Page 1


Hotline Service


Phone: 081257225755 082150002031 SMS: 085347259955

t os

anak P nti

Berlangganan & Pengaduan




Pontianak Post

Kamis 13 Juni 2013 M / 4 Sya'ban 1434 H

Eceran Pontianak Rp. 3.000


Tuntut Ungkap Kasus Pembunuhan Peningkatan kapasitas direksi melalui penambahan beban jalan terbaik untuk capacity building Dollar US

Dolar SGD

MEMPAWAH-Ratusan massa solidaritas Harnofia Fitryani (15), korban penculikan, pembunuhan serta perkosaan yang terjadi 18 Desember 2012 di Desa Sungai

Bakau Besar Laut, Mempawah Timur, kembali menggelar aksi unjuk rasa, Rabu (12/6). Kali ini massa terdiri dari pihak keluarga dan warga Bakau Bes a r melakukan aksinya di Polsek Sungai Pinyuh dan Polres Mempawah.

Sejak pukul 08.30 WIB, dikawal voorijder Lalu Lintas Polres Mempawah, massa menuju Polsek Sungai Pinyuh menggunakan kendaraan roda empat dan roda dua. Sesampainya disana, mereka langsung melakukan orasi di pinggir jalan. Lalu lintas dari dan ke Anjungan sempat macet total.

Dalam aksinya, massa menuntut penyelesaian kasus pembunuhan yang dinilai lambat ditangani oleh Kepolisian. “Bagaimana kinerja kepolisian, sudah enam bulan kasus ini masih ‹Ke Halaman 7 bekolom 5 lum

Ringgit MYR 3.134



Kapolres Baru Disambut Demo

Kurs Rupiah 12 Juni 2013


Jalani Program Hamil OLLA Ramlan tengah menjalani program kehamilan. Setelah menikah dengan Aufar Hutapea pada 20 Desember 2012, ibu satu anak tersebut berniat menunda kehamilan. Namun, sepertinya keduanya berubah pikiran. Olla dan Aufar ingin segera memiliki momongan. ’’Awalnya kan mau pending. Pakai KB. Tapi, sudah sebulan ini dilepas,’’ katanya ketika ditemui di Grand Indonesia kemarin (12/6). Niat menunda memiliki momongan dipilih mereka karena kegiat a n Olla c u kup ‹Ke Halaman 7 kolom 5

Olla Ramlan


Kapal Selam Pertama Buatan Indonesia TNI Angkatan Laut (AL) bakal memiliki kapal selam buatan dalam negeri. Kementerian Pertahanan (Kemenhan) merancang rencana membuat kapal selam pertama di Indonesia. Produksinya dilakukan PT PAL Surabaya. ”Betul, akan dimulai infrastrukturnya tahun depan,” ujar Staf Ahli Bidang Keamanan Menteri Pertahanan Mayjen Hartind Asrin di kantornya kemarin (12/6). Paling lambat dalam dua hingga ‹Ke Halaman 7 kolom 5


Bakal Sampai Pengadilan PENGEMBANGAN pengusutan kasus korupsi proyek pembangunan sport center Hambalang memasuki tahap dibukanya penyelidikan baru. Kemarin Komisi Pemberantasan Korupsi (KPK) meminta keterangan Djoko Pekik, deputi IV Bidang Peningkatan Prestasi Kementerian Pemuda dan Olahraga (Kemenpora). ”Kami lakukan penyelidikan karena diduga ada tindak pidana korupsi,” kata Juru Bicara KPK Jo- Johan Budi han Budi S.P. Dalam penyelidikan baru itu, KPK berupaya menelisik ada tidaknya korupsi di pengadaan peralatan proyek Hambalang. KPK sudah meminta keterangan dari beberapa ‹Ke Halaman 7 kolom 5

Wahyu Ismir & Hamdan Abu Bakar/Pontianak POST

AKSI: Ratusan Massa solidaritas kasus pembunuhan Harnofia Fitriyani melakukan aksi di jalan depan Polsek Sungai Pinyuh, kemarin (12/6). (insert) Kapolsek Sungai Pinyuh, AKP Iwan Setiawan menjelaskan perkembangan kasus itu.

Pasar Lepas Dolar, Rupiah Dijaga

Stabil Rp 9.800 Per USD JAKARTA – Tekanan hebat yang dialami rupiah di pasar uang mulai sedikit reda. Bank Indonesia (BI) pun meyakink-

an bahwa melemahnya rupiah hanya bersifat sementara. Gubernur BI Agus Martowardojo menyatakan, langkah BI dalam upaya stabilisasi rupiah mulai membuahkan hasil. Kemajuan pembahasan APBN Perubahan 2013 juga

memberikan efek positif mengenai kejelasan kenaikan harga BBM. ’’Dengan kemajuan seperti yang kita lihat hari ini, kami meyakini ini semua membawa kondisi yang lebih baik. Jadi, kalau seandainya rupiah me-

lemah, itu kami yakini hanya bersifat sementara,’’ ujarnya saat ditemui di gedung DPR kemarin (12/6). Apa kemajuan dalam proses stabilisasi? Direktur Eksekutif Departemen Komunikasi BI Difi Johansyah mengungkap-

42.200 Calon Haji Batal Berangkat

Saudi Pangkas Kuota, Rugi Rp 300 Miliar

JAKARTA – Pemerintah Indonesia akan meminta ganti rugi kepada pemerintah Arab Saudi terkait dengan pemangkasan kuota haji 2013. Karena pemangkasan kuota haji itu, kerugian yang akan ditanggung penyelenggara haji mencapai Rp 300 miliar. Sekitar 42.200 calon jamaah haji Indonesia (CJHI) juga bakal batal berangkat ke Tanah Suci. ’’Potensi kerugian yang diderita akan kami sampaikan kepada pemerintah Arab Saudi agar dapat di-cover,’’ kata Menteri Agama Suryadharma Ali (SDA) di Kantor Kementerian Agama, Jalan Lapangan Banteng Barat, Jakarta Pusat, kemarin (12/6). Dia menyampaikan, Indonesia akan meminta kompensasi kepada Saudi jika kuota haji 2013 tetap dipangkas. Sebab, persiapan haji Indonesia sudah mencapai 75 persen. ’’Persiapan nyaris selesai. Beberapa pembayaran telah kami lakukan. Misalnya, pelunasan pemondokan dan katering. Jadi, kami akan meminta Arab Saudi untuk membayar kompensasi jika tetap dilakukan pemangkasan,’’ tegasnya. Direktur Jenderal (Dirjen)


MASJIDIL HARAM : Pemerintah Kerajaan Arab Saudi terus membangun. Salah satunya adalah pembangunan Masjidil Haram. Pembangunan yang belum rampung itu berdampak pada pengurangan kuota haji di seluruh Dunia termasuk Indonesia.

kan, gencarnya intervensi BI yang menggerojokkan dolar AS (USD) di pasar uang mulai menumbuhkan confidence para pelaku pasar. ’’Kemarin-kemarin pasar hanya one way. ‹Ke Halaman 7 kolom 1

Puluhan TKI Ditangkap Aparat Saudi JAKARTA-Beberapa tenaga kerja Indonesia (TKI) harus meringkuk di tahanan terkait dengan kerusuhan di Konsulat Jenderal Republik Indonesia (KJRI) Jeddah, Arab Saudi, Minggu (9/6). Mereka ditangkap aparat Saudi karena dugaan menjadi provokator kerusuhan yang menewaskan seorang TKI perempuan tersebut. Duta Besar (Dubes) RI di Riyadh Gatot Abdullah Mansur membenarkan adanya penangkapan beberapa WNI oleh otoritas keamanan Saudi. Namun pihaknya masih belum dapat memastikan berapa jumlah WNI yang ditangkap. “Kami masih belum tahu berapa jumlah seluruhnya. Tapi memang kami telah mendapat kabar dari otoritas setempat,” ujar Gatot saat dihubungi melalui telepon tadi malam. Gatot menjelaskan, pihak juga masih belum mengetahui kondisi WNI yang ditangkap. Ia juga menegaskan bahwa Kedubes masih belum tahu kapan tepatnya dan di mana WNI tersebut ditangkap. “Karena saat itu kami sedang diamankan di dalam kedutaan. Yang

‹Ke Halaman 7 kolom 1

‹Ke Halaman 7 kolom 5

Menikmati Kehangatan dan Kelezatan Makanan Indonesia di Brisbane 11: 41





Jualan Citarasa Nusantara ala Warung Mie Mie Lidah memang punya rasa kangen. Meski hati mantap merantau, kadang lidah masih ingin bernostalgia dengan masakan khas tanah air. Makanan Indonesia adalah “warung” di Brisbane, Queensland, Australia, untuk lidah-lidah yang rindu pulang itu. DOAN WIDHIANDONO, Brisbane “AYO, sanaan dikit! Masak duduk jauh-jauhan gini!” ujar Mie Mie Wing Kie, pemilik restoran Makanan Indonesia, kepada rombongan empat war-

Online: cmyk


tawan Indonesia yang mengunjungi Brisbane, Queensland, atas undangan Tourism Australia dan Tourism and Events Queensland, 28 Mei-3 Juni lalu. Kami pun bergeser merapat ke meja yang terletak di dekat pintu restoran di Hardgrave Road, Brisbane, itu. Makanan Indonesia memang sebuah restoran. Namun, suasananya begitu welcoming. Hangat. Rasanya, lantaran keintiman dan kehangatan pelayanannya, restoran itu lebih pas disebut warung. Lebih humble, lebih bersahaja, dan lebih at home. Kesederhanaan itu tampak pada desain interior restoran, eh, warung tersebut. Meja-mejanya terbuat dari

ALA INDONESIA: Mie Mie di restoran Makanan Indonesia-nya di Brisbane, Australia. Obat kangen warga Indonesia di rantauan.

*Mempawah, Sambas, Singkawang, Bengkayang Rp 3.000 *Landak, Sanggau, Sintang Rp 4.000 *Ketapang Rp 4.000 *Kapuas Hulu Rp 4.000

‹Ke Halaman 7 kolom 1

Jawa Pos Group Media


Ormas Islam Minta Stop Pengiriman TKW

JAKARTA-Insiden kerusuhan di Konsulat Jenderal RI (KJRI) Jeddah diharapkan menjadi titik awal untuk mengevaluasi kebijakan secara umum terkait dengan TKI di luar negeri. Lembaga Persahabatan Ormas Islam (LPOI) pun mendesak pemerintah agar menghentikan pengiriman tenaga kerja wanita (TKW) ke Arab Saudi. Desakan tersebut disampaikan Ketua LPOI KH Said Aqil Siradj setelah memimpin rapat kerja lembaga yang dipimpinnya di Kantor PB NU, Jalan Kramat Raya, Jakarta, kemarin (12/6). Dia mengatakan, kebijakan moratorium atau penghentian sementara pengiriman tenaga kerja perempuan ke Arab Saudi oleh pemerintah selama ini tidak cukup. “Kami mendesak pemerintah, dalam hal ini Kementerian Tenaga Kerja Dan Transmigrasi, agar menghentikan selamanya pengiriman tenaga kerja, khususnya perempuan, ke Saudi Arabia,” tegas Said Aqil. Dia memaparkan, jumlah tenaga kerja bermasalah di salah satu negara Timur Tengah itu yang terbesar hingga kini adalah perempuan. “Karena itu, penghentian pengiriman yang kami minta hanya wanita, laki-laki masih boleh,” tegas ketua umum Tanfidziyah PB NU itu. Di sisi lain, imbuh Said, LPOI juga mendesak Kementerian Luar Negeri meningkatkan pula pelayanan terhadap para TKI bermasalah tersebut. Selain itu, pemulangan tenaga kerja bermasalah ke tanah air diminta dipercepat. Sekretaris LPOI Luthfi A. Tamimi menambahkan, alasan lain terkait dengan permintaan penghentian pengiriman tenaga kerja ke Arab Saudi hanya untuk perempuan, juga menyangkut keberadaan hukum Islam. “Istri atau saudara perempuan kita pergi umrah yang hanya seminggu saja, kalau tidak didampingi muhrimnya, tidak boleh. Sementara itu, TKW tahunan tinggal di sana dibiarkan. Aturan apa ini?” gugat Luthfi. Desakan penghentian pengiriman tenaga kerja perempuan, juga disebabkan sikap pemerintah Arab Saudi yang masih enggan menandatangani kesepakatan bersama dengan Indonesia dalam perlindungan terhadap tenaga kerja. (dyn/c4/fat)


1POUJBOBL1PTUrKamis 13 Juni 2013

DPR Diminta Legawa Terima DPD

Dalam Merancang Undang-Undang

JAKARTA-Dewan Perwakilan Rakyat Republik Indonesia (DPR RI) harus terbuka dan menyambut kehadiran serta peran Dewan Perwakilan Daerah (DPD) dalam proses pembentukan undangundang (UU). Amanah putusan Mahkamah Konstitusi (MK) yang memerintahkan hal tersebut diharapkan tidak sampai menjadi polemik. “Persoalan yang paling inti dan sejatinya, DPR welcome tidak? Mau tidak terima DPD?” tanya Ketua MK M.Akil Mochtar di gedung MK kemarin. Sikap legawa DPR dinilai sangat penting agar sistem tetap berjalan dan kondusif. Akil mengakui, beberapa anggota DPR memang mempertanyakan posisi DPD dalam pembentukan UU yang sebelumnya murni kewenangan legislatif. Pertanyaan itu muncul setelah MK mengabulkan sebagian permohonan uji materi atas UU Nomor 27/2009 tentang MPR, DPR, DPD, dan DPRD serta UU Nomor 12/2011 tentang Pembentukan Peraturan Perundang-undangan. Putusan MK itu menyatakan bahwa DPD dilibatkan dalam penyusunan Program Legislasi Nasional bersama DPR dan pemerintah. “Sudah jelas dalam amar putusan bagaimana pola pembahasannya. DPD memang tidak terlibat semua, hanya UU tertentu terkait daerah, pembahasan otonomi, perimbangan

keuangan pusat dan daerah, dan sebagainya. Tidak semua,” ungkapnya. Sebelumnya, terkait dengan UU tersebut, DPD memang sebatas mengusulkan kepada DPR, tetapi tidak ikut membahas. Pembahasan hanya dilakukan antara DPR dan pemerintah. Tetapi, saat ini pembahasan

harus bersama, bertiga. Namun, DPD hanya ikut membahas di tingkat dasar. Teknisnya, DPR diwakili alat kelengkapannya seperti panitia khusus (pansus), komisi, atau badan. Pemerintah biasanya diwakili menteri terkait. Begitu juga DPD yang harus mengutus wakilnya.

Di tingkat terakhir, DPD boleh hadir, namun tidak mengambil keputusan. “Keputusan itu tetap menjadi milik antara DPR dan presiden. Hak membentuk undang-undang itu tetap DPR dan presiden. Bisa saja, saat RUU akan disahkan, presiden tidak setuju. Kan nggak jadi undangundangnya,” ujarnya.

Meski begitu, kehadiran DPD dalam pembahasan di tingkat awal sebuah UU itu saja sudah merupakan kemajuan besar. Sebelumnya, DPD hanya bisa mengajukan ke DPR melalui badan legislatif (baleg) dan setelah itu tidak ikut dalam pembahasan. “Ini sudah jauh berubah,” tegasnya. (gen/c5/fat)

RS APUNG: Rumah Sakit Apung dr Lie Gunawan dilibatkan dalam Bhakti Bhayangkara KBKes, kemarin (12/6), di Pontianak. Fasilitas ruang operasipun tersedia. MUJADI/PONTIANAK POST

Kunjungi Kubu Raya - HIPMI Expo Aula Makodam XII Tanjungpura, 11-15 Juni 2013

KUNJUNGILAH beramairamai Kubu Raya – HIPMI Expo & Fair 2013 di Halaman dan Aula Makodam XII Tanjungpura, Jl Mayor Ali Anyang (arah ke jembatan tol 2). Kubu Raya – HIPMI Expo & Fair 2013 dibuka Menteri Pertanian Suswono, Selasa, 11 Juni 2013, sekitar pukul 17.00, serta akan berlangsung hingga Sabtu, 15 Juni 2013. Acara yang mengusung tema ‘dari masa lalu hingga masa depan, Kubu Raya tetap Indonesia’ ini diisi berbagai kegiatan.

(1) Pameran ICT, UKM, dan mutli product. (2) Lomba dan pameran foto potensi Kubu Raya. (3) Lomba desain blog umum. (4) Lomba typing master pelajar. (5) Lomba cerdas cermat pelajar via SMS Gat e w ay . ( 6 ) Lomba menggambar dan mewarnai untuk anak. (7) Festival modern dance umum dan anak. (8) Lomba busana batik casual umum dan anak. (9) Display drumband pelajar

dan peserta seni/hiburan. Rangkaian Rakernas XV HIPMI ini menambah semarak momen menyambut HUT ke-6 Kabupaten Kubu Raya, HUT ke-1 Harian Rakyat K a l b a r, d a n HUT ke-41 HIPMI. Bupati Kubu Raya Muda Mahendrawan melihat kegiatan tersebut sebagai wujud harmonisasi seluruh lapisan masyarakat maupun golongan. “Momen ulang tahun ini momen refleksi, agar kita bisa bangkitkan rasa nasionalisme dan ke-Indonesiaan,” ujar Bupati yang menerima predikat Bukan Bupati Biasa dari Majalah Tempo. Dalam kegiatan ini, Muda juga menampilkan program unggulan Kubu Raya di bidang pertanian, peternakan, perikanan, kelautan, kesehatan, dan pendidikan. Mayjen TNI Ridwan, Pangdam XII Tanjungpura menyambut baik dan mendukung penuh pelaksanaan Kubu Raya – HIPMI Expo & Fair 2013. “Ini bukti, Kalbar daerah yang kondusif bagi dunia usaha dan investasi,” katanya.

Mohamad Qadhafy, Manajer Event dan Pengembangan Harian Rakyat Kalbar menyampaikan, pelaksanaan Kubu Raya – HIPMI Expo & Fair 2013 sangat luar biasa. “Momen ini sulit untuk digabungkan, tapi beruntunglah kali ini bisa kita laksanakan bersamaan,” ujar penanggungjawab kegiatan ini bersama Ketua Panitia Alik Rosyad. Panitia menggandeng Akademik Manajemen Informatika dan Komunikasi Bina Sarana Informatika (AMIK BSI) untuk lomba desain blog, cerdas cermat, dan typing master. “Mulai besok, Kamis, 13 Juni 2013, kami akan gelar bazaar pasar murah pada jam-jam tertentu antara jam 17.00-21.00, di Stan BPC HIPMI Kubu Raya,” kata Ketua BPC HIPMI Kubu Raya ini. Panitia mengundang seluruh warga Kalimantan Barat, khususnya di Kubu Raya dan sekitarnya untuk datang dan meramaikan seluruh rangkaian Kubu Raya – HIPMI Expo & Fair 2013. “Jangan lewatkan berbagai acara yang disuguhkan. Dapatkan pula berbagai produk dalam pameran ICT dan UKM,” pungkasnya. (d1/ biz)



4,697.88 12/06/13

21,354.66 12/06/13



Pontianak Post z Kamis 13 Juni 2013

13,289.32 12/06/13

3,153.48 12/06/13

Rp. 9.338.07 12/06/13

Rp 13.119.82 12/06/13

Rp 7.849.65 12/06/13

Rp 513.000 12/06/13

USD 95.91 12/06/13

HKI Sebagai Alat Persaingan Dagang PONTIANAK—Peran hak kekayaan intelektual (HKI) cukup penting bagi perekonomian sebagai alat persaingan dagang, terutama bagi negara maju agar tetap menjaga posisinya menguasai pasar internasional dengan produk barangnya. “HKI juga menjadi alat pendorong kemajuan iptek dengan inovasi-inovasi baru yang dapat diindustrikan,” kata Togi Lumban Tobing, staf Ahli Gubernur Kalbar bidang Hukum dan Politik saat membuka Focus Group Discussion Pentingnya Penetapan HKI yang diselenggarakan Kantor Penelitian dan Pengembangan Kalbar, kemarin (12/6), di Hotel Orchardz Ayani

Pontianak. kaitannya dengan Togi yang saat itu upaya mengejar kemewakili Sekda Kalbar tertinggalan dalam M Zeet Hamdy Assovie hal perlindungan, melanjutkan, HKI juga pemanfaatan, serta sangat penting sebapemahaman HKI gai alat peningkatan itu sendiri,” katanya. kesejahteraan perekoApalagi Indonesia nomian masyarakat, tertinggal 100 tahun khususnya para pelaku Agus Muharso Taufik dari negara-negara litbangyasa (penelimaju seperti Italia, tian, pengembangan Amerika Serikat, Indan perekayasaan) yang mem- ggris yang telah menerapkan punyai temuan yang diindustri- HKI. kan yaitu dengan mendapatkan Kepala Kanlitbang Kalbar imbalan berupa royalti. Agus Muharso Taufik menegas“Menyadari hal tersebut, kan, pihaknya akan terus menyokita memang memerlukan sialisasikan HKI ke masyarakat. suatu gerakan yang cepat, te- Apalagi Kanlitbang ditunjuk oleh pat dan tuntas, khususnya pemerintah pusat sebagai salah

satu sentra HKI dari 10 lembaga yang ada di Indonesia. “Dari 10 itu, delapan dari perguruan tinggi dan satunya Banlitbang Jawa Tengah,” katanya. Dia menambahkan, dalam implementasinya, Kanlitbang Kalbar hanya sebagai fasilitator dalam pengurusan HKI dan lebih banyak mengambil peran dalam hal sosialisasi ke masyarakat. “Kami tidak bekerja sendiri, kami hanya memfasilitasi bagi yang ingin mengurus HKI. Di Kalbar juga ada Universitas Tanjungpura dari Dikti dan di Kementerian Hukum dan HAM terkait perindustrian dan perdagangan,” ujarnya. (zan)

Carrefour Lakukan Pengundian Program Belanja Makin Untung


PAKAI DOLAR: Penjual solar eceran di Jalan Ambawang, dekat Tugu Alianyang, Kabupaten Kubu Raya, memajang papan harga dengan menggunakan logo dolar untuk menarik pembeli yang datang. Banyak cara dilakukan untuk menarik perhatian pembeli yang digunakan para pedagang solar eceran ini.

