Issuu on Google+

cmyk

Hotline Service

Pontianak Post

Po

Phone: 081257225755 082150002031 SMS: 085347259955

t os

anak P nti

Berlangganan & Pengaduan

No

&

RIS N ET ROY MORGA

Sabtu 16 Maret 2013 M / 4 Jumadil Awal 1434 H

Eceran Pontianak Rp. 3.000

PERTAMA DAN TERUTAMA DI KALIMANTAN BARAT

Alasan Paus Baru Memilih Nama Fransiskus Jasa dekat ke keriaan, pujian bisa jadi racun mematikan. Lupakan… Karena Tuhan Maha ingat!

Dollar US

Dolar SGD

Ringgit MYR

7.767

9.700

VATIKAN - Begitu terpilih menjadi Paus baru, Jorge Mario Bergoglio memilih nama Fransiskus sebagai nama untuk menjalankan tugas kepausaannya. Mengapa dia memilih nama tersebut? Sebenarnya nama tersebut untuk menghormati dua santo. Yakni Fransiskus dari Asisi dan Fransiskus Xaverius. Fransiskus dari Asisi adalah santo pendiri ordo Fransiskan Friars pada tahun 1290. Fransiskus Asisi lahir pada

5 Juli 1182. Dia berasal dari keluarga pedagang kain kaya. Namun bukannya nyaman dengan kehidupan keluarganya yang serba berkecukupan. Dia memberontak terhadap bisnis ayahnya yang melulu mengejar kekayaan. Dia pun banyak menghabiskan waktu masa mudanya dengan membaca buku. Dia juga kecewa dengan kondisi sekitarnya. Nah, kisah perjumpaannya dengan seorang pengemis pun mengubah

dirinya menjadi sosok yang sederhana dan dekat dengan warga miskin. Mungkin karena teladan itulah Bergoglio memilih nama Paus Francis I. “Dengan memilih nama Francis, seseorang memahami segera apa yang akan menjadi misinya,” kata Pastor Thomas Rosica dari Kantor Pers Takhta Suci seperti dikutip CBCnews. Ya, sebagai uskup Buenos Aires, Bergoglio memang ‹Ke Halaman 7 kolom 5

Paus Fransiskus

3.114

Kurs Rupiah 15 Maret 2013

SELEBRITAS

Bingung karena Kakak

Status Anas Diprotes Dipanggil KPK Sebagai Mantan Ketum Demokrat

NAMA Agni Pratistha di dunia hiburan lumayan populer. Apalagi sejak dia terpilih sebagai Putri Indonesia 2006. Beberapa kali cewek 24 tahun itu bermain film. Salah satunya adalah Cinta tapi Beda. Namun, di balik sosoknya yang penuh percaya diri, Agni sempat mengalami titik terendah dalam hidupnya. Menurut dia, dirinya pernah merasa down ketika mengawali karir di dunia hiburan. Penyebabnya adalah nama sang kakak, Sigi Wimala, yang lebih dulu dikenal sebagai model iklan, pemain film, serta presenter. ‹Ke Halaman 7 kolom 5

ADE SINUHAJI/JPNN

DIPERIKSA: Mantan Ketua Partai Demokrat Anas Urbaningrum usai diperiksa digedung KPK. Anas diperiksa KPK seputar kasus Simulator SIM dengan tersangka Djoko Susilo.

Agni Pratistha

11: 53

14:57

17:58

19:03

04:33

JAKARTA - Mantan Ketua Umum Partai Demokrat Anas Urbaningrum memutuskan untuk memenuhi panggilan Komisi Pemberantasan Korupsi (KPK). Kemarin (15/3), Anas datang sebagai saksi dalam kasus dugaan korupsi pengadaan Simulator SIM. Namun, tim kuasa hukum mempersoalkan pemanggilan tersebut. Pihak kuasa hukum Anas menilai pemeriksaan kali ini sarat dengan muatan politis. Sebab, dalam surat panggilan yang dilayangkan KPK, kalimat “Mantan Ketua Umum Partai Demokrat” disebutkan dalam kolom pekerjaan Anas. Pencantuman status tersebut membuat pihak kuasa hukum meradang. “Apa urusannya pak Anas sebagai (mantan) Ketua Umum Partai Demokrat diperiksa dalam kasus ini?” Tanya kuasa hukum Anas Firman Wijaya usai pemeriksaan kemarin. Menurut dia, jika Anas dipanggil sebagai mantan ketum Demokrat, artinya secara institusional partai Demokrat juga dibawa dalam kasus tersebut. ‹Ke Halaman 7 kolom 1

Tiga Terduga Teroris Tewas Ikan Endemik dengan JAKARTA – Perburuan terhadap perampok toko emas di kawasan Tambora, Jakarta, berujung pada pengung-

ADVERTORIAL

Sering Mengalami Radang Lambung? Jangan-jangan Itu Kanker Lambung RADANG lambung sering menjadi gejala awal kanker lambung. Tapi, apa itu kanker lambung? Kanker lambung sering disebut kanker perut. Kanker ini berkembang di bagian perut dan dapat menye- bar ke organ lainnya, terutama ke esofagus. Data membuktikan,

kapan sisa-sisa jaringan teroris. Polisi menembak mati Makmur alias Bram, pimpinan perampok yang dianggap m e l aw a n s a a t hendak ditangkap. ’’M ini masuk DPO dalam kasus perampokan CIMB Niaga Medan 2010,’’ ujar Kabareskrim Komjen Sutarman kemarin (15/3). Jaringan tersebut awalnya diungkap tim Reserse Mobile Polda Metro Jaya pimpinan AKBP Hery Heryawan ‹Ke Halaman 7 kolom 1

‹Ke Halaman 7 kolom 5

Harga yang Fantastis

‹Ke Halaman 7 kolom 5

SHANDO SAFELA/PONTIANAK POST

ARWANA: Pengunjung melihat keindahan dan keunikan ikan arwana di PCC kemarin.

PONTIANAK - Puluhan ikan arwana nan cantik menghiasi ruangan besar di Pontianak Convention Center. Selama tiga hari, para pecinta arwana bisa dengan puas menikmati keindahan ikan endemik

Kalbar yang dipajang di dalam akuariumakuarium itu. Bagi yang punya uang lebih bisa merogoh koceknya untuk membawa ‹Ke Halaman 7 kolom 1

Suhartono, Pematung yang “Hidupkan” Lagi Pak Harto di Rumahnya

Perlu Waktu Dua Tahun untuk Jenderal Besar Karyanya tidak perlu diragukan lagi. Beragam patung fenomenal buatannya sudah menghiasi berbagai sudut kota. Terakhir, dia menyelesaikan patung mantan Presiden Soeharto yang berdiri tegak di tanah kelahirannya, Bantul, Jogjakarta.

NAUFAL WIDI AR, Jakarta PATUNG Dewi Saraswati berdiri kukuh di sebuah halaman rumah yang asri di kawasan Duren Tiga, Jakarta Selatan. Pa-

Online: http://www.pontianakpost.com/ cmyk

NAUFAL WIDI A.R/ JAWA POS

PATUNG: Suhartono di depan salah satu karyanya, patung proklamator Bung Karno dan Bung Hatta di kediamannya, kawasan Duren Tiga, Jakarta, kemarin.

tung itu berwarna putih dengan tinggi sekitar 2,5 meter. Rimbunan pohon rambutan seolah memayungi patung yang mempunyai empat tangan tersebut. Tiap-tiap tangannya memegang benda berharga. Tidak jauh dari patung itu, persisnya di bagian teras rumah, sepasang patung proklamator, Soekarno dan Mohammad Hatta, tampak menyambut setiap orang yang bertandang ke rumah itu. Di ruang tamu makin banyak koleksi patung yang bisa dijumpai. Itulah rumah pematung senior Suhartono. Ratusan karya telah dihasilkan seniman yang menggeluti dunia patung sejak hampir setengah abad silam itu. “Ini beberapa (patung) saja. Di studio

*Mempawah, Sambas, Singkawang, Bengkayang Rp 3.000 *Landak, Sanggau, Sintang Rp 4.000 *Ketapang Rp 4.000 *Kapuas Hulu Rp 4.000

‹Ke Halaman 7 kolom 1

Jawa Pos Group Media


cmyk

2

cmyk

Pontianak Post

Sabtu 16 Maret 2013


PONTIANAK BISNIS

cmyk

Pontianak Post

Sabtu 16 Maret 2013

LOKOMOTIF KEMAJUAN EKONOMI KALBAR

3

TRANSMIGRASI

Kaji Ulang Penempatan di Perbatasan PONTIANAK Pemerhati Perbatasan Lorensius SSos Msi meminta pemerintah pusat dalam hal ini Kementerian Tenaga Kerja dan Transmigrasi serta Pemerintah Provinsi Kalbar mengkaji ulang rencana penempatan 4.000 kepala keluarga transmigran asal Jawa di sepanjang perbatasan wilayah Sanggau dengan Malaysia. “Pemerintah harus kaji ulang rencana itu. Dari segala aspek. Terutama mengevaluasi daya dukung lahan dan kawasan hutan perbatasan Kalbar. Jangan sampai penempatan trasmigran itu bertentangan dengan tata ruang dan mengganggu ekosistem di sana,” katanya. Menurutnya, sebelum menempatkan transmigran di sana, yang harus dikaji pemerintah adalah kesejahteraan dan perekonomian masyarakat di kawasan perbatasan. Jangan sampai, kehadiran mereka memicu kesenjangan perekonomian sehingga mengakibatkan benturan dengan warga

Lorensius

pendatang dan asal. Selain itu, sambungnya, juga harus diperhatikan adalah kualitas dalam penempatan transmigran. Jangan sampai hanya menjadi kedok untuk mendapatkan lahan, rumah dan dana, tetapi setiba di sana menjadi tenaga kerja di Malaysia. “Intinya pemerintah harus mengkaji ulang rencana ini. Jangan sampai kawasan konservasi hutan lindung dan hutan produksi terbatas dikor-

bankan untuk kepentingan ini,” katanya. Sebelumnya, Majelis Adat Dayak Nasional (MADN) mendesak pemerintah pusat dalam hal ini Kementerian Tenaga Kerja dan Transmigrasi serta Pemerintah Provinsi Kalbar untuk mengkaji ulang rencana penempatan 4.000 kepala keluarga transmigran asal Jawa di sepanjang perbatasan wilayah Sanggau dengan Malaysia. Menurut MADN, pemerintah pusat seharusnya terlebih dahulu mengevaluasi kondisi terkini daya dukung lahan dan kawasan hutan perbatasan Kalbar. Saat ini, menurut kajian MADN, luas hutan di kawasan perbatasan Kalbar 1.806.172 hektar, dan khusus di Kabupaten Sanggau hanya seluas 143.804 hektar. Hal itu diungkapkan Deputy Presiden MADN BL Atan Palil didampingi sejumlah pengurus MADN Kalbar kepada sejumlah wartawan, belum lama ini. (zan)

HARYADI/PONTIANAKPOST

MENINGKAT: Karyawan toko elektronik di Jalan Nusa Indah Baru merapikan barang dagangannya. Penjualan AC mengalami kenaikan yang tajam di musim panas saat ini.

Pemda Harus Dukung Pembangunan Rumah Sejahtera PONTIANAK—Kalimantan Barat mendapatkan jatah pembangunan sebanyak 5.227 rumah sejahtera untuk masyarakat berpenghasilan rendah pada tahun ini. Untuk mencapai target itu, diharapkan mendapat dukungan pemerintah kota dan kabupaten serta instansi terkait . Demikian disampaikan ketua DPD Realestat Indonesia (REI) Provinsi Kalimantan Barat Sukiryanto, kepada Pontianak Post, di sela acara peringatan HUT REI di Padang, kemarin (15/3), melalui telepon seluler. “Ini akan sulit tercapai jika pemerintah daerah dan instansi terkait tidak mendukungnya. Paradigma jika bisa diperlama mengapa harus dipercepat, dalam mengurus perizinan, harus diubah. Harus dibalik. Itu yang menyebabkan perlambatan dalam pembangunan perumahan,” kata Sukir.Menurutnya, proses dalam pengurusan perizinan pembangunan perumahan di daerah ini masih dipersulit. “Janji Wali Kota Pontianak yang menegaskan perizinan paling lama 14 hari sudah selesai mudah-mudahan bisa direalisasikan di tingkat bawahannya,” pintanya. Demikian juga dalam pengurusan pertanahan di BPN, Sukir berharap, perizinannya

PONTIANAK – Tingkat penjualan pendingin udara atau air conditioner (AC) di Kota Pontianak mengalami peningkatan seiring dengan ekstremnya cuaca panas belakangan ini yang bahkan bisa mencapai 39 derajat celcius. “Dibanding hari-hari biasanya, sebulan terakhir angka penjualan AC di toko kami meningkat hingga 100 persen,” kata Beni pemilik Toko Kita Niaga Elektronik di Jalan Nusa Indah Baru Pontianak, Jumat (15/3). Biasanya, kata Beni, dalam sehari tokonya hanya bisa menjual satu hingga dua AC saja, namun saat musim panas seperti sekarang pihaknya bisa menjual lima hingga enam AC bahkan lebih. “Dari semua tipe, AC yang low watt sangat dimi-

REI KALBAR FOR PONTIANAK POST

HUT REI: Ketua DPD REI Kalbar H Sukiryanto (paling kiri) bersama ketuaketua DPD REI seluruh Indonesia pada perayaan HUT ke-41 REI.

tidak dipersulit. “Perumahan ini untuk masyarakat yang belum punya rumah. Ini program yang sangat bagus dari pusat dan mesti di dukung juga di tingkat daerah. Kalau program ini tidak didukung daerah, sulit tercapai realisasi itu,” katanya. Program pembangunan rumah sejahtera tapak tersebut dijual ke masyarakat dengan harga paling tinggi Rp95 juta dan bunga

7,25 persen. Dalam acara HUT REI di Padang, Menteri Perumahan meresmikan pembangunan 100 ribu unit rumah sejahtra se-Indonesia. Menteri juga mengamanatkan agar perizinan dipermudah dan tidak dipersulit oleh semua kepala daerah. Acara itu dihelat dari tanggal 12-15 Maret. DPD REI Kalbar mengirimkan 29 orang pengurusnya di acara itu. (zan)

c

cmyk

Cuaca Panas AC Laku Keras

m

y

k

nati konsumen,” ucapnya. Soal harga, kata Beni bervariasi tergantung tipe yang diinginkan konsumen, biasanya, kata dia, rata-rata yang cukup banyak yang dibeli harga AC kisaranRp2,5 juta ke atas. Hal senada juga dikatakan Maya, salah satu penjaga toko elektronik di kawasan Jalan Tanjungpura yang mengaku semakin panasnya cuaca mengakibatkan semakin tingginya penjualan AC. “Baru beberapa minggu belakangan jumlah konsumen yang membeli AC memang cukup meningkat dibanding harihari biasanya, terutama AC yang low watt,” katanya. Tidak hanya AC, menurut Maya tingkat penjualan kipas angin turut naik. “Untuk penjualan AC

dan kipas angin saat ini lumayan lebih ramai dibanding hari-hari biasa terutama musim penghujan. Kalau biasanya bias menjual 1 hingga dua unit AC atau kipas angin, sekarang angka penjualan bisa naik hingga dua kali lipat,” terangnya. Sementara salah satu konsumen yang hendak membeli AC di sekitar pasar Sudirman Pontianak, Ahua, memaklumi angka penjualan AC dan kipas angin meningkat lantaran cuaca yang kian panas beberapa pekan terahir. “Kebetulan di rumah saya AC-nya sudah lama, jadi kualitas dinginnya pun tidak maksimal lagi, makanya sekarang saya lagi cari-cari jenis AC lagi yang sesuai dengan kebutuhan saya,” imbuhnya. (ash)


EKONOMI BISNIS

4

Pontianak Post

z

Sabtu 16 Maret 2013

Mandala Terbang Perdana ke Pontianak PONTIANAK—Maskapai Mandala Air melakukan penerbangan perdana dengan rute Jakarta-Pontianak dan sebaliknya, kemarin (15/3). Mandala menggunakan pesawat Airbus A320-200 yang merupakan tipe pesawat terbaru yang digunakan maskapai ini. Perwakilan Mandala Air di Pontianak, Sutrisno, mengatakan untuk sementara pesawat ini hanya mengangkut 90 penumpang dari jumlah

kapasitas tempat duduk yang mencapai 180 orang. Artinya pesawat mandala hanya mengangkut setengah dari kapasitas penumpang. Penumpang yang diangkut Mandala adalah para penumpang yang sebelumnya memiliki tiket Batavia Air yang telah diputus pailit beberapa waktu lalu. “Kami untuk sementara menggantikan slot penerbangan Batavia hingga 30 April nanti. Penumpang Batavia bisa

melakukan registrasi langsung di website mandala air,” jelasnya. Selanjutnya untuk penerbangan regular, manajemen Mandala masih akan mengajukan izin lagi ke kementerian perhubungan. “Kalau izin diperpanjang tentu saja akan ada penerbangan regular,” tambahnya. Maskapai ini mendapatkan izin hingga penerbangan setiap hari untuk rute Jakarta-Pontianak, namun karena

sejumlah alasan maskapai hanya mengambil satu penerbangan saja perharinya. “Sementara ini satu penerbangan dulu. Kami masih hitung berbagai sisi,” kata Sutrisno. General Manager Angkasa Pura II Bandara Supadio Pontianak, Chandra Dista Wiradi, menjelaskan pesawat airbus yang digunakan Mandala air tergolong pesawat berbobot besar. Karena daya dukung landasan yang

kurang maksimal, Kementerian Perhubungan melalui Dirjen Perhubungan Udara memberikan pembatasan jumlah penumpang yang bisa diangkut Mandala Air. “Problemnya itukan Mandala tidak punya pesawat kecil. Sementara kemampuan landasan di Supadio masih belum maksimal. Karena itu ada pembatasan penumpang yang bisa diangkaut,” jelas Chandra. Pembatasan yang dimak-

sud adalah pembatasan berat lepas landas pada bandara supadio (restricted take off weight). Untuk tipe pesawat airbus A320-200 adalah sebesar 57.149 kg. “Pesawat yang masuk ini lebih besar dari yang disyaratkan. Karena itu perlu ada pembatasan. Sebab jika tidak dibatasi, ini akan membahayakan keselamatan penumpang,” kata Chandra. Masyarakat, kata Chandra, perlu diberi penjelasan terkait masalah ini. “Jangan

sampai nanti ada yang protes, tiket sudah habis tetapi mereka lihat kok banyak kursi yang kosong. Mereka mungkin tidak tahu kalau ini ada pembatasan,” katanya. Mandala Air sendiri akan menambah jumlah penumpang jika penebalan landasan pacu selesai dilaksanakan. “Kami patuhi peraturan yang ada. Jika overlay selesai semoga bisa menambah jumlah penumpang,” jelasnya. (her)

WiGO Layani Masyarakat Pontianak Teknologi Layanan Internet 4G PONTIANAK– PT Berca akan segera menghadirkan layanan internet nirkabel berbasis teknologi tercanggih generasi keempat atau yang dikenal dengan WiGO 4G di Pontianak. Dengan berkantor di Komplek Pertokoan Ayani Megamall Blok E No. 12 B, Jl. Jendral Ahmad Yani, Pontianak,WiGOdapat memberikan pengalaman berinternet dengan pelayanan excellent kepada seluruh masyarakat di Pontianak. Kehadiran WiGO di luar Jawa, khususnya di Kalimantan Barat yaitu Pontianak, menjadi tonggak sejarah telekomunikasi di Indonesia. Kecenderungan penenetrasi internet canggih yang selama ini lebih terarah ke Pulau Jawa, menjadi dasar Berca mengoperasikan WiGO di Pontianak, setelah sebelumnya telah hadir di kota-kota besar seperti Makassar, Medan, Balikpapan, Batam, Denpasar, Palembang dan Pekanbaru. WiGO 4G hadir di Pontianak di frekuensi 2.3 GHZ dengan lebar pita/bandwidth 30 MHZ dan hanya diperuntukkan layanan data sehingga menjamin layanan akses internet berkecepatan tinggi bahkan dapat mencapai 100 Mbps dalam kondisi ideal. Dengan teknologi 4G, WiGO dapat membatasi jumlah pengguna pada setiap BTS (Base Transceiver Station) sehingga pelanggan dapat merasakan kecepatan internet yang stabil. WiGO juga dapat mengontrol performa perangkat yang digunakan sehingga kualitas layanan internet dari WiGO tetap terjaga. Dalam rangka persiapan untuk memberikan pengalaman internet yang maksimal, sejak tanggal 4 Maret 2013 WiGO memberikan internet 4G Gratis 1 bulan kepada seluruh masyarakat Pontianak. Gratis 1 bulan dapat diperoleh dengan melakukan registrasi melalui website WiGO yaitu wigo.co.id. Dengan hanya mengisi data diri, customer care WiGO akan segera menghubungi dan membantu melakukan pengecekan jangkauan jaringan sehingga calon pengguna dapat segera menikmati layanan internet berbasis teknologi

TERCANGGIH: Model meunjukkan modem WiGO 4G, sebuah layanan internet nirkabel berbasis teknologi tercanggih generasi keempat.

4G. Program Gratis 1 bulan disebut sebagai layanan uji coba. Program ini memungkinkan para calon pengguna memberikan masukan dan saran atas layanan WiGO 4G. “Kami berharap saat commercial nanti, WiGO sudah siap memberikan pelayanan internet terbaik sePontianak.” Ungkap Duta Sarosa, Direktur Berca. “Program gratis satu bulan ini juga merupakan dedikasi kami kepada para pengguna internet di Pontianak yang ingin menjadi orang pertama yang merasakan kecepatan akses WiGO yang berbasis teknologi 4G” lanjutnya. Untuk dapat menikmati layanan internet dari WiGO, pelanggan memerlukan fasilitas modem. Selama program ini, WiGO meminjamkan modem 4G kepada peserta layanan uji coba. Modem WiGO memiliki kelebihan yaitu telah terintegrasi dengan WiFi, sehingga dengan satu akun pelanggan dapat membagi layanannya kepada 5-10 orang. Jumlah ini adalah angka yang disarankan WiGO demi menjamin kenyamanan dalam berinternet. “Dengan hadirnya WiGO, diharapkan terjadi peningkatan pertumbuhan ekonomi di luar Jawa. Para pelaku usaha dapat melebarkan pemasarannya secara online dan para akademisi dapat memanfaatkan teknologi internet 4G sebagai fasilitas penunjang belajar dan mengajar. Sehingga, pemerataan ekonomi dan penyediaan infrastruktur dapat merata di seluruh pelosok Indonesia.” Ujar Duta Sarososa. (r/*)

MEIDY KHADAFI/PONTIANAK POST

PRIMADONA : Barang ekspor atau biasa dikenal dengan lelong masih menjadi primadona di Kota Pontianak. Terlihat Hasan (28), penjual barang lelong sedang menyortir baju dan celana yang akan dijual kembali.

AHM Klaim Kuasai Pasar Kalbar PONTIANAK – Astra Honda Motor (AHM) dengan produk mereka, sepeda motor Honda, masih memimpin penjualan di Kalbar sepanjang Januari lalu. Pencapaian itu memantapkan posisi mereka yang sejak dua tahun ini terus memimpin pasar di Kalbar. Berdasarkan data registrasi kepolisian (Polreg), sepanjang Januari 2013, penjualan mereka mencapai 6.313 unit. Angka ini menjadikan pangsa pasar mereka mencapai 48 persen dari total penjualan sepeda motor di Kalbar, sebanyak 13.209 unit. Kepala Wilayah PT Astra International, TBk-Honda Kalbar, Yohanes Pratama metakan, sejak awal memang optimistis penjualan Honda akan terus naik. Bahkan, dia yakin, kenaikan bisa mencapai 15 persen. Ia ingin Honda di Kalbar bisa mengikuti jejak posisi mereka secara nasional, yang bisa

memimpin penjualan dengan pangsa pasar 62 persen. “Memang harus optimistis. Kami yakin bisa mempertahankan posisi sebagai pemimpin pasar di Kalbar, bahkan bisa meningkatkan pangsa pasar,” kata dia di Pontianak, baru-baru ini. Data Polreg sepanjang Januari 2013 tersebut memang cukup mengejutkan. Sebab, pangsa pasar mereka naik sangat signifikan menjadi 56 persen. Pasalnya, sepanjang tahun 2012 lalu, mereka juga memimpin pasar sepeda motor di Kalbar. Namun, ketika itu, pangsa pasar hanya 46 persen, dengan total penjualan 85.250 unit. Begitu juga pada 2011 lalu, mereka menguasai pasar dengan 45 persen penjualan, yakni mencapai 109.085 unit. Secara nasional, berdasarkan data Asosiasi Industri Sepeda Motor Indonesia (AISI), sepanjang

Januari lalu, Honda merajai penjualan sepeda motor di Indonesia, dengan pangsa pasar 62 persen. Sepanjang Januari 2013 tersebut, mereka telah menjual hingga 398.200 unit, dari total penjualan sepeda motor nasional 646.082 unit. Secara nasional, tahun 2012 lalu, dari total penjualan sepeda motor nasional sebanyak 7,06 juta unit, mereka juga memimpin pasar dengan pangsa pasar 58 persen. Ketika itu, mereka telah menjual sebanyak 4,08 juta unit. Padahal di tahun sebelumnya, 2011, pangsa pasar mereka baru mencapai 53 persen. Sejumlah komunitas sepeda motor di Kalbar mengaku, persaingan antar merek sudah sangat ketat. Masing-masing perusahaan otomotif memberikan klaim bahwa merek mereka yang menjadi nomor satu. “Selama masih wajar, tidak masalah. Tetapi, kalau sudah

menyajikan data yang tidak benar, itu namanya menipu konsumen. Tapi, semuanya kembali lagi ke konsumen. Mereka akan tahu, mana yang asal klaim, dan mana yang benar-benar merek berkualitas,” ujar Indra, salah satu anggota klub sepedamotor di Kalbar. Sejumlah komunitas sepeda motor Honda di Kalbar mengakui posisi nomor satu yang diraih Honda secara nasional dan juga di Kalbar, lantaran kualitas yang membuktikannya. Makanya, kebanyakan mereka tidak terlalu terpancing oleh iklan klaim dari beberapa merek yang menyatakan produk mereka yang menguasai pasar. “Kita bicara data akurat secara nasional. Tetapi, sebenarnya yang paling akurat adalah kualitas yang sudah teruji. Motor Honda sudah membuktikannya sebagai motor hemat BBM dan bandel mesinnya,” ujar Ketua Honda West Borneo Community (HWBC) tersebut. (ote)

Empat Bom Meledak saat Menko Perekonomian Hatta Rajasa Bertamu PM Irak (1)

Dua Kali Getarkan Gedung, Bilateral Meeting Jalan Terus Paling enak itu adalah “nggak tahu”, “nggak dengar” dan “nggak ngeri.” Karena, ketidaktahuan itu membuat kita tidak merasa takut! Lha apa yang ditakutkan? Wong, tidak tahu sedang terjadi apa? Begitu pun sebaliknya, makin tahu, makin waspada, makin takut, bahkan bisa jadi paranoid. ITULAH pengakuan Menko Perekonomian, Hatta Rajasa, begitu naik di pesawat Royal Jet, di Bagdad International Airport, pukul 22.00 semalam. Dia tidak langsung duduk di kursi. Dia hanya geleng-geleng kepala dan berjalan-jalan di kabin. Rupanya, dia masih menahan rasa galau, sejak empat bom diledakkan teroris persis di dek at Green Zone, ibu kota Irak, Baghdad, betul-betul Kota 1001 Bom. “Ini pengalaman bilateral meeting yang paling mengesankan (baca: mencekam, red). Saya berusaha menahan diri, untuk tidak panik, tidak takut, meskipun lantai bergoyang-goyang, lampu listrik mati sekitar 5 menit, kaca-kaca bergetar keras, dan suara ledakan bom itu terasa begitu dekat! Saya teruskan saja. Tetap concern pembicaraan poin-poin penting,” aku Hatta Rajasa. Keresahan Hatta itu tidak dia pertontonkan saat acara kenegaraan tersebut. Bahkan, saat press conference ditanya wartawan, bagaimana dengan situasi dan keamanan C

M

Y

K

Baghdad, dia ikut menimpali. “Saya kira aman! Kalau tidak aman, tidak mungkin pemerintah RI menempatkan Pak Dubes Safzen Noerdin dan seluruh staf KBRI di ibu kota Irak ini,” jawabnya, membesarkan hati Deputi Perdana Menteri Irak Dr Hussein Al Shahristani. Hussein sendiri mengakui, sampai saat ini memang belum 100 persen bebas dari teror bom di beberapa kota. Konflik panjang aliran Sunni dan Syiah, menjadi salah satu sebab, mengapa Negeri Aladin ini tidak segera bebas dari terorisme. Dalam perjalanan dari airport menuju Guest House di Green Zone, sudah harus melewati lebih dari 5 kali check point. Mobil-mobil umum, yang bukan Corp Diplomat (CD) dan tamu negara, harus minggir, berhenti, mesin dimatikan, semua pintu dibuka, kap mobil dibuka, bagasi belakang dibuka, mobil dikosongkan dari penumpang, semua orang turun dan menjalani pemeriksaan dokumen. Kalau Anda bawa kamera lengkap, Anda dapat bonus. Berupa pemeriksaan lebih lama, lebih detail, semua barang elektronik, termasuk lensa-lensa harus dicatat, dan saat pulang nanti dilaporkan kembali. Check poin lain, menggunakan anjing pelacak.Herder warna coklat yang bermoncong seram itu dibiarkan memeriksa mobil-mobil yang mau masuk Green Zone. Setiap perempatan, pertigaan, check point, dijaga tentara bersenapan laras panjang. Di banyak sudut mo-

ISTIMEWA

WAWANCARA: Hatta Rajasa diwawancarai awak media saat berkunjung ke Irak.

bil tank, mobil antihuru-hara, panser, lengkap dengan senjata yang ditenteng oleh petugas yang berwajah seram. Apa yang terjadi dengan empat bom itu? Ledakannya cukup nendang! Syaiful Anwar, staf KBRI menyebut, kaca-kaca di KBRI pecah berantakan. Ini kali pertama, sejak bom terakhir bulan Maret 2012 lalu menghajar Baghdad. Kala itu, tidak sampai pecahpecah. “Kali ini, ledakan bomnya lebih keras, lebih merusak, dan makin mendekati Green Zone,” jelasnya. Zona hijau atau Green Zone sendiri, sebenarnya sudah sangat luas, hampir sepertiga luasan Kota Bagdad. Kawasan ini dijaga superketat oleh tentara dengan kekuatan penuh dan peralatan yang canggih. Di area ini pula, kantor Keduta an Amerika dan negara-negara Eropa berada. Jadi memang tidak sembarangan. Zona ini jadi sepi, karena pen-

jagaan sangat berlebihan. KBRI itu berada di luar zona hijau ini, tetapi masih dekat dengan radius pengamanan. Tepat dua jam dari Baghdad, kami akhirnya selamat bisa mendarat di Dubai, Uni Emirat Arab. Rombongan yang diantaranya termasuk Susilo Sis woutomo, Wamen ESDM, Edy Hermantoro, Dirjen Migas, M Afdhal Bahaudin, Director of Planning Pertamina, Chrisna Da mayanto Director of Processing Pertamina, bisa tidur nyenyak, di atas pesawat berkapasitas 50 seats itu. Dan mereka baru terbangun ketika roda-roda jet itu menyentuh landasan bandara internasional Dubai. Saya duga, mereka terbangun dari mimpinya. Mudah-mudahan tidak sedang mimpi ada empat ledakan bom seperti yang menggucang Bagdad itu. Karena landingnya memang tidak terlalu mulus. Booommm…. (bersambung)


Pontianak Post

SHOW

Sabtu 16 Maret 2013

SELEBRITAS

5

ACARA TV

07.30 12.00 15.00 18.00 19.00 19.30 21.00 22.00 23.00

Pontianak Pagi Berite Kite Siang PMC ( Pontianak Music Centre ) Video Clip Religi Berite Kite Malam Jungle N’ Run King of Dynasty Han Ngamen di TV Musik Manca

Ulasan berita menarik yang disajikan oleh tim redaksi PON TV serta koran-koran yang tergabung dalam Pontianak Post Group dikupas tuntas pada acara ini. Dikemas santai dan diiringi musik akustik band.

INDOSIAR

METRO TV

06.30 10.00 12.00 15.00 19.00 23.00

07.00 Kiss Pagi 09.00 Sinema Akhir Pekan: Di Antara tiga Cinta 14.00 Hot Kiss Sore 16.00 The Voice Indonesia 19.00 Sinema TV Unggulan : TBA 22.00 Sinema Unggulan: Cinta hingga Akhir Waktu

08.05 Indonesia Now 10.05 Menu & Venue 13.05 Oprah Winfrey Show : A No Hold Barred Conversation with Former 17.05 Metro Hari Ini 20.05 Dua Tamu 23.30 Metro Sports

Apa Kabar Indonesia Pagi Soccer One Indonesia Santap Siang Khazanah Islam Sport Heavyweight Kabar Arena Akhir Pekan

Death Warrant Louis Burke, polisi khusus Kanada yang ditugasi untuk menginvestigasi kasus aneh mengenai terbunuhnya para tahanan di sebuah penjara. Dia menyamar sebagai tahanan. (*)

ANTV

PON TV Pukul 07.30 WIB

Pontianak Pagi

TV ONE

06.45 Hati ke Hati Bersama Mamah Dedeh 09.30 Kaki 5 14.30 Kampiun Sepak Bola Nasional

17.30 Topik Petang Update 21.00 Crazy Sport 21.30 Sinema Spesial Wedding Crashers

07.00 Plester 11.00 Redaksi Siang 14.00 Mancing Mania

17.00 Sebelas Dua Belas 19.45 On The Spot 22.30 Mister Tukul

Trans TV Pukul 22.30 WIB

Nia Dinata Rilis Runway Dreams JAKARTA—Satu lagi karya sutradara Nia Dinata yang bisa dinikmati publik. Kali ini berupa film pendek yang berformat online. Maksudnya, film tersebut tidak tayang di bioskop, melainkan bisa dinikmati siapa saja, kapan saja, dan gratis karena bisa diakses di kanal YouTube. Film berjudul Runway Dreams tersebut merupakan sekuel dari film pendek sebelumnya, The Scent of Passion. Dua film tersebut merupakan hasil kerja sama Nia dengan salah satu produk fabric care. Kamis (14/3), bertempat di Blitz Megaplex Pacific Place, Jakarta, Nia hadir dalam peluncuran film yang mengusung cerita tentang dunia fashion tersebut. “Film ini dibuat untuk menghargai profesi orangorang yang bekerja di fashion industries. Di balik dunia fashion yang terlihat glamor, mereka itu hard-worker,” tutur Nia. Ada tiga karakter utama dalam Runway Dreams. Mikaela seorang koreografer perempuan yang getol mengejar passion, Naira asisten desainer yang innocence, serta Jelita model yang mewakili karakter attraction. Jelita diperankan salah seorang model top Indonesia Karenina. Peran Naira dipercayakan kepada Fitri Tropica, sedangkan Mikaela diberikan kepada Atria Loni, pemenang The Most Fearless dalam ajang Fun Fearless Female 2012. “Saat menulis cerita untuk karakter Jelita, sudah terbayang di kepala bahwa peran itu cocoknya untuk Karenina. Loni didapat dari casting. Fitrop juga sudah kita incar. Susah banget deal skedul dan harga sama dia,” ujar Nia setengah bercanda. Fitrop yang duduk tidak jauh dari Nia menyahut. “Begitu dikasih tahu manajer saya, ditawari main di film Teh Nia, saya langsung bilang mauuu bangeeettt”,” kata Fitrop dengan gaya khasnya. Memerankan karakter innocence menjadi hal yang menarik bagi perempuan yang dikenal kocak itu. “Teh Nia bisa melihat sisi lain dari diri saya,” lanjutnya. Proses syuting film yang durasi totalnya 60 menit itu berlangsung tiga hari. Nia menyebut proses syuting berlangsung sangat menyenangkan. Sutradara Arisan dan Berbagi Suami tersebut mengaku tidak mendapat kesulitanmengarahkanpemain-pemaindalamfilmnya kali ini. Kendala yang ditemui hanya masalah cuaca. Ketika itu, karena hujan, Nia harus mengganti adegan. “Scene Jelita joging bersama ibunya sambil mendorong kereta bayi akhirnya diganti yoga di teras,” ucapnya. Runway Dreams bisa ditonton melalui YouTube sejak Kamis (14/3). Versi online-nya terbagi tiga sesuai dengan tiga karakter dalam film tersebut. Yakni, The Inspiring Passion, The Timeless Attraction, dan The Shining Innocence. Masing-masing film berdurasi sekitar 20 menit. (nor/c4/any)

TRANS 7

RCTI Pukul 22.30 WIB

I Am Number Four Nomor satu, nomor dua, dan nomor tiga telah tewas. Kini giliran nomor empat, John Smith. Dia harus bersembunyi dari mereka yang sudah mengincar nyawanya. (*)

ADELE

Dibayar Rp1,3 M per Menit

Kisah di Balik Industri Fashion

SUARA emas diva bertubuh subur ini sudah diganjar banyak penghargaan di dunia musik. Tidak mengherankan Adele memiliki nilai jual tinggi. Namun yang mencengangkan, tarifnya untuk setiap penampilan tergolong sangat mahal. Harga suara Adele di pesta ulang tahun bisa mencapai 100 ribu poundsterling atau sekitar Rp1,3 miliar per menit. Kabar ini terkuak dari pengakuan konglomerat jus buahbuahan Afrika Selatan, Vivian Imerman. Ia pernah meminta Adele bernyanyi selama 25 menit di pesta ulang tahun anak perempuannya, di Hotel Gosvenor House, London. Namun setelah mengetahui biaya Adele mencapai 2,5 juta poundsterling, konglomerat itu akhirnya membatalkan niatnya meminta Adele tampil selama 25

menit. “Vivian merencanakan sebuah pernikahan yang mewah. Dia membayar Amy Winehouse untuk tampil di pesta pernikahan putri tertuanya, Bianca, tiga tahun silam. Dia berharap melakukan hal yang sama dengan Adele,” ungkap sumber. “Namun dia terkejut ketika mengetahui biaya untuk Adele 2,5 juta poundsterling. Meski uangnya banyak, namun tetap saja dia berpikir terlalu mahal, dan akhirnya mencari artis lain,” tandasnya. Ditolak Imerman, pelantun Skyfall dan Rolling Deep ini tak kecewa. Karena Adele tengah berembug, menuntaskan kesepakatan Rp 150 miliar jadi model iklan untuk satu perusahaan kosmetik ternama. Ini menambah pundi-pundi Adele yang kini berstatus miliarder. (net)

SUARA EMAS: Adele saat tampil di 55th Annual Grammy Awards 10, Februari lalu, di California. KEVORK DJANSEZIAN/GETTY IMAGES/AFP

Syuting ketika Hamil MODEL kenamaan Karenina mencuri perhatian dalam Runway Dreams. Sesuai dengan karakter attraction yang dia mainkan, perempuan 30 tahun tersebut memang memiliki paket komplet yang membuat semua orang tidak bisa mengalihkan pandangan darinya. Sudah melahirkan, namun bentuk tubuhnya masih tampak sempurna mengenakan gaungaun indah yang diperagakan di catwalk. Dalam Runway Dreams, Nina “sapaan Karenina” memerankan Jelita, model yang rehat setelah melahirkan. Niat menonton fashion show karya desainer yang juga teman baiknya, Jelita malah ditawari untuk menjadi model utama. Rupanya, ketika proses syuting Januari lalu,

Nina baru tahu bahwa dirinya hamil anak kedua. Saat ini usia kehamilannya memasuki tiga bulan. “Untungnya, waktu itu nggak rewel. Syuting lancar. Justru sekarang agak mual,” ucap perempuan yang pernah dijuluki model seribu wajah itu. Sebelumnya, Nina memiliki Khrisna yang kini berusia 2 tahun dari perkawinannya dengan pria berdarah India, Kamal Bhojwani. “Khrisna lagi lucu-lucunya, sudah bisa diajak ngobrol, sudah preschool. Cuma, hari ini nggak diajak karena dia nggak betah duduk diam dalam waktu lama,” kata perempuan bertinggi 174 sentimeter itu. Dia mengatakan, sang suami mendukung keputusannya berakting. Dalam dunia modeling,

KAPANLAGI

C

M

Y

K

stereotype tubuh tipis dan tinggi menjulang seakan harus dipenuhi. Namun, Nina sejak dulu dikenal bukan termasuk model yang bertubuh “tipis”. Dia enjoy dengan bentuk tubuh curvy. “Saya hanya berusaha sekurus yang saya mampu. Tapi, saya tidak memaksakan diri. Lagian, saya olahraga membentuk otot, jadi nggak mungkin tipis banget. Yang penting bajunya muat,” ujarnya, lantas tertawa. Setelah melahirkan, untuk mengembalikan bobot ideal, Nina mengombinasikan yoga, aerobik, dan boxing. “Sekarang mulai naik lagi semenjak hamil,” ungkapnya. Dia berpesan kepada setiap perempuan untuk mencintai diri apa adanya. Tidak perlu ingin menjadi seperti orang lain. (nor/c4/any)

ANGGER BONDAN/JAWA POS

CURI PERHATIAN: Karenina saat melakukan peragaan busana di Senayan City, Jakarta, akhir tahun lalu.


CAKRAWALA

6

Pontianak Post

z

Sabtu 16 Maret 2013

AMALIA DAMONTE; PEREMPUAN YANG PERNAH MEMIKAT HATI BERGOGLIO KECIL

Untung Tak Jadi Menerima Cinta Jorge Terpilihnya Jorge Mario Bergoglio alias Paus Fransiskus sebagai pengganti Benediktus XVI membangkitkan kembali kenangan masa kecil Amalia Damonte. Perempuan 76 tahun yang tinggal di kawasan Flores, Kota Buenos Aires, Argentina, itu merasa ikut berjasa “mengantarkan� mantan uskup agung Argentina tersebut ke takhta suci Vatikan.

Pe re m p u a n b e ra m b u t putih itu mengaku masih ingat isi surat cinta teman masa kecilnya yang kini menjadi paus tersebut. Dalam suratnya, menurut dia, Bergoglio kecil “mengancam� akan menjadi pastor jika Damonte menolak cintanya. Belakangan, Paus Fransiskus membuktikan ancamannya. Sebab, Damonte kecil terpaksa menolak cinta sahabatnya itu lantaran kemarahan sang ayah. �Saya hanya menerima satu surat cinta dan ayah langsung mengganjar saya dengan tamparan di pipi,� kenang Damonte. Padahal, imbuh dia, Paus Fransiskus kecil alias Jorge adalah teman yang sangat menyenangkan. Tidak hanya ramah, Jorge juga bocah lelaki yang sopan serta pandai bergaul.

