keluarga almarhum Sutinah tempat tinggalnya berdekatan dengan rumah empat anak yang masih kecil itu. Keluarga almarhum Sutinah pernah mengusulkan supaya empat anak itu dititipkan ke saudara. ’’Namun saat itu Kuswito bersikeras supaya anak-anak tetap berada di

rumah. Dia menolak tawaran bila saudara mengasuh anakanaknya. Kami pun merasa sedih,” jelas Ali Sahudin, 50, paman Tasripin. Setiap hari, Ali berusaha merawat anak-anak Kuswito dengan datang ke rumah mereka yang jaraknya sekitar 20 meter dari tempat tinggalnya. ’’Kalau masalah sandang dan pangan, saya rasa mereka tidak sampai terlewat. Hanya, umur mereka yang masih anak-anak membutuhkan kasih sayang orang tua,’’ jelas Ali. Tasripin menuturkan, sejak delapan bulan lalu ayahnya merantau ke Kalimantan. Setiap bulan ayahnya mengirim uang. Jumlahnya sekitar Rp 300 ribu sampai Rp 500 ribu. Uang tersebut digunakan untuk biayai hidup bersama tiga adiknya. Tasripin sudah berhenti bersekolah sejak duduk di kelas 3 SD. Dulu dia bersekolah di SD Karanggondang, Desa Sambirata. Dia tidak mau melanjutkan sekolah karena terbentur biaya dan lebih senang merawat adik-adiknya. Dua adiknya, yaitu Dandi dan Riyanti saat ini belum sekolah. Sedangkan Daryo yang paling kecil bersekolah di Pendidikan Anak Usia Dini (PAUD) Grumbul Pesawahan. ’’Adik saya tidak mau sekolah. Hanya yang kecil ikut PAUD, itu saja kalau mau berangkat,’’ imbuh Tasripin. Sebenarnya, keluarga ingin Tasripin bersekolah. Namun anjuran itu selalu ditolak. Waktu Tasripin sehari-hari habis untuk mengurus adikadiknya. Setiap pagi, dia memasak untuk sarapan. Seperti menanak nasi, memasak air, sampai membuatkan mi instan. Keluarga dan tetangga sering membantu memberikan nasi maupun lauk untuk bocah-bocah tersebut. Tak

jarang mereka hanya makan nasi dengan lauk seadanya. Untuk pakaian, Tasripin mencuci baju sendiri walaupaun tidak pernah disetrika. ’’Uang kiriman dari bapak untuk membeli beras dan minyak. Terkadang beli beras sampai 15 kilo untuk setengah bulan. Karena satu hari habis setengah kilo untuk makan. Kalau ada uang lebih, kadang untuk jajan adik-adik. Saya bekerja serabutan, kadang mencari kayu bakar di hutan atau jadi buruh menggarap sawah,’’ katanya. Dalam berkomunikasi, ayahnya selalu menghubungi via telepon milik tetangga atau keluarga dekatnya. Beberapa minggu lalu ayahnya menghubungi dan akan pulang bersama kakaknya pada Lebaran mendatang. “Bapak di Kalimantan, di perusahaan kayu. Kalau kakak saya di perusahaan sawit. Bilangnya mau pulang pas Lebaran nanti,” ujarnya. Tasripin sendiri mengaku tidak bisa membaca dan menulis. Tapi setiap hari dia bisa mengajari adiknya mengaji. Namun, sejak kisah Tasripin diberitakan sejumlah media, uluran tangan mulai berdatangan. Masyarakat sekitar, lembaga sosial, hingga instansi pemerintah dan militer ramai-ramai memberikan bantuan kepada Tasripin dan tiga adiknya. Kemarin anggota TNI dari Kodim 0701/Banyumas dan Korem 071/Wijayakusuma melakukan bedah rumah Tasripin. Rumah dipugar agar terang dan sirkulasinya sehat. Para anggota TNI juga membuatkan WC dan memperbaiki dapur. Selain itu, mereka merehab kamar Tasripin berukuran 3x3 meter persegi yang ditempati bersama tiga adiknya supaya lebih besar.

Sedangkan lantai disemen ulang, halaman dipasang paving block, serta papan-papan dinding rumah yang sudah keropos diganti. Selama bedah rumah berlangsung, Tasripin dan tiga adiknya diinapkan di Hotel Wisata Niaga, Purwokerto. Begitu masuk ke kamar nomor 246, mereka terlihat gembira dan langsung bersantai di kasur. ’’Kamarnya besar sekali,’’ ujar Tasripin. Meski awalnya sempat takut-takut, begitu melihat banyaknya minuman segar yang disajikan mereka langsung semringah. Mereka bergilir mengambil susu kotak dan teh kemasan yang disajikan. Nasi goreng hotel yang disajikan pun langsung disantap dengan lahap empat bocah tersebut. Tasripin sampai di Hotel Wisata Niaga pukul 19.00 WIB tadi malam diantar jajaran Kodim. Dia juga ditemani sejumlah saudara serta alumnus SMP Negeri 5 Purwokerto yang memperhatikan Tasripin sejak awal. Dandim 0701/ Banyumas Letkol Inf Helmi Tachejadi Soerjono melalui Pasintel Ruswanto mengatakan, setelah renovasi rumah selesai, Tasripin dan adikadiknya akan pulang. ’’Rumah yang sekarang ini akan direhab sehingga lebih layak dan nyaman untuk tempat tinggal. Semoga berjalan lancar dan sukses,’’ timpalnya. Muhamad Adib sebagai pendamping Tasripin dan adiknya mengucapkan terima kasih kepada pihak-pihak yang telah membebaskan Tasripin dan adiknya dari derita kelaparan serta suramnya masa depan. “Tasripin dan adiknya sudah bisa tersenyum dan bisa menatap masa depan dengan semangat untuk sekolah,” jelasnya. (*/oki)

7 Nanan Lepas Touring Lamborghini Sambungan dari halaman 1

dan Lamborghini Aventador. Perjalanan muhibah ke sejumlah destinasi cagar budaya ini diawali dari Semarang. “Kunjungan pertama akan memulai lawatan ke industri jamu Sido Muncul. Berikutnya

akan mengunjungi beberapa lokasi pelestarian sejarah seperti keraton Surakarta, Keraton Yogyakarta dan Candi Borobudur,” katanya kepada wartawan. Touring Lamborghini ini, kata dia, sengaja memilih sejumlah tempat pelestarian budaya. Karena lawatan

ini juga memiliki misi untuk memperkenalkan budaya Indonesia kepada masyarakat internasional.“Karena pengalaman perjalanan kawankawan Lamborghini Jakarta ini juga akan dipublikasikan ke beberapa negara yang memiliki klub Lamborghini,” imbuhnya. (int)

Harga BBM Naik 5 Mei Sambungan dari halaman 1

itu didampingi anggota KEN lainnya. Seperti, Aviliani, James T Riady, Peter F Gontha, Sandiaga Uno, dan Erwin Aksa. Sebelum ke redaksi, mereka berdiskusi dengan Walikota Surabaya Tri Rismaharini di Balai Kota Surabaya. Ini merupakan rangkaian kunjungan kerja KEN ke Kota Pahlawan. Menurut CT subdisi BBM layak dicabut sebab, pemberiannya tidak tepat. 54 persen penikmat subsidi adalah orang-orang mampu, pemilik mobil pribadi. “Subdisi jangan diberikan dalam bentuk barang, sebab orang yang mampu membeli barang itu yang bisa menikmati lebih banyak. Kasihan orang miskin,” katanya. KEN sendiri berharap kenaikan ini menjadi langkah awal untuk mencabut subsidi. Diharapkan kenaikan secara bertahap tidak membuat gejolak sosial. Apalagi, angkutan umum dan kendaraan roda dua masih bisa me-

nikmati BBM dengan harga Rp 4.500. Bagaimana dengan penyelewengan di lapangan? CT menyebut pemerintah akan melakukan tindakan pencegahan agar, kenaikan ini tepat sasaran. Untuk jangka pendek, setiap SPBU akan mendapat pengawasan langsung dari pihak kepolisian. Jangka menengah, pemasangan alat khusus kepada angkutan umum untuk mendeteksi jumlah pembelian. “Misalkan, angkot (angkutan kota,red) sudah mengisi 20 liter. Dia tidak bisa mengisi lagi dalam waktu cepat BBM,” tuturnya. CT menegaskan kenaikan Rp 2.500 tidak akan berdampak besar kepada kenaikan inflasi. Yang perlu ditakutkan adalah tingginya harga-harga kebutuhan pangan masyrakat. Seperti, bawang putih, bawang merah atau daging. “Hortikultura tidak terkendali, inflasi bisa tembus 7 persen,” katanya. Inflasi Indonesia tahun lalu tercatat 4,3 persen. Pada

tahun ini, proyeksi KEN adalah tidak lebih dari 5 persen. Sementara, merujuk data BPS selama tiga bulan pertama ini indeks kenaikan harga adalah 2,43 persen. Ini berarti sudah mencapai 50 persen dari prediksi. Karena itu, KEN mengusulkan pencabutan kuota impor hasil pertanian dan, itu telah dilaksanakan oleh pemerintah. “Sebab, yang diuntungkan adalah pedagang atau importir. Petani yang diharapkan lebih sejahtera tidak dapat apa-apa. Sebaliknya, masyarakat tertekan dengan kenaikan harga,” jelasnya. KEN pun memberikan solusi memberikan entry barrier kepada produk impor dengan tarif bea masuk. Maksimal sampai 30 persen. “Jika kenaikan 30 persen, petani tanah air tidak bisa bersaing itu berarti kita kurang efesien. Tapi, masyarakat banyak tetap bisa menikmati kebutuhan pangan dengan harga yang sesuai. Inflasi pun bisa terkendali,”ujarnya. (dio/res)

Korban Tewas, Penabrak Ditahan Sambungan dari halaman 1

jam mendapat perawatan medis. Isak tangis pecah, satu persatu sanak keluarga berdatangan untuk melihat jenazah Edi. Terlebih sang istri, Sufi. Dirinya terus meneteskan air mata dengan tatapan kosong. “Saya ingin yang nabrak ditangkap polisi,” harapnya tersedu-sedu. Sufi tak mampu berkata banyak. Dia terus menangis memeluk mendiang suaminya. Masih terbayang dalam benaknya, pagi sebelum kejadian, ternyata itu pertemuan terakhir bagi mereka. Edi yang sehari-harinya pulang kerja sekitar pukul 11.30 wib, pada Jumat(19/4) kemarin tak kunjung datang ke rumah. Sufi mulai cemas. Hingga akhirnya ponsel berdering di tangan Sufi sekitar

pukul 13.00 wib. Telepon itu dari kerabat keluarga mereka, yang menginformasikan bahwa sang suami sedang kritis di rumah sakit karena kecelakaan lalulintas. Lusi beserta sanak keluarga yang lain datang menjenguk Edi. Korban terbaring kaku di ruang ICU. Hingga beberapa saat kemudian, dirinya dirujuk ke ruang khusus untuk dirawat secara intensif. Apa daya, setelah beberapa jam kemudian, saat menjelang petang, Edi menghembuskan napas terakhirnya. Tak berselang lama, akhirnya Satlantas Polresta Pontianak berhasil mengamankan seorang pengemudi mobil yang diduga menabrak korban hingga meninggal dunia. Tersangka diamankan tadi malam, dan dirinya se-

dang menjani pemeriksaan di ruang penyidik. Apakah ada unsur kelalaian, atau ada motif lain, semuanya masih dalam penyelidikan. Hingga pukul 22.30 wib, petugas masih melakukan pemeriksaan terhadap tersangka. Pihak kepolisian belum mau membeberkan secara rinci menyangkut identitas pengemudi mobil tersebut. Saat Pontianak Post menghubungi Kasat Lantas Polresta Pontianak, Kompol Nur Ichsan melalui pesan singkat, dirinya belum mau membeberkan informasi. “Besok saja konfirmasinya. Masih kita amankan dan lakukan pemeriksaan. Kita juga harus istirahat,” begitu bunyi pesan singkat Kasat Lantas yang diterima Pontianak Post, tadi malam sekitar pukul 23.00 wib. (rmn)

Tiap Hari Bawa 10 Gadget Sambungan dari halaman 1

Quickie Express itu membawa puluhan gadget! “Teknologi penting buat aku. Aku jarang komunikasi dengan orang luar, jadi aku pake gadget. Kalau pergi-pergi semuanya (gadget) aku bawa. Aku punya banyak, sekitar sepuluh gadget,” ujar Sandra, baru-baru ini. Selain menjadi alat komunikasi, buat Sandra, gadget juga menjadi hiburan saat menunggu di lokasi syuting. Untuk mengusir jenuh biasan-

ya pemain film Tarzan ke Kota ini suka bermain game ataupun membaca berita-berita mengenai fashion dan beauty. Sandra juga suka memanfaatan aplikasi kamera yang tersedia di gadget-nya untuk mendokumentasikan hal-hal menarik selama kegiatannya di luar dan kemudian mempostingnya ke sosial media. “All the time, gadget banget. Aku sangat suka kamera yang bagus. Apalagi travelling ke luar negeri, kan nggak mungkin bawa kamera berat. Kalau HP kamera bagus kan bisa,”

tambahnya. Menurutnya, kamera ponsel yang bagus berguna untuk memotret pemandangan dan foto diri. “Aku juga suka upload foto. Biasanya dalam sehari ada satu atau dua foto yang diupload. Jangan terlalu banyak juga, ya. Jadi bisa foto sekaligus jadi sarana mendapat informasi dengan berbagi foto via aplikasi instagram. Jadinya sedikit narsisistik lah hehehe,” canda pemilik nama lengkap Monica Nicholle Sandra Dewi Gunawan Basri ini. (mer)

Kulit Manggis Sangat Bermanfaat . . . Sambungan dari halaman 1

pengobatan penyakit, baik ringan maupun berat. Pada kulit manggis terdapat senyawa xanthone yang memiliki tingkat antioksidan yang tinggi. Dengan konten xanthone sekitar 123,97 mg/ml, zat pada kulit buah manggis itu dapat membuang penyakit, memperbaiki sel-sel yang rusak, dan melindungi sel-sel dalam tubuh dari serangan penyakit. Zat kimia alami yang tergolong senyawa polyhenolic itu dapat digunakan sebagai bahan untuk mengatasi berbagai penyakit, misalnya penyakit jantung, arterosklerosis (plak pada pembuluh darah), hipertensi, dan trombosis. Kulit manggis juga dapat membantu penghancuran semua penyakit dan meningkatkan antibodi dalam tubuh. Selain itu, kandungan antioksidannya itu membuat kulit buah manggis dapat dijadikan sebagai antikanker, seperti kanker payudara, kanker darah (leukemia), kanker perut, kanker paru, kanker usus besar, dan kanker hati. Artinya, kulit manggis dapat digunakan sebagai obat kemoterapi untuk mengurangi efek kemoterapi. Manfaat Kulit manggis lainnya adalah mengobati penya-

kit asma, penyakit alzeimer, jerawat, disentri, diare, maag, bronkitis, pneumonia, penyakit parkinson, osteoporosis, HIV, asam urat, kolesterol, dan depresi. Untuk kecantikan, manfaat kulit manggis adalah untuk penurun berat badan. Ini bisa terjadi karena xanthone dapat merangsang pemecahan lemak dalam tubuh. Kulit manggis juga dapat digunakan untuk mencegah penuaan dini karena antioksidannya dapat memperbaiki sel-sel yang rusak pada kulit. Mengonsumsi xanthone kulit manggis dapat membuat kulit lebih kencang dan bersih. Dengan mengonsumsi xanthone Anda juga akan terlihat lebih muda karena antioksidan super ini mempunyai fungsi untuk mempertahankan dan memperbaiki beberapa sel tubuh yang rusak sehingga menjadi lebih baik. Namun, sangat disarankan ibu hamil di bawah enam bulan tidak mengunsumsi jus kulit manggis karena dapat membahayakan janin yang ada di dalam kandungan mereka. Untuk mendapatkan manfaat yang nyata, sangat disarankan mengonsumsi xanthone kulit manggis ini rutin setiap hari. Bila ingin tahu lebih banyak tentang khasiat kulit manggis

tersebut, Anda bisa membacanya di buku berjudul Kulit Manggis Berkhasiat Tinggi, yang tersedia di Toko Buku Gramedia di seluruh Indonesia. Tapi, apakah untuk mendapatkan xanthone itu kita perlu mengimpornya d u l u ? Ti d a k . S e k a ra n g , teknologinya sudah ada di Indonesia. Dan produk itu sudah beredar di apotek dan toko-toko obat terkemuka di kota Anda, dalam bentuk kapsul. Namanya Garcia. Sedangkan xanthone adalah nama zat yang dikandungnya. Bila ingin mendapatkan ekstrak kulit manggis pertama di Indonesia itu, Anda bisa menghubungi distributor Kalimantan Barat 081280016319, (0561) 7161419. Atau bisa juga mendapatkannya langsung di apotek-apotek dan toko obat di Kota Pontianak. Untuk di daerah hubungi Sub Distributor: Kubu Raya (085880501034), Singkawang (085245401200), Sambas (085387155781), Kabupaten Pontianak (085347695045), Bengkayang (085252223557), Landak (082156214191), Sanggau (082153805379), Sekadau (085386211220), Sintang (081258929642), Kapuas Hulu (081257268829) dan Ketapang (085252056206, Kayong Utara (085652054794). (adv)



Pontianak Post


PAN Kalbar Optimis Menang PONTIANAK—Partai Amanat nasional (PAN) Kalbar terus mematangkan persiapan menyongsong Pemilihan Kepala daerah dan Wakil Kepala daerah (Pilkada) yang berlangsung di 4 Kabupaten/Kota di Kalbar pada bulan September 2013 mendatang. Empat pilkada (Kota Pontianak, Kabupaten Pontianak, Kubu Raya dan Sanggau) terus melakukan penjajakan terhadap para calon kepala daerah. Ketua DPW PAN Kalbar, Ikhwani A Rahim menuturkan proses pendaftaran sudah dilakukan sejak beberapa waktu lalu. Sesuai nomor urut PAN yaitu noIkhwani A Rahim mor 8, DPD PAN Kubu Raya telah membuka pendaftaran 28 Februari dan sudah selesai. Sementara DPD PAN Kota Pontianak juga telah membuka pendaftaran tanggal 8 Maret 2013. “Dan dari laporan DPD ke DPW, tidak sedikit para calon kepala daerah mendaftar,” katanya. Hanya, lanjut dia, untuk mengusung pasangan calon kepala daerah di Pilkada di empat daerah tersebut, PAN mau tidak mau harus berkoalisi dengan parpol lain. Sebab perolehan kursi di DPRD yang tidak memenuhi syarat mencalonkan pasangan calon sendiri. Seperti diketahui di kota Pontianak dan Kabupaten Sanggau masing – masing PAN memiliki keterwakilan sedikitnya 4 kursi. Sementara di Kabupaten Sanggau dan Kabupaten Pontianak sebanyak 3 kursi. “Tapi jika kursi PAN digabungkan, termasuk ke kursi PBR yang telah melebur dengan PAN, maka dapat mengusung pasangan calon sendiri seperti di Kota Pontianak, Kabupaten Pontianak dan Kubu Raya,” ucapnya. Ikhwani sekaligus Ketua Fraksi PAN DPRD Kalbar ini terus memantau para calon yang mendaftar ke PAN Kalbar. Hanya saja di PAN sendiri tetap mengikuti mekanisme dan aturan main. Misalnya, mekanisme PAN adalah para bakal calon kepala daerah terjaring diseleksi dan diverifikasi tim Pilkada DPD Kabupaten Kota. Kemudian hasilnya dilaporkan ke tim Pilkada DPW PAN Kalbar. Keputusan final pasangan calon yang diusung berada di DPW Kalbar. Sementara DPP PAN akan mengesahkan dan menetapkan. Sejauh ini, sudah muncul sejumlah nama calon kepala daerah. Namun yang dibidik nantinya harus mengikuti mekanisme termasuk visi dan misi PAN. PAN sendiri mempunyai garis kebijakan sendiri, antara lain berupaya mengusung kader terbaik. Kemudian pasangan calon diusung juga diharapkan berdampak di Pemilu Legislatif tahun 2014. (den)

Sabtu 20 April 2013

BKOW Harus Teladani Kartini SOSOK Raden Ajeng Kartini seperti tidak akan pernah pudar dan hingga saat ini tetap dikenang karena sosok Kartini sangat kental dengan simbol perjuangan perempuan. “Kepeloporan dan pemikiran RA Kartini hendaklah mengilhami dan menjadi teladan gerakan perjuangan BKOW (Badan Kerjasama Organisasi,” ungkap Frederika Cornelis, S.Pd selaku Ketua Dewan Penasehat BKOW Provinsi Kalbar dalam sambutannya pada pembukaan Musyawarah Kerja (Muker) VII BKOW yang dibuka Gubernur Kalbar diwakili Kepala BP3AMBK, TTA Nyarong, M.Si di Balai Petitih, Jumat (19/04). Menurut Istri Gubernur Kalbar ini, simbol perjuangan Kartini pada hakikatnya merupakan refleksi dari sosok seorang pelopor pejuang emansipasi perempuan, sosok pejuang yang membebaskan perempuan dari belenggu kebodohan, sosok


BKOW: (ki-ka) TTA Nyarong, Frederika Cornelis, Bintari M. Damanik dan Nani Mulyani Agus

pendobrak tradisi patriarki yang telah mengakar di masyarakat, sosok pejuang persamaan hak dari praktek diskirminasi, sosok perempuan yang tampil untuk memajukan pendidikan, sosok penggagas kebangkitan perempaun. “Saya kira sangat tepat BKOW menggelar Muker VII di bulan ini, karena bersamaan

dengan momentum peringatan Hari Kartini yang akan dilaksanakan 21 April besok,”katanya. Sementara Ketua Umum BKOW, Hj. Bintarti M. Damanik mengatakan, Muker merupakan forum tertinggi yang diselenggarakan tiga tahun sekali. “Muker merupakan forum yang akan memutuskan

beberapa agenda antara lain, penyampaian laporan pertanggung jawaban BKOW periode 2009-2012, merumuskan program kerja dan menyusun kepengurusan BKOW periode 2013-2016,”terangnya. BKOW sebagai wadah berhimpun organisasi wanita jelas Bintarti M. Damanik mempu-

nyai tugas pokok yaitu, melaksanakan dan mensukseskan program pemerintah daerah, berkoordinasi, menghimpun dan mengembangkan aspirasi perempuan melalui organisasi anggota yang tergabung, memberikan pendidikan dan keterampilan kepada masyarakat dan secara mandiri atau bekerjasama dengan Badan/Instansi terkait dan BUMN dalam melakukan pembinaan kepada masyarakat di segala bidang menuju kesejahteraan masyarakat. Sementara Ketua Panitia Muker, Dra. Hj. Nani Mulyani Agus, MM melaporkan, Muker yang mengangkat tema “Meningkatkan kualitas perempuan dalam mewujudkan generasi penerus yang berkualitas” diikuti utusan organisasi wanita yang tergabung di BKOW Provinsi Kalbar berjumlah 44 organisasi, Utusan GOW Kabupaten/Kota, Pengurus BKOW Kalbar dan dewan penasehat.(agus)

Festival Vokal Grup Antar Gereja Digelar EVENT tahunan Pebuza Vocal Group Contest (PVGC) kembali digelar pada 27 April hingga 5 Mei 2013. Festival vokal grup antar gereja, persekutuan, sanggar, sekolah dan kampus ini memasuki musim yang kelima, sejak dihelat pertama kali tahun 2007. “Kegiatan tahun ini juga bertepatan dengan peringatan hari jadi Persekutuan Pemuda Bukit Zaitun yang ke-41. Persekutuan Pemuda Bukit Zaitun (Pebuza) tak lain adalah penyelenggara event PVGC ini,” kata Ketua Panitia PVGC 2013, Roito Nainggolan. PVGC digelar dengan semangat manfaat untuk memupuk aneka talenta kaum muda Kristiani. Ajang yang terbuka bagi semua denominasi gereja Kristen dan Katolik ini ditargetkan untuk dapat menjadi wahana

pengembangan pengetahuan, keterampilan dan sukacita para muda gereja dalam mendukung pelayanan di gereja melalui bakat yang mereka miliki. Selain kompetisi vokal grup, dalam event PVGC 2013 juga diadakan festival tari tamborin PVGC TamFest (PVGC Tambourine Festival). Festival ini mengikutsertakan tim kontestan dari berbagai gereja, persekutuan, sanggar, sekolah dan kampus di Kalimantan Barat. Pada hari yang sama, juga diselenggarakan perlombaan fotografi POP Contest (PVGC On the spot Photo Contest). Roi menjelaskan, pada tahun ini semua kegiatan PVGC kembali akan dipusatkan di Gereja Persekutuan Pemberitaan Injil Kristus (GPPIK) “Bukit Zaitun”, Jl WR Supratman, Pontianak,


Pontianak Post

Sabtu, 27 April 2013 pukul 16.00 WIB. Rangkaian kegiatan dimulai dengan seminar untuk umum yang mengangkat tema “Musik Gereja versus Musik Sekuler”. Acara langsung dilanjutkan dengan pertemuan teknis dan pengenalan pentas kepada semua peserta festival vokal grup, tari tamborin dan lomba foto. Minggu, 28 April 2013, semua kegiatan festival dihelat. Penampilan peserta lomba tari tamborin dan vokal grup dijadwalkan dimulai pukul 14.00 WIB. Bersamaan dengan acara tersebut, lomba fotografi on the spot juga dimulai. Acara juga akan diramaikan dengan bazaar dan pameran dari berbagai sponsor pendukung kegiatan, yang diadakan hingga sore hari di Kompleks Gereja PPIK “Bukit Zaitun” Pontianak.

Satu pekan setelah perlombaan, tepatnya Minggu, 5 Mei 2013, digelar malam puncak pengumuman pemenang dan perayaan. Acara ini didahului dengan ibadah bersama seluruh peserta kegiatan, pada pukul 17.00 WIB. Pada malam puncak ini, akan diumumkan seluruh pemenang festival vokal grup, baik juara umum, peringkat kategori maupun peraih penghargaanpenghargaan khusus yang meliputi aransemen terbaik, musik terbaik, kostum terbaik, koreografi terbaik, favorit dan pendatang baru terbaik. Sementara untuk festival tari tamborin, selain juara umum dan juara peringkat, dari seluruh peserta juga akan dipilih peraih penghargaan khusus kostum terbaik, favorit dan pendatang baru terbaik. Lomba foto POP

Contest juga berakhir pada hari yang sama dengan adanya pengumuman dari dewan juri bagi para pemenang. Seluruh kegiatan PVGC 2013 ini didukung penuh oleh Harian Pontianak Post sebagai media partner.Berhadiah piala, uang tunai dan bingkisan, pendaftaran festival vokal grup PVGC, festival tari tamborin PVGC TamFest dan lomba fotografi POP Contest masih dibuka hingga Jumat, 26 April 2013. Untuk informasi dan pendaftaran, panitia dapat dihubungi melalui nomor kontak 081256394173 (Roito, ketua panitia) atau 08164993973 (Rudy, sekretaris panitia). Panitia PVGC 2013 mengundang seluruh pemuda Kristiani Pontianak dan sekitarnya untuk turut berpartisipasi dan meramaikan ajang ini. (*)

Metropolis Pontianak Post


SABTU 20 April 2013

Soal Unas SMP Beres

PONTIANAK - Pelaksanaan ujian nasional tingkat sekolah menengah pertama (SMP) sederajat dipastikan sesuai jadwal pada 22 April mendatang. Ketua Panitia Ujian Nasional 2012/2013 Provinsi Kalimantan Barat Sunyata mengungkapkan soal ujian hingga saat ini soal ujian sudah didistribusikan ke seluruh kabupaten dan kota, kecuali Kota Pontianak. ”Pendistribusian untuk Kota Pontianak dilaksanakan sehari sebelum penyelenggaraan ujian nasional. Ini sesuai permintaan dari Dinas Pendidikan Kota Pontianak,” ujar Sunyata, JuSekolah: mat (19/4). - SMP : 1.102 unit - MTs : 228 unit Menurut Sunyata, - SMP Terbuka : 25 unit soal ujian nasional datang ke Kalbar, Peserta : 65.981orang Senin (15/4). Sehari - SMP : 57.437 orang kemudian, Selasa - MTs : 8.284 orang (16/4) pukul 04.30 - SMP Terbuka : 231 orang langsung didistri- SMPLB : 29 orang busikan ke tujuh kabupaten, Sumber: Dinas Dikbud Kalbar

Unas SMP



Seorang bocah menunggu orangtuanya yang sedang mencari sisa barang yang punyai nilai ekonomi di TPA Batu Layang Jalan Kebangkitan Nasional.


Belum Ada Pendaftar KENDATI menyisakan tiga hari lagi, hingga Jumat (19/4) belum satupun partai politik yang memasukan berkas calon anggota DRPD Kalbar. Berbeda dengan Dewan Perwakilan Daerah (DPD) yang hingga kemarin, sudah empat calon memasukan berkas pendaftaran. “Untuk DPRD Kalbar belum ada satupun yang mendaftar, sementara DPD sudah empat orang. Kebanyakan mereka masih konsultasi mengenai pengajuan berkas persyaratan,” ungkap Umi Rifdiawaty, anggota KPU Kalbar kepada Pontianak Post kemarin. Keempat calon anggota DPD yang mendaftar tersebut, ungkap Umi, yakni: Agus Hendro Prayitno, Usmandi, Sakpin P dan Petrus SA. Kemungkinan, ungkap Umi, jumlah pendaftar DPD akan bertambah pada akhir pendaftaran 22 April mendatang. Beberapa anggota Umi Rifdiawaty DPD lama yang kemungkinan akan kembali maju bersaing yakni, Ishaq Saleh dan Maria Goretti. Dia mengungkapkan, untuk syarat berkas calon anggota DPD, sedikitnya mengantongi dukungan minimal 3.000 suara yang dibuktikan dengan fotokopi KTP. Dukungan tersebut tersebar paling sedikit 50 persen kabupaten/ kota se-Kalbar. “Artinya dukungan itu harus berasal dari tujuh kabupaten,” ujar dia. • ke halaman 15 kolom 2

• ke halaman 15 kolom 2

Dewan Kota Sampaikan 57 Rekomendasi PONTIANAK - Dewan Perwakilan Rakyat Daerah (DPRD) Kota Pontianak memberi 57 rekomendasi terhadap laporan keterangan pertanggungjawaban (LKPj) Wali Kota Pontianak tahun anggaran 2012, Jumat (19/4). Rekomendasi yang ditandatangani Ketua DPRD Kota Pontianak Hartono Azaz itu terbagi dalam enam bidang, pemerintahan dan otonomi daerah, pendidikan dan kes-

ehatan, pembangunan dan pariwisata, perekonomian dan perhubungan, dan bidang lingkungan hidup. Rekomendasi itu dibacakan Sekretaris DPRD Kota Pontianak Thomas. “Rekomendasi ini memuat catatan-catatan yang berisi saran, masukan dan koreksi penyelenggaraan pemerintahan. Sebagai bahan perbaikan penyelenggaraan pemerintahan ke depan,” ujarnya.

Rekomendasi tersebut antara tentang peningka- tan kesejahteraan guru, Gedung Kantor Camat Pontianak Kota, penataan Tugu Khatulistiwa, lalu lintas di Jembatan Kapuas I dan pemerataan pembangunan. Usai paripurna, Wali Kota Pontianak Sutarmidji menga-

takan, pada prinsipnya rekomendasi yang disampaikan sudah dilaksanakan, namun memang ada yang perlu peningkatan. “Misalnya taman di Pontianak Timur. Kita memang tengah cari lahannya, di mana,” katanya. Terhadap Gedung Kantor Camat Pontianak Kota

Gadis Bawah Umur Digilir Dua Remaja PONTIANAK - Aksi kekerasan seksual terhadap anak di bawah umur kembali terjadi. Kali ini menimpa remaja umur 15 tahun ini digilir dua remaja di tepi Jalan Parit Lintang Desa Punggur Besar, Jumat (19/4). Kejadian tragis yang menimpa gadis desa ini berawal dari Ad yang meminta nomor telepon genggam milik korban pada Selasa (16/4). Berawal dari tukar nomor handphone itu keduanya saling kenal satu sama lain. Pada Rabu (17/4) sekitar pukul 08.00, Ad dan temannya Tm mengajak korban bertemu yang tak jauh dari rumah korban. Tanpa curiga, korban mengiyakan ajakan kedua remaja terse-

yang dianggap sudah tidak layak, Sutarmidji memaparkan, Pemkot merencanakan kantor camat pindah di Kantor Lurah Sungai Bangkong saat ini. Sedangkan Kantor Lurah Sungai Bangkong menempati arena silat di Jalan Putri Candramidi. “Nanti kantor camat yang sekarang digunakan untuk perluasan Puskesmas Alianyang,” paparnya. • ke halaman 15 kolom 2

Kemenag Seleksi Petugas Haji

but. Saat menemui Ad, korban menggunakan sepeda motor sendiri. Setelahbertemu,Ad langsungmeminta korbanuntukberboncengan dengannya, yakni menggunakan sepeda motor Ad, sedangkan sepeda motor korban dikendarai Tm.

PONTIANAK – Sampai saat ini kuota haji untuk Kota Pontianak dan daerah lainnya belum dapat angka pasti. Kepala Kantor Kementrian Agama Kota Pontianak, Andi Jafar mengatakan, pihaknya masih menunggu keputusan Gubernur Kalbar. “Kota haji masih menunggu, keputusan akhir ada pada gubernur,” ujarnya, Jumat (19/4). Kemungkinan kuota haji untuk Kota Pontianak berkurang. Hal itu dikarenakan ada penambahan kuota bagi daerah lain di Kalbar.

• ke hal.15 kolom 2

• ke halaman 15 kolom 2





Kunjungan Ketua Mahkamah Konstitusi Ke Pontianak Post

Meski Orang Kalbar, Saya Harus Bersikap Independen Ketua Mahkamah Konstitusi Akil Mochtar berkunjung ke Redaksi Pontianak Post, Jumat (19/4) sore. Selama satu jam, pria kelahiran Putussibau, 18 Oktober 1960 itu, banyak bercerita mengenai pengalamannya selama bertugas sebagai hakim konstitusi. HERIYANTO, Pontianak DISKUSI di ruang Redaksi Pontianak Post berlangsung dengan santai. Suasana diskusi malah seperti temu kangen antara Akil Mochtar dengan para wartawan dan redaktur Pontianak Post yang pernah mengenalnya








Ketua MK Akil Mochtar saat berkunjung ke Graha Pena Pontianak Post.

secara dekat. Ya, maklum saja, sebelum menjadi Ketua Mahkamah Konstitusi, Akil pernah malang melintang di berbagai bidang di Kalbar. Dia pernah menjadi pengacara, anggota DPR, bahkan pernah juga mencalonkan diri pada pemilihan Gubernur Kalbar tahun 2007. Saat itu Akil belum berkesempatan memimpin Kalbar karena kalah suara dari pesaingnya. Gagal menjabat sebagai kepala daerah tidak menghentikan langkah pria asal Kapuas Hulu itu. Kiprahnya selanjutnya tidak di Kalbar, melainkan di ibu kota Jakarta. Akil kemudian terpilih sebagai salah satu hakim konstitusi. Selama beberapa tahun dia membaktikan diri sebagai pengadil konstitusi itu di Jakarta. • ke halaman 15 kolom 5



Pontianak Post l Sabtu 20 April 2013

Miras Dominan Picu Kriminal


Jangan Apatis KAPOLDA apolda Kalbar Brigjen Pol Tugas Dwi Apriyanto meminta kepada seluruh jajaran tidak menjadi polisi yang apatis. Namun senantiasa proaktif terhadap permasalahan keamananan dan ketertiban di tengah masyarakat. “Kami minta dengan anggota Polres dan Polsek, agar proaktif untuk mengawasi lingkungan dari kejahatan. Antara lain masalah curas, curat dan curanmor,” kata Kapolda Tugas Dwi Apriyanto di sela memimpin Rapat Kerja Teknis di Gedung Graha Khatulistiwa Polda Kalbar, kemarin (17/4). Dia menegaskan, kepolisian harus tetap menjaga kambtibmas di lingkungan tugasnya. Sebab, tidak lama lagi akan dilaksanakan pilkada. Sehingga menuntut kesigapan aparat kepolisian agar kambtibmas tetap terpelihara. ”Pilkada berkaitan dengan masalah politik, yang rawan menimbulkan kesalahpamanan dan berpengaruh terhadap orang banyak. Jadi diminta kepada semua anggota supaya mampu berperan dan mengontrol persoalan,” ujarnya. Evaluasi terhadap anggota yang bertugas di lapangan juga perlu dilakukan. Itu dilakukan, demi memperbaiki kinerja dan pelayanan terhadap masyarakat. “Kita sangat diuji dan selalu disuguhkan dengan pemberitaan terkait kepolisian. Positif maupun negatif tetap kita jadikan pelajaran,” timpalnya. Dia meminta, kepada seluruh anggota agar dapat menyikapi permasalahan dengan cara tidak emosi. Karena dapat menimbulkan dampak negatif dari masyarakat. Tentunya, harus tetap arif menangani permasalahan di lapangan, supaya mendapat simpati masyarakat. Kemudian, personil dituntun untuk bermitra denganmasyarakat.Supayasetiapmasalahmampu tertuntaskan dan mendapat dukungan dari semua kalangan.“Kepolisianpenting melakukanpendekatan dengan masayarakat. Begitu juga ada yang namannya Polisi RW, harus berperan menangani permasalahan tersebut,” pungkasnya. (rmn)


Digandrungi Pemuda MESKI telah terkontaminasi dengan kreasi, seni budaya asli baik tarian maupun seni rupa sudah digandrungi oleh pemuda. Sehingga keterlibatan mereka dalam berkesenian merupakan salah satu indikasi pengenalan dan menumbuhkan kecintaan terhadap budaya. “Saya pikir tidak masalah, yang penting mereka mengenal kesenian budaya dulu, karena generasi muda sekarang masih menganggap hal tersebut sebagai hiburan, karena ini merupakan pengaruh perkembangan zaman,” ungkap Joseph Odillo Oendoen, Ketua Sekretariat Bersama Kesenian Dayak Kalbar. Menurut dia, dengan kepedulian tersebut, akan menjadi jalan bagi generasi muda mengenal budaya aslinya. Meskipun dalam beberapa sanggar kesenian di Kota Pontianak, sudah mengkreasikan kesenian tersebut. Karena hal terpenting bisa dipertanggungjawabkan. Sebab kreativitas berangkat dari tradisi. “Kalau untuk budaya yang sebenarnya akan kita perkenalkan, terutama di beberapa sanggar rumah betang kalau kita lihat banyak kaum mudayangterlibatdalamtarikreasi.Kalaudidaerah mungkinmasihbanyaktarianasliyangditampilkan, namun selama itu tidak keluar dari koridor budaya maka sah saja,” jelasnya. (wah)


PERAWATAN : Beberapa pekerja sedang mengecat pembatas jalan Sultan Syarif Abdurrahman, Jumat (19/04). Perawatan

terus dilakukan dari dinas terkait.