JAKARTA—PT Trans Retail Indonesia (Carrefour melakukan pengundian program promo undian berhadiah “Belanja Makin Untung” di Carrefour Lebak Bulus, kemarin. Kegiatan tersebut dilakukan di depan Notaris, Kementerian Sosial RI, Kepolisian dan saksi-saksi lainnya. Program promo ini sendiri telah berlangsung sejak 3 Mei sampai dengan 7 Juni 2013, berlaku di seluruh gerai Carrefour di Indonesia. Setiap pelanggan yang berbelanja Rp100,000 dalam satu struk, berlaku keli-







CABUT UNDI: Shafie Shamsuddin Presiden Direktur & CEO bersama manajemen PT Trans Retail Indonesia melakukan pengambilan kupon undian.

patan, mendapatkan satu kupon undian. Bagi pelanggan yang berbelanja menggunakan kartu kredit Carrefour Mega Card mendapatkan tambahan satu kupon undian. “Kami mengucapkan terima kasih kepada seluruh pelanggan setia Carrefour atas semua partisipasi dalam mengikuti program ini. Program ini merupakan bentuk dari apresiasi kami terhadap semua pelanggan setia Carrefour di seluruh Indonesia”, ujar Hendrik Adrianto, Head of External Communications and CSR, PT. Trans Retail Indonesia. Setiap pelanggan Carrefour yang telah mengisi kupon dan memasukkannya ke dalam kotak undian yang berada di setiap gerai Carrefour, berkesempatan untuk mendapatkan berbagai macam hadiah menarik. Pelanggan yang beruntung bisa membawa pulang hadiah utama berupa satu mobil Toyota Alphard. Selain itu, pelanggan Carrefour juga berkesempatan untuk mendapatkan salah satu hadiah berupa empat Toyota Fortuner, enam motor Vespa S 150, 20 paket wisata keluarga ke Disneyland Hongkong, Universal Studio Singapura dan Trans Studio Makassar, dan tiga belas voucher belanja Carrefour dengan total Rp1,3 M. Pemenang akan dihubungi oleh PT. Trans Retail Indonesia dan akan diumumkan di harian Kompas, pada tanggal 14 Juni 2013. Pemenang undian berhadiah “Belanja Makin Untung” Carrefour ini tidak dipungut biaya dalam bentuk apapun. “Kami ingin menginformasikan bahwa secara resmi program ini telah ditutup. Kami juga mengimbau kepada para pemenang khususnya dan masyarakat pada umumnya untuk mewaspadai kejahatan penipuan yang mengatasnamakan Carrefour. Untuk itu, apabila ada yang memerlukan informasi seputar program Carrefour dapat membuka website resmi kami di”, tambah RM. Adji Srihandoyo, Corporate Affairs Director, PT. Trans Retail Indonesia. (r/*)


Pontianak Post


Kamis 13 Juni 2013






Pontianak Post


Kamis 13 Juni 2013




06.00 Berqah (Bersame Qur’an Hadist) 07.30 Pontianak Pagi 11.00 BBM (Berita Berita Musik) 12.00 Berite Kite Siang 15.00 Ngamen di TV 19.00 Berite Kite Malam 20.00 Sejam Bersame Bang Midji 22.00 Ngagak Antu PONTV, PUKUL 22.00 WIB

Ngagak Antu Menelusuri tempat-tempat angker di Pontianak dan sekitarnya. Penuh mistis, mendebarkan dan membuat bulu kuduk Anda bergidik. (*)



05:30 08:45 12:00 19:15 22:00 23:45

05.30 11.00 14.00 16.30 19.30 23.00

Khazanah Ga Nyangka Selebrita Siang On The Spot Bukan Empat Mata (Masih) Dunia Lain

Shaolin Soccer Setelah kesalahan yang menghancurkan karirnya, seorang mantan pemain sepak bola menemui murid saolin untuk menyebarkan arti kungfu sebenarnya. (*)

RCTI Pukul 23.00 WIB

Kembali dengan My Name Is Siti ANGGER BONDAN/JAWA POS

ALBUM BARU: Penyanyi R&B, Sania saat berkunjung ke kantor redaksi Jawa Pos, Graha Pena, Kebayoran Lama, Jakarta, kemarin (12/6).


Kabar Arena Pagi Coffee Break Ruang Kita Gestur Live News: Kabar Malam Live News: Kabar Hari Ini

06.00 Live Fokus Pagi 16:00 Drama Korea: Faith The Great 10.00 Live: Pagi Pagi Bagi Bagi Doctor 14.00 Hot Kiss 18.00 Drama Seri Indonesia: Setulus Kasih Ibu 22.00 Blocking Top Coffee

20.05 360 21.30 Forum Bisnis 23.30 Metro Sports


06.30 10.00 13.30 19.30 21.30 23.30


METRO TV 05.00 Metro Pagi 11.05 Sisi Berita 13.05 Wideshot

TV ONE Lensa Olahraga New Friends Tom & Jerry Topik Petang RT Sukowi Axa City Cruise 2013



JAKARTA – Cukup lama penyanyi bernama Sania ini tidak mengeluarkan album baru. Terakhir dia merilis album ketiganya, Cintai Aku Lagi, pada 2006. Bulan lalu dia kembali. Perempuan yang dikenal luas karena lagu berjudul Santai itu merilis single baru berjudul Tak Cinta Lagi. Single tersebut berada dalam album terbarunya, My Name Is Siti, yang rilis September mendatang. Tidak hanya itu, Sania juga membawa banyak cerita selama lebih dari tujuh tahun belakangan. Dia sempat mengalami masalah kesehatan hingga harus dirawat di Singapura. Di luar musik, Sania berbisnis di bidang edukasi. Bulan depan, film barunya berjudul Tak Sempurna dirilis. Ketika berkunjung ke redaksi Jawa Pos Jakarta, kemarin (12/6), dia banyak berkisah. ’’Sebetulnya album ini disiapkan sejak 2009. Sudah mau rilis. Tapi, karena alasan kesehatan, lagunya nggak terkumpul,’’ ungkapnya. Kala itu, dia sempat merilis satu single. Namun, dia hanya sempat promo 2–3 bulan saja. Sebab, Sania sakit dan harus dirawat. Dia mengalami adenomiosis, salah satu gangguan rahim. Perempuan yang dulu dikenal dengan rambut kepangnya itu pun menjalani perawatan di Singapura. Sania mengungkapkan, sebetulnya sakitnya itu tidak parah. ’’Tapi, bagaimanapun, yang namanya sakit kan nggak boleh dianggap remeh,’’ ucap Sania yang dulu cuek ketika merasakan sakit ketika datang bulan. Setelah dirinya menjalani perawatan, dokter meminta beristirahat total. Itu membutuhkan waktu sekitar tujuh bulan.

Trans TV Pukul 21.30 WIB

The Uninvited Tanpa sepengetahuan Anna, ayahnya menjalin hubungan dengan Rachael. Meski tidak suka dengan kehadiran Rachael, mau tidak mau Anna harus bisa menerima ibu tirinya. (*)

Karena alasan itulah urusan album akhirnya ’’diistirahatkan’’ dulu. ’’Karena sakit itu, saya bisa dikasih waktu istirahat. Untuk introspeksi diri, lebih menjaga kesehatan,’’ katanya. Selama penyembuhan itu, Sania mendapat sebuah peluang bagus. Ada sebuah pre-school yang berpusat di Singapura yang hendak masuk ke Indonesia, MindChamps. Singkat kata, dia bergabung menjadi investor. ’’Sebetulnya ini bidang yang benar-benar baru buat saya. Dari hiburan ke pendidikan,’’ terangnya. Meski belum punya pengalaman apa pun, Sania memiliki visi dan misi yang sama di bidang pendidikan. Karena itu, dia sibuk dengan persiapan kelahiran MindChamps di Indonesia. Baru kemudian Sania teringat lagi pada rekaman dan album setelah sering ditanya orang kapan akan mengeluarkan album lagi. ’’Baru sadar aja. Eh, ternyata masih ada ya orang yang appreciate sama saya,’’ ujarnya lalu tertawa. Tidak perlu lama, proyek album tersebut kemudian digarap lagi. Lagu ciptaan Tohpati berjudul Tak Cinta Lagi menjadi single kedua. Lagunya kental pop. Sania pun bilang, dirinya agak tersiksa menyanyikannya. ’’Agak tersiksa sih. Sebab, saya kan R&B. Dan R&B itu bebas diapa-apain. Kalau pop, harus lurus nyanyinya,’’ ungkapnya. Untuk film, Sania terlibat dalam film berjudul Tak Sempurna. Film tersebut dimainkan para penyanyi dan musisi hip hop. Ada Iwa K, Saykoji, dan lain-lain. (jan/c5/any)




1POUJBOBL1PTUrKamis 13 Juni 2013

Pontianak Post


Kamis 13 Juni 2013


Pasar Lepas Dolar, Rupiah Dijaga Sambungan dari halaman 1

Hari ini mulai two way,’’ katanya. One way adalah istilah untuk menggambarkan kondisi pasar yang hanya ada penawaran beli (bid only). Artinya, seluruh pelaku pasar ingin membeli USD. Kondisi tersebut sudah berubah menjadi two way. Artinya, pelaku pasar tidak hanya membeli USD, tapi juga sudah ada yang melakukan penawaran jual USD (bid and offer). Menurut Difi, pasokan USD kini tidak hanya berasal dari operasi intervensi BI, melainkan juga dari eksporter yang mulai melepas USD untuk ditukar rupiah. ’’Karena itu, kalau kita lihat di pasar spot, rupiah mulai stabil,’’ ucapnya. Dia menyebutkan, nilai tukar rupiah di pasar berjangka non-deliverable forward (NDF) untuk masa pengantaran satu bulan yang beberapa hari sebelumnya sempat menembus 10.400 per USD kemarin sudah melandai di kisaran 10.120 per USD. Data kurs di pasar spot di Reuters yang kemarin pagi dibuka di level 9.999 per USD sempat melemah hingga 10.095 per USD. Namun, pada penutupan sore, rupiah kembali menguat ke level 9.861 per USD. Sementara itu, data Bloomberg menunjukkan posisi rupiah ditutup di level 9.855 per USD. Posisi tersebut tidak berbeda jauh dengan penutupan kurs BI berdasar Jakarta Interbank Spot Dollar Rate (Jisdor) di level 9.856 per USD. Agus Martowardojo menambahkan, BI akan terus merespons perkembangan di pasar uang dengan bauran kebijakan (policy mix). Setelah kemarin menaikkan fasilitas Bank In-

donesia (fasbi) dari 4,0 persen menjadi 4,25 persen, hari ini BI akan melakukan rapat dewan gubernur (RDG) bulanan untuk menentukan BI rate. Apakah BI rate juga berpotensi naik? ’’Itu butuh pembahasan panjang. Kita lihat besok,’’ ujarnya. Sementara itu, twin operation atau jurus kembar terus dilakukan BI. Menurut Difi, penjualan besar-besaran surat utang negara (SUN) oleh investor asing yang membuat merosotnya nilai SUN dilawan BI dengan operasi pembelian besar-besaran. ’’Berapa pun SUN yang dilepas, kami siap tampung,’’ tegasnya. Kemarin BI menargetkan bisa membeli SUN hingga Rp 2 triliun di pasar sekunder. Namun, karena penjualan sudah mereda, BI hanya bisa membeli Rp 1 triliun. Difi menyebutkan, twin operation berupa pembelian SUN dan intervensi valas sekaligus menjadi mekanisme penyeimbang likuiditas rupiah di BI. ’’Kalau kita intervensi valas, dolar keluar dan rupiah masuk ke BI. Kalau kita beli SUN, SUN masuk ke BI dan rupiah keluar dari BI. Jadi, berimbang,’’ jelasnya. RAPBNP Menjelang pembahasan final RAPBNP 2013, Presiden Susilo Bambang Yudhoyono (SBY) menyatakan optimistis rancangan anggaran tersebut disetujui. Dia menuturkan, sekitar 80 persen rancangan anggaran tersebut telah disepakati pemerintah dan DPR. Setidaknya, tinggal beberapa poin yang menunggu persetujuan anggota dewan. ’’Saya sungguh berharap DPR dan pemerintah dalam satu dua hari ini bisa menghasilkan ke-

sepakatan-kesepakatan untuk disetujuinya RAPBNP menjadi APBNP yang definitif. Saya terus mengikuti dan saya juga terus berkomunikasi dengan semua menteri dan gubernur BI. Saya mengikuti juga sekitar 80 persen dari APBNP itu sudah disetujui. Tanggal 17 Juni, harapan saya tuntas semua,’’ ungkap SBY di Kantor Presiden kemarin. Soal keputusan mengurangi subsidi BBM, untuk kali kesekian SBY menuturkan bahwa langkah tersebut diambil untuk menyelamatkan perekonomian Indonesia. ’’Tanpa kenaikan BBM, ekonomi kita memburuk dan membuat ekonomi kita bermasalah di negeri ini. Maka, bismillah kebijakan itu kita ambil dengan pertimbangan sangat mendalam dan perhitungan yang kita lakukan bukan asalasalan dan kita sampaikan ke DPR RI,’’ tuturnya. Sementara itu, Menkeu Chatib Basri memaparkan, kenaikan harga BBM bisa berdampak baik bagi nilai tukar rupiah terhadap dolar AS (USD). Dia menguraikan, posisi pemerintah untuk menaikkan harga BBM sudah cukup jelas. Jika harga BBM dinaikkan, disparitas harga minyak antara domestik dan internasional mengecil. Akibatnya, penyelundupan berkurang. ’’Kalau penyelundupan berkurang, konsumsinya berkurang, sehingga defisit dalam transaksi atau neraca perdagangan akan berkurang, rupiahnya menguat,’’ jelasnya di kompleks Istana Presiden kemarin. Mengenai pergerakan rupiah, Chatib menuturkan, pihaknya telah melaporkan kepada presiden bahwa kurs rupiah sebenarnya mulai menguat di titik Rp 9.800. Namun, di pasar bursa masih

ada koreksi 167 poin minus 3,5 persen. Namun, dia menegaskan, melemahnya nilai mata uang Indonesia bukanlah yang terburuk. ’’Yang terburuk kemarin itu Bangkok dan Manila di atas 4,5 sampai 4,9 persen. Jadi, ini lebih pada fenomena global. Akibat situasi global ini kemudian berpengaruh pada seluruh pasar uang di regional. Itu yang kelihatan di kita,’’ jelasnya.

memperbaiki bangunan Masjidilharam. Karena itu, demi menjamin keselamatan jamaah haji, kuota haji seluruh dunia akan dipangkas 20 persen dari kuota dasar yang telah disepakati negara-negara OKI. ’’Mereka khawatir akan terjadi kecelakaan jika suasana terlalu berdesakan,’’ jelas SDA. Untuk menghadapi kemungkinan terburuk, Kemenag menjamin CJHI yang tidak bisa berangkat tahun ini. Mereka yang gagal berangkat tahun ini dipastikan berangkat pada 2014. Selain itu, bila terjadi kenaikan BPIH, CJHI tidak akan dikenai biaya tambahan. Sebaliknya, bila terjadi penurunan BPIH 2014, sisa pembayaran 2013 akan dikembalikan. ’’Jadi, diharapkan calon jamaah yang telah melunasi BPIH tahun ini lebih bersabar,’’ terang SDA. Saat ini, sekitar 180 ribu jamaah telah melunasi BPIH dan mendapat porsi haji 2013. Selain itu, pemerintah akan mengusulkan agar pemerintah

Saudi menambah kuota jamaah haji 2014. Kuota haji yang dipangkas tahun ini diharapkan ditambahkan untuk kuota haji tahun depan. Jika pemangkasan tetap terjadi, pemerintah akan memprioritaskan CJHI yang telah berusia lanjut. Pemerintah akan lebih memprioritaskan mereka yang berusia 83 tahun ke atas untuk pemberangkatan tahun ini. ’’Kami akan mendahulukan calon jamaah usia lanjut. Jadi, yang kami pangkas nanti adalah usia muda,’’ jelas SDA. Dia tetap meminta CJHI tidak panik karena perundingan terus dilakukan. Pemerintah Indonesia akan berusaha sekuat tenaga agar pemangkasan tersebut dibatalkan. Sebab, selain kerugian finansial dan sosial, masa tunggu jamaah haji Indonesia harus dipertimbangkan. Masa tunggu jamaah yang mencapai 12 tahun akan sangat menumpuk lebih parah jika tahun ini terjadi pemangkasan kuota. (mia/c5)

Perdagangan Melemahnya rupiah pada awal pekan secara tidak langsung berdampak pada perdagangan. Namun, Menteri Perdagangan Gita Wirjawan meyakinkan bahwa dampak tersebut hanya bersifat sementara dan tidak akan berpengaruh terhadap neraca perdagangan. ’’Dampaknya tentu pada produk-produk yang diimpor. Utamanya yang menjadi perhatian kami komoditas produk-produk pangan, khususnya hortikultura. Ditakutkan harganya bakal terangkat,’’ terangnya setelah menghadiri raker dengan Komisi VI DPR kemarin. Gita mengungkapkan, pihaknya telah memantau harga produk-produk pangan kemarin pagi. Berdasar pantauan tersebut, harga komoditas pangan relatif stabil, kecuali daging yang memang merupakan kasus lain. Dengan demikian, dia yakin hingga akhir tahun pasokan komoditas masih cukup aman. Hal yang sama, lanjut dia, terjadi pada produk manufaktur. Lemahnya rupiah, lanjut dia, bakal mengganggu psikologis investor dan pengusaha. Dia meyakinkan pengusaha agar tidak terlalu mengkhawatirkan kondisi itu. Sebab,

42.200 Calon Haji Batal Berangkat Sambungan dari halaman 1

Penyelenggara Haji dan Umrah (PHU) Kementerian Agama (Kemenag) Anggito Abimanyu menambahkan, kerugian yang akan ditanggung biro perjalanan haji swasta mencapai Rp 300 miliar–Rp 350 miliar. ’’Biaya pemondokan, transpor, katering, asuransi, buku manasik, gelang, dan kontrak dengan pemerintah Arab Saudi yang telah dilunasi pada tahap pertama mencapai Rp 300 miliar,’’ jelasnya. Karena itu, pemerintah Indonesia masih akan berunding dengan pemerintah Saudi soal pemangkasan tesebut. SDA menyebutkan, Presiden SBY akan menyurati Raja Arab Saudi Abdullah bin Abdulaziz agar kuota haji Indonesia tidak jadi dipangkas. Selain itu, presiden akan mengirim Menag untuk berunding dengan pemerintah Saudi agar pemangkasan tersebut dibatalkan atau setidaknya hanya dipotong 20 ribu. Selain dampak finansial,

dampak sosial akan dirasakan masyarakat. Mereka akan mengalami tekanan psikologis. Sebab, sebelumnya mereka pasti memberi tahu warga sekitar. ’’Hal tersebut harus diperhatikan juga, efek psikologis. Sebab, begitu selesai pelunasan, pasti tetangga sudah tahu,’’ ungkapnya. Sebagaimana diberitakan, kuota haji Indonesia 2013 dipangkas 20 persen dari kuota dasar yang telah disepakati. Kuota haji yang semula mencapai 211.000 jamaah akan dipangkas sekitar 42.200 jamaah. Dengan demikian, kuota jamaah haji Indonesia 2013 akan menjadi 168.800 jamaah. Pemangkasan kuota haji tersebut disampaikan Kementerian Haji Arab Saudi. Alasannya, rehabilitasi Masjidilharam terlambat selesai. Akibatnya, daya tampung tempat tawaf yang semula mencapai 48 ribu jamaah per jam menjadi hanya 22 ribu jamaah per jam. Para pekerja juga masih sangat sibuk

Jualan Citarasa Nusantara ala Warung Mie Mie Sambungan dari halaman 1

kayu telanjang yang masih tampak serat-seratnya. Tidak seperti restoran lain, di meja itu tidak ada serbet dan sendok-garpu yang ditata di masing-masing meja. Sendok-garpu ditaruh di sebuah wadah di ujung meja. Pengunjung mengambil sendiri sendok-garpu kalau hendak makan. Persis di rumah makan padang atau warung tegal. DindingrestoranMakananIndonesia berhias dekorasi sederhana. Beberapa hiasan wayang golek ditempelkan di dinding yang bercat putih polos. Satudua kertas karton putih dengan tulisan spidol warna-warni juga menghiasi dinding. Salah satu berbunyi: Live Music, Friday & Saturday Evening; Indonesian & Other Songs; Performed by Mono on Keyboard. Di kaca depan, tertempel karton putih dengan tulisan menarik. Yakni, beberapa kata dan ungkapan dalam bahasa Indonesia plus terjemahannya. Isi “kamus dinding” itu, antara lain, angka 1”10 dalam dua bahasa, Indonesia-Inggris. Lalu “apa kabar-how are you”, “apa itu-what is that?”, “berapahow much”, “lapar-hungry”, dan “pedas-spicy/hot taste”. “Kalau kamu, harus belajar menghafal kata cepat,” kata Prisca Hoo dari Tourism Australia kepada Melissa Webster, promotion and trade events coordinator Tourism Queensland. Memang, kunjungan wartawan Indonesia ke Brisbane dan Gold Coast harus menyinggahi tidak kurang dari 16 kegiatan kepariwisataan dalam waktu efektif lima hari. Karena itu, kata-kata “cepat” atau “hurryup” seakan-akan sudah menjadi doktrin ketika rombongan akan berpindah dari satu tempat ke

tempat yang lain. Mie Mie bukan tanpa maksud menempelkan “kamus dinding” tersebut di warungnya. “Itu agar orang sini sedikit-sedikit belajar bahasa Indonesia,” kata perempuan kelahiran 1955 itu sembari menyorongkan menu pembuka: tahu goreng plus saus bumbu kacang. “Kalian pasti kangen tahu goreng kayak gini, kan?” sambungnya. Rasa tahu bikinan Mie Mie memang sip. Masih hangat dan rasanya pas di lidah. Bukan cuma rasanya yang bikin maknyus. Tapi, kehangatannya seolah bisa melawan hawa dingin Brisbane yang siang itu sedang didatangi mendung dan hujan. Tidak perlu menunggu lama untuk datangnya menu utama. Mie Mie memasak buaaanyak sekali untuk kami. Ada cooked mixed vegetables-boiled egg served with peanut sauce & prawn cracker. Terjemahannya, aneka sayur matang dan telur disiram saus kacang plus kerupuk udang. Ya, tak lain dan tak bukan, ini gado-gado! Di daftar menu, harganya AUD 11,5 atau sekitar Rp 105 ribu per porsi. Ada lagi ayam goreng kalasan (marinated fried chicken), fuyunghai (Indonesian omelet with mince chicken, prawn and vegetable tapped with sweetsour sauce), dan cah kangkung (stir fried water spinach). Nasinya pulen dan wangi yang dihidangkan di sebuah bakul yang terbuat dari anyaman bambu. Aroma nasinya sangat khas. Sangat ndesani. Benar-benar komplet menu makan siang itu. Yang tertulis pada daftar menu restoran Makanan Indonesia sejatinya jauh lebih banyak. Semua ditulis dengan dua bahasa, Indonesia dan Inggris. Misalnya, berbagai jenis sate, aneka mi dan kare, asinan, udang dan ikan

asin, hingga es degan. “Kalau mau minta dimasakin petai, jengkol, atau ikan asin, juga bisa lho,” ujar perempuan beranak tiga tersebut. Kepada Jawa Pos, Mie Mie bercerita bahwa usaha restorannya itu sudah dijalankan selama enam tahun. “Cukup laris juga,” ungkap perempuan yang hijrah dari Jakarta pada 1977 itu. Saat pindah ke Australia, dia menuju Darwin. Di kota itu, dia bekerja keras hingga akhirnya bisa menjadi pegawai negeri sipil. Mie Mie lantas pindah ke Brisbane pada 2001. “Yang datang (ke Makanan Indonesia) bukan orang Indonesia yang kangen rumah saja, lho,” ujarnya. Banyak pula warga Australia yang mencicipi masakannya. Biasanya mereka pernah ke Indonesia, rindu masakan Indonesia, atau orang-orang yang ingin menjajal menu kuliner dari negara lain. Selain itu, para mahasiswa atau warga keturunan Timur Tengah yang ingin merasakan makanan khas Indonesia. Sejatinya, jualan utama Makanan Indonesia bukan sematamata masakan bercitarasa Nusantara. Yang membuat warung itu kerap menjadi jujukan adalah kehalalannya. Ya, seluruh menu di Makanan Indonesia halal. Itu juga tecermin pada logo halal yang dikeluarkan lembaga sertifikasi halal Australia di kertas menunya. Sama sekali tidak ada campuran daging bahkan minyak babi atau kandungan non-halal lain. Untuk menjamin standar halal itu, Mie Mie tidak mau sembarangan membeli daging. Dia hanya membeli daging langsung pada butcher (jagal) yang juga menerapkan prinsip halal. “Butcher-nya orang Arab,” terang perempuan yang menjalankan usaha bersama kakak-kakaknya tersebut.