Kini Damonte merasa bangga dengan keputusannya untuk menolak cinta Jorge waktu itu. Sebab, berkat penolakannya, teman sekaligus tetangganya tersebut terpilih sebagai paus setelah bertahun-tahun mengabdikan diri pada agama. “Dia mengatakan, jika saya tidak menjawab surat cintanya dengan “yaâ€?, dia akan menjadi pastor. Beruntungnya dia, saat itu saya menjawab “tidakâ€?,â€? paparnya sebagaimana dilansir Daily Mail kemarin (15/3). Selain mengancam akan menjadi pastor jika cintanya bertepuk sebelah tangan, Paus Fransiskus sempat mengungkapkan impiannya untuk hidup bersama Da“SAYA terpaku di depan monte. “Dia menuliskan batelevisi. Saya tidak percaya hwa kami akan menikah dan Jorge menjadi paus,â€? ujar dia bakal membelikan saya Damonte saat menyaksikan sebuah rumah bercat putih berita tentang paus pertasehingga kami bisa hidup ma dari luar Benua Eropa bersama,â€? kenang tersebut. Dengan Damonte. Sampai bercanda, peremINILAH 13 FAKTA SOAL PAUS BARU sekarang, dia mapuan berkacamata sih tinggal di rumah itu mengungkapJorge Mario Bergoglio resmi menjadi pengganti Paus Benediktus masa kecilnya yang kan, secara tidak XVI. Selain dikenal sebagai sosok yang sederhana dan dekat berjarak sekitar emorang miskin, inilah beberapa fakta kehidupan tentang paus langsung, dirinya baru tersebut: pat rumah dari rupunya andil besar 1. Dia suka bepergian dengan bus. mah masa kecil Paus menjadikan ro 2. Dia telah hidup selama lebih dari 50 tahun dengan satu Fransiskus. paru-paru berfungsi. Dia yang lain dihapus sebagai haniwan 76 tahun seorang pemuda karena infeksi. “Dia naksir saya tersebut sebagai 3. Dia adalah putra dari seorang pekerja kereta api Italia. karena kami banyak panutan umat Ka4. Dia dilatih sebagai ahli kimia. menghabiskan waktolik dunia. Sebab, 5. Dia adalah Paus non-Eropa pertama di era modern. tu bersama. Dulu, 6. Dia mengklaim bahwa adopsi oleh homoseksual adalah dia menolak cinsuatu bentuk diskriminasi terhadap anak-anak tetapi kami biasa bermain ta pria yang kini percaya bahwa kondom â€?bisa diizinkanâ€? untuk di jalanan sekimenjadi orang nomencegah infeksi. tar rumah,â€? lanjut mor satu di Vati7. Pada tahun 2001 ia mencuci dan mencium kaki pasien Damonte. AIDS di sebuah rumah sakit. kan tersebut pada 8. Dia berbicara fasih Italia, serta Spanyol dan Jerman. Dia berharap, 1948â€?1949 silam. 6DPSDLVHNDUDQJLDWHODKWLQJJDOGLVHEXDKĂ€DWNHFLO setelah menjadi “Ketika itu, kami menghindari fasilitas sebagai seorang uskup. pemimpin tertinggi masih berusia 1210. Dia meminta warga Argentina tidak melakukan Vatikan, Paus Fran13 tahun. Tidak perjalanan ke Roma untuk merayakan terpilihnya dia siskus mampu menul e b i h d a r i i t u ,â€? menjadi Paus baru. Menurutnya lebih baik uang untuk larkan kebaikannya ungkap Damonte membeli tiket pesawat diberikan kepada orang miskin kepada seluruh umat sebagai gantinya. mengenang kisah 11. Ia diyakini telah menjadi runner-up dalam konklaf Paus Katolik. Sebagai tecintanya dengan terakhir pada 2005. man yang mengenal Bergoglio alias 12. Dia telah bersama-menulis sebuah buku dalam bahasa Paus Fransisus sejak Paus Fransiskus, Spanyol. YakniSobre el Cielo y la Tierra (Di Surga dan Bumi). 13. Meskipun konservatif pada doktrin gereja, ia telah kanak-kanak, Dayang dia sebut Jormengkritik para imam yang menolak untuk membaptis monte yakin pengge, saat beranjak bayi yang lahir dari ibu tunggal. g a nt i B e n e d i kt u s remaja. (mas/jpnn) VXI itu menyimpan

Amalia Damonte

C

M

Y

K

banyak kebaikan dalam hatinya. �Dia pria yang baik, putra keluarga pekerja. Semoga dia bisa mewujudkan semua harapan dan cita-cita baiknya,� katanya saat diwawancarai salah satu stasiun televisi lokal. Sejak membuka kisah cinta monyetnya dengan Paus Fransiskus, pensiunan yang tidak pernah meninggalkan kawasan Flores itu mendadak menjadi terkenal. Berbagai media, baik cetak maupun elektronik, memburu Damonte untuk mengorek lebih jauh sisi

lain sang paus. Damonte boleh saja mengaku berjasa mengantarkan Paus Fransiskus ke puncak kepemimpinan umat Katolik karena urusan asmara. Tapi, mantan pemimpin Ordo Jesuit (Serikat Jesus) di Argentina tersebut juga boleh mengungkapkan kisah cintanya yang lain. Dalam sebuah wawancara pada 2010, Paus Fransiskus sempat menyinggung soal kehidupan asmaranya. “Dia adalah salah seorang gadis dari kelompok teman-teman saya yang suka berdansa. Tapi, saya lantas memilih untuk mengabdikan

diri pada agama,� bebernya. Paus Fransiskus yang sangat gemar berdansa tango itu memutuskan untuk hidup selibat pada 1958, saat usianya menginjak 21 tahun. Namun, dia baru menjadi imam pada 1969 setelah lebih dari satu dekade mengabdikan diri pada agama. Selain hobi berdansa tango, Paus Fransiskus juga sangat menggemari sepak bola. Bahkan, dia mengaku sebagai salah satu fans berat tim salah satu tim sepak bola asal Buenos Aires, San Lorenzo alias The Saints. (rtr/dailymail/hep/ c5/dos)


Pontianak Post

aneka

Sabtu 16 Maret 2013

7

Status Anas Diprotes Sambungan dari halaman 1

Lain halnya jika alumnus FISIP Universitas Airlangga Surabaya itu dipanggil dalam kapasitasnya sebagai individu atau sebagai mantan anggota DPR RI. Jika dipanggil sebagai mantan anggota DPR, maka kapasitas Anas adalah pejabat

negara. Namun, jika dipanggil sebagai mantan ketum Demokrat, artinya ada kepentingan partai yang dibawa saat Anas diperiksa. Firman menyatakan, pihaknya yakin ada persoalan lain dalam pemanggilan Anas sebagai saksi. “Ya jelas persoalan politik,” tegasnya. Saat

ditanya lebih jauh persoalan politik apa yang dimaksud, Firman ogah menanggapi. Dia menyatakan tidak tahu dan menghormati KPK sebagai institusi penegak hukum. Anas sendiri tampak tenang menjalani pemeriksaan. Dia datang pukul 10.40 dengan senyum semringah. Kepada

wartawan, dia mengatakan bakal dimintai keterangan soal kasus pengadaan Simulator SIM dengan tersangka Irjen Djoko Susilo. “Saya tidak tahu kenapa saya dijadikan saksi dan saya tidak tahu info apa yang dibutuhkan dari saya,” ujarnya. Tidak berselang lama, pu-

bangunan semipermanen bertingkat dua yang berdinding seng tersebut. Setelah itu, beberapa anggota mendobrak pintu yang juga terbuat dari seng. ’’Suara tendangannya keras banget. Polisi minta kami masuk ke dalam rumah. Mereka bilang polisi,’’ ujar Lasih. Tidak lama kemudian, sejumlah polisi berhasil masuk ke dalam bangunan yang didirikan setahun silam tersebut. Bahkan, beberapa kali Lasih mendengar suara gaduh dari dalam. Namun, dia tidak mendengar suara tembakan dari lokasi penggerebekan itu. ’’Ampun Pak, ampun Pak,’’ ujar Lasih menirukan seorang pelaku yang berhasil dibekuk. Seusai melumpuhkan pelaku, seorang polisi mengambil borgol di mobil. Tidak lama kemudian, terlihat dua pelaku sudah diborgol dengan tangan di belakang. Kepala seorang pelaku yang bernama Arman ditutup dengan kresek hitam. ’’Tangannya diborgol. Yang satu kepalanya ditutup pakai kresek hitam. Si Agus nggak. Kemudian, dibawa ke mobil,’’ jelasnya. Sementara itu, Ketua RT 2 Rasim mengungkapkan, saat penggerebekan, dirinya diminta polisi menyaksikan penggeledahan di lokasi. ’’Saya dipanggil untuk menyaksikan. Saya lihat ada dua orang yang ditangkap. Di situ juga ada emas dan pistol,’’ ujarnya.

Seusai penggeledahan, sekitar pukul 07.00, dua pelaku dibawa polisi untuk diperiksa. Seorang pelaku terpaksa ditembak petugas karena dianggap melawan. Sementara itu, bom-bom rakitan yang ditemukan polisi langsung diamankan tim Gegana Polda Metro Jaya. Tim Gegana datang di lokasi sekitar pukul 10.00 dengan peralatan lengkap. Polisi kemudian memasang garis polisi dengan jarak 15 meter dari lokasi ditemukannya bom rakitan itu. Petugas juga mengevakuasi warga yang rumahnya berdekatan dengan lokasi. Warga diminta menjauh karena petugas akan meledakkan bom. Akhirnya, sekitar pukul 11.00, satu bom rakitan berdaya ledak rendah itu diledakkan. Sebanyak 13 bom rakitan lainnya dievakuasi dari dalam gudang penyimpanan barang di lantai dua bangunan tersebut. Kasatresmob Polda Metro Jaya AKBP Hery Heryawan menyatakan, dari hasil penggeledahan, polisi menyita lima pucuk senjata api jenis Scorpion dan 14 bom pipa (satu di antaranya diledakkan). Selain itu, 1 kilogram emas, dua sepeda motor, dan tiga handphone. Dia menjelaskan, timnya masih mengejar anggota jaringan lainnya. ’’Kami bersama tim Densus Polda Metro dan mabes,’’ tegas penangkap Hercules dan penembak kaki John Kei itu. (rdl/adi/jpnn/ c5/nw)

Tiga Terduga Teroris Tewas Sambungan dari halaman 1

yang melacak perampokan toko emas Terus Jaya di kawasan Tubagus Angke, Tambora, Jakarta, 10 Maret lalu. ’’Setelah dikembangkan, ini positif kelompok teroris yang sedang melakukan operasi pengumpulan dana atau fa’i,’’ ujar mantan Kapolda Metro Jaya itu. Pengungkapan kelompok tersebut menjadi semacam ’’berkah’’ bagi Densus 88 karena sedang disorot, bahkan dituntut untuk dibubarkan, oleh sejumlah organisasi masyarakat, termasuk PP Muhammadiyah. Menurut Sutarman, tiga orang terpaksa ditembak mati. ’’Sebab, mereka bersenjata, melawan, dan membahayakan petugas,’’ kata mantan Kapolwiltabes Surabaya itu. Penembakan bertempat di tiga lokasi berbeda. Penangkapan pertama dilakukan di Jalan C, Gang Lilis, kawasan Teluk Gong, Jakarta Barat, Kamis tengah malam (14/3). Dalam operasi itu, Makmur tewas, sedangkan temannya, Hendra, ditangkap hidup-hidup. Dari keterangan Hendra, polisi bergerak ke sebuah tempat di daerah Pondok Aren, Tangerang. Mereka lantas membekuk Kodrat, orang yang belakangan diketahui juga masuk DPO kasus bom Beji, Depok. Kodrat tewas. Tim lalu geser ke Pekayon, Bekasi Selatan, dan membekuk Kiting. Dari keterangan

Kiting, personel menyerbu gudang mebel di kampung Babakan, Mustika Sari, Kecamatan Mustika Jaya, Bekasi. Di tempat itu, seorang tersangka bernama Arman ditembak mati. Seorang lainnya ditangkap hidup-hidup, yakni Siswanto. Seorang lagi bernama Togop dibekuk di Jalan Kapuk Muara, Jakarta Utara, dalam keadaan hidup. Menurut Sutarman, di lokasi gudang mebel itu, ditemukan 14 bom pipa; 5 senjata api; 34 butir peluru kaliber 9 mm; dua sepeda motor; dan 1 kilogram emas. ’’Emasnya cocok dengan yang dirampok. Jadi, memang ini operasi mencari dana kelompok teroris dengan jalan merampok,’’ tegas orang nomor satu di korps Sidik Sakti Indra Waspada tersebut. Penggerebekan rumah bedeng di Kampung Babakan, RT 02/03, Kelurahan Mustikasari, Kecamatan Mustikajaya, itu kontan menggegerkan seisi kampung. Lasih, 35, warga sekitar, menuturkan, penggerebekan bermula dari kedatangan puluhan anggota Resmob Polda Metro Jaya sekitar pukul 05.30. Petugas menggunakan dua kendaraan pribadi dan berpakaian preman. ’’Saya sedang masak, kok banyak orang,’’ kata Lasih kepada Radar Bekasi (Jawa Pos Group) kemarin. Perempuan yang tinggal persis di depan lokasi persembunyian pelaku itu mengungkapkan, puluhan anggota polisi kemudian mengepung

Ikan Endemik dengan Harga Fantastis Sambungan dari halaman 1

pulang ikan supermahal itu. Akuarium-akuarium yang berisi ikan arwana jenis super red berjejer di Pontianak Convention Center, kemarin. Para pengunjung yang sebagian besar adalah penghobi arwana terlihat memandangi ikan-ikan dalam akuarium tersebut. “Ini adalah ikan-ikan arwana terbaik yang berasal dari berbagai tempat, tidak hanya dari Kalbar tapi juga dari luar negeri,” kata Vincent Apriono, Ketua Panitia Borneo Arowana International Contest and Expo 2013 saat ditemui di sela-sela pameran. Sebanyak 72 ikan arwana berjenis super red dipamerkan dalam pameran kali ini yang dilaksanakan selama 3 hari, yakni 15-17 Maret. Peserta kontes berasal dari sejumlah tempat, seperti Putusibau, Pontianak, Meliau, Sintang. Peserta dari luar Kalbar antaralain dari Medan, Jakarta, Surabaya, Thailand, dan Singapura. Kontes kali ini terdiri dari empat kategori, yaitu large untuk ukuran ikan lebih dari 50 cm, medium untuk ukuran ikan antara 40 hingga 50 cm, small untuk ukuran kurang dari 40 cm, dan kategori unique untuk ikan yang memiliki bentuk unik dan indah.

Masing-masing kategori itu kemudian dinilai oleh lima juri yang berasal dari Singapura, Malaysia, Cina, Taiwan, dan Pontianak. “Penilaian didasarkan sejumlah hal, seperti dari sisi keindahan, anatomi dan lain-lain. Penilaian dilakukan malam hari supaya juri bisa tenang melakukan penilaian,” jelas Vincent. Pameran ini menurut Vincent bertujuan meningkatkan pamor ikan arwana yang sedikit meredup belakangan ini. “Kami berusaha meningkatkan harga arwana yang cenderung turun,” tambahnya. Ikan arwana, terutama jenis super red adalah ikan endemik Kalimantan. Ikan super mahal ini dijual harga jutaan hingga ratusan juta rupiah. Pada pameran ini, sejumlah ikan sudah laku terjual. “Tadi (kemarin) sudah ada yang terjual seharga Rp290 juta. Itu ikan pemenang kontes,” kata Yudi Setiawan, Kepala Humas Asosiasi Penangkar dan Pedagang siluk Kalimantan Barat. Salah seorang peserta Joni Ang dari Jakarta mengatakan kelebihan ikan arwana terletak pada setiap bagian tubuhnya, mulai dari badan, sisik, hingga ekornya. Bahkan gaya renangnya juga menampilkan keindahan tersendiri. “Ikan arwana super red itu kesannya gagah,” ujar Joni.

Joni mengikutkan sertakan 2 ekor ikannya yang dia bawa langsung dari Jakarta. Dua-duanya memenangi kompetisi. Satu ikan menjadi juara pertama kategori large, dan satu lagi juara kedua kategori “medium”. Dia sebelumnya sudah percaya diri ikannya akan menang. Sebab ikan miliknya memiliki sejumlah keunggulan. “Ekor ikan saya itu besar, badannya gagah dan kekar, sisiknya mulus, warnanya penuh. Daya berenangnya juga bagus,” katanya. Dalam kontes dan pameran ikan arwana ini, para pengunjung yang berminat memang bisa menawar harga pada sang pemilik. “Rentang harga ikan ini bervariasi. Harganya tergantung pada ukuran dan keindahan ikannya. Pembeli bisa menawar. Kalau deal mereka bisa bawa pulang,” tambah Vincent. Namun pengembangbiakan ikan ini cukup sulit. Misalnya saja dalam penangkaran dibutuhkan air yang bersih dan tidak tercemar. Selain itu dibutuhkan perawatan ekstra dalam penangkaran ikan ini. Saat para penangkar mengalami sejumlah masalah dalam proses penangkaran ikan arwana di Kalbar. Para penangkar mengeluhkan sulitnya mendapatkan sumber air bersih untuk penangkaran. Air sungai Kapuas yang

biasa digunakan kini kualitasnya jauh menurun akibat penambangan emas tanpa izin dan perkebunan kelapa sawit. “Air sungai kualitasnya kurang bagus. Terutama 10 tahun terakhir. Ikan banyak yang kurang sehat. Ada juga yang mati. Produksi jadi jauh menurun,” keluhnya. Karena produksi menurun, para penangkar ikan banyak yang merugi. Di Kalbar sendiri ada sedikitnya 130 usaha penangkaran yang tersebar di berbagai wilayah. Rata-rata mereka menggunakan air sungai untuk penangkaran mereka. Usaha penangkaran ini menyerap cukup banyak tenaga kerja. Mereka mengharapkan campur tangan pemerintah untuk memulihkan kondisi sungai Kapuas sehingga usaha penangkaran ikan arwana bisa terus berjalan. Misalnya dengan menindak tegas pelaku peti dan pemilik perkebunan yang melanggar aturan. Ikan arwana yang merupakan ikankebanggaanKalbarmenurut Vincent harus terus ditingkatkan produksinya. Setiap tahun sekitar 20.000 ikan arwana dari berbagai jenis diekspor ke luar negeri, seperti ke Cina, Singapura, Malaysia, Taiwan dan negara-negara lain. Ikan arwana menjadi sumber devisa yang cukup besar bagi Indonesia. (her)

Perlu Waktu Dua Tahun untuk Jenderal Besar Sambungan dari halaman 1

masih ada patung-patung lain,” tutur Suhartono pekan lalu. Studio yang dimaksud Suhartono itu berada di belakang rumahnya. Luasnya sekitar 10 meter x 13 meter. Di tempat itulah patung-patung tersebut diproduksi. Salah satu patung yang baru saja dia selesaikan adalah patung mantan Presiden Soeharto. Patung setinggi 3,5 meter itu kini dipajang di rumah kelahiran Soeharto di Dusun Kemusuk Lor, Desa Argomulyo, Kecamatan Sedayu, Bantul, Daerah Istimewa Jogjakarta. Lantaran punya nilai sejarah penting, rumah Soeharto tersebut kini dipugar. Oleh pihak keluarga, tempat itu dijadikan bahan kajian dan memorial Jenderal Besar HM. Soeharto yang diresmikan pada 1 Maret lalu. Meski sudah dipajang, patung itu belum kelar 100 persen. Pasalnya, patung tersebut masih harus dicetak dengan fiber untuk kemudian dibentuk lagi dengan bahan perunggu. “Patung di Kemusuk itu, bentuk kepalanya seperti

ini,” kata Suhartono sembari menunjuk patung kepala Soeharto yang tak jauh dari pintu masuk rumahnya. Pria asal Banyuwangi tersebut lantas bercerita ihwal dirinya diminta membuat patung Soeharto yang mengenakan seragam jenderal Angkatan Darat itu. Pada 2010 dia dipanggil untuk menemui Probosutedjo, adik Soeharto. Suhartono tidak tahu dari mana Probosutedjo mendapatkan referensi tentang dirinya. “Ternyata Pak Probo pernah beli patung saya pas pameran. Patung tentang wanita dan seruling,” ungkapnya. Saat bertemu Probosutedjo, Suhartono sempat ditanya soal pengalamannya membuat patung. Karena itu, dia lantas menyodorkan CV (curriculum vitae) dirinya. Dari situlah Probo yakin bahwa Suhartono adalah pematung yang dicarinya. Suhartono kemudian diminta untuk membuat patung Soeharto dengan kostum jenderal besar. Sejak itu, Suhartono langsung menggarap patung sang penguasa Orde Baru tersebut.

Hampir dua tahun dia suntuk, berusaha “menghidupkan” lagi sosok Soeharto yang gagah dan berwibawa. Selama pembuatan patung tersebut, Probosutedjo terus mengecek progresnya. “Kadang sebulan sekali, kadang tiga minggu sekali, beliau rawuh ke sini. Ya di sela-sela kesibukan beliau,” katanya. Garapan Suhartono ternyata dinilai nyaris sempurna. Karena itu, Probo juga meminta Suhartono membuat patung Pak Harto dengan posisi-posisi yang berbeda. Salah satunya, Pak Harto yang sedang memberi hormat. Patung itu kini ikut menghiasi kompleks rumah Atmo Sudiro, ayah Pak Harto, di Kemusuk tersebut. Patung itu menjadi bagian dari diorama perjalanan hidup Soeharto. Ada juga patung Pak Harto dan Ibu Tien mengenakan pakaian resmi: jas dan kebaya. Suhartono juga membuat patung Soeharto naik kuda. Memang belum semua jadi. Termasuk patung Pak HartoIbu Tien, masih terlihat kasar dan dibungkus plastik di da-

lam studio. “Sekarang saya masih konsen menyelesaikan yang di Kemusuk (proses dari fiber ke perunggu). Harus selesai Juni nanti, bertepatan dengan kelahiran Pak Harto,” ujarnya. Saat ditanya berapa Probosutedjo harus merogoh kocek untuk membayar patungpatung karyanya, Suhartono menolak menjawab. ”Ini rahasia perusahaan,” elaknya. Pria 69 tahun itu mengungkapkan alasan pentingnya melibatkan pihak keluarga dalam pembuatan patung. Pasalnya, keluargalah yang paling tahu tentang kondisi sebenarnya si tokoh. ”Dengan cara begitu, patung akan sangat mirip dengan aslinya. Pihak keluarga juga tidak akan komplain,” terang bapak enam anak itu. Misalnya saat membuat patung Soeharto, masukan datang dari Probosutedjo. Kemudian, dia mendapat saran dari Meutia dan Halida Hatta saat membuat patung Bung Hatta serta Sukmawati ketika membuat patung Bung Karno. (*/c11/ari)

kul 12.00, Irjen Djoko datang ke gedung KPK naik mobil tahanan. Mengenakan seragam tahanan KPK, mantan Kakorlantas Mabes Polri itu langsung masuk ke gedung tanpa menghiraukan pertanyaan yang diajukan wartawan di sekelilingnya. Djoko keluar pukul 14.00 dan kembali mengacuhkan wartawan. Dia langsung masuk ke mobil tahanan yang membawa dia kembali ke Rutan KPK. Setelah diperiksa penyidik sekitar empat jam dipotong jeda salat Jumat, pukul 15.00 Anas keluar dari gedung KPK. Dia menyatakan, sebagian besar pertanyaan yang diajukan penyidik dia jawab dengan dua kata. “Tidak tahu,” terangnya. Menurut anas, dia tidak tahu, tidak pernah melihat, mendengar, apalagi sampai mengalami proses pengadaan simulator tersebut. Beberapa pertanyaan yang diajukan penyidik, lanjut Anas, masih berkaitan dengan jabatannya kala itu sebagai Anggota DPR RI. Termasuk soal tugas-tugasnya sebagai anggota Komisi X dan hubungannya dengan sejumlah tokoh. Saat ditanya soal Djoko dan Teddy Rusmawan, Anas mengaku tidak mengenal mereka. “Apa pernah saya ikut membahas anggaran Polri, tidak pernah. Apakah pernah berkomunikasi dengan menkeu Sri Mulyani terkait Penerimaan Negara Bukan Pajak, juga tidak pernah,” tuturnya. Anas pun mengaku bingung mengapa dia dijadikan saksi.

Selain itu, dia juga menegaskan jika tidak dikonfrontir dengan Djoko Susilo. Soal pertemuan dia dengan Nazaruddin, Djoko Susilo, dan Saan Mustofa, Anas dengan tegas membantah. “100 persen ini pertemuan tidak ada,” tegasnya. Dia lalu menunjukkan sebuah surat kabar yang memajang ilustrasi dirinya bertemu dengan tiga tokoh tersebut di sebuah restoran kepiting. Menurut Anas, KPK sempat menanyakan berita yang muncul di koran tersebut kepadanya. “Gambar ini adalah sadisme opini, kejahatan opini,” ucapnya. Jika media membuat berita atau sketsa, menurut Anas seharusnya ada konfirmasi agar tidak terjadi fitnah. Dia menyatakan tidak tahu dari mana koran tersebut mendapatkan informasi yang akhirnya dibuatkan sketsa. Sementara itu, Juru Bicara KPK Johan Budi membantah tudingan kuasa hukum Anas soal status mantan ketua KPU tersebut di surat panggilan. “KPK tidak berpolitik,” terangnya. Menurut dia, kalimat dalam surat pangilan itu hanya menunjukkan predikat Anas saja. Pada kenyataannya, saat ini dia memang mantan ketum Partai Demokrat. Sedangkan, dalam konteks pemeriksaan, Anas diperiksa dalam kapasitasnya sebagai Anggota DPR kala itu. “Tidak ada kaitan dengan partai, itu hanya predikat pengganti,” lanjutnya. Penyidik bisa saja mencantumkan dia sebagai mantan anggota DPR atau

predikat lainnya. Johan mempersilakan jika kuasa hukum Anas menyoal predikat tersebut. Menurut dia, itu hak setiap saksi. Yang terpenting, penyidik memanggil dia sesuai dengan konteks kasus yang sedang disidik. “Pak Anas sudah datang, memberikan keterangan, dan sudah di-BAP,” katanya. Selain Anas, KPK juga memanggil beberapa saksi lain dalam kasus tersebut. Di antaranya, Brigjen Didik Purnomo, salah satu tersangka dalam kasus yang diduga merugikan Negara Rp100 miliar itu. Didik diperiksa dalam kapasitasnya sebagai Pejabat Pembuat Komitmen (PPK) daam proyek tersebut. Selain Didik, KPK juga menghadirkan AKBP Teddy Rusnawan. Dia diperiksa dalam kapasitasnya sebagai ketua panitia lelang proyek simulator. Johan menambahkan, pihaknya tidak pernah mengatakan aset yang disita dari Djoko Susilo bernilai Rp100 miliar. “Yang benar itu, hingga Senin (11/3) kemarin aset yang disita KPK nilainya di bawah Rp100 miliar. Artinya, nilainya puluhan miliar rupiah,” katanya. Salah satu tujuannya adalah memproteksi aset agar tidak sampai berpindah tangan kepada siapapun. Penyitaan itu bukanlah perampasan. Melainkan menjaga agar tidak ada peralihan kepemilikan sampai ada keputusan hakim. Nanti tentu saja bisa dikembalikan berdasarkan keputusan hakim. (byu)

Bingung karena Kakak Sambungan dari halaman 1

“Ketika itu aku merasa seperti berada di bawah bayang-bayang kakakku. Aku nggak tahu apa yang mau aku lakukan,” ungkap Agni ketika ditemui di Kemang, Jakarta Selatan. Untungnya, kekasih Dion Wiyoko tersebut sangat dekat dengan keluarga. Kalau sudah begitu, dia lantas bertukar pikiran dengan keluarga. Atau, dia menuliskan hal-hal kecil dalam diari yang bisa menumbuhkan lagi semangat serta mood-nya. Sampai sekarang, lanjut dia, dirinya masih

melakukan kebiasaan itu. Perlahan Agni bisa bangkit lagi, bahkan semakin aktif. Yang terbaru, dia bermain dalam film 9 Summers 10 Autumns. Dalam film tersebut, dia berperan sebagai Isa, seorang kakak yang penyabar. Itu juga mengingatkan dirinya pada keluarga. Agni adalah anak kedua di antara tiga bersaudara. Dia memiliki adik lakilaki. “Sebagai anak tengah, aku jadi orang yang penyabar karena punya adik. Aku juga jadi pengertian karena punya kakak,” terangnya.

Saat memerankan Isa, kulit Agni terlihat lebih gelap. Rupanya, itu memang disengaja. Sebab, dia menyesuaikan dengan peran. “Nggak disuruh sih sebenarnya. Tapi, yang jadi adikku itu kan kulitnya lebih gelap, jadi ya menyesuaikan,” ungkapnya. Dia memilih untuk lebih sering berada di bawah sinar matahari supaya kulitnya lebih gelap. Agni tidak memilih jalan pintas dengan tanning. “Ah, ngapain keluar duit mahal” Ngapain juga diperbudak sama penampilan?” tegasnya. (jan/ c5/any)

Alasan Paus Baru Memilih Nama Fransiskus Sambungan dari halaman 1

dikenal sebagai uskup yang sederhana dan dekat kaum miskin. Bahkan, dia memilih untuk tinggal di apartemen sederhana dan menolak fasilitas mobil lengkap dengan sopirnya. Dia lebih memilih kemana-mana menggunakan angkutan umum. Selain itu, nama Francis juga untuk menghormati

Santo Fransiskus Xaverius, pendiri ordo Jesuit. Ya, Bergoglio juga berasal dari ordo Jesuit. Lahir pada 7 April 1506 Fransiskus Xaverius adalah seorang misionari yang melakukan perjalanan ke seluruh Asia bahkan Indonesia. Pada 1545-1546, Fransiskus Xaverius melakukan misinya di Makasar dan Ambon. Misi di Ambon tersebut men-

jadi salah satu awal sejarah berdirinya Gereja Katolik di Indonesia. Selain itu, dia berhasil mengkristenkan lebih dari 1 juta orang. Jumlah tersebut paling banyak dibanding siapapun semenjak Santo Paulus. “Jadi mereka adalah dua orang kudus yang konsisten dengan kepribadiannya dan misinya,” imbuh Pastor Thomas. (mas/jpnn)

Sering Mengalami Radang Lambung? Sambungan dari halaman 1

kanker ini menyebabkan kematian satu juta orang di dunia per tahun. Gejala awalnya tak begitu terasa dan kerap tak dihiraukan sehingga pemeriksaannya pun sulit dilakukan. Tapi, bila gejalanya sudah meningkat, baru bisa ditemukan lokasi tumbuhnya. Misalnya, perasaan penuh atau tak nyaman di perut setelah makan bisa menjadi petunjuk bahwa kanker itu berada di lambung bagian bawah. Gejala lain yang sering muncul pada penderita penyakit ini adalah penurunan berat badan, gampang lelah, dan sulit atau tak mampu menyerap beberapa vitamin dan mineral. Penyakit ini lebih banyak menyerang manusia usia lanjut. Kenapa? Karena bisa jadi di lambung mereka sudah lama terdapat tumor. Gara-gara suatu hal, tumor yang tadinya jinak itu kini berubah menjadi ganas dan berkembang menjadi kanker. Para ahli menyatakan, penderita kanker ini di masa mendatang akan makin banyak karena makanan yang dikonsumsi manusia makin bervariasi. Apalagi makanan itu banyak menggunakan zat pengawet dan penyedap. Masuknya zat itu membuat lambung mengalami infeksi, yang kadang-kadang berlanjut pada inflamasi. Kondisi ini bisa saja memberi kontribusi pada luka di lambung serta berbagai jenis kanker pencernaan lainnya. Bakteri yang terdapat dalam ulkus duodenalis juga dapat berperan dalam memunculkan kanker

lambung. Termasuk polip lambung. Karena itu, jika ada, polip lambung harus diangkat untuk mencegah munculnya kanker. Faktor-faktor lain yang dapat memicu kanker lambung adalah asupan garam yang tinggi, karbohidrat yang tinggi, nitrat yang tinggi, serta sayuran dan buah yang kurang. Untuk mengobati, tentu saja Anda perlu ke dokter. Tapi, untuk mencegah, yang perlu dilakukan adalah skrining rutin dengan pemeriksan darah, USG, dan CT Scan. Bisa juga dengan rutin mengonsumsi antioksidan tingkat tinggi. Apa misalnya? Xanthone, yang terdapat dalam kulit buah manggis. Peneliti luar negeri, seperti Martin (1980), Kanchanapoom (1998), Nakasone (1998), Paul (1998), Nakatani (2002), dan Matsumo ( 2003) melaporkan bahwa 10 mikron/ ml alfa-mangostin (turunan xanthone) yang diisolasi dari kulit buah manggis mampu menghambat sel leukimia HL-60 pada manusia, dan garcinone E (juga derivat xanthone) efektif untuk menghambat kanker hati, kanker lambung, dan kanker paru. Khasiatnya bahkan jauh lebih efektif bila dibandingkan dengan obat kanker seperti flauraucil, cisplatin, vincristin, metohotrexete, dan mitoxiantrone. Bila ingin mendapatkan informasi lengkap tentang khasiat kulit manggis tersebut, Anda bisa membacanya di buku berjudul Kulit Manggis Berkhasiat Tinggi itu, yang tersedia di Toko Buku Gramedia di seluruh Indonesia. Tapi, apakah untuk

mendapatkan xanthone itu kita perlu mengimpornya dari luar negeri atau menggiling kulit manggis dulu untuk kemudian meminum airnya? Tidak. Sekarang, teknologinya sudah ada di Indonesia. Dan produk itu sudah beredar di apotek-apotek dan toko-toko obat terkemuka di kota Anda, dalam bentuk kapsul ekstrak kulit manggis. Namanya Garcia. Sekali lagi, nama produk itu adalah Garcia, bukan xanthone, karena xanthone adalah nama zat yang terkandung di dalamnya. Untuk konsultasi kesehatan, hubungi dokter kami pada jam kerja di telepon bebas pulsa 08001401430 atau di e-mail purwati-s@ centrin.net.id. Dan kunjungi juga website kami: www. manggisgarcia.com atau di e-mail: info@manggisgarcia. com. Bila ingin mendapatkan ekstrak kulit manggis pertama di Indonesia itu, Anda bisa menghubungi distributor Kalimantan Barat 081280016319, (0561) 7161419. Atau bisa juga mendapatkannya langsung di apotekapotek dan toko obat di Kota Pontianak. Untuk di daerah hubungi Sub Distributor: Kubu Raya (085880501034), Singkawang (085386711108), Sambas (085387155781), Kabupaten Pontianak (085347695045), Bengkayang (085252223557), Landak (082156214191), Sanggau (082153805379), Sekadau (085386211220), Sintang (085880501034), Kapuas Hulu (081257268829) dan Ketapang (085252056206, Kayong Utara (085652054794). (adv)


cmyk

SOSOK DEWI PERSSIK

KAPANLAGI.COM

Belum Disentuh Pacar Baru BOLAK-balik dikabarkan dekat dengan banyak lelaki, akhirnya Dewi Perssik (Depe) menyatakan dirinya telah resmi dipacari. Pacar terbaru janda Saipul Jamil dan Aldi Taher ini bernama Dion. Dengan muka berseri, Depe mengaku bahagia dengan statusnya saat ini. “Iya sekarang udah punya pacar lagi, liat di twitter aja ya. Bedanya kami nggak pernah ketemu secara fisik, secara intens.” ujar Depe, kemarin. Meski demikian Depe

tetap berharap, hubungannya kali ini dengan Dion adalah hubungan serius. Artinya, pemilik goyang gergaji ini tak mau gagal lagi seperti hubungannya dengan beberapa pria terdahulu. ”Kalau sama yang ini lebih baik kan jauh, menjauhkan dari dosa. Enaknya punya pasangan, selalu ada untuk curhat, kasih masukan positif,” ujar Depe. Ketika ditanya siapakah sosok Dion sehingga mampu meluluhkan hatinya, Depe masih malu-malu. Depe tak mau perkenalannya dengan Dion kali ini hanya hubungan singkat. ”Dia orang indonesia tapi tinggal di luar. Jadi dia ini ternyata fans saya yang sudah lama sekali, selama dua tahun ini dia mendalami saya. Kami jadiannya 10 Oktober (2012),” jelasnya. (OZI)

SURABAYA – Indonesia masih menjadi tempat transit favorit bagi imigran gelap asal Timur Tengah yang akan menyeberang ke Australia. Kemarin dini hari (15/3) Satgas People Smuggling Polda Jatim mencegat bus yang mengangkut sekitar 80 imigran gelap. Rombongan ini akan menuju Banyuwangi untuk selanjutnya menyeberang ke Pulau Christmas, Australia. Selain para imigran, polisi juga menangkap lima orang yang diduga sebagai agen (penyelundup) di kendaraan berbeda. ’’Empat di antaranya WNI,” ujar Kasubid III Renata Ditreskrimum Polda Jatim AKBP Wiji Suwartini kemarin. Rombongan pencari suaka itu tertangkap sekitar pukul 02.00 di jalur pantura, Tuban. Mereka berdesakan dalam bus Dunia Mas yang membawa mereka dari Jakarta ke Banyuwangi. Menurut Wiji, para imigran itu ditangkap berdasar hasil laporan intelijen Mabes Polri. Dari pemeriksaan diketahui mereka berasal dari Iran dan Iraq. Mereka terdiri atas 49 laki-laki, 11 perempuan, dan 20 anak-anak. Salah seorang imigran bernama Ali Alegra. Dia menolak dianggap sebagai penyelundup. Ali mengaku datang ke Indonesia dengan tujuan pelesir ke Bali. ’’Saya datang dengan empat anggota keluarga. Ini paspor dan visa saya,” kata pemuda berkewarganegaraan Iran itu. AKBP Wiji membenarkan bahwa mayoritas imigran memang dilengkapi dokumen resmi sebagai syarat ke luar negeri. Misalnya, paspor, visa, bahkan izin berkunjung. Di antara 80 orang, 52 terbukti memiliki dokumen lengkap. Setelah pemeriksaan pukul 12.00 kemarin, mereka langsung diangkut bus untuk dibawa kembali ke Jakarta. Sebanyak 15 orang lain me-

megang dokumen kedaluwarsa. Sisanya tanpa dokumen apa pun. Mereka diangkut terpisah untuk didata lebih lanjut di Keimigrasian Tanjung Perak, Surabaya. Meski demikian, kata Wiji, dokumen itu hanya kedok agar tidak ditangkap polisi. Polisi juga tidak percaya begitu saja dengan pengakuan imigran yang hendak berlibur ke Bali. Saat ditangkap, pencari suaka memang selalu beralasan sebagai wisatawan. ’’Itu hanya alibi mereka saja. Saya kira, alasan itu sudah umum,” ungkap Wiji. Polisi juga menangkap lima orang yang diduga sebagai agen penyelundup. Dari Jakarta, mereka bertugas mengawal perjalanan imigran agar lancar sampai Banyuwangi. Mereka menggunakan Pajero Sport hitam bernopol F 1061 HV. Empat orang di antara mereka adalah WNI bernama Arsyad, Alami, Mustofa, dan Hamim. Seorang lagi yang disangka sebagai otak penyelundup adalah warga negara Palestina bernama Husein Ali Muhammad. Hingga sore kemarin, polisi memeriksa mereka.Penyidik menduga, lima orang itu adalah sindikat penyelundup imigran ilegal yang melewati wilayah Indonesia. Mereka diduga kerap terlibat dalam aksi penyelundupan sebelumnya. Sopir bus Dunia Mas M. Suep mengaku tidak tahu-menahu tentang aksi penyelundupan itu. Dia hanya menerima order dari Mustofa untuk membawa penumpang sebanyak 80 orang ke Banyuwangi. Dari Jakarta, dia dibayar Rp 28 juta. Namun, Rp 14 juta diambil agen. Sebagai akomodasi di perjalanan, dia hanya diupah Rp 4 juta. Rp 10 juta lain akan diberikan setelah sampai di Banyuwangi. Sumber di intel penyidik menyebut, dari Banyuwangi, mereka akan menyeberang ke Bali, lalu menuju Pulau Lombok dan Sumbawa. Diduga, dari pulau di ujung timur Provinsi NTB itu, rombongan akan menyeberang via kapal laut ke Pulau Christmas. (mar/c1/nw)

JULIA PEREZ

Klaim Status Buronnya Dicabut AKTRIS seksi Julia Perez (Jupe) mengklaim status buron yang dialamatkan Kejaksaan Negeri (Kejari) Jakarta Timur kepadanya telah dicabut. Hal tersebut diungkapkan Jupe melalui kuasa hukumnya, Malik Bawazier. Pengacara yang juga suami artis Cut Keke itu menyatakan bahwa kliennya tidak kabur, tapi sedang sakit. ”Tidak ada yang kabur, tidak ada yang sembunyi. Bahkan lebih jauh, lebih tegas saya katakan, jangan takut-takuti orang dengan kata buron,” kata Malik Bawazier via telepon, Jumat (15/3). Jupe juga berterima kasih kepada kejaksaan yang sudah mencabut status buronnya. ”Pada saatnya nanti 270 KUHAP salinan itu ada, dan dia sudah dinyatakan sehat oleh dokter yang memeriksa dia akan siap menjalani proses

Kalbar Belajar Ternak Sapi ke New Zealand Menurut Numsuan, sistem perternakan di sana menggunakan mekanisasi sehingga hanya membutuhkan sedikit tenaga kerja. Petani dan peternak di sana bisa mendapatkan kredit perbankan dengan mudah karena aset mereka bisa dijadikan jaminan. Kredit ini diberikan oleh koperasi peternakan di Invercargill yang hanya menerima agunan berupa lahan pertanian. “Petani di sana berhasil menjadi petani karier. Siapapun bisa mendapatkan lahan dan penghasilan sebanyakbanyaknya di sana. Kami juga berkunjung ke lahan pertanian dan melihat proses mulai dari pembibitan, penanaman, hingga produksi yang hasilnya diekspor termasuk ke Indonesia,” jelas Numsuan. Numsuan menambahkan Gubernur Kalbar mendorong pengembangan pertanian dan peternakan di Kalbar menggunakan teknologi. “Akan mengembangkan peternakan sapi perah, pertanian dengan teknologi, hidroponik, dan produksinya. Nantinya akan menjadi masukan dalam perumusan kebijakan,” timpalnya. (uni)

DITE SURENDRA/JAWA POS

DIAMANKAN : Anak dari imigran Timur Tengah yang diamankan bersama 80 imigran itu terdiri dari 49 pria dewasa, 11 perempuan dewasa, 11 anak perempuan dan 9 anak laki-laki di Polda Jatim kemarin. Keberadaan mereka sebenarnya sudah terpantau sejak berada di Jakarta, namun karena kerap lolos saat melewati pemeriksaan di perbatasan, akhirnya mereka sampai ke Tuban dan tertangkap oleh tim satuan tugas Kepolisian Daerah Jawa Timur.

HUMAS KALBAR FOR PONTIANAK POST

TUKAR CINDERAMATA: Gubernur Kalimantan Barat Cornelis didampingi Istri. Frederika Cornelis bertukar cinderamata dengan Duta Besar Republik Indonesia Untuk New Zealand, Samoa dan Tonga, Antonius Agus Sriyono.