Dies Natalis ke-26 Polnep Dibuka

Pagi ini, Jalan Sehat Civitas Akademika RANGKAIAN kegiatan Dies Natalis ke-26 Politeknik Negeri Pontianak diawali gerak jalan sehat seluruh civitas akademika yang akan dibuka Wali Kota Pontianak Sutarmidji SH MHum, pagi ini (20/4). Rombongan dilepas dari depan gerbang Polnep menuju depan taspen, lalu berbali ke arah kantor Gubernur Kalimantan Barat dan akhirnya kembali ke Polnep. Dies Natalis kali ini mengusung tema ‘Becoming Campus with Excellent Service’. “Kami ingin tema kali ini tidak sekedar gagah-gagahan. Harus ada wujud nyatanya. Kembali ke basic, sebagai aparatur pemerintahan, kami harus memberikan servis terbaik pertama kali untuk para mahasiswa. Memberikan mereka pelajaran yang baik dan produktif, supaya mereka menjadi mahasiswa produktif dan berkualitas tinggi,” jelas Mahyus SPd SE MM, direktur Polnep pada Pontianak Post, kemarin (19/4). Polnep adalah terminal terakhir, buka antara atau pertama, karenanya terkait hasil produktif, proses yang menyertainya pun harus produktif. Pelayanan terbaik tidak hanya bagi mahasiswa, tapi juga orangtua mereka. Meski terbilang dewasa, banyak kasus terjadi pada mahasiswa karena kurangnya sinergi dengan orangtua, seperti drop out. “Mereka tahu, anaknya setiap hari ke kampus, ternyata tidak, setelah akan dinyatakan drop out, mereka terkejut dan protes,” ujarnya. Ia berharap, dalam usia 26 tahun,

Mahyus SPd SE MM

Polnep bisa menciptakan sinergi yang baik pada semua pihak, mulai dari mahasiswa, orangtua mahasiswa, hingga para dosen dan staf. “Mereka anak bangsa, kita pasti digantikan mereka suatu saat. Pelayanan terbaik bukan hanya untuk meningkatkan akademik, tapi juga kompetensi moral dan sosial,” katanya. Aspek lain, mahasiswa harus optimis dalam menghadapi dunia kerja kelak.

Daya juang mereka harus kuat. “Hidup serba mudah saat ini dengan bantuan teknologi mengurani daya juang anak muda. Padahal teknologi ini pisau bermata dua,” ujarnya. Siaran televisi pun dinilainya banyak yang merusak moral anak muda, terutama mahasiswa. Mereka tidak melihat happy ending dari suatu sinetron, tapi meniru prosesnya, bagaimana seorang anak melawan orangtua, guru, atau bahkan dosen. “Gaya hedonis juga banyak ditayangkan, ini berbahaya bagi kehidupan anak bangsa,” tegasnya. Hj Utin Nina Hermina SE MSi, pembantu Direktur IV Polnep menambahkan, sebagai lembaga pendidikan vokasi yang mencetak lulusan siap pakai, Polnep terus meningkatkan pelayanannya. “Kita sudah lebih dewasa di usia 26 tahun ini, karenanya harus bisa lebih berperan dalam masyarakat,” ujarnya. Penanggungjawab Dies Natalis ke-26 Polnep ini menyampaikan, jalan sehat bakal diikuti 700-an civitas akademika. “Kami menyiapkan banyak doorprize, seperti mulai dari lemari es hingga voucher belanja. Kami ingin jalan sehat ini makin mempererat hubungan kekeluargaan seluruh civitas akademika,” katanya. Jalan sehat akan dilanjutkan berbagai lomba, seperti memancing, gaplek, dan kompetisi olahraga eksternal. “2014, Polnep dipercaya jadi tuan rumah porseni, dies ini sekalian cari bibit unggul,” pungkasnya. (d1/ser)

PONTIANAK—Sepanjang 2012 hingga April 2013, tindak kejahatan di wilayah hukum Pontianak Barat kian meningkat. Seperti penganiayaan, pengeroyokan serta kekerasan dalam rumah tangga semakin mendominasi. Seperti dikatakan Kapolsek Pontianak Barat, Komisaris M. Roni, semua kriminalitas terjadi mayoritas dari faktor minuman keras. “Setiap kali menangani kasus perkelahian dan penganiayaan,pasti pelakunya dipengaruhi minuman keras,” katanya kepada Pontianak Post, kemarin. Dia mengungkapkan, pelaku yang terpegaruh miras tersebut cenderung berpola pikir tidak sehat dan seringkali sensitif. Sedikit saja tersinggung, mereka bisa membuat keributan maupun kerusuhan di lingkungan masyarakat.Kepolisian Sektor Pontianak Barat sendiri mencatat, sepanjang tahun 2012 telah dilaporkan sebanyak 522 kasus dari berbagai jenis tindak kejahatan di wilayah hukumnya. Didominasi antara lain, 118 tindak kejahatan pencurian biasa, 89 kasus tindak pencurian dengan kekerasan, 78 kasus penganiayaan ringan, 50 kasus curanmor, 31 kasus penggelapan, 29 kasus pengroyokan serta 19 kasus Kekerasan Dalam Rumah Tangga. Sementara untuk tahun 2013, masih dirincikan. “Dari jumlah kasus yang dilaporkan tersebut, kami berhasil menyelesaikan 243 kasus,” paparnya. Kini, kata dia, personil telah diterjunkan di daerah rawan konflik. Seperti beberapa waktu lalu, pihaknya menyisir dan berhasil mengamankan puluhan preman yang sering meresahkan masyarakat sekitar. Sampai saat ini, petugas semakin giat melakukan patroli untuk menekan aksi kriminalitas di sana. Sementara latar belakang yang disebabkan dari tindak pidana itu, kata Kapolsek, selain pengaruh minuman keras, banyak diantara tersangka mengaku terdesak kebutuhan ekonomi. Mereka tidak mempunyai pekerjaan tetap, hingga kemudian rela melakukan hal kriminalitas tanpa memikirkan sebab akibatnya. Tindakan ini dilaksanakan sesuai perintah Kapolda Kalbar Brigjen Pol Tugas Dwi Apriyanto yang berkomitmen penuh memberantas segala bentuk tindak kejahatan. Termasuk peredaran miras yang meresahkan masyarakat Kalbar. Sekaligus mengingatkan seluruh jajaran untuk berperan maksimal membasmi para pemasok miras oplosan. Menurut Kabid Humas Polda Kalbar, AKBP Mukson Munandar, pihaknya akan bersikap tegas terhadap setiap tindak kejahatan konvensional. Sekaligus menaruh perhatian serius dalam penanganannya. Apalagi secara geografis Kalbar amat rentan menjadi perlintasan tindak pidana ilegal karena berbatasan langsung dengan negara tetangga, Malaysia. “Kita akan terus lakukan razia, terutama di wilayah hukum Polres dan Polsek se-Kalbar untuk menekan segala bentuk peredaran barang ilegal,” pungkasnya. (rmn)

Pontianak Post •

Halo publik

Sabtu 20 April 2013


Klarifikasi Pernyataan XF-Asali TERKAIT pernyataan Bapak XF-Asali yang termuat di Pontianak Post kemarin tanggal 18 April halaman 15 kolom 4 soal usaha bunuh diri Sdr.Akhiang dari sudut pandang agama, dinyatakan bahwa Agama Buddha memperbolehkan bunuh diri dan justru itu adalah pencapaian pembebasan sempurna. Hal ini adalah tidak benar sama sekali dan justru bertentangan dengan ajaran Buddha, karena bila hal ini benar, maka sedari dulu setiap hari akan kita saksikan Umat Buddha beramairamai Berbunuh Diri sebagai usaha Mencapai Pembebasan Sempurna. Sangat disayangkan pernyataan Bapak XF-Asali selaku


seorang non Buddhis menyampaikan dogma Buddhisme yang menyesatkan masyarakat. Oleh karena itu, perlu Kami selaku Pengurus WALUBI Kalbar untuk meluruskan Pandangan Buddhisme yang benar terhadap masalah Bunuh Diri agar tidak menyesatkan masyarakat dikemudian hari. Dalam salah satu bagian Sila Buddha yaitu Pancasila Buddhis (Lima Pantangan) diterangkan bahwa bunuh diri termasuk pelanggaran sila pertama yaitu membunuh. Jadi, di dalam Pancasila Buddhis, sasaran pembunuhan makhluk hidup itu selain makhluk hidup lain juga termasuk diri sendiri. Oleh karena itu bunuh

diri termasuk pelanggaran sila pertama, di mana pelakunya akan terlahir kembali di alam yang rendah sebagaimana yang tertulis dalam Jataka Atthakatha: “makhluk yang bunuh diri dengan senjata, minum racun, gantung leher, terjun ke tebing dengan didasari kemarahan, akan terlahir di alam neraka dan alam rendah lainnya.” Dari kutipan tersebut dapat dijelaskan bahwa karma ditentukan oleh niat. Orang yang bunuh diri umumnya karena kebencian dan tidak tahan karena menghadapi penderitaan hidup, kecewa dan frustasi. Hal ini akan membuatnya lahir kembali di alam rendah. Jangankan melakukan upaya

bunuh diri, bahkan “berpikir” untuk melukai diri sendiri sudah merupakan perbuatan Karma. Perbuatan apapun yang melalui ucapan, pikiran maupun jasmani  yang membangkitkan keserakahan (lobha), kebencian (dosa) dan kebodohan batin (moha); semuanya merupakan sebab karma buruk. Tentu dalam hal ini, Agama Buddha tidak dapat membenarkan upaya bunuh diri karena memang bertentangan dengan Buddhisme. Sang Buddha membabarkan: “Sangatlah sulit untuk dapat dilahirkan sebagai manusia, sungguh sulit kehidupan manusia, terlebih lagi untuk dapat mendengarkan ajaran Suci Sang Buddha, begitu

pula, sungguh sulit munculnya Seorang Buddha di dunia ini.’ (Dhammapada 182). Dengan demikian Bunuh diri sama saja menyia-nyiakan kesempatan yang sangat langka yaitu terlahir sebagai manusia. Maka sungguh menyedihkan apabila kehidupan yang berharga ini harus diakhiri dengan Bunuh Diri. Demikian sekilas Pandangan Agama Buddha terhadap masalah Bunuh Diri, semoga memberi wawasan dan manfaat bagi kita semua. NAMMOBUDDHAYA Perwakilan Umat Buddha Indonesia (Walubi) Kalimantan Barat


Buddha Tak Pernah Ajarkan Bunuh Diri KAMI Keluarga Besar Mahasiswa Buddhis (KBMB) Universitas Tanjungpura dengan ini menyatakan keberatan atas pernyataaan Bapak XF-Asali yang termuat di Pontianak Post, Kamis (18 April 2013), halaman 15 kolom 2 soal usaha bunuh diri Sdr Akhiang dari sudut pandang agama. Dinyatakan bahwa Agama Buddha memperbolehkan bunuh diri, karena bunuh diri merupakan pencapaian pembebasan sempurna. Buddha tidak pernah mengajarkan umatnya bunuh diri untuk pembebasan sempur-

na. Dalam Pancasila Buddhis diterangkan bahwa bunuh diri termasuk pelanggaran sila pertama yaitu membunuh, di mana pelakunya akan terlahir kembali di alam yang rendah sebagaimana yang tertulis dalam Jataka Atthakatha (makhluk yang bunuh diri dengan senjata, minum racun, gantung leher, terjun ke tebing dengan didasari kemarahan, akan terlahir di alam neraka dan alam rendah lainnya). Sang Buddha juga pernah bersabda: “Sangatlah sulit untuk dapat dilahirkan sebagai manusia, sungguh sulit

kehidupan manusia, terlebih lagi untuk dapat mendengarkan ajaran Suci Sang Buddha, begitu pula, sungguh sulit munculnya Seorang Buddha di dunia ini.” (Dhammapada 182). Hal ini diumpamakan sebagai “Seekor kura-kura buta yang naik ke permukaan lautan untuk membuang dan menarik nafas setiap 100 tahun sekali. Di periode yang sama, dilemparkan sebuah gelang ke lautan tersebut secara acak. Peluang terlahir sebagai manusia sebesar peluang kepala kura-kura buta itu

masuk kedalam gelang.“ Dengan demikian bunuh diri sama saja menyia-nyiakan kesempatan yang sangat langka yaitu terlahir sebagai manusia. Maka sungguh menyedihkan apabila kehidupan yang berharga ini hancur dengan cara bunuh diri. Oleh karena itu kami mohon Bapak XF-Asali untuk mengklarifikasi pernyataannya. Karena pernyataan ini sungguh keliru dan menyesatkan. Terima kasih atas dimuat surat ini. Calvin Ketua KBMB Untan.

Telum Jadi Ruang Charger HP PERKEMBANGAN ponsel kian tak terbendung. Dengan kenyataan seperti itu, banyak pengusaha wartel atau warung telepon yang gulung tikar dan menutup usaha masing-masing. Tak terkecuali dengan sudah banyaknya telepon umum (telum) koin di pinggir jalan di berbagai sudut kota yang tak terpakai. Sungguh sayang memang, tapi apa boleh buat. Sebaiknya pemerintah, dalam hal ini instansi terkait, bisa mengganti telum yang usang itu dengan ruang charger ponsel atau laptop. Hal itu akan lebih bermanfaat untuk

masyarakat saat ini. Sebab, setiap orang sekarang sudah memiliki ponsel. Ruang charger HP itu bisa dikondisikan hampir mirip dengan cara kerja telum. Yakni, dengan pengguna memasukkan koin, otomatis listrik masuk ke HP dalam durasi tertentu. Alat seperti itu sudah bisa diciptakan anak negeri, yang beberapa waktu lalu diujicobakan untuk pengisian listrik kendaraan motor listrik di beberapa tempat di ibu kota Jakarta. Zahara Ayu

Pembersihan Sampah di Parit Sebagai bagian dari warga Kota Pontianak kami menyadari bahwa, kebersihan lingkungan memang sangat kita dambakan agar lingkungn tempat tinggal kita tidak mudah terserang berbagai macam penyakit. Sampah-sampah yang ada memenuhi parit primer maupun skunder yang ada di Kota Pontianak ini, tidak sepenuhnya dari pembuangan warga masyarakat, melainkan adalah droppingan dari sungai Kapuas maupun Sungai Landak, yang masuk melalui saluran parit yang ada. Sehingga, pada saat air turun, sampah tertahan karena parit mulai banyak ditumbuhi rumput. khusus untuk sampah yang berada di darat, saat ini memang kelihatan penanganannya oleh DKP terbilang cukup baik dan tinggal penyempurnaannya saja. Apalagi, konon katanya tahun lalu saja dana yang dianggarkan untuk menangani sampah yang ada di darat khususnya di TPS-TPS, berkisar 17 hingga 18 miliar setahun yang seyogyanya itu sangat mendukung untuk pembersihan. Kecuali Dinas PU sub SDA Kota Pontianak yang katanya, hanya berkisar 3 miliar setahun tentunya, anggaran sebesar itu diprediksikan belumlah cukup untuk menangani sampah-sampah yang ada di aluran maupun dalam parit primer, maupun skunder. Bukan itu saja, pembersihan sampah-







sampah dalam parit hingga pengerukan menggunakan equipment berat, sepertinya relatif kecil kalau pagu dananya hanya sebesar itu karena hamparan parit maupun drainase se-kota Pontianak ini dalam hitungan kilo meter, mungkin ratusan kilo meter panjangnya. Berangkat dari itulah, kebersihan parit maupun lingkungan tidak menjadi kewajiban masyarakat saja, melainkan kewajiban Dinas terkait pun, tak boleh ketinggalan. (081258329218)


Liputan khusus


Pontianak Post


Lagi, HPI-Agro Lakukan Aksi Peduli Kesehatan

Foto bersama karyawan HPI-Agro dan panitia pelaksana usai kegiatan pemeriksaan kesehatan dan pengobatan gratis digelar di Dusun Kumpang Tengah, Kamis (18/4) kemarin.

Layani Warga dari 20 Dusun, Ratusan Warga Ikuti Pengobatan Gratis

HPI-Agro kembali memperlihatkan kepedulian terhadap warga lingkar kebunnya. Kali ini kelompok usaha perkebunan sawit yang beroperasi di Kabupaten Pontianak dan Kabupaten Landak itu, bekerjasama dengan Dinas Kesehatan Kabupaten Landak sukses melaksanakan pemeriksaan kesehatan dan pengobatan gratis kepada sejumlah warga di dua lokasi kebunnya yang b e roperasi di Kabupaten Landak. Tidak kurang sebanyak 21 orang tenaga medis terdiri dari dokter dan perawat yang disediakan oleh Dinas Kesehatan Kabupaten Landak melakukan pemeriksaan kesehatan dan pengobatan gratis kepada ratusan warga dari 15 Dusun yang terletak di Desa Ambarang, Kecamatan Ngabang, Kabupaten Landak. “Berbeda dengan kegiatan yang sama sebelumnya di tahun lalu, kali ini kami menyiapkan dokter dan obat-obatan jauh lebih banyak untuk melayani 900 warga yang berasal dari sekitar kebun kami,” ujar Gloria G. Manalu, Corporate Social Responsibility Manager HPI-Agro, yang menjadi ketua pelaksanaan kegiatan tersebut. Gloria mengungkapkan, pelaksanaan pengobatan gratis ini dilakukan di 3 titik lokasi terpisah pada Rabu, (17/4) April 2013. Hal ini dilakukan guna memudahkan warga yang mungkin datang dari lokasi yang jauh dan untuk berjalannya program ini dengan lebih tertib dan aman. Selain itu, kata Gloria, pada hari Kamis, (18/4) April terpusat di Desa Kumpang Tengah. HPI -Agro bersama Dinas Kesehatan juga melaksanakan kegiatan serupa dengan target 245 warga dari 5 dusun di Desa Kumpang Tengah. “Puji Tuhan, kami bersyukur bahwa tahun ini target warga yang mengikuti pemeriksaan kesehatan dan pengobatan gratis dapat tercapai sepenuhnya. Ini bukti nyata kepedulian HPI-Agro akan kesehatan masyarakat lingkar kebun sesuai dengan prinsip usaha HPI-Agro yang sustainable atau berkelanjutan,” tutur Gloria kepada Pontianak Post “Terkait prinsip berkelanjutan ini, HPI-Agro ingin dapat memberikan manfaat langsung bagi masyarakat setempat, dan pelaksanaan kegiatan ini hanyalah salah satu program CSR kami sebagai bentuk partisipasi perusahaan dalam rangka meningkatkan taraf kesehatan masyarakat secara merata,” terangnya. Sementara itu, Sidarsono, selaku salah satu pimpinan kebun bidang humas menuturkan, kegiatan ini merupakan salah satu wujud perhatian HPI-Agro terhadap masyarakat lingkar kebunnya dengan mengusung prinsip bermitra dan tumbuh bersama masyarakat. “Warga lingkar kebun menyambut sangat baik acara ini dari mulai awal kita mensosialisasikan rencana ini kepada mereka dan mereka sangat senang dengan pemeriksaan kesehatan dan pengobatan gratis ini,” ujarnya Di tempat yang terpisah Kamis (18/04), di Dusun Kumpang Tengah Ernestus Benny, pimpinan kebun bagian Humas di Kebun Sengah Temila mengatakan, antusias masyarakat sangat positif akan kegiatan ini. “Mereka dalam hal ini kepala desa, ketua adat dan para tokoh masyarakat yang ada semuanya turut ambil bagian dalam kepanitiaan membantu mensukseskan berlangsungnya acara ini,”ujar Benny. Ia menambahkan, program CSR yang dilaksanakan HPI-Agro sudah sangat berhasil, hal ini dikarenakan pelaksanaan program CSRnya termasuk pelaksanaan program Pemeriksaan Kesehatan dan Pengobatan Gratis ini dilakukan secara bersama-sama dengan melibatkan masyarakat setempat (**) NARASI : Andreas & Gloria G. Manalu FOTO : Gloria G. Manalu

Warga masyarakat beramai-ramai datang memenuhi tempat kegiatan sesuai dengan yang sudah diaturkan di salah satu lokasi pelaksanaan.

Anak Digelar Minggu, 28 April 2013

KELUARGA adalah harta yang paling berharga. Jika salah seorang anggota keluarga sakit, kebahagiaan keluarga akan terganggu. Setiap anggota keluarga berbeda usia maupun jenis kelaminnya, sehingga

Para Lansia juga turut hadir untuk memeriksakan kesehatan dan mendapatkan pengobatan gratis dari kegiatan yang digelar oleh HPI-Agro

Tim medis memberikan arahan pada saat memberikan obat kepada peserta sesuai dosis yang telah dianjurkan dokter.

memiliki risiko kesehatan dan kebutuhan pemeriksaan laboratorium yang berbeda. Wanita, khususnya ibu, memegang peranan penting, karena ia biasanya mempunyai perhatian lebih besar terhadap kesehatan dan kondisi kesehatan anggota keluarganya. Sadar akan pentingnya kesehatan keluarga dan keinginan untuk menjaga anggota keluarga agar tetap sehat, Laboratorium Klinik Prodia sebagai Laboratorium Klinik terdepan dalam bidang ilmu pengetahuan dan teknologi, memperkenalkan serangkaian pemeriksaan yang disebut Panel Kesehatan Keluarga sesuai dengan usia/perkembangan dan risiko kesehatannya. Kesadaran orangtua untuk melakukan pemeriksaan kesehatan dan skrining penyakit pada anak masih sangat rendah. Padahal, medical check-up untuk anak sejak dilahirkan meskipun mereka tidak sakit, tak kalah penting dengan pemeriksaan pada orang dewasa untuk memastikan anak tumbuh dan berkembang dengan baik, karena anak yang sehat adalah cerminan pada akhirnya mereka akan menjadi dewasa yang sehat. Selain pemeriksaan fisik, pemeriksaan mata, telinga dan mulut, serta pemeriksaan perkembangan lainnya, diperlukan juga beberapa pemeriksaan laboratorium untuk penunjang status kesehatan anak. Untuk membahas lebih lanjut mengenai Kesehatan Anak terkait Tumbuh Kembang Anak, Laboratorium Klinik Prodia menggelar Seminar Nasional Awam pada hari Minggu, 28 April 2013 jam 09.00-12.00 WIB di Hotel Mercure. Pembicara antara lain: dr.James A.Sinaga Sp.A (Pontianak), Yulia E.Tasbita, Psikolog (Pontianak) dan Hera Yuliana I,M.Kes (Jakarta). Biaya registrasi: 100 ribu/ orang, pasangan: 150 ribu. Ikuti juga lomba mewarnai untuk anak usia 5-7 tahun dan dapatkan hadiah menarik. Pendaftaran via http://www.prodiakalimantan. com/event.html atau di Prodia Pontianak 0561-736177/ Reni 085246599922.(d2/biz)

Ingin Kaya Raya & Bahagia Semudah Tersenyum Dengan Seminar OABSN (Garansi 100 %) Bongkar Rahasia Orang Kaya Makin Kaya

Mr Yan (Pelatih OABSN)

TAHUKAH Anda, bahwa hanya 10 persen manusia yang sering menggunakan alam bawah sadar dan terbukti, mereka orang-orang terkaya di dunia dan bahagia. Ternyata alam bawah sadar, juga berkekuatan 10 kali lipat dari pikiran sadar kita. Pikiran bawah sadar mampu mempengaruhi kehidupan atau kesuksesan seseorang sebesar 88 persen dan 12 persennya, dipengaruhi otak sadarnya. Namun, sayang potensi luar biasa ini baru kita ketahui sekarang. Untuk itu, kami mengajak Anda berinvestasi ilmu cara privat mengaktifkan pikiran bawah sadar, sehingga apa yang kita inginkan akan segera terwujud. Manfaat bagi peserta dalam acara ini: pertama, bisa mengaktifkan kekuatan raksasa dalam tubuh (alam bawah sadar, sehingga kesuksesan mengejar Anda). Kedua, mempertajam intuisi, sehingga bisinis menjadi lancar. Ketiga,

Twitter Luncurkan Layanan Musik TWITTER secara resmi meluncurkan layanan musik. Layanan ini memberikan kesempatan setiap pengguna twitter, merekomendasikan lagu-lagu melalui tweet. Langkah ini memungkinkan setiap orang untuk berbagi sampel dan mendengar lagu yang mungkin mereka sukai. “Kami merilis Twitter #musik, sebuah layanan baru yang akan mengubah cara orang menemukan musik yang disukai, berdasarkan

Twitter,” kata perusahaan bersimbol burung yang berbasis di San Francisco dalam rilisnya, dikutip laman Channelnewsasia, kemarin. “Aplikasi ini menggunakan aktivitas Twitter, sehingga kita tahu lagu yang paling populer dan artis-artis pendatang baru,” lanjut Twitter. “Hal ini membawa seniman musik langsung beraktivitas dengan Twitter . Selain itu tentu saja, anda dapat mentweet lagu langsung dari aplikasi.”

Ratusan warga yang berasal dari 5 dusun di desa Kumpang Tengah sangat antusias mendaftar untuk mengikuti pemeriksaan kesehatan dan pengobatan gratis.

Seorang balita sedang diperiksa oleh Dokter yang sudah berpengalaman yang dipersiapkan oleh DinKes Kabupaten Landak

Laboratorium Klinik Prodia Gelar Seminar Nasional Awam Mengangkat Tema: Tumbuh Kembang

20 April 2013

Pengguna Twitter bisa mendapatkan sampel dari setiap lagu selama 30 detik. Dapat diakses melaui iTunes, Spotify atau Rdio (stasiun layanan musik), tetapi tidak tersedia di iTunes, toko online Apple. “Jadi, jika Anda tertarik pada lagu-lagu yang telah di tweeted oleh seniman dan orang-orang yang Anda ikuti di Twitter, Anda dapat menavigasi ke #play (mainkan) untuk melihat dan mendengarkan

lagu-lagu tersebut,” jelas Twitter. Menurut Rdio, aplikasi Twitter Music hanya untuk web browser internet dan perangkat ponsel lain, seperti Apple. Aplikasi ini membiarkan orang melihat lagu apa yang sedang populer dan mendapatkan rekomendasi berdasarkan selera. “Kami senang menjadi bagian dari Twitter Music, ini pengalaman baru dan penemuan baru untuk musik,” ucap Rdio dalam rilisnya. (nam/jpnn)

menarik orang lain mulai dari klien, investor, mitra bisnis, calon pasangan hidup. Keempat, menghindari penipuan dalam berbagai hal. Kelima, membersihkan energi negatif dalam tubuh. Keenam, menjadikan anda lebih sabar dan bijak, sehingga kemudahan datang untuk anda. Ketujuh, kesembuhan dalam penyakit. Kedelapan, menurunkan gelombang otak agar doa anda cepat terkabul bisa untuk semua agama. Maka dari itu, bagi Anda yang ingin mendapatkan semua manfaat di atas, CV. Mega Jaya Group akan melaksanakan seminar Optimasi Alam Bawah Sadar Nasional (OABSN) di Wisma Nusantara, Jl. Letjen Suprapto No.14 Pontianak pada Sabtu, 27 April 2013, pukul 19.0022.00 WIB, dilanjutkan Minggu pukul 09.00-16.00. Dengan menghadirkan Trainer Nasional nomor wahid Mr.Yan, yang juga pengusaha properti di Jawa Timur. Kesaksian yang datang dari para peserta diantaranya: Dahsyat! Refleksi energi positif yang saya tebar seperti pelajaran tadi malam, habis subuh saya sempatkan afirmasi, Alhamdulillah separuh dagangan saya terjual habis, trims atas ilmunya Mr Ryan (Suhendra Jambi). Pada latihan hampir selesai saya dapat SMS dari orang

yang melarikan uang saya Rp150 juta, dia berjanji akan mengembalikan uangnya besok pagi. Sangat ajaib hampir-hampir saya tidak percaya dengan kejadian ini (Edi Medan). Ilmunya sangat paten berguna bagi saya dan keluarga, manajemen hati yang diajarkan membuat usaha saya kebanjiran order dan menjadi magnet uang (Moh Achir Padang) dan masih banyak kesaksian lain yang tidak memungkinkan untuk dicantumkan semua di sini. Contoh-contoh yang bisa kita praktikan dalam seminar ini, para peserta dapat melayang ketika konsentrasi penuh, ini membuktikan bahwa semua orang memiliki kemampuan luar biasa yang selama ini kita anggap mistis. Untuk itu, segera dapatkan tiket seminar Optimasi Alam Bawah Sadar seharga Rp75 ribu/orang, Rp100 ribu/2 orang atau Rp100 ribu/3 orang bagi para komunitas bisnis seperti EU, ESCO dll. Informasi lebih lanjut, cukup SMS, ketik: info (spasi) No.Hp (spasi) asal kota kirim ke 085232888876 (Hadi), atau dapat membeli tiket di resepsionis Wisma Nusantara. Maka kami akan menghubungi Anda! Buruan daftar kesempatan terbatas. Dijamin pasti bisa, garansi 100% uang kembali.(d3/biz)

Pontianak Post

komunikasi bisnis

Sabtu 20 April 2013

Kontes Safety Riding Bersama Paguyuban Honda West Borneo Community PT. Astra Motor sebagai produsen sepeda motor terbesar di Indonesia memiliki tanggung jawab yang besar, akan pentingnya keselamatan pengendara sepeda motor Honda dalam mengendarai motor Honda. Salah satunya rekan-rekan Community Motor Honda yang menjadi perhatian bagi Astra Motor dalam mensosialisasi kan penting nya Safety Riding. Pada 13 April 2013 kemarin, Astra Motor Pontianak melaksanakan kontes Safety Riding for Community yang bertujuan untuk memberikan pengetahuan kepada para anggota community motor Honda di Kalimantan Barat. Dalam kesempatan ini para anggota club motor Honda akan

mendapatkan materi terkait Safety Riding, serta tehnik berkendara yang benar dan tepat yang mengacu pada safety riding. Kontes Safety Riding ini diikuti oleh beberapa klub motor Honda yang ada di Pontianak maupun yang ada di kabupaten-kabupaten lain. Adapun Klub Motor Honda yang berpartisipasi dalam kontes ini adalah dari klub Motor Honda Tiger, Supra, Revo, CS1, Scoopy, Beat dan C70. Para peserta kontes begitu antusias dan semangat dalam mengikuti kontes ini, karena pemenang dari kontes ini akan dikirim untuk mengikuti Kontes Safety Riding tingkat Nasional di Kota Mataram. Sebelum memulai Kontes Safety

Riding para peserta diberikan materi terkait safety riding, dan setelah itu para peserta juga diberi arahan terkait tehnik mengendarai sepeda motor yang baik dan benar oleh Vazzil Saltiani, selaku Instruktur Safety Riding. Dalam kesempatan ini peserta juga diberikan kesempatan praktik langsung dalam mencoba tehnik-tehnik safety riding, dengan mengendarai motor baru Honda yang baru saja Launching pada Maret kemarin, yaitu Motor Honda CB150R yang tampilannya sporty dan gagah. Setelah pemberian materi dan praktik langsung dalam mengaplikasikan ilmu safety riding, maka selanjutnya para peserta akan melaksanakan kontes safety riding. Para peserta terlihat begitu bersemangat dalam menghadapi tiap rintangan yang akan mereka hadapi di kontes ini, karena mereka sangat berambisi agar bisa menjadi yang terbaik dan dapat menjadi utusan Astra Motor Pontianak dalam mengikuti Kontes Safety Riding tingkat Nasional di Mataram. Dan yang memiliki kesempatan serta pemenang dari kontes ini adalah Bro Bayu Ashariyadi (Klub Solusi) Supra Sintang dan Bro Aprifani (Klub Revo) Pontianak. Dari kedua pemenang ini akan dipilih satu untuk menjadi wakil Astra Motor Pontianak dalam Kontes Safety Riding tingkat Nasional. Semoga dengan diadakannya kegiatan ini, Safety riding di dalam komunitas motor Honda dapat diimplementasikan oleh para anggota komunitas motor Honda, sehingga tingkat kecelakaan di jalan raya pun dapat berkurang. Safety Riding Start From Me...!(e9/biz)

Hanya 600 Ribu Rupiah

Bawa Pulang Honda BeAT-FI MAU beli motor tapi bingung nih pilih yang mana? Langsung saja pilih Honda, karena sepeda motor Honda sudah terkenal dengan irit dan tangguhnya. ApalagiHondakiniadapenawaran harga spesial khusus di bulan Kartini. Program yang ini pasti pas untuk semua kalangan, dan pastinya menggemparkan semua orang. Kini, hanya dengan uang 600 ribu rupiah ditangan, Anda semua sudah bisa membeli sepeda motor Honda BeAT-FI. Promo “Honda Surprise”! Kapan lagi ada promo dahsyat seperti ini? Makanya buruan ke dealer-dealer Honda, karena promo ini sangat terbatas dan spesial. Promo ini berlaku khusus untuk Kota Pontianak saja. Bagi yang berada di luar kota jangan kecewa, karena Honda juga hadir dengan berbagai penawaran ringan lainnya. Untuk itu, bagi yang berada di luar Kota Pontianak, segera pastikan penawaran tersebut. Penawaran tersebut juga rahasia & spesial lhoo… Nah bagi yang di Kota Pontianak, untuk diketahui saja nih, promo dengan DP ringan sudah sangat jarang dilakukan apalagi sekarang hingga penawaran 600 ribu rupiah saja, makanya segera kejar program Honda BeAT-FI ini.

Program ini merupakan program terbatas, siapa yang cepat dia yang dapat duluan. Honda BeAT-FI hadir lebih unggul daripada matic sekelasnya, karena Honda BeAT-FI sudah dibekali dengan mesin injeksi 110 cc PGM-FI dengan fitu-fitur keamanan yang sekarang bahkan sudah mulai ditiru yang lain antara lain Honda Parking Brake Lock (Tuas pengunci rem), Side Stand switch (Saklar standar

samping), serta penutup kunci ganda. Honda BeaT-FI juga memiliki ketahanan terhadap banjir hingga ketinggian 30 cm. Keiritan Honda BeAT-FI juga sudah teruji hingga 90,32 km/liter untuk rekor keiritan baru. Adakah motor yang lain mencapai tingkat keiritan tersebut? Makanya pilih Honda BeAT-FI hanya dengan 600 ribu rupiah. Honda One Heart.(e9/biz)

BPW KKS Kalbar Segera Dilantik KERUKUNAN Keluarga Sulawesi Selatan (KKSS) Kalimantan Barat segera menggelar pelantikan Badan Pengurus Wilayah KKSS Kalbar, sekaligus pelantikan BPD KKSS Kota Pontianak dan Kabupaten Kayong Utara periode 2012-2017 pada 20 April mendatang di Hotel Mahkota Hotel Pontianak. Ketua Umum BPW KKSS Kalimantan Barat, Andi Bahrun Aswal mengatakan, sebelumnya pada Desember 2012 lalu telah terlipih H.A Kadir Ubbe sebagai ketua umum KKSS Kalbar, namun karena telah meninggal dunia, belum lama ini membuat KKSS Kalbar menggelar musyawarah wilayah untuk kembali mengadakan pemilihan ketua umum baru. “Semula saya sebagai ketua harian. Namun, setelah musyaawarah wilayah pada Februaari lalu, akhirnya saya terpilih sebagai ketua umum, Viryan Azis sebagai ketua harian,” jelasnya Jumat (19/4) kepada Pontianak Post. Dijelaskan Andi, pada Sabtu malam (20/4) mendatang, selain menggelar pengukuhan dan pelantikan pengurus, dalam kegiatan itu juga akan dilakukan launching buku ‘Manusia Bugis di Kalimantan Barat’, sekaligus pencanangan pembangunan rumah adat Sulawesi Selatan di Kalbar. Andi berharap dengan adanya rumah adat Sulawesi Selatan di Kalbar, bisa menjadi salah satu simbol bahwa hingga sekarang warga Sulawesi Selatan masih eksis dan manjadi bagian dari masyarakat



Kartini’s Weekend Day at Hotel Santika Pontianak

HARI Kartini adalah hari yang sangat bersejarah yang mampu menggoreskan ingatan kita terhadap Raden Ajeng Kartini, sehingga sangat sulit bahkan tidak bisa kita lupakan.