Gita menjamin melemahnya rupiah tersebut hanya bersifat sementara. Lebih lanjut, dia optimistis neraca perdagangan hingga akhir tahun tidak akan terpengaruh. Menurut dia, pelemahan

rupiah justru bisa dimanfaatkan pengusaha untuk menggenjot ekspor. Dalam kondisi itu, daya saing produk Indonesia bakal terangkat. Sebab, harganya lebih murah dibanding sebelumnya. ’’Ekspor Indonesia untuk

beberapa barang dan jasa bisa menikmati depresiasi tersebut,’’ katanya. Meski demikian, dia tidak melihat potensi tersebut akan berdampak signifikan dalam menaikkan nilai ekspor. (owi/uma/ken/c5)

Puluhan TKI Ditangkap Aparat Saudi Sambungan dari halaman 1

jelas mereka ditangkap saat berada di luar KJRI”, ungkapnya. Mengenai berita tentang jumlah WNI yang ditangkap semakin banyak, Gatot menjelaskan bahwa kemungkinan itu bisa saja terjadi. Karena kasus tersebut telah dikembangkan lebih jauh oleh aparat. Sehingga lebih banyak lagi WNI yang ikut ditangkap ditempat lain, baik dirumahnya atau ditempat-tempat lainnya. Selanjutnya, Gatot menerangkan pihak Kedubes RI Riyadh belum mendapatkan informasi lebih lanjut dari PLT Konjen RI di Jeddah mengenai kondisi dan jumlah terakhir dari WNI yang telah ditangkap oleh otoritas setempat. Para WNI ditangkap

karena dituduh melakukan provokasi terhadap WNI lain saat terjadi antrian panjang di KJRI Jeddah hingga timbul kerusuhan dan pembakaran. Dalam mengatasi hal tersebut, pihak Kedubes di Riyadh siap untuk melakukan pendampingan saat melalui proses hukum agar WNI dapat segera dibebaskan. “Tapi saya yakin, sebentar lagi mereka akan dipulangkan. Itu hanya bentuk peringatan oleh pihak berwajib saja”, jelasnya. Saat ini, menurutnya, kondisi KJRI di Jeddah sudah kondusif. Pasca kerusuhan, Gatot mengakyui memang dari pihak kepolisian Jeddah menambah pasukan yang berjaga jaga di sekitar kantor Konsulat RI dari yang sebelumnya 30 menjadi

sekitar 100 orang. Kepolisian setempat menetapkan wilayah steril di sekitar konsulat dalam radius 200 meter dan tidak diperbolehkan ada kerumunan kecuali antrian. Kerusuhan dua hari lalu dipicu dari ketidakpuasan ribuan perkeja migrant yang sedang mengantri untuk mendaftar mendapatkan pemutihan dokumen buat mereka yang overstay terkait tawaran amnesti dari pemerintah Arab Saudi. Mereka sempat membakar satu pos penjaga di depan gerbang konsulat dan akibat kerusuhan itu seorang TKI tewas. Pemerintah Indonesia telah mengirimkan tim untuk mengevaluasi dan membantu pelayanan dokumen di Jeddah. (mia/ca)

Tuntut Ungkap Kasus Pembunuhan Sambungan dari halaman 1

terselesaikan. Tetapi tidak ada titik terangnya,” ungkap salah seorang pengunjuk rasa. Tak lama kemudia n massa berupaya masuk ke halaman Polres, namun di tahan oleh anggota Kepolisian yang berjaga. Sehingga sempat terjadi adu dorong di gerbang Polsek. Akhirnya untuk meredam emosi warga, Kapolsek Sungai Pinyuh, AKP Iwan Setiawan langsung menghadap warga untuk memberikan keterangan. “Kasus ini tidak diabaikan pihak kepolisian, namun kita sudah melakukan upaya penyelidikan. Bahkan mendatangkan tim dari mabes Polri. Kapolda juga sudah terjun langsung ke TKP. Jadi dimohon partisipasi dan dukungan dari warga, agar kasus ini cepat terselesaikan,” jelas dia. Keterangan Kapolsek ternyata tak mampu meredam emosi warga. Ketika Kapolsek memberikan keterangan, sebagian warga menyambutnya dengan ungkapan kekecewaan. Sehingga warga masih terus berupaya untuk masuk ke Polsek. Bahkan upaya Polsek untuk mediasi melalui lima perwakilan

masyarakat pun tak digubris. Terlebih suasana semakin memanas ketika seorang warga melihat salah satu oknum petugas yang berjaga di halaman Polsek diduga melakukan tindakan yang dinilai warga kurang menyenangkan. Situasi semakin memanas, dan massa berupaya masuk ke dalam Polsek untuk mencari oknum tersebut. Namun dengan sigap, petugas memblok kedatangan massa sehingga tidak masuk dan tertahan di halaman. Kembali Kapolsek berupaya menenangkan warga. Namun massa masih menuntut untuk dikeluarkannya oknum polisi tadi. Bahkan Kapolsek menawarkan kepada seorang wanita untuk menunjuk dan mencari dimana anggota tersebut. “Kalau memang ada, dan terbukti anggota saya melakukan tindakan tersebut, maka akan saya tindak tegas, tanpa pandang bulu,” tegas dia. Puas menyampaikan orasinya, massa kembali melanjutkan aksi ke Polres Mempawah. Sesampainya di sana, massa diarahkan berorasi di terminal mempawah, agar tidak mengganggu arus lalu lintas. Sama seperti di Polsek Sungai Pinyuh, massa

dengan antusias menyampaikan keinginan agar pihak Kepolisian segera melakukan penyelesaian kasus ini dengan segera. Mereka membakar replika keranda mayat, dan melempar benda keras serta telur busuk ke arah petugas sebagai bukti kekecewaannya. Namun segera diredam oleh pihak kepolisian. Kapolres Mempawah, AKBP Hadi Poerwanto, yang baru melakukan pisah sambut malam sebelumnya langsung menemui pengunjuk rasa, didampingi Komandam Kodim 1201/Mpe Letnan Kolonel Kav Bambang Sulistyo. Dalam kesempatan tersebut, tak berbeda dengan Kapolsek Sungai Pinyuh, Kapolres juga menyampaikan akan menuntaskan kasus tersebut dengan waktu secepatnya. “Kami telah berupaya maksimal. Polisi dalam hal ini tidak tidur, dan apa yang diduga oleh warga bahwa Kepolisian membiarkan kasus ini hingga berlarut-larut tidaklah benar. Sehingga dukungan baik informasi maupun menjaga kondisi yang kondusif sangat kami harapkan, sehingga kami dapat melakukan penyelidikan dengan maksimal,” tutur dia. (ham/wah)

Jalani Program Hamil Sambungan dari halaman 1

banyak. Dengan melepas KB, Olla berharap bisa segera hamil lagi. ’’Mudah-mudahan bisa (hamil) secepatnya ya, doain,’’ ujarnya. Karena itu, Olla mengurangi kegiatan. Dia tidak menerima tawaran syuting stripping yang menguras tenaga. Dia ingin

konsentrasi menjaga kondisi dan kesehatan supaya programnya berjalan sukses. ’’Jadwal sudah jelas sekarang. Nggak ada syuting stripping. Tinggal jaga kesehatan dan pola makan. Mudah-mudahan (cepat hamil),’’ lanjutnya. Aufar sangat mendukung keputusan istrinya. Dia memang tidak membatasi Olla

dalam berkegiatan. ’’Abang support sih. Dia malah senang kalau istrinya banyak kegiatan. Dia tidak menuntut saya untuk berhenti (kerja),’’ katanya. Tapi, kembali lagi, apa yang dilakukan Olla untuk kebahagiaan mereka. Mereka ingin rumahnya makin ramai dengan kehadiran bayi. (jan/ c6/any)

Kapal Selam Pertama Buatan Indonesia Mie Mie mengaku tidak sulit mendatangkan bahan-bahan mentah untuk memasak. Aneka sayur dan bumbu tersedia di Australia. Di sebelah restoran Makanan Indonesia ada toko milik orang Vietnam yang juga menjual berbagai sayur serta bumbu khas Asia. Beras pun bisa mudah didapat. “Kalau petai, saya pakai petai Thailand. Mereka impor banyak. Kalau terasi, pakai terasi Indonesia, dong,” tutur Mie Mie. Yang agak sulit, kata dia, justru ikan asin. Harganya cukup mahal. Per kilogram bisa dibanderol AUD 20 atau sekitar Rp 184 ribu. Bandingkan dengan daging sapi yang harga per kilonya hanya separo ikan asin. Memang, para bule lebih senang ikan asin dibanding daging sapi. “Nggak tahu, mereka suka banget,” ujarnya. Maklum bila harganya jadi mahal. Apalagi, bila musim dingin (winter), ikan asin sangat sulit didapat. Mie Mie bilang, hanya ada dua restoran di Brisbane yang disebutnya benar-benar Indonesia. Selain Makanan Indonesia, ada Jakarta Indonesian Restaurant di Brunswick Street. “Yang lain, banyak yang palsu, hahaha,” katanya lantas tertawa. Dia menambahkan, banyak restoran yang mengaku menjual makanan Indonesia, tapi kenyataannya menyajikan menu khas Melayu atau masakan Thailand. Dengan spesifikasi khusus masakan Indonesia itu, Mie Mie menyatakan optimistis akan kelangsungan warungnya tersebut. Kendati begitu, dia masih perlu mempromosikan lewat internet dan media sosial Facebook. Situs pencarian Google pun langsung merujuk pada rumah makan milik Mie Mie setiap pengakses mencari dengan kata kunci “masakan Indonesia di Brisbane”.(*/ c5/ari)

Sambungan dari halaman 1

tahun ke depan, Indonesia diharapkan sudah memiliki infrastruktur industri pembuatan kapal selam dan pesawat jet tempur berteknologi canggih, di atas pesawat tempur sekelas Sukhoi dan F-16. Program membuat jet tempur dan kapal selam itu akan dibuat sebagai proyek strategis nasional. ”Kami sedang merancang payung hukumnya supaya prosesnya berjalan lancar dan sinergis,” katanya. Sebagai negara kepulauan, keberadaan kapal selam dan pesawat jet tempur sangat diperlukan untuk menjaga kepulauan Indonesia hingga batas luar. Jika infrastruktur ada, pembuatan kapal selam bisa dilakukan di Indonesia. ”Tentu kita tetap akan membangun kerja sama dengan

negara lain,” ujarnya. Untuk teknologi kapal selam, Korea Selatan (Korsel) yang dilirik. Dua kapal selam tanah air, yakni KRI Cakra dan Nanggala, pernah menjalani perawatan di Negeri Ginseng itu. ”Tapi, kita usahakan seluruh prosesnya nanti di Indonesia,” katanya. Tahapan yang sudah selesai dilaksanakan hingga saat ini mencakup tahap teknologi desain. Dua tahun ke depan, ditargetkan akan mencapai tahap engineering manufacturing development dan prototipe. Indonesia juga sudah mengirim 52 ahli kapal selam ke Korsel untuk belajar. Pengamat militer Andi Widjajanto PhD menilai rencana itu mendesak dilakukan. Sebab, Indonesia belum mempunyai cetak biru yang jelas dalam

pertahanan kapal selam. ”Di Amerika Serikat (AS) sedang dikembangkan kapal selam siluman yang bisa terbang. Bisa masuk ke negara lain dengan senyap,” ujarnya dalam seminar di gedung S-2 Intelijen Universitas Indonesia (UI) kemarin. Artinya, Amerika tidak akan terdeteksi radar jika mau masuk ke Indonesia lewat bawah laut. ”Misalnya saja, tiba-tiba saja ada kapal selam asing masuk lewat Tanjung Priok, terbang, dan Monas dibom, kita tidak bisa apa-apa,” paparnya. Alumnus National Defense University Washington tersebut menjelaskan, teknologi kapal selam siluman AS akan siap pada 2030. ”Saat itu idealnya Indonesia juga harus sudah punya gelar armada laut yang hebat dan berwibawa,” tuturnya. (rdl/c9/ca)

Bakal Sampai Pengadilan Sambungan dari halaman 1

orang untuk mengungkap kasus korupsi pembangunan Pusat Pendidikan Pelatihan dan Sekolah Olahraga Nasional (P3SON) Hambalang, Bogor, Jawa Barat. Tersangka untuk kasus itu adalah mantan Menpora Andi Alifian Mallarangeng, mantan Ketua Umum Partai Demokrat Anas Urbaningrum, mantan Kabiro Perencanaan Kemenpora Deddy Kusdinar selaku pejabat pembuat komitmen, dan mantan Direktur Operasional 1 PT Adhi Karya Teuku Bagus Mukhamad Noor. Keempat tersangka itu belum ditahan karena KPK masih menunggu audit kerugian negara. Khusus untuk tersangka Deddy Kusdinar, rencananya hari ini yang bersangkutan kembali diperiksa. Johan tidak berani memastikan apakah Deddy

bakal ditahan. Deddy pun berharap segera ditahan. Sebab, sebagai orang pertama yang dijadikan tersangka, dia justru menjadi objek intimidasi. Kabarnya, Deddy sering diancam orang tak dikenal. Johan mengatakan, KPK tidak bisa begitu saja memenuhi permintaan Deddy agar segera ditahan. Selama ini belum pernah ada surat permintaan penahanan dari tersangka. ’’Kalau memang ancamannya serius, bisa juga disampaikan ke LPSK (Lembaga Perlindungan Saksi dan Korban),’’ tuturnya. Bagaimana dengan Anas Urbaningrum yang belum pernah diperiksa? Johan mengaku tidak tahu kapan mantan petinggi Partai Demokrat itu diperiksa. Demikian halnya dengan kemungkinan penahanan Anas. ’’Hambalang ini tidak berhenti, teman-teman menjadi

saksi kalau pemeriksaan terus berlangsung. KPK tidak mengejar pengakuan tersangka, jadi bisa diperiksa belakangan,’’ ucap Johan. Itu dilakukan karena selama ini para tersangka kerap tidak mengakui perbuatannya di depan penyidik. Jadi, penggalian keterangan dilakukan melalui saksi. Johan membantah adanya tarik ulur dalam penyelesaian kasus Hambalang. Sejauh ini pemeriksaan saksi terus dilakukan. Dia memastikan kasus Hambalang tetap berjalan dan akan berujung di pengadilan. ’’Sampai saat ini dilakukan pemberkasan untuk ke penuntutan,’’ katanya. Johan belum tahu hasil audit kerugian negara yang dilakukan Badan Pemeriksa Keuangan (BPK). Sebab, audit yang disebut-sebut bisa mempercepat selesainya kasus Hambalang itu belum rampung. (dim/c10/ca)

Pontianak Post


Pontianak Post Kamis 13 Juni 2013




Dada Kecil, Gillard Ngambek JULIA Gillard, Perdana Menteri (PM) Australia, ngambek bukan kepalang. Namanya diabadikan dalam menu makan malam yang dihelat pada sebuah acara amal Partai Liberal, oposisi di pemerintahannya. Yang bikin dongkol, nama Bu PM itu jadi menu burung puyuh (quail) goreng yang merujuk pada ciri-ciri fisiknya. Pada dinner yang dihelat Mal Brough, politikus Partai Liberal, tersebut, ada menu Julia Gillard Kentucky Fried Quail-Small Breast, Huge Thighs and a Big Red Box. Pasti, perempuan mana yang nggak mendidih darahnya ketika disamakan dengan burung puyuh goreng. Apalagi, ada penjelasan bahwa dadanya kecil dan pahanya besar. Sementara itu, red box kerap diartikan sebagai alat genital perempuan dalam ungkapan slang Australia. Kemarin Gillard menyebut bahwa menu olokolok itu mencerminkan perilaku Partai Liberal. Sejatinya, Tony Abbott, pemimpin oposisi, sudah mengutuk insiden tersebut. Dia menyebut menu itu sangat vulgar. Tapi, dia tidak mau menggeser Mal Brough dari daftar kandidat partai pada pemilu September mendatang. Tak urung, Gillard tetap dongkol. ’’Solusi Mr Abbot pada kasus ini tidak menunjukkan sisi kepemimpinannya,’’ kata Gillard. (AFP/c17/dos)

Pemantik Rusuh Divonis 26 Tahun

YANGON – Pengadilan Myanmar menjatuhkan vonis berat terhadap seorang pria Muslim yang dianggap memantik kerusuhan sektarian bulan lalu. Pria 48 tahun itu dihukum 26 tahun penjara karena menyerang seorang perempuan Buddha. Akibatnya, konflik meluas di antara dua kelompok agama di Myanmar tersebut. Media lokal memberitakan, terdakwa adalah seorang pecandu narkoba. Dia didakwa dengan pasal berlapis tentang percobaan pembunuhan, penyerangan, dan penyalahgunaan obat. Kasus itu disidangkan di Pengadilan Negara Bagian Shan, wilayah timur Myanmar. Seorang perempuan 24 tahun yang bekerja sebagai penjual bensin mengalami luka bakar dalam peristiwa tersebut. Insiden itu berbuntut saling serang antara kelompok Muslim dan Buddha di kota tempat tinggal mereka. Karena bentrokan

tersebut, sedikitnya satu orang tewas. Selain itu, sebuah masjid dan panti asuhan Muslim dibakar. “Kami telah menangkap sekitar 60 orang yang diketahui membawa tongkat dan pisau selama kekerasan terjadi,” jelas Kepala Kepolisian Shan Mayor Moe Zaw Linn. Dia menambahkan, terdakwa merupakan pria Muslim pertama yang divonis bersalah dalam kasus itu. Dalam serangkaian kekerasan sektarian sejak akhir tahun lalu, sebagian besar menarget warga Muslim dan membuat citra Myanmar terpuruk. Maret lalu puluhan orang tewas dalam konflik sektarian di Myanmar tengah. Ribuan rumah dibakar. Tahun lalu kekerasan serupa di Negara Bagian Rakhine mengakibatkan 200 orang tewas dan memaksa 140 ribu lainnya mengungsi. Sebagian besar adalah Muslim dari etnis Rohingya.

Sementara itu, seperti dilansir ABC News, biksu Buddha dari seluruh Myanmar akan bertemu hari ini, Kamis (13/6), untuk membahas kekerasan yang terjadi di negara Asia Tenggara tersebut setelah beberapa di antara mereka menjalani proses penyidikan. Sekitar 200 pemuka agama Buddha diundang menghadiri pertemuan di sebuah biara di luar Yangon. Tujuannya, mencari jalan keluar untuk meredam ketegangan antara kelompok Muslim dan Buddha. ’’Orang asing berpikir bahwa kekerasan di Myanmar dilakukan biksu-biksu Budha,’’ ujar Dhammapiya, seorang biksu yang menjadi juru bicara pertemuan tersebut. Beberapa biksu, lanjut dia, memang terlibat dalam penyerangan. Sejumlah lainnya dianggap menjadi pelaku saat mereka berupaya menghentikan kekerasan. (AFP/ ABC/cak/c14/dos)

Manusia Tertua Berpulang Kimura Umur 116 Tahun, Meizhen 127 Tahun

PEREMPUAN dan lelaki tertua di dunia samasama tutup usia bulan ini. Akhir pekan lalu, Luo Meizhen yang berusia 127 tahun mengembuskan napas terakhirnya di Desa Longhong, Bama County, Provinsi Guangxi, Tiongkok. Kemarin (12/6) giliran Jiroemon Kimura yang tutup usia. Kimura meninggal dalam usia 116 tahun. Pria kelahiran 19 April 1897 itu menjadi pria abad ke-19 yang terakhir berpulang. Guinness World Records mencatat mantan tukang pos tersebut bukan hanya sebagai pria tertua, tetapi juga manusia paling tua di dunia. Sebab, Luo yang lebih tua tidak memiliki akta kelahiran yang bisa membuktikan bahwa perempuan Tiongkok itu lahir pada 9 Juli 1885 seperti klaim keluarga. ’’Jiroemon Kimura merupakan pria pertama yang pernah hidup sampai usia 116 tahun,’’ tulis Guinness World Records. Kemarin bapak tujuh anak itu meninggal di sebuah rumah sakit di Kota Kyotango, Prefektur Kyoto, Jepang. Sejak awal Mei lalu, Kimura lebih menghabiskan banyak waktunya di rumah sakit untuk menjalani perawatan medis pneumonia yang dirinya derita. Craig Glenday, editor in chief Guinness World Records, menyebut Kimura sebagai sosok yang luar biasa. ’’Sebagai satu-satunya pria yang pernah menjalani hidup sampai 116 tahun, dia jelas mendapat tempat yang sangat istimewa dalam lembaran sejarah,’’ paparnya seperti dilansir Daily Mail. Apalagi, lanjut dia, pria dengan 14 cucu, 25 cicit (buyut), dan 15 piut (canggah) tersebut memiliki dokumen kelahiran yang sah. Wali Kota Kyotango Yasushi Nakayama menyatakan, pihak keluarga memakamkan Kimura pada Jumat besok (14/6). ’’Dia merupakan dan akan selalu menjadi salah satu harta berharga kota kami, negara ini, dan seluruh dunia,’’ terangnya.