Curi Ilmu Industri Jasa, Ekonomi dan Kesehatan

Kirim Mahasiswa Kuliah di Jepang Ilmu pendidikan memang harus terus digali, tak memandang tempat, letak dalam menimba ilmu tersebut. Apalagi di era globalisasi seperti ini, kaum muda berlomba-lomba mengejar impiannya. Seperti lima mahasiswa Untan yang terpilih melanjutkan pendidikan di luar negeri. Bagaimana proses perjuangan mereka? YULIUS RAYMOND, Pontianak PAGI kemarin (15/3), Pontianak Post disambangi empat wanita dan satu pria muda. Mereka adalah Yuni, Listi, Ridiyat, Fitriana, dan Elenc, mahasiswa Universitas Tanjungpura dari Fakultas Ekonomi jurusan Manajemen Internasional semester empat. Mereka datang bersama Associate professor

Kochi University, Ishizutsu Satoru. Nantinya, kelima tunas bangsa tersebut akan menempuh pendidikan di Faculty of Humanities (ilmu sosial) di Jepang selama enam bulan terhitung sejak Mei nanti. Sebelumnya, kelima mahasiswa ini dipilih karena dinilai layak untuk menempuh pendidikan di sana, tentunya berkat prestasi yang gemilang. “Mereka dipilih sesuai dengan kemampuannya masing-masing,” kata Ishizutsu Satoru melalui Yuni sebagai translatternya waktu berunding di meja bundar Redaksi Pontianak Post. Dalam paparannya, dia berkata, ini merupakan program kerjasama antar universitas. Di mana, setelah mereka menempuh dan mampu menyerap ilmu yang dipelajari, bisa diterapkan di negara asalnya lagi. Mata kuliah yang ditawarkan di Kochi University pun telah disetarakan di Universitas Indonesia. “Sebenarnya, apa manfaat dari program ini? apakah ada tujuan khusus?,” tanya Pimpi-

HARYADI/PONTIANAKPOST

KUNJUNGAN:Sejumlah Mahasiswa luar negeri yang berkuliah di Universitas Tanjungpura,Kemarin(15/3) melakukan kunjungan ke Redaksi Pontianak Post.

nan Redaksi Pontianak Post, B. Salman. Menurut Ishizutsu, ini sangat besar sekali manfaatnya. Selain dapat menimba ilmu, mahasiswa juga diberi kesempatan mempelajari gaya hidup masyarakat Jepang. Bukan dalam artian negatif, namun pola

mela@pontianakpost.com

cmyk

hukum,” kata Malik. Jupe sebelumnya menjadi terpidana dalam kasus pertengkaran dengan lawan mainnya di film ”Arwah Goyang Karawang”, Dewi Perssik. Setelah itu, Jupe ditetapkan sebagai buron oleh Kejaksaan Negeri (Kejari) Jakarta Timur lantaran tidak beritikad baik menjalani proses hukum. (abu/ jpnn)

PONTIANAK—Pemerintah Provinsi Kalimantan Barat yang dipimpin Gubernur Cornelis berkunjung ke New Zealand. Di sana, rombongan belajar teknologi peternakan dan pertanian, yang akan dijadikan masukan dalam merumuskan kebijakan. “Rombongan berkunjung ke New Zealand dan Australia dari 3 Maret hingga 13 Maret lalu,” ujar Kepala Biro Humas dan Protokol Provinsi Kalbar, Numsuan Madsun di ruang kerjanya, Jumat (15/3). Numsuan menjelaskan kunjungan kerja tersebut terkait bidang peternakan, pertanian, pariwisata dan ekonomi kreatif, tenaga kerja, dan Tim Penggerak PKK. Rombongan juga didampingi dari perbankan, keuangan, asisten pemerintahan, dan Bupati Sanggau. “Kunjungan tersebut ke beberapa tempat, salah satunya ke Peternakan di Invercargill. Di sana kami bertemu peternak berkewarganegaraan Indonesia, Reza Abdul Jabar. Ia memiliki 1.800 hektar, 1.700 sapi, dan hanya enam tenaga kerja,” ungkap Numsuan.

Terdeteksi 31 Hotspot PONTIANAK - Sebanyak 31 titik api terpantau di kabupaten/kota di Kalimantan Barat. Gubernur Kalbar Cornelis menginstruksikan agar penanganan titik api yang menyebabkan kabut asap diintensifkan pada radius 50 kilometer dari Pontianak atau Bandara Supadio.“Karena kabut asap dalam radius 50 kilometer diperkirakan akan mengganggu penerbangan atau lalu lintas udara,” ujar Kepala Badan Lingkungan Hidup (BLH) Kalimantan Barat, Darmawan di ruang kerjanya, Jumat (15/3) sore. Darmawan menjelaskan radius 50 kilometer tersebut berada di Kota Pontianak, Kabupaten Pontianak, dan Kubu Raya. Data terakhir BLHD Kalbar yang mengambil hasil deteksi Satelit NOAA yakni pada 14 Maret terpantau satu titik api di Kota Pontianak, 13 titik api di Kubu Raya, dan satu titik api di Kabupaten Pontianak. Titik api ini juga terpantau di kabupten lainnya, yakni di Sambas dua titik api, Landak satu titik api, Sanggau satu titik api, Sekadau empat titik api, Sintang satu titik api, Ketapang empat titik api, dan Kayong Utara tiga titik api, “Totalnya ada 31 titik api. Sehari sebelumnya terpantau hanya 10 titik api,” ungkap Darmawan. Menurut Darmawan, belum bisa diidentifikasi asal titik api tersebut, apakah dari pembakaran lahan oleh individu atau perusahaan. “Karena kami hanya membaca dari satelit NOAA. Titik api ini terbaca pada luasan dua hektar. Kalau lebih kecil tidak terbaca,” jelas Darmawan. Ia menuturkan kabut asap yang ditimbulkan dari titik api tersebut belum menimbulkan gangguan serius. Data pada 15 Maret menunjukkan jarak pandang pada 06.00 hanya 300 meter, pukul 07.00 meningkat menjadi 500 meter, pukul 08.00 menjadi 700 meter, pukul 09.00 menjadi 1 kilometer, dan pukul 10.00 naik menjadi 1,2 kilometer. (uni)

Sabtu 16 Maret 2013

SISI LAIN

Polisi Cegat 80 Imigran Asal Iran-Iraq Hendak ke Australia, Termasuk 20 Anak-Anak

Pontianak Post

KAPANLAGI.COM

8

Pontianak Post

pikir dan cara kerja efisienlah yang harus ditiru. Kochi sendiri adalah suatu daerah berkembang di Jepang. Aktivitas masyarakat di sana familiar. Begitu halnya dengan para pelajar, banyak yang memilih Kochi sebagai tempat

menggali ilmu pendidikan. “Kalau di Indonesia, Kochi seperti Bandung,” timpalnya. Ditegaskannya lagi, para pelajar di sana bukan sekedar belajar secara formal. Dalam kehidupan sehari-hari, khususnya di hari libur, banyak diantara mereka yang bekerja di beberapa tempat usaha makanan dan minuman. “Untuk itulah, waktu sangat berharga sekali bagi mereka,” tuntasnya. Setelah mengerti paparan dalam menempuh pendidikan di Kochi University, kelima mahasiswa terpilih itu kian semangat. Salah satunya Yuni. Dia mengaku, selain bisa mencari pengalaman baru, ilmu pendidikan yang dipelajari nanti akan diterapkannya di Indonesia. “Mudah-mudahan kami dapat menyelesaikan kredit mata kuliah sesuai rencana. Ya, tentunya dengan hasil yang memuaskan. Sekaligus menjadi motivasi bagi teman-teman juga,” kata Yuni yang juga merancang program studinya untuk meraih gelar pasca sarjana di Jepang. (*)


Metropolis Pontianak Post

KORAN

SABTU 16 Maret 2013

PEREMPUAN

Perjuangkan Kaum Hawa TIDAK kurang dari 20 perempuan yang tergabung dalam Pusat Pengembangan Sumberdaya Wanita (PPSW) Borneo mendatangi Gedung DPRD Kota Pontianak, Jumat (15/3). Dalam pertemuan dengan anggota dewan, beberapa elemen organisasi perempuan itu menyampaikan aspirasi dan keluhan mereka pada kebijakan terhadap perempuan. Dari pihak dewan, hanya Uray Heny Novita dan Syarifah Yuliana dewan perempuan yang menerima rombongan PPSW yang juga membawa organisasi Peka, Gemawan, Diantama dan kader posyandu. Empat lainnya memiliki agenda lain pada waktu yang sama. Anggota DPRD Kota Pontianak Uray Heny Novita mengatakan, selaku perempuan selama ini pihaknya terus mengupayakan kebijakan dan anggaran bagi kepentingan kaum hawa. Dia mencontohkan tali asih bagi kader posyandu yang sejak tahun lalu mengalami peningkatan. “Hampir Heny Novita semua kader posyandu perempuan. Kami telah mengupayakan anggaran untuk mereka meningkat,” katanya. Namun dia mengakui peningkatan anggaran untuk kader posyandu belum diikuti dengan asupan gizi balita. Mestinya, kata Heny, ada anggaran asupan gizi ditambah agar balita mengalami tumbuh kembang yang baik. “Selama ini asupan gizinya tidak jauh dari kacang hijau. Kami akui hal ini belum dapat ditingkatkan,” ujarnya. Direktur PPSW Borneo Reni Ludjazi mengungkapkan, pihaknya melakukan studi terkait kebijakan dan penganggaran pemerintah yang berhubungan dengan perempuan. Misalnya berbagai program yang tergabung dalam pengentasan kemiskinan. Tetapi di lapangan kebijakan itu tidak menyentuh secara mendasar terhadap perempuan. “Ini tidak hanya di Pontianak, kami juga lakukan kajian di Klaten dan Aceh,” tuturnya.

Udara Sangat Tidak Sehat Kabut Asap Ganggu Penerbangan PONTIANAK—Kualitas udara di Kota Pontianak tiga hari terakhir masuk kategori tidak sehat, bahkan cenderung sangat tidak sehat. Kualitas udara itu terpantau oleh Air Quality Monitoring Station (AQMS) Kota Pontianak. “Dari data indeks standar pencemaran udara (ISPU) Kota Pontianak tiga hari terakhir cenderung sangat tidak sehat,” kata Kepala Badan Lingkungan Hidup Kota Pontianak, Raihan, Jumat (15/3). Dikatakannya, kualitas udara dengan kategori cenderung sangat tidak sehat terjadi pada malam hingga dini hari. Dari pukul 21.00 hingga 04.00. “Yang sangat

berbahaya ISPU sedangkan kualitas udara ambient dari tanggal 12 sampai 14 Maret rata-rata berada pada kategori sedang,” papar Raihan. Menindaklanjuti hasil stasiun monitoring kualitas udara itu, BLH melayangkan surat kepada, badan penanggulangan bencana daerah, dinas kesehatan, dinas pendidikan, dishubkominfo, enam kantor camat serta 29 kantor lurah. Raihan mengimbau kepada masyarakat agar mengurangi aktivitas di luar rumah terutama pada malam hari. Jika pun terpaksa keluar, sangat dianjurkan menggunakan pengaman saluran pernapasan

seperti masker. “Masyarakat jangan membakar sampah rumah tangga di halaman atau pekarangan. Bagi yang memiliki lahan pertanian atau kebun, jangan membersihkan lahan dengan cara membakar,” imbaunya. Di bidang pendidikan, Raihan memberikan peringatan kepada dinas dan sekolah. Dia mengimbau agar sekolah tidak membuat siswa banyak beraktivitas di luar kelas. “Sebaiknya kurangi jadwal murid di luar ruangan,” katanya. Dinas perhubungan pun tidak luput dari imbauan. Yang mendapat peringatan serius adalah lalu lintas kendaraan sungai. Jarak pandang di air pendek dalam kondisi saat ini. • ke halaman 15 kolom 5

PMI Siapkan 20 Ribu Masker

MEIDY KHADAFI/PONTIANAKPOST

Prihatin kabut asap, PMI dan para mahasiswa serta sejumlah anggota Polda Kalbar turun ke jalan untuk membagikan masker secara gratis, Jum’at (15/03).

BAGI MASKER

PONTIANAK–Kabut asap akibat pembakaran lahan telah menyebar di wilayah Kota Pontianak dan sekitarnya. Hal tersebut mengancamkesehatan, utamanya pernafasan masyarakat. Melihat itu PalangMerahIndonesia(PMI) Wilayah Kalbar dan Kota Pon-

tianak membagikan masker secara gratis di dua titik, perempatan Jalan A Yani-Sultan Abdurahman dan simpang empat Jalan Tanjungpura-Imam Bonjol, kemarin (15/3). Di sana PMI bergabung dengan para mahasiswa dan sejumlah anggota Polda Kalbar. • ke halaman 15 kolom 2

• ke halaman 15 kolom 2

SOSIAL

Minim Yayasan Fardhu Kifayah DILATARBELAKANGI sulitnya masyarakat kurang mampu untuk dapat mempergunakan transportasi terlebih di saat mereka sedang mengalami musibah baik itu sakit maupun saat membawa jenazah, Shabli, pendiri Yayasan Shabli Al-Banjari yang bergerak di bidang sosial kemasyarakatan terketuk hatinya untuk membantu mereka dengan mendirikan yayasan tersebut. Yayasan ini memberiSutarmidji kan pelayanan fardhu kifayah dan pemulasaran jenazah serta membantu masyarakat kurang mampu di bidang pendidikan dan kesehatan. • ke halaman 15 kolom 5

KABUT ASAP Sebuah sampan bermesin melintas di Sungai Kapuas yang dipenuhi kabut asap pada pagi hari, Jumat(15/3). Pembakaran lahan di saat cuaca panas masih menjadi penyebab utama timbulnya kabut asap. HARYADI/PONTIANAKPOST

Pendidikan

Terbelit Anggaran

PONTIANAK—Sektor pendidikan tidak terlepas dari permasalahan anggaran. Anggota VI Badan Pemeriksa

Keuangan RI, Rizal Djalil menyebutkan ada beberapa temuan terkait pendidikan di Kalimantan Barat. ”Temuan ini di antaranya terkait penyaluran beasiswa miskin, dana alokasi khusus, maupun pembangunan sekolah satu atap,” ujar Rizal di Pontianak, belum lama ini. Menurut Rizal, dalam temuan BPK disebutkan adanya kekurangan penyaluran beasiswa miskin senilai Rp17,87 juta dan pe-

BEKELIT

nyaluran tanpa tanda bukti penerimaan siswa. Temuan lainnya berupa realisasi penyaluran dana alokasi khusus bidang pendidikan tahun anggaran 2011 sebesar Rp107,81 juta tidak tepat sasaran. Terdapat juga kekurangan penyaluran beasiswa miskin senilai Rp12 juta dan penyaluran tanpa tanda bukti sebesar Rp309,92 juta. • ke halaman 15 kolom 2

KULMINASI MATAHARI PICU SUHU EKSTREM

Pekan Terakhir Maret, Cuaca Tidak akan Panas Lagi MASYARAKAT patut waspada. Dua musim penyakit yakni cuaca sangat panas dan musim pancaroba akan menyelimuti kota ini, sejak awal bulan Maret hingga April mendatang. Setelah musim ekstrem ini, musim pancaroba bergantian akan datang. “Biasanya setiap mendekati fenomena kulminasi, cuaca panas akan menyelimuti kota ini. Kemudian setelah itu, musim pancaroba akan datang. Tak hanya di Kota Pontianak di beberapa daerah lain yang memiliki garis khatulistiwa juga akan mengalami cuaca yang sama,” ungkap Sutikno Prakirawan Cuaca dari BMKG Kalbar Menurutnya, peristiwa titik kulminasi matahari itu terjadi setahun dua kali.

Cuaca panas dan ekstrem yang terjadi sejak beberapa pekan ini di Kota Pontianak ternyata berkaitan dengan akan datangnya fenomena titik kulminasi yang terjadi pada 21-23 Maret mendatang. Matahari yang terus bergerak dari selatan ke utara hingga nol derajat ternyata memicu terjadinya perubahan cuaca ekstrem menuju ke pancaroba. URAI BUDIANTO, Pontianak

• ke halaman 15 kolom 2 ILUSTRASI : KEKES

C

m

y

k

INT

KULMINASI

Cuaca Kota Pontianak memiliki karakteristik khusus karena berada di lintasan garis khatulistiwa. Fenomena titik kulminasi yang diperingati setahun dua kali di Tugu Khatulistiwa memicu peningkatan suhu.


metropolitan

10

Pontianak Post lSabtu 16 Maret 2013

KKR Jawara Titik Api

KUNJUNGAN: Manajemen Tupperware saat berkunjung ke Redaksi Pontianak Post, Jumat(15/3). Tupperware menyatakan prihatin atas maraknya jajanan anak yang tidak sehat. HARYADI PONTIANAKPOST

Tupperware Sosialisasi Jajanan Berbahaya Gelar Seminar Edukasi PONTIANAK – Sebuah seminar akan digelar oleh Tupperware bertemakan; “Aku Anak Sehat”, hari ini (16/3) di Hotel Kapuas Palace Pontianak. Bahasannya adalah seputar jajanan anak yang ber­ bahaya bagi kesehatan. “Berdasarkan data yang didapat dari BPOM, masih tingginya tingkat angka jajanan Tidak Masuk Syarat pada jajanan sekolah karena mengandung berbagai zat kimia berbahaya masih menjadi keprihatinan

bagi kita semua,” ungkap Ayu Meganin­ grum, panitia acara, saat berkunjung ke ruang Redaksi Pontianak Post, kemarin (15/3). Berangkat dari keprihatinan tersebut, Tupperware kembali menyuarakan mengenai edukasi program “Aku Anak Sehat”, yang tahun ini ikut pula dike­ mas dalam program pencarian “Anak Jempolan” di beberapa kota. Targetnya adalah penyebaran edukasi akan pen­ tingnya membawa bekal yang bersih, sehat, dan bergizi oleh siswa yang di­ pandu guru dan orangtuanya. “Tahun ini kami melibatkan 600 seko­ lah dasar negeri untuk program ini yang

menjangkau 100 ribu siswa. Program ini sudah kita mulai sejak beberapa tahun. Dan Pontianak menjadi salah satu target kita tahun ini,” kata dia. Seminar tersebut akan diisi oleh pemateri-pemateri yang mumpuni di bidangnya. Mereka adalah; Public Rela­ tion and Communication Manager PT Tupperware Umayanti, Indonesia, dokter spesialis anak IDAI dan staf ahli Men­ kokesra Rachmat Sentika, psikolog anak Rose Mini, dan dari BPOM Pontianak. Tahun ini, “Aku Anak Sehat” meng­ gaungkan kampanye bertajuk “Anak Jempolan”, yang akan memilih anak teladan dari masing-masing kelas di

setiap sekolah. “Anak jempolan ini dipilih berdasarkan beberapa kriteria tertentu, salah satunya konsisten mem­ bawa bekal sehat dan bisa menularkan semangatnya kepada teman-teman sekelasnya,” pungkas dia. Sementara itu, Pemred Pontianak Post, B Salman menyebut program terse­ but sangat bagus di tengah maraknya ja­ janan anak yang berbahaya di Pontianak. “Kini jajanan anak semakin beragam dan dibuat menarik. Tentu itu menimbulkan minat anak untuk membelinya. Padahal apakah makanan itu bersih atau men­ gandung zat berbahaya, kita tidak tahu,” kata dia. (ars)

Bawang Naik Pedagang Pasrah PONTIANAK—Pedagang bawang merah dan bawang putih yang beroperasi di sejumlah pasar tradisional di Kubu Raya dan Kota Pontianak hanya pasrah akibat naiknya harga bawang secara tidak terk­ endali. Pasalnya omset penjualan turun drastis dari hari biasa, sebelum harganya meroket. ”Kami hanya bisa pasrah saja. Biasanya, sehari bisa menjual minimal 10 kologram, sekarang untuk menjual satu kilogram saja susah,” kata Amin, pedagang bawang di Pasar Parit Baru ini. Menurut dia sejak melonjaknya harga bawang, fluktuasi

kedatangan pembeli ke tokonya sangat tidak teratur. Kalau hari biasa, bisa 20-50 pembeli, sekarang sudah tidak lagi. ”Mencari pembeli 5 orang saja sudah susah. Rata-rata pembeli sepertinya menunggu kebijakan pemerintah menu­ runkan harga bawang. Makanya, kami tidak bisa berbuat banyak,” ucapnya. Harga bawang sebelumnya tidak tinggi. Namun beberapa hari belakangan mengalami ke­ naikan tajam menyentuh level harga Rp40 ribu perkilogram. Kenaikannya fantastis diikuti langkanya jumlah pembeli. Kata dia meningkatnya harga memang

sudah ada tanda-tandanya sejak sepekan lalu. Harga normal sebelum kenaikan harga bawang merah sekitar Rp25 ribu, namun kemudian meningkat terus. “Har­ ganya naik terus dari Rp25 ribu jadi Rp 35 ribu, jadi Rp 40 ribu sampai sekarang. Setelah ini enggak tahu lagi naik lagi atau tidak,” tuturnya. Amin dan sejumlah pedagang lainnya hanya bisa pasrah menghadapi kenyataan ini. Ia berharap ada usaha dari pemerintah sehingga harga bawang putih maupun bawang merah bisa kembali normal seperti sediakala sehingga bisa penjualan

Sementara itu, Alif Muhammad, pemer­ hati masalah sosial kemasyarakatan Kalbar menduga ada praktik kartel dalam impor komoditas bawang putih. Sehingga har­ ganya melambung akhir-akhir ini. Belum lama ini dugaan tersebut sudah terjadi di bisnis impor daging sapi yang menyebab­ kan KPK memeriksa sejumlah elit. Apalagi membaca pemberitaan di media masa akhir-akhir ini 50 persen kuota impor bawang putih dikuasai kartel alias asosiasi 21 perusahaan di Indonesia. ”Makanya kita curiga dan berdampak ke Kalbar juga,” kata pengusaha swasta ini juga. (den)

PONTIANAK—Sebanyak 31 titik api terpantau di kabupaten dan kota di Kalimantan Barat. Gubernur Kalbar Cornelis menginstruksikan agar penanganan titik api yang menyebabkan kabut asap diintensifkan pada radius 50 kilometer dari Kota Pontianak atau Bandara Supadio. “Karena kabut asap dalam radius 50 kilometer diperkirakan akan mengganggu penerbangan atau lalu lintas udara,” ujar Kepala Badan Lingkungan Hidup (BLH) Kalimantan Barat, Darmawan di ruang kerjanya, Jumat (15/3) sore. Darmawan menjelaskan radius 50 kilometer tersebut berada di Kota Pontianak, Kabupaten Pontianak, dan Kubu Raya. Data terakhir BLHD Kalbar yang mengambil hasil deteksi Satelit NOAA yakni pada 14 Maret terpantau satu titik api di Kota Pontianak, 13 titik api di Kubu Raya, dan satu titik api di Kabupaten Pontianak. Titik api ini juga terpantau di kabupaten lainnya, yakni di Sambas dua titik api, Landak satu titik api, Sanggau satu titik api, Sekadau empat titik api, Sintang satu titik api, Ketapang empat titik api, dan Kayong Utara tiga titik api, “Totalnya ada 31 titik api. Sehari sebelumnya terpantau hanya 10 titik api,” ungkap Darmawan. Menurut Darmawan, belum bisa diidentifikasi asal titik api tersebut, apakah dari pembakaran lahan oleh individu atau perusahaan.   “Karena kami hanya membaca dari satelit NOAA. Titik api ini terbaca pada luasan dua hektar. Kalau lebih kecil tidak terbaca,” jelas Darmawan. Ia menuturkan kabut asap yang ditimbulkan dari titik api tersebut belum menimbulkan gang­ guan serius. Data pada 15 Maret menunjukkan jarak pandang pada 06.00 hanya 300 meter, pukul 07.00 meningkat menjadi 500 meter, pukul 08.00 menjadi 700 meter, pukul 09.00 menjadi 1 kilome­ ter, dan pukul 10.00 naik menjadi 1,2 kilometer. Kabut asap berpengaruh pada kualitas udara. Darmawan mengungkapkan udara pada menje­ lang sore hingga pagi berada dalam kondisi tidak baik. Data kualitas udara ambient Kota Pontianak, kemarin mencatat ISPU PM10 masuk pada katagori sangat tidak sehat dari pukul 00.00 hingga 01.00. Dari pukul 01.30 hingga 6.30 masuk katagori tidak sehat, dan di atas pukul 07.00 masuk katagori sedang. Darmawan mengatakan penanganan maupun pencegahan kabut asap maupun titik api tidak bisa dilakukan instansinya sendiri. “Kami tidak punya armada, yang punya hanya dinas teknis. Salah satunya kehutanan,” katanya. (uni)


Pontianak Post •

Sabtu 16 Maret 2013

Halo publik

Rindukan Rerimbunan Hutan di Kubu Raya

+

Hutan merupakan kekayaan alam yang sangat berpengaruh terhadap kelangsungan hidup seluruh makhluk yang bernyawa. Namun kenyataanya sekarang, hutan tak lagi menjadi kekayaan alam yang tetap dijaga kelestariannya. Faktanya dapat kita lihat di berbagai daerah di Kabupaten Kubu Raya. Hutan sudah banyak yang beralih fungsi seperti digunakan untuk lahan pertanian, lahan perkebunan kelapa sawit, karet, dan komoditi lainnya. Tetapi yang sangat miris sekali bagi penulis adalah penebangan liar yang sangat tidak memperhatikan kelestarian hutan. Penebangan pohon yang tidak menggunakan sistem tebang pilih merupakan suatu kesalahan yang sangat fatal. Semua pohon baik kecil maupun besar dapat dijadikan uang sehingga dimanfaatkan oleh pihak-pihak yang tidak bertanggung jawab. Mari kita lihat kenyataan di berbagai kecamatan di Kabupatem Kubu Raya. Ketika penulis menyusuri jalan di Kecamatan Kubu, pemandangan yang bisa kita saksikan adalah terhamparnya perkebunan kelapa sawit. Sejauh mata memandang hanya dapat menyaksikan rerimbunan pohon kelapa sawit. Sudah jarang sekali ditemukan rerimbunan pohon yang bisa menyejukkan mata. Begitupun ke daerah kelahiran penulis di Desa Muara Tiga Kecamatan Batu Ampar.

Hutan di desa kami sedikit demi sedikit semakin terusik. Beralih fungsi menjadi lahan pertanian masyarakat setempat. Masyarakat sudah banyak yang meninggalkan lahan pertanian mereka, karena dinilai sudah tidak produktif, sehingga masyarakat mengalihfungsikan hutan sebagai lahan pertanian yang dinilai sangat subur. Hutan di Desa Muara Tiga semakin terusik dengan kehadiran perusahaan kelapa sawit. Hutan-hutan sudah semakin menipis karena dimusnahkan dan diganti dengan lahan perkebunan kelapa sawit. Tak hanya di hutan, kelapa sawit juga ditanam di dekat pemukiman penduduk. Sungguh miris sekali, penulis tidak bisa lagi menyaksikan keindahan alam dengan hutannya yang rimbun, pepohonan yang menyegarkan ketika kita menghirupnya. Justru yang kita saksikan adalah kabut asap hasil pembakaran hutan yang digunakan untuk pembukaan lahan perkebunan kelapa sawit. Hal itu pasti dapat mengganggu kesehatan masyarakat setempat. Itulah yang tidak diperhatikan oleh para penguasa hutan di daerah kami. Mereka hanya mementingkan isi perut mereka sendiri, sedangkan kelangsungan hidup makhluk hidup disekitarnya sangat mereka abaikan. Hal yang menjadi kekhawatiran penulis adalah ketika musim ke-

11

Pemuda, Pembangun atau Penghancur?

marau melanda desa kami kelak, apakah masyarakat masih bisa menikmati air yang berasal dari tanah seperti dahulu ataukah hanya menggigit tangan karena cadangan air di dalam tanah sudah tidak tersedia lagi akibat penggusuran hutan secara membabi buta? Yang jelas, penulis saat ini sangat merindukan rerimbunan hutan seperti dahulu lagi. Mungkin itu hanya mimpi belaka, karena faktanya pemerintah Kabupaten Kubu Raya kurang dalam melakukan pengawasan terhadap pembukaan lahan perkebunan kelapa sawit sehingga pihak perusahaan semena-mena dalam pembukaan lahan karena mereka berdalih sudah memiliki izin dari dinas terkait. Mungkin ini hanya coretan yang tidak berguna bagi pihak-pihak yang tidak peduli terhadap kelestarian alam, tetapi tulisan ini benar-benar jeritan kerinduan penulis terhadap rerimbunan hutan seperti dahulu. Penulis mengajak kepada semua pihak secara bersama-sama menjaga kelestarian hutan dengan cara menanam pohon yang berguna agar dapat meminimalisir efek pemanasan global. Mari kita menjadi masyarakat Kabupaten Kubu Raya yang benar-benar peduli terhadap kelestarian hutan di Kabupaten Kubu Raya.

Sesuatu yang tidak akan ada habis-habisnya jika kita membicarakan tentang pemuda. Sejak Indonesia belum merdeka sampai Indonesia berhasil merebut kekuasaan dari tangan penjajah. Semua itu tidak lepas dari peranan seorang pemuda. Kita tentu masih ingat dengan kata-kata dari bung Karno yang berbunyi: “Berikan aku 10 pemuda maka akan ku guncang dunia.”

Pada kata-kata tersebut sudah jelas bahwa pemuda pada saat itu sangatlah berperan penting dan memiliki kekuatan yang sangat hebat dalam membangun dan mempertahankan Indonesia. Dengan begitu hebatnya seorang pemuda pada saat itu, patut untuk kita tiru dalam kehidupan kita sehari-hari. Namun, sayangnya pada masa sekarang ini sangat sedikit pemuda yang mau mencintai tanah airnya dengan sepenuh hati. Hal ini tercermin dari para pemuda yang lebih bangga mengenakan pakaian-pakaian yang berbau kebarat-baratan. Padahal pada kenyataannya budaya kita berbeda dengan budaya barat yang berpakaian kurang sopan menurut pandangan budaya di Indonesia. Selain itu pemuda pada saat ini juga tidak sedikit yang terjerumus dalam kehidupan yang gelap, mulai dari penggunaan narkoba, minum-minuman keras, sampai pada seks bebas. Semua ini membuktikan bahwa moral pemuda sudah tidak berada pada nilai-nilai yang berlaku. Jika moral pemuda terus seperti ini, maka dapat dipastikan bahwa moral yang berlaku pada masa yang

akan datang akan hancur dan juga akan mengakibatkan kerusakan pada identitas bangsa Indonesia. Maka marilah para pemuda Indonesia bangkit dan menyatukan tujuan untuk menyongsong masa depan bangsa yang lebih maju dan lebih indah lagi. Karena majunya bangsa ini ada di tangan kita semua sebagai generasi penerus bangsa. Jadilah pemuda yang membangun, bukan pemuda penghancur. Khozin Arwani Asrama Mahasiswa Kubu Raya.

+

M. Zuhri Ni’am Kadiv OP Primaraya.

Resah Café Kami warga Pasar Melayu Pemangkat sangat merasa terganggu dengan café karaoke di pemukiman warga tanpa izin yang cukup meresahkan. Kami sudah melapor ke Pemda, tapi tak mendapat respon positif. Kemana warga harus mengadu? (08990560014)

Perbatasan Padam Saya tinggal di batas, Entikong. Mengeluhkan listrik yang akhirakhir ini sering padam, bahkan dalam satu hari sampai 8 kali padamnya. Coba bayangkan, kalau rusak ya dibetulkan. Jangan hari-hari macam ini terus. Jangan listrik naik tapi pelayanannya tak bagus. (Yanty, 081348909930)

+

+

cmyk

C

m

y

k


12

Pontianak Post lSabtu 16 Maret 2013

Lenovo IdeaPad Yoga 13

Empat Sensasi dalam Satu Perangkat VARIAN baru diperkenalkan Lenovo pada Maret ini secara resmi adalah meluncurkan IdeaPad Yoga 13. Perangkat ultrabook multi mode pertama di dunia ini hadir menghadirkan empat sensasi dalam satu perangkat. Produk ini memungkinkan pengguna merasakan empat fungsi perangkat dalam satu produk sekaligus yakni laptop, tablet, stand, dan tent. Hadir dengan engsel yang

memungkinkan layar multi touch terbuka hingga 360 derajat. Produk yang dipajang di Mega Bazaar Computer (MBC) 2013 di Celebes Convention Centre (CCC) akhir pekan lalu itu menjadi salah satu pusat perhatian pengunjung. Visualnya tampak menakjubkan dengan dukungan layar IPS high definition 13,3-inci yang memberikan tampilan latar terang dan warnawarna cerah.

President Director PT Lenovo Indonesia, Sandy Lumy mengatakan kehadiran IdeaPad Yoga 13 untuk menjawab kebutuhan unik konsumen dengan menciptakan kombinasi laptop-tablet berkinerja tinggi dalam desain baru. Dia mendiskripsikan dalam penerbangan, pengguna bisa mengatur Yoga dalam mode tent, lalu duduk nyaman dan menikmati film. Saat di pantai mereka bisa bermain games

atau membaca buku dalam mode tablet. Perangkat ini didukung prosesor bertenaga hingga 3rd generation Intel Core i7 3517U, memori DDR3 4GB, penyimpanan SSD 128GB, grafis Integrated Intel HD 4000 dan Windows 8. Daya tahan baterainya bisa diandalkan menyelesaikan pekerjaan sepanjang hari berkat frame super tipis selama delapan jam. (nur/die)


Pontianak Post

Sabtu 16 Maret 2013

komunikasi bisnis

13

Advertorial

Launching CB150R Streetfire & Verza Sabtu, di Lapangan TVRI A.Yani

TANTANG nyalimu untuk merasakan performa sport motor berkelas dari Honda, CB150R Streetfire. Mau tau penampilan Motor Sport terbaru dari Honda? Ayo datang dan saksikan Launching Motor Sport terbaru dari Honda, yaitu CB150R dan Verza 150 di Halaman TVRI Jl. A. Yani, Sabtu, 16 Maret 2013. Jangan kaget dengan motor terbaru CB150R yang berkonsep naked-sport bike berperforma terbaik dengan mesin CBR150R dan mengepankan design sproty terdepan. Berbagai acara menarik di Launching Honda CB150R Streefire hadir untuk menemani Anda seperti Body Jeans Contest, Battle Dance Competition, Community Chef Contest, Modern Dancer, Acrobatic performance, DJ, serta masih banyak hiburan lainnya. Untuk body jeans contest, jangan ketinggalan penampilan pria-pria macho 6-packs dan wanita-wanita sexy dan sporty yang menampilkan keserasian fisiknya dalam nuansa body jeans. Berikutnya jangan ke­ tinggalan pula penampilan battle

DAUN Sirsak mengandung Acetogeniens Annonaceons (bahan kimia) alami yang sangat luar biasa sebagai zat yang ampuh untuk membunuh tumor dan selsel kanker yang mematikan, dan sifatnya tidak mengganggu sel-sel penting lainnya di dalam tubuh.. Acetogeniens Annonaceons yang ada di dalam daun sirsak mempunyai kekuatan sepuluh ribu kali lipat menghambat dan membunuh sel kanker, dibandingkan denganAdriamicin dan terapi kemo. Daun sirsak mengandung kandungan gizi dari senyawa alamiah yang membuktikan tanaman ini memiliki khasiat yang sangat luar biasa, karena dipengaruhi oleh senyawa aktif. Daun sirsak juga berfungsi sebagai anti bakteri, anti jamur, efektif melawan berbagai jenis cacing dan parasit, menurunkan tekanan darah tinggi, defresi, stress, menormalkan kembali sistem syaraf yang kurang baik dan penyakit degeneratif lainnya. Kulit manggis dan daun sirsak sudah dilakukan penelitian secara ilmiah yang lengkap, dalam hal ini belum ada untuk tanaman lain. Sudah banyak para pakar riset obat dari manca negara yang melakukan penelitian ilmiah terhadap daun sirsak dan kulit manggis, untuk menggantikan obat berbahan kimia, yang mana bila diminum dalam jangka waktu lama dapat menimbulkan masalah baru bagi si pemakai. Dari hasil penelitian para pakar riset obat, kalau di dalam kulit manggis mengandung Xantone atau se-

dance seperti yang disaksikan di film-film dance. Akan ada berbagai atraksi dance-dance yang cool abis serta menghebohkan di launching CB150R streetfire & Verza 150 ini. Bagi yang suka dance, jangan sampai menyesal jika tidak mengikuti acara ini. Acara lainnya? Masih banyak lagi yang menarik dan membakar nyali. Akan ada berbagai penampilan atraksi api streetfire serta freestyler. Biarkan adrenalinmu terpacu menyaksikan berbagai atraksi mendebarkan. Penasaran? Makanya siap-siap ke acara Launching Honda CB150R Streetfire & Verza 150 Sabtu ini. Jangan ketinggalan juga karena diacara launching ini akan bertabur berbagai quiz-quiz, games, serta doorprize dengan berbagai hadiah menarik seperti tablet, handphone, powerbank dan gadget keren lainnya. Acara ini terbuka untuk umum dan gratis! Fitur-fiturnya CB150R: Desain Terkini. Honda CB150R Streetfire mengusung desain ‘Speedy Shape’ berkarakter tajam, berkesan ramp-

ing dan ringan sebagai cerminan dari motor sport berperforma tinggi yang membangkitkan aura kecepatan.  Mesin 150cc Berperforma Tinggi. Honda CB150R Streetfire dibekali mesin 150cc, 4-Langkah, DOHC, 4-Katup, 6-Kecepatan, berbasis Honda CBR150R yang macho & kencang. Mesin berpendingin cairan telah menerapkan sistem suplai bahan bakar PGM-FI (Programmed Fuel Injection) ini menghasilkan performa mesin luar biasa, akselerasi terbaik di kelasnya sekaligus hemat bahan bakar dan ramah lingkungan (memenuhi standar emisi gas buang Euro-2). Rangka Truss Frame/Trellis. Model ini didesain menggunakan rangka inovatif tipe truss atau trellis yang ringan namun memiliki kekuatan yang tinggi. Rangka ini dirancang khusus untuk menunjang mesin, memaksimalkan kinerja sistem suspensi Pro-Link dan mengurangi getaran mesin secara optimal, sehingga menghasilkan kestabilan, kelincahan dan kenyamanan selama berkendara. Suspensi Pro-Link. Honda CB150R Streetfire mengadopsi salah satu fitur canggih model CBR250R, yaitu sistem suspensi belakang ProLink yang mampu menyesuaikan diri dengan berbagai kondisi jalan sehingga membuatnya lebih stabil dan nyaman. Untuk mengendalikan kecepatan, model ini sudah dilengkapi dengan rem cakram ganda yang menghasilkan tenaga pengereman maksimal di segala kondisi perjalanan. Model ini hadir dengan 4 pilihan warna, yaitu: Speedy White, Lightning White, Astro Black, dan Furious Red. Tantang Nyalimu dengan CB150R Streetfire. Jangan lupa saksikan launching CB150R dan Verza 150 ini di di Halaman TVRI Jl. A, Yani, Sabtu,16 Maret 2013! Honda-One Heart.(e9/biz)

Greenhill Residence 2 Tipe Emerald Penuhi Keinginan Konsumen, Hadirkan Rumah 2 Tingkat BERHASIL dalam cluster-cluster sebelumnya, Greenhill Residence 2 menghadirkan cluster baru, yaitu Tipe Emerald, rumah mewah 2 lantai. Sebelumnya, pengembang berhasil memasarkan 100% rumah Greenhill Residence tahap 1 dan untuk tahap 2, belum lama ini, perumahan Greenhill Residence Tipe Villagio juga sudah sold out. Kehadiran Tipe Emerald menjawab permintaan calon konsumen yang ingin rumah high end. Greenhill Residence 2 Tipe Emerald ini mulai diluncurkan hari ini, 16 Maret 2013. Lokasinya masih sama di Jl Parit H Husein 2 (Paris 2). Lokasi ini merupakan daerah aman dan nyaman untuk tempat tinggal. Letaknya strategis, dekat dengan Ayani Megamal, tempat ibadah, sekolah, pusat olahraga, dan rumah sakit. Daerahnya pun bebas macet dan bebas banjir. Kondisi ini menjadikan potensi nilai investasi Greenhill Residence tinggi. Tipe Emerald memiliki lima kamar tidur dan empat kamar mandi. Pondasinya mengunakan foot plate dan cerucuk 12 meter. Strukturnya beton bertulang. Dinding dan plaster mengunakan batako dan mortar MU, dinding dicat (double antar rumah). Lantai utamanya pakai keramik 60x60 cm dan keramik 33x33 cm. Kusen dan pintu mengunakan Angzdorr HDF Door (pintu utama) dan Angdorr WPC Door (kamar). Ground Tank-

nya enam meter kubik. Plaffon mengunakan Gypsum dicat rangka metal dan GRC Board dicat (teras). Atap mengunakan rangka metal dan seng metal. Listriknya 3.500 VA. Cluster terbaru yang ditawarkan ini juga memiliki Walk in Closet (satu ruangan khusus untuk lemari pakaian), pemanas air yang mengunakan tenaga surya (solar heater), serta shower untuk setiap WC. Greenhill Residence 2 Tipe Emerald menyediakan beragam fasilitas gaya hidup modern yang dibutuhkan. Tipe ini memberikan berbagai fasilitas pendukung, seperti playground, barbeque pit, taman besar, jogging track. Selain itu, untuk pengembangan ke depan cluster baru akan ditambah lapangan basket dan fasilitas lain. Keamanan pun stand-by 24 jam, dilengkapi dengan CCTV. Konsumen bisa mendapatkan harga promosi spesial untuk pembelian 10 unit pertama Tipe Emerald. Tipe ini dibangun sangat terbatas, hanya 37 unit. Siapa cepat siapa dapat. Jadi tunggu apa lagi, segera kunjungi Marketing Office-nya di Jl Teuku Umar, Komp. Pontianak Mall Blok A40. Bisa pula menghubungi Susi, marketing Executive-nya di 0561-7922299 atau 0561-7056617. Show unit bisa langsung dilihat di lokasi Greenhill Residence Jl Paris 2. Kritik dan saran, SMS ke 05617922233. (d1/biz)

Lomba Cipta Jingle & Maskot Pemilu Wako & Wawako Pontianak

Satu Keluarga Terbebas nyawa yang kurang lebih 50 jenis, yang merupakan anti oksidan tingkat tinggi. Bayak para peneliti kulit manggis membuktikan, kalau kulit manggis mengandung anti oksidan 17.000-20.000 Orac/100 ons, bila dibandingkan dengan bahan lain yang berkadar anti oksidan tinggi. Seperti wartel dan jeruk hanya 300 dan 2400, Orac mempunyai kemampuan anti okksidan menetralkan radikal bebas penyebab penyakit. Orac adalah singkatan dari oksigen radikal absorbance kapasiti bebas. Anda bisa bayangkan kalau satu keluarga mengalami masalah kesehatan. Kepala keluarga menderita rematik, sang istri sering pusing dan muntah-muntah serta anak semata wayang divonis dokter kanker payu dara. Semua aktivitas tentunya tidak akan berjalan lancar. Apakah ini kutukan? Hal ini yang dialami Daeng Baso sekeluarga di Makassar. Karena

keterbatasan biaya, mereka memilih terapi Erjun dari kulit manggis dan daun sirsak, yang Daeng Baso kenal di majalah kesehatan waktu nongkrong di warung kopi. Tuhan mendengar doa kami, karena kini kami sudah terbebas dan anak kami dinyatakan dokter, kanker payu daranya sudah tidak bermasalah. Minum Erjun, sangat bermamfaat untuk mempercepat penyembuhan dan mencegah berbagai penyakit. Erjun sudah beredar di Apotek (Apt) dan Toko Obat (TO) di Pontianak. Daerah Singkawang: Apt Merdeka, Apt Singkawang, Apt Asean dan TO Apollo. Ketapang: Apt Mulia, Lestari Farma dan TO Sumber Sehat. Sambas: TO Santos. Sub distributor Sanggau hubungi Hp. 082151255333. Untuk informasi dan yang ingin menjadi sub distributor di daerah hubungi Hp. 081 352 022 980.(d2/biz)

Pengobatan Sinshe Hongkong yang Manjur SINSHE Hongkong Pontianak yang beralamat di Jl. Agus Salim No. 126 Pontianak, merupakan pusat pengobatan penyakit kronis dengan metode herbal sinshe, ada konsultan sinshe ahli ternama dari Tiongkok, dengan herbal alami sinshe telah berhasil mengatasi penyakit banyak pasien penderita. Menggunakan paduan pengobatan tradisional herbal sinshe & resep ilmu pengetahuan modern, resep kuno kekaisaran, resep pengalaman, resep rahasia turun temurun, khusus mengobati berbagai penyakit bandel, penyakit kronis dan penyakit yang sudah lama diobati namun belum sembuh juga. Sinshe Hongkong Pontianak dalam mengobati berbagai penyakit jenis akut maupun kronis antara lain: asma, radang hidung, radang tenggorokan, bronchitis, emfisema paru dan penyakit lainnya menerapkan metode herbal sinshe yang sudah memiliki sejarah sekitar 2.000 tahun, mengkombinasikan pengalaman para ahli pengobatan kuno, penelitian dan terobosan baru, digabungkan dengan teknologi tinggi modern, melalui penelitian bertahun-tahun berhasil menciptakan terobosan terbaru

FOTO IST

TIPE EMERALD: Greenhill Residence 2 Tipe Emerald, rumah mewah 2 lantai, mulai diluncurkan hari ini.