CIRI khas, kemanjuran dan keunggulan Sinshe Hongkong Pontianak sangat jelas. Dengan resep kuno kekaisaran, resep rahasia turun temurun serta herbal Tiongkok alami, intinya mengobati berbagai penyakit bandel yang susah disembuhkan, khusus menangani berbagai penyakit kronis, begitu diobati langsung dapat dirasakan manfaatnya. Efektif mengobati berbagai penyakit kronis sampai akarnya, tanpa efek samping, setelah diatasi tidak mudah kambuh kembali. Menurut survei terbaru, disfungsi seksual pria termasuk penyakit yang sangat banyak diderita. Terutama persentase penderita impotensi, ejakulasi dini, radang prostat mengalami kenaikan pesat, berdampak jauh lebih parah bagi psikologi dan jiwa, dibanding penyakit pria lainnya, juga merupakan 30% alasan retaknya keharmonisan rumah tangga, menghancurkan kepercayaan diri pria. Penyakit gangguan fungsi seksual menimpa pria pada berbagai kalangan usia dan harus diobati sedini mungkin, agar tidak memburuk hingga menimbulkan penyakit komplikasi bandel lainnya yang sangat parah dan berbahaya. Sinshe Hongkong Pontianak ada konsultan sinshe ahli herbal sinshe ternama dari Tiongkok yang siap membantu Anda. Melalui pengalaman kerja keras puluhan tahun akhirnya berhasil menemukan terobosan terbaru, khusus mengatasi disfungsi seksual pria seperti; impotensi, ejakulasi dini, radang prostat, sperma mati, tidak ada sperma, alat vital tidak normal, kemandulan dll. Hasilnya relatif cepat, aman, dan

Seperti yang kita ketahui, sosok Raden Ajeng Kartini atau yang biasa disebut RA Kartini ini adalah tokoh emansipasi wanita, yang memperjuangkan hak wanita dan meminta kesamaan antara hak wanita dan

pria. Sungguh luar biasa, dan untuk mengingat jasa pahlawan yang satu ini, maka setiap 21 April diperingatilah hari Kartini. Bertemakan “Kartini’s Weekend Day”, Hotel Santika Pontianak hadir dengan promo khusus di peringatan Hari Kartini pada 21 April tahun ini, dimulai dengan memberikan diskon kamar 50% dari harga publish untuk Personal Guest dan Walk in Guest yang check in di tanggal 20-21 April 2013. Bahkan hingga berwisata kuliner juga akan diberikan diskon spesial 20% untuk food and beverage Hotel Santika Pontianak yang terkenal dengan masakan tradisionalnya ini, dan makan malam bertemakan “Pincok Takir Jawa Tengah” hanya Rp79.000/person, all you can eat pukul 17.00-22.00 WIB di malam ke 21 di bulan April ini. Bagi Anda pecinta Spa, Hotel yang 11 Maret lalu baru saja berulang tahun ke-10 ini, memberikan promo “Buy 1 Get 1” khusus untuk Spa Package nya di tanggal 20-21 April 2013, dan bagi 21 konsumen pertama akan mendapatkan Goody Bag Spesial. Untuk informasi & Reservasi silakan hubungi kami di telepon (0561) 733 777. Atau datang langsung ke Hotel Santika Pontianak, Jl. Diponegoro No. 46, Pontianak.(e2/biz)


Solusi Tepat Terobosan Terbaru Atasi Segala Macam Penyakit Pria Pengobatan Sinshe Hongkong yang Manjur, Satusatunya di Pontianak

tanpa efek samping. Terobosan metode sinshe dengan herbal berharga alami yakni “Qiang Yang Bu Shen Liao Fa” ini dipadukan akupuntur elektroterapi sangat terkenal di beberapa negara, berfungsi memperkuat ginjal & sperma, menyeimbangan unsur yin & yang di dalam tubuh, setelah diatasi bisa menormalkan fungsi seksual, masa berhubungan bisa lebih lama. Rata-rata setelah 2-3 tahap pengobatan, gejala penyakit seperti kencing terasa sakit, sering kencing, tidak tahan kencing, kencing tidak

bertenaga, tidak tuntas, berbusa, bernanah dan lainnya berangsur menghilang secara nyata, sistem reproduksi kembali normal, bisa diatasi hingga ke akar penyakit dan tidak mudah kambuh kembali. “Dapatkan program promosi khusus bagi  yang datang berobat ke Sinshe Hongkong.” Untuk konsultasi dan pengobatan hubungi: Sinshe Hongkong, Jl. Agus Salim No. 126, Pontianak telepon: 0561-733268, 0821 52797 888 (Hari Minggu & libur tetap buka).(a2/bn)

Sakit Rematik Hilang Shalat Kembali Nyaman


DIABADIKAN: Ketua Umum KKSS Kalbar Andi Bahrun Aswal (tengah) didampingi sekertaris pelaksana pengukuhan KKSS Kalbar Eko Akbar Setiawan (paling kanan) dan wakil ketua pelaksana pengukuhan KKSS Kalbar Ardiansyah Pandoi (kiri) diabadikan.

Kalbar. Dijelaskannya, dalam acara pelantikan dan pengukuhan nanti, direncanakan Penasehat KKSS Kalbar Oesman Sapta Odang, dan Gubernur Kalbar sekaligus Gubernur Sulawesi Selatan akan hadir secara langsung. Andi berharap adanya pengukuhan sekaligus pelantikan pengurus Badan Pengurus Wilayah KKSS Kalimantan Barat, mampu membawa perubahan yang besar bagi kesejahtraan warga masarakat Sulawesi Selatan yang berada diperantauan maupun yang telah turun temurun di daerah Kalbar. “Intinya kedepan selain melanjutkan visi misi dari pengurus sebelumnya,

saya juga akan berupaya menyukseskan lancaranya pencanangan pembangunan rumah ada Sulawesi Selatan di Kalbar, dan merangkul semua warga Sulawesi Selatan untuk dapat bersama-sama berkontribusi membangun daerah,” ucapnya. Sementara itu, Sekertaris BPW KKSS Kalbar Eko Akbar Setiawan menambahkan, KKSS secara nasional merupakan organisasi paguyuban yang telah eksis sampai usia yang ke 36 tahun. “Kerukunan KKSS berdiri atas dasar keinginan saling membantu, membangun kebersamaan dan tolong-menolong karena hidup diperantauan,” katanya. (b8/ser)

REMATIKadalahpenyakityangmenyerangpersendian dan struktur di sekitarnya. Masyarakat kita umumnya menganggap rematik sebagai penyakit sepele, karena tidak menimbulkan kematian. Padahal, jika tidak segera ditangani dengan baik, rematik bisa membuat anggota tubuh berfungsi tidak normal. Mulai dari benjol-benjol, sendi kaku, sulit berjalan, bahkan kecacatan seumur hidup. Selain itu, proses penyembuhannya pun berlangsung seumur hidup, dengan biaya tidak sedikit. Adalah Siti Halizah atau yang kerap disapa dengan panggilan Siti. Wanita berusia 57 tahun ini telah 1 tahun lamanya mengeluhkan kesehatannya terganggu, karena menderita rematik. “Karena rematik, lutut saya sering terasa linu dan kesemutan, beraktivitas dan beribadah jadi tidak nyaman,” terang wanita yang berdomisili di Kelurahan Siantan Hilir, Pontianak Utara, Kalbar ini memulai perbincangan. Namun, setelah mengonsumsi Gentong Mas, keluhan-keluhan yang ia rasakan dulu perlahan-lahan membaik. “Setelah saya minum Gentong Mas secara rutin, sekarang kondisi saya sudah sehat, keluhan rematik tidak terasa lagi, shalat pun tidak terganggu lagi. Saya sudah merasakan manfaatnya sejak minum kotak kedua,” jelas ibu rumah tangga ini penuh syukur. Setelah merasakan manfaat Gentong Mas, ibu 3 orang anak ini tidak segan-segan untuk berbagi pengalaman sehatnya dengan yang lain. “Mudahmudahan pengalaman saya yang mendapat kesehatan dengan cara alami ini bisa bermanfaat bagi orang lain,” ceritanya menutup perbincangan. Gentong Mas adalah minuman herbal dengan bahan utama Gula Aren dan Nigella Sativa (Habbatussauda), terbukti memiliki banyak manfaat un-

tuk kesehatan. Unsur Asam Linoleat dan Ascorbic Acid yang terdapat di Habbatussauda sangat baik mencegah dan mengobati rematik. Sedangkan Thymohydroquinone berfungsi mencegah radang (inflamasi) pada sendi.Habbatussauda pun dapat mengurangi radang (bengkak) dan arthritis (bengkak sendi). Selain itu, Habbatussauda dapat meningkatkan jumlah sel-sel T, baik untuk meningkatkan sel-sel pembunuh alami. Dengan demikian, mengkonsumsi Habbatussauda dapat meningkatkan kekebalan tubuh. Gula Aren banyak mengandung nutrisi dibutuhkan tubuh diantaranya Riboflavin yang berfungsi membantu pembentukan antibodi, energi, memperbaiki kerusakan sel saat proses produksi energi dan memperbaiki jaringan sistem pencernaan. Untuk hasil maksimal, dianjurkan berolahraga, kontrol makanan yang dikonsumsi dan banyak minum air putih (8 gelas sehari). Manfaat hebat bagi kesehatan dan rasa lezat membuat semakin banyak masyarakat mengonsumsi Gentong Mas. Untuk informasi lebih lanjut silahkan kunjungi Bagi Anda membutuhkan Gentong Mas bisa didapatkan di apotek/toko obat terdekat atau hubungi Pontianak: 081376179880/05617020305, Kubu Raya: 081310766322, Singkawang: 082128103317, Sambas: 082128103317, Bengkayang: 085345340007, Landak: 081376179880, Sanggau: 081220795618, Sekadau: 081220795618, Sintang: 081376179880, Melawi: 081376179880, Mempawah: 085345340007, Ketapang: 081256520280, Putussibau: 0821699920. Terdaftar di Depkes: P-IRT:812.3205.01.114.(e5/biz)



Pontianak Post

Sabtu 20 April 2013

Semangat Kartini dalam Kepemimpinan Perempuan Hingga akhir abad ke-19 pendidikan bagi perempuan Indonesia merupakan sesuatu hal yang langka. Merupakan hal yang biasa jika perempuan dianggap makhluk kelas dua yang disibukkan dengan tugas domestik rumah tangga. Perubahan paradigma masyarakat dunia diakibatkan oleh pergerakan kaum feminis yang dimulai di Eropa, dengan gencar memperjuangkan hak kaum perempuan, terutama untuk memperoleh pendidikan di banyak negara. Dengan keberhasilan gerakan kaum feminis tersebut, gerakan feminisme mulai diterima di masyarakat luas. Di Indonesia kita mengenal Raden Ajeng Kartini sebagai pejuang hak-hak perempuan. Beliau berjuang bukan lewat senjata, namun lewat pemikiran-pemikiran yang menyemangati kaum wanita agar mendapatkan haknya untuk mendapatkan pendidikan. Sosok Kartini adalah perempuan anak ke lima dari Bupati Jepara, yang saat itu hanya mengenyam pendidikan setingkat Sekolah Dasar (SD). Namun setelah itu beliau terus belajar dengan membaca surat kabar berbahasa Belanda dan melalui kegiatan korespondensi. Perannya dalam mendirikan ‘sekolah’ bagi perempuam di rumah sang suami, Bupati Rembang saat itu dan ketekunannya melakukan korespondensi dengan sahabatnya di Belanda untuk menyuarakan harapan kaumnya untuk mendapatkan pendidikan, dianggap merupakan peran perempuan yang sangat

oleh Sulistiowati

besar dan dibanggakan pada saat itu. Walaupun pada akhirnya, riwayat Kartini menggambarkan beliau tetaplah perempuan yang harus mengalah oleh kehendak sosial masyarakat pada saat itu. Beliau harus menerima kenyataan untuk mau dijadikan istri ke empat Bupati Rembang, dan setahun kemudian beliau harus meregang nyawa saat melahirkan anak pertamanya. Perjuangan sosok Kartini tentu saja menjadi perintis perubahan bagi kaum wanita. Hasil perjuangan Kartini dapat kita lihat pada saat ini, yaitu semakin banyaknya perempuan-perempuan yang sukses, bahkan paling tidak kita mengetahui bahwa lakilaki yang sukses karena ada perempuan hebat yang mendukungnya. Kesuksesan perempuan saat ini dapat kita lihat antara lain dari semakin banyaknya perempuan pemimpin di dunia, maupun di Indonesia khususnya. Perempuan sudah banyak yang menduduki posisi-posisi penting yang mengharuskan adanya kemampuan memimpin. Posisi Mentri, CEO di perusahaanperusahaan besar, Kepala Daerah, Kepala Dinas, Rektor, Dekan, dan posisi-posisi penting lainnya. Tanpa bermaksud menunjuk mana pemimpin yang lebih efektif, memang banyak hal yang berbeda antara pemimpin laki-laki dan

perempuan. Maskulin dan Feminin merupakan sifat dasar yang menbedakan perilaku laki-laki dan perempuan. Perilaku berdasarkan sifat-sifat tersebut besar pengaruhnya terhadap gaya kepemimpinan yang diterapkan. Hasil Kajian Robbins (1998) mengemukakan perbedaan perempuan pemimpin dan laki-laki adalah perempuan memiliki gaya kepemimpinan demokratic, sedangkan laki-laki merasa lebih nyaman dengan gaya memimpin directive atau menekankan pada cara yang bersifat perintah. Eagly dan Johnson (1990) mengkaji bahwa kepemimpinan otokratik dan demokratik lebih tepat dalam membedakan kepemimpinan perempuan dan laki-laki. Gaya kepemimpinan lakilaki cenderung otokratik karena sifat maskulin menggambarkan sosok individu yang kuat,tegas, dan berani. Perempuan pemimpin cenderung demokratif, karena gender feminin menggambarkan sifat yang hangat dalam hubungan personal, lebih suka berafiliasi dan cenderung tidak mendominasi. Sehingga gaya kepemimpinan perempuan cenderung pada pendekatan personal pada orang lain, perhatian pada orang lain, membangun hubungan individu lewat berbagi kekuasaan dan informasi, dan mengumpulkan ide-ide dari orang lain (rekan kerja maupun bawahan). Kecenderungan gaya kepemimpinan laki-laki ada-

Ilustrasi: Kekes

lah hubungan atasan dan bawahan dimana bawahan melakukan apa yang diperintahkan oleh atasan tanpa adanya pendekatan emosional antara mereka. Dari observasi yang dilakukan beberapa lembaga peneliti Sumber Daya Manusia, berikut ini adalah sifat-sifat perempuan pemimpin yang jika ada dalam dirinya, dapat membantunya menjadi pemimpin yang sama efektifnya dengan pemimpin laki-laki. 1) perempuan lebih persuasif dibanding laki-laki. Jika berhasil membuat seseorang setuju akan pernyataan-

nya akan memberi kepuasan tersendiri baginya. 2) Perempuan cenderung lebih merasakan sakit akibat penolakan dan kritik. Namun keberanian, fleksibilitas dan keramahan yang tinggi membuat perempuan akan cepat pulih dan segera belajar dari kesalahan mereka. 3) perempuan pemimpin cenderung lebih fleksibel, komprehensif dan penuh pertimbangan dalam membantu bawahan. 4) perempuan pemimpin masa kini, sama seperti laki-laki, berani jika tidak lagi berada di wilayah yang aman. Mereka lebih berani mengambil

resiko. Jika dilihat dari sudut pandang anggota organisasi, khususnya perempuan, banyak harapan yang digantungkan pada perempuan pemimpin, antara lain karena pada saat dipimpin oleh seorang laki-laki ada beberapa kepentingan perempuan yang tidak dapat diakomodir, sedangkan seringkali dalam sebuah organisasi terdapat banyak anggota atau karyawan perempuan. Namun seringkali harapan-harapan tersebut tidak terpenuhi. Masih ada perempuan pemimpin yang tidak mem-

perhatikan kepentingan dan kodrat kaumnya sendiri dalam pengambilan keputusan dengan alih-alih emansipasi. Padahal jika kita mau melihat kembali perjuangan Ibu Kartini, sebenarnya bukan emansipasi yang dimaksud bukanlah membuat perempuan benar-benar sama dengan laki-laki. Tentu banyak perbedaan yang masih harus dipertimbangkan berkaitan dengan kodratnya masingmasing.* * Penulis Dosen Fakultas Ekonomi Untan, Konsentrasi Manajemen SDM

Konsekuensi Logis UNGKAPAN “konsekuensi logis” merupakan salah satu konsep penting dalam ilmu logika. Ungkapan ini dipakai dalam banyak percakapan tanpa disertai pemahaman yang memadai. Tulisan ini bertujuan mengkaji kriteria dan implikasi dari suatu akibat yang disebut konsekuensi logis. Kamus Besar Bahasa Indonesia mengartikan “konsekuensi” sebagai akibat dari suatu perbuatan. Dalam logika, konsekuensi merupakan pernyataan yang “mengikuti” suatu (serangkaian) pernyataan yang lain. Suatu argumentasi logis disebut valid jika kesimpulannya mengikuti premis-premisnya. Dengan kata lain, kesimpulan yang valid merupakan konsekuensi dari premis(-premis) sebelumnya. Suatu konsekuensi disebut konsekuensi logis jika hubungan kesimpulan yang mengikuti premisnya dapat ditarik secara logis.

Pontianak Post

Kriteria Kriteria apakah untuk menentukan suatu kejadian (tindakan) merupakan konsekuensi logis dari peristiwa lainnya? Alfred Tarski menawarkan tiga kriteria untuk mengidentifikasi suatu konsekuensi logis, yakni: (1) hubungan dari konsekuensi logis merupakan keniscayaan atau tak terhindarkan; (2) hubungannya bersifat formal, artinya, terbentuk dari pernyataan-pernyataan yang terlibat; dan (3) hubungannya bersifat apriori, artinya, dapat ditetapkan tanpa perlu disertai pengetahuan empiris. Mengacu pada Tarski, suatu konsekuensi logis menjelaskan hubungan kausal antara dua (lebih) kejadian (pernyataan). Jika A terjadi, maka dengan sendirinya, B akan mengikuti. Hubungan A dan B bersifat formal, dalam arti B bersifat unik karena tergantung pada A yang menyebabkan/ memben-

oleh tuknya. Hubunsecara aposteriori gannya juga bersidi mana pelaku Lianto, S.Ag., M.M. fat apriori karena bisa jadi tidak peristiwa B dapat memperkirakan dipikirkan/diramalkan sebelum bahwa tindakan A akan diikuti tia terjadi/muncul. oleh peristiwa B. Seperti dikatakan Tarski, hubungan kausal suatu Implikasi konsekuensi logis bersifat apriori. Suatu konsekuensi logis ken- Kemunculannya dapat dipikirkan dati memperlihatkan suatu aki- secara logis oleh setiap orang bat yang muncul secara niscaya, yang memiliki akal sehat. Dengan tidak dapat mengurangi, apalagi demikian pelaku tindakan yang menghilangkan tanggung jawab menimbulkan suatu konsekueyang melekat pada pemicunya. nsi logis seharusnya melakukan Jika peristiwa B muncul mengi- antisipasi untuk meminimalkuti peristiwa/tindakan A, maka isasi dampak negatif yang bakal segala akibat negatif yang timbul mengikuti. tetaplah menjadi tanggung jawab pelaku tindakan A. Aplikasi Salah Kaprah Alih-alih mengurangi atau Berhubung suatu konsekuensi menghilangkan tanggung jawab, logis muncul secara niscaya, bansuatu konsekuensi logis justru yak pihak memanfaatkan sifat itu menuntut tanggung jawab yang untuk melepaskan diri dari tanglebih besar karena sifat apriori gung jawab. Orang yang memyang melekat padanya. Suatu bongkar rumahnya yang awalnya konsekuensi logis bukan muncul merupakan satu blok bangu-

nan dengan para tetangga menganggap insiden kebocoran yang mengikuti tindakan pembongkaran sebagai suatu konsekuensi logis yang tak terhindari. Pemilik bangunan berpikir bahwa dirinya hanya mengambil (merobohkan) apa yang menjadi haknya. Adapun insiden kebocoran yang mengikuti merupakan konsekuensi logis di luar tanggung jawabnya. Demikian pula ketika penancapan tiang-tiang beton yang diikuti oleh retaknya dinding tetangga juga dianggap sebagai konsekuensi logis di luar kehendaknya. Ini salah kaprah besar. Keniscayaan suatu konsekuensi logis tidak dapat menafikan tanggung jawab yang melekat pada pihak penyebab. Seseorang berhak membongkar dan membangun sesuatu di atas lahan miliknya. Namun hak itu dibatasi oleh hak orang lain. Ketika pemakaian hak

seseorang menimbulkan kerugian pada orang lain, maka pemakaian hak itu akan diikuti oleh sejumlah kewajiban. Tanggung jawab atas suatu konsekuensi logis yang muncul justru lebih besar mengingat setiap orang yang berakal sehat pasti dapat berpikir/meramalkan akibat yang bakal muncul. Ketika antisipasi tidak dilakukan untuk meminimalisasi suatu konsekuensi logis, maka setidaknya ada dua kemungkinan sebab, yakni (1) yang bersangkutan melakukan pembiaran karena berpikir konsekuensi logis merupakan dalih yang cukup untuk lari dari tanggung jawab, atau (2) yang bersangkutan tidak memiliki akal sehat, atau malas untuk memakai akal sehatnya.* *Penulis Dosen STIE Widya Dharma Pontianak

Terbit 7 Kali Seminggu. Izin terbit Menteri Penerangan RI No. 028/SK/Menpen/SIUP/A7. Tanggal 3 Februari 1986. Per­setujuan Peru­bahan Nama No: 95A/Ditjend. PPG/K/1998 Tanggal 11­September 1998. Alamat Redaksi dan Tata Usaha: Jalan Gajah Mada No. 2-4 Pontianak 78121. Kotak Pos 1036. Fax. (0561) 760038/575368. Telepon Redak­si: (0561) 735070.Telepon Iklan/Pema­saran:735071. Hunting (Untuk seluruh bagian) Fax. Iklan 741873/766022. Email: redaksi@pon­ Penerbit: PT.Akcaya PERTAMA DAN TERUTAMA DI KALIMANTAN BARAT Utama Press Pontianak. Pembina: Eric Samola, SH, Dahlan Iskan. Komisaris Utama: Tabrani Hadi. Direktur: Untung Sukarti. Pemimpin Re­daksi/Penang­gung Jawab: B Salman. Redaktur Pelaksana: Khairul­rahman, Muslim Minhard, Donatus Budiono, Basilius. Sidang Redaksi: Abu Sofian, Surhan Sani, Mela Danisari, Yulfi Asmadi, Andre Januardi, Mursalin, Robert Iskandar, Efprizan. Sekre­taris Redaksi: Silvina. Staf Redaksi: U Ronald, Deny Hamdani, Budianto, Chairunnisya, M Kusdharmadi, Hari Jawa Pos Group Kurniatama, Hendy Irwandi, Pracetak/Artistik: Mochsinin (Koordinator), Grafis: Sigit Prasetyo, Ilustrator: Kessusanto. Fotografer: Timbul Mudjadi, Sando Shafella. Biro Singkawang: Zulkarnaen Fauzi (Jl. Gunung Raya No.15 Telepon (0562) 631912). Biro Sambas: Hari Kurniatama (Jl P Anom Telp (0562) 392683) Biro Sanggau: Sugeng (Jl. Sudirman No. 4 Telp. (0564) 21323). Biro Ketapang: Asri Isnaini, (Jl. Gajahmada No. 172. Telp. (0534) 35514). Kabupaten Pontianak: Hamdan, . Biro Sintang: Sutami. Pema­saran/Sirkulasi: Kiki Fredrik S; Iklan: Dewiyanti.S. Percetakan: Surdi. Devisi Event: Budi Darmawan. Jakarta: Max Yusuf Alkadrie. Harga Lang­ganan per 1 Bulan dalam kota Rp 80.000,- (luar kota tambah ongkos kirim). Tarif iklan: Per mm kolom hitam putih Rp 40.000,- full colour Rp 50.000,- Iklan baris Rp 15.000,- per baris (minimal 2 baris, mak­­si­mal 10 baris) pem­bayaran di muka. Telepon Langganan/Pengaduan: 735071. Iklan: 730251. Perwakilan Jakarta: Jl. Jeruk Purut-Al-Ma’ruf No.4 Pasar Ming­gu, Jakarta Selatan 12560. Telepon: 78840827 Fax. (021) 78840828. Percetakan: PT.Akcaya Pariwara Pontianak. Anggota SPS-SGP ISSN 0215-9767. Isi di luar tanggung jawab percetakan.

Pontianak Post

Sabtu 20 April 2013

aneka pontianak


48 Potensi Konflik di Kalbar PONTIANAK - Kapolda Kalimantan Barat Tugas Dwi Apriyanto mengatakan potensi konflik di Kalbar cukup besar. Dari pemetaan yang telah dilakukan Polda, ada sedikitnya 48 potensi konflik yang cukup besar di Kalbar. Sekitar 80 persen terkait tumpang tindih lahan dan perkebunan. Kita sudah jelaskan ke bapak gubernur. “Potensi konflik itu banyak berkaitan tumpang tindih lahan dan tapal batas. Baik karena ada pemekaran wilayah, perkebunan, dan lain-lain. Mengenai tapal batas bisa karena pemekaran wilayah , baik tapal batas antar kabupaten, antar kecamatan, atau antar desa,” ujarnya. Menurut Tugas, berbagai persoalan ini menjadi perhatian khusus bagi Polda Kalbar. MUJADI/PONTIANAKPOST

DIKAVELING: Pinggir Jalan Mayor M Alianyang, Kubu Raya sudah dikaveling untuk membangun berpuluh-puluh kios. Namun pihak Pemkab Kubu Raya memasang larangan.

Soal Unas SMP Beres Sambungan dari halaman 9

yakni Kabupaten Ketapang, Kayong Utara, Kapuas Hulu, Sintang, Sanggau, Sekadau, dan Melawi. Rabu (17/4), didistribusikan ke Kabupaten Pontianak, Landak, Bengkayang, Sambas, dan Singkawang. Kamis (18/4) didistribusikan ke Kubu Raya, dan terakhir ke Kota Pontianak. ”Sejauh ini tidak ada masalah. Semuanya berjalan lancar dan pelaksanaan sesuai jadwal dari 22 April hingga 25 April,” ungkap Sunyata. Sunyata menjelaskan pada 22 April diselenggarakan ujian nasional Bahasa Indonesia. Keesokan harinya Bahasa Inggris,

Rabu (24/4) Matematika, dan hari terakhir Ilmu Pengetahuan Alam (IPA). Tahun ini, lanjut Sunyata, total peserta unas sebanyak 65.981 orang, terdiri atas SMP 57.437 orang, MTs 8.284 orang, SMP Terbuka 231 orang, dan SMPLB 29 orang. Peserta paling banyak berasal dari Kota Pontianak sebanyak 9.873 orang dan paling sedikit Kayong Utara sebanyak 1.450 orang. ”Untuk ujian nasional SMP juga melibatkan Universitas Tanjungpura sebagai koordinator, satuan pendidikannya turun,” jelas Sunyata. Menurut Sunyata, lembar jawaban yang diisi siswa tidak dibawa oleh satuan pendidi-

kan, melainkan dibawa tim dari penyelenggara kabupaten dan kota. Pemindaian lembar jawaban juga tidak dilakukan di Untan. ”Pemindaian dilakukan Dinas Pendidikan dan Kebudayaan Provinsi Kalbar. Ini berbeda dengan SLTA karena SLTA akan meneruskan ke perguruan tinggi. Mungkin datanya bisa digunakan untuk penerimaan siswa baru,” katanya. Ia menambahkan untuk melancarkan kegiatan unas, Dinas Pendidikan Kalbar sudah menyampaikan imbauan kepada PT PLN maupun pihakpihak lainnya. ”Kami meminta partisipasinya untuk membantu kelancaran ujian nasional,” ujarnya. (uni)

Kemenag Seleksi Petugas Haji Sambungan dari halaman 9

Jika memang harus dikurangi Kantor Kemenag Kota Pontianak berharap pengurangan tidak terlalu banyak. “Mudah-mudahanlah tidak terlalu banyak. Lebih bagus lagi kalau tidak dikurangi,” Andi berharap. Tahun lalu kuota haji Kota Pontianak 729 jamaah. Se-Kalbar kutanya sebanyak 2.339, jumlah itu dibagi masingmasing kabupaten kota. Dengan angka kuota tahun lalu, antrean haji di Kota Pontianak sampai 2023. “Itu kondisinya sekarang,” ungkapnya. Walau belum mengetahui kuota haji, Kantor Keme-

nag Kota Pontianak telah melakukan seleksi petugas haji. Sebanyak 20 orang dari seluruh pegawai kemenag termasuk guru dan KUA turut dalam seleksi tersebut. Dalam perjalanannya satu orang mengundurkan diri. “Seleksi ini merujuk pada Peraturan Menteri Agama Nomor 10 Tahun 2010. Tidak boleh ada kolusi menentukan petugas haji,” kata Andi. Petugas haji adalah orang yang diberangkatkan oleh negara. Mereka bertugas membantu jamaah dan menyukseskan perjalanan haji secara keseluruhan. Satu kloter dari diri dari lima orang, satu ketua kloter, satu orang

pembimbing haji, satu dokter dan dua medis. Seleksi dimulai dengan tes tertulis pada 9 April lalu. Dirjen Kementrian Agama RI, Moch Yasin yang juga mantan Ketua KPK datang langsung ke Pontianak. “Pak Yasin yang langsung mengoreksi hasil tes. Hari itu juga diumumkan,” jelas Andi. Empat orang lulus dalam seleksi itu. Mereka selanjutnya akan mengikuti seleksi tingkat provinsi. Bisa lulus semua, sebagian atau tidak sama sekali, karena mereka bersaing dengan daerah lain. “Petugas haji ini akan dibagi dalam lima kloter se-Kalbar,” ucap Andi.(hen)

Gadis Bawah Umur Digilir Dua Remaja Sambungan dari halaman 9

Setelah itu, korban diajak jalan-jalan, dengan alasan Ad ingin pergi ke rumah temannya. Namun di Jalan Parit Lintang Desa Punggur Besar, Ad yang membonceng korban ini pun berhenti di pinggir jalan, seraya menoleh kiri kanan. Jalan terlihat sepi, Ad langsung memaksa korban untuk berbuat mesum. Ad menarik tangan korban dengan kuat, kemudian menjambak rambutnya. Korban yang merasa disakiti berusaha minta pertolongan kepada warga setempat. Namun, upaya itu gagal karena tak satupun orang ada di lokasi tersebut kecuali mereka bertiga. “Saya sudah minta tolong dengan cara berteriak, tapi jalannya sepi tidak ada orang, malah Ad yang mengancam saya untuk diam. Kalau saya melawan maka sepeda motor milik saya yang dipakai Tm temannya itu akan diambil. Saya diam dan tak melawan,” ungkap korban saat dijumpai di Polresta Pontianak yang didampingi orangtua dan keluarganya. Korban menangis dan hendak melarikan diri. Namun

genggaman tangan Ad dan tenaganya lebih kuat, dia pun pasrah. “Lalu saya diperkosa Ad dan temannya bernama Tm. Pertama Ad yang memperkosa saya, kemudian Tm temannya. Saya diperkosa di pinggir jalan. Saat diperkosa saya hanya bisa menangis dan tidak bisa melawan karena rambut saya dijambak dan tangan saya dipegang, bahkan saya diancam jika tidak mau diam,” jelas korban. Korban juga mengakui bahwa akibat dari pemerkosaan yang dilakukan Ad terhadapnya, Ia mengalami trauma berat. “Ad mengaku kepada saya bahwa ia itu tinggal di Pontianak. Sedangkan temannya Ad yang juga memperkosa saya bernama Tm itu tinggal di Punggur,” ungkapnya. Orang tua korban tidak terima atas perlakuan tak senonoh yang dialami putrinya. Ia merasa nama baik keluarganya tercoreng akibat peristiwa itu. Selain itu masa depan anaknya juga sudah rusak. Sehingga ia pun meminta kepada kepolisian untuk memproses hukum kedua pelaku pemerkosaan terhadap anaknya. “Saya merasa malu dan

masa depan anak saya juga sudah hancur, jadi saya benar–benar tidak terima atas apa yang dilakukan kedua pelaku tersebut kepada anak saya,” tegasnya. Ia berharap kepolisian menangkap pelaku. “Saya percaya semuanya kepada pihak kepolisian. Saya minta kedua pelaku diproses hukum dengan hukuman seberat– beratnya,” harapnya. Kasat Reskrim Polresta Pontianak Kompol Puji Prayitno membenarkan peristiwa tersebut. “Kasus ini masih dalam tahap pemeriksan, baik dari itu keterangan korban, dan saksi. Kedua pelaku sudah diamankan saat ini. Ketika semua bukti sudah kuat untuk menjerat kedua pelaku, maka akan segera dilakukan penahanan,” ungkapnya. Kata dia, pemerkosaan itu terjadi pada hari Rabu (17/4) sekitar pukul 21.00, di Desa Punggur Besar. “Menurut pengakuan Ad kepada kami, bahwa yang melakukan pertama kali adalah dirinya, sedangkan pengakuan Tm hanya memegang–megang saja, sementara menurut korban adalah kedua–duanya yang memperkosa,” jelasnya. (arf )

Dewan Kota Sampaikan 57 Rekomendasi Sambungan dari halaman 9

Tentang rekomendasi peningkatan insentif guru, Sutarmidji menjelaskan, pihaknya sudah memberikan melalui kelompok kerja guru (KKG) musyawarah guru mata pelajaran (MGMP). Anggaran untuk KKG MGMP tersebut hampir Rp8 miliar. “Karena kalau ben-

tuknya insentif tidak boleh, jadi anggaran ganda. Karena dari pemerintah pusat itu ada juga insentif untuk guru,” katanya. Terkait penataan Tugu Khatulistiwa, dia mengatakan, Pemkot Pontianak sebetulnya ingin cepat melakukan penataan. Namun terkendala lahan yang statusnya bukan milik pemkot. Tetapi penataan kawasan su-

dah mulai dilakukan dan terus berlanjut. “Tribunnya sudah, taman juga. Tahun ini mulai penurapan. Kalau museumnya sekarang sedang desain,” tutur Sutarmidji. Rekomendasi lain, menurut Sutarmidji sebagian besar sudah dilaksanakan. “Hampir semua sudah dilaksanakan itu,” ucapnya. (hen)

Belum Ada Pendaftar Sambungan dari halaman 9

Sementara itu, jelas Umi, untuk syarat berkas anggota DPRD Kalbar adalah warga

negara Indonesia (WNI). Berumur sekurang-kurangnya 21 tahun pada tanggal 21 April. Tidak pernah dijatuhi hukuman pidana dengan ancaman lima

tahun. Sehat jasmani dan rohani. Bersedia tidak praktik sebagai advokat, akuntan, direksi, komisaris BUMN, BUMD dan terdaftar sebagai pemilih. (bdi)

Menurut Tugas, sejak awal bertugas di Kalbar dia sudah melakukan pemetaan konflik itu untuk mendapatkan solusi atas persoalan tersebut. “Kita coba dekati banyak tokoh masyarakat dan kelompok-kelompok yang rentan bergesekan,” jelasnya. Terkait tapal batas menurut dia hal itu juga menjadi domain pemerintah daerah. Karena itu dia berharap gubernur, para bupati dan wali kota bisa menyelesaikan persoalan ini. Sementara mengenai tumpang tindih lahan, dia berharap dinas atau instansi teknis bisa turut berperan untuk mengatasinya. “Dalam hal ini mungkin Dinas Perkebunanan, Dinas Pertambangan, maupun BPN,” katanya. Tugas berharap, segala per-

soalan yang berpotensi menimbulkan konflik bisa diselesaikan segera. “Pemerintah daerah itu kita dampingi, kami bisa menjadi mediator, sehingga segala sesuatu bisa kita selesaikan secara win win solution. Itu yang kita harapkan. Supaya tidak terjadi konflik terbuka.” Tugas mengatakan, dirinya sudah menjelaskan berbagai potensi konflik ini kepada Gubernur. Gubernur sendiri menurutnya sudah meneruskan informasi ini kepada para bupati dan wali kota di Kalbar. “Kita harapkan para bupati dan walikota ini harus aktif. Kita akan memprovokasi supaya ada penyelesaian. Terutama dinas dan instansi itu bisa mengambil peran,” harapnya. (her)

Bingung Aturan Tes Kesehatan PONTIANAK – Setalah Partai Keadilan Sejahtera, Jumat (19/4) Partai Hati Nurani Nasional Kota Pontianak menyambangi KPU Kota Pontianak untuk mendaftarkan 45 kadernya untuk turut serta menjadi calon legeslatif pada pemilu 2014. Ketua DPC Hanura Kota Pontianak Uray Heni Novita menerangkan dalam pemilu kali ini pihaknya telah menyiapkan 35 persen caleg perem-

puan dari 45 kader terbaiknya itu. “Untuk pemilu mendatang kami telah benar-benar siap untuk ikut serta dalam pemilu mendatang,” kata Heni. Legislator dari Partai Hanura ini yakin saat ini masyarakat Pontianak kian cerdas untuk menentukan partai mana yang mampu membawa perubahan yang lebih baik lagi bagi Kota Khatulistiwa ini. “Dengan slogan hati nurani, tidak hanya

sebatas slogan namun dalam implementasinya juga kita lakukan untuk meningkatkan kesejahteraan masyarakat,” jelasnya, Ia mengatakan semua kader Hanura yang turut serta menjadi caleg telah memenuhi syarat dan tidak tersandung kasus hukum. “Kita bersih, kader kami yang ikut caleg tidak dalam masalah hukum,” ucapnya. (ash)