Tahun lalu, saat Kimura merayakan ulang tahunnya yang ke-115, Nakayama sempat berkunjung ke kediamannya. Dalam perayaan ulang tahun ke-115 tersebut, Kimura berbagi resep awet hidup. Yakni, menikmati sinar mentari. ’’Setiap hari saya tidak lupa mendongakkan kepala dan memandangi langit. Itulah yang selalu saya lakukan,’’ ungkapnya saat itu. Selain itu, Kimura tidak pernah makan sampai kenyang. Meski tetap makan tiga kali sehari, dia hanya mengisi kapasitas perutnya sekitar 80 persen. April lalu Kimura memperingati hari jadinya yang ke-116 dengan menyaksikan video ucapan selamat ulang tahun dari Perdana Menteri (PM) Shinzo Abe. Tetapi, tidak lama setelah ulang tahunnya itu, lelaki yang terlahir dengan nama Kinjiro Miyake tersebut jatuh sakit. Keluarga lantas melarikan Kimura ke rumah sakit terdekat. Dia pun dirawat intensif di rumah sakit tersebut sampai ajal menjemput. Berbeda dengan eksistensi Kimura yang diakui dunia sebagai pria tertua, Luo tutup usia tanpa apresiasi apa pun. Padahal, dia menjalani hidup sampai usia 127 tahun. ’’Dalam kartu identitasnya, tercantum 1885 sebagai tahun kelahiran. Tapi, dia tidak memiliki akta kelahiran atau bukti yang lain,’’ jelas pejabat pemerintah setempat. Jika benar Luo lahir pada 1885, dirinya merupakan orang paling tua di dunia. ’’Nenek meninggal dalam usia 127 tahun,’’ kata Huang Heyuan, salah seorang cucu Luo. Sebelum tutup usia di kediamannya yang sederhana, ibu lima anak itu sakit selama berbulan-bulan. Huang Youhe, salah seorang putra Luo, menuturkan bahwa perempuan yang gemar bercocok tanam itu memang tidak menjalani perawatan medis di rumah sakit. Menurut rencana, Luo dimakamkan pada akhir bulan ini. (AP/AFP/BBC/ hep/c14/dos)

MEMBANGUN MUJAHIDIN Panitia pembangunan Masjid Raya Mujahidin Tahap II mengajak para dermawan menyalurkan infak dan sedekah untuk membantu terealisasinya pembangunan masjid terbesar di Kalimantan Barat. Sumbangan Anda dapat disetor langsung ke Rekening an. Panitia Pembangunan Masjid Raya Mujahidin Kalbar: Bank Kalbar 1009000301, Bank Kalbar Syariah 2011000608, BNI 233947864, Mandiri 1460011112229, BRI 00710100139330, Bank Syariah Mandiri 7033438499, BRI Syariah 1008039549.


Tanggal Nama Penyumbang

Jumlah (Rp)



30/05/2013 30/05/2013 30/05/2013 30/05/2013 30/05/2013 30/05/2013 31/05/2013 31/05/2013 31/05/2013 31/05/2013 31/05/2013 31/05/2013 31/05/2013 31/05/2013 31/05/2013 31/05/2013 31/05/2013 01/06/2013 01/06/2013 01/06/2013 02/06/2013 02/06/2013 02/06/2013 03/06/2013 03/06/2013 03/06/2013 03/06/2013 03/06/2013 03/06/2013


1.000.000 200.000 1.000.000 100.000 10.100 50.000 200.000 650.000 20.000 200.000 50.000 500.000 800.000 200.000 200.000 500.000 2.000.000 25.000 250.000 150.000 188.335 1.000.000 100.000 100.000 300.000 100.000 300.000 25.000 100.000


METROPOLIS Pontianak Post


KAMIS 13 Juni 2013


PNS Dilatih Militer Ganggu Pelayanan ANGGOTA DPRD Provinsi Kalbar, Tony Kurniadi mempertanyakan Rancangan Undang Undang Komponen Cadangan Pertahanan Negara yang bakalan mewajibkan pegawai negeri sipil (PNS) dan pekerja atau buruh dilatih secara militer. “Sepertinya kurang sreg diberlakukan. Pasalnya masih banyak yang harus dibenahi dan diperlakukan PNS ataupun pekerja buruh untuk negara ini. Mereka punya description pekerjaan yang pasti,” katanya, Rabu (12/6) di ruang kerja. Menurut dia, RUU Komponen Cadangan Pertahanan Negara memang mengarahkan bagaimana PNS, pekerja, Tony Kurniadi dan buruh wajib menjadi anggota komponen cadangan. Sebagai anggota komponen cadangan, PNS dan buruh bakalan dilatih militer. Keduanya di posisikan sebagai komponen cadangan jika sewaktu-waktu kondisi perang.“Dari sisi sumber daya manusia rekrutmen PNS dan pekerja untuk pendidikan militer dan pasukan cadangan pasif kurang tepat. Harus ada pola lain,” usulnya. • ke halaman 15 kolom 5


Demokrat Restui Paryadi - Sebastian TIDAK menunggu lama akhirnya kepastian siapa pemakai kursi Partai Demokrat pada pemilihan kepala daerah empat wilayah 19 September 2013 mendatang terkuak. Nama Paryadi-Sebastian disebut mendapatkan rekomendasi DPP Demokrat untuk bertarung di



Menkokesra Agung Laksono dan Gubernur Kalbar Cornelis melakukan kunjungan sekaligus memberikan kartu perlindungan sosial.

Dijatah 233.922 Keluarga Penerima Kartu Perlindungan Sosial

PONTIANAK - Menteri Koordinator Bidang Kesejahteraan Rakyat, HR Agung Laksono melaksanakan inspeksi mendadak ke rumah warga penerima kartu perlindungan sosial di Kota Pontianak, Rabu (11/6) pagi. Sidak tersebut untuk memastikan bahwa pendistribusian kartu tepat sasaran. Sidak dimulai sekitar pukul 08.00. Menkokesra didampingi Gubernur Kalbar Cornelis, Sekretaris Kota Pontianak M Akip, serta aparatur kecamatan dan kelurahan.


626.943 keluarga

• ke halaman 15 kolom 1

Kalbar :

Kalteng :



keluarga dari 1.964 desa dan kelurahan


keterangan: pembulatan ke atas per 50.000 keluarga

Kaltim :

Kalsel :





Mar: Maaf Saya Bohong Buat Laporan Polisi

• ke hal.15 kolom 1

PONTIANAK- Dugaan tindak pidana pemerkosaan disertai pengancaman terhadap Mar(17),seorangpembantu rumah tangga, sepertinya tidak benar. Ketika dijumpai Pontianak Post di rumah majikannya, Mar mengaku memberikan keterangan palsu kepada aparat kepolisian. Dia menuturkan, saat membuatlaporan ke Polda Kalbar, ada te-

Rabu, 5 Juni 2013 Mar melaporkan peristiwa dugaan perkosaan yang dialaminya itu ke Mapolda Kalbar. Mar didampingi Forum Keluarga Besar Flobamora NTT Kalbar, YNDN dan KPAID Kalbar.

Jumat, 7 Juni 2013 Paryadi

Jejak Laporan Mar

Tudingan itu dibantah oleh keluarga dan terduga pelaku.

Selasa, 11 Juni 2013 Mar mencabut laporan dugaan perkosaan tersebut. Ia mengaku berbohong telah membuat laporan kepolisian.



kanan dari pihak LSM yang menemaninya beberapa waktu lalu itu. “Saya diajari orang-orang LSM untuk bicara sesuai keinginan mereka. Kerena takut, saya menuruti dan memberikan keterangan palsu ketika membuat laporan polisi. Sebenarnya saya tidak diperkosa. Saya hanya lari dari rumah majikan karena takut dimarahi,” ungkap Mar tertunduk lemas kepada Pontianak Post, kemarin (12/6).

Disinggung sikap majikannya(ES, red), Mar mengaku tak ada masalah. Justru, ungkap dia lagi, keluarga majikannya itu sangat murah hati, hanya saja sedikit tegas. Terlebih, jika pekerjaan rumah belum rampung dilakukan. “Saya suka dimarahi. Apalagi kalau saya telat bangun dan belum mengerjakan pekerjaan rumah. • ke halaman 15 kolom 1


Budaya yang Tak Lekang Ditelan Zaman Saat zaman mulai mengganti piring dengan kotak pada saat acara keagamaan, masyarakat Kampung Wak Metik masih tetap setia dengan budaya makan saprahannya. ENDANG WULYANTHY, Kubu Raya SEKITAR pukul 10.00 acara peringatan Isra Miraj Muhammad SAW dilaksanakan di Kampung Parit Wak Metik, Desa Pasir Putih, Kabupaten Kubu Raya. Acara yang berlangsung di dalam masjid Fathullah tersebut terlihat terisi penuh dengan warga. Bila dilihat sekilas, tak ada perbedaan acara peringatan Isra Miraj di Kampung Parit Wak

Metik dengan tempat lain. Bermula dengan kata sambutan dari berbagai kalangan pengurus di desa hingga pembacaan doa. Namun, bila mengikuti acara hingga selesai, akan terlihat perbedaan yang sangat mencolok. Saat berada pada acara-acara peringatan Islam di tempat lain, akan disuguhkan dengan sebuah kotak yang didalamnya berisi makanaan. Namun, lain halnya dengan masyarakat Kampung Parit Wak Metik yang masih mempertahankan makan dengan cara saprahan. Nasi saprahan dihidangkan dalam sebuah nampan. Di dalamnya terdiri dari beberapa lauk pauk dan sayur. Satu nampan biasa disuguhkan untuk empat hingga lima orang. mereka akan makan bersama dan akan saling berbagi. WISATABHORNEO.BLOGSPOT.COM

• ke halaman 15 kolom 1







Tradisi saprahan masih melekat dalam masyarakat.


Pontianak Post

Kamis 13 Juni 2013

Pontianak Post


Kamis 13 Juni 2013



CIMB Niaga Auto Finance Bertindak Sesuai Prosedural Hukum


BERSAMAAN dengan ini saya Aldo Joe, S.H, M.H., sebagai In-house Lawyer, bertindak untuk dan atas nama CIMB Niaga Auto Finance, dengan ini melakukan klarifikasi sehubungan laporan Saudara M. Hendra yang beralamat di Jalan Panglima Aim pada Halaman Halo Publik Pontianak Post pada hari Sabtu, 11 Mei 2013. Dalam laporan tersebut berjudul Niaga Finance yang “Memaksa�. Hal tersebut merupakan pemberitaan publik yang sangat tidak benar sehingga fitnah tersebut sangat merugikan nama baik Pihak CIMB Niaga Auto Finance sebagai salah satu perusahaan pembiayaan terbesar seluruh Indonesia. Pada tanggal 2 April 2012, terjalin perjanjian pembiayaan konsumen 1 (satu) unit Toyota Innova, tahun 2012, nomor polisi KB 1612 SF, warna black mica, nomor rangka MHFXW40G5C4503154, nomor mesin

1TR7284696, antara Pihak CIMB Niaga Auto Finance sebagai Kreditur Preference / Penerima Fidusia serta Pihak M. Hendra sebagai Debitur atau Pemberi Fidusia, dimana dalam perjanjian tersebut didukung oleh dokumendokumen terkait guna menciptakan kepastian hukum kepada para pihak. Dokumen yang dimaksud diatas salah satunya antara lain, perjanjian pembiayaan konsumen nomor 431101200188 yang diikuti akta jaminan fidusia yang telah bersetifikat jaminan fidusia dengan nomor W16.009620.AH.05.01 tahun 2013. Dari awal pembiayaan konsumen, cicilan pembayaran terhadap unit tersebut selalu dalam posisi terlambat. Sesuai prosedur perusahaan sebelum melaksanakan eksekusi Jaminan Fidusia maka diperlukan Surat Peringatan ke-1 dan ke-2 yang telah disampaikan melalui Pos kepada kediaman Debitur, namun ternyata Debitur sudah tidak tinggal di alamat tersebut tanpa pemberitahuan kepada Kreditur yang merupakan itikad tidak baik Pihak Debitur, sehingga selanjutnya Surat Peringatan ke-3 diantarkan ke rumah orang tua Debitur. Selama proses penagihan, unit tersebut tidak pernah terlihat dipakai Debitur dan unit tidak berada di rumah Debitur. Setelah dilakukan pelacakan ternyata unit dari pertama pengambilan ternyata digunakan untuk rental taxi sehingga melanggar Pasal 36 UndangUndang Fidusia No. 42 tahun 1999. Debitur memberikan keterangan palsu, karena pada awalnya unit diajukan untuk keperluan pribadi dan bukan

untuk usaha rental taxi. Berbagai upaya penagihan sudah dilakukan pada divisi kami, mulai penagihan 1-7 hari yang dilakukan oleh Desk Collector, 8-30 hari yang dilakukan Field Collector, penagihan 30-60 hari yg dilakukan oleh Problem Account 1 (PA1), serta >60 hari yang dilaksanakan oleh Proffesional Collector (Prof Coll). Pada saat dilakukan penagihan, Debitur selalu ingkar janji berdasarkan komitmen yang telah disepakati. Collection Head Cabang Pontianak yang bernama Tatang Bastaman dengan berat hati memberikan perintah kepada bawahannya untuk melaksanakan Eksekusi Jaminan Fidusia. Pada tanggal 7 Mei 2013, unit ditemukan di sekitar Kota Pontianak, ternyata unit tersebut mengarah ke luar kota (Singkawang). Pada saat itu Prof Coll bersama PA1 dan Field Coll dimana seluruh Pihak CIMB Niaga Auto Finance hanya berjumlah 3 (tiga) orang melaksanakan negosiasi dengan Debitur setelah kendaraan Debitur menepi ke arah sisi tepi kiri jalan. Kemudian PA1 menghampiri Debitur dan bersalaman dengan Debitur yang kemudian Debitur keluar dari unit tersebut. Ketika itu dilihat pada unit tersebut terdapat seorang ibu bersama anaknya, setelah dilakukan konfirmasi ternyata mereka adalah penumpang dari mobil Debitur yang secara ilegal menggunakan mobil tersebut untuk rental taxi. Pada saat itu Pihak CIMB Niaga Auto Finance menawarkan penumpang tersebut untuk pindah ke mobil taksi lainnya untuk diantar ketujuan penumpang ataupun langsung mengantar penumpang tersebut ke tempat tujuan. Namun penumpang

memilih untuk keluar dari mobil untuk dijemput oleh kerabatnya yang berada disekitar lokasi. Pada akhirnya Debitur karena tidak sanggup melunasi serta merasa kerapkali ingkar janji terhadap janji-janji yang telah disepakati maka Debitur tanpa paksaan menyerahkan sendiri kunci mobil tersebut, namun tidak mau memberikan tanda tangan berkas serah terima kendaraan yang telah disediakan perusahaan. Selanjutnya unit diamankan ke kantor CIMB Niaga Auto Finance Cabang Pontianak. PA1 standby di lokasi untuk memastikan bahwa penumpang yang berada di mobil Debitur tidak terlantar, dan akhirnya penumpang tersebut naik taksi lain ke arah Kota Singkawang. Setelah dipastikan penumpang tersebut tidak terlantar, kemudian PA1 segera kembali ke kantor CIMB Niaga Auto Finance. Berdasarkan klarifikasi diatas, maka saya mewakili CIMB Niaga Auto Finance berharap Saudara M. Hendra dapat melaksanakan klarifikasi terhadap hal-hal yang tidak sesuai fakta yang ada sehingga nama baik CIMB Niaga Auto Finance tetap terjaga baik. Namun apabila tidak dilaksanakan klarifkasi tersebut, maka Kami CIMB Niaga Auto Finance sebagai Kreditur Preference / Penerima Fidusia yang beritikad baik dan menjunjung tinggi hukum positif yang berlaku di Indonesia, akan meminta perlindungan hukum terkait hak-hak Kami kepada Pihak yang berwenang. Demikian atas klarifikasi yang dapat kami berikan, mohon maaf apabila ada salah kata. Terima kasih. Aldo Joe, S.H, M.H. Pengacara CIMB Niaga Auto Finance

Polisi Tidur, Solider Tukang Bakso BANYAK jalan dan gang saat ini diberi gundukan polisi tidur oleh warga. Tetapi, pemasangan polisi tidur yang bertujuan menyamankan warga kerap tidak lagi mengindahkan keselamatan pengendara kendaraan dan pedagang. Polisi tidur dibuat terlalu tinggi dan terkesan berbentuk lancip. Akibatnya, pengendara sepeda dan sepeda motor berisiko terjatuh karena tidak seimbang. Pedagang yang menggunakan rombong, seperti bakso dan soto, juga bisa terguling saat melintasinya. Apalagi kalau pengendaranya adalah ibu hamil, pastinya polisi

tidur lebih berbahaya bagi kandungannya. Alangkah idealnya polisi tidur dibuat cukup setinggi lima cm dan landai serta dicat bergaris seperti zebra cross agar di malam hari pun terlihat oleh pengendara atau pelintas jalan tersebut. Dengan begitu, kita lebih mempertimbangkan keselamatan dan kenyamanan pejalan kaki, pengendara kendaraan, dan pedagang yang menggunakan rombong. Semoga bermanfaat.

CPNS Honorer Tenaga honor yang telah lama mengabdikan diri, yang memang sudah terbiasa dengan pekerjaannya karena berguru lama dengan pengalaman. Didalam kesibukan bekerja dan mengurus keluarga masih adakah waktu untuk konsentrasi belajar menyiapkan diri mengikuti tes CPNS honorer? Pengabdian yang sudah puluhan tahun akan dinilai lagi dengan setumpuk soal-soal. (085245794408)


Proyek Jalan Terputus? KADIS PU yang terhormat, saya mau tanya, kenapa perbaikan jalan Martadinata antara depan SMU Negeri 2 sampai depan gang Pala 2 tidak selesai dikerjakan? Mengapa hanya separuh badan jalan saja yang diperbaiki? Tentu saja penyelesaian jalan yang terkatungkatung ini mengakibatkan pada ketidaknyamanan kepada warga yang berdiam di dekat lokasi tersebut, serta pengguna jalan yang melintas. Mohon kiranya bisa diteruskan lagi dengan segera perbaikan jalan tersebut. (081345000311)

BBM Bersubsidi HAMPIR di setiap SPBU terjadi antrean panjang truk-truk dan roda 4. Akibat terjadinya antrean panjang tersebut adalah banyaknya tangkitangki siluman berebutan menguras BBM bersubsidi di SPBU. Rakyat ekonomi lemah sampai saat ini tidak memikirkan BBM bersubsidi atau tidak karena sekedar untuk mengisi motor 2 liter cukup mengisi di kios-kios kecil di sepanjang jalan. Namun Rp 6 ribu/liter bukan masalah ketimbang antrian panjang walaupun Rp 4.500 ribu/liter hanya buang-buang waktu. Turunnya harga BBM bermodus subsidi, banyak mafia ambil kesempatan. Rakyat miskin tak pernah memikirkannya karena tidak ada kendaraan kecuali sepeda engkol. Jika BBM naik, rakyat miskin tidak terpengaruh walau harga sembako meroket. Karena rakyat miskin makan cukup seadanya bisa hidup. Yang ribut-ribut itukan kelompok mafia kapitalis dan orang kaya banyak mobil. (Ibrahim Myh, 081288673500)

Raden Panji Yohanes



C cmyk






Sekarang Berani Makan Pedas Lagi MERACIK suatu ramuan memerlukan pengetahuan, pengalaman dan keterampilan tinggi. Kualitas bahan baku, perbandingan komposisi dari masing-masing komponen serta pengolahan benar akan menentukan hasil kualitas manfaatnya. Sekarang, hadir Gentong Mas sebagai herbal terstandar. Seorang ibu rumah tangga yang menderita sakit maag telah membuktikan manfaatnya. “Suami yang mengkhawatirkan kondisi saya ketika maag kambuh, menyarankan mencoba Gentong Mas. Ternyata memang benar-benar bermanfaat. Setelah 4 bulan minum secara teratur, sekarang maag tidak pernah kambuh lagi, bahkan saya sudah berani makan pedas lagi,” terang Safariah. Gastritis atau lebih dikenal sebagai maag berasal dari bahasa Yunani yaitu Gastro, yang berarti perut/lambung dan itis yang berarti inflamasi/peradangan. Jika dibiarkan tidak terawat, Gastritis akan dapat menyebabkan peptic ulcers dan pendarahan pada lambung. Beberapa bentuk Gastritis kronis dapat meningkatkan risiko kanker lambung, terutama jika terjadi penipisan secara terus menerus pada dinding lambung dan perubahan pada sel-sel di dinding lambung. Sebelumnya, ibu 2 anak ini seringkali merasa aktivitasnya terganggu karena sakit maag. “Ka-

lau sakitnya kambuh, saya sering muntah-muntah, perut terasa mual sampai tidak bisa makan. 1 tahun saya merasakan keluhannya,” cerita wanita berusia 40 tahun tersebut. Ia yang kini telah merasakan manfaat mengonsumsi Gentong Mas, merasa terpanggil untuk berbagi pengalaman sehatnya dengan orang lain. “Mudah-mudahan pengalaman saya ini bermanfaat,” pungkas warga Perum Borneo, Kelurahan Pal Sembilan, Kecamatan Kakap, Kubu Raya, Kalbar ini. Gentong Mas adalah minuman herbal dengan kandungan vitamin dan nutrisi bermutu. Bahan utama Gentong Mas yaitu Gula Aren dan Nigella Sativa (Habbatussauda)

terbukti memiliki banyak manfaat untuk kesehatan. Habbatussauda bermanfaat memelihara pembuluh darah, perbaikan sistem saraf, optimalisasi aktivitas hormon, meningkatkan proses penyembuhan dinding lambung, meningkatkan daya tahan tubuh dan bersifat anti bakteri. Selain itu juga, Habbatussauda dapat mengatasi gangguan tidur dan relaksasi. Cabe jamu yang terdapat dalam Gentong Mas bermanfaat untuk mempercepat penyembuhan mukosa lambung. Sedangkan kandungan yang terdapat dalam Kayu Manis bersifat anti kembung dan mules. Kapulaga dalam Gentong Mas bermanfaat sebagai anti muntah serta radang lambung. Dan Gula Aren bermanfaat untuk menurunkan penyerapan lemak dan perbaikan sistem saraf. Untuk hasil cepat dan maksimal dianjurkan makan teratur, hindari alkohol, rokok, kendalikan stres dan jika memungkinkan hindari obat penghilang nyeri. Manfaat yang hebat bagi kesehatan dan rasa yang lezat membuat semakin banyak masyarakat yang mengkonsumsi Gentong Mas. Untuk informasi lebih lanjut silahkan kunjungi www. Bagi Anda yang membutuhkan Gentong Mas bisa didapatkan di apotek/toko obat terdekat atau hubungi: 14047.(e5/biz)

Nyeri Sendi di Malam Hari!