Sinshe Hongkong, Satu-satunya di Pontianak Atasi Rinitis & Asma secara Efektif dan Sampai Keakar-akarnya

herbal alami yang sangat berkhasiat untuk mengobati berbagai macam penyakit radang hidung dan tenggorokan serta asma sampai ke akar-

akarnya, yakni “San Lian He Xiao Yan Fang Fa” dan “Yi Tian Ding Chuan San”. Metode pengobatan herbal sinshe ini memiliki hasil efektifitas yang sangat tinggi, persentase keberhasilannya sangat tinggi, tidak beracun, tidak memiliki efek samping, tidak peduli kondisi penyakit ringan/ parah, usia tua/ muda, riwayat penyakit panjang/ pendek, rata-rata begitu konsumsi obat herbal akan terasa khasiatnya, rata-rata diobati sekitar 3-7 hari semua gejala penyakit berangsur menghilang, dengan obat 2-3 tahap pengobatan bisa diatasi, sesudah diatasi tidak mudah kambuh. “Dapatkan program promosi khusus bagi yang datang berobat ke Sinshe Hongkong.” Untuk konsultasi dan pengobatan, hubungi: Sinshe Hongkong, Jl. Agus Salim No. 126 Pontianak, telepon: 0561-733268, 0821 52797 888 (Hari Minggu & libur tetap buka).(a2/bn)

AYO ikuti Lomba Cipta Jingle dan Maskot Pemilu Wali Kota dan Wakil Wali Kota Pontianak tahun 2013. Lomba dimulai sejak 13 Maret 2013 hingga 26 Maret 2013. Lomba ini terbuka untuk masyarakat umum, kecuali penyelenggara Pemilu Wali Kota dan Wakil Wali Kota Pontianak tahun 2013 dan panitia lomba. Kegiatan ini mengusung tema ‘Pemilihan Umum Wali Kota dan Wakil Wali Kota Pontianak. Rebut hadiah uang tunai untuk Juara 1 dan Nominator 2-5 dalam Lomba Jingle dan Maskot, pajak hadiah ditanggung pemenang. Jingle dibuat dalam bentuk notasi angka, lirik, dan musik pengiring dengan durasi 60-180 detik. Notasi angka dan lirik dicetak di atas kertas F4 putih 80 gram. Jingle yang sudah dikirim sudah termasuk musik pengiring. Soft copy Jingle disertakan dalam format MP3 dalam CD atau flash disk. Jingle wajib disertai deskripsi tertulis tentang makna Jingle tersebut pada kertas putih ukuran F4. Satu peserta diizinkan mengirim maksimal dua Jingle dalam amplop terpisah. Peserta diwajibkan melampirkan formulir pendaftaran yang dapat diunduh di www.kpupontianak.com, dan menyertakan foto copy KTM/SIM. Jingle harus

karya sendiri (original), belum pernah dipublikasikan dan belum pernah diikutsertakan pada lomba apapun. Sementara itu, Lombas Maskot, syaratnya. Maskot minimal dalam bentuk dua dimensi berwarna, namun masih tampak jelas apabilan difotocopy hitam putih. Dimensi maskot dibuat di atas kertas putih 100 gram ukuran F4 dan tanpa inisial, serta ditempel di atas karton tebal warna hitam. Softcopy maskot disertakan dalam format jpeg, gif, png, tiff dengan resolusi 72 dan 300 dpi dalam CD. Maskot wajib disertai deskripsi

tertulis tentang bentuk, warna, dan makna pada kertas putih ukuran F4. Maskot wajib hasil karya sendiri (orisinil), belum pernah dipublikasikan dan belum pernah diikutsertakan pada lomba mana pun. Satu peserta diizinkan mengirim maksimal tiga maskot dalam amplop terpisah. Peserta wajib melampirkan formulir pendaftaran, dapat diunduh di www.kpupontianak. com, dan menyertakan fotocopy KTP/SIM. Jingle dan Maskot harus dikirim langsung oleh peserta (tidak boleh diwakilkan) dalam amplop coklat tertutup. Pada sudut kiri atas ditulis Lomba Cipta Jingle Pemilu Wali Kota dan Wakil Wali Kota Pontianak tahun 2013 atau Lomba Cipta Maskot Pemilu Wali Kota dan Wakil Wali Kota Pontianak tahun 2013. Amplop di alamatkan kepada Panitia Lomba di Kantor KPU Kota Pontianak Jl Johar No.1A. Pengumuman pemenang melalui pemberitaan media massa dan di website: www.kpupontianak. com. Keputusan Panitia Lomba Jingle dan Maskot berlaku mutlak dan tidak dapat diganggu gugat. Dokumen dan materi lomba yang masuk menjadi hak dan milik KPU Kota Pontianak. (d1/biz)

Infeksi Ginjal, Ginjal Bengkak dan Bernanah

Sembuh Berkat Sarang Semut & Gami SAYA (Sudarmini) Lampung, sudah lama merasakan sakit yang luar biasa dibagian pinggang. Akhirnya saya memeriksakan diri ke dokter dan saya dinyatakan positif terkena infeksi ginjal, dibagian luar ginjal saya bengkak dan bernanah. Gejalanya itu pinggang sakit sekali sampai terasa ke kaki. Akhirnya saya disarankan oleh keponakan saya yang bekerja di Apotek Sido Waras Metro, untuk mengonsumsi Sarang Semut & Gami. Padahal, 2 minggu lagi saya akan dioperasi. Tetapi saya coba untuk mengonsumsi Sarang Semut dan Gami PT. Prima Solusi Medika. Setelah 2 minggu saya periksakan lagi ke dokter, ternyata saya dinyatakan sembuh, saya tidak jadi dioperasi. Puji syukur keadaan saya sekarang jauh lebih baik dan lebih prima. Terima kasih Sarang Semut PT. Prima Solusi Medika. Info Penjualan Sarang Semut & Gami di Kalimantan Barat hubungi telepon: 0852 4596 1665. Info produk: 0821 1154 8616. Atau diperoleh di Apt Amelia (Sei Raya), Apt Antara (Jl. Adi Sucipto), Apt Bersama (Jeruju), Apt Gajah Mada (Jl. Gajah Mada), Apt Kharias Bakti (Jl. Siam), Apt Makmur II (Jl. Gajah Mada), Apt Mandiri I (depan RS. Antonius.0), Apt Mandiri II (Jl. Penjara). Apt Mega Sari Farma (Jl. Veteran),

Apt Merdeka Timur (Jl. Hos Cokroaminoto), Apt Sejahtera (Tanjung Hulu), Apt Siantan Jaya (Siantan), Apt Nusa Indah (Jl. Nusa Indah III Pontianak). Apt Sui Raya Dalam (Sei Raya Dalam), Apt Therapy (Jl. Danau Sentarum), Toko Obat 168 (Jeruju), Toko Obat Asia (Jl. Gajah Mada), Toko Obat Batara (Sei Raya Dalam), Toko Obat Ericia (Kobar), Toko Obat Hidup Sehat (Flambooyan), Toko Obat Jenaka (Jl. Penjara), Toko

Obat Kapuas (Seroja), Toko Obat Labora (Jl. Husin Hamzah), Toko Obat Semi Abadi (Jl. Batanghari), Toko Obat Sinar Abadi I (Jl. Gajah Mada), Toko Obat Sinar Abadi II (Jl. Gajah Mada). Konsultasikan kondisi Anda ke nomor: 0821 1154 8616 untuk mendapatkan hasil optimal. Untuk mendapatkan testimoni lengkap pengguna produk ini silakan klik di www.primasolusimedika.com. (a2/bn)


14

opini

Pontianak Post

Sabtu 16 Maret 2013

Paus Fransiskus I: Menjinakkan Bom Waktu Konflik Sawit Si Papa & Si Bintang Cemerlang KARDINAL Jorge Mario oleh jual kain-kain yang maBergoglio, SJ (76 th) dari hal di gudang simpanan Leo Sutrisno Argentina pada tanggal 14 milik ayahnya. Uang hasil Maret 2013 terpilih menjadi penjualan kain digunakan Paus-pemimpin 1,2 miliar untuk memperbaiki gereja umat Katolik sedunia yang ke-266. Banyak yang hampir roboh. Ia diusir dan pergi pengamat merasa terkejut dengan hasil tanpa bekal apa pun. Selanjutnya hidup kepemilihan itu karena tidak diunggulkan sama seharian Fransiskus Asisi adalah memintasekali oleh media massa. Inilah sebuah minta dan mewartakan penebusan Jesus ke rahasia iman yang harus diterima tanpa masyarakat sekitarnya. Ia mengikuti jejak pertanyaan. Jesus dengan hidup bebas dari segala ikatan Ia menjadi anggota Ordo Serikat Jesus harta. Semangat persaudaraan, kesederha(SJ) yang pertama terpilih sebagai Paus. Ia naan, samadi dan berdoa merukana cara orang pertama yang berasal dari luar Eropa hidup kelompok religius yang dibentuknya, terpilih sebagai Paus sejak Paus Gregorius Ordo Saudara-suadara Hina-dina. Salah III asal Suriah pada abad kedelapan. Ia juga satu di antaranya adalah Ordo Saudara memilih nama kepausannya Fransiskus I. Ia Hina Dina Fransiskan Kapusin (OFM. Cap) dilahirkan pada 17 Desember 1936, sebagai yang ada di Keuskupan Agung Pontianak. anak pertama dari keluarga menengah di Tanda lahir kelompok ini adalah jubah Argentina. Assosiated Press mengabarkan coklat dan menggunakan tali ikat pinggang. bahwa ia sudah 50 tahun hidup dengan satu Lambang kesederhanaan. paru-paru. Dikabarkan juga bahwa ia adalah Di pihak lain Paus Fransiskus I ini anggota kardinal yang paling tua dari calon-calon Ordo Serikat Jesus (SJ). Ordo ini didirikan oleh yang paling mungkin menjadi Paus dalam St. Ignasius dari Loyola. Ignasius Loyola adapemilihan kali ini. lah putra bungsu dari keluarga bangsawan Sejarah gereja menyebutkan, seusai dari Basque, Spanyol. Seperti St. Fransiskus menyandang gelar master di bidang Kimia dari Asisi (Italia), di masa mudanya ia juga dari Universitas Buenos Aires, Bergoglio menikmati kehidupan yang serba mewah. bergabung ke Seminari Villa Devoto dan Ignasius Loyola pernah menjadi tentara. Ia masuk Ordo Serikat Jesuit pada 1958. Me- mendirikan serikat rohaniwan dengan nama megang gelar di bidang filsafat dari Colegio Serikat Jesus (SJ). Serikat ini mendasarkan Maximo San Jose di San Miguel, Bergoglio diri pada tiga kaul: kemiskinan, ketaatan dan sempat mengajar studi literatur dan psiko- kemurnian dan ditambah satu kaul khusus, logi di Kolese de la Inmaculada di Santa Fe, yaitu kesigapan untuk melaksanakan perinBuenos Aires. Sesudah itu, dia belajar filsafat tah di mana saja dan kapan saja. Anggota SJ dan teologi di seminari San Miguel. Dilan- sering disebut sebagai ‘prajurit’ Kristus. jutkan pengabdiannya sebagai pengajar di Dalam pelayanannya, serikat ini banyak seminari ini sampai mendapat gelar profesor. bergerak dalam bidang pendidikan. Karena Pada 1980, dia menjadi rektor seminari San itu, bangak anggota Serikat Jesus yang menyMiguel hingga 1986. Gelar doktornya diraih andang gelar guru besar, seperti Paus Fransdi Jerman. iskus I yang baru terpilih ini. Latihan rohani Pelayanan gereja Bergoglio dimulai pada yang dikembangkan oleh Ignasius Loyola 1973. Jorge Mario Borgoglio pernah menjabat sangat berpengaruh sampai hari ini sebagai sebagai Uskup Agung Buenos Aires, Argen- model penggemblengan karakter orang tina, 1998 - 2012. Karena pertimbangan usia muda. Dalam badan yang kuat terkandung ia mengundurkan diri dari jabatan ini. Pada jiwa yang kuat. Orang tidak cukup menjadi 2001, dia dipromosikan menjadi kardinal. baik (mengasihi diri sendiri dan sesama), Kardinal Bergoglio dikenal sebagai sosok tetapi juga kompeten (memiliki keahlian/ yang rendah hati dan sederhana. Dia tinggal ketrampilan tertentu) sehingga hidupnya di apartemen kecil, alih-alih menempati berarti. Ia mesti mampu bersinar bagai kediaman resmi uskup. Dia memasak bintang. makanannya sendiri. Serta lebih banyak Tampaknya, Paus yang baru saja terpilih menggunakan bus umum dari pada kenda- ini, memilih nama kepausannya Fransiskus I raan pribadi sebuah limosin. Pilihan nama untuk mengisyaratkan akan kesederhanaan, kepausan Fransiskus I mengirimkan isyarat kerendahan hati serta kesigapannya untuk akan keberpihakannya kepada kaum papa, secara cemerlang mengemban pelayanan kaum miskin yang hina dina. Nama ini di bagi semua orang. Ia menjadi gabungan ambil dari nama St. Fransiskus dari Asisi. St. antara si papa dan si bintang cemerlang. Ia Fransiskus dari Asisi (Italia) dikenal sebagai bagai si papa yang selalu siap sedia melakaanak dari keluarga kaya raya. nakan tugas. Karena itu, ia mampu menjadi Pada usia 26 tahun, ia kedapatan men- pelindung bagi semua orang. Semoga! **

Pontianak Post

BANYAK sumber konflik yang harus diantisipasi agar tidak menjadi bom waktu yang bisa meledak kapan saja. Masalah perkebunan yang selama ini terjadi diantaranya adalah lahan, tumpang tindih lahan, ganti rugi, tumpang tindih perizinan, maupun pembangunan kebun plasma (Pontianak Post, Sabtu, 23 Februari 2013). Persoalan di atas memang harus segera diantisipasi kalau kita memang ingin agar bom itu tidak meledak kapan saja. Namun, yang tak kalah pentingnya adalah agar pihak perusahaan dan pemerintah juga mau belajar dan melihat kembali alur ketika perusahaan masuk serta penyelesaian-penyelesaian konflik pada masa lalu. “Niat baik” para investor dan pemerintah juga kini ditunggu banyak pihak terutama kalangan masyarakat. Karena hanya dengan mau belajar, ditambah lagi dengan “niat baik” para investor dan para pengambil kebijakan, maka bom waktu konflik sawit itu setidaknya bisa dijinakan. Persoalan bom waktu konflik sawit bermula dari tidak adanya penghargaan secara fakta untuk orang kampung. Dalam banyak kasus, sulit untuk tidak mengatakan kalau proses ekspansi perkebunan sawit memang cenderung telah melakukan penggusuran wilayah adat di kampung tanpa izin, menggusur kebun karet, tembawang/ pedahasan, ladang dan pekuburan, juga mengumbar janji. Padahal, kenyataannya pada pihak masyarakat kampung justru sebaliknya, yakni mereka sebelumnya sudah menyatakan menolak keberadaan perkebunan sawit di kampung mereka. Perihal ganti rugi lahan yang telah digusur juga tak jarang menjadi bahan perusahaan untuk berkelit. Versi mereka (pihak perkebunan sawit) merasa sudah membayar ganti rugi. Namun hal sebaliknya dirasakan oleh warga kampung. Warga kampung memang tidak merasa menyerahkan lahan untuk perkebunan sawit. Mereka tidak menyerahkan lahan/tanah itu karena memang sudah menanaminya dengan karet atau tanaman buah. Hal lain adalah strategi yang digunakan oleh pihak perusahaan yang kemudian berimbas pada keresahan masyarakat, saling curiga antara satu dengan yang lainnya, bapak

berkelahi dengan oleh lihan penyelesaian anak/ponakan, konflik seperti ini Andika Pasti perkelahian adik biasanya bermula beradik, paman verketika pihak perusus ponakan dan sahaan tidak mau sebagainya terkait lahan. Dalam melakukan proses musyawarah banyak kasus, pihak perusahaan atau perundingan, serta peran menggunakan strategi mencari dari pihak pemerintah yang hanya kelompok yang menyenangi peru- membuat janji-janji akan diikutsahaan untuk menekan kelompok sertakan dalam perusahaan sawit. yang tidak menerima perusahaan. Akibatnya bom waktu konflik keRasa keadilan masyarakat juga mudian makin berlarut-larut dan kadang terusik terutama bagi mer- siap meledak kapan saja. eka yang masih menjunjung tinggi Terkait dengan hal tersebut, ada norma dan hukum adat. Karena beberapa hal yang kiranya bisa tak jarang, ketika proses penyele- dilakukan. Pertama; pada upaya saian konflik sudah diselesaikan pencegahan konflik, para pihak secara hukum adat, namun dalam yang berkaitan dengan investasi prakteknya masih saja ada pihak perkebunan sawit harus memperusahaan yang tetap melapor- buka diri dan saling membangun kan warga ke ranah hukum tertulis. kesepakatan bersama yang diPenyelesaian-penyelesaian konflik dasari atas semangat keterbukaan sawit melalui cara-cara pidana dengan masyarakat. Masyarakat ini, kalau bisa disimpulkan adalah harus mengetahui sebenar-benar deretan cerita kegagalan. Sedikit dan seterang-terangnya tentang sekali kasus yang dibawa ke meja hak dan kewajiban mereka ketika hijau yang berhasil dimenangkoleh perkebunan sawit masuk. Begitu masyarakat. pula dengan pihak perusahaan dan Dalam banyak kasus, masyarakat pemerintah daerah. Mereka harus masih selalu memberikan ruang tahu apa yang harus atau tidak untuk mengakhiri dan menghindari harus dilakukan untuk masyarakat konflik. Ruang yang diberikan itu di kampung. Setidaknya janganlah kebanyakan memang dilakukan mengusik lahan-lahan mereka. dengan cara-cara kultural yakni Kedua; niat mengeruk keuntunmelakukan musyawarah, perund- gan sebanyak mungkin dan meningan atau pelaksanaan hukum gumbar janji harusnya bukan lagi adat dengan pihak perusahaan. menjadi patokan pihak perusahaan. Namun perlu juga dicatat bahwa Namun yang lebih penting adalah tak jarang dalam penyelesaian bagaimana mereka memiliki dan konflik masyarakat ada yang memi- menerapkan etika dalam bertinlih untuk mengambil alih tanah, dak di kampung-kampung secara menduduki dan membakar kantor- nyata. Keberhasilan yang hanya kantor perusahaan, atau menahan dihitung berdasarkan keuntungan alat-alat berat milik perusahan. Pi- dan angka-angka keuangan tidak

akan mampu membesarkan dan melestarikan, malahan akan semakin jauh dari prinsip pengelolaan lingkungan atau prinsip pembangunan berkelanjutan. Ketiga; sikap hukum dan niat baik dari pemerintah daerah, kepolisian dan kejaksaan terhadap perusahaan harusnya sama dengan yang diperlakukan terhadap laporanlaporan masyarakat. Persamaan di depan hukum mesti ditegakkan. Dan pendekatan yang menghargai kepentingan masyarakat di kampung harusnya jauh lebih penting dan dikedepankan oleh setiap investasi perkebunan sawit. Karena dengan memahami kondisi konkrit masyarakatnya, kalaupun ada konflik maka akan bisa diselesaikan melalui musyawarah mufakat dan tidak melulu melaporkan masyarakat ke ranah hukum tertulis dan memenjarakan mereka. Keempat; pengakuan secara de facto di lapangan. Kelima; sebaiknya pula upaya-upaya yang dilakukan lebih pada perubahan program perkebunan kelapa sawit yang sekarang ini terlalu ekspansif dan meninjau ulang izin-izin yang sudah diberikan untuk mencegah perluasan baru yang merugikan hutan dan masyarakat adat. Semoga kita bisa turut serta menjinakkan potensi bom waktu konflik sawit itu. Namun alangkah bagusnya pula, jika kita dikemudian hari telah mampu untuk tidak menghadirkan/menciptakan lagi bom waktu konflik sawit itu sendiri. * *Pemerhati budaya tinggal di Kota Pontianak

Ilustrasi: Kekes

Terbit 7 Kali Seminggu. Izin terbit Menteri Penerangan RI No. 028/SK/Menpen/SIUP/A7. Tanggal 3 Februari 1986. Per­setujuan Peru­bahan Nama No: 95A/Ditjend. PPG/K/1998 Tanggal 11­September 1998. Alamat Redaksi dan Tata Usaha: Jalan Gajah Mada No. 2-4 Pontianak 78121. Kotak Pos 1036. Fax. (0561) 760038/575368. Telepon Redak­si: (0561) 735070.Telepon Iklan/Pema­saran:735071. Hunting (Untuk seluruh bagian) Fax. Iklan 741873/766022. Email: redaksi@pon­tianakpost.com. Penerbit: PT.Akcaya PERTAMA DAN TERUTAMA DI KALIMANTAN BARAT Utama Press Pontianak. Pembina: Eric Samola, SH, Dahlan Iskan. Komisaris Utama: Tabrani Hadi. Direktur: Untung Sukarti. Pemimpin Re­daksi/Penang­gung Jawab: B Salman. Redaktur Pelaksana: Khairul­rahman, Muslim Minhard, Donatus Budiono, Basilius. Sidang Redaksi: Abu Sofian, Surhan Sani, Mela Danisari, Yulfi Asmadi, Andre Januardi, Mursalin, Robert Iskandar, Efprizan. Sekre­taris Redaksi: Silvina. Staf Redaksi: U Ronald, Deny Hamdani, Budianto, Chairunnisya, M Kusdharmadi, Hari Jawa Pos Group Kurniatama, Hendy Irwandi, Pracetak/Artistik: Mochsinin (Koordinator), Grafis: Sigit Prasetyo, Ilustrator: Kessusanto. Fotografer: Timbul Mudjadi, Sando Shafella. Biro Singkawang: Zulkarnaen Fauzi (Jl. Gunung Raya No.15 Telepon (0562) 631912). Biro Sambas: Hari Kurniatama (Jl P Anom Telp (0562) 392683) Biro Sanggau: Sugeng (Jl. Sudirman No. 4 Telp. (0564) 21323). Biro Ketapang: Asri Isnaini, (Jl. Gajahmada No. 172. Telp. (0534) 35514). Kabupaten Pontianak: Hamdan, . Biro Sintang: Sutami. Pema­saran/Sirkulasi: Kiki Fredrik S; Iklan: Dewiyanti.S. Percetakan: Surdi. Devisi Event: Budi Darmawan. Jakarta: Max Yusuf Alkadrie. Harga Lang­ganan per 1 Bulan dalam kota Rp 80.000,- (luar kota tambah ongkos kirim). Tarif iklan: Per mm kolom hitam putih Rp 40.000,- full colour Rp 50.000,- Iklan baris Rp 15.000,- per baris (minimal 2 baris, mak­­si­mal 10 baris) pem­bayaran di muka. Telepon Langganan/Pengaduan: 735071. Iklan: 730251. Perwakilan Jakarta: Jl. Jeruk Purut-Al-Ma’ruf No.4 Pasar Ming­gu, Jakarta Selatan 12560. Telepon: 78840827 Fax. (021) 78840828. Percetakan: PT.Akcaya Pariwara Pontianak. Anggota SPS-SGP ISSN 0215-9767. Isi di luar tanggung jawab percetakan.


Pontianak Post

Sabtu 16 Maret 2013

aneka pontianak

PMI Siapkan 20 Ribu Masker Sambungan dari halaman 9

“Kami melihat kabut asap sudah mulai banyak dan ini meresahkan masyarakat. Oleh sebab itu, kami berinisiatif membagikan masker. Hari ini ada 5 ribu masker yang kita bagikan kepada para pengguna jalan yang melintas,” ungkap Kepala Markas PMI Provinsi Kalbar, M Suhardi saat membagikan masker. Meski bukan jaminan bagi penggunanya untuk tidak terserang infeksi saluran pernapasan dan gangguan kesehatan lainnya, dia menyebut pemakaian masker dapat mengurangi potensi tersebut. “Masker ini bisa menutup dan menyaring partikel-partikel kecil yang timbul dari kabut asap itu agar tidak terhirup manusia,” kata dia. Sementara itu, Anggota Pengurus PMI Kalbar, Hadi Sumaryadi menyebut PMI setiap tahunnya rutin membagikan masker di musim kemarau. Pasalnya, kemarau di Kalbar, bukan saja menimbulkan gerah, namun juga hampir pasti diiringi kabut asap. Sudah tradisi musim kering banyak digunakan orang untuk menggelar pembakaran lahan gambut. Sementara ini, PMI Kalbar telah menyiapkan lebih dari 20 ribu masker untuk dibagikan secara cuma-cuma kepada masyarakat. “Kita tidak akan berhenti sampai di sini saja.

Tapi akan berkesinambungan ke daerah-daerah lain. Kita masih menunggu PMI Kubu Raya, karena di sana banyak titik-titik api yang menyebabkan kabut asap yang tebal,” tandas dia. Putra, salah seorang pengguna jalan mengaku pembagian masker tersebut cukup bermanfaat. Namun paling penting menurutnya adalag menghentikan aktifitas pembakaran lahan. “Saya kalau tidak dibagikan, tidak kepikiran kalau mau beli. Sebenarnya penting (pakai masker), karena sekarang lagi banyak asap. Setiap tahun seperti ini, harusnya pembakaran lahan itu ditindak,” ujarnya. Kabut asap sendiri makin meningkat dalam beberapa terakhir ini, dan kemungkinan akan terus terjadi hingga musim kemarau berakhir. PMI mengingatkan warga untuk menggunakan masker apabila sedang berada di jalan dalam kondisi kabut asap. Pasalnya di saat-saat itu ISPA rentan menyerang. Tindak Pembakar Lahan Sementara itu, Anggota DPRD Provinsi Kalbar, HM. Ali Akbar meminta dinas teknis dan pihak terkait memantau sebaran titik api (hot spot) yang menyebar merata di Kalbar. Jangan sampai ditemukan titik api akibat ulah oknum tak bertanggung jawab. ”Misalnya oknum perusahaan atau oknum tak bertanggung jawab. Kita minta ditangani

Udara Sangat Tidak Sehat dan diberikan peringatan keras. Namun kalau untuk petani kecil sebaiknya diberikan teguran,” katanya, Jumat (15/3) di Pontianak. Menurutnya, ada sanksi hukum yang dapat diterapkan kepada mereka pembakar hutan atau lahan secara sengaja. Sanksi-sanksi tersebut diantaranya undang-undang nomor 41/1999 tentang kehutanan, UU Nomor 23/1997 tentang lingkungan hidup dan UU Nomor 18/2004 tentang perkebunan. Dimana ancaman hukumannya mulai dari penjara hingga denda. “Bagi yang tak mengindahkan, berikan tindakan keras,” ucap dia. Tindakan tegas dan keras bagi pihak pembakar lahan dimaksudkan untuk menimbulkan efek jera. “Kalau sekarang belum tampak ketegasan itu. Aparat hukum harus serius dan komit menindak pelaku pembakaran lahan. Kalau benar bersalah, harus ditindak,” ungkapnya. Politikus PPP Kalbar ini meminta kepala daerah kabupaten atau kota di Kalbar yang banyak ditemukan titik api harus secepatnya melakukan pemantauan. Apalagi, daerah investasi yang banyak memiliki investor perkebunan sangat rentan. Soalnya, di Kalbar pembukaan areal pertanian dan perkebunan dengan cara tradisional seperti menjadi hal lumrah. ”Padahal efek yang ditimbulkan cukup tinggi, khususnya bagi daerah tersebut,” ucap dia.(ars/den)

Perjuangkan Kaum Hawa Sambungan dari halaman 9

PPSW berharap legislator perempuan di DPRD Kota Pontianak dapat membantu mendorong setiap kebijakan untuk kepentingan kaum hawa. “Sebelumnya kami sudah dengar pendapat dengan dewan, tapi baru sekarang sempat bertemu dengan anggota dewan yang perempuan,” katanya. Koordinator Program PPSW

Borneo, Rosmaniar mencatat banyak hal yang perlu ditingkatkan pemerintah termasuk di dalamnya dukungan legislatif terhadap perempuan. Dicontohkannya, dari segi usaha mikro kecil dan menengah (UMKM) yang masih sulit diakses oleh perempuan, terutama dalam permodalan. Bunganya pun dinilai berat. “Dana bergulir tersebut tidak tepat sasaran, masih terjadi nepotisme. Belum ada juga

kebijakan terhadap kepala keluarga perempuan di daerah,” katanya. Kebijakan Pemerintah Pusat juga dikritik Rosmaniar. Program Nasional Pemberdayaan Masyarakat (PNPM) Mandiri Perdesaan dan PNPM Perkotaan membuat kecemburuan sosial. “Pada PNPM Perdesaan ada simpan pinjam perempuan, namun di perkotaan tidak ada,” ujarnya. (hen)

Pendidikan Terbelit Anggaran Sambungan dari halaman 9

Terakhir, adanya temuan pembangunan tujuh sekolah dasar dan menengah pertama satu atap tahun 2010-2011 di Kabupaten Sambas berindikasi kerugian negara sebesar Rp636,49 juta. Rizal menuturkan BPK turun ke beberapa daerah untuk mengetahui permasalahanpermasalahan bidang pendidikan yang mengakibatkan terjadinya temuan. Lembaga tersebut menggelar workshop yang diikuti pemerintah kabupaten dan kota bersama elemen pendidikan. ”Nantinya temuan-temuan kami di lapangan akan disampaikan langsung kepada Mendikbud,” katanya. Deputi Pencegahan Komisi Pemberantasan Korupsi (KPK), Iswan Elmi menjelaskan Indeks Persepsi Korupsi Indonesia pada 2012 adalah 32, atau berada di peringkat 118 dari 176 negara yang disurvei pada tahun tersebut. Indeks Indonesia tersebut sejajar posisinya dengan Republik Dominika, Ekuador, Mesir, dan Madagaskar. ”Banyak pengaduan masyarakat terkait indikasi korupsi dari 2004 hingga 2012. Totalnya 57.964 pengaduan. Pada 2012 sebanyak 6.344 pen-

gaduan,” jelas Iswan di Pontianak, baru-baru ini. Khusus di Kalbar, terdapat sebanyak 951 surat pengaduan masyarakat sepanjang 2004 hingga 2012. Rinciannya pada 2004 sebanyak 58 pengaduan, 2005 sebanyak 148 pengaduan, 2006 sebanyak 109 pengaduan, 2007 sebanyak 79 pengaduan, 2008 sebanyak 156 pengaduan, 2009 sebanyak 119 pengaduan, 2010 sebanyak 80 pengaduan, 2011 sebanyak 99 pengaduan, dan 2012 sebanyak 103 pengaduan. Iswan menjelaskan berbagai upaya dilakukan dalam melakukan pemberantasan korupsi. Diantaranya melalui koordinasi dan supervisi pencegahan. ”Ada beberapa hasil pengamatan melalui koordinasi dan supervisi pencegahan di Kalbar terkait bidang pendidikan,” ungkap Iswan. Hasil pengamatan koordinasi dan supervisi di Dinas Pendidikan menunjukkan masih ada proses lelang pada instansi tersebut yang dilakukan manusia. Layanan Pengadaan Secara Elektronik hanya digunakan untuk mengumumkan paket pekerjaan yang akan dilelangkan. Pengamatan lainnya menemukan adanya pemenang pengadaan buku SMP untuk daerah perbatasan atau ter-

pencil tidak pernah mendaftar untuk mengikuti lelang atau tender. Calon pemenang kedua menggunakan alamat palsu, dan HPS tidak didasarkan pada harga pasar yang wajar. Selain iu, pengadaan jasa konsultansi perencanaan pelaksanaan tryout ujian SMA/SMK tahun 2012 oleh bimbingan belajar dari Binjai Sumatera Utara dengan penunjukkan langsung, jasa tersebut tersedia di Pontianak. Komisi Pemberantasan Korupsi juga menemukan adanya pengadaan buku mata pelajaran untuk SD di perbatasan dan daerah terpencil diindikasikan harganya terlalu tinggi dan tidak sesuai kebutuhan, sehingga buku tidak dimanfaatkan. ”Strategi KPK lima tahun kedepan menyangkut keuangan, pendidikan, dan kesehatan. Kami berkoordinasi dengan Dirjen Kementerian Pendidikan dan Kebudayaan, Kemendagri, BPKP, dan Kementerian Keuangan, serta Kemenag untuk menentukan langkah kedepan,” ungkap Iswan. Pada tahun ini, lanjut Iswan, pihaknya akan mengawal dana di sektor pendidikan yang mencapai Rp220 triliun. ”Kami akan menelusuri bagaimana mengalir, penggunaan, dan pertanggungjawabannya,” kata Iswan. (uni)

Pekan Terakhir Maret, Cuaca Tidak akan ... Sambungan dari halaman 9

Tanggal 21-23 Maret dan 21-23 September. Menjelang fenomena tersebut, perubahan cuaca sudah mulai terasa. Selepas musim penghujan di antara Bulan Oktober hingga Desember, di bulan Januari, matahari akan berada di posisi selatan. Kira-kira sampai 23 derajat di posisi lintang selatan. Kemudian di bulan Februari, ulas Sutikno, Matahari akan menuju ke utara dan akan semakin rendah lagi. Dan di bulan Maret, Matahari akan mulai menuju ke lintang nol derajat. “Saat itulah terjadi fenomena Matahari tepat berada di atas kepala. Di daerah Khatulistiwa proses terjadinya fenomena titik kulminasi sangat menarik untuk disaksikan. Manusia dan benda lainnya tanpa bayangan, karena Matahari tepat berada di atas kepala,” jelas dia. Ditambahkannya, usai fenomena titik kulminasi yang terjadi selama kurang lebih tiga hari, cuaca di kota ini akan mulai berubah. Biasanya selepas itu, kata dia, tepatnya di akhir minggu terakhir bulan Maret cuaca tidak

akan panas lagi. Karena akan ada perubahan cuaca dari panas ke hujan. “Akan terjadi banyak hujan. Itulah musim pancaroba tiba,” jelas dia. Perubahan cuaca dari panas ke hujan, ungkap Sutikno, memang akan terasa tak hanya di bulan itu saja. Di bulan Oktober dan Desember juga akan terjadi musim pancaroba atau peralihan musim dari kemarau ke penghujan. Pancaroba, ulas dia, dipengaruhi oleh tiga jenis iklim yang ada di Indonesia. Pertama iklim musim (muson), iklim tropica (iklim panas), dan iklim laut. Iklim muson sangat dipengaruhi oleh angin musiman yang berubahubah setiap periode tertentu. Satu periode biasanya terjadi selama enam bulan. Kedua adalah iklim tropis. Menurut Sutikno, iklim ini umumnya terjadi di wilayah Asia Tenggara dan hanya memiliki dua musim yaitu musim kemarau dan musim hujan. Ketiga adalah iklim laut, yang terjadi di negara kepulauan yang memiliki wilayah laut yang luas sehingga penguapan air laut menjadi udara yang lembab dan mengakibatkan curah

15

hujan yang tinggi sering terjadi. “Namun beberapa tahun terakhir, perubahan iklim dirasakan sedikit berubah,” ungkap dia. Menurut Sutikno, siklus peralihan musim pada umumnya terjadi setiap enam bulan sekali. Sekalipun terjadi perubahan dalam siklus pergantian musim (pancaroba), tidak akan mengalami pergeseran yang cukup signifikan. Menurutnya, transisi peralihan musim itu hanya satu atau dua bulan lebih cepat atau sebaliknya. Masa peralihan dari musim hujan ke kemarau biasanya terjadi sekitar bulan Maret-April, sementara peralihan dari musim kemarau ke hujan sekitar bulan September-Oktober. Dia menyarankan agar masyarakat saat ini terus menjaga kondisi, karena perubahan cuaca seperti itu menyebabkan udara kurang baik. “Saat ini, kondisi cuaca memang sudah kurang baik bagi kesehatan. Kondisi cuaca ekstrem seperti ini membuat orang gampang terkena penyakit. Saya menyarankan agar masyarakat lebih menjaga kesehatannya,” saran dia. (*)

Sambungan dari halaman 9

“Pengguna alur pelayaran Sungai Kapuas harus hatihati, pada malam hari jarak pandang sangat pendek,” ujarnya. Tujuh Penerbangan Ditunda Kabut asap juga menyebabkan sejumlah penerbangan di Bandara Supadio Pontianak terganggu. Sedikitnya tujuh penerbangan pada pagi kemarin mengalami penundaan penerbangan akibat kabut asap tebal yang menyelimuti bandara. Sejumlah pesawat yang sedianya mendarat mulai pada pukul 07.10 harus ditunda hingga pukul 09.30. General Manager Angkasa Pura II Bandara Supadio Pontianak Chandra Dista Wiradi mengatakan, jarak pandang (visibility) pada pagi kemarin hanya sekitar 600 meter. Padahal jarak pandang minimal dalam pendaratan minimal 900 meter.

“Kami terpaksa tidak izinkan pesawat mendarat. Ini demi keselamatan penumpang. Kami ijinkan pendaratan setelah jarak pandang bagi penerbangan,” jelas Chandra saat ditemui di ruangannya, kemarin (15/3). Sejumlah pesawat yang mengalami penundaan penerbangan antaralain Sriwijaya, Lion, Garuda Indonesia, Kalstar, dan lain-lain. Penundaan yang terjadi pada pagi hari juga berpengaruh pada jadwal penerbangan setelahnya. “Jadwal penerbangan jadi mundur semua,” jelasnya. Kabut asap sendiri mulai menganggu penerbangan selama satu pekan terakhir. Namun yang cukup pekat terjadi pagi kemarin. Dari pantauan Pontianak Post, pada pukul 10.00 kabut tipis masih menyelimuti bandara. “Tadi pagi jam 07.00 tower bandara saja tidak kelihatan,” katanya. Kabut asap menjadi persoalan tersendiri bagi warga

Kalbar, terutama bila hujan tak turun dalam beberapa waktu. Kabut asap tidak hanya mengganggu penerbangan, namun juga transportasi air. Jarak pandang yang sangat dekat membahayakan kapalkapal di Sungai Kapuas. Aktivis lingkungan Deman Huri Gustira mengatakan, kabut asap menjadi masalah klasik di Kalbar yang hingga saat ini belum mampu diatasi. “Ini jadi masalah klasik. Sebab pemerintah tidak tegas pada mereka yang membakar lahan. Ada indikasi pembakaran lahan oleh perkebunan sawit. Itu mestinya diselidiki,” katanya. Sementara itu, dari pantauan Pontianak Post kemarin sore, wilayah Kota Pontianak sudah diguyur hujan sekitar 15 menit. Sayangnya, meskipun hujan tersebut cukup deras, turunnya tidak merata. Adapun lokasi yang sempat tersiram air hujan antara lain di kawasan Pontianak Timur. (hen/her)

Minim Yayasan Fardhu Kifayah Sambungan dari halaman 9

Yayasan Shabli Al-Banjari ini dilengkapi dengan ruangan untuk tempat fardhu kifayah, satu unit mobil ambulan dan satu motor air. Walikota Pontianak, Sutarmidji yang meresmikan Yayasan Shabli Al-Banjari ini mengakui, yayasan yang bergerak di bidang fardhu kifayah dan sosial kemasyarakatan di Kota Pontianak sangat terbatas. Untuk itu, Pemerintah Kota (Pemkot) Pontianak sangat mendukung keberadaan yayasan-yayasan fardhu kifayah serta yayasan yang bersifat sosial kemasyarakatan lainnya. “Saat ini masalah fardhu kifayah itu sudah mulai susah mencarinya di beberapa lokasi. Makanya Pemkot Pontianak membantu operasional untuk para pelaksana fardhu kifayah sebesar Rp 1,8 juta per orang dan yang sudah kita bina sebanyak 120 orang, itu pun belum cukup,” ujarnya usai meresmikan yayasan yang terletak di Kelurahan Banjar Serasan Kecamatan Pontianak Timur, Jumat (15/3)

Diakuinya, para petugas fardhu kifayah sangat terbatas sehingga ada beberapa lokasi yang mendatangkan petugas dari lokasi lainnya lantaran di lokasi itu tidak ada petugas fardhu kifayah. “Dengan keberadaan yayasan ini, apalagi dilengkapi dengan mobil ambulance, dan yayasan ini juga memperhatikan bidang pendidikan dan kesehatan, Pemkot sangat berterima kasih karena ini sebagai bentuk kepedulian masyarakat dalam mengentaskan kemiskinan, pendidikan dan masalah sosial kemasyarakatan,” kata Sutarmidji. Dewan Pembina Yayasan Shabli Al-Banjari, Shabli menuturkan, awalnya ide didirikannya yayasan ini lantaran ia mempersiapkan fardhu kifayah bagi dirinya sendiri dan keluarga. “Saya katakan kepada keluarga saya kalau mungkin saya hidup tidak akan lama lagi jadi saya tidak mau merepotkan kalian makanya saya siapkan sendiri fardhu kifayah untuk saya,” ungkapnya. Terbentuknya yayasan ini, menurutnya berkat dorongan

dan dukungan masyarakat sekitar serta tokoh-tokoh masyarakat. Yayasan ini terbentuk murni untuk membantu masyarakat yang membutuhkan fardhu kifayah maupun transportasi untuk mengantar jenazah. “Siapapun yang membutuhkan, silahkan mengambil fardhu kifayah atau menggunakan ambulance gratis dan motor air gratis. Saya sudah terapkan kepada semua anggota tidak ada istilah iuran apapun itu,” jelasnya. S e m e nt a ra i tu , Ke tu a Yayasan Shabli Al-Banjari, Zulkifli menuturkan, yayasan ini murni untuk membantu masyarakat yang membutuhkan dan tidak mencari keuntungan dalam keanggotaan dan tidak memberatkan anggotanya. “Yayasan ini sematamata untuk kepentingan sosial. Kalau ada para dermawan yang ingin memberikan sumbangan atau menyisihkan hartanya untuk yayasan ini, kita sangat terbuka dan akan kita kelola dengan baik untuk membantu masyarakat yang membutuhkan,” pungkasnya. (her)

Jadi AIMI Kedelapan Sambungan dari halaman 16

ingatan ibu-ibu untuk mau kembali lagi ke ASI. “Dalam rangka menyehatkan penerus bangsa dan tidak lagi tergiur dengan susu formula,” kata Marsia. “Jadi mengapa harus memilih susu formula kalau bisa kembali ke ASI untuk

generasi yang lebih baik,” tambahnya. Rencananya AIMI Kalbar akan diresmikan pada 30 Maret 2013 di Hotel Orchadz Perdana disertai dengan seminar kesehatan anak yang menghadirkan dokter spesialis anak Wiyarni Pambudi, Rudi Satrya, serta Konselor Menyusui dan  Ketua

AIMI Pusat Mia Sutanto. KPA juga telah bertemu dengan Wali Kota Pontianak Sutarmidji dan Wakil Wali Kota Paryadi dalam tempat dan waktu terpisah. Kedua pemimpin Kota Pontianak itu menyambut baik keberadaan AIMI Kalbar yang berpusat di Kota Pontianak.(hen)

Bantuan Masjid Digelapkan Sambungan dari halaman 16

menandatangani. Sementara posisi MA Spd waktu itu hanya

sebagai jemaah masjid bukan pengurus. ”Itu juga kita minta pertanggungjawabannya,” ujarnya. MA Spd dihubungi

terpisah melalui nomor kontaknya tidak bisa dihubungi. Berkali-kali coba dikonfirmasi juga tidak aktif.(den)

Evaluasi Program MDGs 2015 Sambungan dari halaman 16

dunia, tetapi di sisi lain kemiskinan sejumlah besar warga dunia tergolong miskin sehingga terjadi ketegangan sosial yang dipicu kesenjangan. ”Muncul wilayah kemiskinan baru. Bukan hanya di Indonesia. Makanya kita perlu

kerangka kerja yang mampu menjawab tantangan dan peluang masa depan,” katanya. Ia menambahkan paska 2015, pemerintah mendorong partisipasi masyarakat sipil dalam pembangunan. ”Tidak hanya antar-pemerintah tetapi juga antar-komunitas, baik lokal, nasional, maupun global,” ujarnya.