Meski Orang Kalbar, Saya Harus Bersikap ... Sambungan dari halaman 9

Saat ini merupakan periode kedua dia mengemban tugas di lembaga itu. Meski saat ini bertugas di Jakarta, Akil mengaku tetap memantau perkembangan politik di Kalimantan Barat melalui media massa. Termasuk mengenai berbagai situasi pemilu dan pemilukada. “Saya pantau dari berbagai media, termasuk Pontianak Post,” katanya. Selama bertugas sebagai hakim konstitusi, banyak sekali kasus yang dia tangani. Kasusnya sendiri beragam, mulai soal gugatan suatu undang-undang hingga gugatan pemilukada. Diantara sekian banyak kasus yang ditangani itu, ternyata kasus-kasus mengenai pemilukada tergolong cukup banyak. Apalagi selama setahun ada banyak daerah yang melaksanakan pemilukada di seluruh Indonesia. Kebanyakan pasangan calon yang tidak lolos tidak merasa puas dan menggugat ke Mahkamah Konstitusi. Sejumlah kasus terkait gugatan pemilukada di Kalimantan Barat juga pernah ditanganinya. Misalnya beberapa waktu lalu, dia menerima gugatan salah satu pasangan calon Gubernur Kalbar yang merasa tidak puas atas hasil pemilukada gubernur. “Meski itu berasal dari Kal-

bar, saya tetap harus bersikap independen. Jangan karena saya pernah kenal, atau pernah makan di rumahnya saya kemudian menjadi tidak adil. Sebagai hakim saya terikat pada kode etik. Karena itu keadilanlah yang menjadi patokan saya,” katanya. Selama bertugas, banyak sekali godaan yang dia alami. Mulai dari godaan uang, jabatan, hingga godaan perempuan. Tetapi sebagai hakim dia mengaku berusaha sekuat tenaga menolak godaan itu. Menurut Akil, seorang hakim adalah “wakil” Tuhan di dunia. Di tangan seorang hakimlah suatu perkara diputus. “Kalau kita tidak adil dalam memutus perkara, berarti kita tidak amanah terhadap kekuasaan yang kita miliki,” katanya. Akil termasuk salah satu hakim yang kerap memberikan opini berbeda (dissenting opinion) dari hakim-hakim lain terkait suatu perkara. “Dalam memutuskan suatu perkara, saya berusaha semaksimal mungkin memberikan penilaian dengan objektif sesuai ilmu dan pengetahuan hukum yang saya miliki terkait perkara tersebut,” jelasnya. Direktur Utama Pontianak Post Untung Sukarti memuji sosok Akil. Menurutnya, Akil bisa menjadi contoh bagi putra daerah lain. “Beliau ini sosok putra daerah yang membanggakan. Dia satu-satunya

warga Kalimantan Barat yang pernah menjadi hakim konstitusi dan bahkan sekarang bisa menjabat sebagai ketua MK. Kita tentu patut berbangga,” kata Untung. Akil adalah lulusan Fakultas Hukum Universitas Panca Bhakti Pontianak. Dia kemudian melanjutkan pendidikan S2 di Magister Ilmu Hukum Universitas Padjajaran Bandung, dan Doktor Ilmu Hukum di Universitas Padjajaran Bandung. Siapa sangka pada masa kecil, Akil adalah sosok yang sangat bersahaja. Dalam website pribadinya disebutkan, Ia pernah melakoni hidup sebagai tukang semir, loper koran, supir, bahkan sempat hampir putus sekolah. Namun berkat keuletannya, ia berhasil menjadi seorang pendekar hukum di lembaga penegak konstitusi di Indonesia. Akil Mochtar menghabiskan masa kecil dan remajanya di Putussibau, ibukota Kabupaten Kapuas Hulu, Kalimantan Barat, sebuah daerah terpencil di perbatasan Indonesia-Malaysia sehingga sempat menjadi wilayah konflik antara kedua negara. Daerah ini kira-kira berjarak 860 km dari Pontianak, ibu kota Kalimantan Barat. Berhubung pada tahun 60-an belum ada jalur darat, daerah ini hanya bisa dijangkau lewat jalur sungai. Perjalanan dari Putussibau ke Pontianak bisa sampai 14 hari dengan kapal kecil. (*)

Penjual Poster Bengkas Rumah Sambungan dari halaman 16

“Saya lihat ada kesempatan, ya saya masuk. Tapi saya tak pernah mencuri kok,” kilah Ad lemas. Kapolsek Pontianak Timur, AKP A. Rachman membenarkan penangkapan tersangka. Pihaknya dengan sigap terjun ke tempat kejadian perkara untuk

menetralisir keamanan sekitar. “Mendapat laporan, kita langsung ke lapangan, dan menggiring tersangka untuk diperiksa lebih lanjut,” ungkapnya. Dia merincikan, tersangka sempat mencongkel jendela rumah incarannya. Kemudian berusaha masuk, namun aksi tersangka diketahui seorang wanita. Spontan, saksi mata

itu pun menjerit histeris meminta pertolongan kepada warga sekitar. “Apes, tersangka langsung dihakimi beramai-ramai. Kini, dirinya masih menjalani pemeriksaan untuk dilakukan pengembangan penyidikan. Demi menanggung perbuatan itu, tersangka kita jerat dengan pasal 53 tentang pencurian,” tegasnya. (rmn)

Mobil Tabrak Sepeda Motor Sambungan dari halaman 16

Motor lalu tumbang di bawah mobil dan terseret beberapa meter sebelum menyangkut di Tugu BTN. Hingga kini polisi masih mencari informasi keberadaan pengemudi mobil yang kabur usai kecelakaan. Polisi hanya berhasil menyita mobil beserta surat-suratnya. Pengendara sepeda motor, Edi Susanto (32), warga Gang

Suka Pinang, Kelurahan Sungai Jawi Luar, Pontianak Barat, kondisinya kritis. Dia terbaring lemas di Rumah Sakit Antonius Pontianak. “Saya juga tak tahu, kenapa bisa begini,” kata Sufi tersedu-sedu. Berdasarkan hasil pemeriksaan medis, Edi mengalami luka yang cukup serius di beberapa bagian tubuh. Dokter IGD RS Antonius Pontianak, dr. Karida yang mengatakan, korban

mengalami patah tulang yang meliputi di bagian paha sebelah kanan, betis sebelah kanan, kaki sebelah kanan dan tangan sebelah kiri. Buah zakar korban juga mengalami luka robek. “Untuk sementara sudah dapat kami tangani secara medis. Setelah kita rawat, kondisinya mulai membaik. Semoga saja di hari berkutnya, pasien dapat sembuh total,” harapnya. (rmn)

Batasi Izin Tambang Sambungan dari halaman 16

eksploitasi atau operasi produksi sebanyak 177 izin. Jumlah IUP tersebut meningkat sebanyak 45 izin atau 6,91 persen dibandingkan dengan 2011. ”Pada 2011 jumlah IUP yang difasilitasi sebanyak 651 izin,” kata Christiandy. Christiandy mengungkap-

kan dari kegiatan pengelolaan dan pemanfaatan sumber daya mineral dan batu bara, pada 2012 mampu memproduksi tambang sebanyak 14.023.324 meterpersegi perton. Pemerintah daerah pun mendapatkan kontribusi dari pemanfaatan tersebut. ”Kontribusi langsung yang diperoleh pemerintah daerah

dari kegiatan usaha pertambangan ini berupa penerimaan negara bukan pajak,” kata Christiandy. Penerimaan tersebut, lanjut Christiandy mencapai Rp79,105 miliar, terdiri atas iuran tetap sebesar Rp13,333 miliar dan iuran produksi sebesar Rp65,771 miliar. (uni)

Bahas Tindak Pidana Atensi Pilkada Sambungan dari halaman 16

demi tetap kondusifnya keamanan Kalbar. “Patroli rutin

akan terus diintensifkan. Memantau keamanan di lingkungan masyarakat. Menanggulangi ancaman tindak kejahatan. Su-

paya potensi gangguan dapat diminimalisir sejak dini. Apalagi saat pemilu berlangsung nanti,” pungkasnya. (rmn)



Pontianak Post

Penjual Poster Bengkas Rumah


Batasi Izin Tambang KALIMANTAN Barat memiliki potensi tambang yang besar. Tetapi pemanfaatannya masih terbatas. ”Kita punya intan, batu bara, berlian, nuklir, uranium, dan bauksit. Tetapi saya rem. Jangan dulu (dieksplorasi). Nanti dikuasai orang,” ujar Gubernur Kalbar, Cornelis di Balai Petitih Kantor Gubernur Kalbar, baru-baru ini. Menurut Cornelis, ia meminta agar mengembangkan sektor lainnya dulu, seperti perkebunan. Cornelis Kendati demikian, sektor pertambangan mulai digarap seperti bauksit dan timah. Penggarapan sumber daya alam ini juga berdampak positif pada rakyat. ”Untungnya rakyat bisa bekerja,” kata Cornelis. Ia menambahkan saat ini pajak perkebunan sawit, tambang, karet, dan lainnya masuk ke pendapatan pemerintah pusat. ”Yang masuk ke kita hanya PBB. Kalimantan dari zaman dulu menjadi penopang APBN, tetapi kita tidak pernah ribut,” ungkapnya. Di tempat terpisah, Wakil Gubernur Kalbar, Christiandy Sanjaya menuturkan Pemerintah Provinsi Kalbar memfasilitasi 696 Izin Usaha Pertambangan pada 2012. Izin usaha tersebut terdiri atas IUP eksplorasi sebanyak 519 izin, dan IUP Ke Halaman 15 kolom 5


Desa Mandiri Pangan PEMERINTAH Provinsi Kalimantan Barat melakukan pemberdayaan 106 Desa Mandiri Pangan dan penguatan cadangan pangan provinsi sebanyak 296.975 ton pada 2012. ” Jika dibandingkan dengan target Standar Pelayanan Minimal (SPM) sebesar 200 ton untuk cadangan pangan provinsi, berarti tercapai SPM sebesar 148,49 persen,” ujar Wakil Gubernur Kalbar, Christiandy Sanjaya di Christiandy Sanjaya Pontianak. Menurut Christiandy, banyak urusan ketahanan pangan yang dilaksanakan pada tahun lalu. Diantaranya pengembangan lumbung pangan desa dan masyarakat, pembinaan dan pemantauan cadangan pangan daerah, pengembangan distribusi pangan masyarakat, peningkatan koordinasi kelancaran distribusi ada akses pangan masyarakat, pengawasan dan pembinaan keamanan pangan, serta percepatan penganekaragaman konsumsi pangan. Semuanya untuk pencapaian swasembada dan swasembada berkelanjutan, peningkatan diversifikasi pangan, peningkatan nilai tambah, daya saing dan ekspor, serta peningkatan kesejahteraan petani. ”Dilakukan juga pembinaan sistem kerja latihan dan kunjungan, pembinaan kader penyulu, desa model, fasilitasi kontak tani nelayan andalan, dan sebagainya. Semuanya untuk mendukung kompetensi sumber daya manusia penyuluh maupun petani,” ungkapnya. (uni)

Sabtu 20 April 2013


BELUM SADAR: Korban kecelakaan lalu lintas di Jalan Rahadi Osman masih terbaring dan belum sadarkan diri di Rumah Sakit Antonius.

Mobil Tabrak Sepeda Motor PONTIANAK - Sebuah mobil menabrak sepeda motor di Bundaran Rahadi Usman Pontianak, Jumat (19/4). Akibatnya, pengendara sepeda motor kritis setelah sempat terseret sepanjang sepuluh meter di jalan raya. Bukan hanya itu, pagar di tugu tersebut juga rusak karena lakalantas ini. Pantauan Pontianak Post, body sepeda motor ringsek dan menyangkut di Tugu BTN tak jauh dari rumah dinas Wakil Gubernur Kalbar. Warga yang melintas, berkerumun menyaksikan sepeda motor yang ringsek tersebut. Kecelakaan ini diduga, ketika mobil bernomor polisi KB 1046

HM melaju dari arah Matahari Mall ke arah Jalan Pak Kasih. Hilang kontrol, mobil kemudian menabrak sepeda motor bernomor polisi KB 5787 0K dari arah belakang. Pengendara sepeda motor terdorong sekitar sepuluh meter sebelum akhirnya tersangkut di tugu BTN. Sementara pengemudi mobil itu, melarikan diri usai lakalantas terjadi. Kasat Lantas Polresta Pontianak Kompol Ichsan Nur menuturkan, pihaknya sedang mencari identitas si pemilik mobil tersebut. Apakah ada kelalaian dari si pengendara, atau ada pengaruh lain pemicu

tabrakan. “Masih kita selidiki. Sebab si pengemudi mobil melarikan diri. Kita akan mencari jejak dia,” ungkapnya. Saat dilakukan pemeriksaan, kata dia, petugas menemukan satu botol minuman keras di dalam mobil tersebut. Kesimpulan awal, mungkin si pengemudi mobil sedang mabuk dan tak mampu mengontrol laju kendaraannya, hingga kemudian menabrak sepeda motor yang melintas. Menurutnya, kecelakaan diduga terjadi karena mobil menabrak sepeda motor yang dikendarai Edi dari belakang. Ke Halaman 15 kolom 5

PONTIANAK - Penjual poster babak belur dihakimi massa, kemarin(19/4) pagi. Dia dituding ingin melakukan tindak pidana pencurian di salah satu rumah warga, Jalan Tanjung Raya Komplek Cendana Pontianak Timur. Ad (31) belum sempat masuk ke rumah incarannya, sudah kepergok masyarakat di komplek tersebut. Aksinya tercium oleh seorang wanita, yang kemudian berteriak maling. Tak berselang lama, warga pun keluar rumah dan mengepung tersangka dari segala penjuru. Panik, Ad pun berusaha untuk melarikan diri. Namun dirinya tak bisa mengelak lagi. Kerumunan warga datang menghampiri pria beranak tiga ini. Ada yang berbekal kayu, ada pula yang datang membawa benda keras lainnya. Mereka kemudian mendaratkan beberapa pukulan ke tubuh dan wajah Ad. Puas menghakimi, beberapa warga kemudian menggiring Ad untuk diamankan di salah satu tempat sembari menunggu polisi tiba. Mengetahui hal tersebut, akhirnya anggota Reskrim Polsek Pontianak Timur dengan sigap menghampiri kerumunan warga. Kemudian mereka mengamankan Ad, agar tak dihakimi lagi. Ad menuturkan, pagi itu dirinya hendak menjajakkan dagangan berupa poster di komplek tersebut. Melihat rumah kosong, dan didukung kondisi sedang lengang, dia membujurkan niat kriminalnya. Ad kemudian mencongkel jendela yang posisinya tepat di depan rumah saksi mata. Ketika jendela itu berhasil dicongkel, Ad berusaha untuk segera masuk. Namun nahas, aksinya dipergoki seorang wanita. “Saat saya mau masuk, ada perempuan teriak maling. Saya panik, dan berusaha lari, namun sudah dikepung dan saya dikeroyok,” ungkapnya saat diinterogasi petugas. Kenapa berniat melakukan tindak pidana pencurian itu, Ad bungkam. Dia tertunduk lemas saat sejumlah pewarta kembali bertanya. Dirinya hanya mengaku telah setahun berdagang poster dan menjajakannya di rumahrumah warga. Ke Halaman 15 kolom 5

Bahas Tindak Pidana Atensi Pilkada PONTIANAK - Kepolisian Daerah Kalimantan Barat berkomitmen penuh menciptakan rasa aman di masyarakat. Segala bentuk isu yang berkembang akan ditanggapi serius agar tidak terjadi gangguan kamtibmas. Terlebih menjelang pelaksanaan pesta demokrasi Pemilihan Umum Kepala Daerah (Pemilukada) nanti. “Kita membahas mengenai diversi penanganan tindak pidana yang menjadi atensi kepolisian. Berupaya memberikan pelayanan maksimal, terutama memenuhi tuntutan rasa keadilan masyarakat,” kata Kapolda Kalbar Brigjen Pol Tugas Dwi Apriyanto kepada Pontianak Post, kemarin.

Pihaknya selalu berkomitmen melaksanakan penegakan hukum dengan jujur, benar dan adil. Itu dilakukan untuk memenuhi tuntutan rasa keadilan masyarakat. Kapolda menuturkan, jajarannya akan segera membentuk kesatuan dalam hal pengamanan pemilukada tersebut. Tapi sebelumnya, ungkap Kapolda, segera melakukan rapat koordinasi. Segala tindak pidana akan dibahas di sini. Mulai membahas perlindungan anak dan tindak pidana perdagangan orang, penanganan tindak pidana pada Pemilukada, penanganan tindak pidana korupsi, penanganan tindak pidana kehutanan dan pertambangan,





penanganan tindak pidana di perairan, penanganan tindak pidana perbankan, money laundering dan cyber crime, penanganan tindak pidana industri dan perdagangan. “Kita juga membahas penanganan curanmor dan peran Dit Lantas dalam penanganan curanmor,” cetusnya. Selain tindak kejahatan konvensional, perawatan dan pengamanan tahanan serta pengelolaan barang bukti turut dibahas dalam rapat nanti. Termasuk penyelidikan dan penyidikan tindak pidana narkotika, psikotropika dan bahan berbahaya tetap menjadi perhatian jajaran pihak kepolisian. “Selain upaya penindakan hukum,

upaya pencegahan agar tidak terjadi tindak kejahatan juga menjadi perhatian utama kita. Maka setiap isu yang berkembang di masyarakat secepatnya akan kita tindak lanjuti. Semua itu dilakukan, agar personil lebih matang dalam menghadapi isu saat pemilu nanti,” kata dia. Kapolda berharap, peran masyarakat untuk membantu kepolisian menjaga kambtibmas sangat dibutuhkan. Menyampaikan informasi terkait isu yang berkembang terutama terkait masalah keamanan. Sehingga setiap permasalahan dapat diantisipasi cepat, Ke Halaman 15 kolom 5

Sabtu 20 April 2013

pro-kalbar Pontianak Post



Lomba Desa

Wakili Kalbar KETUA Tim Penggerak PKK Kabupaten Landak Ny Maria Bernadetha Adrianus, mengatakan dari lima kabupaten/ kota yang ada Desa Model yang dibina oleh Pemprov Kalbar, Kabupaten Landak merupakan desa model terbaik sehingga akan mewakili Kalbar ke tingkat nasional. Keberhasilan ini, tidak lepas dari kerja sama yang baik mulai dari masyarakat, PKK tingkat Desa, KecaMaria Adrianus matan sampai dengan Kabupaten. Terlebih dari dukugan dan semangat masyarakat yang ada di Desa model. “Ini merupakan sebuah kerja sama yang baik mulai dari Kelompok PKK yang ada di tingkat desa, Kecamatan sampai defan tingkat kabupaten termasuk dukungan penuh dari masyarakat yang ada di Desa Bagak Ke Halaman 27 kolom 5



TANPA JARING: Sebuah truk angkutan sawit melenggang di jalan tanpa jaring pengaman. Padahal, bisa saja tandan sawit tersebut jatuh ke jalan dan membahayakan pengguna jalan lainnya.

Wujudkan Bandara Tebelian

ilustrasi internet

Insentif Sapi Naik INSENTIF sapi bunting yang diserahkan kepada petani di Kelurahan Nyarumkop, Singkawang Timur mengalami peningkatan. Jika sebelumnya insentif sapi bunting yang diserahkan pada tahun 2012, Rp500 ribu/ekor meningkat menjadi Rp750 ribu/ekor pada tahun 2013 ini. Ketua Gerakan Peduli Masyarakat (GPM) Kota Singkawang, Marsianus Kodim mengatakan, meningkatnya jumlah insentif sapi bunting yang diserahkan itu karena GPM Kota Singkawang dianggap berhasil dan transparan dalam penyerahan bantuan ini pada tahun sebelumnya. Karena itu,lanjut Kodim,Singkawang merupakan satu-satunya Ke Halaman 27 kolom 1

Lewat TPA

Bina Usia Dini  WAKIL Bupati Sanggau Paolus Hadi, Kamis (18/4) kemarin secara resmi melakukan penancapan tiang pertama pembangunan Taman Pendidikan Al Quran (TPA) Nasrun Minallah III (tiga) di Dusun Jaya Indah Desa Bakti Jaya Kecamatan Meliau dan TPA Nasrun Minallah IV (empat) Dusun Tantang Jaya Desa Tapang Dulang Kecamatan Kapuas. Yang mana penancapan tiang pertama pembangunan kedua Paolus Hadi TPA tersebut diharapkan dapat dijadikan sebagai wadah pembinaan dan pembentukan watak anak dari usia dini. Wakil Bupati mengatakan selaku mewakili Pemerintah Kabupaten Sanggau sangat menyambut baik dengan dimulainya pembangunan kedua TPA tersebut. Pembangunan Ke Halaman 27 kolom 1

SINTANG- Bupati Sintang Milton Crosby berharap Dewan Perwakilan Daerah Republik Indonesia (DPD) Daerah Pemilihan Kalimantan Barat dapat mendorong percepatan pembangunan Bandara Tebelian di Kabupaten Sintang. Hal tersebut ditegaskan pada acara ramah tamah

dengan anggota DPDRI Asal Kalimantan Barat H. Ishaq Saleh di pendopo Bupati Jumat, (18/4). “Di kabupaten Sintang ada tiga proyek besar salah satunya Bandara Bertaraf Internasional Bandara Tebelian. Karena itu saya berharap DPDRI dapat membantu mendorong percepatan pembangunan

tersebut,” kata Milton. Untuk Pembangunan bandara tebelian Airport Pemerintah Kabupaten Sintang sudah membebaskan lahan mencapai 156 hektar. Lahan tersebut akan digunakan untuk landasan pacu dan penempatan sarana prasarana Ke Halaman 27 kolom 1

Perjuangkan Nasib Petani, Nelayan dan Buruh BENGKAYANG-Mengu­sung komitmen memperjuangkan nasib petani, nelayan dan buruh, Jumat (19/4) kemarin salah seorang tokoh pemuda Kalbar, Petrus SA SH mendaftarkan diri menjadi anggota Dewan Perwakilan Daerah (DPD) Kalbar. Dia melengkapi syarat utama yakni dukungan minimal 3.000 suara dari tujuh kabupaten kota. Petrus tak sendiri, mantan Ketua DPRD Kabupaten Bengkayang yang juga President Front Pembela Dayak Kalbar itu datang bersama Ke Halaman 27 kolom 1


DAFTAR: Petrus SA didampingi para pendukungnya, Jumat kemarin memasukkan berkas ke KPU Kalbar.

Rentang Kendali Panjang PUTUSSIBAU – Kabupaten Kapuas Hulu merupakan salah satu kabupaten terluas di Kalimantan Barat. Penyebaran penduduk dan wilayah terbentang di berbagai titik. Akibatnya, rentang kendali menjadi cukup panjang. “Karena rentang kendali yang panjang, berbagai urusan memakan waktu yang cukup lama. Selain itu,

berdampak pada akselerasi perkembangan berbagai sector di masyarakat menjadi lambat,” ungkap tokoh pemekaran, Juardi, S.Pd. Solusiuntukmemperpedek rentang kendali itu dikatakan Juardi salah satunya adalah pemekaran wilayah. Pembagian wilayah menjadi beberapa daerah pemerintahan. Sehingga rentang kendali dan

pelayanan semakin dekat ke masyarakat. “Hanya saja untuk merealisasikan itu bukan perkara gampang,” ujarnya.Diakui Juardi, upaya memperjuangkan pemekaran di Kabupaten Kapuas Hulu sudah pernah dilakukan pihaknya. Dimana diperjuangkan Ke Halaman 27 kolom 1

Kapuas Raya Terhalang Rekomendasi SINTANG – Anggota DPD asal mampu mengurus Kalbar sendirian,” Kalbar diminta membantu mendesak katanya. Komisi II DPR RI untuk mewujudkan Dia menegaskan pembentukan Provinsi Kapuas Raya. provinsi baru yaitu Apalagi, Anggota DPD RI Provinsi Kapuas Raya asal Kalbar, Ishaq Saleh tidak lagi untuk memjuga sangat mendukung percepat pembangunan terbentuknya Provinsi wilayah timur Kalbar Kapuas Raya. dan daerah perbatasan. “Kami DPD bersama “Pemekaran ini juga DPR RI asal Kalbar sangat untuk mempercepat mendukung pemekapembangunan di daerran Provinsi Kalbar. Tapi ah-daerah tertinggal dan memang ada satu syarat mempersempit rentang yang belum terpenuhi kendali pemerintah,” yaitu rekomendasi dari tegasnya. gubernur,” katanya. Milton juga menIshaq Saleh Ap a l a g i , l u a s n y a ganggap pembentukan wilayah Kalbar yang mencapai provinsi baru Kapuas Raya ini untuk 146.807 km2 atau sama dengan lu- memperkokoh NKRI di wilayah asnya Pulau Jawa ditambah Bali ini perbatasan. Keuntungan lain dari membuat rentang kendali pemerin- pemekaran, Kapuas Raya akan tah provinsi menjadi sangat besar. mendapatkan DAU sendiri untuk Akibatnya siapapun yang menjadi membangun wilayah timur. gubernur tidak akan mampu menBupati menegaskan, untuk ibu gurus pembangunan infrastruktur kota provinsi baru, Sintang sudah di Kalbar. Karena itu, Kalbar harus siap dan layak menjadi ibu kota. Dia dimekarkan menjadi tiga provinsi. mengatakan Pemkab Sintang telah Sementara Bupati Sintang, Mil- menyiapkan berbagai fasilitas untuk ton Crosby saat bertemu anggota mendukung terbentuknya provinsi DPD asal Kalbar, Ishaq Saleh, Jumat baru. (19/4). “Sintang sedang membangun ruMilton menilai, pemekaran mah sakit rujukan, lapangan bandara, provinsi Kalbar harus segera dilaku- listrik dan sudah menyiapkan lahan kan agar pembangunan daerah ini untuk kantor gubernur Kapuas Raya,” dapat dipercepat. ungkap Milton. “Bayangkan saja luas wilayah KaMilton mengatakan pembentulbar yang sama dengan Pulau Jawa kan Provinsi Kapuas Raya ini akan ditambah Bali hanya diurus oleh terwujud dalam waktu dekat karena seorang gubernur sementara di Pulau gubernur Kalbar sudah setuju. Jawa dan Bali ada tujuh gubernur. Be“Mudah-mudah tahun ini atau lum lagi bicara soal DAU, Kalbar kecil tahun depan dapat terwujud,” harapsekali. Akibatnya siapapun tidak akan nya. (tra)

Pengakuan DS, Istri yang Mengotaki Pembunuhan Suami

Sering Terima Kekerasan, Siap Dinikahi Selingkuhan


DS (23) warga Paket C Desa Kamuh Kecamatan Tujuh Belas, Kabupaten Bengkayang tega membunuh suaminya, Saprianto (32) yang tinggal serumah dengannya. Apa yang melatarbelakanginya, sehingga dia nekad membunuh suaminya yang keseharian bekerja sebagai tukang? Berikut pengakuan DS, disela-sela rekontruksi yang dilakukan Kamis (18/4) siang di rumahnya. Zulkarnain, Paket C Desa Kumuh SUGENG/PONTIANAKPOST

PASANG TIANG: Lubang membahayakan di kota Sanggau ditutupi dengan sebuah tiang agar menjadi peringatan pengguna jalan lainnya.

MOTOR yang dikendarai DS, terhenti. Di depannya sudah ada seorang pemuda tampan. Pemuda itu lantas meminta


REKA ULANG: Tersangka Hat, yang ikut ambil bagian menghabisi suami DS. Meski demikian, DS siap dinikahi Hat jika kelak mereka bebas.





nomor ponsel yang digunakan DS. Ternyata, DS langsung memberi. Tak lama DS langsung pergi meninggalkan pria itu. Pertemuan kali pertama itu terjadi satu tahun lalu. Ternyata, pertemuan itu, menimbulkan benih-benih cinta antara DS dan Hat, pria yang bekerja sebagai operator tover milik telpon selular. Walaupun DS sudah punya suami dan beranak satu, rasa cinta itu tak bisa dipendam. “Saya mencintai Hat,” kata DS yang masih mengenakan pakaian tahanan Polres Bengkayang. Hubungan mereka berlanjut. Tidak ada lagi yang bisa memisahkan antara mereka berdua. Hubungan mereka ini ternyata tercium oleh orang tua DS. Orang tua DS pun marah. Dia pun melaporkan perselingkuhan DS dan Hat itu ke Polres Bengkayang, Oktober 2012. Laporan ke polisi tak membuat cinta DS kepada Hat itu terhambat. Dia tetap menjalin asmara terlarang. Hat yang sempat ditahan oleh polisi, akhirnya dilepas karena orang Ke Halaman 27 kolom 1


SMAN 2 Batu Ampar Diresmikan PEMERINTAH Kabupaten Kubu Raya terus melakukan pembenahan kuantitas dan kualitas pendidikannya, seperti melakukan penataan infrastruktur, fasilitas dan mutu pendidikan, seperti membangun SMA Negeri 2 di Kecamatan Batu Ampar. Keberadaan sekolah tersebut sejak 2012, membuka penerimaan siswa-siswi baru. Sekolah yang baru memiliki 40 pelajar dengan 6 tenaga pengajar yang Muda Mahendrawan terdiri dari 2 orang guru PNS dan 4 orang tenaga honorer Bupati Kubu Raya, Muda Mahendrawan mengatakan pembangunan sekolah tersebut adalah bentukkepeduliandanperhatianseriuspemerintah terhadappeningkatanpelayananpendidikan kepadamasyarakat.Terutamadalamupayauntuk membuka peluang masyarakat untuk terdidik. “Pemerintah terus beupaya membuat terobosan dan upaya-upaya yang maksimal mulai dari penataan infrastruktur pendidikan, fasilitas serta kemudahan lain yang dimaksudkan untuk memudahkan masyarakat untuk mendapatkan pendidikan,” katanya, Jumat (19/4). Dia menegaskan membangun sekolah, membangun pendidikan adalah tanggungjawab pemerintah dan hak masyarakat yang harus dipenuhi. “Sejak awal, Pemkab sangat konsen terhadappembangunanpendidikandiKubuRaya dengan standar wajib belajar adalah 12 tahun. Menurutnya, membangun pendidikan yang baik bagi masyarakat adalah tanggungjawab semua pihak, peran pemerintah adalah membuka akses dan memperpendek jarak pelayanan kepada masyarakat. Pemkab akan terus menata fasilitasfasilitas pendidikan secara bertahap, yakni dengan memperbaiki dan menambah unit sekolah baru. “Senua muaranya adalah bagaimana supaya masyarakat terlayani dengan baik. Salah satu bentuk perhatian nyata dari pemerintah, lanjut dia adalah dengan terus menambah dan memperbaiki fasilitas sekolah seperti gedung sekolah dan fasilitas pendukung lainnya. Salah satunya dengan membagun sekolah baru di Batu Ampar, yaitu Sekolah Menengah Atas Negeri 2 Batu Ampar,” tuturnya. Kepala Dinas Pendidikan Kabupaten Kubu Rays, Frans Randus berharap masysrakat membangun rasa memiliki SMA Negeri 2 tersebut, yakni dengan sama-sama nenjaga dan memeliharademikelangsunganprosesbelajar-mengajar yang baik di Desa Batu Ampar. “Terkait dengan kekurangan tenaga pengajar akan disesuaikan dengankebutuhandanketersediaantenagaguru yang ada,” terangnya. Sementara itu. salah seorang warga setempat, Sutinah pembangunan sekolah tersebut sudah lama diinginkan masyarakat, untuk melanjutkan pendidikan anak-anak mereka. Karena selama ini setelah tamat SMP harus melanjutkan pendidikan ke daerah lain, yakni di Padang Tikar. “Kami sangat bersyukur kepada Pemkab yang peduli dengan pendidikan di Batu Ampar. (adg)


Pontianak Post


20 April 2013

Tour Kewirausahaan Siswa Berprestasi


MEMBAHAYAKAN: Lubang di tikungan Jalan Soekarno – Hatta, Kubu Raya, sangat membahayakan. Seiring bertambah waktu, kondisi lubang semakin melebar dan dalam.

14 Tahanan Polsek Dipindah ke Polresta SUNGAI RAYA- Sejumlah 14 tahanan di Markas Polisi Sektor (Polsek) Sungai Raya Kabupaten Kubu Raya dipindahkan ke tahanan Polresta Pontianak, Kamis (18/4)lalu.MenurutKapolsekSungaiRaya, AKBPSugiyonopemindahanitudilakukan lantaran ruang tahanan sedang dilakukan perbaikan. Dia mengatakan pihaknya tidak ingin aksi tahanan kabur kembali terulang, sehingga sel yang sebelumnya pernah dijebol oleh tahanan dilakukan perbaikan dengan pemasangan besi baja pada dindingdindingseltahanan.“Tahananakanberada di Mapolresta Pontianak hingga proses perbaikan sel selesai. Sehingga diharapkan tidak ada lagi tahanan yang bisa melarikan diri,” katanya, Jumat (19/4).

Seperti diketahui, lanjut dia beberapa bulanyanglalu,duatahananberhasilmelarikan diri dengan menjebol dinding tahanan. Sehingga jika tidak dilakukan perbaikan dikhawatirkankejadiansepertiituakanterulang kembali. “Kita tidak mau kecolongan, sehingga antisipasi sedini mungkin harus sudah dilakukan,” terangnya. Jika renovasi rumah tahanan di Polsek SungaiRayasudahselesai,diamenambahkan makake14tahananyangkitatitipkanke Mapolresta Pontianak akan dikembalikan untuk dilakukan penahanan. “Kalau perbaikan rumah tahanan kita sudah selesai, jelas tahanan akan kita ambil kembali. Dan kita akan lebih aman karena tidak ada peluang bagi mereka untuk melarikan diri atau kabur,” ucapnya.

Terkaidenganduatahananyangberhasil melarikandiri,diamenegaskankasustersebut akan menjadi prioritas pihaknya untuk melakukanpenangkapankembali.Sampai saat ini pihaknya telah mengumpulkan informas tentang keberadaan dua tahanan itu. “Kasus itu menjadi pekerjaan rumah kita untuk segera diselesaikan,” tuturnya. Dia menjelaskan ke 14 tahanan yang saat ini sudah dipindahkan ke MapolrestaPontianakmerupakanparatersangka, dengan tindak pidana pencurian dengan pemberatan, pencurian dengan tindak kekerasan, dan pencurian kendaraan bermotor. Yang mana barang bukti hasil curian tersangka sudah dilimpahkan pihaknya ke Kejaksaan Negeri untuk dilakukan proses selanjutnya. (adg)

SUNGAI RAYA-Pemerintah Kabupaten Kubu Raya menjanjikan akan memberikan hadiah bagi sepuluh siswa peserta ujian nasional tingkat SMA/ MA dan SMK yang mampu meraih prestasi nilai tertinggi. Bupati Kubu Raya, Muda Mahendrawan mengatakan hadiahnya, akan langsung serahkan kepada siswa, seperti pada tahun sebelumnya. Dimana siswa dengan nilai tertinggi akan mendapatkan tour kewirausahaan untuk menambah pengetahuan siswa dan mempersiapkan mereka menjadi wirausahawan muda yang andal. “Untuk lokasi tournya memang sampai saat ini belum ditentukan. Tahun sebelumnya kita memilih Pusat Pelatihan Kewirausahaan Sampoerna, namun pada tahun ini bisa saja di luar kota dan bisa juga di Kubu Raya. Yang jelas kita akan memberikan penghargaan kepada siswa seperti tahun lalu,” katanya, Jumat (18/4). Diamenyatakan,Pemkabsengajatidakmemberi penghargaanberupabarangdanuangkepadasiswa, namunhaltersebutdigantibentuknyamenjaditiket untuk pendidikan kewirausahaan dan karakter di pusat pendidikan dan latihannya langsung untuk membangun pemikiran baru bagi siswa sekaligus bekal berharga bagi mereka setelah lulus dari SMA. Dengan adanya pelatihan itu, lanjut dia tentu akan membangun pola pikir siswa agar lebih tangguh dan mampu mandiri. Diharapkan siswa akan menularkan apa yang didapatkannya kepada orang lain. “Yang jelas pelatihan kewirausahaan dan pendidikan karakter itu kita lakukan sesuai denganprogrampemkabyangsudahmembangun pendidikan kewirausahaan dari awal masa pemerintahan dan program itu akan terus dimatangkan,” ucapnya. Dari hasil UN tersebut, dia menyebutkan bahwa pintar saja tidak cukup, karena perlu pembangunan karakter dari siswa yang lulus dengan nilai tetinggi, setidaknya hal itu menjadi motivasi bagi siswalainnyayangakanmenghadapiUN.Pihaknya pun merencakanan pelatihan kewirausahaan tidak hanya diberikan kepada pelajar berprestasi yang akan dikirim ke pusat pelatihan tetapi tokoh pemuda, perwakilan Sarjana Pendamping Desa, Komite kesehatan desa dan perwakilan UMKM yang ada di kabupaten akan diikutsertakan. Bupati berharap peserta tour kewirausahaan yang akan diutus itu bisa menimba ilmu kewirausahaan di tempat pelatihan dan bisa membagi ilmunya kepada masyarakat lain di Kabupaten Kubu Raya. (adg)

FAD Kunjungi Arpusda Kubu Raya SUNGAI RAYA-Sejumlah 60 anak dari Forum Anak Daerah (FAD) Kabupaten Kubu Raya mengunjungi Kantor Kearsipan dan Perpustakaan (Arpusda) Kabupaten Kubu Raya. Anak-anak yang masih duduk di SMP dan SMA itu pun mengaku koleksi buku di Arpusda sangat lengkap. Salah seorang anggota FAD, Zaki mengaku selama ini dirinya hanya mengetahui jika Perpustakaan Daerah itu hanya ada di Kota Pontianak. “Kita baru tahu keberadaan

perpustakaan daerah di Kantor Kearsipan dan Perpustakaan Daerah (Arpusda) ternyataa juga ada di Kubu Raya,” katanya, kemarin. Presidium FAD Kubu Raya 2013, berjanji akan menyosialisasikan dan mengajak teman-teman lainnya untuk selalu mendatangi Perpustakaan Daerah sebagai tempat bahan bacaan guna menambah pengetahuan dan bahan referensi. Yang mana akhirnya akan dapat menumbuh

kembangkan minat baca,. “Saya salut dengan koleksi buku di Kantor Arpusda Kubu Raya. Karena selain jumlahnya yang banyak juga jenis-jenis bukunya sangat bermutu dan lengkap. Bahkan koleksi buku-buku fiksi dan nonfiksi juga ada,” ucap Zaki. Pembina FAD Kabupaten Kubu Raya, Kusna Yunaida menjelaskan FAD yang dibentuk sejak empat tahun silam itu lebih dominan diisi para pelajar SMP maupun SMA. Mereka direkrut dari sejumlah seko-

lah di sembilan kecamatan. “Forum ini kita bentuk agar menjadi wadah penampung aspirasi dari permasalahan anak-anak yang kemudian akan disampaikan ke masingmasing SKPD,” ungkapnya. Dia menjelaskan, kunjungan ke Perpustakaan Daerah diharapkan akan memberikan manfaat mendorong anak-anak untuk lebih giat mengembangkan kreatifitasnya melalui buku bacaan dan dapat mengetahui berbagai ilmu. (adg)

Pontianak Post


20 April 2013




Dikalahkan Pileg AKTIVITAS proses Pilkada Bupati dan Wakil Bupati Kabupaten Mempawah yang akan dihelat September 2013 sepertinya terhenti. Itu semua terlihat jelas, sejak proses pencalegan bakal calon (balon) anggota DPRD Kabupaten Mempawah untuk pemilu legilsatif 2014. Pasalnya, semua pimpinan partai politik yang dipastikan sebagai penggusung pasangan balonkada, sibuk mengurus kelengkapan administrai bakal calon anggota legislative (balonal) yang mereka persiapan untuk ikut berkompetisi pada pemilu legislatif 2014 untuk empat daerah pemilihan di Kabupaten Mempawah. MenurutpantauanKoraninidilapangan,pemilihan anggota legislative (pileg) mengalahkan suksesi Pemilihan Kepala Daerah (Pilkada). Sebab, pilag terkait nasib berseorangan. Sedaagkan Pilkada menyangkut pasangan yang diusung oleh parpol maupun yang memakai jalur perseorangan. “Kalau saya amati kesibukan dilapangan memangsepertiitu.Karenasemuabalonsibukngurus kelengkapanadministrasipribadimulaidqariSurat Keterangan Kesehatan, Surat keterangan tidak terlibat Narkoba dan sidik jari dari Polres,” nilai Yudho Seseno angota KPU dikonfirmasikan. Disebutkan, khusus Kabupaten Mempawah pada tahun 2013 ini ada moment besar berupa Pemilihan Kepala Daerah Bupati dan Wakil Bupati periode 2013-2018. (ham)


Diadukan Petani PETANImengadukanaktivitasPTCalindoPalm Oil (CPO) dan PT Tiga Pilar Sejahtera (TPS) di Desa Semunti Kecamatan Air Besar Kabupaten Landak ke DPRD Landak. Menurut mereka sawah mereka terendam lumpur setinggi 60 cm akibat aktivitas perusahaan. Matius, pemilik lahan sawah dihadapan anggota dewan yang terhormat mengatakan pada awalnya kejadian tersebut di mana lahan sawah yangberjarak3Kmdarilokasiperusahaanternyata di tumpukan tanah setinggi 1 meter padahal jalan tersebut bukan milik perusahaan sehingga akibat tumpukan tanah tersebut turun dan tertimbun di sawah masyarakat. Dengan kejadian tersebut pihak masyarakat sangat keberatan sehingga melapor ke pihak perusahaan dengan tujuan agar tumpukan tanah tersebutdibuangdanparityangtertutupolehtanah tersebut. “Ini sudah kita laporkan ke perusahaan tetapi tidak ditanggapi. Mereka minta agar perusahaan membuang tumpukan tanah di sawah saya dan mengeruk parit sawah yang di isi oleh lumpur, “ ungkapnya. (wan)


GUNAKAN MESIN: Pembangunan ruko berlantai tiga dengan cor beton di komplek Pasar Pinyuh mengunakan tenaga mesin demi mengejar target penyelesaian.