Awas Asam Urat

APAKAH Anda sering mengalami nyeri sendi di malam hari? Terkadang persendian menjadi bengkak kulit seperti kemerahan dan tampak mengkilap dengan rasa sakit luar biasa, dan biasanya terjadi di daerah jempol kaki, pergelangan tangan, jari tangan serta lutut. Waspadai bisa jadi itu nyeri sendi, karena Asam Urat! Tahukah Anda, kenapa nyeri sendi akibat asam urat pada saat malam hari nyerinya sangat luar biasa? Ada 2 hal menyebabkan nyerinya sangat tidak tertahan. Pertama, karena adanya kristal Monosodium Urat Monohidrat dalam sendi yang mengerakkan sendi, sehingga otot terasa seperti sobek. Kedua, radang yang terjadi pada jaringan disekitarnya, menyebabkan gesekan tipis dari selimut bisa menimbulkan nyeri luar biasa. Monosodium Urat Monohidrat adalah garam asam urat yang dapat mengendap berbentuk kristal seperti pecahan kaca. Oleh karena itu untuk mencegah terjadinya kecacatan sendi maka perlu dilakukan pengobatan asam urat yang tepat yaitu tidak hanya difokuskan dengan menghilangkan rasa nyeri dan bengkak saja, namun harus diikuti dengan adanya penurunan asam urat yang berlebih dari tubuh, mencegah kekambuhan dan komplikasi. Tahukah Anda, sebenarnya alam sudah menyediakan berbagai macam nutrisi yang terkandung dalam bahan alam bisa

dimanfaatkan untuk membantu menghilangkan rasa nyeri, bengkak serta menurunkan kadar asam urat dalam tubuh seperti Remact. Remact merupakan hasil riset penelitian para ahli di Jepang, yang berisikan formulasi bahan alami untuk membantu mengatasi rasa nyeri dan bengkak dengan kombinasi 3 tanaman yang sudah melewati proses ekstraksi tingkat tinggi, yaitu ekstrak gingerol yang diambil dari jahe merah dan juga Boswellia Serrata dan Devil’s Claw yang bersifat “natural steroid” sehingga membantu mengurangi pembengkakan. Untuk membantu menurunkan kadar asam urat berlebih, Remact sudah dilengkapi dengan ekstrak biji seledri, dimana kandungan 3nB (3-nbuthylphtalide) dan apigenin dalam

biji seledri akan membantu menghambat pembentukan asam urat dan mengeluarkan kelebihan dalam tubuh, dengan mengeluarkannya lewat ginjal.Danuntukmendapatkan hasil optimal, maka pengobatan tersebut harus diikuti dengan melakukan diet atas makan tinggi purin, menghindari konsumsi alkhohol dan menghindari kegemukan. Remact dikonsumsi 2x2 kapsul per hari secara rutin, dan bila sudah terjadi perbaikan, maka dosisnya bisa diturunkan secara perlahan. Hotline service (SMS Only): 087771001007 atau PT Marion Sam. Remact dipasarkan dengan harga Rp154 ribu per boks isi 30 kapsul dan sudah tersedia di Kota Pontianak. Jalan Tanjungpura (Apt Utama), Jalan Gajahmada (Apt Cahaya, Apt Makmur 2, Apt Gajahmada, Apt Kencana), Jl. Imam Bonjol (Apt Imam Bonjol), Jl. K.H. Wahid Hasyim (Apt Agung, Apt Mandiri 2). Jl KH. Ahmad Dahlan (TO Jenaka), Jl. Veteran (Apt Megasari Farma), Jl. HOS Cokroaminoto (Apt Merdeka Timur), Jl. Jend. Urip (Apt Mulia), Jl. Serayu (Apt Makmur 1). Informasi lebih lanjut hubungi distributor kami: PT. Penta Valent Cab. Pontianak, telepon (0561) 742854, Didin (085252093350). No. POM Remact: TI. 094 340 391, No. Persetujuan Iklan Remact: T. 100712C8.(a2/biz)

Selamat Tinggal Kulit Kusam dan Flek Hitam MEMILIKI kulit kusam apalagi dihiasi dengan banyak flek hitam di wajah menjadi hal yang sangat menakutkan bagi wanita, karena kulit merupakan elemen penting pada penampilan. Jika kulit terlihat kering, kusam dan dihiasi oleh banyak flek hitam terutama diwajah tentu sangat tidak nyaman dipandang, sehingga banyak cara dilakukan untuk mendapatkan kulit cerah, lembut serta bebas flek hitam. TahukahAnda,bahwakulit kusam dam flek hitam biasanya timbul karena proses penuaan yang terjadi akibat terpapar sinar ultraviolet dari matahari, terlalu lama berada di ruanganber-AC,pemakaiankosmetik tidak tepat, akibatnya sel melanin dari dalam kulit lebih aktif untuk melepas warna coklat dan menyababkan terjadinya kerusakan kolagen sertaelastinyangdapatmenyebabkan munculnya flek hitam serta menjadikan kulit lebih kering dan kasar, sehingga tampak kusam. Karena itu banyak carayang dilakukan untuk mendapatkan kembali kulit cerah serta bebas flek hitam seperti penggunaan glutathione, mercury dengan mengabaikan efek samping. Ada cara mudah dan praktis tanpa resiko efek samping seperti rebound efek maupun kegemukan, dan Anda bahkan tidak perlu mengeluarkan jutaan rupiah untuk suntik pemutih tapi Anda tetap terlihat menarik untuk waktu yang lebih lama. Atau Anda bisa memilih memutihkan kulit secara alami dengan nutrisi alami

seperti “Kirei”. Kirei merupakan hasil riset para ilmuwan di Jepang untuk membantu meremajakan, mengencangkan dan menghaluskan kulit secara alami dari dalam. Kandungan kulit ari beras merah (Red Brown Rice) dalam Kirei, mampu membantu mengembalikan ceramide yang hilang dan mampu memperbaiki lapisan kulit terluar anda menjadi lembab dan halus. Kirei juga mengandung protein ikan laut (lisin & prolin) serta jeruk (vitamin C). Gabungan keduanya akan membentuk jaringan kolagen dan elsatin serta dipercaya mampu membantu meregenerasi sel-sel kulit baru, sehingga anda pun akan tampak lebih muda. Tidak hanya itu, Kirei juga dilengkapi dengan OPC (Oligomeric Proanthocyanidin) yang berasal dari ekstrak biji anggur yang merupakan Super Antioksidan, karena memiliki kekuatan 20x vitamin C dan 50x Vita-

min E. Selain itu, OPC larut dalam air sehingga aman untuk dikonsumsi setiap hari. Kirei dilengkapi dengan Litchi Seed Extract dan juga Broccoli Extract sebagai whitening alami, yang berfungsi untuk mencerahkan kulit dan mencegah warna belang-belang pada wajah. Kirei merupakan nutrisi alami dari buah dan sayur yang dapat dikunyah dengan rasa asli buah anggur, serta tidak menggemukkan. Kirei dapat dikonsumsi 3 x sehari 1 tablet selama 3-6 bulan dan rasakan perubahannya pada awal bulan pemakaian seluruh kulit wajah menjadi lebih lembab, halus, hingga cerah bercahaya dan setelah 3 bulan pemakaian dapatkan kulit awet muda yang selalu menjadi impian Anda. Hotline service (SMS Only): 087771001007 atau PT Marion Sam. Sudah beredar di Kota Pontianak; Jl. Tanjungpura (Apt Utama/734219), Jl. Gajahmada (Apt Cahaya/736423), Apt Makmur 2/738744), Apt Gajahmada/735242), Jl. KH. Wahid Hasyim (Apt Agung/7087888, Apt Mandiri 2/731216)). Jl. KH. Ahmad Dahlan (TO Jenaka/731950), Jl. Veteran (Apt Megasari Farma/760242), Jl. HOS Cokroaminoto (Apt Merdeka Timur/734561), Jl. Jend. Urip (Apt Mulia/766690), Jl. Serayu (Apt Makmur 1/732794), Jl. Dr. Sutomo (Apt Zam-Zam/747213). Informasi lebih lanjut hubungi Distributor kami: PT. Penta Valent Cab. Pontianak, telepon (0561) 742854 atau pada Didin (085252093350).(a2/biz)



Pontianak Post

Kamis 13 Juni 2013

Ayo Ikuti Funwalk Diabetasol Dan Raih Beragam Hadiah Minggu, 16 Juni 2013, di Halaman Mess Daerah Singkawang DEWASA ini, Diabetes sudah menjadi penyakit yang semakin merajalela di masyarakat. Fakta mengatakan, bahwa setiap 10 detik 1 orang meninggal karena diabetes? (sumber: IDF Atlas Third Edition, WDF backgrounders and WDD Website). Peningkatan ini berkaitan erat dengan pola hidup masyarakat yang cenderung tidak sehat, seperti kurangnya olahraga dan pola makan yang tidak sehat. Untuk itulah Diabetasol sebagai ahlinya nutrisi diabetes di Indonesia bermaksud mengingatkan masyarakat mengenai pola hidup sehat, dengan Gerakan Pola Makan Sehat 3J (Jumlah, Jenis dan Jadwal) yang berkaitan erat dengan pola makan untuk menjaga kadar gula darah, agar jauh dari resiko diabetes atau tetap hidup sehat walaupun sudah menderita diabetes. Gerakan 3J ini mengajak kita untuk senantiasa melakukan pola makan sehat dan ideal. Mudah saja, yaitu dengan menghitung Jumlah kalori ideal yang harus dikonsumsi tubuh, kaitannya erat dengan tinggi badan serta ativitas fisik yang biasa dilakukan. “J” yang kedua adalah memperhatikan Jenis makanan yang dikonsumsi. Komposisi gizi seimbang akan menunjang pola makan sehat. Jenis makanan sehat yang ideal yaitu mengandung 4565% karbohidrat, 10-20% protein, lemak 20-25% serta vitamin dan mineral. Yang terakhir adalah mengatur Jadwal makan dalam sehari. Jadwal makan yang ideal adalah 3 kali makan besar diselingi dengan 3 kali makan kecil termasuk sarapan pagi.

Diabetasol hadir untuk melengkapi pola makan 3J, 1 gelas Diabetasol mengandung 250 kkal yang setara dengan kebutuhan Jumlah kalori sarapan pagi atau selingan malam untuk membantu mengatur Jadwal makanan Anda. Diabetasol juga diformulasikan khusus dengan nutrisi seimbang yang dapat memenuhi Jenis nutrisi diabetisi setiap hari. Diabetasol pada rangkaian edukasinya kali ini membawa tema Pola Hidup Sehat 3J yang dituangkan dalam berbagai kegiatan, salah satunya Diabetasol Fun Walk. Dalam acara ini Diabetasol mengajak para peserta untuk bersama-sama berkomitmen menjalani pola hidup sehat, dengan kegiatan senam dan jalan sehat. Jalan sehat dirangkai dengan talk show mengenai Pola Makan Sehat 3J bersama spesialis gizi klinis, yang mengupas mengenai bagaimana menerapkan pola makan sehat 3J, menghitung jumlah, memilih jenis, dan mengatur jadwal makan untuk tetap sehat menjaga kadar gula darah. Tahun ini Diabetasol mengadakan kembali even tersebut di 19 kota (Jakarta, Tangerang, Bandung,

Bekasi, Bogor, Medan, Surabaya, Makassar, Semarang, Yogyakarta, Pekanbaru, Pematang Siantar, Banjarmasin, Palembang, Padang, Malang, Denpasar, Samarinda dan Pontianak). Dengan diadakannya edukasi Pola Makan Sehat 3J ini, diharapkan masyarakat Indonesia dapat menerapkan pola hidup sehat dengan 3J disertai olahraga teratur sehingga kadar gula darah senantiasa terjaga untuk hidup sehat dan optimal. Bersama Diabetasol, Start 3J, Stop Diabetes ! Serius! Funwalk Diabetasol dan Edukasi Pola Hidup Sehat 3j digelar Minggu, 16 Juni 2013, pukul 05.30 WIB, bertempat di halaman Mess Daerah Singkawang, dengan acara; senam sehat, jalan sehat, edukasi gizi, cek kesehatan, pembagian dorprize, hiburan lokal band. Pembicara: dr. didik. SpPd, harga tiket Rp16.000, benefit: t-shirt, snack, dorprize, cek kesehatan, cek lemak gratis. Untuk informasi dan pendaftaran hubungi: Rini (08524580230), Yaya ( 0 8 9 6 9 3 6 1 9 3 1 9 ) , Ve ra (085750266966) dan Ema (085282230432).Tiket terbatas! Bersama Diabetasol, Start 3J, Stop Diabetes! Serius! (e2/biz)

Training One Day Healing Seft Orchadz Perdana Hotel, Minggu, 16 Juni 2013 SEGALA permasalahan yang datang terkadang membuat Anda putus asa, apalagi jika datang silih berganti tanpa hentihentinya. Hal inilah yang akan berdampak pada efek karir Anda terhambat, rezeki tersumbat dan penyakit semakin berkarat hingga menyebabkan emosi Anda meningkat. Jika sudah begitu beratnya beban hidup Anda, maka harus ada solusi jitu. Sebuah program pembelajaran praktis, khusus bagi Anda yang ingin memprogram keberuntungan hidup baik dari segi kesehatan fisik maupun nonfisik, keluarga bahagia & harmonis setiap hari, hidup penuh berkah dan mulia karena nantinya bisa bermanfaat buat orang lain dengan metode yang ilmiah. Setelah sukses mengadakan dua kali Training untuk mengatasi masalah-masalah tersebut dan telah begitu banyak orang yang merasakan efek dari training tersebut. Salah satunya, Kepala Dispora Pontianak Suparma. Ia mengatakan, bahwa efek setelah mengikuti Training SEFT pada 4-5 Mei 2013 di Pontianak, ke-

marin membuat dirinya merasa seperti menjadi pribadi yang berbeda. Pribadi yang jauh lebih ikhlas, damai dan berbagai masalah kesehatan dirinya ikut teratasi. Kini Training SEFT hadir kembali di Kota Pontianak, namun kali ini berbeda dari Training yang pernah diadakan sebelumnya. Jika Training SEFT Total Solution diadakan selama dua hari ful dengan biaya Training Rp3,5 juta, maka untuk Training One Day Healing ini hanya diadakan satu hari ful dengan biaya Rp1,5 juta. Dengan biaya yang jauh lebih murah, diharapkan kehadiran Training One Day Healing ini memang untuk menbantu orang-orang yang ingin sembuh dari berbagai masalah penyakit fisik mupun nonfisik. Sementara manfaat yang didapat dalam Training ini; pertama, mengatasi berbagai masalah fisik dan penyakit yang anda derita. Kedua,

mengatasi berbagai masalah emosi seperti; takut, trauma, depresi, cemas dan kecanduan rokok. Ketiga, berbagai masalah keluarga dan anak-anak yang datang dari ketidak harmonisan keluarga. Keempat, meningkatkan prestasi olahraga, prestasi dan karir di tempat kerja, serta meningkatkan omset penjualan. Kelima, mendapatkan pencerahan spiritual serta meningkatkan kedamaian hati dan kebahagiaan diri menjadi pribadi yang lebih baik setiap hari nya. Segera daftarkan diri Anda dengan menghubungi Mira Pratama nomor handphone (0852 5038 4448/0857 5005 4442) atau meng-SMS-kan (nama anda)#SEFT#Beruntung”. Bagi Anda yang ingin mendapatkan discount 30 persen (Rp500 ribu) dari Rp1,5 juta dan hanya membayar Rp1juta saja untuk biaya Training. Silakan transfer langsung ke rekening kami (nomor rekening akan di infokan lewat sms atau telepon), diskon ini hanya berlaku bagi Anda yang mendaftar dan melunasi biaya Training sebelum Sabtu, 15 Juni 2013. (d2/biz)


*Pusat Pengobatan Penyakit Kronis *Pengobatan Sinshe Hongkong yang Manjur, Satu-satunya di Pontianak SINSHE Hongkong yang beralamat di Jl. Agus Salim No. 126, Pontianak, merupakan satu-satunya pusat pengobatan berbagai penyakit kronis dengan metode eksklusif herbal sinshe, menerapkan resep rahasia turun temurun yang sudah memiliki sejarah 2.000 tahun lebih, resep kuno kekaisaran, resep pengobatan modern, sangat efektif mengatasi berbagai penyakit kronis. Konsultan sinshe ahli ternama yang sudah memiliki banyak pengalaman hadir di Sinshe Hongkong Pontianak, membantu Anda mengobati berbagai penyakit yang sudah lama diobati tetapi belum sembuh juga, bisa diatasi hingga keakar-akarnya antara lain: 1.Penyakit kanker/tumor; kanker paru-paru, kanker liver, kanker getah bening, kanker usus, kanker payudara, kanker leher rahim, kanker saluran pencernaan, dan kanker lainnya, (2) Rematik/nyeri sendi; radang dan pembengkakan sendi, sakit pinggang, radang bahu, sakit ruas tulang leher, dan sakit nyeri lainnya. (3) Diabetes (kencing manis), hipertensi, stroke, lumpuh setengah badan, bronchitis, asma, radang hidung & tenggorokan,



telinga mendengung, pendengaran kurang, penyakit mata, radang ginjal, batu ginjal, wasir/ ambeiyen, epilepsy (ayan), penyakit usus & lambung, kulit. (4) Penyakit reproduksi pria & wanita (herpes, sipilis, gonorrhea), kemandulan, gangguan fungsi seksual pria (impotensi, ejakulasi dini, fungsi seksual menurun, sperma mati, tidak bersperma). Radang prostat berakibat sering kencing, kencing terburu-buru, kesulitan kencing, kencing tidak tuntas. (5) Hepatitis (peradangan tipe A, B, C). (6) Penyakit kewanitaan; radang organ reproduksi, pembesaran kelenjar susu, radang leher rahim, haid tidak lancar, haid terasa sakit. (7) Migrain, pening/pusing, sakit

kepala dan lainnya. Sinshe Hongkong menggunakan obat herbal Tiongkok eksklusif, sekitar 60-an jenis metode/resep pengobatan khusus yang sangat efektif mengatasi berbagai penyakit kronis, tidak peduli kondisi penyakit parah/ringan, usia penderita tua/muda, riwayat penyakit panjang/ pendek, rata-rata setelah diobati 2-7 hari, berbagai gejala penyakit akan berangsur menghilang setelah diatasi tidak mudah kambuh. Dengan menggabungkan obat herbal sinshe mujarab, akupuntur, tuina dan lainnya, sebagian pasien yang penyakitnya semakin lama akan semakin cepat membaik, hari itu konsumsi obat hari itu juga mulai terasa khasiatnya, rata-rata setelah 2-3 tahap pengobatan bisa diatasi. “Dapatkan program promosi khusus bagi yang datang berobat ke Sinshe Hongkong”. Untuk konsultasi dan pengobatan hubungi: Sinshe Hongkong Jl. Agus Salim No. 126 Pontianak, Telp: 0561-733268, 0821 52797 888 (hari Minggu & libur tetap buka). (a2/bn)

Pontianak Post

Kamis 13 Juni 2013




Prodi Fisika STKIP Pilihan Anda Kelas Internasional FE Untan Peluang Jadi Guru Fisika Terbuka Luas PERSAINGAN menjadi calon pegawai negeri setiap tahunnya semakin ketat. Apalagi dengan adanya pembatasaan perekrutan calon pegawai negeri sipil, akibat minimnya anggaran pemerintah pusat dan daerah. Namun berbeda jika Anda bergabung di Prodi Fisika STKIP-PGRI Pontianak, yang menawarkan peluang untuk menjadi calon guru swasta dan guru mandiri. Sekretaris Prodi Pendidikan Fisika, Eka Kasah Gordan MPd mengatakan, Prodi Fisika hadir di STKIP-PGRI Pontianak tidak hanya melengkapi kebutuhan guru bidang studi Fisika saja, melainkan mencetak tenaga kependidikan yang mampu mengajar dipusat pendidikan swasta maupun mandiri. Ia juga menjelaskan, memang tidak dipungkiri jumlah mahasiswa Prodi Fisika lebih sedikit dibandingkan prodi lain, namun dengan jumlah yang sedikit ini efektivitas dan daya serap mahasiswa untuk memahami setiap mata kuliah akan lebih cepat. Ia juga membantah, jika fisika itu dikatakan sebuah pelajaran sulit. Padahal, ilmu fisika itu jauh lebih mengasyikan dibandingkan ilmu yang bersifat sosial. Sebab, mahasiswa dapat melakukan eksperiment sekaligus membuktikan segala kejadian nyata yang dijumpai dalam kehidupan sehari-hari manusia. “Dikatakan sulit jika kita kurang

JEPANG Suasana tenang di Kampus Kochy University Japan. FOTO IST


FISIKA: Prodi Fisika STKIP-PGRI Pontianak kerap kali memberikan sosialisasi termasuk memberikan praktik sederhana ilmu fisika kepada para siswa SMP di Pontianak.

melatih diri untuk mengerjakan soal, kurang memanfaatkan peran otak untuk menyelesaikan sebuah eksperimen serta kurangnya memahami ilmu dasar fisika yakni ilmu matematika,” terangnya. Ia menambahkan, untuk peluang kerja kami menjamin lulusan Prodi Fisika masih terbuka luas. Sebab, tidak hanya kurangnya tenaga formasi guru fisika saja, perguruan tinggi yang memiliki Prodi Fisika baru sedikit, bahkan tenaga guru fisika mandiri seperti guru private masih banyak dibutuhkan. Untuk itu marilah bergabaung di STKIP-PGRI Pontianak. Caranya ikuti Seleksi Penerimaan Mahasiswa Baru (SPMB) tahap I dimulai 25 Maret-20 Juli 2013.