Cornelis juga mendorong sektor swasta agar mampu berpartisipasi bersama pemerintah dalam pelaksanaan pembangunan paska berakhirnya program MDGs. ”Bisa menerapkan model bisnis baru yang lebih inklusif dan terapkan paska MDGs tahun 2015 dalam koorporasinya,” katanya. (uni)

Bentuk Badan Pengaduan Sambungan dari halaman 16

sebuah tim khusus dan sebuah badan pengaduan untuk mengurusi persoalanpersoalan seperti ini,” saran Petrus. Mengandalkan dinas terkait, ungkap Petrus, bukan dirinya tak percaya. Hanya saja, dinas tersebut tentu memiliki banyak pekerjaan yang harus dilakukan. “Masalah ini memang terkesan sepele. Tapi kerap terjadi di masyarakat. Dan snagat merugikan konsumen,” ungkap Presiden Front Pembela Dayak Kalbar tersebut. Petrus mencontohkan, ada seorang rekannya, yang anaknya meninggal dunia, gara-gara mengkonsumsi makanan tidak bersih. Anak temannya itu makan tumis kangkung di sebuah warung nasi. Tiba-tiba mengalami sakit perut. Dia dibawa ke rumah sakit dengan orang tuanya. Ternyata usai diperiksa oleh dokter di dalam ususnya banyak bakteri. “Kata dokter karena kangkung yang dikonsumsinya tidak bersih. Tidak direbus dengan benar.

Didalamnya masih banyak bakteri,” ungkap dia. Jika ada persoalan seperti ini, tanya Petrus, siapa yang disalahkan. Harusnya ada standarisasi izin yang diberikan pemerintah terhadap pendirian sebuah warung makan atau restoran. “Warung harus bersih. Jika diluarnya saja banyak lalat, gimana dapurnya. Gimana dia memasaknya. Nah inikan sangat merugikan konsumen. Jika ada badan khusus yang menangani ini, mungkin kita bisa melapor,” saran dia. Kemudian satu kasus lagi yang dialami temannya. Saat minum salah satu merek air kaleng, tiba-tiba temannya mengalami sakit perut yang sangat luar biasa. Hingga dia harus dilarikan ke rumah sakit. Usut punya usut, ternyata sahabatnya itu minum air kaleng yang sudah terkena air kencing tikus dan sudah berkarat hingga masuk ke dalam kaleng tersebut. “Dia harus dirawat selama tiga hari di rumah sakit, garagara hal sepele tersebut. Jika kondisi ini terjadi siapa yang harus disalahkan. Pemilik war-

ung seharusnya harus menjaga kebersihan dan kesehatan warungnya. Bisa saja teman saya melaporkan kejadian seperti ini, tapi apakah ada undangundangnya. Kemudian dia harus melapor kemana,” tanya mantan Ketua DPRD Kabupaten Bengkayang yang sekarang aktif sebagai pengusaha perkebunan tersebut. Kemudian ada permasalahan lain yang biasanya mendera masyarakat daerah ini, terlihat sepele, tapi sebenarnya sangat merugikan masyarakat. Misalnya, kata Petrus, ada sebuah bengkel mobil atau motor yang nakal dan memainkan harga barang. “Yang seharusnya barang bisa diperbaiki tapi kata mereka harus diganti. Masalah seperti ini memang sepele, tapi sangat merugikan masyarakat, apalagi yang berpenghasilan pas-pasan,” ungkap dia. Menurut Petrus, tugas pemerintah, sebenarnya tak hanya membangun daerah ini saja. Tapi juga harus memperhatikan keberadaan masyarakatnya. Persoalan seperti ini, kata dia, juga menjadi bagian tugas pemerintah dalam menanggulanginya. (bdi)


metropolis

16

Pontianak Post

Bantuan Masjid Digelapkan

KONSUMEN

Bentuk Badan Pengaduan SALAH satu tokoh pemuda Kalimantan Barat Petrus SA SH menyorot berbagai permasalahan sosial yang kerap terjadi di masyarakat. Dia meminta pemerintah cukup tegas dalam mengantisipasi persoalan tersebut. Beberapa permasalahan sosial yang patut diperhatikan pemerintah, ungkap dia, salah satunya adalah perbuatan yang merugikan konsumen. “Ada warung makan yang tidak menjaga kese­ hatan makanannya dan Petrus SA menyebabkan masyarakat menjadi terkena penyakit. Masakan kurang bersih, banyak lalat, kemudian minuman sudah kadaluarsa masih tetap dijual. Warung-warung ini harus diberi sanksi. Makanya kita butuh tim yang bisa mengecek permasalahan seperti ini. Harus ada Ke Halaman 15 kolom 5

MUJADI/PONTIANAK POST

TAMBAH RAMAI: Pengantre air di booster PDAM kompleks Stadion Sultan Syarif Abdurrahman bertambah ramai. Jika dalam beberapa hari mendatang tidak juga hujan, bisa dipastikan antrean bakal panjang.

Peduli ASI

Jadi AIMI Kedelapan KOMUNITAS Kalbar Peduli Asi (KPA) tidak lama lagi akan menjadi Asosiasi Ibu Menyusui Indonesia (AIMI). Kalbar merupakan cabang kedelapan se-Indonesia. Ketua KPA Marsia Dewi mengungkapkan, AIMI Kalbar nantinya akan bekerjasama dengan beberapa penyedia fasilitas dan tenaga kesehatan serta pihak-pihak lain yang terkait. Hal ini dilakukan untuk terus menggaungkan pentingnya pemberian ASI eksklusif selama enam bulan sebagai bagian dari Millenium Development Goal’s (MDG’s). “Yang kami kejar dalam hal ini tentu saja peningkatan persen ibu menyusui sebagai upaya peningkatan kesehatan anak. Seperti kita ketahui dengan ASI sudah banyak kandungan serta zat-zat yang dibutuhkan anak dalam masa pertumbuhannya,” ungkapnya. Marsia menegaskan perubahan status KPA menjadi AIMI Kalbar akan dilaksanakank akhir Maret ini. Persiapannya saat ini sudah 80 persen. “Kami sudah mempersiapkan dengan matang proses peresmian ini sejak dua bulan lalu, mulai dari pembicara hingga peserta seminar,” ujarnya. AIMI Kalbar akan diresmikan dengan mengusung tema “Kembali ke ASI Untuk Generasi Emas”. Tema tersebut dipilih untuk menyegarkan Ke Halaman 15 kolom 5

Sabtu 16 Maret 2013

Evaluasi Program MDGs 2015 PONTIANAK— Program Millennium Development Goals (MDGs) berakhir pada 2015. Gubernur Kalimantan Barat, Cornelis meminta instansi terkait di provinsi maupun kabupaten/kota mengevaluasi terkait program tersebut, kemudian memberi masukan yang nanti akan disampaikan kepada Presiden. ” Ya n g m e n a r i k sekarang ini adalah masalah MDGs. Kami rapat dengan Presiden sehubungan MDGs. Ini program internasional dan berakhir pada 2015,” ujar Cornelis. Menurut Cornelis, ada beberapa hal penting terkait pelaksanaan

tercakup tetapi penting. Setelah MDGs ini apalagi program selanjutnya,” ungkap Cornelis. MasukanMana yang berhasil, mana masukan dalam yang bermakna, mana evaluasi pelaksayang tidak berhasil, naan MDGs ini akan disampaikan dan mana yang tidak kepada Presiden tercakup tetapi penting. melalui Unit Kerja Setelah MDGs ini Presiden Bidang Pengawasan dan apalagi program Pengendalian selanjutnya.” Pembangunan (UKP4). Selain itu, lanjut Cornelis, saat ini MDGs. Pemerintah daerah bersama instansi terkait dapat mengevalu- lanskap pembangunan berubah asi pengalaman dalam pelaksanaan drastis. Di satu sisi negara berkemMDGs. ”Mana yang berhasil, mana bang menjadi mesin pertumbuhan yang bermakna, mana yang tidak Ke Halaman 15 kolom 5 berhasil, dan mana yang tidak

c

M

y

K

PONTIANAK—Benu Umar, Ketua Masjid Nurul Iman, Parit Lintang, Dusun Cempaka RT22/ RW 08 Desa Kalimas, Kecamatan Sungai Kakap, Kubu Raya meminta aparat kepolisian Polresta Pontianak segera mengambil alih kasus dugaan dana masjid yang pernah dilaporkan kelompoknya ke Polsek Sungai Kakap. ”Kita kecewalah. Makanya kami meminta jumpa pers ini. Ini juga bahwa kami protes dan minta cepat selesaikan persoalan ini,” kata Benu sapaan karibnya didampingi M. Yani Muslim tokoh masyarakat Desa Kalimas saat mengelar jumpa pers di Rumah Makan Pondok Ale-Ale Pontianak, Kamis (14/3) di Pontianak. Menurut Benu kenapa dirinya bersama anggota pengurus masjid perlu membuat laporan. Sebab, ada beberapa item bantuan yang perlu mendapatkan penjelasan. Yang pertama bantuan dari Gubernur Kalbar Rp5 juta dan bantuan sosial(bansos) sebesar Rp10 juta Pemkab Kubu Raya yang perlu diluruskan. ”Bantuan-bantuan tersebut atas nama ketuanya oleh MA Spd, seorang PNS guru. Padahal yang bersangkutan bukan ketua Masjid,” ujarnya. Bukan hanya itu saja, bendahara Masjid Senong H. Umar yang tercatat dibawah kepengurusannya juga pernah membuat surat pernyataan. Sang bendahara mengakui tidak pernah menandatangani bansos yang dikeluarkan Pemkab Kubu Raya oleh yang menangani bansos. ”Itu sudah dibuat di atas materai dan diketahui Kades Desa Kalimas, Nasir Muslim,” ucapnya. Benu mengakui sebetulnya malu dan keberatan kasus ini dibesarkan ke publik. Namun dampak dari kasus tersebut sebelumnya pernah membuat salah satu temannya harus masuk ke penjara gara-gara dianggap menganiaya MA Spd. Padahal waktu itu warga ingin mempertanyakan secara baik-baik. ”Sebelumnya, kita sudah minta datang dan jelaskan secara terperinci. Sayang yang bersangkutan tetap ogah,” kata dia. Terkait kasus ini, ia juga mempertanyakan peran Kepala Bagian Kesejahteraan Pemkab Kubu Raya yang berani meng-goal-kan dana bantuan sosial Rp10 juta tahun 2012. Padahal ia sebagai ketua termasuk bendaharanya tidak pernah Ke Halaman 15 kolom 5


Sabtu 16 Maret 2013

pro-kalbar Pontianak Post

3

17

SHANDO SAFELA/PONTIANAKPOST

PARAH: Kendaraan melintas jalan yang rusak dan berdebu tak jauh dari Kota Tayan. Kondisi jalan seperti ini membuat banyak pihak merugi karena banyak memakan waktu dan tenaga.

Aksi FPI Dibatalkan

PEMANGKAT

Warga Menyemut di Patung Naga

HARI KURNIATHAMA

MENCARI: Tim SAR Sintete Saat melakukan­ pencarian Safari di perairan Sebangkau kemarin.

Nelayan Tenggelam SEORANG warga Sungai Emas Desa Pemangkat Kota Kecamatan Pemangkat, Safari berusia 60 tahun diduga tenggelam di periran laut Sebangkau Jumat (3/15) sekitar pukul 01.00 dini hari. Peristiwa ini diketahui oleh temannya Nawawi (55) yang sama-sama sebagai nelayan jeremal di perairan laut Sebangkau. Hingga kini Safari belum ditemukan, SAR Sintet, Polisi Air Polres Sambas, dan warga tengah­melakukan pencarian. Menurut Ke Halaman 27 kolom 1

PELANTIKAN

Ursus Camat Mandor BUPATI Kabupaten Landak, Adrianus Asia Sidot, Jumat (15/3) resmi melantik Camat Mandor yang baru yakni Ursus, bertempat di Kantor Camat Mandor. Ursus menggantikan Camat Mandor yang lama yakni Marius Baneng yang saat ini menjabat sebagai Kepala Bagian (Kabag) Pertanahan Sekretariat Daerah (Setda) Landak. Sebelum menjadi Camat Mandor, Ursus menAdrianus AS jabat sebagai Kepala Bidang (Kabid) Pengadaan dan Mutasi Badan Kepegawaian, Pendidikan dan Pelatihan (BKPP) Landak. Pelantikan Camat Mandor ini­pun dihadiri sejumlah Kepala SKPD dilingkungan­ Pemkab Landak, jajaran Muspika Mandor, anggota DPRD Landak Dapil 2, sejumlah Ke Halaman 27 kolom 5

BIDIK

SINGKAWANG-Usai salat Jumat (15/3) patung naga yang terletak dipersimpangan Jalan Niaga-Kempol Mahmud Singkawang Barat mendadak ramai. Ratusan warga mengerumuni sekitar patung naga. Mereka ingin melihat “aksi” yang dilakukan Front Pembela Islam (FPI) Kota Singkawang. Padahal, sejak Rabu lalu sudah diputuskan, Pemerintah Kota Singkawang mengambil alih patung naga tersebut. Warga bukannya bubar, malah menyemut. Alhasil, kemacetan tak terhindari.

Polisi akhirnya dengan pengeras suara mengumumkan kalau di Patung Naga tidak ada aksi yang informasi diterima warga. Pengumanan itu masih juga belum dipatuhi oleh warga yang ingin menyaksikan secara langsung. Setelah diberikan pemahaman oleh polisi dan tentara, akhirnya warga bubar. Apalagi, di Kota Singkawang diguyur hujan sehingga mereka mulai menghindar. Menurut sejumlah warga dihubungi Pontianak Post, mereka mendatangi patung naga karena ada yang memberitahukan kalau ada aksi pengrobohan patung yang dibangun oleh pengusaha Beny Setiawan dizaman Hasan Karman sebagai wali kota. “Kita diberitahu kawan. Kita pergi ingin­ melihat secara langsung. dulu, juga kita melihat,” kata warga yang

mengaku berasal dari Kaliasin. Dia juga tidak tahu apakah FPI membatalkan atau tidak aksinya. “Kami datang saja. Kalau ada, kita ingin liat,” katanya. Front Pembela Islam Cabang Singkawangmelaluisekretaris­ nya menyebutkan, aksi damai yang akan mereka lakukan, Jumat Ke Halaman 27 kolom 5

OZY/PONTIANAKPOST

Tak Ada Izin Baru Kios BBM

Pembakar Lahan Terancam Pidana SINGKAWANG-Polres Singkawang mengingatkan warga maupun perusahaan perkebunan untuk tidak sembarangan membuka lahan dengan cara membakar. Pasalnya, pelaku pembakar bisa terancam dikenakan sanksi pidana, UU No 32 Tahun 2009 tentang Perlindungan dan Pengelolaan Lingkungan Hidup. Tidak hanya dikenakan sanksi pidana, tapi tetapi juga didenda hingga milyaran rupiah. Di dalam UU tersebut, pasal 98 ayat satu menegaskan jika setiap orang yang dengan sengaja melakukan perbuatan yang meng­ akibatkan dilampauinya baku mutu udara ambien, baku mutu air, baku mutu air laut, atau kriteria baku kerusakan lingkungan Ke Halaman 27 kolom 5

Singkawang. Sedangkan pengendara motor, Lie Sin Shin (43), warga Pasar Sedau. Korban tewas yakni Lie Sin Shin, sedangkan yang luka berat Se Nga (32) penumpang dari mobil pikap. Informasi yang berhasil dihimpun, kejadian itu berawal dari pikap yang

SINTANG – Tidak ada izin lagi yang akan diberikan Pemkab Sintang kepada para pemilik kios BBM baik itu izin baru maupun perpanjangan izin. Hal ini ditegaskan Kepala Kantor PTSP Kabupaten Sintang, Sudirman, Jumat (15/3) Sudirman menegaskan pihaknya akhir Maret ini akan memanggil semua para pengecer BBM untuk menjelaskan Perpres No 15 Tahun 2012 Tentang Pengendalian Penjualan BBM. Dalam regulasi tersebut jelas disebutkan bahwa untuk pengendalian harga BBM maka penjualan BBM hanya boleh dilakukan oleh Pertamina melalui SPBU. “Atas dasar regulasi inilah, PTSP tidak akan memberikan izin kepada para pemilik kios BBM,” tegasnya. Dia mengatakan setelah sosialisasi ini, maka terserah kepada masyarakat apakah akan tetap menjual BBM eceran atau tidak. “Kami tidak bisa memaksa agar masyarakat tidak menjual BBM secara eceran. Tapi jika masyarakat menjual resiko tanggung

Ke Halaman 27 kolom 1

Ke Halaman 27 kolom 1

Pikap vs Motor

Seorang Tewas SINGKAWANG-Kecelakaan lalu lintas kembali menelan korban jiwa. Kali ini insiden kecelakaan terjadi di Jalan Ali Anyang depan Kodim, Kamis (14/3) pukul 17.30 WIB antara, Pikap bernomor polisi B 9321 TAG melawan sepeda motor KB 4192 YK. Diketahui pengemudi pikap Bang Sin (27), warga Gang Nyiur RT 59 RW 08,

Jembatan Semuntai, Mukok Bakal Terancam

Ditabrak Ponton CPO, Satu Tiang Roboh Waspada saat melewati jembatan Semuntai di Desa Semuntai, Kecamatan Mukok Kabupaten Sanggau. Salah satu tiang penyangganya tumbang, diduga ditabrak sebuah kapal ponton pengangkut CPO milik Pantai Ekspres (PE). Fikri Akbar, Sanggau

ZUL/PONTIANAKPOST

DONOR DARAH: HUT Dharma Pertiwi ke49 dan Persit Kartika Chandra Kirana ke-67 digelar donoh darah yang dipusatkan di Aula Makodim 1202 Singkawang bekerjasama (PMI) Cabang Singkawang

TUGU NAGA: Warga saat memenuhi tugu naga dan menunggu demo yang batal dilakukan oleh FPI Singkawang.

PERISTIWA itu terjadi Senin (24/2) lalu sekitar pukul 09.00 WIB. Tak hanya itu, akibat kejadian tersebut beberapa tiang penyambung jembatan tersebut juga ikut lepas. “Sampai saat ini belum ada upaya perbaikan dari yang menabrak,” jelas Sekretaris Desa Semuntai, Sarmijan,

Fikri Akbar

ROBOH: Sarmijan di samping tiang penyambung jembatan yang juga ikut terlepas. Satu tiang penyangga tumbang akibat ditabrak ponton.

c

M

y

K

Jumat (15/03) di Kantor Desa Semuntai. Kepada wartawan Sarjiman menceritakan, insiden tersebut dilapor kepada pihak desa berdasarkan kesaksian beberapa warga yang mengaku melihat. Sarjiman sendiri mendapat laporan tersebut saat dia sedang memanen sawit. “Saya langsung lapor ke Polsek Mukok. Lalu kami kejar dari Sanggau pakai speed boat. Ketemunya di dekat Pancur Aji sekitar jam 13.00 WIB,” jelasnya. Namun, setelah ditanyakan pada sang nakhoda ponton. Sang nakhoda tidak mau bertanggungjawab, karena pihaknya mengaku hanya merasa menabrak kayu yang tersangkut yang kemudian mengenai tiang penyangga. “Kalau cuma kena kayu kenapa sampai tumbang tiang itu. Padahal berdasarkan laporan warga itu kena tiang langsung,” bantah Sarjiman kepada nahkoda ponton. Tak puas sampai di situ, Sekdes bersama anggota Polsek Mukok juga sudah mendatangi langsung pemilik ponton di Pontianak. Namun, Ke Halaman 27 kolom 5


18 BANTUAN MASJID

Pengurus Masjid Ancam Lapor Polisi BENU Umar, Ketua Masjid Nurul Iman, Parit Lintang, Dusun Cempaka RT22/RW 08 Desa Kalimas, Kecamatan Sungai Kakap, Kubu Raya meminta aparat kepolisian Polresta Pontianak segeramengambilalihkasusdugaandanamasjid yang pernah dilaporkan kelompoknya ke Polsek Sungai Kakap. ”Kita kecewa. Makanya kami meminta jumpa pers ini. Ini juga bahwa kami protes dan minta cepatselesaikanpersoalanini,”kataBenusapaan karibnya didampingi M. Yani Muslim tokoh masyarakat Desa Kalimas saat menggelar jumpa persdiRumah Bantuan-bantuan Makan Pontersebut atas nama dok Ale-Ale Pontianak, ketuanya oleh MA Kamis (14/3) Spd, seorang guru di Pontianak. Me nu r u t PNS disalahgunaBenu kenapa kan. Padahal yang dirinya berbersangkutan bukan sama anggota pengurus ketua Masjid. masjid perlu membuatlapBenu Umar oran. Sebab, ada beberapa item bantuan yang perlu mendapatkan penjelasan. Pertama bantuan dari Gubernur Kalbar Rp5 juta dan bantuan sosial(Bansos) sebesar Rp10 juta Pemkab Kubu Raya yang perlu diluruskan. ”Bantuan-bantuantersebutatasnamaketuanya oleh MA Spd, seorang guru PNS. Padahal yang bersangkutan bukan ketua Masjid,” ujarnya. Bukan hanya itu saja, bendahara Masjid SenongH.Umaryangtercatatdibawahkepengurusannya juga pernah membuat surat pernyataan. Sang bendahara mengakui tidak pernah menandatangani bansos yang dikeluarkan Pemkab Kubu Raya oleh yang menangani bansos. ”Itusudahdibuatdiatasmateraidandiketahui Kades Desa Kalimas, Nasir Muslim,” ucapnya. Benu mengakui sebetulnya malu dan keberatan kasus ini dibesarkan ke publik. Namun dampak dari kasus tersebut sebelumnya pernah membuat salah satu temannya harus masuk ke penjara gara-gara dianggap menganiaya MA Spd. Padahal waktu itu warga ingin mempertanyakan secara baik-baik. ”Sebelumnya, kita sudah minta datang dan jelaskan secara terperinci. Sayang yang bersangkutan tetap ogah,” kata dia. Terkait kasus ini, ia juga mempertanyakan peran Kepala Bagian Kesejahteraan Pemkab Kubu Raya yang berani menggolkan dana bantuan sosial Rp10 juta tahun 2012. padahal ia sebagai Ketua termasuk Bendaharanya tidak pernah menandatangani. SementaraposisiMASpdwaktuituhanyasebagai jemaah masjid bukan pengurus. ”Itu juga kita minta pertanggungjawabannya,” ujarnya.(den)

KUBU RAYA

Pontianak Post

Sabtu

16 Maret 2013

Komplek Pemakaman Rawan Tempat Mesum

MUJADI/PONTIANAK POST

TERSUMBAT: Gorong-gorong Jalan Purnama banyak yang tersumbat sampah. Bisa dilihat, saat Parit Tokaya kering seperti sekarang, parit tersier (kecil) masih menggenang.

Program Pemdes Harus Bersinergi SUNGAI RAYA-Kepala Desa Pematang Tujuh Kecamatan Rasau Jaya, Surjana resmi dilantik Bupati Kubu Raya, Muda Mahendrawan. Pelantikan yang dilakukan di halaman kantor desa itu dipadati sejumlah warga, kemarin. Muda meminta kepala desa baru, agar segera melakukan penataan rencana pembangunan desa dengan konsep yang berkeadilan. ”Karena seperti yang diketahui bahwa Kubu Raya memiliki arah yang jelas kedepan sebagai daerah penyangga utama Kalimantan Barat,” katanya. Untuk mencapai tujuan itu, lanjut dia partisipasi dan arah kebijakan pembangunan masyarakat di desa juga mesti searah dengan kebijakan pemkab. Dengan merancang program dan penguatan sasaran pembangunan di desa yang bersinergi dengan desadesa di sekitarnya. Mengikutsertakan

semua masyarakat dalam kegiatan pembangunan dengan kembali membangun semangat gotong royong. ”Dengan demikian arah kebijakan pembangunan yang berkeadilan dapat dirasakan masyarakat,” ucapnya. Dia mengaharapkan, Kades yang sudah dilantik dapat meneruskan program-program pembangunan di masyarakat dengan sinergi bersama Pemkab, seperti melakukan desain tata ruang desa yang baik dengan menyeimbangkan antara program-program penguatan dimasyarakat seperti pertanian dan perkebunan dengan investasi yang mungkin masuk. Serta segera menyelesaikan batas-batas desa yang hingga saat ini belum terselesaikan. Tidak kalah penting, tambahnya Pemerintah desa dapat melakukan perencanaan untuk penguatan kehidupan masyarakat dan program-program

pelayanan di Posyandu yang melibatkan kader-kader militant. Karena Posyandu merupakan garda terdepan untuk memberikan promosi pelayanan kesehatan. Sementara itu warga setempat Sunarto berharap kepala desa baru mampu membawa kemajuan bagi desa. Dengan menjalankan program-program kerja yang tentunya sesuai dengan kebutuhan masyarakat. “Siapapun yang memimpin desa ini, warga berharap program yang dijalankan nantinya adalah program yang pro rakyat,” katanya. Kedepan, lanjut dia karena proses demokrasi telah selesai, maka di tengah masyarakat jangan lagi ada kelompokkelompok yang memecahkan dirinya. Warga harus ikut bahu membahu membangun desa dengan mendukung program yang akan dijalankan kades baru. (adg)

SUNGAI RAYA-Komplek Pemakaman saat ini rawan menjadi kawasan mesum. Lantaran tempatnya yang sunyi, gelap dan luput dari pengawasan. Seperti yang terjadi beberapa waktu lalu di Komplek Pemakaman Tionghoa Yayasan Bhakti Suci Kelurahan Batulayang Pontianak Utara. Sejumlah anak baru gede (ABG) diamankan pihak Mapolresta Pontianak terindikasi sedang melakukan pesta lem dan sek. Kasat Polisi Pamongpraja (Sat Pol PP) Kabupaten KubuRaya,AndyHasryaditerkaitditangkapnyasejumlah ABG di kawasan pemakaman itu pihaknya akan segeramenjadwalkanpatrolirutindisejumlahkawasan pemakaman yang ada di Kabupaten Kubu Raya. Menurutnya, hal itu dilakukan guna mengantisipasi penyalahgunaan komplek pemakaman. “Kita harus belajar dari apa yang terjadi di Komplek Pemakaman Tionghoa Yayasan Bhakti Suci Kelurahan Batulayang. Jangan sampai komplek pemakaman di Kubu Raya digunakan untuk melakukan perbuatan-perbuatan tidak terpuji,” katanya, Jumat (15/3). Dia menuturkan, memang tidak dipungkiri kawasan-kawasansunyitanpapenerangan,sepertidi Tugu Ali Anyang Ambawang dan komplek-komplek pemakaman selalu digunakan untuk kegiatan-kegiataan maksiat, seperti menegak minum-minuman keras, bahkan melakukan tindakan asusila. “Nanti kita akan awasi tempat-tempat yang berpotensi disalahgunakan,” ucapnya. Pada dasarnya, lanjut dia Pemerintah Kabupaten Kubu Raya telah membuat aturan, yakni Perda tentang ketertiban umum. Dimana kegiatan-kegiatan yang dilakukan masyarakat, apabila telah meresahkan dan mengganggu dapat dibubarkan. Apalagi kegiatan-kegiatan seperti asusila tentu tidak ada ruang untuk dilakukan di Kabupaten Kubu Raya. Menurutnya, masyarakat memiliki peran dalam hal pengawasan terhadap kenakalan remaja yang dilakukan di tenmpat-tempat umum. Memang untuk melakukan penertiban tidak bisa dilakukan langsung, setidaknya dilakukan penyelidikan atau ada laporan dari masyarakat. Dia menegaskan, jika memang masyarakat melihat dan mengetahui tindakan-tindakan tidak terpuji baik yang dilakukan oleh ABG maupun masyarakat umum untuk segera lapor kepada pihak yang berwenang, seperti RT, Sat pol PP dan kepolisian. Karena Dari informasi tersebut, aparat dapat mengambil tindakan. “Yang jelas masyarakat jangan main hakim sendiri, laporkan saja jika melihat kami akan menertibkannya. Jika terbukti melanggar hukum tentu akan kita seret ke pihak kepolisian,” tegasnya. (adg)

Batas Gunung Tamang Pulau Limbung Disepakati SUNGAI RAYA-Persoalan tapal batas memang terus menjadi permasalahan yang dihadapi Pemerintah Kabupaten Kubu Raya. Namun satu demi satu pula permasalahan tapal batas selesai, seperti Pemerintahan Desa Gunung Tamang dan Pulau Limbung yang akhirnya menyepakati tapal batas wilayah yang dilakukan secara musyawarah dan mufakat. Kesepakatan tapal batas desa ditandatangani masing-masing kades pada Rabu (13/3). Kepala Desa Pulau Limbung, Usmanmengakulegadanmem-

beriapresiasitelahdisepakatinya tapalbatasantardesayangmasih masuk dalam wilayah administrasi Kecamatan Sui Raya itu. Titik koordinat telah diambil dan tinggal menunggu hasil pemetaan dari pihak Badan PemerintahanDesa(BPMPD) Kubu Raya. “Alhamdullilah kami sudah menyepakati sehingga terealisasikesepakatanduabelah pihak untuk menentukan batas desadenganamandantertib,”katanya.Langkahselanjutnya,lanjut dia adalah menyosialisasikan ke masyarakat letak batas-batas wilayah yang disepakati. Batas wilayah yang disepakati itu yakni ParitOjek,MunggukTampaiKecil dan Besar. Kalau Mungguk Tampai Kecil masuk dalam wilayah administrasi Desa Gunung Tamang sedangkan Mungguk Tampai Besar disepakati masuk wilayah Desa Pulau Limbung. Jadi, ini yang belum pernah difasilitasi selama ini. Bukan karena ada sengketa tapal batas. Menurutnya, kesepakatan itu difasilitasiPTSawitJayaMakmur (SJM)yang disaksikan Camat, Kapolsek, tokoh masyarakat, pengurus pemerintahan desa serta dari BPMPD Kubu Raya.

“Kedepan kami berharap tidak ada lagi masalah-masalah di desa kami. Apalagi, dengan sudah masuknya perkebunan kelapa sawit,” ujarnya. Sementara itu Kepala Badan Pemberdayaan Masyarakat dan Pemerintahan Desa (BPMPD) Kubu Raya, Fauzi Kasim mengatakan hasil kesepakatan itu akan ditindak lanjuti dengan penerbitan SK Bupati dan pemetaan secara formal. Menurutnya, selain Gunung Tamang - Pulau Limbung,duadesalainnyayakni Rasau Jaya Umum (Rasau Jaya) Punggur Kecil (Sui Kakap) juga telah disepakati tapal batas wilayahnya. “Penyelesaian tapal atas ini dapat selesai jika kedua belah pihak mengedepankan musyawarah mufakat,” ucapnya. Dia menjelaskan dalam PP 72 tentang Desa disebutkan penyelesaian tapal batas desa hendaknya diselesaikan lebih dulu secaramusyawarahdanmufakat oleh kedua desa. Namun jika tidak terselesaikan maka keputusan terakhir kewenangannya berada di bupati dengan melihat beberapa aspek seperti aspek hukum, riil di lapangan serta keadilan di lapangan. (adg)


Pontianak Post

Sabtu

16 Maret 2013

PINYUH - NGABANG

PILKADA

Jalan Rusak Bupati Ditegur

Balon Bakal Nambah PEMILUKADA diyaini kasih akan bertambah. Namun tidak begitu signifikan. Khusus untuk orang nomor satu, sepertinya masih tambal sulam. Artinya, yang sudah mencuat kepermukaan, boleh jadi mundur dan digantikan calon lain. Juga bada kemungkinan calon figur Bupati turun menjadi calon figure Wakil Bupati. “Politik itu memang sulit ditebak. Setiap waktu dapat berubah sesuai kebutuhan dilapangan,” nilai Taufik Urochman. Tak hanya itu, dalam pemunculan figure, masih ada calon yang malu-malu kucing. Artinya, saat tim mengambil formulir, mereka sudah minta identitas calon figur yang akan maju itu memang masih dirahasiakan. Termasuk saat mereka mengembalikan formulir juga enggan dipublikasikan. “Yang sudah mengembalikan formulir, baru Ria Norsan (incumbent). Yang lainnya minta dirahasiakan,” aku H Rusli Abdullah ketua tim penjaringan DPC PDIP. Halnya dengan Taufik Urochman Ketua tim Penjaringan Partai Hanura juga menyatakan hal yang sama. Tak hanya itu, kepada koran ini salah satu figur menjelaskan, alasan dirinya belum mau mencuat kepermukaan, karena masih melihat kondisi lapangan. Seberapa besarnya dukungan yang masih bertahan, jika dirinya maju sebagai kandidat orang nomor satu. “Saya memang bermaksud maju sebagai calon Bupati. Tapi masih melihat kondisi dan peluang dilapangan,” aku salah satu Balon yang sudah mengambil formulir di beberapa tim penjaringan parpol mempertegas, belum saatnya untuk dipublikasikan. Dalam perhelatan Pemilu BupatiWakil Bupati. Setiap balon bersama tim sukses maupun tim pendukung, harus pula bias melihat kekuatan lawan. Orang bijak selalu mengingatkan setiap balon kada, jangan pernah merasa lebih besar dari tim lainnya. Jangan pula pernah mengklaim, bakal keluar sebagai pemenang. Seberapa besarpun yang sudah diberikan kepada masyarakat belumlah menjadi suatu jaminan untuk keluar sebagai juara. ‘Perlu strategi’. Dan masing-masing balon kada dan tim penggusung maupun pendukung tentu tidak sama penerapan strateginya dilapangan. Permainan money politik hanya akan menjadi boomerang dan merugikan. Sebab, salah satu trategi tim pendukung adalah menangkap basah pelaku saat membagikan uang dalams erangan siang, sore, malam, tengah maam, fajar hingga pada saat di TPS. Juga akan disoroti pemberian pemberian bantuan kepada masyarakat agar memilih salah satu pasangan balon. (ham)

19

HAMDAN/PONTIANAKPOST

LANTIK PPK: Ketua KPU Mempawah lantik anggota PPK se kabupaten Mempawah. Diharapkan kinerja mereka meningkat dengan dimulainya masa kampanye beberapa partai serta jelang Pilkada mendatang.

KPU Lantik 45 PPK Pemilu 2014 MEMPAWAH- Sebanyak 45 anggota Panitia Pemilihan Kecamatan (PPK) se Kabupaten Mempawah resmi diambil sumpah dan dilantik oleh Munir Putra ST MSi, Ketua KPU Mempawah kemarin. “Tugas kita sebagai penyelanggara pemilu sudah menunggu. Semua PPK yang sudah dilantik secepatnya melakukan koordinasidenganpihakkecamatan,”pinta Munir Putra dalam pengarahannya usai pelantikan yang dihadiri Gusti Ramlana S.Sos, kemarin. Pelantikan dihadiri pula Muhammad anggota Badan Pengawas Pemilu (Bawaslu) provinsi bersama salmah staf asistensi, peerwira Polres, Camat, sekcam se Kabupaten serta jajaran secretariat KPU. “Para anggota PPK yang saya lantik, semuanya sudah professor. Lantaran sejak tahun 1994, sudah pernah melaksanakan

Pemilu legislatif, Pilpres, Pemilu kada hingga tahun 2012 lalu sudah 8 kali,” aku Ketua KPU. Karenanya Munir tidak pelit menganugerahkan sebutan profesor kepada mereka yang dilantik sebagai PPK. Lantaran dari sisi pengalaman kerja sudah tidak perlu diragukan lagi. Terlebih pula lanjutnya, dia yangs emula sebagai anggota era Idris Maheru dan melanjutkan sebagai Ketua memang sudah selalu bersamasama dengan PPK dalam setiap perhelatan pesta demokrasi, baik itu berupa pemilu legislatif, pemilu kada (Bupati-Wabupred), Pemilu kada (Gubernur-Wagub-red) serta Pemilu Presiden. “Jika ada anggota PPK yang ingin memaju sebagai anggota legislative. Maka, yang bersangkutan harus mundur,” tegas Munir. Pasalnya, kesiapan itu memang

mejadi tugas dan tanggung jawab KPU beserta jajaran yang ada dibawahnya seperti PPK. Sedikitnya ada 18 point tugas PPK seperti telah dibacakan sekretaris KPU sebelum pelantikan. “Jaga kemandirian,” pesannya. Itu disebabkan, dalam pemilu legislatif, tentu akan ada keluarga, teman dekat, sahabat, kawan yang maju. Maka, dalam pelayanan tetap mengedepankan netralitas, tanpa memandang siapa,” pesannya. Dari 45 anggota PPK yang dilantik, terdapat lima wanita yakni Oktaviani dari PPK Sui Kunyit, Titin PPK Mempawah Hilir, Ivoliana PPK Sadaniang, Agusmini PPK Sui Pinyuh dan Natalia PPK Toho. Melihat keterwakilan wanita yang duduk dalam komposisi PPK, Munir melihat sudah wajar. (ham)

NGABANG-Masih belum mulusnya ruas jalan yang menghubungkan antara Ngabang-Serimbu Kecamatan Air Besar masih menjadi momok yang dihadapi Pemerintah Kabupaten (Pemkab) Landak.Bahkan,BupatiLandakAdrianusAsiaSidot sempatmendapattegurandariKomisiOmbutsman Perwakilan Kalbar akibat belum mulusnya ruas jalan sepanjang 53 KM tersebut. “Tapi teguran itu sudah saya jawab. Saya bilang, kalau saya punya dana yang banyak, itu akan gampang. Dalam waktu dua atau tiga bulan, semuanya beres. Namun persoalannyakan justru di duitnya yang tidak ada,” ujar Bupati saat membuka Musrenbang tingkat Kabupaten Landak belum lama ini di aula besar Kantor Bupati Landak. Menurutnya, karena minimnya dana yang tersedia, Pemkab Landakpun tidak bisa berbuat apa-apa. Apalagi Pendapatan Asli Daerah (PAD) Landak hanya Rp20 miliar lebih. “Itupun sudah kita paksa-paksakan. Hal ini ditambah lagi dengan pendapatan kita dari sumber-sumber yang kecil. Mungkin saja ongkos tagihnya lebih besar daripada pajak yang didapat,” katanya. Bupatimenuding,rusaknyaruasjalanNgabangSerimbu tersebut dikarenakan dilalui alat berat milik perusahaan perkebunan yang dilakukan setiap harinya untuk melakukan kegiatan Leand Clearing (LC). “Tapikadang-kadangadayangmengkritisi,mengapaBupatimemberikanizin.Padahalkitakanmau meningkatkan kegiatan ekonomi di daerah. Kalau di daerah tersebut masih semak belukar, apa yang maukitaharapkan.Jadiharusadakegiatanekonomi didaerahitu,”tegasnya.Iamenambahkan,kegiatan ekonomi memang memiliki berbagai macam konsekwensi tertentu. “Tidak mungkin suatu kegiatan tanpa konsekwensi,” ucap Bupati. (wan)

Diduga Serobot Tanah, CG dipolisikan PINYUH- CG alias Ak, 50 tahun, warga Sui Purun Kecil (SPK) Kecamatan Sui Pinyuh, dituding membalikkan fakta di lapangan yang akhirnya menjerat Ak ke ranah hukum, karena dinilai melakukan manipulasi data hak milik tanah yang semula dipercayakan kepadanya untuk diurus. Awal Maret 2013 dia dilaporkan seorang warga asal Sui Purun kecil yang yang tinggal di Jakarta untuk mengurus surat-menyurat tanahnya. Namun, oleh Ak yang ini bersta-

tus sebagai tersangka itu, malah tanah yang diurusnya menjadi hak miliknya. Merasa dibohongi tersangka Aban, 68 tahun melaporkan kasus itu ke Polsek Pinyuh. Hasil penyelidikan awal terhadap tersangka, diketahui, kalau CG alias Ak itu benar melakukan penyerobotan tanah milik orang lain. Kemudian melakukan penebangan pohonpohon kelapa yang ada diareal tanah yang dikaui. Kemudian batang kelapa itu diolah jadi batang olahan dan dijual.