Baru 2 Parpol Serahkan berkas MEMPAWAH- 22 April 2013 merupakan batas waktu yang ditentukan Komisi Pemilihan Umum (KPU) bagi semua parpol peserta pemilu legislatif 2014, untuk menyerahkan berkas-berkas persyaratan bakal calon anggota legislatif 2014. HIngga jumat (19/4) kemarin, KPU baru menerima dua parpol yang resmi menyerahkan. Selain PAN, disusul PDIP. Sementara 9 parpol lainnya masih bergelut dengan melengkapi persayaratan bai setiap balon caleg mereka. “Hingga jumat, KPU memang baru menerima dua parpol yang menyerahkan berkas,” kata Ruspandi, anggota KPU Mempawah dikonfirmasikan koran ini kemarin. Terkait sisa waktu yang tersedia, sepertinya KPU Mempawah tidak mengenal istilah hari libur (minggured). Sekretariat KPU hari Minggu 21 April tetap akan hingga pukul 15.00 WIB. Itu semua untuk memberikan

Pada dasarnya, semua balon caleg dari empat daerah pemilihan sudah siap. Kita akan serahkan berkas-berkas kelengkapan balon caleg. Dalam penyerahan berkas, Golkar memang tidak terburu-buru. H Dudung As kesempatan bagi semua parpol yang belum menyerahkan daftar caleg yang bakal diajukan. Sementara DPD Partai Golkar Kabupaten Mempawah, akan menyerahkan berkas kepada KPU sabtu hari ini.

“Pada dasarnya, semua balon caleg dari empat daerah pemilihan sudah siap. Kita akan serahkan berkas-berkas kelengkapan balon caleg,” terang H Dudung As S.Sos, Ketua Harian DPD Golkar. Dalam penyerahan berkas, Golkar memang tidak terburu-buru. Dan tetap sesuai batas waktu yang ada dan ketentuan yang berlaku. Munir Putra ST M.Si, Ketua KPU Kabupaten Mempawah menyebutkan, 22 April merupakan batas akhir penyerahan berkas-berkas terkait balon caleg dari empat dapil. Setelah itu, KPU baru akan melakukan verifikasi kembali menyangkut kelengkapan berkas yang disampaikan parpol. Sesui jadwal yang sudah ditentukan KPU, proses masih panjang. Termasuk penggantian balon caleg jika dalam verifikasi KPU ditemukan kejanggalan-kejanggalan seperti penggunaan ijazah palsu misalnya. (ham)

Tak Ada Intruksi Angkat Guru Honorer KEPALA Dinas Pendidikan (Disdik) Kabupaten Landak, Aspansius menegaskan bahwa Disdik Landak tidak pernah mengintruksikan kepada sekolah-sekolah yang ada di Landak untuk mengangkat tenaga guru honorer. Hal tersebut ditegaskan Aspan saat melakukan pertemuan dengan sejumlah tenaga guru honorerK2Landak,Selasa(17/4) di aula besar Kantor Bupati Landak. “Tetapi karena sekolah-sekolah yang ada di Landak ini sangat membutuhkan sekali tenaga guru, sehingga proses belajar mengajar itu paling tidak berjalan semestinya, makanya sekolah diberi kesempatan untuk menerima guru-guru yang bukan PNS dalam bentuk pengangkatan Guru Tidak Tetap

(GTT),” ujar Aspan. Dijelaskannya,didalamPeraturan Menteri Negera Pendayagunaan Aparatur Negara dan Reformasi Birokrasi tahun 2006, memang sudah melarang Pemerintah Daerah untuk mengangkat tenaga honor. “Makanya, bagi mereka yang diangkat tenaga honor pada tahun 2005 ke bawah supaya didata yang disebut dengan data base dan ada di Badan Kepegawaian Negara (BKN) Pusat melalui Badan Kepegawaian Daerah (BKD) masing-masing Kabupaten/Kota dan Provinsi se Indonesia,” katanya. Sehingga tambah Aspan, tenaga honor dengan batas waktu tahun 2009 supaya diangkat sebagai PNS. Tapi ternyata pada tahun 2009 juga belum mengakomodir semua tenaga

honor. “Maka dilakukan kembali pemuktahirandatatenagahonor pada tahun 2010. Artinya, pemuktahiran data ini merupakan tenaga honor yang diangkat tahun 2005 ke bawah. Oleh karena itu kita tidak berani lagi meminta kepada sekolah untuk mengangkat tenaga honor didalam SK Kepala Sekolah, yang ada hanya GTT. Sebab GTT ini tidak menuntut untuk diangkat PNS, karenabukankewenangansekolah dan Disdik Kabupaten/Kota. Yang berwenang mengangkat yakni di BKN,” jelasnya. Dikatakannya,DisdikLandak sendirimengintruksikankepada pihak sekolah untuk melakukan pengangkatan terhadap GTT. Pengangkatan inipun dalam bentukpembagiantugasmengajar setiap semester. (wan)

Apresiasi Kinerja PDAM MEMPAWAH- Beberapa Lembaga Swadaya Masyarakat (LSM) memberikan apresiasi terhadap kinerja PDAM Mempawah terkait upaya dan usahanya dalam memperluas jaringan baru maupun mengaktifkan kembali sambungan rumah (SR) yang kurun waktu lama tidak aktif. “Realita dilapangan menyebutkan banyak pihak menyambut gebrakan yang dilakukan Bupati terkait harapan masyrakat yang memang mendambakan sarana air bersih, “ nilai Jamaludin HZ Koordinator LSM KPK bersama Samiun H Ilyas Ketua LSM Putra Bangsa serta Malik Ibrahim Har Ketua Forum Rembuk Masyarakat (Formas) Kabupaten Mempawah kepada koran ini. Dengan telah dibangunnya jaringanindukpipanisasiPDAM dari Tanjung Berkat hingga Sui Pinyuh, tentu diharapkan kedepanya akan memberikan konstribusi yang besar bagi perkembangan PDAM itu sendiri serta masyarakat. “Air bersih merupakan salah satu kebutuhan vital bagi kehidupan manusia. Terobosan Ria Norsan Bupati bersama Direktur PDAM layak diacungkan jempol,” nilai ketiga pengurus LSM itu. Dilain pihak, realiasais jaringan pipa induk yang terpasang itu, bentuk nyata dari apa yang pernah dijanjikan Bupati Ria

Norsan ketika tahun 2008 lalu mensosialisasikan janji-janjinya. Satu diantaranya adalah pelayanan jaringan air bersih. ‘Kami menilai positif, apa yang diberikan Bupati pada saat lounching pengaliran air kran pertama milik PDAM. Dimana, Bupati memberikan subsidi 50 persen bagi 100 pelanggan pertama,” kata mereka. Pengurus LSM melihat, Sui Pinyuh komplek merupakan potensi yang cukup besar untuk pengembangan PDAM kedepan. Wajar kiranya, pelanggan yang sudah tidak aktif kembali dihidupkan. Kedepan, kebutuhan air bersih akan sangat didambakan masyarakat pertokoan dan perumahan biasa. Luasnya jangkauan jaringan yang ada, tentu akan semakin mempermudah bagi mwarga untuk minta pasangan baru. “S ebagai kompenen masyarakat, kami mengharapkan kinerja PDAM dibawah komando Ir Zainul Arifin selaku Direktur akan semakin baik,” support mereka. Menurut penilaian LSM, maju mundurnya sebuah perusahaan seperti PDAM, akan sangat ditentukan oleh kemampuan manajemen seorang direktur. Mampu mengakomodir kemampuan SDM yang dimiliki serta menempatkan sesuai kemampuan yang dimiliki. (ham)


2.815 Peserta Tidak Rontok KEPALABidang(Kabid)PendidikanMenengah (Dikmen), Dinas Pendidikan Kota Singkawang, Andi Nasrullah, mengatakan sebanyak 2.815 peserta UjianNasional(Unas)2013, untuk jenjang SLTA sederajat, keseluruhan jumlah siswa tersebut bisa mengikuti pelaksanaannya. “Tidak ada siswa yang tidak ikut pelaksanaan Unas, artinya dari jumlah yang ada, semua ikut,” kata Andi, Kamis (17/4) lalu di Singkawang. Andi Nasrullah Menurut Andi, selain diikuti seluruh peserta Unas, dia juga mensyukuri pelaksanaannya secarakeseluruhanberjalanlancar. “Alhamdulillah, semuanya lancar,” katanya. Ketika ditanya mengenai dokumen Unas setelahdikerjakansiswa,dikatakanAndi,untuknaskah soal, masih diamankan sampai dengan selesai pengumuman nanti. Sementara untuk lembar jawaban, dikirim ke Universitas Tanjungpura (Untan) Pontianak, selaku pihak penyelenggara Unas. “Kalau soal masih kita simpan, tapi untuk lembar jawaban kita serahkan ke Untan, jadi bukan kita yang melakukan koreksi hasil Unas para siswa,” katanya. (fah)


Pontianak Post

DINAS Pendidikan Kota Singkawang mengingatkan agar para guru di Kota Seribu Kelenteng ini jangan ‘galau’ menghadapi kurikulum baru tahun 2013. “Memang ada perbedaan antara kurikulum sebelumnya dengan kurikulum 2013. Meski ada perbedaan, guru-guru jangan galau lah menghadapi kurikulum baru ini,” terang Kepala Dinas Pendidikan Kota Singkawang melalui kepala Seksi (Kasi) Kurikulum Bidang Pendidikan Dasar, Anita, baru-baru ini. Ia menegaskan sebagai tenaga pengajar, maka guru harus bisa menunjukkan sikap profesional, dalam menerima perubahan kurikulum. “Suka-suka tidak suka, sebagai tenaga pendidik harus siap menerimanya,” tukas Anita. Yang terpenting, kata Anita, bagaimana masing-masing sekolah melakukan penguatan terhadap tim pengembangan kurikulum dan tim kelompok belajar. Namun, dia memastikan bahwa Dinas juga tidak akan menutup mata, melainkan tetap melakukan sosialisasi kurikulum baru ini ke stakeholder dan instansi terkait lainya. “Baik itu standarisasi isi kurikulum dan evaluasinya, akan dibahas melalui stakeholder dan instansi terkait lainnya,” imbuhnya. Sebaliknya, Anita menilai dengan adanya kurikulum baru, malah meringkankan beban guru. Ini lantaran, ditambahkan dia, para guru kelak tidak sibuk membuat silabus atau materi pembelajaran. Dengan begitu, para guru diharapkan juga bisa memaksimalkan pembelajaranya. “Kurikulum baru ini tidak memberatkan guru, justru memaksimalkan pembelajaranya yang tidak hanya di dalam kelas, maupun di luar kelas,” sebutnya. Tidak hanya itu, jelas Anita, pemerintah juga sudah mempersiapkan buku pembelajaran beserta penunjang lainnya, untuk mendukung terbentuknya Kurikulum 2013 ini. (mse)

20 April 2013

Tukang Cukur Diusir


Guru Jangan ‘Galau’



BERSEPEDA: Siswa Singkawang lebih memilih bersepeda dibanding kendaraan bermotor lainnya untuk berangkat ke sekolah. Di samping sehat, tentu saja bebas polusi.

Hilangkan Kesan Ujung-ujungnya Duit SINGKAWANG - Seluruh Anggota Korpri Kota Singpegawai negeri di jajaran kawang, Rabu (17/3) lalu. Pemerintah Kota SingPenting juga, diingatkan kawang, harus aktif turun dia, yang harus dilakukan ke lapangan, agar mengePNS, yakni harus bisa tahui keluhan-keluhan menghilangkan kesan bahyang dihadapi masyarakat. wa pelayanan diberikan Penting juga, para abdi tergantung jika ada duitnegara tersebut harus bisa nya. “Sejak dini, adanya menghilangkan kesan bahanggapan dari masyarakat wa memberikan pelayanan bahwa pelayanan tergankepada masyarakat, ujungtung duit, harus dihilanujungnya duit. gkan, terlebih di masa peWakil Wali Kota Singmerintahan Aidol (Awang kawang, Abdul Mutalib, Ishak dan Abdul Mutalib, menegaskan agar semua Red) sekarang ini,” katanya. pegawai negeri sipil (PNS) Mutalib pun menegaskan jangan sampai mendahulubahwa dirinya tidak mau kan kepentingan pribadi. lagi mendengar keluhan Namun, dia menambahmasyarakat, mengenai Abdul Mutalib kan, bagaimana mereka lebih menguta- adanya pungutan uang yang dilakukan makan pelayanan kepada masyarakat. PNS, di saat ada warga mengurus sesuatu, PNS, menurutnya, juga dituntut aktif di mana hal tersebut tidak dibenarkan untuk turun di tengah-tengah masyarakat, oleh peraturan. agar mengetahui seperti apa permasala“Jangan sampai ada keluhan masyarakat han yang dihadapi mereka. “Seorang PNS, mengenai adanya pungutan sejumlah harus jeli melihat, mendengar, agar tahu uang (di luar ketentuan yang berlaku) keluhan masyarakat, sehingga apa peran ketika warga sedang berurusan dengan PNS bisa dirasakan warga,” kata Mutalib, birokrasi. Jangan ada kesan pengurusan ditemui usai membuka kegiatan Sosial- tersebut akan lancar jika ada duit, dan tidak isasi Peraturan Pemerintah (PP) Nomor lancar kalau tidak ada duitnya,” katanya. 53 Tahun 2010 tentang Disiplin PNS dan Kalaupun masyarakat Kota Singkawang PP Nomor 42 Tahun 2004 tentang Pembi- menemukan kejadian tersebut, Mutalib naan Jiwa Korps dan Kode Etik PNS untuk meminta agar segera dilaporkan kepadan-

ya langsung, disertai dengan bukti-bukti. “Silakan laporkan saja, karena memang hal tersebut tidak dibenarkan,” katanya. Dalam melaksanakan tugas, mantan anggota DPRD Kota Singkawang tersebut menegaskan bahwa PNS sudah jelas dan memiliki aturan main. Namun, demi kebaikan bersama, sebagai seorang wakil kepala daerah, dirinya menerima teguran atau pembenaran dari bawahannya, jika melakukan kesalahan. “Seorang pimpinan bukanlah raja, artinya jika memang saya salah, meski itu pejabat di bawah saya, jangan segan-segan menegur. Karena kalau itu salah dan tidak berani menegur, semuanya bisa masuk dalam lubang,” katanya. Sebagai pejabat di pemerintahan, dikatakan Mutalib, PNS juga harus transparan, baik dalam pengambilan keputusan ataupun dalam pemberian pelayanan. Para PNS juga diminta untuk bisa mempertanggungjawabkan segala sesuatu yang berkenaan dengan kebijakan tersebut. “Korpri sebagai wadah PNS, juga harus bisa membantu dalam rangka meningkatkan pengabdian PNS kepada masyarakat,” pesannya. Mutalib juga mengingatkan mengenai kenetralan PNS di dalam dunia politik. “PNS harus memperkokoh kenetralannya dalam dunia politik, tapi bagaimana mengabdikan dirinya kepada Negara dan bangsa,” katanya.(fah)

SINGKAWANG – Tukang cukur rambut diusir oleh panitia pertandingan sepakbola yang akan digelar di tanah kosong, persis di samping Gang Bhkati Jalan GM Situt, Kelurahan Pasiran, Singkawang Barat. “Saya tidak dibenarkan bekerja lagi, karena ada pertandingan sepakbola. Padahal, itu bukanlah lapangan sepakbola. Mengapa saya harus diusir. Saya hanya mencari makan. Menafkahi istri yang sedang lumpuh,” kata Firnandus alias Afui, tukang cukur yang dimaksud, kepada Pontianak Post, kemarin, di Singkawang. Menurut dia, mulai besok dia sudah tidak diperkenankan lagi membuka usaha di tempat di mana dia mengais rezeki. “Mulai hari Minggu (besok, Red) nanti saya setop. Sampai kapan saya tak tahu?” kata Afui. Dia juga mengaku tak mengetahui bagaimana kelanjutan usahanya tersebut. “Saya tak tahu harus buka di mana selama mereka bertanding? Saya butuh makan dan menghidupi istri. Apa salah saya sehingga harus diganggu? Di tempat usaha saya saja tidak ada sewa. Saya hanya menumpang di pos milik partai,” kata Afui menceritakan. Dia meminta perhatian dari semua pihak agar bisa membantu meringankan apa yang dialaminya tersebut. “Saya orang kecil. Tak tahu harus mengadu ke mana. Saya tiap hari pukul tujuh pagi (07.00 WIB) sampai pukul tiga sore (15.00 WIB) bekerja. Tak tahu siapa yang bisa dihubungi? Saya berharap ada kejelasan dari usaha ini,” katanya. Sementara itu, menurut sejumlah warga, dulu atau sekitar 2 tahun yang lalu, pernah digelar pertandingan sepakbola di lapangan tersebut. Alhasil, terjadi keributan. “Kita khawatir terjadi keributan seperti 2 tahun lalu. Apalagi, hampir setiap kali pertandingan sepakbola selalu saja ribut. Bagaimana jika keributan itu sasarannya kami warga setempat? Siapa yang bertanggungjawab nanti? Itu kan bukan lapangan sepakbola, melainkan hanya tanah lapang,” kata warga yang namanya enggan dikorankan. Diakuinya, kepolisian tidak pernah mengeluarkan izin mengenai penggunaan tanah lapang tersebut untuk pertandingan sepakbola. “Tapi, ada spanduk Brigif 19/Khatulistiwa yang mau ulang tahun. Mungkin panitia menggandeng Brigif 19/KH. Saya sudah tanya ke polisi, tidak pernah izin dikeluarkan hingga hari ini,” kata warga menginformasikan. Sebelumnya, berdasarkan informasi, pihak panitia pertandingan telah menghubungi Polres Singkawang, untuk meminta izin menggelar pertandingan sepakbola yang dinamai Liga Pedagang. Kajian intelijen, lokasi lapangan tersebut bukan merupakan lapangan sepakbola, melainkan hanya tanah lapang milik seorang pengusaha. Kepolisian akhirnya tidak mau mengeluarkan izin lantaran khawatir berdampak pada warga Gang Bhakti dan masyarakat umum yang melintas, termasuk lalu lintas kendaraan yang cukup padat. (zrf)

Liburan, Tempatkan Penjaga Pantai SINGKAWANG – Ketua Koordinator Wilayah Tagana Singkawang, Zulfian Agus, meminta kepada para pengelola pantai di Kota Singkawang, agar dapat menyiapsiagakan anggota pemantau pantai, apalagi saat menjelang liburan sekolah. Selain itu, ia juga mengingatkan agar para penjaga pantai dari pengelola, dapat mewajibkan pelampung jaket untuk anak-anak yang berusia di bawah 15 tahun “Ini untuk mengurangi dan sebagai langkah antisipasi agar anak-anak tidak tenggelam karena terseret arus gelombang,” kata Zulfian, kemarin, di Singkawang. Tidak hanya itu, Zulfian juga meminta agar penjaga pantai dapat memberikan imbauan, dengan menggu-

nakan pengeras suara, serta memasang papan plang imbauan. “Pemantau pantai tidak segan-segan memberikan imbauan, dengan menggunakan pengeras suara, sambil berjalan-jalan ke pantai,” jelas Zulfian. Menurutnya, dengan mengambil langkah-langkah tersebut, maka diharapan tidak ada lagi korban menjelang liburan sekolah mendatang. Senada dengan itu, Dedi Suryadi, warga Kota Singkawang, juga berharap agar para pengelola pantai, tidak hanya mengambil keuntungan dari para pengunjung yang datang, tetapi juga dapat menyiagakan para petugasnya. “Petugas atau pengawas tidak hanya di-standby-kan

di pantai, tapi juga di kolam renang,” kata dia. Menurutnya, dengan adanya penempatan petugas, maka dapat memberikan rasa aman kepada pengunjung. Selain ke pengelola pantai, Dedi juga mengingatkan agar para orang tua, maupun pembina yang membawa anak-anak maupun anak muridnya, harus selalu mengawasi gerak gerik anak-anak tersebut selama berada di pantai maupun kolam renang. “Orang tua maupun pembina harus mengawasi terus, jangan sampai teledor,” ujarnya. “Baik pengelola, sekuriti, pengawas, pihak kepolisian, dan orang tua diharapkan untuk bisa meningkatkan pengawasannya menjelang liburan sekolah,” pungkasnya. (mse)

Pontianak Post


Sabtu 20 April 2013



Jangan Percaya


KEPALA Satuan Polisi Pamong Praja(SatpolPP)KabupatenSambas, Razia Aprianto, mengimbau agar masyarakat tidak mudah percaya terhadap berbagai modus penipuan. Dia memisalkan seperti iming-imingan ada pihak yang dapat meloloskan sese­ orang menjadi anggota Satpol PP di Kabupaten Sambas. Kasatpol PP meminta agar masyarakat dapat mempertanyakan Razia Aprianto sesuatu tersebut kepada pihak yang lebih berwenang. “Masyarakat jangan mudah percaya jika ada seseorang yang mengaku dapat meloloskan seseorang itu menjadi anggota Satpol PP, mengenai penerimaan pegawai, khususnya anggota Satuan Polisi Pamong Praja Kabupaten Sambas,” ungkapnya. Mengenai pihak yang lebih berwenang akan hal ini, menurut dia, tentu pihak Badan Kepegawaian Daerah (BKD) lebih memahami prosedur penerimaan aparatur. Agar tidak tertipu, dia menyarankan, jika ada masyarakat yang mendapat tawaran seperti penerimaan anggota Satpol PP, sebaiknya mempertanyakan langsung ke Kantor BKD. Karena, menurut dia, setiap penerimaan pegawai di kota/kabupaten, maka instansi yang satu ini, yang lebih mengetahui. Dirinya juga memastikan bahwa sejauh ini, tidak ada sama sekali penerimaan anggota Satpol PP yang merupakan pesanan seorang pejabat. “Prosedurnya tetap sesuai ketentuan dan peraturan yang dikeluarkan oleh pemerintah, yang berhubungan dengan penerimaan pegawai di instansi pemerintah. Maka dari itu, sebaiknya masyarakat lebih berhati-hati, jika ada tawaran yang mengiming-imingi menjadi pegawai tetap atau honorer di kantor Satpol PP,” jelasnya. Lebih lanjut dia berharap agar masyarakat tidak mudah percaya, jika ada yang mengatasnamakan Bupati, terkait penerimaan pegawai tetap maupun pegawai honorer. “Sebaiknya selalu mencari informasi yang berhubungan dengan kepegawaian ke kantor BKD, karena tidak ada penerimaan pegawai tanpa sepengetahuan BKD,” katanya. (Har)


TINJAU: Wakil Bupati (Wabup) Sambas Pabali Musa saat meninjau ladang pengembala sapi milik Kelompok Tani Udas Sambas Perkasa di Desa Semangau, Sambas, Kamis (18/4) lalu.

Sambas Miliki Padang Gembala Seluas 100 Ha SAMBAS – Wakil Bupati (Wabup) Sambas Pabali Musa memberikan apresiasi dan semangat kepada Kelompok Tani Udas Sambas Perkasa, yang terus eksis memperjuangkan pembangunan padang gembala ternak. Agar cepat berkembang, Wabup berpesan agar para petani tersebut meningkatkan semangat kerjasama, dalam mengelola ternak sapi di areal lahan seluas 100 hektar (ha) ini. “Buktikan padang gembala ini mampu mendongkrak swasembada daging Kalbar, khususnya Kabupaten Sambas,” gugah Wabup di Desa Semangat, Sambas, Kamis (18/4) lalu. Dalam sambutannya, Pabali meminta agar kelompok tani dapat memanfaatkan bantuan dana dari pusat, untuk pengembangan ekonomi. Ini, menurut dia, lantaran bantuan yang disalurkan tersebut merupakan Program Swasembada

Daging secara nasional tahun 2014, “Semoga upaya dan kerja keras kelompok tani ini membuahkan hasil dan mampu mendukung program nasional. Apalagi padang gembala ini merupakan yang pertama di Kalbar, jadi haris betul-betul mengelolannya,” pesan Wabup. Sementara itu, kepala Bidang (Kabid) Peternakan Dinas Peternakan dan Kesehatan Hewan Provinsi Kalbar, Kholid Mahdar, mengungkapkan, untuk mendukung Program Swasembada Daging Sapi tahun 2014 ialah padang pengembalaan sapi. “Untuk di Kalbar, sampai 2012, populasi sapi 169 ribu, dan itu baru bisa mencukupi kebutuhan sapi Kalbar sekitar 70 persen, sedangkan pemotongan sapi setiap tahun 45 ribu,” jelasnya. Menurut Kholid, masuknya sektor swasta sangat diharapkan dalam

mendukung Program Swasembada Daging. Ini lantaran diakui dia, daerah ini sangat memerlukan dukungan pengembangan swasembada tersebut. “Saat ini kita masih kekurangan sapi sekitar 89 ribuan, karena kita baru memiliki 169 ribu,” ujarnya dalam kegiatan yang dihadiri ketua DPRD Kabupaten Sambas, Mas’ud Sulaiman; serta Kepala Badan Ketahan Pangan, jajaran Muspika, dan para tokoh Desa Semangau Sedangkan kepala Dinas Pertanian dan Peternakan (Distanak) Kabupaten Sambas, Daryanto, dalam sambutannya, menjelaskan, Kelompok Tani Udas Sambas Perkasa ini mendapatkan dana TP dari Bansos sebesar Rp700 juta. “Hal yang perlu dibenahi ialah batas desa, karena batas Desa Semangau, Sambas, berbatasan dengan

Desa Madak, Kecamatan Subah,” jelasnya. Sambil menunggu bantuan sapi datang, dia menyarankan agar kelompok tani ini menanam buah-buahan, sehingga pada saat bantuan sapi datang, pohon menjadi rindang dan menjadi tempat tempat berteduh hewan-hewan ternak tersebut. “Saya yakin, kelompok ini bisa membuka wawasan untuk kemajuan desa di Kabupaten Sambas. Karena upaya ini sesuai dengan Program Sambas Berswasembada Daging sesuai RPJM Bupati dan Visi Misi Terpikat Terigas,” jelasnya. Sementara itu, ketua Kelompok Tani Tanjung Udas Sambas Perkasa, Darmanto Ali, dalam laporannya menjelaskan bahwa mereka memperoleh bantuan sebesar Rp700 juta. “Alhamdulillah dengan dana tersebut kami berhasil melaksana-

kan Program Padang Pengembalaan Sapi. Untuk lokasi penanaman padi dan jenisnya, Rumput Taiwan ditanam seluas 30 hektar, Rumput Mexico dan Taiwan seluas 10 hektar, lokasi rumput alam 20 hektar,” jelasnya. Dijelaskan dia, terdapat empat tahapan dalam pembukaan padang pengembalaan sapi, di mana tahapan pertama adalah pembebasahan lahan, serta pembersihan hutan dan lahan. Tahapan selanjutnya adalah membuat pagar, kemudian pembelian rumput tanam sapi seluas 60 hektar, pemupukan, serta terakhir pembelian 10 ekor bibit sapi. “Dalam perjalanan tersebut banyak halangan dan rintangan yang kita hadapi, namun semua cobaan tersebut merupakan ujian yang harus dihadapi bersama,” ungkapnya semangat. (Har)

Tebas jadi Capaian Perekaman e-KTP Tertinggi SAMBAS – Walaupun menghadapi beberapa kendala di lapangan, namun tidak menghalangi jalannya pelaksanaan program e-KTP yang hampir satu tahun ini berjalan. Dalam pelaksanaan program tersebut, banyak mendapat tanggapan positif dari masyarakat di Kabupaten Sambas, sementara evaluasi dari Dinas Kependudukan dan Catatan Sipil (Disdukcapil) Kabupaten Sambas, disebutkan bawha Kecamatan Tebas berada pada posisi pertama pencapaian

e-KTP, dengan alokasi mencapai 53,901 penduduk atau 67,84 persen dari jumlah penduduk. “Pencapaian perekaman e-KTP di Kabupaten Sambas memang belum mencapai 100 persen, namun sudah sangat maksimal. Walaupun dalam pelaksanaannya, operator ada mendapat kendala teknis, seperti listrik padam, data yang kurang valid ataupun alat perekam yang mengalami masalah,” aku Bupati Sambas Juliarti Djuhardi Alwi, saat memberikan motivasi ke-

pada operator e-KTP se-Kabupaten Sambas, Jumat (19/4) lalu di Aula Utama Kantor Bupati Sambas. Dari hasil evaluasi pelaksanaan e-KTP, menurut Bupati, jika di ranking, maka terdapat kecamatan yang pencapaian nominal perekamannya masuk dalam tiga besar, dan secara persentase masuk dalam lima besar. “Walaupun secara presentase Kecamatan Tebas menduduki peringkat pertama, namun realisasi persentase masih belum maksimal. Hanya saja, Kecamatan HARI KURNIATHAMA/PONTIANAK POST

SERAH PENGHARGAAN: Bupati Sambas Juliarti Djuhardi Alwi menyerahkan penghargaan kepada operator e-KTP di Aula Utama Kantor Bupati Sambas, kemarin (19/4).