Mencetak Manusia Internasional

Adapun tahapan SPMB yang harus diikuti yakni, tes tertulis 22 Juli, tes wawancara 23 Juli, tes fisik 24-26 Juli (Prodi Penjaskes), tes praktik 24-26 Juli (Prodi PTIK dan Bahasa Inggris). Pengumuman SPMB tahap I ini disampaikan 3 Agustus dan daftar ulang dilaksanakan 5-24 Agustus 2013. Pendaftaraan juga dapat dilakukan secara online. Caranya: calon mahasiswa datang ke kantor POS atau Bank BTN terdekat dengan membawa pas foto (4x6) satu lembar, membayar biaya pendaftaraan Rp200 ribu (1 pilihan prodi) dan Rp250 ribu (2 pilihan prodi). Informasi lebih jelas hubungi telepon (0561) 748219, fax (0561) 6589855 atau email: (d3/biz)

MAU menjadi manusia Internasional? Daftar aje.... di Kelas Internasional Fakultas Ekonomi Untan. Anda akan dididik untuk menjadi sarjana yang siap bersaing di kancah Internasional. Belajar dengan pengantar bahasa Inggris, akan menyiapkan Anda lancar berkomunikasi dalam pergaulan internasional. Materi sebagian disampaikan di kampus luar negeri dengan pengajar asing akan menjadikan Anda sarjana berkelas Internasional, karena diberikan langsung oleh pakarnya dengan dukungan fasilitas lengkap dan modern. Zaman sudah berubah, sudah saatnya pemikiran Anda juga berubah. Rebut pasar kerja internasional yang terbuka lebar tumbuh menjanjikan. Kelas Internasional 2 Tahun Berjalan Saat ini, Kelas Internasional telah memasuki semester 4. Semua

Program Studi Ekonomi Islam STAIN Pontianak PROGRAM Studi Ekonomi Islam (Prodi EI) adalah Program Studi Ekonomi Islam pertama di Kalimantan Barat. Setelah dikeluarkannya UU tentang duel banking system, oleh pemerintah yaitu penyempurnaan undang-undang yang lama tentang bank bebas bunga, maka Undang-undang No.10 tahun 1998 inilah yang menjadi dasar program studi yang awalnya bernama muamalah merubah menjadi nama Program Studi Ekonomi Islam. Hal ini dikarenakan adanya kebutuhan akan sarjana-sarjana ekonomi yang sesuai dengan prinsip prinsip Islam, maka Prodi Ekonomi Islam yang disingkat Prodi EI ini terus melakukan perubahan dengan berbagai disipilin ilmu, yang sesuai dengan kebutuhan pasar. Hal ini didasarkan pada; pertama, karena regulasi tentang Undang-undang Perbankan Syariah tersebut. Kedua, perlunya mempersiapkan calon-calon sarjana yang keluar dari Prodi EI untuk diterjunkan langsung ke dunia kerja, sehingga sampai akhir ini Prodi Ekonomi Islam telah menghasilkan para sarjana-sarjana yang berada disetiap dunia kerja. Visi Program Studi Ekonomi Islam menjadi program studi yang terdepan dalam pendidikan dan pembelajaran penelitian dan pengabdian kepada masyarakat dalam penerapan ekonomi Islam. Kompetensi lulusan Program Studi Ekonomi Islam (EI) antara lain:

INGIN anak Anda sehebat einstein (ilmuan dunia) atau sekaya Bill Gates (orang terkaya nomor 1 dunia atau sedahsyat Thomas Alfa Edison, penemu dan pemilik perusahaan General Electrik. Ternyata mereka hebat bukan tiba-tiba, tetapi mereka sengaja dibentuk orangtuanya menjadi orang hebat semenjak umur 0-17 tahun, sehingga terbukti kehebatannya bisa kita lihat sekarang. Anak adalah permata jiwa bagi orangtuanya, sehingga apapun akan kita lakukan demi kesuksesan dan kebahagiaan anak. Kita tahu anak dilahirkan fitrah atau suci dalam perkembangannya orangtualah yang membentuk dia sukses atau tidak. Untuk itu, kami dari CV.Insan Mulia mempersembahkan seminar rahasia anak jenius dalam 5 menit bersama trainer nasional Wahyu A, pada Sabtu, 15 Juni 2013 pukul 14.00-17.00 dan dilanjuti 16 Juni 2013 pukul 09.00-16.00 di Wisma Nusantara Pontianak. Manfaat seminar ini adalah: (1) membuat cinta kepada Tuhan, mahluk dan alam semesta. (2) membuat perubahan permanen pada diri orangtua dan anak. (3) membuat anak percaya diri, termotivasi dari dalam dirinya, mandiri, kreatif dan energik. (4) solusi masalah pelajaran dan

Pontianak. Selain itu, mahasiswa juga berkesempatan mendapat berbagai macam beasiswa baik yang bersumber dari DIPA STAIN Pontianak, maupun beasiswa kerjasama STAIN Pontianak dengan lembaga lainnya. Anda juga akan menikmati berbagai fasilitas kampus yang memadai, kelas ber-AC, hot spot, sport center dan berbagai macam lab yang terkait ekonomi Islam. Informasi lebih lanjut silakan mengunjungi Pendaftaran jalur tes tertulis dilaksanakan pada 6 Mei-15 Juni 2013. Atau Anda mendaftar melalui SPMB-STAIN Pontianak yang bersifat lokal. Pendaftaran dalam SPMB-STAIN ini akan dimulai pada 1 Juli-30 Agustus 2013. Kemudian ujian tertulisnya akan dilaksanakan pada 2-3 September 2013.(d4/biz)

Biro Organisasi Gelar Rakornis BIRO Organisasi Pemerintah Provinsi Kalbar menggelar Rapat Koordinasi Teknis Bidang Organisasi se-Kalbar di Hotel Kapuas Palace Pontianak, Selasa (11/6) hingga hari ini. Peserta 64 orang terdiri dari perwakilan sekretaris daerah, asisten, kepala bagian dan sub kepala bagian yang membidangi organisasi di provinsi maupun kabupaten/kota. Narasumber Kepala Biro Organisasi serta Kepala Bagian di lingkungan Biro Organisasi Sekretariat Daerah Kalbar. Sekretaris Daerah Kalbar Drs M Zeet Hamdy Assovie MTM yang diwakili Staf Ahli Gubernur Bidang Hukum dan Politik Togi Lumban Tobing SH MHum mengatakan, dalam dua tahun belakangan, terdapat berbagai regulasi terkait peraturan perundang-undangan yang telah ditetapkan oleh pemerintah pusat untuk ditindaklanjuti. Antara lain, Perpres No 70/2012 tentang perubahan kedua atas Perpres No 54/2010 tentang pengadaan barang/jasa pemerintah. “Satu hal yang sangat krusial dari Perpres tersebut, yaitu diwajibkannya setiap kementerian/lembaga/ pemerintah daerah/instansi membentuk Unit Layanan Pengadaan (ULP) yang diharapkan pada 2014 sudah dapat operasional,” ungkap Togi. Mempedomani ketentuan

versity Tokyo. atau Universitas terkenal di California Amerika Serikat San Diego State University. Dengan belajar dari dosen berkelas Internasional, praktikum di laboratorium modern dan belajar di perpustakaan dengan buku-buku yang lengkap, akan mencetak sarjana berkelas Internasional yang siap bersaing merebut pasar kerja Internasional. Bagaimana mendaftar kelas Internasional? Anda harus mengikuti SNMPTN dan memilih Kelas Internasional. Bagi yang dinyatakan lulus segera mendaftarkan diri di Fakultas Ekonomi Untan. Informasi lengkap dapat Anda peroleh di Fakultas Ekonomi Untan, Jl. A Yani Pontianak, telp. 0561766840, Faks. 0561-766840, www., e-mail, kontak person: Ibu Lina 08533275-8275. Pastikan Anda menjadi manusia Internasional dengan bergabung di Kelas Internasional Fakutas Ekonomi Untan. (d1/biz)

Rahasia Jenius Dalam 5 Menit Rancang Kesuksesan dan Kebahagian Anak Sejak Dini

pegawai negeri sipil (yang membutuhkan kompetensi ekonomi Islam, tenaga pendidik di berbagai lembaga pendidikan tingkat menengah maupun tinggi yang menyebarkan pengetahuan ekonomi Islam, pegawai Bank Syariah, profesional pada lembaga keuangan nonbank (Koperasi, BMT, Pegadaian, Asuransi dan lain-lain). Berikutnya tenaga peneliti dan konsultan di berbagai lembaga penelitian dan lembaga swadaya masyarakat yang bergerak dalam pengembangan bisnis berbasis Islam, wirausahawan yang mampu mendirikan dan mengembangkan bisnis berbasis Islam. Sebagai bagian dari STAIN Pontianak, biaya pendidikan di Program Studi Ekonomi Islam relatif murah, sama dengan program studi lain yang ada di STAIN

mahasiswa kelas Internasional tersebar di berbagai Universitas Luar Negeri. Di Malaysia di University of Malaya Kuala Lumpur, Universitas Utara Malaysia (UUM) di Kedah, UNIMAS Sarawak, dan UNIMAP di Perlis. Di Jepang di Kochy University Tokyo. Mereka belajar selama satu semester di luar negeri. Pada 2014 diharapkan mahasiswa Kelas Internasional dapat menyelesaikan studi mereka. Kuliah dan praktikum di luar negeri Kegiatan mahasiswa Kelas Internasional di luar negeri saat ini adalah mengikuti kuliah dan praktikum. Mereka bebas memilih salah satu di antara universitas yang sudah menjalin kerja sama dengan Fakultas Ekonomi Untan, seperti di Cina; Guangxi University for Nationalities, Tianjin University, Guangdong University of Foreign Studies. Di Malaysia; University of Malaya Kuala Lumpur, Universitas Utara Malaysia (UUM) di Kedah, UNIMAS Sarawak dan UNIMAP di Perlis. Di Jepang; Kochy Uni-

nilai di sekolah. (5) membentuk keluarga berkarakter. (6) memastikan masa depan anak sukses dan bahagia. (7) menyikapi anak hiperakatif. (8) membantu anak menghilangkan sifat malas, mengompol, suka nonton tv, suka game, tak percaya diri dan phobia. Beberapa kesaksian setelah mengikuti seminar ini datang dari Ny Farida dari Surabaya, sebelumnya anak saya lambat dalam mengingat sesuatu, agak

WAHYU A pendiam, kurang percaya diri, bahkan nilai pelajaran kurang baik. Namun setelah mengikuti seminar ini anak saya lebih mudah dan cepat mengingat sesuatu, dia lebih ceria, percaya diri dan nilai pelajaran baik dari sebelumnya. Ny Lily dari Jakarta mengaku, sebelumnya anak lebih cepat marah dan kurang sopan terhadap orangtuanya maupun orang lain.

Namun setelah mengikuti seminar ini anak saya lebih penyayang dan lebih riang gembira. Bahkan kepada orangtuanya maupun orang lain dia lebih perhatian, terlebih dia mengerjakan PR dari sekolahnya dengan kesadaran sendiri. Bagi anda ingin mendaftarakan anaknya dalam seminar ini, maka orangtua dapat mengikuti anak-anaknya dalam seminar rahasia anak jenius: diperuntukkan bagi anak-anak dari usia 0-17 yang dapat dipraktikkan dalam seminar ini. Mulai dari menghafal puluhan kata acak dalam hitungan detik, dengan begitu menunjukan anak-anak pada dasarnya jenius tergantung bagaimana orangtua mendidik dan menjaganya. Bagi orangtua berminat mengikuti seminar rahasia anak jenius, dapat membeli tiket sebelum hari pelaksanaan dengan biaya Rp50ribu/keluarga. Pembelian tiket dapat dilakukan melalui transfer kerekening ke Bank BRI dengan nomor rekening 484 201006484535 dan Bank Mandiri 1460006749720 atas nama Hadi Prayitno. Setelah ditransfer lakukan sms dengan cara : Nama#genius#jumlah transfer ke 082357757580, bukti transfer sebagai pengganti tiket. Pembelian tiket pada hari pelaksanaan harga naik menjadi Rp200 ribu (kesempatan terbatas), dijamin pasti bisa garansi 100 persen uang kembali dan bagi yang belum jelas dapat melakukan sms. Caranya: info (spasi) nama kirim ke082357757580 maka akan dihubungi panitia. (d3/biz)

Finalis LKTI Bakesbangpol Kalbar SETELAH melewati penyeleksian tahap 1 dan II Lomba Karya Tulis Ilmiah (LKTI) partisipasi politik masyarakat tahun 2013, yang digelar Pemerintah Provinsi Kalimantan Barat melalui Badan Kesatuan Bangsa dan Politik beberapa waktu lalu, mengumumkan peserta yang masuk ke babak final. Ada pun yang masuk ke babak final antara lain, untuk tingkat SLTA: Felicia Putri dari SMA Santo Petrus, Lulu Mutia dari SMAN 3 Pontianak, Alby Arief D dari SMAN 3 Pontianak, Naomi C A dari SMA Immanuel Pontianak,


SAMBUTAN: Togi Lumban Tobing saat memberikan sambutan sekaligus membuka Rakornis.

dimaksud, ungkap Togi, pemda baik provinsi maupun kabupaten/ kota yang belum membentuk ULP diharapkan tahun ini telah membentuk ULP barang/jasa. Berdasarkan Peraturan Kepala LKPP RI No 5/2012 pasal 3 ayat 1 menyatakan, bahwa menteri/ pimpinan lembaga/kepala daerah/ pimpinan instansi membentuk ULP yang bersifat permanen, dapat berdiri sendiri atau melekat pada unit yang sudah ada. “Jika ULP diwadahi dalam unit struktural tersendiri, maka pembentukannya berpedoman pada PP No 41/2007. Namun, jika ULP melekat pada unit

yang sudah ada, maka ULP diintegrasikan pada unit struktural yang secara fungsional melaksanakan tugas dan fungsi di bidang pengadaan barang/jasa,” katanya. Sebagai informasi, Kemendagri telah menyiapkan Rancangan Peraturan Mendagri tentang pembentukan kantor layanan pengadaan barang/jasa pemerintah provinsi dan kabupaten/kota. Dalam draft tersebut, ULP diwadahi dalam bentuk kantor yang disebut Kantor Layanan Pengadaan (KLP). Menurut peraturan tersebut, pembentukan KLP ditetapkan dengan Peraturan Kepala Daerah.(d5/ser) C


Stenley A dari SMA Gembala Baik dan Novianti C dari SMKN 3 Pontianak. Sedangkan untuk tingkat perguruan tinggi masing-masing; Nikodemus N dari Fakultas Ilmu Sosial dan Politik (Fisipol) Universitas Tanjungpura, Susanto dari Fisipol Untan, Eni Ratnawati dari Fakultas Kehutanan Untan, Tajul Anshor dari Fakultas Kedokteran Untan, Atem dari Fisipol Untan dan Adima dari IPDN (Manajemen Pemerintahan). Berkaitan dengan itu, Badan Kesbangpol Kalbar memberitahukan kepada para finalis LKTI

untuk mengikuti seminar pada 18 Juni 2013 yang sebelumnya direncanakan di Hotel Mercure diubah ke Hotel Santika Pontianak pada pukul 07.00 WIB. Penilaian seminar berdasarkan penguasaan materi dengan bobot 30%, kemampuan dalam mempertahankan argumentasi dengan bobot 25%, sistematika penjelasan dengan bobot 15%, penggunaan alat bantu/alat peraga dengan bobot 15% dan performance dengan bobot 15%. Pemenang akan diumumkan pada hari itu juga setelah seminar dan penghitungan nilai.(d5/ser)

PERMOHONAN MAAF SAYA (YUSUF) mohon maaf kepada khalayak ramai bahwa artikel di halaman “Komunikasi Bisnis” yang saya tayangkan di harian Pontianak post edisi 4,6,8, 10 Juni 2013 dengan tema: “Konsultasi Kembalikan Gairah Seks Istri, Pengasuh: Dr. Yansen Muliono, .Repro.SP.And. Yang beralamat Jl. Cipayung Dalam No. 53 Jakarta Timur”. Saya Jelaskan bahwa “Alamat dan pengasuh adalah fiktif belaka”. Demikian permohonan maaf saya sampaikan. YUSUF Alamat: Jalan Sei Raya Dalam, Komplek Kosgoto B8 Y




Pontianak Post

Kamis 13 Juni 2013

Homoseksual: Perspektif Nalar Agama

ilustrasi: Kekes

Pesan Moral Film Sang Kiai SENIN (10/6/) saya menyempatkan diri mengikuti kegiatan menonton bersama, film Sang Kiai. Studio XXI A. Yani Megamal Pontianak, penuh sesak oleh para kiai, ustadz, tokoh masyarakat, guru, mahasiswa, santri dan pelajar untuk menonton film. Kegiatan ini digagas oleh Bupati Kubu Raya, Muda Mahendrawan. Terasa istimewa, acara itu dihadiri Yenny Wahid (keluarga dekat Hadratussyeikh Hasyim Asy’ari), sutradara filmnya- Rako Prijanto dan artis kawakan Ikranegara dan Christine Hakim yang menjadi pemeran utama dalam film tersebut (Pontianak Post, 11/6/2013 hal. 9). Film Sang Kiai, bukan sekadar menjadi tontonan yang menyajikan fakta sejarah, melainkan dapat menjadi tuntunan bagi generasi sekarang dan masa mendatang. Film yang berdurasi sekitar dua jam tersebut, berkisah tentang tokoh pergerakan nasional dan pendiri NU, KH Hasyim Asyari, pejuang dan pendiri pesantren Tebu Ireng, Jombang, Jawa Timur. KH Hasyim Asyari merupakan kakek Abdurrahman Wahid (Gus Dur), Presiden RI keempat. Film yang menampilkan aktor dan aktris berbakat seperti Agus Kuncoro, Adipati Dolken, Meriza Febriani, dan Dimas Aditya ini terbukti mampu menggambarkan pesan-pesan heroik tentang pentingnya resolusi jihad terhadap bangsa kolonial. Film yang berlatar belakang saat menjelang detik-detik kemerdekaan itu sarat unsur drama, perang serta dakwah dan menggambarkan perjuangan umat Islam melawan penjajah dan mempertahankan kemerdekaan Negara Kesatuan Republik Indonesia. Film ini penuh dengan pesan-pesan moral. Pertama, keyakinan bahwa Allah SWT adalah sebaik-baik pemberi rizki. Pesan ini mengingatkan kita bahwa usaha yang tangguh dan doa yang sungguh-sungguh mesti dilakukan untuk mendapatkan rizki yang halal dan baik. Sang Kiai menjelaskan, beliau terjun langsung untuk bertani biar bisa merasakan dan menghargai makanan yang diraih. Sungguh bertolak belakang dengan apa yang dikerjakan para koruptor belakangan ini. Kedua, keyakinan kita pada Allah SWT. Tak boleh tergantikan dengan apapun. Tauhid dan keimanan kita mesti kokoh dalam segala kondisi. Meskipun disiksa dan dipaksa untuk menandatangani surat agar menyembah dewa matahari,


dia tak goyah. “Bagimu agamamu dan bagiku agamaku” menjadi prinsip yang harus dipegang teguh. “Orang Jepang ini boleh saja menggantungku, setelah aku selesai shalat,” katanya Sang Kiai. Ketiga, kita mesti belajar sungguhsungguh, termasuk menguasai bahasa asing. Siapa yang menguasai bahasa, maka dia akan mengusai dunia. Ketika itu, menulis dengan huruf latin dan bahasa inggris di samping bahasa Arab sudah mulai diajarkan di Pondok Pesantren Tebuireng, meskipun sebelumnya mendapat pertentangan yang kuat dari para sesepuh. Dengan menguasai bahasa asing, kita tidak bisa dibodohi oleh bangsa lain. Pesan ini begitu tepat, terlebih di era globalisasi sekarang ini. Keempat, kecintaan kita kepada bangsa-negara adalah bagian dari iman. Kedatangan Jepang yang semula menganggap saudara tua, ketika itu disambut dengan suka cita. Tak berapa lama, Jepang berlaku kejam dan menangkap Para Kiai. Tentu saja perlakukan Jepang tersebut mendapatkan perlawanan para santrinya. Berbagai upaya dilakukan. Berperang dengan senjata seadanya dilakukan. Banyak korban yang berjatuhan. Semua dilakukan karena kecintaan dan semangat untuk membela bangsa. Semangat patriotisme, pantang menyerah dan dimbangi spiritualitas yang harus diserap oleh generasi sekarang ini. Kewajiban melawan penjajah merupakan suatu jihad yang hukumnya fardlu ‘ain. Pencapaian kemerdekaan di negeri ini mengorbankan ribuan nyawa, kucuran darah, dan tetesan air mata. Tugas kita semua, khusus generasi muda untuk mempertahankan dan membangun bangsa ini dengan berbagai prestasi dan karya. Kelima, perlunya kerjasama semua pihak untuk membangun bangsa. Di film ini Resolusi Jihad yang digaungkan diatur dengan berbagai strategi. Untuk kalangan pemuda dibentuk laskar Hisbullah yang dipimpin oleh KH Zainul Arifin. Untuk kalangan dewasa dibentuk laskar Sabilillah yang dipimpin oleh KH Maskur. Sementara untuk kalangan sesepuh dan kiai dibentuk laskar Mujahidin yang dipimpin oleh KH Wahab Hasbullah. Mereka bergerak secara

berbondong-bondong menuju Kota Surabaya. Ketiga kekuatan itu, yakni laskar Hisbullah, Sabilillah, dan Mujahidin itu akhirnya berhasil mengalahkan dan mengusir tentara sekutu. Berbagai generasi; pemuda, dewasa, sesepuh mesti bekerjasama untuk membangun bangsa ini, sesuai dengan kapasitas masing-masing. Film ini menggambarkan bahwa Islam memiliki peranan besar dalam mengusir penjajah demi kemerdekaan Indonesia. Dalam buku “Menjadi Indonesia” Komaruddin Hidayat menjelaskan, ada kesan peranan Islam dalam mempersatukan ikatan emosional dan heroisme perjuangan mengusir penjajah serta pembentukan wilayah kepulauan ini “menjadi Indonesia” hendak diabaikan, hendak disingkirkan, dianggap tidak signifikan. Padahal, pergerakan Islam-lah kata Mohammad Natsir, yang lebih dulu membuka jalan perjuangan kemerdekaan. (Baca “Menjadi Indonesia: 13 Abad Eksistensi Islam di Bumi Nusantara”, Mizan & Yayasan Festival Istiqlal: 2006 hal. xvi-xvii). Sebagai sebuah karya film, wajar jika memiliki keterbatasan tertentu sehingga tak seutuhnya menggambarkan peristiwa heroik itu. Terlepas dari itu, film Sang Kyai ini layak kita apresiasi sebagai bagian tak terpisahkan dari upaya pendokumentasian sejarah, sekaligus menumbuhkan nilai edukatif dan refleksi diri bagi setiap generasi. Tak berlebihan bila Wakil Presiden Boediono, menyarankan generasi muda Indonesia harus menonton film Sang Kiai. Saran Wapres tersebut agar generasi muda mengetahui betapa sulitnya merebut kemerdekaan. “Semangat membela Tanah Air harus menjadi contoh generasi muda dan agar bisa memahami betapa mahalnya memperoleh kemerdekaan,” kata Wapres Boediono kepada pers usai menyaksikan film Sang Kiai di Djakarta Theatre, Jakarta. Saran Wapres tersebut langsung ditindaklanjuti oleh Bupati Kubu Raya, --Muda Mahendrawan, yang terpilih sebagai salah satu “Bukan Bupati Biasa” versi Majalah Tempo-- dengan mengajak tokoh agama, pelajar, pemuda dan mahasiswa nonton bersama film Sang Kiai tersebut. Penulis Ketua Forum Lingkar Pena Kalimantan Barat, bekerja di Sekolah Tinggi Agama Islam Negeri Pontianak