Saat dipanggil penyidik, CG alias Ak enggan memberikan keterangan. Setelah dijelaskan penyidik kasus yang dipersalahkan, tersangka akhirnya siap untuk diperiksa namun tetap didampingi penasehat hukum. Penangkapan Cg alias Ak disambut gembira warga SPK. Menurut warga, perbuatan tersangka dinilai sudah meresahkan masyarakat. “Memang benar, satu tersangka terkait kasus penyerobotan tanah, penebangan pohon

kelapa milik warga dan batang kelapa olahan itu dijual,” terang AKBP Sigit Dedi Purwanto SIK MH, Kapolres Mempawah sebagaimana diterangkan AKP Iwan Setiawan, SH Kapolsek Pinyuh ditemui koran ini kemarin. Atas perbuatan itu, tersangka dipersalahkan melanggar pasal 385 sub pasal 362 subsider lagi pasal 406 KUHP. “Jika dipersidangan, perbuatan tersangka terbukti bersalah, bisa diancam pidana lima tahun,” terangnya. (ham)


SINGKAWANG

20

Pontianak Post

Sabtu 16 Maret 2013

ZULKARNAEN FAUZI/PONTIANAK POST

JALAN SEHAT: Kegiatan donor darah yang digelar Persit Kartika Chandra Kirana yang juga diikuti oleh PIA Ardhya Gharini, kemarin (15/3) serta siap ikut serta dalam JSPP (foto 1). Perwakilan Jasaraharja siap untuk ikut serta dan mendukung perhelatan JSPP, bahkan menyediakan doorprize (foto 2). Ketua DPRD Kota Singkawang Thjai Chui Mie siap ikut serta dan juga menyediakan doorprize buat peserta (foto 3), Pegadaian memborong beberapa lembar tiket JSPP (foto 4).

HUT Dharma Pertiwi dan Persit Kartika Chandra Kirana

Dari Donor Darah hingga Ikut Jalan Sehat Pontianak Post SINGKAWANG– HUT Dharma Pertiwi ke-49 dan Persit Kartika Chandra Kirana ke-67 yang juga diikuti oleh PIA Ardhya Gharini (organisasi Persatuan Isteri Prajurit TNI Angkatan Udara), Jumat (15/3), menggelar donoh darah yang dipusatkan di Aula Makodim 1202 Singkawang di Jalan Alianyang. Setidaknya, seratusan pendonor ikut menyumbangkan darah untuk kemanusiaan. Merr eka bekerjasama dengan Palang Merah Indonesia (PMI) Cabang Singkawang. “Semoga darah ini sangat bermanfaat,” kata ketua Persit Kartika Chandra Kirana Cabang Singkawang, Endang Parjiyo, t kemarin, kepada Pontianak Post, di Singkawang. Sebelum melakukan donor, baik ibu-ibu maupun prajurit TNI diperiksa terlebih dahulu oleh tim medis dari PMI. Bila memungkinkan, langsung diambil darah mereka. Namun, jika yang bersangkutan dalam kondisi tidak sehat, dipersilakan pulang.

Menurut Endang, donor darah merupakan rangkaian kegiatan HUT dua organisasi tersebut. “Ini adalah bagian dari kepedulian kita untuk masyarakat. Semoga hasil donor ini bermanfaat bagi kehidupan,” kata perempuan yang memiliki tiga buah hati ini. Selain donor darah, kata Endang, juga digelar ceramah keluarga yang bertemakan membina keharmonisan keluarga, sesuai ajaran agama dan dampaknya. Narasumber yang dihadirkan antara lain ketua ICMI Kota Singkawang, Dokter Sumardi. “Pesertanya bukan hanya ibu-ibu. Tapi, para suami pun juga hadir. Mereka mendengarkan dengan seksama. Bahkan, usai ceramah agama ini, ada beberapa keluarga yang langsung berkonsultasi,” kata Endang. Perempuan asal Samarinda dan mengenakan jilbab ini, mengaku akan terus melakukan kegiatan lainnya, seperti ajangsana di kediaman para istri TNI AD yang sudah ditinggal suaminya. “Kita

bersilaturahmi dan membawa bingkisan. Bentuk kepedulian kita terhadap mereka,” kata dia. Tak hanya itu, HUT ini juga diisi dengan lomba caca, serta lomba pembawa acara membuat kue kudapan berbahan singkong, yang akan digelar pada akhir bulan. Endang menambahkan bahwa selain itu, mereka juga meramaikan Jalan Sehat Spekk takuler Pontianak Post, yang akan dilaksanakan, Minggu (24/3) pukul 06.00 WIB di Halaman Kantor Wali Kota Singkawang. “Kita sudah membeli tiket. Jadi, kita siap ikut,” kata Endang. Ketua DPRD Sediakan Doorr prize Ketua DPRD Singkawang, Thjai Chui Mie, memastikan hadir dalam perhelatan Jalan Sehat Spekk takuler Pontianak Post, 24 Maret pukul 06.00 WIB mendatang. Kepastian tersebut diungkapkan Thjai Chui Mie ketika Panitia JSS Pontianak Post bertandang ke ruang kerjanya, kemarin siang.

Politisi PPIB yang merupakan satu-satunya ketua DPRD perempuan di Kalbar ini, memastikan akan ikut serta dengan membawa keluarga. “Acaranya sangat baik. Pasti akan ikut serta nantinya,” janji Chui Mie. Selain membeli tiket, Chui Mie juga memastikan akan menyediakan doorprizee bagi peserta. “Untuk dapat doorprizee pastilah harus ikut,” kata dia memberikan penjelasan. Doorprizee yang akan diberikan oleh ketua DPRD tersebut sampai saat ini masih dirahasiakan. “Nanti, tunggu saja tanggal

mainnya, pasti akan terlihat,” kata Chui Mie. Sementara itu, sejumlah warga berdatangan untuk membeli tiket. “Kami ingin memastikan membeli tiket. Khawatir tidak kebagian,” kata warga yang membeli tiket sebanyak lima lembar ini. “Semua ini untuk keluarga,” kata dia. Hal yang sama juga diakui oleh politisi PBB Kota Singkawang, Zainal Abidin. Dia memborong tiket sebanyak 25 lembar, yang akan diberikan kepada keluarganya. “Keluarga memang suka mengikuti acara ramai-ramai seperti ini, apalagi

berhadiah. Pasti mereka suka,” kata legislator yang tinggal di Kecamatan Singkawang Utara ini. Koordinator Penjualan Tiket Kantor Pontianak Post Singkawang, Uddin Alsani, mengakui begitu banyak warga yang memesan tiket menjelang pelaksanaan jalan sehat tersebut. “Kita pun membagi kerjaan dengan kawan-kawan. Jadi, sampai malam pun kita tunggu bila ada yang hendak membeli tiket,” kata Uddin. Uddin juga mengungkapkan bagaimana warga dari Ka-

bupaten Bengkayang, sangat berminat untuk mengikuti kegiatan jalan sehat tersebut. “Kita pun memberikan kesempatan mereka untuk datang membeli tiket, kemudian langsung mengisi lembaran yang tersedia,” kata Uddin. Sekretaris Panitia JSS Pontianak Post, Herly Kusmayadi, mengatakan bahwa pihaknya sudah siap melaksanakan kegiatan tersebut. “Tadi (kemarin, Red) kita sudah ketemu dengan Wali Kota. Wali Kota memastikan akan melepas peserta jalan sehat,” kata Herly. (*)

Panen Padi yang Membanggakan

Pemupukan Berimbang, Hasilkan 9,4 Ton Perhektar Di Kelurahan Sedau, Singkawang Selatan, Kamis (14/3) siang, berlangsung panen dengan sistem demplot pupuk berimbang. Hasilnya sangat memuaskan petani. Apalagi, dalam penanaman menggunakan pupuk organik yang diproduksi sebuah perusahaan pupuk Kota Singkawang, PT Sinka Sinye Agrotama (SSA)

-

a . a k n , n a T a i a k a h


Pontianak Post 6DEWX0DUHW

5#/$#5



DPRD Sesalkan Pelayanan Feri Penyeberangan

 +

SAMBAS – Paska kebakaran yang menghanguskan 25 ruko di Pasar Segarau Desa Segarau Tebas, minggu lalu, membuat anggota DPRDKabupatenSambasdan masyarakat geram. Ini terjadi lantaran terjadinya keterlambatan kendaraan pemadam kebakaranyanghadirdilokasi kebakaran. Menurutmereka,keterlambatan ini terjadi dikarenakan lambannya pelayananferi penyeberangan dalam menyeberangkan mobil pemadam kebakaran, dari Dermaga TebasKualamenujuDermaga Perigi Piai. Lambannya pelayanan feri penyeberangan Pangkalan Tebas Kuala inilah yang membuat anggota DPRD Dapil III Sambas kesal. “Yang kita kesalkan kenapa pihak ASDP, kapal feri yang melayani rute Tebas Kuala – Perigi Piai, tidak memprioritaskan penyeberangan mobil pemadam kebakaran yang akan memadamkan kebakaran di Pasar Segarau? Akibat keterlambatan tersebut, armada kebakaran dari Tebas, Semparuk, dan Sam-

bas jadi terlambat berada di lokasi kebakaran. Bahkan, pemadam dari Kota Sambas lebih memilih balik kanan (kembali) karena tidak dilayani oleh pihak feri,� kesal Jamiat Jufri, anggota DPRD Kabupaten Sambas dapil III yang didampingi Usa Maliki, dan Syahrial, ketua Forum Peduli Percepatan Pembangunan Jembatan Mensere – Segarau (FP3JM), baru-baru ini kepada Pontianak Post, di Gedung DPRD Kabupaten Sambas. PihakASDP,kataJamiat,seharusnyalebihmengedepankanpenyeberanganarmadapemadam kebakaran daripada penumpang umum, lantaran menyangkut keselamatan korban kebakaran. Melihat darisegipelayanan tersebut, pihaknya sangat menyesalkan pelayanan yang diberikan. Dia mengungkapkan, sudah dua kali pelayanan seperti itu diberikan pihak ASDP Pangkalan Tebas Kuala. Sebelumnya, menurutnya, pelayanan yang sama juga dirasakan oleh armada pemadam kebakaran Jawai dan

instansi terkait. Dia berharap agar jangan sampai kejadian yang sama terulang kembali. â&#x20AC;&#x153;Bupati harus tegas dalam hal ini, dengan memanggil pihak terkait seperti pihak ASDP dan Dinas Perhubungan,â&#x20AC;? tegas Jamiat. Jamiatberharapagarjangan sampaiakibatpelayananyang diberikan ASDP pangkalan Tebas tersebut, menyebabkan kepercayaan masyarakat menjadi hilang. â&#x20AC;&#x153;Kalau pemadam kebakaran dari Tebas, Semparuk, dan Sambas cepat sampai, kemungkinan korban akibat kebakaran tersebut tidak sebesar saat ini, berjumlah 25 ruko. Bahkan ada satu orang korban yang harus kehilangan uang tunai dengan nilai mendekati satu miliar. Atas pelayanan tersebut, masyarakat sangat kecewa +$5,.851,$7+$0$3217,$1$.3267 karenapelayananyangdiberi.(/8+.$1/$<$1$1$6'3.HWXD)RUXP3HGXOL3HUFHSDWDQ3HPEDQJXQDQ-HPEDWDQ0HQVHUHÂą6HJDUDX )3-0 6\DK kan sangat lambat. ASDP ULDO$QJJRWD'35'-DPLDW-XIULGDQ8VD0DOLNLPHQJHOXKNDQSHOD\DQDQIHULSHQ\HEHUDQJDQ'HUPDJD7HEDV.XDODPHQXMX Provinsidimintadalamhalini 'HUPDJD3HULJL3LDL untukdapatmenindak kepala â&#x20AC;&#x153;Pelayanan serupa kali kesal,â&#x20AC;? ujar Jamiat dengan Syahrial, meminta agar Bu- ASDP Tebas, Aan Arianto, Jawai Selatan, ketikaakan ikut patiSambasdapatmemanggil sebelum masyarakat yang memadamkan kebakaran di ini diulangi lagi oleh pihak suara lantang. Atas pelayanan tersebut Ja- Kepala Dinas Perhubungan, bertindak,â&#x20AC;? ungkap Jamiat Pasar Tebas di tahun 2010 ASDP. Atas pelayanan terselalu. but, masyarakat benar-benar miat bersama Usa Maliki dan pihak ASDP, serta beberapa kesal. (har)

 +

Kades â&#x20AC;&#x2DC;Nyalegâ&#x20AC;&#x2122; Sah-sah saja, Giliran Apdesi Angkat Bicara SAMBASâ&#x20AC;&#x201C;Sejumlahkepala desa yang tergabung dalam Asosiasi Pemerintahan Desa Seluruh Indonesia (Apdesi) Kabupaten Sambas, angkat bicara mengenai pencalonan mereka sebagai anggota legislatif. Mereka bersepakat tetap akan mencalonkan diri dalam Pemilu 2014 dan optimis mampu meraih kursi di DPRD.

 +

Sikap mereka ini sekaligus menjawabpernyataansejumlah kalangan, seperti tokoh politikmaupunanggotaDPRD yangmemandangsiniskeinginan mereka tersebut. â&#x20AC;&#x153;Selaku kades, kami tetap mengikuti aturan undang-undang (UU). Namunlangkahtersebuttidak menyurutkan kami untuk maju sebagai caleg, karena ini merupakan hak bagi siapap-

un,â&#x20AC;? ungkap sekretaris Apdesi Kabupaten Sambas, Deni Abdul Hadi, dalam Rapat Apdesi membahaspencalonankades sebagai caleg di Pemilu 2014, baru baru ini. Menurutnya,denganadanya statemen yang terkesan memojokkan mereka, justru lebih memotivasi untuk menyukseskan langkah merebut kursi di DPRD.

â&#x20AC;&#x153;Makadariitu,kitamengimbau kepada kades yang mencalonkan diri sebagai caleg, baik di kabupaten maupun provinsi, bisa menerima konsekuensinya. Karena UU yang berlaku menetapkan harus munduratau mundursementara dari jabatan. Artinya kita tetapmajudenganalasan kita tetap menghormati UU yang berlaku di Indonesia,â&#x20AC;? ungkap dia. Deni, sapaan akrab Kades Sungai Kelambu, Tebas ini, menjelaskan, sesuai Surat Edaran (SE) Menteri Dalam Negeri (Mendagri) Nomor 140/2661/SJ tertanggal 2 September 2008, bahwa surat edaran tersebut mengatur penonaktifankadesdanmemberhentikan perangkat desa, jika maju sebagai caleg dalam Pemilihan Umum (Pemilu) 2009. â&#x20AC;&#x153;Haltersebutbukanlahmerupakantantangan.Jadikanlah inisebagaimotivasibagikades untuk maju. Mungkin karena khawatir atau sedikit kacau dengan banyaknya calon-

calon kades yang menjadi caleg, jadi mereka beranggapan bahwa kades-kades yang akan mencalonkan diri sebagai (anggota) DPR harus berhenti,dikajidariperaturan UU yang berlaku, misalnya kajian peraturan UU Nomor 8 Tahun 2012,â&#x20AC;? tegasnya. Jika dikaji, dijelaskan dia, tidak secara eksplisit mengatakankadesdanperangkatnya harusberhentisementaraatau berhenti otomatis, karena dalam UU Nomor 8 Tahun 2012 dan PP Nomor 72 Tahun 2005 menyatakan kades dilarang dilibatkan dalam kampanye dankadestidakbolehmerangkap jabatan menjadi anggota DPRD. â&#x20AC;&#x153;Terkaitpersoalanini,Mahkamah Konstitusi (MK) juga telah memutuskan bahwa kades yang mencalonkan diri kembali sebagai calon kepala daerah (incumbent) dalam pemilu kepala daerah (Pilkada)harusdiberhentikan sementara dari jabatanya sebagai kepala daerah. Namun menurut kajian UU tersebut,

teknisnyakadesdanperangkat desayang mencalokandiri sebagaicalegharusmengajukan permohonan tertulis kepada bupati atau wali kota yang ditembuskan kepada camat dan badan permusyawaratan desa (BPD), dan surat permohonan itu menjadi dasar bupati mengeluarkan surat pemberhentian dan mengangkat pejabat sementara kades atau perangkat desa yang baru,â&#x20AC;? jelasnya. Sementara Irfan, ketua Apdesi Kabupaten Sambas, meminta Bupati untuk segera mengambil sikap terkait beberapa kepala desa yang hendakmencalonkandirisebagai anggota legislatif. Namun, dia menambahkan, untuk keinginan beberapa kades ini, statemen anggota DPRD menjadi sesuatu yang tidak perlu. Karena, menurutnya, penyelenggara Pemilu adalah Komisi Pemilihan Umum (KPU), sehingga biarlah KPU yang menyampaikan aturan tersebut. Dia berharap, jangan

sampai muncul kesan di masyarakat bahwa ada upaya menghalangi kades menjadi calon anggota legislatif. â&#x20AC;&#x153;Sesuai hasil rapat Apdesi, kita tetap mengikuti aturan dan juga tetap maju sebagai caleg. Jadi kita sudah menerima risikonya dan menunggu keputusan resmi dari KPU, terkait majunyakadessebagai caleg,â&#x20AC;? tegas Kades Singaraya, Semparuk ini. Hal senada juga diungkapkan Mayadi Satar, kepala Desa Nibung, Paloh. Menurut dia, hasil rekomendasi Rapat Apdesi, meminta agar Pemkab segera mengeluarkan keputusan dengan UU yang sudah ada. â&#x20AC;&#x153;Jangan mengeluarkan peraturan yang bertentangan denganperaturan yang sudah ada yang lebih tinggi, terutama tentang majunya kades sebagai caleg. Maka dari itu, kita meminta agar Pemkab Sambas dapat mengeluarkan keputusantentangUUNomor 72, termasuk Keputusan MK,â&#x20AC;? pungkasnya. (har)

 +


22

sanggau

Pontianak Post

Peluang Terima PNS Kecil

hut persit

Santuni Janda TNI SANGGAU—Dalam rangka memeriahkan HUT ke 67 Persit, Persit Kartika Chandra Kirana Kodim 1204 Sanggau melaksanakan berbagai kegiatan olahraga yang berlangsung di halaman Makodim 1204 Sanggau, Jumat (15/3). Ketua Persit Kartika Chandra Kirana Cabang 48 Kodim 1204/Sanggau, Ny Titi Susanti Zulkifli menyampaikan dalam rangka memperingati HUT Persit tersebut, berbagai kegiatan olahraga yang diselengarakan antara lain olahraga bakiak, kemudian olahraga bola dangdut dan bola voli.  Selain olahraga tersebut, HUT Persit juga diwarnai dengan anjangsana ke Warakawuri dengan memberikan santunan kepada para janda anggota TNI yang membutuhkan bantuan. “Ini tugas kita bersama membantu mereka, apalagi yang kita bantu ini merupakan keluarga prajurit yang sudah mengabdikan hidupnya untuk bangsa dan negara,” ujarnya.  Ia berharap, berbagai kegiatan jelang HUT Persit Chandra Kirana ke 67  dapat dijadikan sebagai sarana untuk mempererat rasa kekeluargaan antar anggota Persit. Sehingga menurutnya, dalam urusan perlombaan sendiri, kalah menang merupakan hal yang biasa dalam suatu pertandingan. Yang penting adalah kebersamaan/hubungan silaturahmi tidak terputus.  “Kami juga nanti akan mengadakan lomba memasak/membuat nasi goreng yang diikuti oleh para Danramil yang ada di Kodim 1204/ Sanggau. Puncaknya HUT ke 67 Persit nanti akan dilaksanakan tanggal 9 April,” katanya. (sgg)

Sabtu 16 Maret 2013

ATASI LONGSOR: Alat berat diturunkan untuk mengatasi longsor di tiga titik.

Awang/Pontianak Post

Longsor di Kecamatan Boyan Tanjung Selesai Diatasi PUTUSSIBAU – Longsor yang terjadi di Dusun Sukma, Desa Nanga Sangan Kecamatan Boyan Tanjung pada pertengahan bulan lalu telah selesai ditangani Dinas Bina Marga dan Pengairan Kabupaten Kapuas Hulu melalui UPJJ Wilayah I. Tiga titik longsor yang sempat menutup akses jalan tersebut telah seratus persen diatasi. “Perbaikan longsor ini menggunakan dana darurat. Dinas Bina

Marga akan sesegera mungkin melakukan perbaikan yang bersifat darurat apabila dana tersebut masih ada,” terang Kepala Dinas Bina Marga dan Pengairan Kabupaten Kapuas Hulu, Ana Mariana ST MM. Sementara itu Kepala UPJJ Wilayah I, Dinas Bina Marga dan Pengairan Kabupaten Kapuas Hulu, M. Rolindar Amd menambahkan penanganan longsor di Dusun Sukma dilaksanakan selama lima

C

m

y

k

hari dengan menggunakan satu unit exavator dan dua unit dump truck. “Exavator kita sewa dari pihak ke tiga sedangkan dump truck milik Pemkab Kapuas Hulu,” jelasnya. Untuk penanganan tersebut, terang Rolindar, selain membuka kembali ruas jalan, bagian tebing juga dibentuk turap tebing. “Penanganan itu selesai pada 3 Maret lalu. Sudah seratus persen,” tutupnya. (wank)

SANGGAU-Untuk tahun 2013, penerimaan calon Pegawai Negeri Sipil (CPNS) di lingkungan Pemerintah Kabupaten (Pemkab) Sanggau kecil kemungkinan untuk dilaksanakan. Pasalnya, pemerintah pusat menilai anggaran belanja pegawai telah melebihi dari 50 persen dari apa yang telah ditentukan. Demikian disampaikan Bupati Sanggau, Setiman H Sudin belum lama ini. Setiman mengatakan, bahwa dirinya telah mengusahakan untuk penerimaan CPNS di tahun ini. Menurut Setiman, jika Sanggau ingin menerima CPNS lagi, berarti anggaran harus dinaikkan. Sehingga dengan naiknya anggaran tersebut, belanja barang dan modal itu semakin besar dari pada belanja pegawai. “Kita sudah mengusahakan tenaga-tenaga teknis. Diberi atau tidak, tidak

masalah. Kalau tidak diberi saya sudah bekerja dengan apa adanya dan maksimal,” tutur Bupati. Ditambahkan Setiman, kalau dulu bekerja dengan jumlah pegawai sedikit semangat kerjanya tinggi. Semangat kerja yang tinggi sebaiknya dipertahankan. “Tapi terkadang orang banyak tunggu menunggu. Tapi lagi-lagi, jangan menambah pegawai dulu. Terus terang, saya sudah menyampaikan bagaimana Pemerintah Daerah harus meningkatkan PAD,” katanya. Saat pertama kali menjadi Bupati Sanggau, APBD Sanggau saat itu Rp450 miliar dan sekarang sudah Rp1,4 triliun. PAD dulunya Rp11 miliar sekarang menjadi Rp56 miliar dan tabungan Pemda di Bank Kalbar dulunya hanya Rp3,7 miliar sekarang telah menjadi Rp24 Miliar. (sgg)


Pontianak Post •

Sabtu 16 Maret 2013

sintang

Kajari-Dandim Dukung Jalan Sehat Berhadiah Utama Rumah Lengkap Isi

+

SINTANG—Kepala Kejaksaan Negeri serta Komandan Kodim 1205 Sintang turut mendukung pelaksanaan jalan sehat spektakuler dalam rangka hari ulang tahun ke-40 Pontianak Post. Dua pimpinan forum komunikasi pimpinan daerah Sintang ini pun menyatakan kesiapan untuk hadir saat hari pelaksanaan, membaur dengan seluruh peserta. Kajari Sintang Moch Djumali tidak ketinggalan ikut memborong tiket jalan sehat. Tiket tersebut akan diperuntukkan bagi seluruh keluarga besar Kejari. Kemudian Kajari juga mengatakan kalau pihaknya akan menyiapkan doorprize bagi peserta, berupa dua unit sepeda. Dandim 1205 Sintang Letkol Inf Parlindungan Hutagalung ikut memastikan akan menyokong penuh jalan sehat, yang akan digelar pada 24 Maret, ini. “Kita pasti dukung,” kata dia. Saat pelaksanaan, Dandim juga menyatakan akan turut hadir. Hingga kemarin Jumat (15/3), permintaan tiket terus berdatangan. Begitu pula doorprize sudah siap diserahkan kepada peserta jalan sehat yang beruntung. Seperti televise, telepon genggam, sepeda, sepeda motor, tanpa terkecuali satu unit rumah lengkap isi di Pontianak. Sementara rute pelaksanaan jalan se-

+

hatnya yakni melintasi jalan Pangeran Kuning-Pangeran Antasari-M-Saad- dan kembali ke Jalan Pangeran Kuning. Startmaupun finisnya di Makorem 121/ABW Sintang. Start dimulai pukul 06.30. Jalan sehat spektakuler ini sendiri digelar serentak di tujuh kota/kabupaten di Kalimantan Barat pada 24 Maret mendatang. Untuk di Sintang, Pontianak Post bekerjasama dengan Korem 121/ABW dalam penyelenggaraannya. Keikutsertaannya juga terbuka bagi masyarakat Kabupaten terdekat. Seperti masyarakat Melawi, Kapuas Hulu serta Sekadau. Untuk menjadi peserta jalan sehat,  sangat mudah.   Cukup dengan membayar Rp.10.000,   satu kupon jalan sehat bisa didapatkan. Yang  tiap kupon tersebut nanti akan diundi buat menentukan pemenang. Baik untuk

hadiah utama berupa satu unit rumah maupun hadiah menarik lainnya. Jalan sehat ini, selain   berhadiah utama  satu unit rumah lengkap furniture,  juga menyiapkan hadiah menarik seperti sepeda motor, televisi dan berbagai macam lainnya juga akan diberikan kepada peserta yang beruntung. Dan semua peserta akan mempunyai kesempatan sama. Sementara untuk mendapatkan kupon jalan sehat bisa dengan mendatangi kantor Biro Pontianak Post Sintang jalan JC Oevang Oeray atau menghubungi nomor telepon 081345107773 (Sutami Biro Pontianak Post Sintang). Pelaksanaan jalan sehat HUT ke 40 Pontianak Post di Sintang ini juga turut didukung harian Kapuas Post. (stm)

23

Kodim 1205 Perkuat Pembinaan Teritorial SINTANG—Kodim 1205 Sintang menjalankan pola pembinaan teritorial dalam menjaga wilayah perbatasan. Pasalnya Sintang merupakan wilayah satu dari lima kabupaten di Kalimantan Barat yang berbatasan langsung dengan Malaysia. Pembinaan teritorial dimaksudkan agar kesadaran bela negara dan cinta tanah air tetap dipegang warga diperbatasan. Demikian kata Dandim 1205 Sintang Letkol Inf Parlindungan Hutagalung, kemarin. Menurut Dandim, TNI membantu mengajar di sekolah di daerah perbatasan menjadi salah satu bentuk pembinaan teritorial yang dilakukan. Kemudian melalui program TMMD. Kedua langkah tersebut sudah terlaksana serta akan terus berlanjut. Pasalnya hubungan TNI dan masyarakat memang tidak bisa terpisahkan. Karena itu, lanjut Dandim, peran Koramil serta Babinsa terus diperkuat. Hubungan

dengan masyarakat senantiasa dapat dibangun, agar pembinaan teritorial mampu berjalan maksimal. Pembinaan tersebut dinilai penting guna membangun semangat patriotisme, serta jangan sampai luntur. Dandim menambahkan TNI juga berkoordinasi dengan pemerintah Kabupaten Sintang dalam pembinaan teritorial di wilayah perbatasan. Dan, pihaknya selalu mendukung program pemerintah untuk membangun serta memajukan kawasan perbatasan. Sementara mengenai kerawanan di wilayah perbatasan, menurut Dandim, tetap berpotensi menjadi lalu lintas perdagangan illegal. Karena itu, koordinasi dengan kepolisian juga dilakukan. Kendati demikian, lanjut dia, perbatasan di wilayah Sintang, dinilai cukup aman. Hanya beberapa tahun lalu, sempat diamankan alat berat. Dandim menambahkan, sulit dipungkiri jika masyarakat

Parlindungan Hutagalung

diperbatasan acap kali keluar masuk Malaysia melalui jalur tikus. Aktifitas tersebut karena kepentingan ekonomi masyarakat setempat. “Misal masyarakat kita menjual hasil bumi ke Malaysia. Kemudian pulangnya membawa kebutuhan pokok,” kata Dandim. “Tapi itu masih hanya untuk memenuhi kebutuhan sendiri. Kalau sampai beli barang berkarung-karung dan di jual ke Sintang, masih belum ditemukan,” kata Dandim. (stm)

+

+

cmyk


-#27#5



Pontianak Post 6DEWX0DUHW

Ledeng Macet Bupati Panggil Direktur PDAM

,1)5$6758.785

Tuntaskan Gertak Sungai Kapar

 +

SETELAH sekian lama tak jelas arah, akhirnya Dinas Pekerjaan Umum Kabupaten Sekadau melalui Bidang Bina Marga berani memastikan jembatan Sui Kapar, Desa Sui Ringin rampung pengerjaannya pada 2013 ini. â&#x20AC;&#x153;Kita berani jamin jembatan itu beres tahun ini,â&#x20AC;? ungkap Kepala Bidang Bina Marga, Heri Handoko Susilo, ST. Dalam perencanaan, jembatan yangmenjadiaksesvitalmasyarakat Sui Ringin itu dibangun dengan modelkomposit.â&#x20AC;?Girdernyamenggunakanbahanbaja,denganlantai beton,â&#x20AC;? terang lelaki berbadan jangkung itu. Seperti diketahui, jembatan +HUL+DQGRNR6XVLOR67 tersebutambruklantaranpondasinyatidakkuatmenahanteksturtanahyanglongsor.Mengantisipasi faktor alam yang bisa mengancamkapan saja,Dinas PU dan Pertambangan merencanakan pengerjaan pondasi baja kokoh. Tiang-tiang baja itu nantinya akan ditanamkan ke dalam lapisan bebatuan. â&#x20AC;&#x153;Tiang akan ditancap ke dalam batu sedalam satu meter. Jadi kita yakin tidak akan ambruk lagi,â&#x20AC;? ucap Heri mantap. Sebelumnya,padatahunanggaran2012,PemkabSekadau telahmenganggarkansenilaiRp1,2miliaruntukpembangunan abutment dan pemasangan tiang baja. Namun, akibat keterlambatan datangnya material baja, pembangunan tidak sampai pada penancapan. â&#x20AC;&#x153;Berdasarkan laporan di lapangan, tiang baja terlambat datang. Jadi, penancapan tidak dapat dilakukan. Tapi tiang baja sudah ada di gudang dan siap ditancap begitu pekerjaan tahun ini dimulai,â&#x20AC;? pungkasnya. (nie)

*2721*52<21*

Warga Swadaya Perbaiki Jalan WARGA Gang Rawa Bhakti melakukan perbaikan jalan gang secara swadaya, Minggu (10/3) kemarin. Perbaikan dilakukan lantaran kondisi ruas jalan gang telah rusak parah. Salah seorang warga yang ikut dalam kegiatan itu, Bastianus mengungkapkan ide untuk memperbaiki secara swadaya muncul atas inisiatif masyarakat setempat. Bastianusmenuturkan,wargaGangRawaBhaktiyangberjumlahlebihkurang30KKmasing-masingmenyumbangkan uangsenilaiRp110.000perkepalakeluargauntukkeperluan memberi bahan material. Adapun material yang sudah terkumpul yakni pasir, kerikil, kawat besi dan semen. â&#x20AC;&#x153;Ini merupakan kesepakatan warga yang tinggal di komplekkarenajalangangmerupakanaksessatu-satunyadisini. Segalakebutuhansepertimaterialdanalat-alatpertukangan sudah tersedia,â&#x20AC;? tutur pria yang akrab disapa Uju. Kondisi jalan gang yang dibangun Pemkab Sekadau pada tahun 2007 silam itu tampak rusak parah. Di sejumlah titik, lubang tampak menganga. Badan jalan yang terbuat dari semen telah terkelupas seiring waktu. Kondisi itu jelas menyulitkan warga untuk keluar masuk gang Rawa Bhakti. (nie)

 +

Emanuel: Pipa Induk IPA II Pecah

$:$1*3217,$1$.3267

3$1(13HQJHOROD%DODL%HQLK,NDQ %%, .ODVLQGLVDNVLNDQSHMDEDWGDUL'LQDV3HULNDQDQ .DSXDV+XOXSDQHQELELWLNDQDUZDQDVXSHUUHG

Berhasil Pijahkan Arwana Super Red KALIS â&#x20AC;&#x201C; Rabu (13/3) Balai Benih Ikan (BBI) Klansin kembali berhasil memanen anak ikan arwana super red (Scleropages formosus). Pada penen ikan arwana super red yang kelima kalinya ini, para pengurus BBI Klansin turut didampingi Dinas Perikanan Kabupaten Kapuas Hulu diwakili Sekretaris Dinas, Ir Rismawati. â&#x20AC;&#x153;Untuk setingkat BBI di Indonesia, BBI Klansin lah yang pertamaberhasilmemijahkan arwana super red,â&#x20AC;? terang Risma sembari menyaksikan proses pemijahan arwana super red di kolam penangkaran BBI Klansin. Risma menuturkan hasil pemijahan arwana super red tersebut akan dijadikan bakal calon induk di BBI Klansin. DengandemikianBBIKlansin dapat mengembang biakan lebihbanyakarwanasuperred. â&#x20AC;&#x153;Hasil panen atau pemijahan ini akan kita kembangbiakan lagi untuk dijadikan induk di BBI Klansin ini. Agar kedepan

BBI Klansin bisa memijahkan lebihbanyakikanarwanajenis ini,â&#x20AC;? imbuh Risma. Sementara itu Kepala BBI Klansin,RuslanSutrisna mengatakan dari lima kali pemijahan yang sudah dilakukan, tiga diantaranya memiliki rentang waktu yang cukup singkat yakni dua sampai tiga bulan. â&#x20AC;&#x153;Tiga kali pemijahan terakhir waktunya cukup dekat. Pertama Oktober 2012 berhasil memijah 31 ekor, kedua Desember 2012 berhasil memijah 42 ekor dan pemijahan kali ini yang berhasil memijah 41 ekor,â&#x20AC;? terang pria yang akrab disapa Olan ini. Halini,tambahOlan,dikarena BBI Klansin telah menemukan metode baru dalam mendukungprosespemijahan arwana super red. Metode ini diterapkan pada stabilitas ekosistem dari kolam ikan arwana tersebut. â&#x20AC;&#x153;Dalam metode ini kita tidak menggunakan obat atau punsemacamnyakepadaikan

arwana. Di sini kita murni penyesuaian lingkungan kolam, dengan mengatur kondisi air dan pasang-surutnya termasuk pola pemberian pakan,â&#x20AC;? papar Olan. (wank)

PUTUSSIBAU â&#x20AC;&#x201C; Sudah tiga hari ini air ledeng dari PDAM tidak mengalir. Kaum ibu utamanya mengeluhkan karena terkendala dalam kegiatan masak, cuci dan lainnya. Salah satu diantaranya Anti, ibu rumah tangga warga Dogom. Ia mengaku stok air di rumah sudah sangat menipis. Sehingga untuk berbagai keperluaniaharusberbagidengan anggota keluarga yang lain. â&#x20AC;&#x153;Adatongpenampunganair hujan tapi airnya pun sudah habis. Jadi terpaksa berbagi stok air yang masih tersedia. Mau mencuci pakaian masih dibatalkan. Lihat sehari dua ini kalau tidak mengalir mau tak mau harus mandi dan mencuci ke Sungai Kapuas,â&#x20AC;? kata Anti.

Bupati Kapuas Hulu, AM Nasir mengaku mendapatkan sejumlah sms dari warga terkait persoalan air yang tak mengalir itu. Bahkan Nasir menegaskan akanmemanggil direktur PDAM untuk meminta penjelasan. â&#x20AC;&#x153;Akan dipanggil. Apakah ada kerusakan atau seperti apa. Jika ada kerusakan harus dapat ditangani dengan segera,â&#x20AC;? ungkap Nasir. Sementara itu, Direktur PDAM Putussibau, Emanuel Haraan Riyanto, mengatakan tidak mengalirnya air PDAM karena ada kerusakan pipa indukdiInstalasiPengolahanAir (IPA) II yang menjadi sumber air masyarakat Kota Putussibau. Emanuel mengatakan telahdilakukanperbaikandan air sudah mulai disalurkan ke pipa jaringan. â&#x20AC;&#x153;Mudah-mudahan besok (hariini,red)airsudahmengalirnormal,â&#x20AC;?pungkasEmanuel. (wank)

 +

Akan Gelar Lelang Jabatan PUTUSSIBAU â&#x20AC;&#x201C; Bupati AM Nasir, Kamis (14/3) memimpin Pengambilan sumpah/ janji danPelantikanPejabatStruktur Eselon II,III dan IV di lingkungan Pemerintah Kabupaten KapuasHulu.Dalampelantikan ini, 63 orang Pegawai Negeri Sipil (PNS) terdiri dari 1 g pejabat eselon II, 11orang pejabat eselon III, dan 51 orang pejabat eselonIVdiambilsumpahjabatannya. Pengambilan sumpah jabatan dilaksanakan di Aula Kantor Bupati Kabupaten Kapuas Hulu tersebut turut dihadiri sejumlah Kepala SKPD Kabupaten Kapuas Hulu dan jajaran Forkumpinda Kabupaten Kapuas Hulu. Dalamsambutannya,Bupati

mengatakan langkah penyegaran ini merupakan wujud untuk menggapai akselarasi pembangunan yang maksimal di Kabupaten Kapuas Hulu. OlehsebabituIa berpesanagar 63 orang pejabat yang telah diberikan amanah tersebut melakukanpelayananterhadap masyarakat dengan sebaik mungkin. â&#x20AC;&#x153;Ini hendaknya dipahami untuk meningkatkan akselarasi pembangunan dari PemerintahKabupaten Kapuas Hulu. Tuntutan, keinginan dan harapan masyarakat tentunya harus direspon dengan sesegera mungkin,â&#x20AC;? pesan Bupati. Nasir pun mengakui dalam pemenuhan jabatan di Pemkab Kapuas Hulu sedikit rumit.

Berbagai pertimbangan berat dilakukan, terutama dalam pemenuhan pejabat aselon II. â&#x20AC;&#x153;Dari yang dilantik ini mungkin masih banyak yang belum diakomodir karena ini melalui pertimbangan yang cukup rumit. Kita upayakan dengan menyisir dari pangkat dan golongan,karenamemangbelum ada yang sesuai,â&#x20AC;? aku Nasir. Nasir juga mencanangkan kedepannyaKapuasHuludapat menerapkansistemlelangjabatan. Dengan demikian komitmen dalam membangun daerah akan lebih nyata, disamping menonjolkan sisi transparansi. â&#x20AC;&#x153;Kita harap kedepan bisa menerapkanlelangjabatan,â&#x20AC;? imbuh Bupati. (wank)

 +


Pontianak Post

POTRET

Bawang Masih Normal

+

KETAPANG

Sabtu 16 Maret 2013

Jembatan Pawan II Dibersihkan

MELAMBUNGNYA A harga bawang di berbagai daerah, tidak berpengaruh di Kabupaten Ketapang. Kepala Dinas Koperasi, UKM, Perindustrian, dan Perdagangan Kabupaten Ketapang, Syahrani, mengatakan, sampai dengan Jumat (15/3), harga bawang masih stabil. “Sampai saat ini masih normal, tidak ada kel u h a n d a r i m a s y a r a k a t d i l a p a n g a n ,” k a tanya saat ditemui di kantornya, kemarin (15/3). Sementara itu, kepala Bidang Perdagangan, Simon Petrus, juga mengungkapkan hal yang sama. Menurutnya, hasil dari pantauan tim pengawas di lapangan, harga bawang sampai dengan Jumat (15/3), masih belum ada reaksi atau masih dalam kondisi normal. “Harga masih normal, namun bukan berarti aman. Bisa saja harga bawang naik, mengingat kondisi di berbagai daerah, harga bawang naik semua,” ungkap Petrus. Dia juga menjelaskan, pihaknya tidak bisa memberikan jaminan kalau harga bawang tidak akan naik. Karena, menurutnya, untuk memenuhi kebutuhan bawang di Ketapang, harus mendatangkan dari daerah lain. Termasuk juga, tentu saja dari Pulau Jawa. “Bawang di Ketapang masuk dari Pontianak dan Jawa. Mudah-mudahan tidak ada kendala. Sedangkan langkah untuk mengantisipasi harga dan stok bawang, kami melakukan koordinasi dengan pemasok bawang ini,” tuturnya. Syahrani

Untuk mengetahui harga barang-barang sembako di lapangan, Harga masih pihaknya rutin melakukan pemantauan setiap normal, namun Senin. bukan berarti Selain harga, Petrus juga mengatakan kaaman. Bisa saja lau stok bawang juga normal. Namun, untuk harga bawang naik, sementara ini, pihaknya mengaku masih belum mengingat kondisi mendapat informasi resmi terkait naiknya di berbagai daerah, harga bawang ini. “Kita harga bawang naik akan terus memonitor semua harganya di lapangan,” ujarnya. Dia juga mengakui jika di Ketapang tidak ada agen resmi untuk bawang ini. Sehingga, menurutnya, siapa saja boleh m

25

AHMAD SOFI/PONTIANAK POST

SERAHKAN : Penyerahan secara simbolis buku dan kartu tabungan KPN oleh kabag Keuangan Setda Pemkab Ketapang, Marwannor, kepada salah satu anggota koperasi, beberapa waktu lalu.