Tebas memiliki penduduk terbanyak di Kabupaten Sambas,” jelasnya. Bupati dalam kesempatan tersebut meminta kepada para operator, agar dapat bersama-sama dengan pihak kecamatan dan kepala desa, untuk lebih meningkatkan komunikasi yang intensif. Tujuannya, menurut dia, agar operator bisa mendapatkan data secara detail tentang jumlah penduduk yang wajib memiliki e-KTP, sehingga target yang diinginkan dapat tercapai. “Maka dari itu, tingkatkanlah sinergi dalam mendukung kelancaran program e-KTP, baik operator, kecamatan, maupun pemerintahan desa,” imbaunya. Bupati tak menampik, selama hampir setahun berjalan, tentunya para operator sudah mencatat apa saja yang menjadi kendala di lapangan. Bupati yakin, para operator ini tetap berpikir, mengapa target belum juga tercapai, sedangkan kinerja sudah dilakukan secara maksimal, terutama dalam memberikan pelayanan. “Oleh sebab itu, marilah kita bersama membahas kendala dan pencapa-






ian perekaman e-KTP yang telah dilaksanakan,” imbau Bupati. Suksesnya pelaksanaan e-KTP, diakui Bupati, tidak terlepas dari peran serta operator yang telah bekerja secara maksimal, sehingga pelaksanaan program e-KTP bisa berjalan. “Untuk penempatan operator di setiap kecamatan berjumlah empat orang, (di mana) semua bekerja sangat baik. Ini dapat dilihat dari kinerja operator Kecamatan Paloh yang secara persentase pencapainnya mencapai 96,83 persen, ataupun Kecamatan Sajingan Besar secara presentase pencapainnya mencapai 93,01 persen,” pujinya. Bupati memberikan apresiasi kepada lima kecamatan yang masuk dalam ranking lima besar, serta operator lainnya, yang telah bekerja secara maksimal. “Saya berharap agar operator tetap semangat dan dapat menuntaskan program ini dengan baik. Jika terus seperti ini, saya yakin target hingga 100 persen dapat tercapai. Kuncinya, operator, camat, dan kades, serta masyarakat dapat mensuksekan program (ini),” harapnya. (Har)


22 sosok

Jadi Santri Kok Minder TIDAK mesti harus minder dengan status sebagai santri yang menempuh pendidikan di Pondok Pesantren (Ponpes). Sejauh ini, alumnus Ponpes justru lebih bisa membuktikan diri menjadi orang sukses dan besar di masyarakat. Demikian disampaikan Kepala Kantor  Kementerian Agama (Kemenag) Kabupaten Sanggau, Jamaludin KL. Menurutnya, kualitas pendidikan di Pondok Pesantren tidak kalah kualitasnya dengan pendidikan pada umumnya. Karena itu, ia meminta agar kualitas dan mutu pendidikan di pesantren harus terus ditingkatkan baik itu soal duniawi maupun ukhrawi. “Jadi santri itu harus punya cita-cita tinggi dan mempunyai rasa percaya diri yang besar. Karena rata-rata orang besar juga Jamaludin K berasal dari pondok pesantren. Jadi harus bangga menjadi anak pondok,” ujarnya saat membuka Porseni Pondok Pesantren beberapa hari lalu. Terkait porseni ponpes, ia sangat berharap acara tersebut akan memunculkan generasi-generasi baru yang berprestasi dan menjadi cikal bakal lahirnya generasi emas di Kabupaten Sanggau. “Mari tunjukkan kepada masyarakat di Kabupaten Sanggau, bahwa ponpes itu bukan hanya mendidik urusan akhirat, tetapi juga mampu memunculkan generasi-generasi emas Kabupaten Sanggau di semua bidang kompetisi. Ini yang sudah harus kita kembangkan bersama, agar jangan muncul kesan anak pondok ini bisanya hanya ngaji dan baca kitab melulu,” ujarnya. (sgg)


Pontianak Post

Sabtu 20 April 2013

Bakti Negeri Lintas Batas Ditutup SANGGAU--Pada Kamis, 18 April 2013 pukul 10.00 WIB, kegiatan “Bakti Negeri di Lintas Batas Menuju Indonesia Sejahtera” secara resmi ditutup Dansatgas Pamtas Yonif 123/ Rajawali di Pos Gabma Satgas Pamtas Yonif 123/Rajawali Entikong dengan konsep acara sederhana dan sangat khidmat. Turut hadir Camat Entikong, Danramil 12/Entikong, Wakapolsek Entikong, Kepala BKKBN Propinsi Kalimantan Barat, Kepala BKKBN Kabupaten Sanggau, Kepala RRI Entikong, Veteran dari Entikong dan Balai Karangan, Kepala Desa Entikong, Indosiar, Mahasiswa Fakultas Kedokteran UNTAN Pontianak, pendongeng GEPPUK dari Jakarta, tokoh agama, tokoh adat, tokoh masyarakat, tokoh pemuda serta masyarakat Kecamatan Entikong. Dalam sambutannya Dansatgas Pamtas Yonif 123/Rajawali menjelaskan kegiatan Bakti Negeri Di Lintas Batas Menuju Indonesia Sejahtera wujud kepedulian TNI AD bersama segenap komponen masyarakat di wilayah perbatasan, dalam rangka membantu kesulitan masyarakat perbatasan. Bakti sosial ini merupakan salah

DITUTUP: Penutupan kegiatan Bakti Negeri Lintas Batas

satu kegiatan pemberdayaan masyarakat wilayah perbatasan sebagai wujud kemanunggalan TNI rakyat di perbatasan. Masih menurut Dansatgas, kegiatan ini sangat berhasil karena atas kerjasama antara Satgas Pamtas Yonif 123/Rajawali, SIKIB, PT. Indosiar Visual Mandiri, Satuan jajaran Kodam XII/TPR, Ditkesad (Direktorat Kesehatan TNI AD), UNTAN Pontianak, BKKBN, TVRI Kalbar, RRI Entikong, ANTARA TV, TV One, Pontianak Post, PT. Sinar Mas serta seluruh elemen






masyarakat dan swasta khususnya di Kecamatan Entikong dan seluruh masyarakat di sepanjang perbatasan Kalbar. Kegiatan “Bakti Negeri Di Lintas Batas Menuju Indonesia Sejahtera” yang dilaksanakan mulai 26 Maret-18 April 2013, di sepanjang perbatasan darat Indonesia-Malaysia wilayah Kalbar, dalam rangka pemberdayaan wilayah perbatasan guna meningkatkan derajat kesehatan dan kualitas pendidikan untuk masyarakat perbatasan. Di bidang kesehatan mem-

berikan pelayanan kesehatan gratis dalam bentuk pelayanan pengobatan umum, pengobatan katarak, pelayanan KB, gigi, sunatan, bedah minor dan operasi bibir sumbing.   Sedangkan di bidang pendidikan, kegiatan yang dilaksanakan adalah dengan mengoperasionalkan mobil pintar bantuan dari SIKIB (Solidaritas Istri Kabinet Indonesia Bersatu), meresmikan pembangunan dan renovasi Rumah Pintar Rajawali (sanggar belajar) untuk anakanak SD dan usia dini, menyalurkan bantuan SIKIB berupa buku-buku pelajaran untuk SD, baju seragam SD dan bantuan tenaga guru oleh personel Satgas Pamtas Yonif 123/Rajawali. Di bidang sosial tim Bakti Negeri berhasil menyalurkan bantuan SIKIB berupa kaos ACI (Aku Cinta Indonesia), jaket loreng dan piagam penghargaan untuk penunjuk jalan, membagikan bendera merah putih kepada masyarakat di 26 lokasi di perbatasan. Pelayanan kesehatan gratis untuk pengobatan umum sebanyak 5.088 pasien, pelayanan KB 664 orang, khitanan 318. orang, pengobatan mata dan katarak 196 orang, pengobatan gigi 82 orang, sunatan (khitanan)318

orang, bedah minor 45 orang, penyakit dalam 20 orang, spesialis anak 296 orang dan operasi bibir sumbing 1 Orang. Di bidang pendidikan, tim telah mengoperasionalkan dua buah mobil pintar bantuan dari SIKIB, membangun 26 buah Rumah Pintar/sanggar belajar Rajawali,   melaksanakan bantuan tenaga guru 32 orang untuk 26 SD di perbatasan,  menyalurkan bantuan SIKIB berupa buku pelajaran SD 7.920 buah,  bantuan baju sergam SD 100 buah, bantuan 50 juta dari Indosiar untuk SD 08 Sebindang.   Sedangkan   untuk bidang sosial, pada kegiatan ini tim dipimpin Dansatgas Pamtas Yonif 123/Rajawali meresmikan pembangunan mushola AlIman di Dusun Sungai Ampelas Perimpah dan gereja di desa Enteli kab. Sintang, menyalurkan bantuan kaos ACI (Aku Cinta Indonesia) bantuan dari SIKIB, membagikan 474 buah bendera merah putih, menyalurkan bantuan 50 buah jaket loreng untuk penunjuk jalan, sarung 100 buah untuk pasien khitanan, membagikan topi ACI 50 buah serta menyumbangkan 1 buah kursi roda untuk pasien lumpuh di desa Sei Beruang.(sgg/*)

Pontianak Post •


Satu Partai Mendaftar



Sabtu 20 April 2013

HINGGA 19 April 2013 kemarin, baru satu Partai Politik peserta Pemilu 2014 mendaftarkan Calon Legislatif di KPU Sintang. KPU men-deadline pendaftaran Calon Legislatif  hingga  22 April pukul 16.00, dan di atas jam tersebut tidak dilayani. Menurut Ade, kesempatan mendaftar masih berjalan hingga satu pekan mendatang. Karena itu pihaknya masih tetap membuka pendaftaran untuk semua partai politik, menyerahkan DCS. Dimana dengan mendaftarnya satu parpol ke KPU Sintang, berarti masih menyisakan 11 parpol lain yang belum mendaftar. KPU juga tidak memberikan toleransi selain tenggang waktu yang telah ditetapkan untuk partai mendaftar. “Kami tidak melakukan perpanjangan bila lewat tanggal 22 hingga jam 16.00 tidak mendaftar. Artinya, Parpol bersangkutan tidak mengikuti Pemilu Legislatif di Sintang,” kata Ketua KPU Kabupaten Sintang, Ade Iswadi, kemarin. (stm)


DPD Dorong Percepatan PKR Fasilitas Pendukung Lebih Siap SINTANG—Pembentukan Provinsi Kapuas Raya dinilai sudah sangat layak. Fasilitas pendukung juga telah dipersiapkan untuk menunjang pemerintahan berjalan. Memperjuangkannya sejak 2006 silam serta kelengkapan administrasi sudah mencukupi, kecuali rekomendasi Gubernur Kalimantan Barat. Hal demikian terungkap saat kunjungan kerja anggota Dewan Perwakilan Daerah (DPD) RI Ishak Saleh ke Sintang, kemarin. Tatap muka dengan pemerintah Kabupaten dan ketua tim koordinator pemekaran Kapuas Raya juga banyak mengupas mengenai

pembentukan provinsi di wilayah Timur Kalbar itu. “Saya sangat terkesan dengan aset persiapan pemekaran Kapuas Raya. Sudah siap semua, termasuk sarana fisik. Daerah lain yang dimekarkan menjadi Provinsi belum memiliki fasilitas selengkap ini,” kata Ishak ketika berada di gedung serbaguna Sintang, yang dipersiapkan sebagai kantor Gubernur Kapuas Raya. Selain mengunjungi gedung serbaguna, Ishak dengan didampingi Bupati Sintang Milton Crosby sekaligus koordinator pemekaran Kapuas Raya juga meninjau lokasi pembangunan Rumah Sakit Rujukan serta berkunjung ke Museum Kapuas Raya di Jalan Raya Kelam. Ishak menilai kalau secara kasat


mata sebetulnya Kapuas Raya lebih siap ketimbang Provinsi Kalimantan Utara. Namun persoalan administratif membuat pemekaran dengan provinsi induk Kalimantan Timur itu telah terealisasi. Padahal Kapuas Raya juga lebih siap. Administrasi secara keseluruhan juga sudah tak ada persoalan, namun masih membutuhkan persetujuan Gubernur. Kendati demikian Ishak mengaku salut dengan kegigihan perjuangan Milton memperjuangkan Kapuas Raya. Senantiasa berjalan serta mempersiapkan administrasi sekaligus saran penunjang bagi pembentukan provinsi baru. Karena itu, lanjutnya, secara kelembagaan, DPD akan mendorong percepatan Kapuas Raya untuk terbentuk..(stm)


CALON KANTOR: Anggota DPD-RI Ishak Saleh bersama Bupati Sintang Milton Crosby meninjau Gedung Serbaguna Sintang, yang dipersiapkan sebagai Kantor Gubernur Kapuas Raya.









Bina Marga Lelang 24 Paket


KEPALA Dinas PU dan Pertambangan Kabupaten Sekadau, melalui Kepala Bidang Bina Marga, Heri Handoko Susilo, mengabarkan setidaknya ada 24 paket pekerjaan fisik yang sudah dilelang. Proyek fisik yang dilelang rata-rata dengan pagu di atas Rp1 miliar. “Proses lelang di LPSE sudah dimulai, bahkan Rabu kemarin sudah dibuka dokumen penawaran,” jelas Heri, Dinas PU sendiri tahun ini berupaya mempercepat proses pelelangan sampai penandatangan kontrak apabila pemenang penyedia jasa sudah ditentukan berdasarkan seleksi penawaran dan kelengkapan dokumen. Hal itu dimaksud agar proses pekerHeri Handoko ST jaan di lapangan lebih cepat dari tahun sebelumnya. “Kalau tidak ada halangan Mei nanti sudah penandatangan kontrak kerja (dokumen SPK),” ucap Heri. Kata dia, proses lelang akan terus berlanjut sampai semua paket pekerjaan fisik tahun 2013 selesai. Khusus untuk yang lelang pengadaan proyek fisik yang sudah dalam proses ini, Heri berharap kalau sudah dilakukan penandatangan kontrak bersama pihak nanti, maka kegiatan akan lebih cepat dimulai di lapangan. “Harapan kita, jika kontrak sudah ditandatangani bersama penyedia jasa bisa secepatnya melakukan action di lapangan,” tandasnya. (nie)


Berharap UN SMP Sukses DINAS Pendidikan Pemuda dan Olahraga Kabupaten Sekadau memastikan peserta UN tingkat SMP/MTs berjumlah 3.856 orang, dengan rincian peserta UN laki-laki sebanyak 1.916 orang dan peserta UN perempuan sebanyak 1.940 orang. Sedangkan data peserta ujian nasional Sekolah Dasar (SD) /Madrasah Ibtidaiyah tahun 2013 berjumlah 3.856 orang, terdiri dari laki-laki sebanyak 1.916 orang dan perempuan sebanyak 1.940 orang.  Bupati Sekadau Simon Petrus, menyambut baik pelaksanaan Ujian Nasional (UN) tingkat SMA, SMK, MA sederajat tahun ajaran 2012/2013 yang digelar mulai Senin 15-18 April 2013 berjalan dengan baik, aman dan lancar.  “Saya ingin menyampaikan apresiasi dan penghargaan yang setulustulusnya kepada masyarakat saya di Kabupaten Sekadau atas kerja sama yang baik dari semua pihak,” ujar Bupati Simon kepada Wartawan, di Sekadau Rabu, (17/4).  Menurut Bupati, berjalannya proses pelaksanaan UN di Sekadau yang aman, tertib dan lancar adalah buah kerja sama dari semua pihak, mula dari masyarakat, lingkungan, orang tua, siswa, pihak sekolah dan pemerintah Kabupaten Sekadau.  “Semuanya berjalan dengan baik, ini berkat kerja sama semua elemen masyarakat,” ujar Bupati.  Bupati juga berharap, hasil Ujian Nasional tahun 2013 mulai dari tingkat, Sekolah Dasar (SD), Sekolah Menengah (SMP) dan Sekolah Menengah Umum (SMU) hasilnya lebih baik dari tahun tahun sebelumnya. “Kita berharap ada peningkatan hasil yang kebih baik,” ujarnya. (nie)


Pontianak Post

Sabtu 20 April 2013

Koperasi "Berjalan" Meresahkan Perindagkop UKM Tak Pernah Beri Izin

Sukarni/Pontianak Post

PEMBIBITAN: BBI Kemawan yang kian tahun kian meningkatkan kualitas dan kinerja untuk memenuhi kebutuhan ikan di Kabupaten Sekadau.

BBI Kemawan Kantongi Sertifikat Ikan Mas Majalengka SEKADAU - Balai Benih Ikan Kemawan Sekadau berdiri sejak tahun 2006 kini menjadi sentra bibit ikan di Bumi Lawang Kuari. Kolam-kolam yang berada di lahan seluas sekitar lima hektare telah dimanfaatkanuntukmengembangbiakkan bibit ikan air tawar. Terdapat 32 kolam dengan sumber air dari perbukitan di sekitar Balai Benih. Selain didukung 11 petugas, Balai Benih juga telah memiliki gudang pakan, gedung kawin atau pachri serta bengkel ikan. Ada tiga jenis komoditas ikan yang hidup disana yakni ikan lele, nila dan mas menjadi komoditas utama Balai Benih Ikan Kemawan. “Proses rutin mencakup perawan, seleksi, pengawinan, penetasan induk. Selanjutnya sortir benih, pemeliharaan dan terakhir panen,” jelas Iwan Supardi, koordinator Balai Benih Ikan Kemawan. Tujuan utama Balai Benih mem-

bantu penyediaan bibit ikan kepada masyarakat yang berminat budidaya keramba maupun kolam. Warga juga dapat berkonsultasi tentang budidaya ikan yang benar dan tepat kepada para petugas Balai Benih. Sejak tahun lalu, Balai Benih Ikan Kemawan sudah mengantongi sertifikasi ikan mas Majalengka. Artinya, bibit ikan mas di Balai Benih Ikan tersebut dijamin berkualitas standar. Bahkan pada tahun 2013 ini, bertekad untuk mendapatkan sertifikasi ikan nila. “Maksud dari itu kan biar sempurna,” papar Iwan. Sebelumnya, dua petugas Balai Benih Ikan Kemawan juga telah mengantongi sertifikasi manajemen pengendali mutu perbenihan. Setiap tahun, Balai Benih juga menabur ribuan benih ikan ke sungai-sungai di Sekadau untuk berkembang biak secara alamiah serta mendidik masyarakat agar menghindari sistem tuba atau


racun. “Istilahnya restoking untuk ikan liar,” ungkapnya. Iwan memastikan setiap tahun, produksi benih meningkat signifikan. Permintaan masyarakat terhadap benih ikan secara alamiah turut meningkat. Pada akhirnya, penduduk semakin banyak mengkonsumsi protein ikan cukup mendukung kesehatan terlebih menjadi pangan keluarga dan meningkatkan kecerdasan generasi muda.“Secara rutin mengkonsumsi ikan tentu akan baik bagi anak dan keluarga, semoga saja generaasi semakin cerdas,” katanya. Kepala Dinas Pertanian, Perikanan dan Peternakan Sekadau Adrianto menjelaskan selain Balai Benih Ikan Kemawan, Sekadau juga telah memiliki satu lagi Balai Benih Ikan di Kecamatan Nanga Mahap. Balai Benih Ikan dikhususkan untuk ikan lokal mencakup tengadak, jelawat, gurame dan baong. (nie)

SEKADAU- Keberadan Koperasi sebagai suatu badan usaha yang bertujuan untuk kesejahteraan anggotanya memang dibutuhkan di daerah yang tengah berkembang seperti Sekadau. Sayangnya, tak banyak pengelola Koperasi faham aturan besaran bunga pinjaman sesuai dengan standar yang ditetapkan pemerintah. Baru-baru ini, warga Sekadau mengeluhkan sistem Koperasi simpan pinjam ‘berjalan’. Istilah Koperasi ‘berjalan’ karena pegawai Koperasi sendiri yang mendatangi rumah-rumah warga untuk menawarkan pinjaman uang untuk usaha dan keperluan lainnya. Beberpa nasabah Koperasi Berjalan kerap mengeluhkan bunga pinjaman yang dianggap terlalu tinggi mencapai 20 persen dari jumlah pinjaman. Kepala Dinas Perindustrian, Perdagangan, Koperasi dan UKM Kabupaten Sekadau Isdianto, saat dikonfirmasi mengungkapkan Disperindagkop tidak pernah mengeluarkan perizinan ataupun rekomendasi kepada koperasi ‘Berjalan’ atau unit simpan pinjam yang lain. “Sampai saat ini tidak ada satupun jasa simpan pinjam yang melaporkan aktivitas usaha simpan pinjamnya ke kita (Disperindagkop dan UKM Sekadau),” ujar Isdianto dijumpai di ruang kerjanya. Meski demikian, Isdianto menolak menyebut koperasi-koperasi tersebut sebagai koperasi ilegal. “Yang pernah saya dengar, mereka memiliki badan hukum di daerah lain, tapi kegiatan usahanya melebar ke berbagai daerah termasuk Sekadau,” bebernya. Terkait sistem yang dijalankan, Isdianto mengatakan sesuai dengan prinsip dasarnya, Koperasi hanya memberikan pinjaman sebatas kepada anggotanya saja. Isdianto sendiri ragu apakah koperasi “keliling” itu memiliki anggota atau tidak. “Yang jelas sistem mereka (Koperasi,red) tidak sejalan dengan prinsip-prinsip Koperasi yang sebenarnya,” ucapnya mengira. Sampai saat ini, cukup banyak Koperasi yang berdiri di Sekadau, termasuk diantaranya Koperasi ‘berjalan’ atau istilah lain ‘Bank 47’. Lembaga jenis Koperasi jasa simpan pinjam lainnyapun menjamur, kendati tak pernah dapat izin resmi dan legalitas dari Pemkab Sekadau. Isdianto mengimbau kepada masyarakat Sekadau sebaiknya   memohon pinjaman kepada lembaga yang dipercaya misalnya Bank atau kepada Credit Union (CU). “Sebaiknya masyarakat meminjam uang dengan lembaga yang dipercaya. kan ada Bank, ada CU,” ucap dia. (nie)







Pontianak Post


Sabtu 20 April 2013



Tak Pengaruhi Kuorum


WAKIL Ketua Dewan Perwalikan Rakyat Daerah (DPRD) Kabupaten Ketapang, Budi Mateus, mengungkapkan, kepindahan beberapa anggota DPRD yang partainya tidak lolos Pemilu 2014 ke partai yang lolos, tidak berpengaruh terhadap kinerja legislatif. Menurutnya, perpindahan tersebut tetap jalan dan kinerja di DPRD juga terus jalan. “ Ji k a m e r e k a ( a n g g o t a DPRD, Red) mundur, tidak akan berpengaruh kepada kuorumnya sidang paripurna,” kata Budi, belum lama ini. Dia menjelaskan, saat ini anggota legislatif yang duduk di DPRD menjalankan tugas dan fungsinya masing-masing. Jumlah anggota DPRD yang aktif, sampai sekarang ini, diungkapkan dia, sekitar 2/3 dari jumlah secara keseluruBudi Mateus han, sehingga tetap kuorum untuk setiap kali digelar rapat. “Ada beberapa anggota dewan yang partainya tidak ikut serta dalam Pemilu Legislatif 2014, namun tidak terlalu signifikan,” lanjutnya. Dia juga mengatakan, sampai saat ini masih belum mengetahui pasti berapa jumlah anggota legislatif yang mundur dan mencalonkan diri ke partai yang lolos Pemilu 2014. Yang dia ketahui, sampai saat ini baru tiga anggota DPRD yang partai pengusung mereka sebelumnya pada Pemilu 2009, tidak lolos di pemilu kali ini. Namun dia juga mengaku tidak tahu secara pasti, apakah ketiga orang ini akan mundur dan mencalonkan diri ke partai yang lolos atau tidak. “Banyak parpol yang tidak lolos, namun bukan berarti mereka akan pindah ke partai lain. Anggota dewan parpolnya yang tidak lolos hanya tiga saja, “ paparnya. Lebih lanjut, Budi juga mengungkapkan, untuk proses mundurnya anggota dan mendaftar di partai lainnya, tetap harus mendapat persetujuan dari DPRD. Sementara prosesnya sendiri, dijelaskan dia, diajukan oleh parpol bersangkutan, untuk kemudian dilakukan penggantian antar waktu (PAW). “Mengundurkan diri ini hanya syarat ke KPU saja,” ujar Budi. Sementara itu, ketua KPU Kabupaten Ketapang, Juardhani, mengungkapkan, sampai dengan Rabu (17/4), dia belum menerima satu nama pun dari anggota legislatif, yang mundur dari DPRD dan kembali mencalonkan diri melalui parpol yang lolos Pemilu 2014. “Sampai saat ini kami masih belum menerima laporan anggota DPRD yang mundur dan kembali mencalonkan melalui partai yang lolos pada Pemilu 2014. Jika ada anggota dewan yang mundur, kita akan segera proses untuk penggantinya yang memang benar-benar memperoleh suara terbanyak setelahnya,” ungkapnya, kemarin (17/4). (afi)


FOTO BERSAMA: Ketua dan Wakil Ketua TP PKK Kabupaten Ketapang beserta peserta Lomba Busana Kebaya, berfoto bersama pada babak penyisihan hari petama, kemarin.

TP PKK Gelar Lomba Busana Kebaya Peringatan Hari Kartini di Ketapang KETAPANG – Dalam rangka memperingati Hari Kartini yang dirayakan setiap tanggal 21 April, Tim Penggerak PKK Kabupaten Ketapang, menggelar Lomba Busana Kebaya bertempat di Pendopo Bupati Ketapang. Kegiatan ini bertujuan untuk mengingat dan mengenang, serta menghargai perjuangan RA Kartini. “Kita harapkan seluruh kaum wanita yang ada di

Ketapang ini dapat menghargai perjuangan RA Kartini dan emansipasi wanita, serta para wanita di Ketapang dapat menghargai kebaya sebagai busana nasional,” kata ketua panitia, Ny Heni Kamboja, kemarin (19/4) siang. Kegiatan ini merupakan program Kelompok Kerja (Pokja) II dan III. Peserta yang berpartisipasi pada lomba tersebut terdiri dari orgasasi wanita yang tergabung di Gabungan Organisasi Wanita (GOW) serta dari PKK di 20 kecamatan. Seluruh peserta berjumlah 77 peserta, di mana lomba ini dibagi menjadi dua bagian yaitu, penyisihan dan

final. Untuk babak penyishan akan dilakukan selama dua hari, 19 dan 20 April, yang bertempat di Pendopo Bupati Ketapang. Pada hari pertama babak penyisihan, sebanyak 30 peserta tampil memukau dua dewan juri, di mana satu di antaranya dari Kota Pontianak. Sedangkan untuk hari kedua, hari ini (20/4), sebanyak 47 peserta akan tampil di hadapan juri. Dari seluruh peserta tersebut akan dipilih yang terbaik dan berhak kembali berlaga di final. Malam final sendiri akan dilaksanakan pada Senin

(22/4) malam di Pantas Seni Budaya Pendopo Bupati Ketapang. Peserta yang berhasil menjadi yang terbaik berhak mendapatkan uang tunai dan trofi. Untuk juara I berhak mendapat uang pembinaan sebesar Rp5 juta, juara II (Rp4 juta), dan juara III (Rp3 juta). Sedangkan untuk harapan I, II, dan III, the best dan favorit akan mendapatkan hadiah menarik. Sementara itu, untuk peserta yang berasal dari kecamatan akan ada penilaian khusus dari Ketua dan Wakil ketua TP PKK. Ketua TP PKK Kabupaten Ketapang, Ny Riniwati Hen-

rikus, pada kesempatan itu menyampaikan terima kasih kepada para ibu yang telah ikut berpartisipasi dalam lomba tersebut. Bahkan, dia mengaku takjub lantaran terdapat peserta yang berasal dari kecamatan terjauh, namun masih mau ikut serta dalam lomba ini. “Walaupun emansipasi wanita saat ini sudah bagus, tapi jangan lupa dengan kodrat kita sebagai ibu serta ibu rumah tangga yang wajib mendidik anak dan mengurus anak dan suami,” pungkas istri orang nomor satu di jajaran pemerintahan Kabupaten Ketapang tersebut. (ser)

Mobil Kesehatan Dinkes Banyak Tak Layak Jalan


KETAPANG – Kepala Sub Bagian Umum Kepegawaian dan Perlengkapan Dinas Kesehatan Kabupaten Ketapang, Daniel, mengatakan, sebanyak 24 kendaraan operasional puskesmas keliling yang ada di Ketapang, hanya 30 persen saja yang masih dalam keadaan layak untuk operasional. Sedangkan selebihnya, diakui dia, mengalami kerusakan, bahkan tidak bisa dioperasionalkan sama sekali. “Ada sebagian mobil kesehatan yang dipaksakan untuk tetap bisa dioperasionalkan, walaupun sebenarnya sudah tidak layak lagi. Demi pelayanan agar terus jalan, kami harus paksakan, seperti Puskesmas Keliling di Sandai,” katanya, kemarin (18/4) di Ketapang. Daniel menjelaskan, kebijakan yang diambil Dinas Kesehatan saat ini adalah melakukan pemantauan terhadap semua puskesmas keliling (Pusling) yang tersebar di kecamatan-kecamatan. Jika ditemukan Pusling yang tidak layak, maka mereka akan langsung membuat berita acara (BA) ke Pemda. “Ketika Pusling tersebut kita tarik ke Kota, kita tanya ke teknisinya, apakah bisa

diperbaiki lagi atau tidak? Kalau tidak bisa, dicarikan jalan untuk beli baru,” jelasnya. Dia juga tak menampik bahwa Dinas Kesehatan Ketapang tidak ingin membiarkan Pusling terbengkalai di pusat-pusat servis. Karena, menurutnya, jika dibiarkan di bengkel hingga bertahuntahun dan tidak segera diperbaiki, maka pihaknya yang malu. Oleh karena itu, Daniel mengungkapkan, jika Pusling tersebut masih bisa dioperasikan, namun dalam kondisi rusak, maka sesegera mungkin untuk dibetulkan dan digunakan kembali. Lebih lanjut, dia juga mengungkapkan, untuk wilayah utara Ketapang, ada beberapa kecamatan yang Puslingnya sudah tidak bisa dioperasionalkan lagi. Seperti halnya di Simpang Dua dan Nanga Tayap. “Contohnya di utara yaitu di Balai, Simpang Dua, Laur, Sandai, dan Tayap. Simpang Dua sudah tidak jalan lagi, Nanga Tayap juga, kalau untuk di Balai dengan Sandai dipaksakan jalan,” tuturnya. Setelah dilakukan inventarisasi keadaan Pusling, saat ini, diungkapkan dia, terdapat beberapa kedaraan Pusling

yang mulai didatangi untuk dilakukan penarikan ke Kota Ketapang, baik untuk diperbaiki ataupun dicarikan opsi pembelian baru. “Sudah mulai pengadaan, hari ini (kemarin, Red) sudah ada yang naik ke Manis Mata. Mana yang tak bisa digunakan, langsung kita tarik ke sini (Kota Ketapang, Red). Tumbang Titi tak lama lagi masuk, Singkup, Kendawangan, pokoknya semuanya yang ada di wilayah sana itu,” ungkapnya. B e rat nya o p e ra s i o na l lapangan di wilayah hulu, menurut dia, menjadi satu di antara penyebab kerusakan Pusling. Selain itu, dia menambahkan, beberapa kendaraan operasional jenis Hilux juga mengalami kendala untuk perbaikan, lantaran terbatasnya suku cadang di Ketapang. Di sisi lain, diakui dia bahwa anggaran yang dimiliki juga terbatas. Efek dari kerusakan Pusling, diungkapkan dia, yang paling besar adalah terhadap rujukan pasien. Namun, dia menjelaskan, untuk masalah yang satu ini, mereka mencoba menyiasati dengan menggandeng ambulans-ambulans yang dimiliki oleh perusahaan yang

berada diwilayah pedalaman. “Ada kerjasama dengan perusahaan, saling sinergi, karena banyak perusahaan juga yang punya ambulans,” tutupnya. Sementara itu, kepala Dinas Kesehatan Kabupaten Ketapang, Heri Yulistio, juga mengakui bahwa kendaraan operasional lapangan Dinas

Kesehatan seperti mobil puskesmas keliling banyak yang kini dalam keadaan tua. Sehingga, menurut dia, inilah yang menjadi sebab seringnya terjadi kerusakan. Opsi perbaikan hingga pergantian baru, dikatakan dia, sangat diperlukan agar pelayanan kesehatan untuk

masyarakat wilayah terpencil tidak terganggu. “Memang saat ini banyak mobil Dinas Kesehatan yang sudah tua dan perlu direhab. Bila memungkinkan diganti yang baru agar pelayanan tak terganggu,” katanya. Sementara khusus untuk ambulans, ditegaskan dia,

tetap ditempatkan khusus di Rumah Sakit Umum Daerah dr Agoesdjam, bukan di puskesmas-puskesmas kecamatan. “Selain ambulans, ada satu lagi kendaraan yang mestinya kita punya, terutama untuk rumah sakit, yaitu mobil jenazah,” pungkasnya. (afi)






26 petuah

Jangan Malu Dibilang Pelayan SUDAH lumrah dan biasa dilafalkan bahwa pegawai negei sipil (PNS) atau para abdi negara lainnya, disebut sebagai pelayan masyarakat,sehinggajanganpernahmaluapalagimarahdikatakan harusmelayanimasyarakat.HaltersebutdisampaikanBupatiKayongUtaraHildiHamid,dalamsebuahkesempatan,belumlamaini. “Jangan malu dibilang pelayan masyarakat, karena gaji kita itu dari rakyat yang dikelola pemerintah,” ungkap Hildi di hadapan para aparaturnya. Hildi mengingatkan, sebagai pelayan masyarakat, aparatur pemerintah sudah seharusnya melayani masyarakat, dengan sepenuh hati. Seorang aparatur diharapkan Hildi agar dapat melayani tidak denganemosiataurasaacuh.Pasalnya, dia mengingatkan kembali bahwa masyarakat memiliki karakter dan kelas yang berbeda-beda, sehingga diperlukan etika seorang Hildi Hamid pelayan yang benar-benar bijak. Bupati berharap, Pemerintah Kabupaten Kayong Utara, melalui dinas-dinas terkait, yang langsung bersentuhan dengan pelayanan dengan masyarakat, seperti Dinas Kesehatan, Dinas Kependudukan dan Pencatatan Sipil, Dinas Pendidikan, serta Dinas Pertanian dan Peternakan, harus memiliki pegawai yang handal. Bupati menuturkan bagaimana dulu, masih sering terdengar kabar ada sejumlah masyarakat yang diusir atau dibentak pegawai, hanya karena masyarakat tersebut tidak mengerti aturan yang berlaku. Justru, diingatkan dia, salah satu tugas pelayanan masyarakat adalah memberikan pengetahuan dan pencerahan kepada masyarakat yang tidak mengetahuinya.(mik)

kayong utara

Pontianak Post

Sabtu 20 April 2013

Senin Ini Akhir Sidang Gugatan JH


MENYAKSIKAN SIDANG: Perwakilan warga Kayong Utara yang hadir di ruang sidang Fakultas Hukum (FH) Untan Pontianak, baik dari kubu pasangan JH dan H3I, Kamis (18/4) lalu di Pontianak.

Warga Tanjung Satai Disidang Nelayan SUKADANA - Us, warga Desa Tambak Rawang, Sukadana, nampaknya benar-benar terkena batunya. Ini lantaran setelah diperingatkan untuk tidak menggunakan pukat harimau saat melaut, ternyata tidak diindahkan. Alhasil, beberapa waktu lalu, dia bersama dua anak buah kapal (ABK), ditangkap oleh masyarakat nelayan Desa Tanjung Satai, ketika sedang menangkap ikan di perairan Sungai Besar, lengkap dengan kapal dan alat tangkapnya. Dikatakan plt Kabid Pengawasan Laut Dinas Kelautan dan Perikanan Kabupaten Kayong Utara, Sunaryadi, yang bersangkutan memang sudah sering melakukan penangkapan ikan dengan menggunakan pukat trawl jenis Apollo, di perairan

sekitar sungai besar. Bahkan, dia menambahkan bahwa yang bersangkutan sudah sering dilarang. “Us dan ABK-nya ditangkap masyarakat Tanjung satai dan ‘disidang’ di sana (Tanjung Satai, Red),” kata Sunaryadi. Sidang yang dihadiri aparatur desa dan masyarakat itu, bukanlah sidang yang anarkis, namun justru diselimuti suasana kekeluargaan. Ketika itu, berdasarkan pengakuan dan penyesalan dari pelaku, hukuman peringatan menjadi sanksi yang harus diterima oleh US dan ABK-nya. “Mereka disanksi untuk tidak mengulangi lagi. Kalau mengulangi lagi, maka kapal akan disita dan bisa jadi ditenggelamkan atau dibakar,” katanya. Namun musyawarah yang





dilakukan dengan dikawal oleh aparatur dari Dinas Kelautan dan Peikanan ini, berjalan dengan lancar. Bahkan kapal milik Us, alat tangkap, bersama nahkoda dilepas untuk kembali ke rumah mereka di Sukadana. “Hasil tangkapan dibagikan ke masyarakat,” imbuhnya. Sunaryadi juga menyampaikan imbauaan kepada masyarakat nelayan agar menaati aturan main yang telah menjadi kesepakatan masyarakat. Dia juga meminta agar masyarakat nelayan tidak menggunakan alat tangkap yang bukan sesuai peruntukannya. Hal itu, menurutnya, sebagai salah satu langkah aman bagi semua pihak, agar dalam menjalankan aktivitas dengan aman tanpa kehawatiran. (mik)

SUKADANA – Ketua Mahkamah Konstitusi (MK) Dr M Akil Mochtar berharap agar sidang gugatan pasangan perseorangan, Jalian dan Hamdan Harun, berakhir Senin, 22 April besok. Hal itu diungkapkan Akil saat memimpin sidang lanjutan, perselesihan Pemilihan Umum Kepala Daerah (Pemilukada) Kabupaten Kayong Utara tahun 2013, Kamis (18/4) lalu. Menariknya, selain digelar di Ruang Sidang MK di Jakarta, dalam waktu bersamaan melalui telekonferensi, sidang serupa dilaksanakan di Ruang Sidang Fakultas Hukum (FH) Untan Pontianak. “Kalau begitu, kita lanjutkan sidang pada Senin mendatang jam 14.00 WIB. Kita harapkan semua bukti-bukti sudah bisa dihadirkan, itu hari terakhir ya. Kita juga ingin hadirkan pihak Panwaslu KKU,” tegas Akil ketika itu. Sidang itu sendiri menghadirkan saksi-saksi, terhadap dugaan pelanggaran yang dilakukan tim sukses (Timses) nomor urut 2, H Hildi Hamid dan Idrus (H3I). Hadir pada persidangan tersebut, Jalian didampingi para timsesnya. Selain itu, tidak ketinggalan pula para pendukung H3I seperti ketua DPD PAN Kabupaten Kayong Utara, Syarif Mussadeq. Sidang ini juga disaksikan birokrat Setda Pemprov Kalbar asal Kayong Utara seperti Citra Duani, kemudian dekan Fakultas Hukum (FH) Untan Pontianak, Prof Dr Garuda Wiko, beberapa mahasiswa asal Kayong Utara di Pontianak, serta undangan lainnya. Acara sidang tersebut mendengarkan jawaban termohon, pihak terkait, dan pembuktian, yang dimulai sekitar pukul 15.00 WIB. Nomor perkara sidang 31/ PHPU.D-XI/2013 dengan pokok perkara, perselisihan hasil Pemilukada. Pemohon adalah pasan-

gan JH dengan kuasa hukum, Hasan beserta kawankawan. Dalam sidang lanjutan tersebut, saksi-saksi yang ada di ruang sidang FH mengungkapkan mengenai dugaan politik uang (money politic) yang dilakukan Timses H3I atas nama Ym. Selain mengetengahkan beberapa dugaan politik uang selama masa tenang (25 – 27 Maret), juga dikemukakan pembagian beberapa barang. Semula diberitakan, sebanyak 70 saksi dipersiapkan JH, untuk memberikan kesaksian di MK pada persidangan sebelumnya. Namun, para saksi tidak dapat dihadirkan, sehingga sidang ditunda dan kembali dilanjutkan Kamis lalu. S e d a n g k a n s e k re t a r i s Timses JH, Irwansyah, yang hadir di Ruang Sidang MK di Jakarta, mengungkapkan jika ketua Panwaslu Kabupaten Kayong Utara, Heppy Susanto, masih tercatat sebagai pengurus DPD PAN Kayong Utara. Sementara itu, dekan FH Untan Pontianak, Prof Dr Garuda Wiko, usai persidangan mengungkapkan jika pihak Untan, tergabung dengan 35 fakultas hukum negeri di Indonesia, bekerjasama dengan MK untuk menggelar persidangan sengketa Pemilukada. “Fakultas Hukum Untan menggelar sidang MK secara langsung melalui telekonferensi. Kerjasama Fakultas Hukum Untan dan MK ini, bertujuan efisiensi persidangan di MK,” tutur Garuda. Untuk sidang lanjutan Senin depan apakah masih memerlukan pola telekonferensi seperti ini, menurut Garuda, masih menunggu kepastian dari pihak MK. “Kalau digelar lagi di sini (FH, Red), biasanya kita akan diberi tahu MK, kemudian kita teruskan ke pihak-pihak terkait,” pungkasnya. (mik)

Pontianak Post •

Sabtu 20 April 2013

aneka KALBAR

Bina Usia Dini Sambungan dari halaman 17

yang di mulai dengan swadaya masyarakat tersebut juga diharapkannya dapat memberikan dorongan tersendiri terhadap pembangunan masyarakat. Dikatakannya, pembinaan anak dari usia dini merupakan tugas bersama guna mempersiapkan masa depan anak yang cerah. Hal itu guna

mengantisipasi agar anakanak tidak terjerumus dalam hal negatif. “Dan menjadi tugas kita bersama baik orang tua, para guru di sekolah maupun lainnya untuk membina serta mengawas anak-anak kita agar tidak terjerumus pada masa depan yang suram,” katanya. Camat Meliau, Wayah Untung menyambut baik atas dimulainya pembangunan

TPA di Dusun Jaya Indah Desa Bakti Jaya Kecamatan Meliau, menurutnya, melihat kondisi saat sekarang banyak anakanak sudah menyimpang ke hal yang dapat merusak masa depan anak itu sendiri. Camat Kapuas F Meron mengatakan bahwa pembinaan anak dari usia dini merupakan langkah yang tepat guna mengatasi anak dari berbagai hal negatif, maka dengan membina dalam

bidang kerohanian yang baik sianak juga akan mempunyai iman dan moral yang baik pula. “Mengenai pembangunan TPA yang nantinya merupakan tempat pendalaman serta pembelajaran iman kepada anak-anak yang ada di Kedesaan Tapang Dulang. Hal ini sangat disambut baik oleh pihak pemerintah Kecamatan Kapuas dan Desa Tapang Dulang,” katanya. (fik)

ingat masih banyak sapi di Kota Singkawang yang belum menerima bantuan dari pemerintah. “Bantuan ini difokuskan untuk sapi-sapi yang belum mendapatkan bantuan,” kata Kodim. Selanjutnya, kata Kodim, persyaratan juga diberlakukan dalam pemberian bantuan itu, yakni sapi dinyatakan bunting oleh dokter hewan yang ditugaskan dari Dinas Pertanian dan Kehutanan Kota Singkawang. Selain itu, tambah dia, “Hasil pemeriksaan itu, berupa surat hasil pemeriksaan yang ditandatangani oleh petugas

pemeriksa dan pemilik sapi yang menyatakan bahwa sapi tersebut bunting,” jelasnya. Menurut Kodim, bantuan ini diberikan tidak hanya pada sapi-sapi pemerintah yang dipelihara petani, tapi juga ke sapi-sapi pribadi. “Dengan catatan, hanya beberapa ekor saja. Karena bantuan ini tidak untuk peternak melainkan untuk membantu petani yang kurang mampu dalam pemeliharaan sapi agar induk dan anak sapi tetap sehat. Sehingga petani dapat merasakan manfaatnya dalam memelihara sapi untuk jangka panjang,” pungkasnya. (mse)