BERBAGAI media merilis berita tentang kontroversi pengesahan pernikahan sejenis (same-sex marriage). Kehebohan berita tentang pernikahan sejenis ini dipicu oleh mengesahkan pernikahan sejenis dalam undang-undang Prancis pekan lalu. Prancis menjadi negara ke-9 di Eropa yang mengakomodir pernikahan sejenis. Argumen utamanya adalah pemenuhan hak kesetaraan tanpa diskriminasi karena perbedaan jenis kelamin. Selebihnya, pembelaan terhadap rasa cinta yang, oleh kelompok gay atau lesbian, dipandang sebagai sesuatu yang natural atau alamiah. Artinya, cinta tidak hanya relasi jenis kelamin yang berbeda tetapi juga cinta diterima dalam ranah jenis kelamin yang sama. Dengan demikian, tuntutan kaum homoseksual untuk diakui hak-hak sosialnya, seperti hak hidup bersama; membangun rumah tangga dengan sesama jenis kelamin, seperti mendapat energi baru. Legalisasi ini memicu pro dan kontra. Bagi komunitas homoseksual, ini merupakan “berkah”. Nista, labelisasi yang selama ini melekat, karena dianggap sebagai perilaku menyimpang, sesat dan pendosa dengan sendirinya akan berubah. Hampir dapat dipastikan, perspektif terhadap kaum homo yang sudah bertahan dalam rahim kebudayaan manusia ribuan tahun akan runtuh. Sementara itu, bagi kalangan konservatif dan agamawan, ini musibah. Mereka mencela undang-undang pernikahan sejenis yang dianggap tidak bermoral, melawan hukum alam dan merusak. Bahkan, musibah seperti bencana angin Tornado yang baru-baru ini terjadi di Oklahoma, negara bagian Amerika Serikat, ditengarai karena kaum homoseksual yang terus berkembang. Terlepas dari pro dan kontra, paling mengejutkan, adalah fakta komunitas homo yang sangat liquid atau cair. Ternyata, komunitas ini tidaklah sematamata tumbuh atau berasal dari orang-orang awam atau dari orang-orang yang anti agama; ateis. Mereka juga berasal dari agamawan. Sebut saja Ludovic Mohamed Zahed, sebagaimana dirilis oleh majalah Tempo, edisi 20-26 Mei 2013 adalah anggota dari komunitas Gay Prancis yang bernama Homosexuaels Musulmans de France (disingkat HM2F). Uniknya, ia adalah imam pada masjid Mosque de l’Unicitée, masjid komunitas Gay di salah satu sudut kota di Paris. Anomali! Mungkin itu kata yang paling tepat untuk mengambarkan fakta ini. Bagi yang membaca laporan Tempo ini, mungkin tidak akan dapat


menyembunyikan senandung kalbunya, bagaimana mungkin seorang yang mengerti agama dapat menjadi bagian dari komunitas Gay? Bukankah ini sebuah penyimpangan dan pengingkaran terhadap akal sehat? Ada beberapa argumentasi untuk melapangkan jalan komunitas homoseksual ini diterima oleh publik. Dengan sedikit akrobat intelektual, akal budi manusia “dipaksa” untuk menerima alasan-alasan yang mereka kemukakan. Stigma bahwa homoseksual sebagai pendosa dan sudah dikutuk sejak era Nabi Luth, bagi mereka memiliki konteks yang berbeda. Hubungan homoseksual yang terjadi ketika itu adalah hubungan yang tidak diikat oleh rasa cinta. Hubungan homoseksual lebih sebagai pengumbar hawa nafsu, kejam dan tidak berprikemanusiaan. Hubungan seks yang seperti itu dibenci oleh Tuhan. Sementara itu, faktanya, dalam pembelaan kaum homo, banyak pasangan di kalangan mereka yang hidup dengan kesetiaan. Dengan demikian, tidak relevan membandingkan kaum homo sekarang ini dengan kaum homo di era Nabi Luth. Jika argumentasi seperti di atas menjadi pijakannya, apakah cukup kuat dan layak diterima. Disebutkan dalam al-Qur’an, surat Hud (11) ayat 78, Nabi Luth berkata kepada kaumnya: “…Hai kaumku, inilah puteri-puteriku, mereka labih suci bagimu, maka bertakwalah kepada Allah dan janganlah kamu mencemarkan (nama)ku terhadap tamuku ini. Tidak adakah di antaramu seorang yang cerdas?” Kemudian, ayat 79 menerangkan lebih lanjut: “Mereka menjawab: sesungguhnya kamu telah tahu bahwa kami tidak mempunyai keinginan terhadap puteri-puterimu; dan sesungguhnya kamu tentu mengetahui apa yang sebenarnya kami kehendaki”. Ayat ini, meskipun tidak menceritakan secara detail tentang kejadian prilaku homoseksual kaum Luth, tetapi sesuai dengan narasi ayat tersebut, dapat dibaca bahwa mereka memiliki kecenderungan yang kuat kepada sesama jenis. Untuk mencegah penyimpangan tersebut, Nabi Luth menawarkan puterinya namun ditolak. Karena prilaku yang menyimpang, kemudian Allah Swt menghukum mereka. Membaca ayat di atas, setidaknya ada dua kosa kata yang perlu dicermati. Kedua kosa kata di ayat ini, merupakan elemen penting untuk memahami logika yang dirangkai dalam

ayat ini. Tanpa memahaminya ayat ini secara integral, akan gagal memahami message atau pesan ayat tersebut. Pertama, kata takwa. Kedua, kata cerdas. Kata pertama harus diletakkan sebagai pesan inti yang menjadi dasar memahami pesan yang lain. Maksudnya, meskipun ada kata kedua, yaitu kata rasyid atau cerdas harus dipahami dalam konteks takwa. Sekali kata takwa dilepaskan dari kata rasyid atau cerdas maka makna kecerdasan menjadi liar dan tidak terkendali. Inilah ironi dari argumen yang dibangun oleh komunitas homoseksual sebagaimana dikemukakan di atas. Meskipun argumennya kelihatan logis, tetapi karena tidak berpijak di atas ketakwaan, maka argumen tersebut menjadi rapuh dan menyesatkan. Hampir dapat dipastikan bahwa prilaku homoseksual adalah prilaku yang jauh dari ketakwaan dan penggunaan akal secara sehat. Kenapa? Takwa sebagaimana dirilis dalam al-Qur’an adalah sifat paripurna yang menjadi puncak pencapaian seorang mukmin. Takwa merupakan pesona yang memancarkan kesalihan keseluruh penjuru mata angin. Dapat dipastikan, setiap tindakan yang didasari oleh ketakwaan, sesungguhnya tidak perlu penjelasan dan pembelaan logika karena secara inheren, tindakan tersebut adalah genuine, selaras dengan fitrah kemanusiaan. Sementara itu, seperti kasus homoseksual yang, oleh pelaku-pelakunya dibela sebagai sesuatu yang harus diterima dengan alasan kesetaraan, mencederai banyak hal. Sejak semula, pernikahan merupakan bagian dari religi. Dalam Islam, pernikahan disebut sebagai sunnah Nabi. An-nikahu sunnati, demikian bunyi dari salah satu hadis Nabi yang sangat populer. Sunnah berarti prilaku, peri kehidupan, jalan, cara atau tabiat. Dengan demikian, pernikahan dapat dipastikan sebagai prilaku, peri kehidupan, jalan, cara dan tabiat kenabian. Sekarang, untuk menguji keabsahan alasan para komunitas homoseksual yang dalam beberapa kasus, mereka mengakui tetap menjalankan keyakinan agamanya, dapat ditelusuri dengan mengecek jejak-jejak kenabian. Pertanyaannya: apakah Nabi dan Rasul pernah mempraktikan prilaku homoseksual? Jawabannya dapat dipastikan, tidak. Dengan demikian, alasan apa pun yang dibangun oleh komunitas homo untuk membenarkan tindakan mereka, adalah alasan absurd dan bertentangan dengan citacita profetis. Wallahu’alam! * Penulis adalah Ketua Sekolah Tinggi Agama Islam

Terbit 7 Kali Seminggu. Izin terbit Menteri Penerangan RI No. 028/SK/Menpen/SIUP/A7. Tanggal 3 Februari 1986. Persetujuan Perubahan Nama No: 95A/Ditjend. PPG/K/1998 Tanggal 11September 1998. Alamat Redaksi dan Tata Usaha: Jalan Gajah Mada No. 2-4 Pontianak 78121. Kotak Pos 1036. Fax. (0561) 760038/575368. Telepon Redaksi: (0561) 735070.Telepon Iklan/Pemasaran:735071. Hunting (Untuk seluruh bagian) Fax. Iklan 741873/766022. Email: Penerbit: PT.Akcaya PERTAMA DAN TERUTAMA DI KALIMANTAN BARAT Utama Press Pontianak. Pembina: Eric Samola, SH, Dahlan Iskan. Komisaris Utama: Tabrani Hadi. Direktur: Untung Sukarti. Pemimpin Redaksi/Penanggung Jawab: B Salman. Redaktur Pelaksana: Khairulrahman, Muslim Minhard, Donatus Budiono, Basilius. Sidang Redaksi: Abu Sofian, Surhan Sani, Mela Danisari, Yulfi Asmadi, Andre Januardi, Mursalin, Robert Iskandar, Efprizan. Sekretaris Redaksi: Silvina. Staf Redaksi: U Ronald, Deny Hamdani, Budianto, Chairunnisya, M Kusdharmadi, Hari Jawa Pos Group Kurniatama, Hendy Irwandi, Pracetak/Artistik: Mochsinin (Koordinator), Grafis: Sigit Prasetyo, Ilustrator: Kessusanto. Fotografer: Timbul Mudjadi, Sando Shafella. Biro Singkawang: Zulkarnaen Fauzi (Jl. Gunung Raya No.15 Telepon (0562) 631912). Biro Sambas: Hari Kurniatama (Jl P Anom Telp (0562) 392683) Biro Sanggau: Sugeng (Jl. Sudirman No. 4 Telp. (0564) 21323). Biro Ketapang: Asri Isnaini, (Jl. Gajahmada No. 172. Telp. (0534) 35514). Kabupaten Pontianak: Hamdan, . Biro Sintang: Sutami. Pemasaran/Sirkulasi: Kiki Fredrik S; Iklan: Dewiyanti.S. Percetakan: Surdi. Devisi Event: Budi Darmawan. Jakarta: Max Yusuf Alkadrie. Harga Langganan per 1 Bulan dalam kota Rp 80.000,- (luar kota tambah ongkos kirim). Tarif iklan: Per mm kolom hitam putih Rp 40.000,- full colour Rp 50.000,- Iklan baris Rp 15.000,- per baris (minimal 2 baris, maksimal 10 baris) pembayaran di muka. Telepon Langganan/Pengaduan: 735071. Iklan: 730251. Perwakilan Jakarta: Jl. Jeruk Purut-Al-Ma’ruf No.4 Pasar Minggu, Jakarta Selatan 12560. Telepon: 78840827 Fax. (021) 78840828. Percetakan: PT.Akcaya Pariwara Pontianak. Anggota SPS-SGP ISSN 0215-9767. Isi di luar tanggung jawab percetakan.

Pontianak Post

Pontianak Post


Kamis 13 Juni 2013


Ombudsman Jemput Bola Terima Aduan Pelayanan Publik PONTIANAK – Upaya peningkataan pelayanan terhadap aduan persoalan masalah publik terus dilakukan ombudsman perwakilan Kalimantan Barat, dengan membuka gerai pengaduan masyarakat di Singkawang sejak 12 hingga 14 Juni 2013

di RSUD Dr. Abdul Azis, Singkawang. Kepala Perwakilan Ombudsman Kalimantan Barat Agus Priyadi mengatakan, kegiatan yang dilakukan pihaknya itu merupakan sebagai salah satu cara mempercepat pelayanan

Karena tidak enak sama keluarga majikan, saya memilih kabur,” ungkapnya lugu. Kini kondisi Mar sudah terlihat baik. Dia mulai bekerja seperti biasanya di rumah majikan. Sebelumnya, Mar diamankan di salah satu shelter LSM. Kemudian dijemput sang majikan, ES, bersama orangtua kandungnya. “Saya tak sanggup dikurung di shelter. Syukur dijemput majikan, dan membawa saya pulang kembali. Saya minta maaf sebesar-besarnya kepada keluarga majikan. Saya mengaku salah, karena sudah mengambil keputusan tak baik itu dan memberikan keterangan palsu,” timpalnya. Disinggung hasil visum yang menyatakan Mar tak perawan lagi, dirinya terlihat malu menceritakan hal tersebut. Dia mengaku, pernah berkali-kali melakukan hubungan badan dengan mantan pacarnya di kampung halaman. “Saya memang pernah bersetubuh. Kejadian itu sudah beberapa tahun yang lalu saat saya masih sekolah. Jadi saya bukan diperkosa. Itu bohong, dan keterangan

palsu yang saya buat itu atas tekanan dari pihak LSM. Jadi bukan BL yang memerkosa saya,” ungkapnya. Menurut ES, Mar takut dimarahi karena belakangan diketahui mengunakan telephone rumah untuk menghubungi teman-temannya di Rote yang berakibat membengkaknya biaya telepon. “Saya kira Mar takut, kemudian kabur. Karena dia menggunakan telephone rumah hingga Rp3juta. Saya juga tidak tahu dia menghubungi siapa, karena saya sudah tanya kepada bapaknya, kalau Mar tidak pernah menelpon dia. Usut punya usut ternyata dia menghubungi teman-temannya di Rote,” kata ES yang sehari-hari bekerja sebagai Jaksa di Rotendau NTT ini. Sebab Mar kabur dari rumah, juga dibenarkan Jermias Mui, ayah kandung Mar yang baru saja datang dari Kupang NTT ini. Menurut Jermias, tudingan anaknya terhadap BL tidak benar. Menurutnya, saat ini Mar masih berumur 17 tahun, sehingga masih labil dan belum memiliki ketetapan untuk berfikir positif. “Saya rasa ini tidak benar. Karena saya percaya kepada ES. Maklum anak saya masih

17 tahun sehingga belum memiliki pikiran positif,”kata laki-laki yang sehari-hari sebagai petani ini. Kedatangan Jermias ke Pontianak bukan karena persoalan tersebut, melainkan karena beberapa hari terakhir, anak kedua dari empat saudara itu kabur dari rumah ES. “Terus terang, saya datang bukan diminta oleh ES. Tapi saya datang karena anak saya dikabarkan kabur dari rumah ES, jadi saya harus memastikan kebenarannya,” singkatnya. Kini pihak pelapor sudah mengajukan permohonan untuk mencabut laporan palsu itu kepada jajaran Polda Kalbar. Pihaknya juga tak ingin masalah ini menjadi dilema. Kasubdit IV Renata Polda Kalbar AKBP Nowo Winarti membenarkan pencabutan laporan tersebut. Dia merincikan, ketika pelapor hendak mencabut laporan tersebut, pihak mereka terlebih dulu memeriksa kembali korban dan ayah kandungnya. “Sebenarnya tak semudah itu untuk mencabut laporan. Kita harus sesuai prosedur,” ungkapnya kemarin. “Kita lakukan pemeriksaan

ulang. Dalam pengakuannya, Mar mengaku salah memberikan keterangan palsu. Sesuai hasil visum, ternyata luka robek di kemaluannya sudah setahun silam. Korban juga mengaku dia pernah bersetubuh dengan mantan pacarnya sewaktu sekolah dulu. Jadi kesimpulannya bukan diperkosa,” ungkap Nowo. Dari hasil pemeriksaan inilah, lanjut dia, maka pencabutan laporan itu kita buat dan sedang dalam proses. Dalam waktu dekat, petugas juga akan diperintahkan untuk melakukan gelar perkara. Disinggung hukum pidana karena korban membuat keterangan palsu, Nowo sudah memberi toleransi akan hal tersebut. Dia menilai, korban tak sepantasnya diberikan ganjaran hukuman, karena masih labil dan terbilang di bawah umur “Bukan berarti kita senang, karena pelapor mencabut laporan kembali. Sebab, proses penyelidikan sudah berjalan sesuai dengan prosedur. Jika dicabut, kita harus bongkar ulang prosedur kerja tersebut. Tapi sebagai pengayom, kita harus mampu melayani publik,” singkatnya. (*/rmn)

PNS Dilatih Militer Ganggu Pelayanan

busikan kartu. Penerima harus benar-benar tepat sasaran. Jika dalam dua tahun keluarga penerima kehidupan ekonominya meningkat, ia akan dicoret sebagai penerima dan digantikan yang lainnya. Kartu didistribusikan oleh PT Pos Indonesia ke seluruh wilayah di Indonesia, bahkan hingga pulau-pulau terluar. Ada sekitar 60 ribu personil yang dikerahkan. ”Semuanya mulai turun sekarang. Paling lambat 30 Juni tahun ini semuanya sudah didistribusikan,” katanya. Gubernur Kalbar Cornelis mengatakan kunjungan ke lapangan tersebut dilakukan secaramendadak.”Initidakada rekayasa. Memang mendadak untuk mengecek secara langsung,” ujar Cornelis. Ia minta warga yang menerimakartuperlindungansosial agar menyimpannya secara hati-hati. ”Kalau hilang lapor polisi, buat berita acaranya. Kemudian lapor ke kantor pos,”

ujarnya. Kepala PT Pos Indonesia Cabang Pontianak, Raharjo mengungkapkan penerima kartu perlindungan sosial di Kalimantan sebanyak 626.943 keluarga. Dari jumlah tersebut, penerima di Kalbar sebanyak 233.922 keluarga dari 1.964 desa dan kelurahan, Kaltim sebanyak 147.718 keluarga, Kalteng sebanyak 83.711 keluarga, dan Kalsel sebanyak 161.592 keluarga. ”Kartu langsung diserahkan kepada rumah warga,” kata Raharjo. Raharjo mengungkapkan di Kota Pontianak terdapat 33 personil yang siap dikerahkan. Sedangkan personil untuk seluruh Kalbar sebanyak 63 personil. Bagi daerah-daerah yang sulit dijangkau, penyerahan dilakukan dengan cara komunitas. ”Warga dikumpulkan di satu tempat, kemudian dilakukan penyerahan kartu. Kartu ini untuk mengambil bantuan langsung sementara,” katanya. (uni)

Dijatah 233.922 Keluarga Sambungan dari halaman 9

Ada tiga lokasi sidak, yakni rumah di Gang Karang Anyar dan Gang Lestari di Jalan P Natakusuma, dan satu rumah di Jalan Swignyo. Ketika tiba di rumah warga penerima kartu perlindungan sosial, Menkokesra langsung melihat kondisi rumah tersebut dan berbincang dengan warga. Fhiong Yuk Chin (47) merupakan salah satu penerima kartu perlindungan sosial. Ia pun bercerita mengenai kondisi keluarganya kepada Menkokesra maupun Gubernur. Fhiong Yuk Chin mengungkapkan rumah sederhana yang didiaminya itu merupakan kontrakan, bukan milik sendiri. Anggota keluarga yang tinggal di sana sebanyak delapan orang, yakni suaminya, Lim A Tjai (57), mertuanya yang kini berusia 77 tahun, bibinya, dan empat anaknya. ”Hanya suamisayayangbekerjasebagai tukang angkut-angkut barang,” katanya.