Jadikan RAT sebagai Evaluasi Lebih Baik Koperasi Praja Nirmala Gelar RAT 2012 KETAPANG

K

i

pendekatan pemberdayaan masyarakat menjadi prioritas,” katanya, kemarin. Dia melanjutkan, organisasi koperasi harus aktif membangun dirinya. Pemerintah, dikatakan Buti t t tdi l k

Dengan dilaksanakan RAT KPN ini, menurutnya, merupakan sebuah momen penting dalam mengevaluasi pelaksanaan program kerja tahun 2012. Dia menegaskan, ini seb i b h b ik di

KETAPANG – Persatuan Perawat Nasional Indonesi (PPNI) Kabupaten Ketapang bersama Kodim 1203 Tanjungpura, Dinas Kebersihan dan Pertamanan Ketapang, unsur pemerinrtahan desa, beserta masyarakat, melakukan gotong royong di Jembatan Pawan II. Kegiatan ini diakukan dalam rangka memperingati Hari Ulang Tahun (HUT) PPNI ke-39. Sekitar 100 orang lebih berpartisipasi melakukan gotong-royong membersihkan jembatan sejak pukul 06.00 WIB. “HUT PPNI secara nasional itu diperingati pada 17 Maret. Namun, khusus di Ketapang, untuk memperingatinya kita sudah mulai sejak 9 Maret lalu dan puncaknya pada 30 Maret nanti,” kata ketua PPNI Kabupaten Ketapang, Ardianus Adi, di selasela kegiatan gotong royong, kemarin (15/3). Selain kegiatan gotong royong, untuk memeriahkan hari jadinya, PPNI juga menggelar berbagai kegiatan. Di antaranya cerdas cermat, donor darah, lomba penyuluhan kesehatan, seminar kesehatan, dan sunatan massal yang akan diselenggarakan di Kendawangan. “Kita libatkan 70 dari Akper, Dinas Kesehatan (sebanyak) 70 orang, perangkat desa, termasuk juga personil dari Kodim 1203 Tanjungpura,” ujarnya. Kapten Perwira Seksi Teritorial Kodim 1203 Tanjungpura, Budi, mengatakan, kegiatan gotong royong ini sendiri merupakan agenda rutin yang selalu dilakukan setiap Jumat pagi, dengan lokasi

yang berbeda-beda. Namun, dia menambahkan, kali ini secara kebetulan, dilaksanakan berbarengan dengan perayaan HUT PPNI. “Dari TNI kita turun enam personil. Selain bertujuan untuk membersihkan lingkungan, kegiatan seperti ini juga bertujuan untuk menjalin silaturrahmi. Kita berharap kegiatan seperti ini rutin digelar,” kata Budi. Selain itu, Budi juga menjelaskan, untuk menjaga agar tidak terlalu monoton dan jenuh, yang hanya melakukan gotong-royong, Kodim 1203 Tanjungpura juga menyelingi kegiatan Jumat pagi tersebut dengan agenda lain. Di antaranya senam bersama. “Kalau gotong-royong terus, bisa jenuh. Kita akan selingi dengan senam bersama, biar tidak jenuh,” tutur Budi. Sementara itu, ketua Panitia HUT PPNI ke-39, Suyatmi, mengatakan, kegiatan gotong-royong seperti ini sudah sering dilakukan oleh masyarakat. Namun, diakui dia, bergotong-royong untuk membersihkan jembatan seperti ini, sangat jarang dilakukan. “Kita fokuskan di jembatan, karena selama ini sangat jarang orang gotong-royong membersihkan jembatan. Padahal di jembatan itu perlu dibersihkan, seperti pasir yang dapat menyebabkan kecelakaan karena licin,” katanya. Dia juga menambahkan, kegiatan seperti ini akan terus dilakukan dan akan menjadi komitmen dari PPNI untuk terus menjaga kebersihan. Ini merupakan komitmen dari kami,” pungkasnya. (afi)

+

k J n m b J m s o d s “ l P d h k s p p

+

+

C

M

Y

K


26 Petuah

Siagakan ‘Water Canon’ KAPOLRES Ketapang AKBP Ari Wahyu Wijananto mengatakan bahwa Polres Ketapang mendapat kiriman mobil water canon dan mobil taktis lainnya dari Polda Kalbar. Kiriman tersebut dimaksudkan dalam mengantisipasi adanya aksi demonstran yang dapat mengganggu tahapan Pemilukada Kabupaten Kayong Utara. Mobil yang memiliki bobot hingga 10 ton tersebut, nantinya akan digunakan sebagai kendaraan untuk menghalau para demonstran, jika benar-benar akan ada aksi demo besar-besaran oleh salah satu pihak, yang tidak puas dengan sebuah hasil proses pemilihan kepala daerah di kabupaten ini. Ary Wahyu Widijananto “Semua sebagai langkah antisipasi, dan tidak akan diterjunkan jika memang tidak diperlukan,” kata Kapolres, belum lama ini. Selain mobil water canon, menurutnya, juga disiagakan beberapa unit kendaraan untuk mobilisasi personil, serta terdapat satu unit mobil logistik dan dua  mobil taktis. “Disiagakan di Polsek Sukadana,” imbuhnya.(mik)

kayong utara

Pontianak Post

Sabtu 16 Maret 2013

Tiga Kali Sortir, KPU Kerja Ekstra Ditemukan 25 Surat Suara Rusak SUKADANA – Walau harus kerja lembur, staf dan komisioner KPU Kabupaten Kayong Utara, mulai merampungkan sortir dan pengepakan logistik Pemilukada Kabupaten Kayong Utara. Hingga H-12, sebagian besar logistik untuk Panitia Pemungutan Kecamatan (PPK) sudah siap. Dari enam PPK, empat di antaranya sudah rampung dan siap didistribusikan. “Kita rampungkan dulu wilayah yang jauh, sekarang tinggal dua kecamatan di sekitar sini, Teluk Batang dan Simpang Hilir, yang belum selesai dan sekarang masih disortir,” kata divisi Logistik KPU Kabupaten Kayong Utara, Syarif Usman Assegaf, Kamis (14/3) di Sekretariat KPU Kabupaten Kayong Utara. Terkait waktu pendistribu-

M SURIMIK UNTUK PONTIANAK POST

SORTIR: Staf dan komisioner KPU terlihat sibuk mensortir kertas suara yang akan dicoblos pada Pemilukada Kayong Utara, yang akan segera dilaksanakan pada 28 Maret mendatang.

sian, diperkirakan dia, pada 17 Maret mendatang, seluruh

C

m

y

k

logistik akan dikirim ke masing-masing PPK. Selanjutnya,

dia menambahkan, logitsik tersebut akan diteruskan oleh

PPK ke masing-masing PPS, sesuai dengan jadwal yang telah ditentukan. Untuk dua kecamatan kepulauan yakni Pulau Maya dan Kepulauan Karimata, pengiriman logistik akan dilakukan pada 23 Maret mendatang. Hal itu, menurut dia, dikarenakan dalam pengiriman akan langsung didistribusikan ke masing-masing PPS. “Pengiriman kita lakukan bersamaan dengan sosialisasi dengan PPS, karena tiap PPS itu berbeda-beda pulau,” imbuhnya. Dikatakannya, sortir yang dilakukan di KPU tidak cukup satu atau dua kali sortir. Mereka bahkan harus melakukannya hingga tiga kali sortir, mulai dari penghitungan hingga pemilahan surat suara yang laik atau tidak. Hingga H-12, mereka telah menemukan 25 lembar surat suara yang mengalami kerusakan. Kerusakan dimaksud, di mana terdapat cacat, baik pemotongan di percetakan, maupun adanya surat suara yang sobek dan bahkan ditemukan tetesan tinta yang tidak sempurna. “Semua nanti kita kumpulkan dan kita buatkan berita acara pemusnahan yang rusak,” katanya. Disebutkan, temuan kertas suara yang rusak untuk sementara seperti kertas mengalami sobek dan potongan kertas suara yang tidak sesuai dari percetakan. (mik)


Pontianak Post •

Sabtu 16 Maret 2013

aneka Kalbar

27

YAK Jual Bangunan PAUD NGABANG-Pihak yayasan Abdul Kahar Kecamatan Ngabang berencana akan melakukan tukar guling terhadap satu unit bangunan yang merupakan asset dari yayasan tersebut. Bangunan yang dimaksud yakni bangunan gedung Pendidikan Anak Usia Dini (PAUD) yang berada di Desa Hilir Tengah Kecamatan Ngabang atau tepat berada disamping Klenteng Yayasan Hati Murni (YHS) Ngabang. Namun, rencana tukar guling tersebut ditentang sejumlah elemen umat Islam yang ada di Landak. Salah satunya tokoh pemuda Islam Landak, Abdul Syukur. Ditemui Kamis (14/3) di Ngabang, ia menceritakan sejarah dari bangunan tersebut. Menurutnya, bangunan tersebut merupakan peninggalan zaman Jepang. “Setelah Jepang angkat kaki dari Ngabang, bangunan itu diberikan kepada umat Islam

Ngabang. Makanya bangunan tersebut diberi nama Nadiyah yang merupakan perkumpulan Islam. Bangunan tersebut juga punya pemiliknya yakni Jalaludin, Badarudin dan Ya’ Ahim,” ujar Syukur. Dari ketiga orang pemiliknya, bangunan tersebut dihibahkan kepada salah satu tokoh masyarakat Ngabang Alm. Ya’ Jafar supaya bisa memelihara bangunan tersebut untuk kepentingan umat Islam. “Begitu Yayasan Abdul Kahar berdiri, yayasan mau mendirikan Madrasah Aliyah. Karena tidak punya bangunan, akhirnya pihak yayasanpun memakai bangunan tersebut untuk Madrasah Aliyah,” ceritanya. Ia menambahkan, setelah bangunan tersebut digunakan untuk Madrasah Aliyah, bangunan itupun dihibahkan oleh Alm. Ya’ Jafar ke yayasan Abdul Kahar. “Sekarang inipun pihak

yayasan Abdul Kahar sudah mengantongi sertifikat dan berencana akan menjual tanah berikut bangunan tersebut ke pihak lain. Inilah yang menjadi keberatan kita. Mengapa bangunan itu mau dijual. Padahal bangunan tersebut merupakan hibah untuk kepentingan umat Islam,” katanya. Dikatakannya, secara hukum, yayasan Abdul Kahar ini merupakan organisasi kemasyarakatan. Namun asset berupa bangunan yang dimilikinya merupakan milik umat Islam Kecamatan Ngabang. Ia berharap supaya pihak yayasan Abdul Kahar Ngabang mengurungkan niatnya untuk menjual bangunan tersebut kepada pihak lain. Demikian juga kepada pihak yang berminat ingin membeli bangunan itu supaya bisa membatalkan niatnya. “Apabila hal ini terjadi, kami selaku bagian

dari komponen umat Islam akan melakukan gugatan, terutama mensomasi Badan Pertanahan Nasional (BPN)

supaya tidak membalik nama sertifikat itu,” tegasnya. Ketika dikonfirmasikan ke pihak yayasan Abdul Kahar

Ditabrak Ponton CPO, Satu Tiang Roboh

Sambungan dari halaman 17

Sambungan dari halaman 17

denda paling sedikit Rp5 M dan paling banyak Rp15 M,” jelasnya lagi. Menurut Kapolres, jika pelaku pembakar lahan itu merupakan badan usaha maka sanksi yang diberikan dan kepada siapa sanksi itu diberikan juga berbeda. Karena, lanjut dia, berdasarkan pasal 116 ayat satu dan dua. Menurut Kapolres ayat satu pada pasal tersebut, menyebutkan apabila tindak pidana lingkungan hidup dilakukan oleh, untuk, atau atas nama badan usaha, tuntutan pidana dan sanksi pidana dijatuhkan kepada, badan usaha; dan atau orang yang memberi perintah untuk melakukan tindak pidana tersebut atau orang yang bertindak sebagai pemimpin kegiatan dalam tindak pidana tersebut. “Jadi jika pelakunya badan usaha perkebunan yang membuka lahan dengan cara membakar, maka sanksi itu dijatuhkan kepada pemberi perintah dan pimpinan dari badan usaha itu sendiri,” tegas dia. Bahkan tambah dia, sanksi yang diberikan kepada badan usaha perkebunan tersebut diperberat sepertiga, seba-

gaimana disebutkan dalam pasal 117 jika tuntutan pidana diajukan kepada pemberi perintah atau pemimpin tindak pidana sebagaimana dimaksud dalam Pasal 116 ayat (1) huruf b, ancaman pidana yang dijatuhkan berupa pidana penjara dan denda diperberat dengan sepertiga. “Jika pelakunya badan usaha perkebunan, maka sanksinya diperberat dari sanksi yang diberikan perorang. Misalnya perorangan yang membakar lahan dikenakan sanksi minimal lima tahun, maka untuk badan usaha perkebunan, ditambah lagi seperti tiga, jadi enam tahun lebih,” jelasnya lagi. Karena itu, ia mengingatkan masyarakat maupun perkebunan tidak membuka lahan dengan cara dibakar. Selain dapat merusaka kesehatan dan ekosistem, dampaknya lainnya dikhawatirkan pembakaran lahan itu meluas dan dapat menimbulkan korban jiwa. “Tidak hanya keselamatan jika pembakar lahan yang terancam karena membuka lahan dengan cara membakar, tetapi juga orang lain,” ingatnya. (mse)

kiri pikap. “Karena panik, pengemudi motor melarikan kendaraanya ke tengah jalan, tetapi malah menghantam bagian kiri pick up,” kata Kapolres Singkawang, AKBP Prianto melalui Kasat Lantas, AKP Wahyu Jati Wibowo S.IK, Jumat (15/3) sore.Sebelum kedua kendaraan itu bertabrakan, pikap sempat melarikan kendaraanya ke arah kanan, untuk menghindar sepeda motor yang melaju dengan kecepatan 60 km/jam. “Pikap juga melarikan ke arah kanan, tapi sepeda mo-

tor Lie Sin Shin sudah menghantam bagian kiri pick up,” jelas Kasat saat didampingi Kasubag Humas Polres, Iptu Asep S. Kasat menyebutkan jika korban yang meninggal dunia sempat dilarikan ke rumah sakit. Sayangnya, ketika tiba di rumah sakit, nyawa Lie Sin Shin tidak tertolong lagi. “Korban tidak meninggal di tempat, sempat dilarikan ke rumah sakit,” kata Kasat. Sedangkan untuk korban yang mengalami luka berat, masih menjalani perawatan di rumah sakit. (mse)

Seorang Tewas Sambungan dari halaman 17

dikemudikan Bang Sin melaju dari arah Sakok menuju ke arah Pemkot Singkawang. Bang Sin lantas mengambil jalur kanan dan menyalip sepeda motor di depannya. Melihat pikap tersebut, Lie Sin Shin panik dan melarikan kendaraanya ke kanan jalan. Sebaliknya upaya Lie Sin Shin untuk melarikan kendaraannya itu malah menyebabkannya tewas. Pasalnya, ketika melarikan kendaraanya ke kanan jalan, Lie Sin Shin malah menabrak bagian

Tak Ada Izin Baru Kios BBM Sambungan dari halaman 17

sendiri karena melanggar hukum,” ujarnya. Untuk penjualan BBM di daerah pendalaman, lanjut Sudirman. Pihaknya akan mengajukan permohonan kepada BPMigas dan Pertamina untuk memberikan rekomendasi kepada badan usaha tertentu atau koperasi desa dalam penyediaan stok BBM. “Bila perlu Pertamina dapat mendirikan SPBU di kecama-

tan-kecamatan,” harapnya. Satpol PP Harus Lakukan Penertiban. Ketua DPRD Kabupaten Sintang, Harjono Bejang mendesak Satpol PP Sintang segera melakukan penertiban terhadap kioskios yang masih menjual BBM setelah sosialisasi tersebut dilakukan. “Kalau memang tidak boleh ya harus ditertibkan. Ini menjadi tugas Satpol PP,” tegasnya. Hal yang sama juga disampaikan Anggota DPRD Kabupaten Sintang, Wiwin Erlias. Dia

meminta ada tindakan tegas yang harus dilakukan bagi para pengecer BBM karena penjualan BBM eceran ini melanggar peraturan perundangan. “Para pengecer BBM ini perlu ditertibkan,” ujarnya. Tidak hanya itu, Wiwin meminta SPBU-SPBU di Sintang tidak bermain mata dengan para pengecer BBM. Penyediaan stok BBM juga harus selalu ada. “Saya minta SPBU buka 24 jam dalam melayani masyarakat,” desaknya. (tra)

Nelayan Tenggelam Sambungan dari halaman 17

Nawawi, saat kejadian ia bersama korban sedang beraktivitas di jeremal atau Togok. Jeremal Nawawi dan Safari berada sejajar, sehingga ia bisa melihat apa yang dilakukan korban begitu juga sebaliknya. “Saat beraktivitas, mesin motor airnya hidup, tak seleng berapa lama ada “lampu motor hidup mati hidup mati” seperti tanda minta pertolongan, lalu saya mendekat korban sudah tidak ada,” ungkapnya. Singkatnya ia pun melapor ke SAR Sinteta dan Polisi Air. Menurut ketarangan tim SAR Sintete, pihaknya sedangkan menurunkan tim dengan menggunakan rubber boat

yang menyusuri sepanjang sungai dan perairan Sebangkau, sementara masyarakat menerjunkan lima motor air ikut membantu pencarian yang dimulai pukul 07.00 wib hingga pukul 11.00 wib dan dilanjutkan usai sholat Jumat. “Hingga kini pencarian masih dilakukan, karena kita dapat informasi dari keluarga korban dalam kondisi tidak sehat,” ungkap Relawan SAR Yan Wahyudi. Menurut informasi di lapangan. Korban hilang usai menaikkan hasil tangkapan di jermalnya yang berada di Perairan Sungai Sebangkau. “Saat itu Safari pergi melaut seorang diri menggunakan perahunya, dan memang pada saat yang sama banyak

nelayan yang juga pergi ke laut,” ujar Iwan salah satu warga. Ia mengatakan Sampan korban tidak terbalik, dan diketemukan sekitar lebih dari 40 meter dari lokasi atau berada ke tengah laut. Hal senada juga dikatakan Ata, satu diantara nelayan mengatakan saat itu korban pergi ke laut untuk mengambil hasil tangkapan. Dan pada saat itu nelayan lain juga pergin namun dirinya masih belakangan. “Dia termasuk terakhir di belakang, sedangkan nelayan lainnya sudah mulai pulang, dan nelayan lain melihat ada sinar lampu senter dari kejauhan. Kami tak tahu juga ada apa, karena kami kira dia masih berada di laut,” katanya.(har)

lagi-lagi menurutnya, pihak perusahaan tidak mau bertanggungjawab atas kerusakan itu. “Sabtu (02/03) kemarin ketemu bosnya di Pontianak tapi dia katakan. Sedikitpun tidak mau ganti rugi walaupun dengan dinas provinsi,”

jelasnya. Sarmijan yang dahulunya mantan penjaga jembatan tersebut mengaku kesal dengan jawaban pemilik ponton. Ia mengaku tidak ingin kondisi tiang penyengga yang roboh bisa berdampak fatal bagi jembatan tersebut. “Saya cuma tidak mau kejadian di Kutai, Kaltim

+

Ngabang melalui Ketua I, Abdullah AMS membantah kalau bangunan itu dijual untuk kepentingan pribadi. (wan)

Pembakar Lahan Terancam Pidana hidup, dipidana dengan pidana penjara paling singkat tiga tahun dan paling lama 10 tahun dan denda paling sedikit Rp3 M dan paling banyak Rp10 M. “Untuk ayat duanya, jika mengakibatkan orang luka dan atau bahaya kesehatan manusia, dipidana dengan pidana penjara paling singkat empat tahun dan paling lama 12 (dua belas) tahun dan denda paling sedikit Rp4 M dan paling banyak Rp12 M,” jelas Kapolres, Jumat (15/3) sore.Tetapi, lanjut Kapolres, pelaku pembakar lahan bisa dikenakan sanksi dan denda lebih besar jika sampai menimbulkan korban jiwa. Dalam pasal 98 ayat tiga menyebutkan, jika mengakibatkan orang luka berat atau mati, dipidana dengan pidana penjara paling singkat lima tahun dan paling lama 15 tahun dan denda paling sedikit Rp5 M dan paling banyak Rp15 M. “Akibat dari pembakaran lahan itu ada yang terbakar, atau mengalami luka berat, pelaku pembakarnya diancam kurungan lima tahun dan paling lama 15 tahun dan

cmyk

HERI IRAWAN

BANGUNAN DIJUAL: Bangunan PAUD yang tepat berada disamping Klenteng Hati Murni Ngabang direncanakan akan dijual oleh yayasan Abdul Kahar kepada pihak Klenteng. Namun rencana tersebut ditentang sejumlah elemen umat Islam Landak.

terjadi di Kalbar. Nanti sudah seperti itu, timbul korban itu yang saya tidak mau. Jadi, kita minta secepatnya jembatan itu diperhatikan,” ungkapnya. Dirinya juga telah melaporkan kejadian itu ke Polsek Mukok. Jika memang pemilik ponton tidak bertanggungjawab, ia berharap ada tindakan hukum. (*)

Ursus Camat Mandor Sambungan dari halaman 17

Kepala Desa (Kades) se Mandor dan undangan lainnya.Dalam arahannya, Bupati mengatakan ada yang istimewa dalam pelantikan Camat Mandor ini. “Meskipun jabatan Camat eselonnya sama dengan Ka-

bid, yakni eselon III a, namun selain pejabat struktural, Camat juga merupakan kepala wilayah yang dipimpinnya,” ujar Bupati. Bupati menegaskan, dengan dilantiknya Ursus sebagai Camat Mandor, yang bersangkutan merupakan eksekutor untuk wilayah Ke-

camatan Mandor. “Tugas utama yakni pembinaan Pemerintahan Desa. Hal inipun sagnat penting, karena Desa merupakan halaman depan di NKRI. Selain itu, Desa bersentuhan langsung dengan masyarakakat. Apalagi banyak permasalahan berasal dari Desa,” ungkapnya. (wan)

Aksi FPI Dibatalkan Sambungan dari halaman 17

(15/3) usai shalat Jumat dibatalkan. Pembatalan itu sudah dilakukan sejak, Rabu lalu. Rabu lalu, kata Muhammad Zen, ada pertemuan pemkot dan stakeholder lainnya. “Kita sudah berkoordinasi denganpemkot.Ternyatapemkot merespon agar masalah ini bisa diselesaikan dalam waktu dekat,” kata Zen. Zen membenarkan, mendeadline Pemkot Singkawang hingga Jumat (15/3), agar masalah patung naga ini diselesaikan. Bila tidak ada solusi, kata Zen, pihaknya akan menutup patung dengan kain putih. Masalah patung naga ini sudah menjadi masalah sejak lama. Awalnya, akan

dibangun di depan Vihara Tengah Kota Singkawang oleh sejumlah pengusaha Singkawang. Sejumlah pihak menolak. Alasannya, karena membahayakan bagi keselamatan pengendara. Akhirnya, wali kota ketika itu, Awang Ishak-Raymundus akhirnya mengeluarkan surat tidak membolehkan membangun patung naga tersebut. Selanjutnya, perjalanan waktu, terpilihnya Hasan Karman-Edy R Yacoub dalam Pilkada 2007. Akhirnya, ide mendirikan patung naga itu dilanjutkan dan disetujui oleh Hasan Karman. Pengusaha Hotel Prapatan, Beny Setiawan pun membangun patung dan lokasinya berada dipersimpangan Jalan Niaga-Kempol Mahmud.

Sebelum dibangun patung naga, lokasi tersebut telah berdiri lampu penerangan jalan. Protes kembali bergulir. FPI sebagai organisasi menolak keras. Aksi pun dilakukan. Aksi tersebut pun dihadang oleh Polres Singkawang yang diback up Brimob Pelopor Lohabang. Kepemimpinan FPI berganti, patung naga pun kembali akan dirobohkan. Aksi ini memakan korban. Sejumlah anggota FPI termasuk Ketua FPI, Ilyas Buchari ditangkap kepolisian dan dibawa ke Polda Kalbar. Kota Singkawang mencekam dan oleh polisi mengumumkan Singkawang Siaga 1. Aksi teror bom molotov pun terjadi. Polisi berhasil mengungkap dan menangkap dan membawa ke proses hukum. (zrf)

TP Sentarum Banua-Lanjak Dialog ke DPRD Sambungan dari halaman 28

dicanangkan. “Pemda tidak memperlambat proses pemekaran. Namun, kami sedang dalam menyajikan data yang akurat dan akan segera menyerahkannya ke pihak DPRD melalui Pansus,” jelasnya. Dengan demikian, timpal Iman, Pansus Pemekaran Kabupaten Sentarum dan Banua Landjak akan menunggu data-data dari pihak Eksekutif.

Setah mendapat data tersebut, akan langsung dicocokan dengan hasil kajian kelayakan pemekaran yang telah dilakukan. “Tinggal kita sesuaikan, apa yang kurang kita lengkapi, apa yang berlebihan kita sesuaikan. Untuk itu, saya harap data-data yang dibutuhkan itu segera masuk,” kata Iman. Dari hasil pertemuan tersebut, Tim Pemekaran Kabupaten Sentarum dan Banua

Landjak, Pemkab Kapuas Hulu dan DPRD Kabupaten Kapuas Hulu berkomitmen untuk sesegera mungkin menyelesaikan proses admintrasi dengan kelengkapan dan data yang valid sesuai fakta di lapangan. “Jadi kita tunggu saja data yang valid dari Eksekutif, setelah itu dipelajari Pansus akan segera kita paripurna. DPRD dalam hal ini tidak ada maksud untuk memperlambat proses pemekaran,” imbuh Ding. (wank)

Pemekaran Kabupaten Jangan Seperti Kecamatan Sambungan dari halaman 28

“Karena inti yang terpenting adalah data yang akurat, jangan sampai nanti dibatalkan seperti Kecamatan

Sentarum dan Hulu Kapuas,” tegas pria yang akrab disapa Budi ini. Kedua legislator ini pun menegaskankan, segala aspek yang dibutuhkan dalam

upaya merealisasikan kedua kabupaten baru ini haruslah sesuai dengan data dan fakta dilapangan. Di samping sesegera mungkin ditinjau dan diparipurnakan. (wank)

Pemekaraan, Desak Pendataan Asset Sambungan dari halaman 28

kabupaten pemekaran merupakan asset yang benar adanya, dan akan menjadi catatan pelepasan asset bagi kabupaten induk. “Bisa saja mungkin selama ini persoalan asset tidak begitu diperhatikan dengan serius.

Nah, ketika ada pemekaran dan mensyaratkan pelepasan asset, mau tidak mau data harus akurat. Langkah sensus asset pun dilakukan. Kalau tidak ada wacana pemekaran, apa iya pendataan kemudian dilakukan secara intensif dan komprehensif,” papar Marwan. Oleh karena itu, Marwan men-

gatakan, harus diambil hikmah yang lebih besar dari sebuah proses yang tengah digulirkan masyarakat terkait pemekaran itu. Apakah hasil akhir di setujui atau tidak aspirasi tersebut, namun ada proses lain yang memberi manfaat ke pemerintah dan masyarakat Kapuas Hulu. (wank)

Datangi Kepala SKPD Sambungan dari halaman 28

kepala SKPD untuk tidak melakukan perjalanan ke luar daerah, jika tidak ada keperluan. Ia juga mengharapkan agar kepala SKPD mengkonfirmasi jika ada keperlun ke

luar daerah, sehingga Pemkab Kapuas Hulu dapat mengatasi jika ada kebutuhan yang mendesak. “Jangan sampai hari ini menghadap ada kegiatan, siangnya malah ketemu di pesawat. Kalau Eselon II

sudah begini bagaimana stafstafnya,” sindir Bupati. Nasir juga mengimbau agar kepala SKPD yang terkait dalam agenda kunjungan kerja, usahakan ikut serta. Karena dalam setiap kunjungan pasti ada keluhan masyarakat. (wank)

+


PRO-KALBAR Pontianak Post

28 SIDAK

Datangi Kepala SKPD BUPATI Kabupaten Kapuas Hulu, AM Nasir SH menegaskan, dirinya dan Wakil Bupati Agus Mulyana akan terus memantau kinerja SKPD Kabupaten Kapuas Hulu. Terutama untuk melihat kedisiplinan para kepala SKPD yang ada. Hal ini dilakukan untuk mewujudkan pelayanan yang prima di dalam tubuh Pemkab Kapuas Hulu, di samping menumbuhkan rasa profesionalisme disetiap PNS dan kepala SKPD. AM Nasir “Saya sudah membahas dengan Wakil Bupati, kami sudah agendakan pergi ke dinas-dinas untuk mengontrol kinerja para pegawai,” kata Bupati saat melantik Pejabat Eselon II, III dan IV, belum lama ini. Kenapa hal ini menjadi agenda? Karena katanya, perlu disadari bahwa maju mundurnya Pemkab Kapuas Hulu ini bukan semata-mata karena Bupati dan Wakilnya saja, tentu juga harus ada peran prima dari setiap SKPD yang berwenang dibawahnya. “Bupati dan Wakilnya itu umpa supir, kalau motorisnya tidak bagus kami juga rinsek. Pembangunan Kapuas Hulu juga akan seperti itu kalau SKPD tidak prima,” kias orang nomor satu di Kabupaten Kapuas Hulu ini. Pada kesempatan yang sama, Nasir mengingatkan kepada seluruh Ke Halaman 27 kolom 5

PENDIDIKAN

Rehab Madrasah KEMENTERIAN Republik Indonesia membuka peluang pengajuan anggaran untuk rehab bangunan madrasah di seluruh Indonesia. Hal itu dibenarkan Kepala Kantor Kementrian Agama Kapuas Hulu, H Syahrul Yadi. “Kita sudah dikabari soal itu, bahkan Kementerian akan mengalokasikan anggaran rehab sekolah madrasah yang ada di seluruh Indonesia,” kata Syahrul. Alokasi anggaran tersebut, dikatakan Syahrul, akan bermula pada tahun ini hingga tahun 2014 mendatang. Pihaknya saat ini tengah melakukan pendataan jumlah madrasyah yang ada di Kapuas Hulu, baik itu madrasah ibtidaiyah, tsanawiyah dan aliayah. “Terutama diarahkan untuk yang swasta. Kalau yang negeri sudah ada porsinya dan selama ini juga telah tersalurkan dengan baik,” katanya. Dilanjutkan Syahrul, data yang ada saat ini dipihaknya, untuk madrasah ibtidaiyah ada 18 sekolah swasta dan hanya satu negeri. Untuk madrasah tsanawiyah ada 15 swasta dan 3 negeri. Selanjutnya untuk madrasah aliyah ada 3 swasta dan 2 berstatus negeri. Pihaknya, akan melakukan pendataan kembali apakah data itu sama dengan keadaan yang ada saat ini, sehingga dalam proses pengajuan anggaran untuk rehab tersebut akan lebih mudah. (wank)

Sabtu 16 Maret 2013

Pemekaran Kabupaten Jangan Seperti Kecamatan PUTUSSIBAU--Dua anggota Pansus Pemekaran Kabupaten Banua Landjak dan Kabupaten Sentarum DPRD Kapuas Hulu, Budiharjo dan Baco Maiwa berharap pemekaran Kabupaten Kapuas Hulu tak bernasib sama dengan Pemekaran Kecamatan Hulu Kapuas dan Kecamatan Danau Sentarum. Menurut mereka, pemekaran Kecamatan Hulu Kapuas dan Kecamatan Danau Sentarum merupakan catatan sejarah kelam di Bumi Uncak Kapuas. Ketika ditetapkan kemudian dicabut

Pemekaran, Desak Pendataan Asset PUTUSSIBAU--Wacana pemekaran yang digulirkan masyarakat di dua wilayah Kabupaten Kapuas Hulu, telah membawa dampak positif bagi pemerintah Kabupaten Kapuas Hulu. Salah satunya, adalah pendataan asset daerah kemudian dilakukan secara intensif. “Karena desakan dalam tanda kutip masyarakat di calon Kabupaten Sentarum dan Kabupaten Banua Landjak untuk memekarkan diri, Pemerintah Kabupaten Kapuas Hulu mau tidak mau melakukan pendataan asset daerah secara menyeluruh. Mungkin kalau tidak ada wacana pemekaran ini, asset yang ada tidak akan terdata dengan baik. Jadi, patut disyukuri, bahwa wacana pemekaran ini telah mendorong upaya-upaya positif pemerintah daerah,” ungkap Marwan HY, tokoh masyarakat Kapuas Hulu, belum lama ini. Kenapa bisa demikian? Marwan kemudian menjelaskan, bahwa setidaknya ada 7 keputusan DPRD yang harus dikeluarkan sebagai kelengkapan syarat administrasi pemekaran wilayah. Salah satu keputusan itu terkait persetujuan pelepasan asset yang dimiliki kabupaten induk, untuk diserahkan ke calon kabupaten pemekaran. Sebelum keputusan itu keluar, maka data asset di wilayah kabupaten induk maupun kabupaten pemekaran harus benar-benar singkron antara data adminstrasi dan fakta di lapangan. Sehingga asset yang diserahkan kecalon Ke Halaman 27 kolom 5

kembali akibat dari berbagai persoalan yang tak tertuntaskan. Sebab itu, pemekaran kabupaten yang digulirkan di mata Budi dan Baco jangan sampai asal-asalan. Baco menilai, pemekaran Kabupaten Sentarum dan Banua Landjak adalah suatu kewajiban dan harga mati. Karena, kedua kabupaten canangan tersebut sangat menjadi kebutuhan masyarakat Kapuas Hulu saat ini. “Pemekaran ini adalah kebutuhan yang medesak. Jadi, kami mohon apa yang dibutuhkan data-datanya

disampaikan, fakta-faktanya juga dicantumkan, serta dilampirkan resmi dicap dan ditanda tangani Bupati,” imbuhnya. Sedangkan Budiharjo menilai, pemekaran kedua kabupaten tersebut tidak boleh dibawa seutuhnya kepada unsur politik. Sebab itu, data dan fakta di lapangan harus sesuai, sehingga kedepannya kabupaten yang sudah menjadi angan-angan bertahuntahun ini bisa terbentuk. Ke Halaman 27 kolom 5

Budiharjo

Baco Maiwa

TP Sentarum Banua-Lanjak Dialog ke DPRD

FOTO AWANK

DIALOG: Pertemuan di gedung DPRD Kapuas Hulu antara tim pemekaran Kabupaten Banua Landjak, tim pemekaran Kabupaten Sentarum, Pemkab dan Pansus Pemekaran DPRD Kapuas Hulu membahas soal pemekaran.

PUTUSSIBAU--Puluhan masyarakat yang tergabung dalam Tim Pemekaran (TP) Kabupaten Sentarum dan Landjak, Jumat (15/3) kemarin mendatangi Gedung DPRD Kabupaten Kapuas Hulu. Kedatangan tim pemekaran ini adalah untuk mengetahui proses lanjutan dari perencanaan menghadirkan daerah otonomi baru, yakni Kabupaten Sentarum dan Kabupaten Landjak. Kedatangan tim pemekaran tersebut disambut dengan forum diskusi yang dipimpin langsung Wakil Ketua DPRD Kabupaten Kapuas Hulu, Agustinus Ding. Forum diskusi tersebut juga dihadiri Asisten III Setda Kapuas Hulu, Yohana Endang, Ketua Pansus Pemekaran Kabupaten Sentarum dan Banua Landjak, Iman Sabirin dan beberapa Anggota Pansus serta beberapa perwaki-

c

M

y

K

lan SKPD Kapuas Hulu. Dalam forum diskusi tersebut, Ketua Tim Pemekaran Kabupaten Banua Landjak, Sutomo Mana menegaskan, perlu adanya komitmen waktu dari pihak Pemkab Kapuas Hulu dan DPRD Kapuas Hulu baik dalam penyajian data ataupun pembahasan administrasi, terkait pemenuhan persyaratan pemekaran kabupaten sehingga dapat segera diparipurnakan di tingkat kabupaten. “Yang terpenting juga pembahasan untuk hibah selama dua tahun dari kabupaten induk,” imbuhnya. Hal senada juga disampaikan Ketua Tim Pemekaran Kabupaten Sentarum, H Mustafa. Ia menegaskan, agar sesegera mungkin persyaratan administrasi baik aset, tata ruang daerah, dana pemilu pertama, pegawai pemerintahan untuk

disingkronkan pihak Pemkab dengan Pansus di DPRD Kabupaten Kapuas Hulu. Agar tak terkesan lamban. “Sehingga tidak terkesan seperti ‘enggan’ mempercepat proses. Kami dan masyarakat mengharapkan pemekaran ini segera dipari purnakan,” imbuhnya. Merespon terkait admintrasi tang dibutuhkan untuk Pemekaran Kabupaten Sentarum dan Banua Landjak, Endang selaku PLT Sekda Kapuas Hulu menuturkan data-data tersebut telah disiapkan namun masih membutuhkan waktu untuk memvalidasi data, sehingga kedepannya tidak menjadi masalah. Ia juga menekankan, Pemkab Kapuas Hulu tidak bermaksud untuk memperlamban pemekaran kedua kabupaten yang Ke Halaman 27 kolom 5


Pontianak Post

29

Sabtu 16 Maret 2013

OTOMOTIF

MASIH SULIT TEBAK PETA KEKUATAN Jarang sekali musim baru Formula 1 dimulai dengan ”peta buta.” Di Grand Prix Australia akhir pekan ini, benar-benar belum ada yang berani bilang siapa unggulannya. Apalagi, Pirelli bikin pusing, menurunkan ban yang sama sekali belum pernah dicoba. Ulasan AZRUL ANANDA BABAK latihan Grand Prix Australia 2013 dimulai kemarin (15/3), di Sirkuit Albert Park, Melbourne. Tahun ini, peta kekuatan benar-benar sulit ditebak. Khususnya di barisan lima tim teratas: Red Bull-Renault, Ferrari, McLaren-Mercedes, Lotus-Renault, dan Mercedes. Dalam konferensi pers resmi di sirkuit

Kamis (14/3), bintang Ferrari, Fernando Alonso, pun membenarkan pertanyaan bahwa setidaknya ada sepuluh pembalap yang realistis bisa menang di Australia. “Saya kira demikian. Saya kira Mercedes, McLaren, Lotus, Ferrari, dan Red Bull telah menunjukkan potensi masing-masing saat uji coba, di hari yang berbeda-beda,” kata Alonso. “Saya kira akan sangat sulit untuk memilih (siapa unggulan utama),” lanjutnya. Alonso menegaskan, hasil uji coba sama sekali tidak bisa dijadikan pegangan. “Kita harus menunggu munculnya jawaban-jawaban, dari pertanyaanpertanyaan yang tidak terjawab selama uji coba,” tegasnya. Peta kekuatan semakin sulit ditebak gara-gara kebijakan Pirelli sebagai supplier ban eksklusif F1. Akhir pekan ini, mereka membawa ban jenis supersoft dan medium. Tantangannya: Ban supersoft itu baru akan dipakai untuk kali pertama di Sirkuit Albert Park. Ban itu sama sekali belum pernah

Red Bull Renault 1 Sebastian Vettel

dipakai saat uji coba pramusim! Ditambah lagi, temperatur di Melbourne akan lebih hangat dari saat uji coba. Selama latihan di Jerez dan Barcelona, Januari-Februari lalu, temperatur ban tak pernah melebihi 60 derajat Celcius karena cuaca dingin! Handling mobil di Melbourne bisa berubah total! Tahun lalu, Pirelli menuai banyak pujian karena membuat ban yang gampang ”habis.” Memaksa tim lebih memutar otak dalam menentukan strategi. Tahun ini, Pirelli menegaskan niatan untuk membuat ban yang tidak kalah agresif. Dan kebijakan di atas membuat tim-tim makin pusing. Sebelumnya, beberapa pembalap menyampaikan kesan-kesan terhadap ban-ban baru Pirelli. ”Saya pikir semua mengalami masalah yang sama soal ban. Sepanjang (uji coba), dalam segala kondisi, ban-ban itu cepat sekali habis. Ban (sekarang) lebih lengket untuk satu lap dari tahun lalu. Tapi mereka juga habis lebih cepat. Meski demikian, (cuaca dingin) saat uji coba bisa membuat

AFP PHOTO/WILLIAM WEST

BAN : Pirelli bikin pusing, menurunkan ban yang sama sekali belum pernah dicoba.

segalanya berbeda di sini,” tutur Kimi Raikkonen, andalan Lotus. Kalau menurut Lewis Hamilton, yang kini membela Mercedes, masalah ban ini tidak akan terlalu dia pusingkan. Sebab, semua pembalap punya

masalah yang sama! “Semua berada dalam situasi yang sama, jadi menarik untuk memperhatikan berapa lama ban supersoft bisa bertahan. Apakah akan lebih cepat rusak dari tahun lalu,” ucapnya.

Menurut Paul Hembery, bos balap Pirelli, para pembalap akan punya opsi strategi yang berbeda antara satu sama lain. “Setiap mobil mungkin harus melakukan dua atau tiga kali pit stop,” ungkapnya. (*)

Preview Tim -Tim Form ula 1 2013

2 Mark Webber

Moga-Moga Makin Seru 1

2

Selama masih ada Adrian Newey merancang mobil Red Bull, tim ini harus selalu dianggap sebagai unggulan. Saat uji coba, tim ini tidak bersinar. Tapi kabarnya, itu karena mereka menyembunyikan kekuatan. Penggemar umum mungkin berharap agar tim ini tidak dominan, dan F1 berlangsung makin seru. Meski demikian, jangan heran bila tiba-tiba Red Bull langsung menghancurkan para pesaing sejak lomba perdana. Banyak pesaing sudah khawatir dominasi tim ini bakal terjadi. (*)

Ferrari 2 Felipe Massa

1

McLaren-Mercedes

2

1 Nico Hulkenberg

2 Romain Grosjean

1

Berupaya merebut posisi enam konstruktor, tim ini memilih memakai pasangan pembalap yang “aman.” Paul di Resta akan didampingi pembalap lebih senior, Sutil. Strategi ”aman” ini bisa jadi jitu. Di tengah ketatnya persaingan papan tengah, setiap poin yang diraih bisa bermakna luar biasa. Dan Force India merasa, tangan senior lebih bisa dipercaya daripada tangan pendatang baru. (*)

2

2

2 Nico Rosberg

1 Pastor Maldonado

Toro Rosso-Ferrari 2 Valtteri Bottas

1 Daniel Ricciardo

1 Tak perlu disangkal lagi, fokus utama seri pembuka di Australia akan tertuju pada pasukan silver. Hadirnya Lewis Hamilton memberi beban ekstra bagi tim untuk menghasilkan mobil terbaik. Saat uji coba, Mercedes pun mampu berkali-kali mencatat waktu terbaik. Tinggal pembuktian saja di Australia. Apakah catatan waktu itu hasil ”bohong-bohongan” atau real. Andai mobil belum tercepat, Hamilton punya kemampuan untuk mendorongnya lebih cepat dari seharusnya. (*)

Peringkat sembilan tahun lalu, Toro Rosso punya ambisi finis di urutan enam konstruktor 2013. James Key, direktur teknik Sauber, mereka comot. Saat uji coba, mobil terbaru tampak jauh lebih ”menyenangkan” dari mobil 2012. Kemungkinan akan mampu meraih poin lebih mudah. Naik peringkat” Itu masalah yang berbeda lagi. (*)

2

2

Marussia-Cosworth

Caterham-Renault 2 Giedo van der Garde

Max Chilton

1

Dua tahun bercokol di urutan sepuluh konstruktor, Caterham (dulu Team Lotus) tak kunjung menunjukkan tanda-tanda mendobrak papan tengah. Gawatnya, tahun ini mereka terancam melorot ke juru kunci. Mobil terbaru mereka kurang meyakinkan saat uji coba, dan dua pembalap muda biasanya bukan pemandu pengembangan yang ideal. (*)

C

M

Y

K

2 Jules Bianchi

1

1

2

2 Jean-Eric Vergne

1 ”Cinderella” tahun lalu, Williams mungkin tidak akan bisa mencuri lagi kemenangan pada 2013 nanti. Mobil terbaru mereka tampak lebih konsisten dari pendahulunya. Sayang Maldonado tetap punya tendensi anginanginan. Bottas, kabarnya, adalah calon superstar. Tapi rookie adalah rookie. Mungkin tetap butuh waktu untuk menunjukkan performa terbaik. (*)

Charles Pic Pic 1 Charles

2 Adrian Sutil

1

Williams-Renault

1 Lewis Hamilton

2

1 Paul di Resta

Kandidat utama best of the rest di F1 2013. Ganti total barisan pembalap, tim ini tetap diyakini sebagai yang terbaik di papan tengah. Hulkenberg dikenal cepat, berpeluang tampil lebih baik daripada Sergio Perez tahun lalu. Saat uji coba tim ini juga solid. Dan untungnya, mobil mereka tidak lagi berwarna putih membosankan. Warnanya lebih gelap, lebih garang. (*)

1 Tanpa Lewis Hamilton, McLaren-Mercedes mungkin wajib menghasilkan mobil terbaik kalau ingin meraih gelar juara dunia. Jenson Button sudah membuktikan diri mampu merebut gelar, tapi dia bukan tipe yang bisa memaksakan mobil paspasan untuk menang. Sergio Perez menunjukkan beberapa keajaiban tahun lalu. Tapi mungkin McLaren belum bisa menuntut terlalu banyak darinya. Selain 2013, McLaren sendiri sudah menatap lebih jauh ke depan. Honda kabarnya akan kembali menyokong mesin untuk tim ini mulai 2015. (*)

2 Esteban Gutierrez

1 Tidak punya anggaran sebesar tim-tim lima besar yang lain, Lotus mampu mengejutkan banyak orang tahun lalu. Bahkan mencuri kemenangan bersama Kimi Raikkonen. Tahun ini, mereka akan mencoba mengulangi kesuksesan tersebut. Raikkonen terbukti mampu merengkuh kesempatan, sedangkan Romain Grosjean seharusnya sudah lebih dewasa, tidak lagi banyak tabrakan. Saat uji coba, tim ini tampak solid. Kesempatan mereka untuk mencuri sukses adalah di awal musim. Termasuk mungkin di seri perdana di Australia. (*)

Mercedes 2 Sergio Perez

Force India-Mercedes

Sauber-Ferrari

1 Kimi Raikkonen

1 Fernando Alonso mungkin pembalap terbaik di F1. Tapi dia butuh mobil yang mampu bersaing dengan mobil terbaik. Juara dunia atau tidak, bergantung pada F138, senjata terbaru Kuda Jingkrak. Tidak ada tanda-tanda lonjakan performa dari Ferrari saat uji coba. Namun mereka berjanji akan agresif dalam mengembangkan mobil. Felipe Massa tentu dituntut untuk meningkatkan performa, atau karir panjangnya berbaju merah akan berakhir di penghujung 2013. (*)

1 Jenson Button

2

ULASAN AZRUL ANANDA Lotus-Renault

1 Fernando Alonso

2

Sirkus Formula 1 2013 segera kembali keliling dunia. Akhir pekan ini, seri pembuka diselenggarakan seperti biasa-- di Melbourne, Australia. Berikut ulasan singkat seluruh tim peserta, dan prospek mereka hingga akhir tahun nanti.