Insentif Sapi Naik Sambungan dari halaman 17

dari 14 Kab/Kota lainnya di Kalbar yang mendapatkan bantuan itu secara berkelanjutan. Sementara itu, insentif sapi bunting ini merupakan program dari Dinas Peternakan dan Kesehatan Hewan Provinsi KalBar dan di Kota Singkawang sendiri difasilitasi oleh Dinas Pertanian dan Kehutanan Kota Singkawang pada bidang peternakan. Meski bantuan itu berkelanjutan, tambah Kodim, diperkirakan ada perbedaan dalam penyerahan bantuan itu

ditahun 2013 ini kepada para pemilik sapi. “Jika tahun lalu, pemilik sapi bunting di panggil secara bertahap, sesuai daerahnya masing-masing baru uangnya diserahkan. Untuk tahun ini, sapi yang bunting dikumpulkan di beberapa titik yang sudah disepakati, kemudian uang insentif langsung diberikan secara kolektif pada pemilik sapi,” jelasnya. Sedangkan untuk pemilik sapi bunting yang sudah menerima bantuan ini di tahun sebelumnya, maka tidak akan mendatkan lagi pada tahun ini, karena meng-

Perjuangkan Nasib Petani, Nelayan dan Buruh Sambungan dari halaman 17

beberapa tokoh masyarakat Kalbar diantaranya, BL Atan Palil (Deputi Preiden MADN Kalbar), Thadeus Yus SH MPh (Dewan Pertimbangan MADN), Pendeta Yakobus Poli’i (Tokoh Agama) dan beberapa simpatisan dari kalangan mahasiswa Kalbar. Rombongan diterima secara resmi oleh tiga staf KPU Kalbar. Sekitar satu jam menyelesaikan kelengkapan adminstrasi, Petrus dinyatakan sah dan berhak maju menjadi anggota DPD Kalbar. Kepada Pontianak Post, Petrus mengungkapkan keinginannya untuk maju didasari keinginannya untuk membangun dan memajukan Kalimantan Barat. Dia berjanji jika terpilih nanti akan bersamasama anggota DPR-RI untuk memperjuangkan nasib akar rumput, terutama petani, nelayan dan buruh. Menurutnya, penghasilan petani, nelayan dan buruh sangatlah kecil. Jika dibandingkan dengan gaji para pejabat, sangat berbeda jauh. Karena

itu, tak sedikit rakyat Kalbar yang hidup dibawah garis kemiskinan. “Bersama-sama anggota DPR RI dan Pemerintah Kalbar, saya ingin membangun daerah ini menjadi propinsi teladan dan maju di bidang ekonomi, sosial serta kemasyarakatan. Dengan kemajuan di bidang tersebut, saya yakin rakyat kita akan lebih makmur,” ungkap dia. Petrus juga berjanji akan memperjuangkan amanah UUD 45 dan Pancasila. Menurut dia, saat ini Pemerintah Pusat belum melaksanakan sepenuhnya amanah UUD 45 dan Pancasila. ”Masih sepotong-potong. Seperti contoh, masih belum ada keadilan etnis. Masih banyak etnis yang terisolir dan termajinalkan. Contoh lagi, masih ada masyarakat kita yang kesulitan menjalankan ibadah,” ungkap dia seraya mengatakan semua suku di negara ini adalah harta negara, maka dari itu patut dijaga dan diberi keadilan. Lebih lanjut Petrus juga mengatakan akan memper-

juangkan kemakmuran rakyat dengan meningkatkan investasi daerah ini. Harus ada solusi dan terobosan agar ada rasa aman dan nyaman bagi para investor. Selain itu, lanjut dia, dirinya akan memperjuangkan kemajuan wilayah perbatasan yang selama ini kurang mendapat perhatian serius dari pemerintah. ”Pemerintah Pusat harus lebih konsentrasi terhadap wilayah perbatasan. Jangan membangun perbatasan dengan setengah-setengah. Harus ada terobosan,” kata dia. Masih kata Petrus, dirinya mendukung rencana majunya salah satu tokoh masyarakat Kalbar Oesman Sapta di kancah pemilihan DPD nanti. “Saya senang beliau juga maju. Saya anggap ini bukan persaingan. Jika kami samasama terpilih nanti, saya yakin saya dan bang OSO akan jadi kekuatan besar untuk memperjuangkan kemakmuran rakyat Kalbar,” yakinnya. Sementara itu, BL Atan Palil Deputi Preiden MADN Kalbar mengungkapkan siap mendukung Petrus SA maju sebagai

anggota DPD. Menurut dia, Petrus merupakan figur muda yang konsen dan berani dalam memperjuangkan aspirasi rakyat Kalbar. “Petrus figur pemuda yang peduli terhadap rakyat akar rumput. Karena itu kami yakin, jika nanti dia terpilih akan memberikan perubahan yang signifikan bagi kemakmuran dan pembangunan daerah ini,” ungkap dia. Senada disampaikan Thadeus Yus SH MPh, Dewan Pertimbangan MADN Kalbar. Menurutnya, saat ini, peran DPD sudah semakin strategis di pusat. Tak hanya membawa aspirasi rakyat di daerah, DPD juga memiliki peran optimal di Mahkamah Konstitusi dalam menelorkan keputusan perundang-undangan. Karena itu, Kalbar perlu figur DPD yang tepat dan mampu menyuarakan aspirasi rakyat Kalbar dengan sepenuhnya. “Figur tersebut harus memiliki kapasitas, berani serta mampu menyuarakan suara rakyat daerah di pusat nanti. Dan figur tersebut komplit dimiliki Petrus SA,” kata dia. (bdi)

pembentukkan Kabupaten Sentarum. Dengan wilayah kekuasan eks kewedanaan Semitau. Sejumlah kecamatan digabungkan ke dalam Kabupaten baru tersebut. “Tapi itu tadi, masih banyak kendala yang menghadang. Perjuangan membutuhkan energi yang masih sangat besar,” kata Juardi. Sehingga menurutnya, untuk memperpendek rentang kendali solusi lainnya adalah memperlancar akses jalan.

Saat ini telah ada jalan poros utama. Baik jalan Lintas Selatan maupun Lintas Utara. Tinggal bagaimana pemerintah menghubungkan daerahdaerah lainnya ke jalan poros utama itu. Juardi mencontohkan beberapa jalan penghubung telah mampu sedikit member solusi. Seperti jalan Jongkong, Selimbau, Dangkan dan lainnya. “Yang masih harus dilakukan adalah peningkatan kualitas jalan. Karena ratarata ruas jalan penghubung ke poros utama masih rusak.

Bahkan jalan poros utama lintas utara saja hingga saat ini masih hancur-hancuran,” jelas Juardi. Sementara itu, Bupati Kapuas Hulu, AM Nasir SH dalam sebuah kesempatan mengatakan bahwa persoalan jalan menjadi salah satu perhatian dirinya. Dikatakan Nasir, dirinya akan berjuang sekuat tenaga menjolok danadana di pusat untuk perbaikan maupun peningkatan serta membuka akses jalan di Kapuas Hulu. “Kalau hanya mengan-

dalkan dana daerah masih kurang. Dibutuhkan perjuangan yang intensif ke pusat untuk mendapatkan anggaran guna membangun daerah. khsuusnya lagi pada sector akses jalan,” kata Nasir. Nasir optimis, ke depan Kabupaten Kapuas Hulu dapat melangkah lebih maju lagi. Bahkan mampu mengejar ketertinggalan dari daerah lainnya. Yang terpenting dikatakan Nasir bagaimana pemerintah dan rakyat bersinergi membangun Bumi Uncak Kapuas. (w@Nk)

Sering Terima Kekerasan, Siap Dinikahi Selingkuhan Sambungan dari halaman 17

tua DS mencabut laporan karena DS berjanji tak akan mengulangi perbuatannya. DS tetaplah mencintai pria itu. Dia pun berencana membunuh sang suami. Apalagi, menurut pengakuan DS, suaminya selalu kasar termasuk dalam urusan seks. Bahkan, (maaf ) dalam keadaan haid pun, DS dipaksa harus melayani nafsu sang suami. “Dia sering meludahi saya saat berhubungan intim. Saya pun pernah melayani ketika saya sedang haid,” kata DS

polos. Tekanan demi tekanan itulah, membuat DS ingin berpisah. Ternyata, niat berpisah terkabul. Rencana yang disusun bersama Hat berhasil. Sejak dari Kota Bengkayang, DS dan Hat mengatur rencana pembunuhan itu. Hat memberi obat tidur dan sekaleng minuman bersoda. Ternyata, minuman itu ampuh menidurkan korban hingga ajal menjemput. “Awalnya, saya beri bakso yang sudah diberi obat. Ternyata, dia (korban) kepahitan. Jadi, dia tak memakannya. Saya pun beri minuman

kaleng yang sudah dicampur dengan insto,” kata DS. Ketika tidur pulas itulah, Hat yang dibantu OI menghabisi nyawa Saprianto. Kini cinta terlarangnya tak ada halangan. Mereka siap hidup bersama walaupun di sel. “Saya siap nikah dengannya,” kata Hat. Begitu juga DS. Dia tetap ingin bersama HAT yang meluluhkan hatinya. Rosita Nengsih dari Lembaga Hukum Perempuan, Keluarga dan Anak Kalbar, mengakui, usai menjalani proses hukum di pengadilan,

Hat dan DS akan dinikahinya di rumah tahanan negara. “Ya, usai menjalani persidangan yang mungkin membutuhkan waktu enam sampai tujuh bulan, akan kita nikahkan mereka. Apalagi, mereka ingin hidup bersama,” katanya. Diakui Neneng, Rosita Nengsih dipanggil, dari pengakuan DS, ada kekerasan dalam rumah tangga oleh suaminya sebelum dia membunuh. “Bukan hanya itu, dalam hubungan intim pun ada kekerasan,” kata Neneng. Neneng pun siap memberikan pendampingan hukum yang akan berjalan. (*)

bandara. “156 Hektar memang belum cukup kedepan kami akan membebeaskan lahan kembali sekitar 44 hektar lagi sehingga nantinya lahan pembangunan bandara mencapai 200 hektar,” ujar Milton. Proses pembangunan Bandara Tebelian terus memperlihatkan kemajuan. Ha ini terlihat dari proses pembangunan landasan pacu sudah hampir mendekati finis. Pemerintah kabuaten Sintang berharap cmyk

pembangunan bandara tersebut akan rampung pada tahun 2014 mendatang. “Ini target dari kami. Mudah-mudahan pada tahun 2014 mendatang bandara tersbeut sudah dapat digunakan,” tukasnya. Keberadaan Bandara di wilayah timur Kalimantan Barat, lanjut Milton, bukan hanya menguntungkan pihak pemerintah. Keberadaan bandara tersebut menguntungkan semua pihak. Sebut saja dari sektor swasta. Keberadaan bandara sangat menguntungkan terutama

Kecamatan Kejar Target L A N D A K -Ti n g k a t k e sadaran masyarakat untuk melakukan perekaman KTP Elektronik (e-KTP) di Kabupaten Landak ternyata masih rendah. Hal ini terbukti di dua Kecamatan yakni Kecamatan Mandor dan Kecamatan Ngabang. Menurut Camat Mandor, Ursus mengatakan dari 19.764 masyarakat Kecamatan Mandor yang wajib KTP, baru 15.147 masyarakat yang sudah melakukan perekaman e-KTP. Selebihnya yakni 7.002 masyarakat setempat belum melakukan perekaman e-KTP. “Hal ini mungkin saja dipengaruhi beberapa hal, seperti adanya informasi e-KTP yang tidak sampai ke masyarakat. Tapi kalau kita perhatikan bahwa e-KTP ini sudah berlangsung sekitar 2 tahun yakni tahun 2011 dan 2012. Jadi, kalau misalnya informasi tidak sampai, tidak masuk akal juga,” ujar Ursus, Kamis (18/4) di kantornya. Pengaruh yang kedua kata Ursus, kesadaran masyarakat yang belum begitu tinggi untuk perekaman e-KTP. Kemungkinan saja ada masyarakat yang tidak melihat bahwa e-KTP ini sangat penting. “Apalagi KTP yang lama mulai Januari 2014 mendatang sudah tidak berlaku lagi. Maka dari itu awal April lalu kita sudah menulis surat kepada semua Kepala Desa (Kades) se Kecamatan Mandor su-

paya memberitahukan kepada penduduknya yang belum melakukan perekaman eKTP supaya datang ke Kantor Camat Mandor untuk melakukan perekaman,” harapnya. Ia menambahkan, sampai saat ini pihak Kantor Camat Mandor masih menunggu bagi masyarakat yang belum melakukan perekaman eKTP untuk segera melakukan perekaman. “Sebab kita diberi waktu kurang lebih 2 bulan yakni sepanjang bulan April dan sepanjang bulan Mei ditambah lagi pada minggu pertama bulan Juni harus selesai semua. Makanya saya mendesak supaya masyarakat yang belum merekam e-KTP di Kecamatan Mandor supaya segera melakukan perekaman. Apalagi masyarakat yang belum merekam e-KTP ini namanya sudah ada,” kata Ursus. Hal sama juga terjadi di Kecamatan Ngabang yang merupakan ibukota Kabupaten Landak. Di Kecamatan tersebut terdapat 46.949 masyarakat yang wajib KTP. Namun dari jumlah tersebut baru 28.721 masyarakat saja yang sudah merekam dan menerima e-KTP. Selebihnya 17.773 masyarakat belum melakukan perekaman eKTP. “Saya menilai kesadaran masyarakat ini memang berbeda-beda. Kalau tingkat mobilitasnya tinggi, masyarakat akan sadar. Tapi kalau memang mobilitasnya rendah, sudah kita sosialisasikan sampai turun

ke lapanganpun untuk jemput bola, masyarakat belum ada kesadarannya. Sehingga kesimpulannya masih rendahlah kesadaran masyarakat kita ini,” ungkap Camat Ngabang, Julimus, Jumat (19/4) di kantornya. Menurut Julimus, rendahnya kesadaran masyarakat untuk melakukan perekaman e-KTP tidak hanya terjadi pada masyarakat di Desa pedalaman Kecamatan Ngabang saja. Sejumlah Desa yang ada di Kota Ngabangpun keadaannya demikian. “Kalau memang informasi mengenai e-KTP ini tidak jelas, tidak mungkin. Sebab kita sudah mengantarkan surat undangan kepada masyarakat untuk melakukan perekaman e-KTP, sudah menginformasikannya melalui media masa dan sebagainya, tetapi masih banyak masyarakat Kecamatan Ngabang yang belum melakukan perekaman e-KTP,” kesalnya. Untuk mengatasi hal tersebut, ia meminta Kades sampai RT untuk menginformasikan kembali kepada masyarakat yang belum melakukan perekaman e-KTP untuk segera melakukan perekaman. “Sehingga target kita sampai bulan Juni 2013 ini seluruh masyarakat Kecamatan Ngabang yang wajib KTP sudah melakukan perekaman e-KTP. Memang ada perkembangan berikutnya, setiap hari masyarakat dari berbagai Desa datang ke Kantor Camat Ngabang untuk merekam e-KTP,” pungkasnya. (wan)

desa model juya harus dapat mengembangkan hal ini dengan baik. Apalagi dalam pengembangan desa model itu sendiri terdiri dari berbagai tanaman sayur-sayuran, kacang-kacangan, tomat dan holtikultura lainnya akan sangat mendukung sekali untuk mendukung pendapatan masyarakat apabila di kelola dengan baik.

“Makanya kita dari tingkat Kabupaten akan terus memacu perkembangan desa model yang ada di Bagak ini agar lebih menigkatkan keberhasilan yang sudah di capai, apalagi ini adalah lomba tingkat Nasional otomatis persaingan akan lebih berat termasuk penilaiannya juga akan semakin berat “ tuturnya. (wan)


Wakili Kalbar Sambungan dari halaman 17

Kecamatan Banyuke sebagai Desa Model, “ ungkapnya. Ia mengatakan dalam rangka peningkatan pengembagan program pengembangan tanaman perkerangan tersebut, tidak hanya dikembangkan didesa model saja akan tetapi diharapkan kepada masyarakat di luar

Sambungan dari halaman 28

saat ini di Kapuas Hulu tidak hanya eksis dengan mengharapkan bantuan Pemkab, tapi kembangkanlah diri terus-menerus,” imbau Alex. “Melalui pemasan di TMII

dalam sektor perdagangan. “Pembangunan bandara akan mempercepat proses pembangunan.Salah satunya akan mempermudah transportasi masyarakat untuk datang dan pergi ke Sintang,” tukasnya. Sementara Ketua rombongan DPDRI H. Ishaq Saleh dalam sambutanya mengaku akan berusaha membantu dan menaympaikan hal ini ke DPRRI. “Memang inilah tugas kami ketika datang kedaerah untuk menyerap aspirasi masyarakat. Sehingga nantinya jika ada permasalahan

akan kami bawa ke tingkat pusat,” ujar Ishaq. Dalam kunjunganya, Ishaq yang baru menjabat sebagai Anggota DPDRI kurang lebih dua bulan menggantikan Hj Sri Kadar Wati Aswin yang sudah terlebih dahulu meninggal dunia, mengaku akan terus berusaha memperjuangkan kepentingan masyarakat Kalimantan Barat. Hal tesebut ditunjukan salah satunya mengunjungi Kabupaten Sintang. “Ini upaya kami untuk menyerap aspirasi masyarakat,”pungkasnya. (jie)

dan Istora Senayan ini, sangat diharapkan kedepan daerah Kapuas Hulu bisa lebih terekspos dan terpasarkan sehingga wisatawan bisa terus masuk ke Indonesia dan Kapuas Hulu juga. Karena budaya yang ada di Kapuas Hulu ini beraneka

ragam. Di samping itu alam kita juga mempesona, dan ini adalah kebanggaan bersama yang patut diperjuangkan secara bersama-sama oleh semua pihak agar lebih berkembang,” tutup Alex. (wank)

Bupati: Jangan Ada Unas Lagi Sambungan dari halaman 28

Milton mengatakan pendidikan karakter lebih penting daripada standar nilai dalam kelulusan. Apalagi standar kelulusan dipukul rata tanpa memperhatikan kemampuan anak-anak di daerah. Dekan FKIP Untan, Aswandi punya pendapat yang berbeda. Dia mengatakan, meski pelaksanaan Unas tahun ini hancur-hancuran, tapi dia menilai Unas harus tetap ada. Dikatakannya, bicara soal mutu pendidikan memang harus ada standarnya. Kalau standar mutu pendidikan atau standar kelulusan ini ditentukan ke sekolah, saat ini sekolah masih belum bisa jujur soal standar mutu tersebut. Aswandi juga menilai jika tidak

ada Unas, maka pelaksanaan pendidikan di sekolah menjadi tidak serius karena tidak ada yang menjadi tolok ukur bagi sekolah. “Unas ada, dapat menggenjot sekolah memacu kualitas pendidikannya,” jelas Aswandi. Dia menegaskan kesadaran siswa untuk belajar yang masih kurang inilah, sehingga perlu dilaksanakannya Unas. “Kecuali kesadaan belajar sudah tinggi, maka Unas tidak perlu dilaksanakan. Unas ialah kontrol kualitas. Ada kebanggaan siswa jika lulus Unas. Kalau Unas tidak dilaksanakan rusak pendidikan kita nanti,” tegasnya. KPK Perlu Periksa Anggota Komisi III DPRD Kabupaten Sintang Mardiansyah, merasa sangat prihatin dengan amburadulnya pelak-

sanaan Unas tahun ini. Dia menilai gagalnya pelaksanaan Unas secara serentak dan jeleknya kualitas cetakan soal dan lembar jawaban Unas, harus menjadi perhatian Komisi Pemberantasan Korupsi (KPK). “Proyek pencetakan soal Unas tampaknya asalasalan, KPK harus menyelidiki ini,” desaknya. Mardiansyah menilai kualitas hasil cetakan lembar soal dan lembar jawaban Unas yang jelek patut diselidiki oleh KPK. “Kualitas kertasnya seperti tidak standar. Kita belum tahu untuk Unas SMP, apakah kualitas lembar jawabannya juga jelek. Kalau sama juga dengan Unas SMA, maka patut dipertanyakan ada apa dengan proyek Unas ini,” katanya. (tra)

menghapus data yang ganda. Yang berwenang menghapus adalah pemerintah pusat,” paparnya. Kalau itu sudah diperkuat dan sistem pelaporan bagus, tidak akan menjadi masalah lagi dalam pendataan penduduk di Kapuas Hulu. Data yang masuk ke Kementrian Dalam Negeri pun sesuai data di lapangan. “Sebab itu, saya juga mengajak agar RT atau

RW turut meduku pendataan agar semuanya sesuai fakta di lapangan. Di samping itu, kami juga berharap pemerintah pusat dan provinsi dapat memperhatikan sistem jaringan yang menghubungkan pihak kecamatan dengan Disdukcapil Kabupaten Kapuas Hulu, agar dapat mempersingkat waktu dalam menggudate data kependudukan,” harap Marcellus. (wank)

Harus Aktif Sambungan dari halaman 28

Wujudkan Bandara Tebelian Sambungan dari halaman 17

E-KTP, Kesadaran Masyarakat Rendah

Pasarkan Budaya di TMII dan Istora Senayan

Rentang Kendali Panjang Sambungan dari halaman 17


bertambah. “Kalau mau bagus, kita memang mengharapkan dari tingkat bawah itu aktif. Lahir, meninggal, pindah dan datang betulbetul tercatat. Karena apa pun data yang masuk ke Disdukcapil Kapuas Hulu, itu yang diserahkan ke Kementrian Dalam Negeri. Sebab, kami tidak ada kewenangan untuk

Jembatan Rusak Rawan Kecelakaan Sambungan dari halaman 28

dibangun terlihat memprihatinkan dan sangat rawan,

bila dilewati kendaraan roda dua maupun empat. Kalau hujan, tanahnya akan licin dan bisa membuat pengendara

terperosok ke bagian bawah jembatan. Kita mencegah itu semua terjadi,” ungkapnya. (sgg)


PRO-KALBAR Pontianak Post


Jangan Kebut-kebutan MASIH sering ditemukannya ajang adu kebut di jalan raya, sangat disayangkan Anggota DPRD Kapuas Hulu. Salah satunya adalah Kusfery Ace. Menurut Ace, harusnya dibangun kesadaran, terutama generasi muda agar lebih sayang nyawa ketimbang kebut-kebutan di jalan raya. Karena, aksi tersebut selain membahayakan diri sendiri juga membahayakan orang lain. “Kalau sudah ngebut Kusfery Ace tak terkendali, maka celaka mengancam. Bisa-bisa nyawa melayang. Sebab itu, janganlah kebut-kebutan dan sayangi nyawa,” imbau Kusfery. Ketua MPC Pemuda Pancasila Kapuas Hulu ini mengimbau kepada masyarakat khususnya pemuda-pemuda se-Kabupaten Kapuas Hulu, untuk tidak ugal-ugalan apabila menggunakan kendaraan. Termasuk mengendarai sepeda motor dalam kondisi kurang normal. Seperti habis menegak minuman keras dan lain sebagainya.(wank)

Sabtu 20 April 2013

Pasarkan Budaya di TMII dan Istora Senayan PUTUSSIBAU--Kabupaten Kapuas Hulu akan memasarkan budayanya di Taman Mini Indonesia Indah (TMII) dan Istora Senayan Jakarta. Pemasaran budaya Kapuas Hulu tersebut melalui event Explore Eksotika of Borneo (E2OB) dan Pekan Budaya Dayak Nasional (PBDN), yang turut diukuti seluruh provinsi di Pulau Kalimantan. “Untuk E2OB di TMII, kita ikuti besok (hari ini, Red) dari 20-21 April, selanjutnya PBDN di Istora Senayan itu dari 27-30 April,” kata Kepala Dinas Kebudayaan dan Pariwasa (Disbudpar)

Kabupaten Kapuas Hulu, Alexander Rombonang, Jumat (19/4). Dipaparkan Alex pada kedua even tersebut, Kapuas Hulu menampilkan tari Lesung (menumbuk padi) yang dikolaborasikan Sanggar Terabai dan Sanggar Kenyalang Kayu. Di samping itu, Kapuas Hulu juga membuka stan pameran potensi pariwisata dan parade lagulagu daerah.

Alexander Rombonang

“Dalam kedua even ini ada 40 orang yang diturunkan dari Kapuas Hulu. Rombongan ini selain penari ada juga ibu-ibu Dharma Wanita Persatuan Disbudpar Kapuas Hulu yang akan menyanyikan lagu daerah di sana. Rombongan tersebut saya yang pimpin langsung,” imbuhnya. Melalui even-even seperti ini, Kapuas Hulu diupayakan untuk lebih

Ke Halaman 27 kolom 5

Bupati: Jangan Ada Unas Lagi


Harus Aktif UNTUK mencapai data-data yang akurat dalam pencatatan penduduk, Kepala Dinas Kependudukan dan Pencatatan Sipil (Disdukcapil) Kapuas Hulu, Marcellus, menilai hal tersebut dapat dicapai apabila jajaran dasar di desa dan kecamatan serta jaringan online benarbenar aktif dalam mengupdate data terbaru. “Agar pencatatan itu valid 100 persen. Perlu diperbaiki juga jaringan dari kecamatan ke Disdukcapil Kapuas Marcellus Hulu, karena selama ini tidak online dari kecamatan dan ke kabupaten. Selain itu dari data yang lahir dan meninggal, pindah dan datang juga harus aktif dicatat oleh RT dan RW setempat dan diupadate ke kecamatan. Dengan demikian tidak akan ada data ganda,” imbuh Marcellus. Diakui Marcellus, kedua hal tersebut yang menjadi salah satu kendala di Kapuas Hulu, sehingga pencatatan penduduk Kapuas Hulu tidak bisa akurat seratus persen. Terutama pencatatan angka kematian sangatlah kurang, karena masyarakat jarang melaporkan tentang meninggalnya keluarga mereka. Sedangkan kelahiran selalu aktif

menggemakan potensi budaya yang ada di daerah. Di samping itu, hal tersebut juga menjadi motivasi bagi sanggarsanggar lain yang ada di Kapuas Hulu, karena sudah ada wadah pemasaran untuk karya seni tari. “Untuk itu kedepan Disbudpar Kapuas Hulu juga akan berusaha semaksimal mungkin untuk membina sanggar tari yang ada, sesuai kemampuan. Namun terlepas dari itu, kami juga mengajak agar sanggar-sanggar yang ada


RAWAN: Kondisi jembatan menuju ke PLTU Sui Batu memprihatinkan dan rawan kecelakaan saat musim hujan.

Jembatan Rusak Rawan Kecelakaan SANGGAU--Kondisi infra­ struktur jalan dan jembatan menuju lokasi Pembangkit Listrik Tenaga Uap (PLTU) di Desa Sui Batu, Kabupaten Sanggau masih membutuhkan banyak perbaikan, terutama jembatan yang sudah mulai mengkhawatirkan bagi kendaraan yang lalu lalang di wilayah tersebut, termasuk warga sekitar. Staf Unit Pelaksana Konstruksi (UPK) PLTU Kalimantan Barat III, Arif Nurhadi saat ditemui belum lama ini membenarkan hal tersebut. Bahkan pihaknya

terpaksa melakukan perbaikan pada lokasi-lokasi yang sudah sangat parah. Soal infrastruktur juga dilakukan oleh kontraktor, agar akses transportasi bisa tetap berjalan normal. “Kita sudah surati Pemkab Sanggau. Sementara jembatan dan kerusakan yang ada di infrastruktur dari pihak pengembang, ini yang bisa kami lakukan sambil terus mem-follow up kepada Pemkab agar bisa ditindaklanjuti segera,” ujarnya. Ia juga memberi informasi,

Ke Halaman 27 kolom 5

bahwa anggaran perbaikan jalan baru akan direalisasikan pada tahun 2013 setelah dicairkannya anggaran. Pihaknya berharap Pemkab memberi sinyal positif, agar pembangunan PLTU di Desa Sui Batu tersebut dapat segera terealisasi. “Jika infrastruktur utamanya jembatan sudah bisa baik, maka kita harapkan semuanya bisa berjalan lancar kedepannya. Memang ada beberapa kondisi jembatan sementara yang Ke Halaman 27 kolom 5

SINTANG--Kacau balaunya pelaksanaan Ujian Nasional (Unas) tahun ini dengan tertundanya Unas di 11 provinsi dan jeleknya kualitas cetakan soal Unas, semakin membuat banyaknya publik menolak Unas. Penolakan adanya Unas Kita lihat pelaksanaan juga datang dari Bupati Sintang Unas selalu Milton Crosby, mendatangkan Ju m a t ( 1 9 / 4 ) saat berdiskusi masalah” dengan anggota Milton Crosby D P D K a l b a r, Ishaq Saleh. Milton menyarankan, sebaiknya jangan ada Unas lagi di tahun depan. “Kita lihat pelaksanaan Unas selalu mendatangkan masalah,” tegasnya. Dia meminta DPD Kalbar menyampaikan kepada Kementerian Pendidikan untuk meniadakan Unas. Milton menyarankan soal kelulusan siswa sebaiknya diserahkan kepada sekolah untuk menentukannya. “Soal kualitas lulusan yang ditentukan sekolah, biar nanti akan terseleksi saat masuk di perguruan tinggi,” ujarnya. Soal standar dari kualitas pendidikan, Milton menyarankan standar tersebut cukup diberikan di tingkat perguruan tinggi. “Hasil Unas tidak bisa menentukan keberhasilan seseorang,” ujarnya. Dia menilai, adanya Unas mengajarkan anak menghapal dan tidak jujur. Anak menjadi mudah teriming-imingi pihak lain yang akan menjual kunci jawaban padanya. “Kalau siswa sudah tidak jujur bagaimana nanti dia menjadi pejabat,” tanyanya. Ke Halaman 27 kolom 5





Pontianak Post


Sabtu 20 April 2013




BARCELONA- Asisten pelatih Barcelona Jordi Roura mengungkapkan, prioritas timnya di musim ini adalah menjuarai La Liga Spanyol. Saat ini, Blaugrana nyaman di puncak klasemen La Liga dan unggul 13 poin dari peringkat kedua Real Madrid. “Bagi kami, liga domestik adalah turnamen paling penting. Jika kami pada akhirnya hanya memenangi liga, saya pikir kami semua akan sangat bahagia dengan musim ini,” ujar Roura dalam jumpa pers menjelang laga akhir pekan melawan Levante. “Tim ini telah melewati berbagai kesulitan. Kami mengalami banyak cedera pemain dan dapat mengatasinya. Kami butuh sembilan poin lagi untuk memenangi liga dan kami akan mencoba meraihnya secepat mungkin,” pungkasnya. Usai menghadapi Levante, Barcelona akan bertandang ke Jerman untuk menjalani leg pertama semi-final Liga Champions melawan Bayern Munich pada tengah pekan besok. Sementara itu Lionel Messi mulai kembali berlatih menyusul cedera hamstring yang menderanya. Ini menjadi kabar gembira untuk Barcelona menjelang laga Liga Champions kontra Bayen Munich. MessimendapatkancederahamstringketikamembelaBarcamenghadapiParisSaint-GermaindilegIbabak perempatfinal Liga Champions lalu pada 2 April lalu. Akibat cedera tersebut, empat hari kemudian Messi cuma menjadi penonton ketika timnya memetik kemenangan 5-0 atas Real Mallorca di partai La Liga. Namun demikian, pada 10 April lalu ia terpaksa diturunkan di setengah jam terakhir, dalam kondisi tidak maksimal, guna membantu Barca mengatasi PSG di laga leg II perempatfinal. Bagusnya, Messi kini sudah kembali terlihat di lapangan latihan Barca, Kamis (18/4). Pemain asal Argentina itu tentu diharapkan sudah bugar sepenuhnya untuk partai leg I babak semifinal kontra Bayern di Allianz Arena, Rabu (24/4) dinihari WIB. “Kabar besar dari sesi latihan hari ini adalah keberadaan Leo Messi,” tulis situs Barca. “Pemain Argentina itu, yang mengalami cedera hamstring kanan di Parc des Princes, memulai latihan kebugaran di salah satu lapangan Ciutat Esportiva,” lanjut keterangan tersebut. Ditambahkan, Sergio Busquets yang mengalami cedera ringan di bagian kunci paha juga sudah terlibat dalam sesi latihan tim, setelah sehari sebelumnya berlatih terpisah.(int)

AGENDA Premier League Sabtu, 20 April 2013 Fulham v Arsenal (siaran langsung Global TV pukul 20.30 WIB) Norwich City v Reading QPR v Stoke City Sunderland v Everton Swansea City v Southampton West Bromwich v Newcastle United West Ham United v Wigan Athletic Minggu, 21 April 2013 Tottenham Hotspur v Manchester City (siaran langsung Global TV pukul 19.00 WIB) Liverpool v Chelsea (siaran langsung MNCTV pukul 21.30 WIB) Primera Division Sabtu, 20 April 2013 Granada v Real Valladolid Real Madrid v Real Betis (siaran langsung Trans TV pukul 22.40 WIB) Minggu, 21 April 2013 (dini hari WIB) Barcelona v Levante (siaran langsung Trans TV pukul 00.50 WIB) Valencia v Malaga Minggu, 21 April 2013 Getafe v Espanyol Deportivo La Coruna v Athletic Bilbao Senin, 22 April 2013 (dini hari WIB) Osasuna v Real Sociedad Sevilla v Atletico Madrid (siaran langsung Trans 7 pukul 01.45 WIB) Serie A Minggu, 21 April 2013 (dini hari WIB) Genoa v Atalanta Udinese v Lazio Minggu, 21 April 2013 Inter Milan v Parma AS Roma v US Pescara Bologna v Sampdoria Catania v Palermo Fiorentina v Torino Napoli v Cagliari (siaran langsung TVRI pukul 20.00 WIB) Siena v Chievo Senin, 22 April 2013 (dini hari WIB) Juventus v AC Milan (siaran langsung TVRI pukul 01.45 WIB)



Nou Camp Paling Semarak

Real Madrid Pentaskan Pasukan Pelapis MADRID- Real Madrid sudah angkat tangan dari perburuan gelar Primera Division Spanyol. Target realistis mereka sekarang tinggal memastikan diri mengunci posisi kedua di belakang sang penguasa klasemen sementara Barcelona. Rival sekota mereka, Atletico Madrid, juga menguntit pada posisi ketiga dengan ketertinggalan tiga angka di belakang (65-68). Namun, untuk jornada ke-32, konsentrasi Real terserap pada first leg semifinal Liga Champions melawan Borussia Dortmund (24/4). Alasan itulah yang membuat entrenador Jose Mourinho lebih memilih merotasi skuadnya. Para pelapis akan diberikan kesempatan unjuk gigi ketika menjamu Real Betis di Santiago Bernabeu, malam nanti (siaran langsung Trans TV pukul 23.00 WIB). “Kami harus fokus pada sisa musim ini dengan baik. Masih jauh mencapai tujuan utama kami. Masih dua pertandingan menuju final Liga Champions, di Primera Division kesempatan kami sudah habis,” jelas Mourinho, seperti dikutip Marca. Selain di Liga Champions, target gelar Los Blancos, julukan Real,

lainnya adalah di Copa del Rey. Mereka telah mencapai final dan akan menghadapi rival sekotanya Atletico dalam El Derbi Mardrileno di Bernabeu pada 17 Mei nanti. (ham)





2012 Klub Barcelona (Spanyol) B. Dortmund (Jerman) Man United (Inggris) Real Madrid (Spanyol) Bayern (Jerman)

Stadion Nou Camp Signal Iduna Old Trafford Bernabeu Alliaz Arena

Kapasitas 98.787 81.264 75.957 80.354 69.000

Penonton 84.119 80.521 75387 74. 836 69.000

2011 Barcelona (Spanyol) B. Dortmund (Jerman) Man United (Inggris) Real Madrid (Spanyol) Bayern (Jerman)

Nou Camp Signal Iduna Old Trafford Bernabeu Alliaz Arena

98.787 81.264 75.957 80.354 69.000

79.268 79.151 75.109 71. 289 69.000

2010 Barcelona (Spanyol) B. Dortmund (Jerman) Real Madrid (Spanyol) Man United (Inggris) Bayer n (Jerman)

Nou Camp Signal Iduna Bernabeu Old Trafford Alliaz Arena

98.787 81.264 80.354 75.957 69.000

78.097 77.248 74. 921 74.864 69.000

2009 Man United (Inggris) B. Dortmund (Jerman) Real Madrid (Spanyol) Barcelona (Spanyol) Bayern (Jerman)

Old Trafford Signal Iduna Bernabeu Nou Camp Alliaz Arena

75.957 81.264 80.354 98.787 69.000

75.304 74.830 71. 289 71328 69.000

2008 Real Madrid (Spanyol) Man United (Inggris) B. Dortmund (Jerman) Bayern (Jerman) Barcelona (Spanyol)

Bernabeu Old Trafford Signal Iduna Alliaz Arena Nou Camp

80.354 75.957 81.264 69.000 98.787

76. 234 75.691 72.510 69.000 67.560

*) Rata-rata penonton setiap laga dalam setahun.