Untuk kali pertama, Marussia tampak percaya diri bakal naik peringkat. Walau punya dua pembalap rookie, mereka telah banyak berinvestasi dari sisi teknis. Misalnya, untuk kali pertama memakai KERS (kinetic energy recovery system). Banyak yang menjagokan tim ini bakal menggusur Caterham di urutan sepuluh konstruktor. (*)

2


30 Kalahkan Mavs, Spurs Torehkan Rekor San Antonio - San Antonio Spurs mengalahkan Dallas Mavericks dalam lanjutan NBA di AT&T Center, Jumat (15/3/2013) pagi WIB. Kemenangan tersebut membuat Spurs masuk ke buku rekor. Pada laga tersebut, Spurs sukses memimpin di dua kuarter awal. Saat jeda, tim asuhan Gregg Popovich itu masih unggul 50-41. Namun, Mavs makin mendekat di sisa waktu. Meski kalah dalam perolehan poin di kuarter ketiga dan keempat, Spurs tetap menang setengah bola dengan skor akhir 92-91. Tim Duncan jadi motor Spurs dengan sumbangan 28 poin dan 19 rebound. Gary Neal menambahkan 16 poin, sementara Kawhi Leonard 12 poin. Di kubu Mavs, Dirk Nowitzki menyumbangkan 21 poin dan 11 rebound. Darren Collison mencetak 12 poin, sedangkan O.J.Mayo, Mike James, Brandan Wright, dan Vince Carter masing-masing membukukan 10 poin. Berkat kemenangan ini, Spurs membukukan rekor menang-kalah 50-16 pada musim ini. Mereka pun masuk buku rekor NBA sebagai tim yang selalu meraih minimal 50 kemenangan dalam 14 musim secara berturut-turut. “ K o n s i s t e n s i . Ya n g l u a r b i a s a ,” u n gkap Duncan saat ditanya soal rekor ini. “Ada pemain yang datang dan pergi. Tim berubah setiap tahun dan kami ada di posisi ini. Tentu saja, sudah cukup lama sejak terakhir kami juara, namun kami ingin kembali ke sana,” kata pemain yang membela Spurs sejak 1997 ini.(int)

ALL SPORT

Pontianak Post

z

Sabtu 16 Maret 2013

Marquez Sapu Bersih Uji Coba Austin AUSTIN - Pembalap debutan MotoGP Marc Marquez, menegaskan ancamannya pada para pembalap papan ats MotoGP di musim 2013. Pembalap Repsol Honda itu tak terkalahkan selama uji coba privat pramusim di Circuit of the Americas, Austin. Selama tiga hari tes di sana, dia selalu menjadi yang tercepat, mengalahkan rekan setimnya, Dani Pedrosa. Saat hari terakhir uji coba, Kamis (14/3) waktu setempat atau kemarin WIB, pembalap Spanyol itu menorehkan waktu terbaik 2 menit 03,281 detik. Dia unggul 0,617 detik atas Pedrosa, yang dua hari sebelumnya juga berada di posisi kedua. “Sejak awal, saya punya perasaan yang sama dengan kemarin (sehari sebelumnya). Terutama karena kami memulai beberapa setting teknis untuk pertama kalinya dan kami mendapatkan peningkatan besar,” beber Mar-

quez pada Crash. Kali ini Honda memang tak mendapat perlawanan karena hanya mereka yang melakoni hari terakhir uji coba, termasuk pembalap LCR Honda, Stefan Bradl, yang menempati posisi ketiga. Pasalnya, dua pembalap Yamaha, Jorge Lorenzo dan Valentino Rossi, sudah lebih dulu kembali setelah hanya menjalani dua hari pertama tes tersebut. Sementara, Pedrosa hanya menyelesaikan total 24 lap. Runner-up musim 2012 itu mengalami gangguan pada lehernya, sehingga dia tak mampu menyelesaikan banyak putaran seperti Marquez (60 kali), Bradl (43) dan pembalap Attack APR-Kawasaki Blake Young (42). “Setelah keluar pertama kali pagi hari, saya merasa sakit di leher. Saya tak tahu penyebabnya, jadi saya memutuskan tak melahap banyak lap. Secara umum, semua berjalan baik dan

C

M

Y

K

tiga hari di sini berbuah positif,” tutur Pedrosa. Uji coba di Circuit of The

Americas, Austin dianggap penting oleh Honda. Sebab, lomba kedua tahun ini berlangsung

di sirkuit yang mulai dipakai balapan Formula 1 musim lalu itu. (ady)


Pontianak Post

Sabtu 16 Maret 2013

Spurs Jadi Korban Rasis Lagi TOTTENHAM Hotspur jadi langganan bullying saat bertarung di Europa League. Kalau sebelumnya mereka dikerjai tifosi Lazio dalam dua bentrok, kemarin dini hari WIB, klub berjuluk Spurs itu dikerjai fans Inter Milan. Saat melawan Lazio, fakta bahwa Tottenham identik dengan Yahudi menjadi bahan celaan, maka ketika melawan Inter, para pemain berkulit hitam yang jadi sasaran. Striker Tottenham asal Togo Emmanuel Adebayor paling sering jadi sasaran. Para fans Inter sengaja melempari para pemain Tottenham dengan balon berbentuk pisang berwarna kuning. Itu simbol dari penghinaan rasis seolah mengejek para pemain berkulit gelap sebagai monyet. Penghinaan yang membuat manajer Tottenham Andre Villas Boas geram. “Ini benar-benar situasi yang sensitif. UEFA harus beraksi menanggapi masalah ini. Sangat-sangat mudah kami mendengar ejekan-ejekan, jadi agak aneh bila UEFA tidak beraksi,” jelas Boas, seperti dikutip Reuters. Rupanya fans Inter memang kepala batu. Sebab, baru pekan lalu mereka dijatuhi sanksi dari FIGC berupa denda sebesar 43 ribu euro atau setara Rp 539 juta. Penyebabnya, ejekan rasis

kepada striker AC Milan Mario Balotelli pada derby della Madonnina. “Ini akan menyulitkan Inter, karena beberapa waktu lalu fans mereka baru saja melakukan hal serup. Insiden itu memang tidak mempengaruhi pertandingan, tetapi seharusnya bisa dihindari,” kata mantan pelatih Chelsea dan FC Porto tersebut. Kendati Boas telah melancarkan komentar pedas ke media, tetapi sampai saat ini belum ada pengaduan resmi dari Tottenham ke UEFA. Sebelumnya, Tottenham pernah mengadukan Lazio ke UEFA karena ejekan rasis saat kedua tim bertemu di fase grup. Bukan hanya ejekan rasis, fans Tottenham yang ikut menemani tim kesayangannya sempat menjadi korban kekerasan pada akhir November tahun lalu. Ketika itu, sepuluh fans Tottenham yang nongkrong di bar di Campo de Fiori, Roma, diserbu sekelompok orang tak dikenal. Gara-gara perkelahian yang tidak berimbang, karena mereka harus menghadapi penyerang yang membawa senjata tumpul dan tajam, fans Tottenham pun luka-luka. Bahkan, salah seorang di antaranya mengalami luka tusuk parah dan sempat kritis. (ham)

FOOTBALL LOVERS

31

Nerazzurri Muluskan Dominasi Inggris MILAN - Inter Milan tampil heroik pada second leg babak 16 besar Europa League dengan mengalahkan Tottenham Hotspur 4-1 (1-0) di Giuseppe Meazza, kemarin dini hari WIB. Sayang, itu tidak cukup membawa mereka lolos ke perempat final. Mereka harus merelakan Tottenham lolos karena agregat gol tandang. Pada first leg, Inter kalah 0-3 dari Tottenham (7/3), sehingga gol Emmanuel Adebayor pada perpanjangan waktu menjadi penentu. Inggris pun dominan di perempat final. Ya, selain Spurs, sebutan Tottenham, dua tim Inggris lainnya juga memastikan diri melaju ke perempat final. Mereka adalah Chelsea yang menyingkirkan klub Rumania Steaua Bucharest dan Newcastle United yang menyisihkan klub kaya Rusia Anzhi Makhachkala. B e rd a s a rk a n d raw i n g perempat final di markas UEFA di Nyon, tadi malam, ketiga tim asal Inggris itu tidak saling bertemu. Tottenham bertarung dengan klub Swiss Basel, Chelsea melawan Rubin Kazan (Rusia), dan Newcastle menghadapi

AFP PHOTO / OLIVIER MORIN

CETAK GOL: Pemain tengah Inter Milan Riccardo Alvarez (kanan) mencetak gol ke gawang Tottenham Hotspur pada putaran kedua babak 16 besar Europa League di Stadion San Siro Milan (15/3).

Benfica (Portugal). Kesempatan itu membuka peluang tim asal Inggris untuk kembali mendominasi di semifinal. Setidaknya menjadi pelipur lara dari kegagalan tim asal Inggris di Liga Champions. Tidak ada satu pun klub Inggris pada perempat final Liga Champions. “Tidak ada alasan bagi

C

M

Y

K

kami untuk bersantai di kompetisi ini. Kami punya peluang untuk mencapai final kejuaraan Eropa dua musim beruntun. Itulah yang akan menjadi tujuan kami berikutnya,” jelas Rafael Benitez, manajer Chelsea, seperti dikutip Soccernet. Setelah menjuarai Liga C ha m p i o n s mu s i m i n i ,

Chelsea secara mengejutkan tersingkir pada fase grup. Untungnya, mereka masih bisa berkompetisi di Europa League karena finis di posisi ketiga. Kesempatan mereka menembus kesalahan. Sementara itu pada pertandingan kemarin dini hari, Tottenham lolos secara dramatis. Berbekal kemenan-

gan 3-0 pada first leg, mereka diprediksi bisa lolos dengan mulus. Ternyata, hingga 2x45 menit, Inter mampu unggul 3-0 melalui Antonio Cassano (20”), Rodrigo Palacio (52”), dan bunuh diri bek Tottenham William Gallas (75”). Otomatis, tiket lolos harus ditentukan melalui perpanjangan waktu. Sayang, pada menit ke-96 Adebayor membobol gawang Inter. Mereka bisa membalasnya melalui Ricky Alvarez (110”), tetapi tidak cukup membawa Inter lolos. “Siapa yang menyangka kami bisa mencetak empat gol ke gawang Tottenham. Kami senang dengan performa dan jalannya pertandingan. Sayangnya, kami gagal lolos. Inilah indahnya sepak bola,” bilang Javier Zanetti, kapten Inter, seperti dikutip Football Italia. P e l a t i h I n t e r A n d re a Stramaccioni juga puas, meski gagal lolos. “Kami melewati 90 menit dengan luar biasa. Kami bisa membungkam semua kritik setelah kekalahan sebelumnya. Ini momentum bagi bangkit dan berjuang di Serie A nanti,” jelasnya. (ham)


STEPHENIE MEYER ”Meski berjuang keras untuk tidak memikirkan dia, aku tidak

32

berjuang untuk melupakan.” - Writer, New Moon -

WEEKLY HOROSCOPE ADAM LEVINE 18 Maret 1979

PISCES 20 FEBRUARI-20 MARET

Yuk mulai dibenahi semua hal yang agak berantakan. Katanya nggak bakal berleha-leha lagi dan mau berjuang lebih keras lagi, ya lakukan. Jangan cuma niat doang. ARIES 21 MARET - 19 APRIL Good job, kamu udah nentuin pilihanmu ya, soal percintaan maupun kehidupanmu yang sempet bikin galau. Fokus sama yang ada di depanmu. TAURUS 20 APRIL - 20 MEI Bakal ada babak baru percintaanmu. Bisa berupa putus, jadian, atau jadi korban PHP, hehehe. Kalau emang udah jenuh, ya bilang aja jenuh. GEMINI 21 MEI - 21 JUNI Emang sih banyak banget pikiran dan beban yang harus dipikirin akhir-akhir ini. Makanya, refreshing dikit dari rutinitas yang mencekek leher, keuangan kan lagi lancar jaya. CANCER 22 JUNI - 22 JULI CLBT, cinta lama belum tuntas, ngahahaha. Kayaknya ada orang lama yang lagi intip-intip kehidupanmu sekarang tuh. Tapi, jangan terhanyut dulu sama rayuan cinta lama. LEO 23 JULI - 23 AGUSTUS Ngapain ngarep sama cinta yang nggak pasti, apalagi sama teman sendiri. Yang pasti-pasti aja deh. Nggak salah ngebuka hati buat yang lain. VIRGO 24 AGUSTUS - 22 SEPTEMBER Okelah kalau sekarang rasa sayangmu ke pacar baru masih biasa-biasa aja. Tapi, ntar lama-kelamaan bakal terasa kok, semua kan butuh waktu. LIBRA 23 SEPTEMBER - 23 OKTOBER Kayaknya kamu lagi kering ide ya, kok sering bingung sih akhir-akhir ini kalau dihadapin dengan pilihan. Bukan kamu banget deh, biasanya selalu punya ide gemilang. SCORPIO 24 OKTOBER - 22 NOVEMBER Dih ada yang lagi seneng nih, secara lagi deketdeketnya sama gebetan. Tapi, cyin tetap DBL (dilarang berharap lebih) okayy. Yang penting keep in touch and keep contact. SAGITARIUS 23 NOVEMBER - 21 DESEMBER Selamat Anda sekarang berada dalam level lumayan bisa move on, yeaay. Lumayanlah udah ngebuka dikit-dikit hati sama yang lain. CAPRICORN 22 DESEMBER - 20 JANUARI Jangan turutin mood, kalaupun lagi nggak mood, lebih baik diem dan menyingkir dari peradaban #tsaaah. Menyendiri di kamar sambil nonton drama bikin pikiran cerah lagi. AQUARIUS 21 JANUARI - 19 FEBRUARI Effort yang kamu lakukan untuk menghasilkan suatu karya bakal menunjukkan titik terang tuh. So, lanjutin aja, jangan bosen-bosen buat berjuang jadi yang lebih baik.

Pontianak Post ʁ Sabtu 16 Maret 2013

TERPAKSA

JALIN CINTA ASAH KREATIVITAS

< Jangan Berburuk Sangka Kamu harus ubah mindset. Karena sudah telanjur, coba deh ambil positifnya aja. Siapa tahu kamu bakal menemukan pengalaman baru dan berbeda dalam menjalani hubungan ini. Nggak ada yang bisa menebak akhir sebuah kisah kan? Ceilee… < Gaya Nge-Date Kreatif Merasa jenuh menjalani hubungan? Jangan nyerah! Bikin agenda nge-date kreatif dan kejutan buat dia yang berbeda tiap minggunya. Selain mengasah kreativitas, siapa tahu benih-benih cinta bakal hadir di antara kalian. < Akhiri Baik-Baik Udah berbagai cara kamu coba. Kalau kamu ternyata tetap merasa nggak kuat, mending diakhiri aja. Nggak ada orang yang suka menjalani suatu hubungan yang semu. Tapi ingat ya, harus diakhiri dengan cara baik-baik. (*/det) Semoga kisah mereka bisa menjadi pelajaran kita semua. Cinta bisa menghampiri siapa pun tanpa memandang usia. Tidak ada kata ter-

Pasangan

Abadi

M

Y

A, lagu itu pernah happening banget dan tentu kita pasti masih ingat. Coba perhatikan deh liriknya. Pernah nggak sih kalian mengalami kasus yang kayak gini? Pacaran sama orang yang kita cuma ngasih setengah hati buat dia? Wah, agak kejam juga dengernya, hehe... Tapi, mereka tentu punya alasan tersendiri untuk melakukan itu. Ilfeel Tingkah Pacar Berbagai alasan menjadi penyebab kenapa mereka harus menjalani hubungan yang dilandasi keterpaksaan ini. Ada yang karena nggak enak dengan teman-teman pacarnya. Sebut saja Tomi Antonius yang pernah mengalami pacaran karena terpaksa. Awalnya hubungan mereka baik-baik saja. Tapi, lama-kelamaan sang pacar berubah menjadi posesif dan selalu mencurigainya. Apalagi kalau ia bertemu teman cewek. Itu bikin Tomi terpaksa menjalani hubungan. Ia ilfeel dengan sikap bawel dan judes pacar. Pengen putus tapi enggak enak sama teman-temannya juga. Untung, akhirnya sang pacar pindah sekolah dan minta putus. Terbebaslah ia dari rasa pacaran karena terpaksa tersebut #plong.

Hormati Perjanjian Ssst ada lagi nih alasan lainnya, karena pasangan itu menghormati perjanjiaan untuk nggak putus. Khan ada nih pasangan yang punya janji kalau pacaran nggak boleh main-main dan gampang mengucap kata putus. Istilahnya, mau menerima kelebihan dan kekuran g a n pacar gitu deh. Tapiii sebenarnya ini bikin makan hati loh. Bayangin aja kalo pacar kamu berbuat salah, semisal kepergok berdua-duaan ama cewek lain dan mengulangi lagi insiden serupa, maka ada baiknya dipikirkan lagi deh hubungan kalian. Daripada menjalani pacaran terpaksa, dengan alasan terikat sebuah perjanjian, lebih baik tegaskan saja seperti apa hubungan kalian. Emang mau diikat terus ama perjanjian nggak jelas kayak gitu, bakal bikin hati kamu nelangsa terus ngeliatin tingkah pacar yang kian menggila, enggak mau khan!? (*/det)

< Taruhan sama Hati Telanjur bilang ya, tapi hati nggak rela. Ayo jangan mau kalah. Segera bilang, ”Wahai hatiku, ayo kita taruhan. Aku pasti menang dan bakalan jatuh cinta beneran sama dia.” Coba dulu deh, jangan keburu mundur.

C

(Status Palsu – Vidi Aldiano)

Ogah Nge-jomblo Selain alasan tersebut, ada juga yang mau pacaran karena memang dia pengen punya pacar. Lha maksudnya gimana tuh? Enggak mau dibilang jomblo forever, main terimaterima aja ketika ada lawan jenis yang menembak. Jadi sebenarnya enggak ada perasaan cinta gitu, tapi dipaksakan cinta biar gak dibilang kuper, halaah.. zaman genee? Akibatnya karena niat juga udah setengah-setengah, dikhawatirkan pacarannya pun hanya bertahan beberapa waktu saja. Karena memang sebenarnya pacaran terpaksa ini enggak akan mendatangkan kebahagiaan.

RINDU? Nggak. Sayang? Nggak juga. Kalau cinta? Wah, apalagi ini. Pasangan yang pacaran normal sih pasti ngalamin tiga hal itu. Tapi, kalau yang dijalani hanya karena terpaksa, gimana dong? Nah lho! Cobain deh tip cinta ala Cupid berikut. Siapa tahu jurusnya manjur dan bikin kamu jatuh cinta beneran.

Herbert (lahir 1905) dan Zelmyra Fisher (lahir 1908) adalah pasangan dengan pernikahan terlama. Mereka menikah pada 13 Mei 1924, jadi mereka telah menikah selama 89 tahun. Sang pria meninggal pada akhir bulan Februari 2010 dalam usia 105 tahun. Walaupun sudah lanjut usia, pasangan ini bisa menjadi inspirasi banyak orang, mengingat perceraian makin mudah dilakukan. Coba lihat, bagaimana mereka saling menggenggam tangan, hangat dan penuh cinta. Pada Valentine 2010, pasangan ini menuliskan “Belajarlah untuk bersatu, bukan berpisah.”

Terpaksa aku mencintai dirimu Hanya untuk status palsu Setengah hati ku jalani cinta Karena aku tak suka denganmu

lambat untuk sebuah pernikahan. Yang pasti, pernikahan akan menjadi hari terindah jika bisa dipertahankan hingga maut memisahkan. Pernikahan bisa membuat seseorang jatuh cinta setiap hari, di sepanjang usianya.**

Y

K

Berpisah atau Berdamai

Dalam menjalin suatu hubungan, terdapat dua motif yang paling dominan. Motif pertama adalah afiliasi, yang mengutamakan feel. Motif kedua adalah achievement, yaitu berdasar tujuan hidup. Jika suatu hubungan dilandasi rasa keterpaksaan, efek yang timbul bisa berbeda sesuai dengan karakter masing-masing. Seseorang bisa bertahan dalam hubungan tersebut, dengan kata lain dia mau mencoba belajar untuk suka terhadap pasangannya. Namun, bisa juga dia berusaha menghindar dari pasangan karena merasa tertekan. Dalam hubungan yang terjadi karena terpaksa, pilihannya adalah berpisah atau berdamai. Harus diingat juga, jika berdamai, mungkin akan timbul rasa ketidaknyamanan, timbul masalahmasalah kecil yang bisa memicu keributan. Tak heran, kebanyakan hubungan yang terjalin karena terpaksa `tak berumur panjang. (det)


Desainer asal Inggris, Jess Eaton membuat gebrakan aneh dengan gaun pengantin dan aksesorinya dari bulu hewan dan tulang manusia. Bulu diambil dari hewan yang sudah disembelih untuk dimakan, atau hewan yang mati secara alami. Sementara tulang diperolehnya dari fakultas kesehatan di beberapa universitas.

ASRAT tiba-tiba m e n g goda kala sedang m e n g e rjakan paperwork di kantor. Dalam kondisi normal, yang paling sering dilakukan adalah berusaha menahannya rapat-rapat hingga jam kantor berakhir. Setelah sama-sama sampai di rumah, eh semua masih juga berurusan dengan kegiatan rumah tangga, seperti membereskan makan malam atau menidurkan si kecil. Alhasil, momen romantis bersama pasangan paling cepat baru terlaksana tengah malam. Lebih buruk lagi, karena sama-sama sudah lelah, gairah yang muncul siang tadi menguap dengan sendirinya. Jika dibiarkan, bisa-bisa, acara bercinta hanya dilakukan sekali sepekan, yakni saat weekend. Nah, salah satu kunci mengatasi krisis seksual semacam itu adalah bercinta secara spontan. ”Tidak ada yang lebih seksi daripada melakukan

H

Tahukah

Anda?

Pontianak Post Sabtu 16 Maret 2013

seks saat benar-benar membutuhkan. Seluruh hasrat seperti keluar langsung dari sumbernya, tidak berasal dari imaji atau mood yang kita bangun,” jelas dr Yvonne K Fulbright, seksolog asal Amerika Serikat. ”Seks spontan tidak hanya penting untuk menarik pasangan, tapi juga menjaga ketertarikan itu,” imbuhnya. ”Spontanitas membangunkan sisi lust (dalam sebuah hubungan). So, hubungan tidak melulu soal love. Itu membuat acara bercinta semakin menyenangkan. Ketika dibutuhkan, hal tersebut bisa membawa pasangan keluar dari rasa bosan,” papar pendiri konsultan seksual Sexuality Source Inc. tersebut. Mulai sekarang, coba lebih berani bereksperimen dengan seks spontan. Salah satu yang patut dicoba, ajak pasangan melakukannya di sela-sela istirahat makan siang. Jika jarak kantor tidak terlalu jauh, kemunculan secara tiba-tiba di ruang pribadi si dia bisa menjadi kejutan tersendiri. Belum lagi ajakan quickie yang sama

sekali tidak terencana. Rencana di atas memang tricky karena mungkin saja pasangan sedang sangat sibuk atau sedang bertemu klien. Kita wajib mengetes, apakah si dia available atau tidak sebelum memutuskan invasi ke tempat kerjanya. Caranya, mengirimkan pesan pendek atau foto-foto nakal nan menggoda. Jika si dia welcome dan membalas sinyal-sinyal ”undangan”, perjalanan setengah atau satu jam ke kantornya a ka n t e ra sa worth it. ” S e b a liknya, jika pasangan mengirimkan sinyal-sinyal yang mengundang, jangan ragu menerima. Hal yang paling sering menggagalkan spontanitas dalam bercinta adalah saling menunggu atau saling berpersepsi,” papar Fulbright. ”Anda takut melancarkan ajakan karena takut pasangan sedang sibuk. Demikian

L O V E

sebaliknya. Jadi, kapan pun Anda berminat, jangan takut-takut mengungkapkan,” lanjutnya. Ketika sedang bersama si dia, kita akan lebih mudah lagi melancarkan spontanitas meski tengah berada di ruang publik, seperti mal atau restoran. Tinggal cari restroom unisex yang kini makin banyak tersedia. Pacuan adrenalin dijamin bakal bikin acara bercinta lebih seru. Pastikan untuk meminimalkan risiko sebelum memutuskan bercinta di tempat umum. Bagaimana jika sedang sama-sama berada di rumah? Secara teori sih, hal tersebut jauh lebih gampang lagi. Cukup tinggalkan apa pun yang tengah digarap, gandeng suami masuk kamar, dan kunci rapat-rapat. Namun, kadang, itu lebih gampang diucapkan daripada dilakukan. Penghalangnya, apalagi kalau

L I F E

bukan si kecil yang sewaktuwaktu membutuhkan mama. Satu-satunya kesempatan memang terjadi saat si kecil tengah terlelap. Jangan tunda lagi. Langsung melompat ke pangkuan suami (dalam arti sebenarnya) setelah lampu kamar si kecil padam. Jika ingin nakal pada pagi, ketuk pintu kamar mandi saat suami sedang mandi, lalu lakukan sesi singkat bersama dia. Satu hal yang perlu diperhatikan, kata Fulbright, meski titelnya adalah bercinta secara spontan, kita harus tetap mempersiapkan spontanitas. Maksudnya, kita harus siap jika sewaktu-waktu gairah datang tanpa diundang. ”Tidak ada salahnya selalu siap membawa pengaman atau lubrikan di tas sebelum mengirimkan sinyal mengundang kepada pasangan,” kata Fulbright. ”Pikirkan juga soal lokasi, apa kah tempat yang sedang dituju mendukung spontanitas pasangan atau tidak. Anda tidak mau kan hasrat datang ketika sedang berada di tengah dinner romantis di restoran yang tidak punya toilet unisex,” imbuhnya. (*/JP)

Bikin Pekerjaan Tertunda KEKUATAN spontaneous sex untuk menjaga kemesraan dan kehangatan pasangan tak perlu diragukan lagi. Paling tidak, itu pernyataan Yunita, 34. Perempuan yang sudah tujuh tahun menikah itu menyebut kehidupan seksual dirinya dan pasangan dengan istilah berapi-api alias masih membara. ”Memang kami pasangan yang sangat kompatibel. Artinya cocok di segala hal. Tapi, kalau teman-teman tanya, apa yang bikin hubungan kami

masih hangat, itu kehidupan seksual kami yang sangat bagus,” papar Yunita. ”Salah satu tipnya adalah seks yang tidak direncanakan,” imbuh perempuan berambut cokelat itu. Sama-sama bekerja sebagai penulis freelance, Yunita dan suami lebih sering menggarap pekerjaan di rumah. Biasanya, mereka nangkring di tempat tidur sambil menghadap notebook masing-masing. ”Kalau tiba-tiba turn on, saya tinggal menutup notebook, lalu menggodanya. Awalnya, sama sekali

tidak ada niat bercinta. Tapi, kalau sudah begitu, kan jadi tidak terhindarkan,” ucapnya, lantas tertawa. ”Kalau bukan saya yang pengin, ya pasti dia. So, jangan heran kalau kerjaan sering tertunda bila kami mengerjakannya di rumah,” imbuhnya, kembali disusul tawa. Bukan itu saja. Ketika asyik menonton siaran sepak bola dini hari, Yunita kadang tergoda begitu melihat suami yang tengah terlelap. Kalau sudah begitu, meski pertandingan

lagi seru, dia rela memalingkan muka demi menggoda suami. Begitu sang suami bangun, mereka langsung bikin pertandingan sendiri. ”Kalau kedengaran gol, baru saya ngelihat ke televisi lagi,” ujar fans berat Chelsea itu, lalu terkekeh. Bicara soal spontanitas, Arinda juga paling suka melakukannya. Hanya, dia tidak punya keleluasaan waktu di rumah seperti Yunita. Alhasil, dia harus bekerja lebih keras untuk mencari tempat

C

m

y

k

dan kesempatan saat jauh dari rumah. ”Salah satu spontanitas yang paling saya ingat sih terjadi beberapa bulan lalu. Saat itu pasangan menjemput saya di kantor. Kebetulan, saya lembur sampai menjelang tengah malam,” tutur Arinda. ”Lalu, tiba-tiba muncul ide untuk berbuat nakal. Ya sudah, kami cari lantai yang paling sepi di gedung perkantoran saya, lalu make love di sana. Lucu dan asyik banget,” lanjut perempuan 25 tahun itu dengan mata berbinar. (*/JP)

33


34

Pontianak Post

C

M

Y

K

Sabtu 16 Maret 2013


Pontianak Post

Sabtu 16 Maret 2013

METRO SPORT

Pelatnas Tinggal Dua JAKARTA -- Duta Indonesia gagal mengulangi pencapaian apik di All England lalu. Di kejuaran bulu tangkis tertua itu, Merah Putih menempatkan delapan wakilnya,

tujuh dari pelatnas, di babak perempatfinal. Kemarin (15/3) di St.Jacobshalle Basel dalam Swiss Terbuka, Indonesia tinggal menyisakan lima wakil. Dua diantaranya dari

pelatnas. Wakil pelatnas yang etrsisa adalah ganda campuran. Yakni Tontowi Ahmad/Liliyana Natsir serta M.Rijal/Debby Susanto. Lalu non pelatnas adalah Mar-

kis Kido/Pia Zebadiah, Alvent Yulianto/Markis Kido, dan Pia Zebadiah/Rizki Amelia. Nah, dalam pertandingan kemarin ganda campuran non pelatnas Kido/Pia kalah di babak delapan besar atas Zhang Nan/Tang Jinghua 19-21,2119,14-21. Pada pertandingan yang diselesaikan lewat rubber

C

M

Y

K

game itu pasangan Indonesia dan Tiongkok itu berjibaku selama 55 menit. Dalam statistik pertandingan yang ditulis tournamentsoftware, Nan/Jinghua memenangi smas sebanyak 21 kali. Lalu Kido/Pia 16 kali. Permainan di depan net, Nan/Jinghua juga lebih tenang. Mereka men-

35 gungguli wakil Indonesia dengan perbandingan 16 laan 12. Hingga dini hari tadi, Owi/ Butet, panggilan Tontowi Ahmad/Liliyana natsir, masih bertanding melawan Shin baek Choel/Jang Ye Nang di abbak perempatfinal. Sedang M.Rijal/Debby Susanto berjibaku melawan Michael

Fuchs/Birgit Michels. Sementara itu, pelatih ganda putri pelatnas Richard Mainaky menuturkan pencapaian Anneke Feinya dkk di Swiss Terbuka ini kurang maksimal. Ditarget mencapai babak perempatfinal, Anneke Feinya/ NItya Krishinda kandas di babak pertama. (dra)


SOCCER

36 Real Madrid v Galatasaray

Waspada Ledakan Cim Bom Cim Bom - julukan Galatasaray - sebenarnya sudah bagus dengan menembus perempat final karena menyamai prestasi terbaik pada 2001. Tapi, seperti 12 tahun lalu, klub asuhan Fatih Terim itu mendapat kesempatan lagi menghadapi Real Madrid. Real tidak beruntung karena harus menjadi tuan rumah lebih dulu di Santiago Bernabeu (2/4). Itu membuat Los Merengues “ julukan Real “ harus menabung banyak gol kemenangan sebelum melawat ke kandang neraka, Turk Telekom Arena, (10/4). Laga ini akan menjadi momen reuni bagi entrenador Real Jose Mourinho dengan tiga mantan anak asuhnya, Didier Drogba (eks Chelsea) dan Wesley Sneijder (eks Inter Milan), dan Hamit Altintop yang musim lalu masih berkostum Los Merengues. Ini sekaligus duel antara dua pemain tersubur di kompetisi ini. Yakni, Cristiano Ronaldo (Real) versus Burak Yilmaz (Gala) yang sama-sama mengemas 8 gol. Capaian Yilmaz cukup fantastis karena memiliki minute play lebih sedikit ketimbang Ronaldo (677 banding 720). Head to Head Pertemuan terakhir keduanya terjadi pada perempat final Liga Champions edisi 2001. Real memang lolos dengan agregat 5-3, tapi Galatasaray memenangi leg pertama dengan 3-2. Real Menang 1

Seri 0

Gala Menang 2

Malaga vv Borussia Borussia Dortmund Dortmund Malaga

Perang Kuda Hitam Seperti diungkapkan der trainer Borussia Dortmund Juergen Klopp seusai drawing : kedua tim sama-sama menampilkan permainan mengejutkan di Liga Champions musim ini. Kesimpulannya, satu tempat di semifinal digaransi menjadi milik tim kuda hitam. Laga home bakal menjadi kunci kesuksesan masingmasing. Malaga telah membuktikannya di 16 besar dengan membalikkan defisit 0-1 dari FC Porto di Portugal dengan victory 2-0 di La Rosaleda. Sedangkan Dortmund menunjukkan superioritasnya di Signal Iduna Park saat menggilas Shakhtar Donetsk 3-0 (setelah imbang 2-2 dalam leg pertama di Ukraina). Dua playmaker muda, sama-sama 20 tahun, siap beradu dalam tie ini. Mario Goetze dari Dortmund versus Isco (Malaga). Jika Isco meraih Golden Boy Award (penghargaan pemain terbaik Eropa U-21 dari Tuttosport), maka Goetze adalah pemenanng setahun sebelumnya. Catatan khusus untuk pelatih Malaga Manuel Pellegrini. JIka dia sukses menyingkirkan Dortmund akan membuatnya menyamai catatan gemilangnya pada musim 20052006. Yakni, kala meloloskan Villarreal menembus empat besar dalam debutnya di Liga Champions.

REUNI IBRA DENGAN BARCA NYON - Sejak musim 20072008 atau dalam lima musim terakhir, Barcelona selalu sukses menembus semifinal di ajang Liga Champions. Itu termasuk dua kali merebut juara pada 2009 dan 2011. Tapi, upaya Barca - sebutan Barca - untuk meraih streak yang keenam musim ini tidak akan mudah. Itu mengacu drawing perempat final di Nyon, Swiss, kemarin yang mempertemukan Barca dengan klub Prancis paling hot saat ini, Paris Saint-Germain (PSG). Leg pertama bakal digelar di kandang PSG, Parc des Princes (3/4), sedangkan leg kedua di kandang Barca, Nou Camp, dimainkan enam hari berikutnya (9/4). “Kami cukup mengenal kekuatan PSG sebagai sebuah tim yang bagus di setiap lini karena kami pernah menjajal mereka di pramusim (dalam ajang Le Trophee de Paris pada 4 Agustus 2012 yang dimenangi Barca 4-1 setelah imbang 2-2 dalam waktu normal, Red),” kata Andoni Zubizarreta, direktur olagraga PSG, seperti dilansir Marca. Salah satu pemain PSG yang akan menjadi perhatian Barca tentu saja Zlatan Ibrahimovic. Bomber 31 tahun Swedia itu pernah mengenakan kostum

Barca pada musim 2009-2010 dengan catatan 46 laga dan 22 gol. Di pramusim, Ibra juga sudahmembobolgawangmantan klubnya itu. Hanya, Ibra tak bisa menghadapi Barca dalam leg pertama seiring masih menjalani sisa skors satu laga lagi meyusul kartu merah saat melawan Valencia di leg pertama 16 besar (12/2). “Saya pikir, kehilangan Ibrahimovic di leg pertama bakal menurunkan potensi kekuatan PSG sekalipun mereka masih memiliki pemain bagus seperti (Ezequiel) Lavezzi dan (Javier) Pastore,” kata bek kiri Barca Jordi Alba. Menyikapi hasil drawing yang mempertemukan dengan Barca, kubu PSG tak berani berharap banyak. “Ini adalah undian paling sulit bagi kami karena yang kami hadapi adalah tim terbaik dunia,” kata Leonardo, direktur olahraga PSG, seperti dilansir di situs resmi UEFA. “Barca mutlak favorit. Tapi, PSG tidak takut,” tandas pria yang menggelar proses lamaran kepada kekasihnya, Anna Billo, seusai drawing itu. Berbeda dengan Barca, rival abadinya, Real Madrid hanya akan bertemu Galatasaray. Di atas kertas, Galatasaray memang bukan favorit alias kuda

hitam. Tapi, Real tidak bisa menganggap sebelah mata klub Turki itu karena keberadaan dua rekrutan top mereka di bursa transfer Januari lalu, yakni Didier Drogba dan mantan pemainnya, Wesley Sneijder. “Setiap tim yang telah mencapai fase ini (perempat final), tidak bisa dikatakan mudah,” kata Emiliano Butragueno, direktur Real, kepada Marca. Runner-up musim lalu, Bayern Munchen, tidak beruntung karena harus menghadapi raksasa Italia, Juventus. Dari rekor pertemuan atau enam laga, Juve masih lebih baik dengan lebih banyak menang (tiga banding dua). “Saya telah melihat permainan Juventus dalam dua musim terakhir dan mereka bukan tim yang senang bertahan. Saya harap pertandingan nanti akan berlangsung terbuka,” kata der trainer Bayern Jupp Heynckes di situs resmi klub. Satu slot delapan besar lainnya mempertemukan dua kuda hitam. Debutan Malaga versus Borussia Dortmund. “Saya mengenal permainan mereka (Malaga) semasa masih membela Real Madrid dan mereka bermain bagus ketika menghadapi kami. Jadi, kami harus berhati-hati,” kata gelandang Dortmund Nuri Sahin kepada Kicker. (dns)

Pontianak Post

Sabtu 16 Maret 2013

Bayern Munchen v Juventus

Ditentukan Detail Kecil PERTEMUAN antara klub Jerman versus klub Italia selalu menarik. Begitu pula antara Bayern Munchen kontra Juventus. Boleh dibilang, keduanya merupakan representasi kekuatan terbaik di Bundesliga dan Serie A. Untuk musim ini, baik Bayern dan Juve juga tengah nyaman memuncaki klasemen di liga masing-masing. Bayern yang berambisi membayar kegagalan di final musim lalu tak akan mudah melewati hadangan Juve. Seperti kekhawatiran kiper Bayern Manuel Neuer yang menyebut bahwa tim-tim asal Italia memiliki organisasi permainan yang rapi. Berarti, FC Hollywood “ julukan Bayern “ tidak boleh melakukan kesalahan atau bakal dihukum seperti saat dipermalukan Arsenal 0-2 di leg kedua 16 besar (13/3). Ingat, Juve juga masih belum terkalahkan sepanjang Liga Champions musim ini alias menang lima kali dan seri tiga kali. Nyonya Tua “ sebutan Juve “ pun telah menegaskan bakal memberi prioritas lebih di LIga Champions. Itu masuk akal karena Juve hanya tinggal berkiprah di dua ajang (Serie A dan Liga Champions). Bandingkan dengan Bayern yang masih eksis di tiga ajang (Bundesliga, DFB Pokal, dan Liga Champions). Head to Head Pertemuan terakhir terjadi di fase grup Liga Champions empat tahun lalu yang dimenangi Bayern dengan skor telak 4-1 di Turin (kala itu kandang Juve masih Olimpico). Tapi, overall, Juve masih lebih banyak menang ketimbang Bayern. Bayern Menang 2

Seri 1

Juve Menang 3

PSG vv Barcelona Barcelona PSG

Reuni Sarat Emosi BARCELONA kembali mendapatkan lawan berat setelah AC Milan di babak 16 besar. PSG memang tidak memiliki tradisi Eropa sebagus Milan. Jika Barca “ sebutan Barcelona - selalu menembus semifinal dalam lima edisi terakhir, PSG kembali berkiprah di Liga Champions setelah absen tujuh tahun. Tapi, siapapun tahu bahwa kekuatan PSG tidak bisa diremehkan. Setidaknya ada tiga alumnus Barca yang bakal tersulut sisi emosionalnya karena merasa pernah disingkirkan klub asal Catalan itu. Yakni, Zlatan Ibrahimovic, Maxwell dan Thiago Motta. Ibra, sapaan akrab Ibrahimovic, tentu menjadi sosok sentral. Hanya, karena masih harus menjalani skors satu laga lagi menyusul kartu merah di 16 besar, Ibra bakal absen dalam leg pertama di Parc des Princes alias baru turun dalam leg kedua di Nou Camp. Berbeda dengan 16 besar, Barca akan mendapat suntikan motivasi kuat seiring bakal kembalinya sang entrenador, Tito Vilanova. Azulgrana “ julukan Barca “ juga telah mengonfirmasi sekaligus menggaransi Vilanova tetap menangani Carles Puyol cs musim depan.

Head to Head Ini adalah pertemuan pertama kedua tim. Tapi, bagi Dortmund, pengalaman saat menghadapi raksasa Spanyol Real Madrid bisa membantu. Dalam dua pertemuan, Die Borussen - sebutan Dortmund - menang home (2-1) dan seri 2-2 di Santiago Bernabeu. Malaga Menang Seri 0 0

Head to Head

Liga Champions Ambassador: Steve McManaman

Tie ini merupakan ulangan perempat final Liga Champions 1995 yang dimenangi PSG dengan agregat 3-2 (menang 2-1 di Parc des Princes dan bermain 1-1 di Nou Camp). Dua tahun kemudian, Barca membalasnya dengan kemenangan 1-0 di final Piala Winners. PSG Menang Seri Barca Menang 1 1 1

Dortmund Menang 0

C

M

Y

K


Pontianak Post