Pontianak Post


Sabtu 20 April 2013

Kejar Posisi di Belakang Tim Pabrikan AUSTIN - Keuntungan besar bakal dinikmati para pembalap tim pabrikan Honda dan Yamaha saat berlangsungnya MotoGP Austin di Circuit of The Americas (COTA), Austin, Amerika Serikat (AS). Masing-masing dua pembalap dari Repsol Honda dan Yamaha Factory, ditambah Stefan Bradl dari LCR Honda sudah mencoba sirkuit yang baru pertama kali menggelar balapan MotoGP itu. Hal tersebut diungkapkan oleh salah satu pembalap tim Yamaha Tech 3 Cal Crutchlow. Menurutnya, akan sulit menandingi lima pembalap tersebut. Dibandingkan dirinya, lima pembalap tersebut punya bekal keuntungan yang besar begitu datang lagi untuk menjalani akhir pekan balapan. “Posisi lima atau enam besar jadi batas terbaik. Jika melewatkan tiga hari pertama, makin mustahil untuk bersaing di barisan depan,” tutur Crutchlow. Bidikan paling realistis baginya adalah posisi terbaik di antara para pembalap yang belum mencicipi COTA. “Dengan lintasan yang panjang dan sangat teknis, kami akan kehilangan banyak waktu. Tapi, saya kira para pembalap lain yang belum

(Mirco Lazzari gp/Getty Images Europe)

SIAP : Pembalap Team Monster Yamaha Tech 3, Bradley Smith (kiri) dan Cal Crutchlow dengan kendaraannya masing masing siap tampil di lomba Moto GP tahun ini.





melakukan uji coba (di COTA) akan mengalami hal serupa. Jadi, tugas saya adalah berada di depan kelompok itu,” tuturnya. Pada balapan pertama di Losail, Qatar, dua pekan lalu, Crutchlow mampu memberikan perlawana ketat pada para pembalap pabrikan. Dia sempat bersaing untuk memperebutkan posisi kedua. Namun, akhirnya di harus puas dengan posisi kelima setelah Dani Pedrosa menyalipnya beberapa lap sebelum balapan berakhir. Tapi, sebelum seluruh tim turun menuju latihan perdana di COTA, Yamaha Tech 3 sudah mendapatkan nasib sial. Yamaha Tech 3 mengalami musibah, terjadi kebakaran di garasi mereka Kamis (18/4) dinihari waktu setempat sebelum latihan perdana berlangsung. Kejadian itu dipicu dari starter elektrik salah satu motor milik kedua pembalap mereka Cal Crutchlow dan Bradley Smith. Akibatnya, sebagian peralatan komputer mengalami kerusakan. Meski begitu, tim mengatakan tidak akan menyebabkan masalah besar untuk balapan akhir pekan ini. “Kami mengalami kerusakan cukup banyak dan tentu saja kejadian

ini menghambat persiapan kami. Tapi untungnya pencegahan kebakaran yang dilakukan pihak penyelenggara COTA dan bantuan dari unit pemadam kebakaran setempat bergerak cepat untuk menghentikan kobaran api agar tidak meluas,” terang bos tim Yamaha Tech 3 Herve Poncharal. Poncharal juga meminta maaf kepada tim Yamaha, LCR Honda serta Cardion AB yang mendapatkan dampak dari kejadian kebakaran tersebut ketika sistem penyiraman otomatis di garasi mereka berfungsi. Garasi tiga tim tersebut ikut basah dan beberapa peralatan basah. Bahkan, motor-motor tim tersebut ikut basah. Sementara itu, Bos tim Yamaha Factory, Massimo Meregalli mengatakan gangguan yang menghampiri timnya tidak akan menghambat timnya untuk tetap fokus ke dalam balapan. “Kesan pertama kami setelah tiba benar-benar buruk. Tapi untungnya tidak seburuk dari yang dipikirkan sebelumnya. Sekarang langkah yang harus kami lakukan adalah, membongkar motor dan mengeringkannya, membersihkan, dan kembali memperbaiki motor,” kata Meregalli.(ady)

Pontianak Post

Sabtu 20 April 2013

Football lovers

Bale-Hazard Favorit Terbaik Inggris

Chelsea Kembali True Blue TAK ada lagi aksen warna gold di jersey Chelsea musim depan. Lupakan pula aksen merah di kerah seperti dua musim lalu. Dengan kata lain, Chelsea memilih kembali ke selera asal mereka, yakni true blue. Chelsea pun menajdi klub pertama di Premier League yang sudah merilis jersey utamanya (home) musim depan. Sekalipun videonya baru dirilis kemarin, pengambilan gambar sejatinya telah dilakukan pada Februari lalu. Bertempat di Halliford Studios di Surrey, dekat dengan markas latihan Chelsea di Cobham, sembilan bintang The Blues “ sebutan Chelsea “ didapuk sebagai model. Yakni, David Luiz, Gary Cahill, Fernando Torres, Juan Mata, Oscar, John Terry, Demba Ba, Eden Hazard, dan Petr Cech. Khusus Torres, kehadirannya mengindikasikan bahwa striker internasional Spanyol itu tetap menjadi bagian skuad Chelsea musim depan. Selama pengambilan gambar, setiap pemain “dihias” dengan warna biru (bukan cat, melainkan gliserin yang tidak berbau). “Biru adalah identitas klub, pemain, dan suporter,” kata Mata seperti dilansir Daily Mail. “Chelsea sudah seperti rumah sendiri dan telah menjadi keluarga kedua bagi saya,” sahut Cech yang hampir satu dekade membela Chelsea itu. Tentu saja, tidak hanya warna yang menjadi keunggulan kostum baru Chelsea. Ada teknologi TechFit yang akan membantu pemain meningkatkan kecepatan, daya tahan, dan kesadaran. TechFit menstabilkan otot dan memfokuskan energi sehingga pemakainya bisa mengeluarkan akselerasi yang eksplosif dan kekuatan yang maksimal. Tak ketinggalan Climacool yang akan mengontrol panas dan kelembaban. Lubang-lubang ventilasi dan kain 3D meningkatkan aliran udara ke kulit di areaarea penting untuk memicu dikeluarkannya panas tubuh. Rencananya, jersey ini baru akan dilempar ke pasaran pada 15 Mei mendatang. (dns/bas)


ROBIN van Persie begitu menginspirasi permainan Manchester United. Luis Suarez juga menjadi mesin gol Liverpool sekaligus pemuncak semantara top scorer Premier League. Tapi, bukan keduanya yang favorit bakal memenangi penghargaan pemain terbaik di Inggris musim ini (2012-2013). Keduanya memang masuk nomine pemain terbaik PFA (Asosiasi Pemain Sepak Bola Inggris). Hanya, mengacu prediksi rumah bursa, favorit pemenang adalah Gareth Bale. Bintang Tottenham Hotspur itu pun diprediksi bakal memenangi award keduanya setelah dua tahun lalu. Sejak kali pertama diberikan pada 1973-1974, hanya empat pemain yang pernah memenanginya lebih dari sekali. Antara lain, Mark Hughes, Alan Shearer, Thierry Henry, dan Cristiano Ronaldo. Henry dan Ronaldo bahkan tiga kali meraihnya. “Jika Anda memband-

Gareth Bale





ingkan dengan musim lalu, transformasi Gareth (Bale) sangat luar biasa musim ini,” kata pelatih Spurs sebutan Tottenham - Andre Villas-Boas seperti dilansir teamTALK. Bale yang dulu lebih suka memberi assist itu kini telah menjelma sebagai predator. Koleksi golnya tak lagi belasan, melainkan 22 gol dari 38 laga sepanjang musim ini. Kemampuan winger 23 tahun itu juga makin matang (kini spesialisasi free kick) dan lengkap (bisa bermain di tengah bahkan striker). Bale pun telah diband-

ing-bandingkan dengan dua pemain terhebat sejagat saat ini, Lionel Messi dan Ronaldo. Real Madrid juga telah menempatkan pemain berkebangsaan Wales tersebut sebagai buruan utama di bursa transfer musim panas nanti. Tak hanya pemain terbaik, Bale juga masuk nomine pemain muda terbaik. Hanya winger Chelsea Eden Hazard yang namanya juga masuk dua kategori penghargaan. Untuk kategori yang musim lalu dimenangi bek kanan Spurs Kyle Walker itu, Hazard paling favorit versi bursa. (dns)

Nomine PFA Award Pemain Terbaik:

Pemain Muda Terbaik:

Gareth Bale (Tottenham)

Eden Hazard (Chelsea)

Robin van Persie (Man United)

Gareth Bale (Tottenham)

Michael Carrick (Man United)

Romelu Lukaku (West Brom)

Luis Suarez (Liverpool)

Christian Benteke (Aston Villa)

Juan Mata (Chelsea)

Danny Welbeck (Man United)

Eden Hazard (Chelsea)

Jack Wilshere (Arsenal)

PANGLIMA TIAN FENG ”Dari dulu beginilah cinta, penderitaan-


nya tiada pernah berakhir..”

Pontianak Post ʁ Sabtu 20 April 2013

- Ti Pat Kay, Journey to The West -





Suatu hari kamu diajak nongkrong bareng pacar dan teman-temannya. Apa yang kamu lakukan di sana ? a. Cuek aja, udah biasa kok. Biar nggak garing mainan Twitter aja ah. b. Tampil cool, siapin senyum manis ke teman pacar yang kece. c. Diam-diam udah naruh perhatian ke salah seorang teman pacar yang charming abis. d. Deketin yang paling oke dong. Siapa tahu diajak kenalan, terus jadi dekat.

MESKI ngaku setia kayak apa juga, tanpa sadar kalian pasti pernah melakukan perselingkuhan yang tidak disengaja. Nih, X kasih tes untuk mengetahui potensi selingkuh seperti apa yang akan dan pernah kalian lakukan. Jawab yang jujur ya.


Lagi libur sekolah, boring banget di rumah. Enaknya ngapain ya? a. Nerusin game yang kemarin biar cepet tamat. b. Stalking timeline kakak kelas yang itu tuuh. c. PING! Kontak teman di BBM, cari teman chatting. d. Nggak pake lama, langsung ajak nonton si somebody else.


Akhir-akhir ini, kamu kayaknya makin dewasa dalam menghadapi apa yang terjadi di hidupmu. Soal cinta, udah deh hadapin apa yang ada. Ikutin ritmenya. GEMINI 21 MEI - 21 JUNI Duh, ada yang lagi jatuh cintrong nih. Ibarat bunga, kamu lagi wangi-wanginya, makanya banyak kumbang yang ngedeketin. Gebet salah satunya! CANCER 22 JUNI - 22 JULI Nah loh ketahuan kan kalau lagi galau? Sukanya ngeluh aja. Hei, mengeluh nggak membuat segala tugasmu cepat selesai. Mending jalan-jalan sama pacar. LEO 23 JULI - 23 AGUSTUS Nobody’s perfect. Nggak ada alasan lagi kamu nuntut atau ngarep yang macam-macam sama pacarmu atau gebetanmu. Manusia pasti punya kekurangan. VIRGO 24 AGUSTUS - 22 SEPTEMBER Cuaca lagi nggak bersahabat. Badan kamu yang rentan cuaca juga terancam deh. Udah sakit, nggak punya pacar yang lagi stand by pula. Sedih kan. LIBRA 23 SEPTEMBER - 23 OKTOBER Kamu kelihatan selalu ceria. Nggak tahu kalau dalam hatinya galau atau nggak, hehe. Tapi, nggak ada untungnya juga kan nunjukin muka bete ke orang lain. SCORPIO 24 OKTOBER - 22 NOVEMBER Ah, ternyata kamu magamon (manusia gagal move on) tipis-tipis ya. Inget mantan terus sih. Apalagi mantan udah punya gandengan baru #uhuk. SAGITARIUS 23 NOVEMBER - 21 DESEMBER Ada yang kangen sama aktivitas lama nih. Tapi inget, kamu harus komitmen dan menyelesaikan tanggungan di depan mata. Soal cinta, move on yuk. CAPRICORN 22 DESEMBER - 20 JANUARI Sifat keras kepala kamu bikin geregetan. Coba sesekali dengerin kata orang lain. Psst, diam-diam ada yang masih ngarep ya sama kamu. Buruan kasih sinyal sana. AQUARIUS 21 JANUARI - 19 FEBRUARI Kayaknya udah mantep banget ya sama pacar yang sekarang. He/she is the one gitu deh kayaknya. Nggak ada salahnya sih kalau kamu udah yakin sama dia. PISCES 20 FEBRUARI-20 MARET Selamat datang di dunia baru aja deh buat Pisces yang bulan ini dihadapkan pada babak baru di hidupnya. Entah itu pacar baru, kecengan baru, atau yang lainnya. ARIES 21 MARET-19 APRIL Selesaikan apa yang harus diselesaikan. Satu lagi nih, jangan pernah galau karena ngerasa kesepian, karena banyak yang peduli sama kamu.


Handphone kamu tiba-tiba berdering. Di luar dugaan, mantan menelepon bilangnya pengin ngobrol. Apa reaksimu ? a. Nolak ngobrol lama-lama, bilang lagi sibuk. b. Nggak masalah, fine aja. Toh, lama nggak ngobrol. c. Mendadak kangen, inget kenangan masa-masa pacaran dulu. d. Menerimanya dengan manis. Syukur kalau dia ngajakin ketemuan.


Saat di kantin lagi makan bareng sama pacar, kebetulan ada teman pacar yang lebih ’’tipe” kamu banget duduk di hadapan. Dia juga menyapa kalian ramah. Lalu, yang kamu lakukan? a. Balas senyum, lalu lanjutin makan. b. Balas sapa sambil ajak salaman dan sok nanya-nanya. c. Balas senyum, sambil bayangin ’’kenapa nggak dari dulu ketemu dia aja ya?” d. Perhatiin terus teman tersebut, lalu minta nomornya pas pacar lagi bayar makanan.


Like fanpage Xpresi :

Coba pilih jawaban di bawah ini yang ’’kamu” banget. Boleh milih lebih dari satu: a. Sering nunda bales SMS pacar karena nge-game atau baca novel favorit. b. Milih dijemput teman daripada harus berangkat sekolah sendiri. c. Suka kagum sama teman-teman idola di sekolah dan bayangin jadi pacarnya. d. Nggak masalah nerima orang yang nembak kita pas udah punya pacar, kan nanti yang serius tetap satu.

Xpresi Pontianak Post Follow Xpresi :



Apa yang kamu pikirkan saat mendengar ungkapan ’’teman tapi mesra”: a. Wajar aja sih, yang namanya teman udah biasa akrab. b. Teman yang selalu bisa nemenin kalau lagi kita butuh. c. Teman yang ’’aku” banget, tapi sayang udah ada yang punya. d. Pacar cadangan.

SELINGKUH HATI SELINGKUH OBJEK THE RESULTS Udah punya pacar, tapi kok Kalau yang lain selingkuh Lihat lagi semua lebih kepikiran sama orang sama manusia, ada juga nih jawaban yang sudah lain? Udah gitu, kamu lebih yang selingkuh sama kegiatankamu pilih, lalu hitung ngerasa ser-ser gimanaa gitu nya. Objeknya banyak, mulai jumlahnya. Jika : kalau ngelihat orang tersebut. surfing internet, nonton bola, Ditambah lagi, si someone else hingga nongkrong bareng teJawaban banyak A : itu juga menanggapi sinyalman-teman. Selingkuh objek SELINGKUH OBJEK sinyal hati kamu. Kalau udah ini termasuk amanaman, tapi kayak gitu kejadiannya, kamu berbahaya. Soalnya, kamu jadi Jawaban banyak B : positif terjangkit selingkuh hati. rawan dicemburuin. SELINGKUH FISIK Selingkuh jenis itu memang Yang pengin Amor tekankan nggak membuat kamu sama si di sini sih bukan selingkuhnya, Jawaban banyak C: someone else tersebut terjerat tapi reaksi kamu kalau diselingSELINGKUH HATI hubungan resmi. kuhin kayak gitu. Ngapain juga Kamu cuma ngerasa, entah mesti cemburu? Cemburu sama Jawaban banyak D : kenapa, kok lebih cenat-cenut pertandingan bola atau Twitter SELINGKUH HUBUNGAN aja kalo ngeliat dia daripada itu Cuma tingkah anak yang labil, ketemu pacar. Nah, kalau udah kayak kamu. Jika tingkat selingkayak begini, mending tinggalin kuh objeknya udah termasuk parah, itu bakal berakhir dengan praduga tak aja pacarmu. Kasihan. Dia udah membagi hatinya bersalah, kayak gini: ’’Jadi pacarmu ini aku atau sama kamu, eh kamu malah berbagi hati dengan orang lain. Twitter sih?” SELINGKUH FISIK Selingkuh fisik ini adalah tahap lebih lanjut dari selingkuh hati. Jadi, kamu nggak hanya liriklirikan genit sama SMS-an. Kamu (atau dia) sudah mulai ngajak jalan berdua. Misalnya nih, ’’Lagi di mana? Suntuk nih. Ngopi-ngopi cantik yuk.” Tapi, perlu kamu catat di saku celana baik-baik bahwa ’’kegiatan” itu belum berlandas kata ’’jadian”. Ya, kalian berdua cuma hepi-hepi bareng aja... sambil memantapkan getaran-getaran asmara juga sih. Beware! Selingkuh yang ini bakal membutuhkan berbagai kedok dan intrik. Kalau kamu sudah sampai di tahap ini, pliss Bro, jangan nanggung. Putusin pacar kamu dan jadian sama someone special itu! One is better than a half.



SELINGKUH HUBUNGAN Caution, ini cuma berlaku untuk kamu yang cerdik dan berwajah polos aja! Sebab, selingkuh jenis ini adalah selingkuh dalam arti yang sebenarnya. Iya, kamu punya pacar lebih dari satu. Dalam selingkuh ini, bukan hanya hati dan fisik yang dibagi, tapi juga status. Ibaratnya nih, sekali dayung, dua-tiga pulau terlampaui. Jadi, selain pacaran sama si ini, kamu berpacaran sama si itu. Kalau udah sampai ke selingkuh yang kayak gini, kamu wajib bisa membagi waktu, hati, dan kehadiranmu dengan sebaik-baiknya. Kenapa? Ya, biar nggak ketahuan lah. Gimana sih kamu? Kalau emang kamu udah nggak feel sama pacar yang lama, ya mending putusin aja, Bro. Jangan pura-pura gitu deh. (*/det)




Bunga Mawar Banyak cara untuk membuat sebuah pernikahan berkesan. Pasangan berikut ini pun tahu benar cara melakukannya. Pernikahan ini bisa dibilamg unik adan aneh. Demi menikahi kekasihnya , Xiao Liu, seorang pria asal China rela menghabiskan uang yang setara dengan gajinya setahun untuk membeli 99.999 bunga mawar merah. Buang mawar tersebut digunakan untuk menghias 30 mobil yang menjadi latar belakan pernikahan pasangan berusia 24 tahun tahun itu. Angka 999 dipilih karena dipercaya sebagai angka keberuntungan.**

Para mempelai perempuan, bawalah sejumput gula di sarung tangan. Menurut Kebudayaan Yunani, gula akan mempermanis ikatan pernikahan Anda. THEKNOT



Pontianak Post Sabtu 20 April 2013

Hadapi Kekerasan dengan Ketegasan PERNIKAHAN merupakan fase hubungan cinta paling complicated. Dua individu dalam pernikahan adalah komplementer, saling berkaitan satu sama lain. Pernikahan tak bisa berjalan jika hanya salah satu yang menginginkan, harus keduanya. Salah satu problem dasar yang dihadapi adalah perbedaan karakter masing-masing. Beberapa orang beranggapan bahwa sisi temperamental seorang pria akan berkurang ketika dia berkeluarga. Namun, banyak pula kondisi yang menunjukkan bahwa sikap temperamental tersebut tidak hilang, bahkan bertambah besar karena makin banyaknya problem yang dia hadapi dalam rumah tangga. Menurut Dr Fred Antonelli, marriage and family therapist, dalam menghadapi suami temperamental, d i p e rlukan ”s e n t u h a n ” khusus. D i a n taranya, positive thinking. Hadapi kemarahannya tidak dengan kemarahan

pula. Tunggu beberapa waktu sampai dia agak reda, lalu berikan sentuhan lembut di punggung untuk mendinginkan emosinya. Hal itu menunjukkan dukungan untuknya. Sebaiknya tidak merajuk ketika suami sedang emosional. Terkadang karena merasa tidak bersalah, kita ”menuntut” suami untuk mengakui kesalahannya dan melakukan apa yang kita mau. Awali dengan dialog, setelah emosinya luruh, dia bisa dengan sendirinya menunjukkan penyesalan. Tetapi, jika sikap suami sudah mengarah pada abusive (kekerasan), perlu respons yang berbeda. Istri harus segera bertindak. Misalnya, meminta bantuan ke penasihat pernikahan. Memaki istri, memberikan komentar menyakitkan tentang penampilan istri, itu termasuk kekerasan verbal. Apalagi jika ditambah kekerasan fisik atau sek sual, menampar, memukul istri, dampaknya tak hanya fisik, tetapi juga psikis.(nor/ c7/any)


Tak Segan Layangkan Tamparan K

AMI bertemu saat bekerja di kantor yang sama. Dia sudah karyawan lama, saya karyawan baru. Kami berpacaran selama dua tahun sebelum akhirnya menikah. Selama berpacaran, dia terlihat baik di mata saya, tak pernah berkata kasar kepada saya. Keluarga menyetujui hubungan kami dan menyarankan untuk segera menikah. Setelah menikah, kami memutuskan mengontrak rumah karena ingin mandiri. Karena kantor tidak mengizinkan pasangan suami istri bekerja di tempat yang sama, suami pun resign. Saya tetap bekerja di kantor tersebut, suami pindah ke tempat lain. Satu bulan, dua bulan, tiga bulan, hubungan kami begitu mesra. Selayaknya pasangan lain yang baru menikah. Apalagi, pada bulan kedua, saya positif hamil. Pada bulan keempat, suami mulai terlihat temperamental. Saat mendapat tekanan kerja, dia melampiaskannya di rumah. Salah sedikit, saya kena omel. Lama membuka-

kan pintu pagar, dia membentak. Saya tanya ada apa, kemarahannya makin meluap. Saya jelas kaget dan nelangsa. Saya ini sedang hamil. Pernikahan kami juga baru berjalan empat bulan. Tetapi, dia tega bersikap kasar kepada saya seperti itu. Tidak ada kata maaf darinya, tahu-tahu sudah bersikap biasa. Saya berusaha memaklumi, mungkin dia stress karena pekerjaan. Masalah makin parah ketika dia dipecat dari kantornya. Beberapa bulan dia menganggur. Sedangkan saya tetap bekerja. Dia banyak diam, sikapnya ketus. Kalau saya pulang agak malam, dia bertanya dengan nada menuduh. Saat usia kandungan saya tujuh bulan, ibu menawarkan acara selamatannya di rumah beliau saja. Saya mengajak suami ngobrol tentang biaya



yang diperlukan. Saya bilang akan mengambil dana dari tabungan saya. Dia menentang karena uang itu untuk membayar cicilan rumah. Dia bilang, biaya selamatan jadi tanggungan ibu saya saja. Kami berdebat. Tidak disangka dia marah besar, mengatai saya sombong, sok, mendorong meja hingga mengenai saya. Keesokannya, saat acara di rumah orang tua, saya tidak

tahan. Masalah rumah tangga itu membuat saya tidak fokus bekerja. Puncaknya, pertengkaran hebat membuat saya mendapat tamparan di wajah. Saya melarikan diri ke rumah orang tua, membawa anak kami yang baru masuk TK. Ibu dan bapak kaget melihat kondisi saya, apalagi kejadian itu sudah berlangsung selama empat tahun lebih. Suami datang ke rumah dan mengajak saya puTAK KAPOK : Penyanyi Rihanna pernah mengalami kekerasan fisik oleh kekasihnya Chris Brown. Seakan tak jera, Rihanna justru rujuk lagi dengan mantannya yang penganiaya itu. Hmmm…

menunjukkan kesedihan. Saya sengaja berlamalama di sana sekalian menenangkan diri. Sampai putri kami lahir, suami tak banyak berubah. Meski kemudian dia mendapat pekerjaan lagi, sikap temperamennya masih sering muncul. Setiap bertengkar, dia selalu memaki, bahkan memukul. Dia sering melontarkan ancaman yang membahayakan saya. Masalah ekonomi sering jadi penyebab karena pekerjaannya tidak tetap. Saya mencoba untuk ber-

lang, tetapi orang tua tidak mengizinkan. Saya pun tak berani kembali ke rumah itu dan tinggal bersamanya. Tempat teraman adalah rumah orang tua. Bapak dan ibu berusaha menasihati suami, tetapi dia membalas dengan perkataan kasar dan menantang bercerai. Tetapi, setelah itu dia tak punya itikad untuk mengurus perceraian. Saya yang pontang-panting ke pengadilan. Dia berusaha meminta hak asuh anak. Syukurlah, pengadilan memutuskan saya yang berhak. Saat ini saya berusaha me na ta hidup kembali demi membesarkan anak. (nor/c7/any)


Malam Penentuan

‘Sang Juara’ PONTIANAK – Malam puncak Pemilihan Duta Lingkungan Hidup Kota Pontianak berlangsung Sabtu (20/4) ini di Hotel Orchardz Gajahmada, Pontianak. Sebanyak 26 peserta akan tampil semaksimal mungkin dihadapan dewan juri. Mereka memperebutkan gelar juara satu dan runner up, yang selanjutnya akan mewakili

kota Pontianak pada pemilihan Duta Lingkungan Hidup tingkat propinsi Kalimantan Barat. Kesemua peserta yang terdiri dari mahasiswa dan pelajar ini sebelumnya telah mengikuti rangkaian sesi kunjungan dan juga penjurian. Hari pertama, peserta menerima arahan dan materi dari Kepala Badan Lingkungan Hidup Kota

diuji kembali pengetahuan dan wawasannya. Masing-masing peserta akan diberi waktu untuk berkampanye tentang lingkungan dan permasalahannya, berikut solusi yang ditawarkan. Dari sini, barulah juri akan mengkerucutkan 26 peserta menjadi hanya sepuluh besar saja. Penilaian dilakukan tak hanya semata-mata penampilan diatas pentas saja, tapi juga meliputi penilaian keseluruhan dari hari ke hari tahap kunjungan hingga penjurian. Wakil Walikota Pontianak, Paryadi dijadwalkan akan membuka secara resmi malam puncak Pemilihan Duta Lingkungan Hidup Kota Pontianak ini. Dan selanjutnya akan menyematkan selempang kepada para Duta terpilih di tahun 2013. **

Pontianak, Ir. Raihan. Setelah itu peserta diterima di kantor redaksi Pontianak Post, dimana selain belajar jurnalistik, peserta juga diberi materi tata rias oleh sponsor Inez Cosmetics. Kamis (19/4) menjadi masa yang menegangkan bagi peserta karena disinilah mereka berhadapan langsung dengan lima orang dewan juri dari berbagai bidang ilmu. Mulai dari wawasan lingkungan, penampilan kepribadian, pengetahuan umum, bahasa Inggris dan psikologis. Setelah melewati dua hari rangkaian acara, akhirnya tibalah di hari ini para peserta akan unjuk kebolehan diatas panggung. Mereka tak hanya akan tampil memikat para juri dan penonton dengan busana corak insang, namun juga akan

PESERTA & WAWALI : Wakil Walikota Pontianak, Paryadi diabadikan bersama para peserta Duta Lingkungan Hidup Kota Pontianak tahun 2013, para juri dan Pejabat Kantor BLH serta Duta Lingkungan tahun lalu. PENYELENGGARA : KANTOR BLH KOTA PONTIANAK, BEKERJASAMA DENGAN KRU XPRESI & FORHER

Kampanyekan Cinta Lingkungan PONTIANAK – Kepala Badan Lingkungan Hidup Kota Pontianak, Ir. Raihan berharap adanya ajang pemilihan duta lingkungan hidup tidak hanya menjadi salah satu acara seemonial saja. “Siapapun yang menjadi pemenang saya harapkan bisa bersama-sama membantu pemerintah mengkampanyekan pentingnya menjaga lingkungan kepada masyarakat luas,” katanya, usai menerima kunjungan peserta duta lingkungan hidup Kota Pontianak, belum lama ini. Sama seperti tahun-tahun sebelumnya, dengan kemampuan intelektual yang dimiliki, Raihan mengatakan setiap pemenang duta lingkungan hidup bakal dilibatkan dalam setiap kegiatan badan lingkungan hidup yang berkaitan dengan edukasi dan pemberdayaan masyarakat dalam mengelola dan menjaga kelesatarian lingkungan. “Dalam satu tahun kedepan duta lingkungan hidup yang terpilih akan kita libatkan dalam mengkampanyekan pelestarian dan perlindungan lingkungan hidup,” ucapnya. Dukungan Orchardz Malam puncak pemilihan Duta Lingkungan Hidup Kota Pontianak yang digelar di hotel Orchardz Gajahmada Pontianak pada malam ini, merupakan bentuk dukungan

yang diberikan oleh Orchardz dalam mendukung event lingkungan yang saban tahun digelar ini. Hal itu langsung diungkapkan oleh Executive Assisten Manajer Hotel Orchardz Gajahmada, Darmakitri. “Kami dari pihak hotel sangat mendukung kegiatan ini. Saya berharap kedepannya para duta lingkungan ini bisa bersama-sama membantu pemerintah mengkampanyekan ke masyarakat akan pentingnya menjaga kelestarian lingkungan,” katanya kepada Pontianak Post, Jumat (20/4). Dikatakan Darmakitri, tanggung jawab dalam menjaga lingkungan tak hanya menjadi tanggung jawab pemerintah dan instansi terkait saja, namun setiap individu. “Dengan adanya duta lingkungan hidup ini, sejak awal kita berharap para generasi muda agar semakin sadar betapa pentingnya menjaga keasrian dan kelestarian lingkungan,” jelasnya. Hotel Orchardz sendiri sambungnya, hingga sekarang telah berupaya melakukan pencegahan kerusakan terhadap lingkungan, misalnya dengan membuat ruang smoking area dan memilih sampah organic dan an-organic sebelum dibuang. “Kedepan Hotel Orchardz, juga akan terus berupaya berkontribusi dalam menjaga kelestarian lingkungan,” pungkasnya. (ash)

Sponsored by : Inez Cosmetics, Hotel Orchardz, Telkomsel dan Istana Boneka. NARASI : ASHRI ISNAINI / FOTO-FOTO : SHANDO SAFELA






Pontianak Post





Sabtu 20 April 2013

Pontianak Post

Sabtu 20 April 2013




Pontianak Post

Sabtu 20 April 2013

Battle of Big Four KETIKA persaingan juara antara duo Manchester tidak lagi seru dan menarik, persaingan empat besar atau zona Liga Champions justru sedang panas-panasnya. Dari dua kuota tersisa, empat klub bakal bersaing ketat, tiga di antaranya adalah Londoners. CHELSEA Poin Laga Agregat gol Laga

: 61 : 32 : +31 Prediksi


21 April v Liverpool (A) 0 61 28 April v Swansea (H) 3 64 5 Mei v Man United (A) 0 64 8 Mei v Tottenham (H) 3 67 11 Mei v Aston Villa (A) 3 70 19 Mei v Everton (H) 3 73 Poin akhir musim 73 Keterangan: Chelsea bakal kesulitan meraih angka di Anfield dan Old Trafford karena bakal terpecah konsentrasinya menghadapi FC Basel di semifinal Europa League. ARSENAL Poin Laga Agregat gol Laga

: 60 : 33 : +29 Prediksi


Demi Tradisi Le Professeur


20 April v Fulham (A) 3 63 28 April v Man United (H) 1 64 4 Mei v QPR (A) 3 6 14 Mei v Wigan (H) 3 70 19 Mei v Newcastle (A) 1 71 Poin akhir musim 71 Keterangan: United merupakan tim tangguh tersisa, tapi The Gunners tidak bisa menyepelekan tim-tim zona degradasi seperti QPR dan Wigan yang juga sangat butuh tambahan angka. TOTTENHAM Poin : 58 Laga : 32 Agregat gol : +15 Laga Prediksi Poin 21 April v Man City (H) 1 59 27 April v Wigan (A) 3 62 4 Mei v Southampton (H) 3 65 8 Mei v Chelsea (A) 0 65 12 Mei v Stoke (A) 3 68 19 Mei v Sunderland (H) 3 71 Poin akhir musim 71 Keterangan: Seiring Gareth Bale belum sepenuhnya fit dan catatan pertemuan yang tidak bagus merupakan alasan Tottenham bakal sulit memperoleh angka dari City dan Chelsea. EVERTON Poin : 56 Laga : 33 Agregat gol : +14 Laga Prediksi Poin 20 April v Sunderland (A) 1 57 27 April v Fulham (H) 3 60 5 Mei v Liverpool (A) 0 60 12 Mei v West Ham (H) 3 63 19 Mei v Chelsea (A) 0 63 Poin akhir musim 63 Keterangan: Masih menyisakan dua away masingmasing kontra Liverpool dan Chelsea memberi handicap bagi The Toffees bisa finis empat besar. Sunderland yang akan dihadapi malam nanti juga belum tentu bisa dikalahkan. (dns/bas)


The Gunners Forsir Tiga Angka )



3 2-

4 l(


e rs


19 Cazorla




28 Emanuelson

10 Petric

28 Gibbs 8 Arteta

6 Koscielny

10 Wilshere 12 Giroud

1 Pela tih: A rsen Szczesny e We n


4 Mertesacker 16 Ramsey

9 Berbatov

3 Sagna

14 Walcott

pekan lagi, posisi Arsenal belum 27 l aman di empat besar 14 Fu Riether atau zona Liga Cham4 Karagounis pions. Mikel Arteta dkk Senderos 11 5 terlibat persaingan ketat Ruiz Pela dengan dua rival London Hangeland tih: Mar tin J 1 lainnya, Chelsea dan Tot3 ol LONtenham Hotspur. Selisih Schwarzer Riise DON - Tanpa poin ketiganya juga rapat. trofi di akhir musim Akhir pekan ini, situasinya ini tak akan membuat Arseseharusnya bersahabat dengan nal menangis. Betapa tidak, sudah Arsenal karena kedua pesaingnya delapan tahun terakhir Arsenal mengalamenghadapi laga berat. Chelminya. Arsenal, khususnya fans mereka alias s e a harus menghadapi tuan rumah Gooners, baru akan menangis seandainya Liverpool dan Spurs - sebutan Tottenham skuad asuhan Arsene Wenger itu gagal finis - menjamu Manchester City dalam Super empat besar di Premier League. Sunday (21/4). Ya, selama ditangani Wenger atau dalam Bandingkan dengan Arsenal yang hanya 16 musim terakhir, The Gunners - sebu- melawan Fulham di Craven Cottage malam tan Arsenal - selalu finis big four. Tiga di nanti (siaran langsung Global TV kickoff antaranya dipungkasi dengan gelar juara. 21.00 WIB). Kendati away dan bertajuk Tradisi Wenger itulah yang diharapkan derby LOndon, Arsenal di atas kertas seArsenal masih bertuah musim ini. harusnya bisa mengatasi Fulham. Dengan kompetisi menyisakan lima

m ha

7 Sidwell





FULHAM memang tak pernah kalah dalam empat pertemuan terakhir kontra Arsenal. Tapi, karena The Cottegers baru saja kalah home 0-3 dari Chelsea dan The Gunners tengah memburu hasil

absolut demi finis empat besar, favorit mengarah kepada tim tamu. Asian Handicap memberikan voor 3/4 kepada Fulham. Ini berarti Arsenal dijagokan menang dua bola. Rumah

Bursa William Hill Bwin Bet Victor Bet365

Home 4,5 4, 75 4,8 5

Draw 3,5 3,8 4 4

bursa dunia juga meyakini skuad Arsene Wenger berjaya dengan menawarkan keuntungan maksimal 1,8 kali lipat (William Hill), sedangkan Fulham maksimal 5 kali lipat (Bet365). (dns/bas)

Away 1,8 1,67 1,75 1,75

“Kami harus menang di Craven Cottage. musim. Itu tak lepas dari capaian anak asuh Ini adalah kesempatan bagi kami untuk me- Martin Jol tersebut yang mulai menghirup nempatkan diri dalam posisi kuat sekaligus kebebasan dari zona degradasi (Fulham memberikan tekanan kepada para pesaing,” kini peringkat kesepuluh). kata Wenger kepada Sky Sports. “Kami cukup senang menembus angka “Ini sekaligus mencari gantidua poin 40 yang saya pikir memberi rasa aman. Tapi, yang hilang dalam laga terakhir liga belum selesai dan saya tidak (ditahan 0-0 Everton di kandang akan menoleransi seandainya sendiri, 16/4, Red),” imbuh anak-anak mengulang kesalahan pelatih berjuluk Le Professsuer yang sama dalam laga sebelumnya (Si Professor) itu. (saat kalah 0-3 dari Chelsea, 17/4, Gelandang Arsenal Aaron Red) ketika menghadapi Arsenal,” Ramsey juga menyebut sangat papar Jol yang dalam pertemuan penting tidak tergelincir dalam pertama di Emirates membawa PEKAN # 33 laga-laga yang di atas kertas bisa anak asuhnya bermain seri 3-3 itu dimenangi. “Grafis performa kepada London 24. kami cukup bagus dan kami beHandicap bagi Fulham saat ini lum terkalahkan dalam sebulan adalah bagaimana mengembaliPukul 21.00WIB terakhir. Kami tidak ingin kehilkan naluri gol Dimitar Berbatov. angan momentum,” tutur pemain Eks striker Manchester United itu berjuluk Rambo itu. scoreless dalam tiga laga terakhir. Statistik Berbeda dengan Arsenal yang termoti- mencatat, ketika Berba (sapaan akrab Bervasi memburu empat besar, Fulham justru batov) mencetak gol, Fulham tak terkalahmulai kehilangan gairah mendekati akhir kan (6 menang dan 4 seri). (dns)

Pontianak Post