Fhiong Yuk Chin mengaku bersyukur mendapatkan kartu perlindungansosial.Iaberharap kartu tersebut bisa bermanfaat bagi keluarganya. ”Selama ini kami sudah mendapat jamkesmas. Kadang dapat juga raskin,” ujarnya. Menkokesra, HR Agung Laksono mengungkapkan kedatangannya ke rumah warga secara acak itu untuk mengecek langsung penerima kartu perlindungan sosial. ”Benar tepat sasaran atau tidak. Selama ini kan ada keluhan bantuan langsung tunai tidak tepat sasaran,” kata Agung, kemarin. Agungmengungkapkanpenerimakartuperlindungansosial sebanyak15,5jutakeluargaatau diberikan kepada 62 juta hingga 65 juta jiwa. Jumlah tersebut hampir seperempat dari total jumlah penduduk Indonesia. Kartu diproyeksikan untuk seluruh program prorakyat dan berlaku selama dua tahun. MenurutAgung,pemerintah berhati-hati dalam mendistri-

Demokrat Restui Paryadi - Sebastian Sambungan dari halaman 9

Pemilihan Walikota Pontianak. Keputusan ini sekaligus memupus peluang Hartono Azas—Paruki dengan Billy Arman, dua pesaing Wakil Wali Kota Pontianak ini. Meskipun belum mendapatkan penjelasan resmi, Wakil Ketua I DPD Partai Demokrat Kalimantan Barat, Bobby Crisnawan sudah memberikan bocoran. ”Untuk Pilwako Pontianak, nama Paryadi—Sebastian paling berpeluang memakai perahu demokrat. DPP sepertinya sudah mengeluarkan rekomendasi,” kata dia, Rabu (12/6) di Pontianak. Pasangan Paryadi—Sebastian dengan perolehan 8 kursi di DPRD Kota Pontianak juga tidak perlu berkoalisi dengan parpol lain. Pasalnya persyaratan pencalonan kepala daerah

di Kota Khatulistiwa minimal 7 anggota legislatif. Selain restu di Pilwako Pontianak, rekomendasi untuk Kabupaten Kubu Raya juga sudah ada. Nama Djohansyah, anggota DPRD Kota Pontianak yang berpasangan dengan Ahok Angking, Pengusaha dan Tokoh Tionghoa Kubu Raya disebut akan memakai perahu dengan ciri khas lambang mercy ini. ”Ya, di Kubu Raya pasangan Djohansyah-Ahok Angking mendapat restu DPP Demokrat,” ucapnya. Ahok Angking ketika dimintai komentarnya tidak menepis rekomendasi tersebut. Hanya Partai Demokrat Kubu Raya harus berkoalisi dengan parpol lain karena hanya memiliki 4 kursi. ”Sepertinya berkoalisi dengan PDK dan satunya lagi Hanura Kubu Raya. Kalau ditotalkan jumlahnya di atas angka tujuh sebagai syarat

mengusung pasangan calon kepala daerah,” katanya. Untuk pemilihan kepala daerah di Kabupaten Pontianak, nama Bupati Petahana, Ria Norsan berpasangan dengan Sekda Mempawah, Gusti Ramlana juga mendapat restu untuk memakai perahu Demokrat. Keputusan tersebut sekaligus memupuskan harapan Sabli Awaludin, Wakil Ketua DPRD Mempawah yang ikut bersaing memakai perahu ini. Hanya, lanjutnya, di Kabupaten Sanggau sepertinya belum alot dan terjadi tarik ulur siapa pemakai Partai Demokrat di sana. Namun sebelumnya dua nama mengerucut antara Supardi, Ketua DPC Demokrat Kabupaten Sanggau dengan Paolus Hadi, Wakil Bupati Sanggau. “Untuk di Kabupaten Sanggau masih terjadi ko-

munikasi politik secara santun dan bersih dengan pasangan masing-masing. Namun Insya Allah dalam waktu dekat akan keluar siapa pemakai perahu demokrat,” ungkap Bobby. Lantas bagaimana dengan partai lain? untuk PAN Kalbar melalui Ketua Panitia Seleksi pilkada empat daerah Syarif Izhar Assury menutuskan PAN sudah memantapkan dan menetapkan langkah. Di Pilwako Pontianak PAN mengusung Sutarmidji-Edi Rusdi Kamtono. Di Kabupaten Sanggau nama Nasri Alisan tidak tergantikan. Sementara di Mempawah nama Bupati petahana Ria Norsan menjadi pilihan utama PAN. “Kalau sebelumnya Kubu Raya belum ada kejelasan. Di Kubu Raya, PAN memastikan mengusung Rusman Ali,” tuturnya. (den)

Budaya yang Tak Lekang Ditelan Zaman Sambungan dari halaman 9

Dalam makan saprahan juga dikenal dengan adanya nasi penombong. Istilah penombong adalah nasi tambahan yang diberikan kepada para warga yang merasa butuh tambahan nasi. Bila nasi utama disuguhkan hanya sebatas satu atau dua sendok nasi, namun berbeda halnya dengan nasi penombong. Nasi ini disuguhkan dengan

volume yang membumbung hingga melebihi tinggi tempat untuk menyajikannya. Abdul Gani (48) menyatakan bahwa masyarakat Kampung Parit Wak Metik memang masih sangat mempertahankan tradisi di kampung mereka. “Terdapat banyak hikmah dari makan secara saprahan ini. Yang terutama adalah makan dengan saling berbagi,” ungkapnya pada Kamis (6/6).

bidang perizinan, tata kota, pertanahan dan penegakan hukun di Kota Singkawang. Untuk menindaklanjuti pengaduan tersebut beberapa pengunjung gerai akan menyerahkan kronologis, data pendukung dan persyaratan formal pengaduan agar dapat ditindaklanjuti Ombudsman. (ash)

Pada hari pertama penyelenggaraan gerai pengaduan di Kota Amoi tersebut, Ombudsman Perwakilan Kalimantan Barat menerima total 2 pengaduan, 8 konsultasi, dan 10 meminta informasi tentang lembaga Ombudsman. “Pengaduan yang diterima yakni keluhan tentang sarana

Mar: Maaf Saya Bohong Buat Laporan Polisi Sambungan dari halaman 9

parasarana rumah sakit yang perlu dilengkapi, serta letak loket Jamkesda yang tidak strategis serta menyulitkan bagi ibu hamil, lansia dan orang berkebutuhan khusus,” papar Agus. Sedangkan untuk konsultasi laporan, kata Agus, beberapa warga mengeluhkan soal pelayanan di

Apalagi kata dia, hingga sekarang Singkawang sangat jarang ditemukan wadah formal bagi masyarakat untuk menyampaikan pengaduan atau laporan atas tindakan maladministrasi yang dialami dari penyelenggara pelayanan publik.

bagi masyarakat dengan cara ‘menjemput bola’ ke daerah-daerah. “Adanya gerai pengaduan yang kami buka ini, diharapkan bisa mempermudah dan mendekatkan akses pengaduan bagi masyarakat kota Singkawang,” jelasnya.

Hal senada juga turut diungkapkan oleh Susi (18). Sebagai remaja Kampung Wak Metik yang terlihat sangat aktif menyiapkan hidangan saprahan. Dia menyatakan kebahagiaannya bisa berpartisipasi dalam acara tersebut. “Senang bisa berpartisipasi. Apalagi kalau makan saprahan seperti ini lebih bisa mempererat tali persaudaraan kita,” ungkapnya.

Kampung Parit Wak Metik, sebagian besar warga bersuku Bugis dan bekerja sebagai petani dan nelayan. Dalam keadaan kampung yang masih jauh dari jangkawan itu, masyarakat sangat mempertahankan budayanya. “Kami tidak akan meninggalkan budaya kami hingga nanti. Budaya kami tak akan pernah berubah meski zaman sudah semakin modern,” ungkap Abdul. (*) C




Sambungan dari halaman 9

Seharusnya, saran Tony, negara melakukan rekrutmen warga sipil fresh untuk dilatih pendidikan militer. Namun bukan tenaga PNS atau buruh yang sudah memiliki pekerjaan dan bakalan dicatat sebagai pasukan cadangan pasif aktiv jika dibutuhkan negara. Politisi PAN Kalbar ini berharap DPR di pusat merevisi pasal 8 RUU Komponen Cadangan Pertahanan Negara. Isi pasal itu seperti pegawai negeri sipil, pekerja atau buruh yang telah memenuhi persyaratan wajib menjadi anggota komponen cadangan. Kemudian mantan prajurit TNI yang telah memenuhi per-

syaratan dan dipanggil, wajib menjadi anggota komponen cadangan. “Telaahnya harus mendalam,” tutur dia. Dia berpandangan RUU Komponen Cadangan Negara sekarang ini belum mendesak. Alasannya ancaman dari luar masih rendah. Pun demikian keadaan Indonesia dalam kondisi damai dan tentram. Lebih lanjut dikatakannya buruh atau pekerja semestinya diarahkan meningkatkan produktifitas. Produktifitas tinggi akan ikut mengangkat dan mempengaruhi perekonomian negara. Terlebih kondisi Indonesia saat ini tengah bangkit. Justru, kata dia, negara wajib memilih cara ideal

khusus membangun dan meningkatkan kesejahteraan rakyat. “Bela negara memang wajib namun bukan melalui wajib militer yang memaksa warga sipil. Lebih bijaksana kawal dan jaga perbatasan juga kedaulan negara sehingga tidak ada sejengkal tanah NKRI dicaplok negara tetangga,” tuturnya. Di samping itu, Tony menyarankan khusus PNS yang juga akan disertakan adalah bagaimana meningkatkan kinerja sebagai pelayan warga. Kalau nantinya dilatih militer kesannya bisa tegas dan justru menakuti rakyat. “Kalau PNS dilatih militer, bisa-bisa gaya militer dibawa kerja. Itu tidak bagus loh,” tuturnya.(den)

Seratus Kelompok Sambungan dari halaman 16

Mereka pun mendapatkan pelatihan dan diberi keterampilan agar bisa membangun usaha. ”Bantuan tidak bisa diberikan kepada perorangan, harus berkelompok karena untuk yang perorangan langsung ditangani pusat,” kata Junaidi. Bentuk dari keterampilan tergantung minat kelompok tersebut. Ada yang mendapatkan pelatihan ternak lele,

ternak sapi, usaha kelontong (warung), bidang kecantikan, dan lainnya. Narasumber yang didatangkan adalah orang-orang yang berkompeten di bidangnya. Ketika pelatihan selesai, kelompok tersebut mendapatkan bantuan modal. Mereka pun mengembangkannya dengan dasar ilmu pengetahun yang diperoleh selama pelatihan. Junaidi berharap program pemberdayaan masyarakat ini dapat membantu pemer-

intah dalam mengentaskan kemiskinan. Dengan kemampuan wirausaha, diharapkan mereka yang sebelumnya berasal dari rumah tangga miskin bisa meningkatkan taraf hidupnya. Diharapkan mereka bisa keluar dari lingkar kemiskinan dan kesejahteraannya pun meningkat. ”Usaha yang mereka jalani itu tentunya akan memberikan penghasilan setiap bulan. Kesejahteraan mereka pun pastinya membaik,” timpal Junaidi. (uni)

Pertemuan Raya Pemuda Sambungan dari halaman 16

Badan Pekerja Harian Majelis Sinode GKE di Banjarmasin, pengurus Komisi Pelayanan Pemuda Majelis Sinode GKE di Palangkaraya, ketua-ketua Resort GKE dan tokoh-tokoh GKE yang ada di Kalimantan Barat. Target peserta dan undangan yang akan hadir sebanyak 1.350 orang. Menurut Wakil Ketua Komisi Pelayanan Pemuda

Majelis Sinode GKE Stepanus Wiwin, kegiatan pertemuan Raya Pemuda GKE se-Kalimantan Barat tersebut akan diselenggarakan dalam sorotan spirit tema United in Love to Better Life dengan sub tema Kita Wujudkan Pemuda yang Kreatif dan inovatif. Pengkajian sorotan tema dan sub tema tersebut akan menghadirkan Ketua Umum Majelis Sinode GKE Pdt. D. Petrus Jarob, S.Th. Pengkajian tema dan sub itu diangkat kar-

ena pemuda GKE menyadari bahwa pada dasarnya konteks kekinian kita berada pada tiga realitas, yaitu realitas global, nasional dan lokal. “Dari situ kemudian akan memberikan mekna yang positif tentang kehadirannya di bumi Kalimantan. Kesadaran itu juga diharapkan bahwa dalam realitas global, nasional dan local itu banyak tantangan yang harus dihadapi oleh pemuda GKE,” katanya. (*/mnk)

Penyelarasan Pendidikan Atasi Pengangguran Sambungan dari halaman 16

Ia menambahkan pada 2010 telah dilaksanakan pilot project pertama yang melibatkan 50 lembaga pendidikan dan pelatihan dari lembaga

kursus dan pelatihan, SMK, dan politeknik yang dipilih Direktorat masing-masing. Hasilnya menunjukkan bahwa mayoritas lembagalembaga tersebut tidak memiliki mekanisme penelusuran

lulusan memadai. ”Pada 2011 pilot project ditingkatkan ruang lingkupnya menjadi rangkaian aktivitas untuk meningkatkan capaian indikator penyelarasan,” katanya. (uni)

DCS Boleh Kampanye Sambungan dari halaman 16

Seluruh nama yang masuk dalam DCS diperbolehkan membuat alat peraga kampanye. Hanya saja, ia mengingatkan setelah penetapan DCS ada tahapan selanjutnya yang harus diperhatikan. ”Sejak ditetapkan dan diumumkannya DCS hingga 10 hari, masih memungkinkan adanya tanggapan masyarakat terkait administrasi mereka yang masuk dalam DCS,” katanya. Bagi masyarakat yang ingin mengklarifikasi terkait administrasi DCS tersebut, dipersilakan menginformasikan kepada KPU Provinsi Kalbar. Nantinya KPU Kalbar akan meminta klarifikasi kepada partai politik dari 28 Juni hingga 4 Juli mendatang. Partai pun diberikan kesempatan menjawab dari 5 Juli hingga 18 Juli mendatang. ”Kalau berdasarkan penelitian atas laporan masyarakat mengenai persyaratan yang tidak dipenuhi, jika tidak terbukti, dianggap tidak bersalah,” katanya. Jika dianggap terbukti, lanjut Umi, partai diberi kesempatan untuk mengganti calon tersebut. ”Jadi walaupun sudah masuk dalam DCS, masih memungkinkan untuk diganti jika adanya laporan masyarakat dan terbukti laporan itu benar terkait persyaratan administrasinya,” jelas Umi.

Komisi Pemilihan Umum (KPU) Provinsi Kalimantan Barat mengumumkan Daftar Calon Sementara (DCS) Anggota DPRD Provinsi selama lima hari berturut-turut pada media cetak lokal. Mulai hari ini, 13 sampai 17 Juni mendatang. “Berdasarkan hasil verifikasi administrasi perbaikan, dari 747 bakal calon anggota DPRD yang diajukan 12 partai politik, terdapat dua bakal calon yang tidak memenuhi persyaratan administrasi. Seperti ijazah, surat keterangan kesehatan jasmani dan rohani, serta bebas narkoba, foto copy KTP, dan KTA Parpol,” kata Ketua KPU Kalbar, Umi Rifdyawati, SH, Rabu (12/6) di Hotel Mercure saat memimpin penyusunan daftar calon sementara (DCS), didampingi komisioner KPU lainnya, Delfinus, Kasiono, Viryan Aziz dan Misrawi. Selain itu, terdapat satu Parpol yang tidak mengajukan bakal calon di satu daerah pemilihan. Selanjutnya kata Umi, KPU Kalbar memberikan kesempatan kepada masyarakat untuk menyampaikan masukan atau tanggapan terhadap persyaratan administrasi daftar calon sementara yang diumumkan. ”Masa tanggapan atau masukan masyarakat selama 10 hari sejak diumumkan DCS ini. Tanggapan atau masukan disampaikan ke

KPU Provinsi disertai dengan identitas yang jelas,” terangnya. Terhadap tanggapan dan masukan tersebut, KPU akan meminta klarifikasi kepada partai politik sejak tanggal 28 Juni sampai 4 Juli mendatang. ”Selanjutnya partai politik menyampaikan jawaban atas klarifikasi ke KPU Provinsi sejak tanggal 5 Juli hingga 18 Juli 2013. Apabila, dari hasil klarifikasi calon tersebut terbukti tidak memenuhi persyaratan, maka KPU provinsi akan menyampaikan pemberitahuan kepada partai politik untuk melakukan penggantian calon sementara dengan tanpa mengubah nomor urut sejak tanggal 19 hingga 25 Juli nanti,” jelasnya. Pengaju a n p engga nt i bakal calon hasil klarifikasi tersebut, dimulai sejak tanggal 26 Juli hingga 1 Agustus. Tanggal 1 Agustus juga merupakan batas akhir untuk calon dengan status belum memenuhi syarat (BMS) untuk menyampaikan surat keputusan pemberhentian atau surat keterangan bahwa pemberhentiannya sedang dalam proses. “Jika pada waktu yang ditentukan partai politik tidak menyampaikan surat keputusan atau surat keterangan yang dimaksud, maka calon yang bersangkutan dinyatakan tidak memenuhi syarat (TMS),” tegasnya. (uni/her)



Kamis 13 Juni 2013

Pontianak Post

DCS Boleh Kampanye


Seratus Kelompok KEPALA Dinas Sosial Provinsi Kalimantan Barat, Junaidi mengungkapkan pada tahun ini sedikitnya 100 kelompok di wilayahnya mendapatkan program pemberdayaan masyarakat. Program ini menggunakan anggaran pendapatan belanja daerah maupun anggaran pendapatan belanja negara. ”Dari APBD kabupaten dan kota pasti juga ada,” ujar Junaidi di sela-sela inspeksi mendadak Menkokesra, Agung Laksono Junaidi bersama Gubernur Kalbar, Cornelis, Rabu (12/11). Junaidi menjelaskan program ini diberikan kepada kelompok masyarakat yang berasal dari rumah tangga miskin. Satu kelompok terdiri atas 10 kepala keluarga. Ke Halaman 15 kolom 5



Pertemuan Raya Pemuda GEREJA Kalimantan Evangelis (GKE) akan menyelenggarakan Pertemuan Raya Pemuda se-Kalimantan Barat pada 31 Juli sampai 3 Agustus 2013 di GKE Resort Sintang. Kegiatan tersebut akan diisi dengan berbagai kegiatan yang bersifat pembinaan iman, ceramah dan perlombaan-perlombaan serta pertandingan fisik. Panitia juga akan menyelenggarakan Kebaktian Kebangunan Rohani dengan menghadirkan pengkhotbah Pdt. Dr. Keloso S. Ugak, yang juga dosen dan Ketua STT GKE Banjarmasin. Peserta yang akan hadir dalam kegiatan tersebut adalah utusan dari 11 Resort dan 2 Calon Resort GKE yang ada di Kalimantan Barat, Ke Halaman 15 kolom 5

BUNDARAN: Pembangunan Bundaran Digulis Untan yang akan dibuat air mancur sudah sampai pembuatan lantainya.

PONTIANAK - Daftar Calon Sementara (DCS) anggota legislatif ditetapkan hari ini, Kamis (13/6). Ketua Komisi Pemilihan Umum Provinsi Kalbar, Umi Rifdiawaty mengungkapkan mereka yang masuk dalam DCS telah memenuhi syarat secara administrasi serta pemenuhan kuota 30 persen keterwakilan perempuan dan unsur penempatannya. ”Berdasarkan hasil penelitian hanya dua orang yang tidak memenuhi syarat dan tidak masuk dalam DCS anggota legislatif DPRD Provinsi Kalbar, sedangkan yang masuk DCS sebanyak 747 orang,” ungkap Umi di Pontianak, kemarin. Umi mengungkapkan saat ini telah memasuki tahapan kampanye. Ke Halaman 15 kolom 5

Penyelarasan Pendidikan Atasi Pengangguran PONTIANAK—Persentase pengangguran di Indonesia setiap tahunnya semakin menurun. Tetapi ketika persentasi tersebut dikalikan dengan jumlah penduduk usia kerja yang terus bertambah setiap tahun, tetap memunculkan jumlah pengangguran yang mengkhawatirkan. ”Pengangguran merupakan masalah nasional yang serius dan memerlu-

kan solusi komprehensif,” ujar Maria Anityasari, tim sosialisasi Kerangka Kualifikasi Nasional Indonesia (KKNI) program penyelarasan dunia usaha Dirjen PAUDNI, Nonformal, dan Informal, Kemendikbud, di Grand Mahkota Hotel, Rabu (12/6). Maria menjelaskan untuk mengatasi masalah pengangguran, prioritas pembangunan pendidikan diarahkan pada





peningkatan akses pendidikan yang berkualitas, relevan, dan efisien. ”Jadi pendidikan tidak hanya dituntut berkualitas, melainkan harus relevan dengan kebutuhan dunia kerja dan kebutuhan penciptaan peluang usaha,” ungkap Maria. Agar relevan, lanjut Maria, diperlukan program penyelarasan pendidikan dengan dunia kerja. Tetapi

penyelarasan pendidikan dengan dunia kerja merupakan hal kompleks yang memerlukan kerjasama tim yang erat dengan semua pemangku kepentingan. Sejauh ini belum ada upaya peningkatan keselarasan yang komprehensif dan bersifat lintas kementerian tersebut. Ke Halaman 15 kolom 5

PRO-KALBAR Pontianak Post

Kamis 13 Juni 2013

3 17

Enggan Transaksi via ATM

MANDI HARI BAKCANG: Anak-anak terlihat riang saat mandi berkah di sungai dalam Perayaan Bakcang di Singkawang, siang kemarin.


Widhihandoko Kapolres Singkawang



GRATIS: Hiburan gratis dari Ratu Mandarin.

Hiburan Gratis VIHARA Fuk Tek Si Sui Pangkalan II Kecamatan Sui Raya Kepulauan Kabupaten Bengkayang, selama lima hari menggelar perayaan ulang tahun yang ke tiga belas. Perayaan ulang tahun ini untuk memberikan hiburan gratis bagi warga sekitar. Selasa (11/6) malam, masyarakat Tionghoa sudah memadati halaman vihara yang berada di aliran sungai. Mereka ingin menyaksikan Ke Halaman 27 kolom 1


Diumumkan Hari Ini DIUMUMKANNYA nama-nama Daftar Calon Sementara (DCS) oleh Komisi Pemilihan Umum (KPU) Kota Singkawang. Merupakan bagian untuk memberikan waktu kepada masyarakat agar bisa memberikan masukan dan tanggapan mengenai Caleg yang diusung Partai Politik peserta Pemilu 2014 di kota ini. Anggota KPU Kota Singkawang, Ramdan mengatakan masa Ramdan Ke Halaman 27 kolom 1


SINGKAWANG-Setelah serah terima jabatan di Mapolda Kalbar, Selasa (11/6), AKBP A. Widhihandoko SH, resmi menjabat sebagai Kapolres Singkawang, menggantikan Kapolres sebelumnya, AKBP Prianto. Rabu (12/6) pagi, digelar penyambutan Widhihandoko, di Polres Singkawang. Kedatangan Widhihandoko disambut dengan tarian yang selanjutnya digelar apel di halaman Polres Singkawang. AKBP Prianto yang menjadi inspektur upacara dalam apel tersebut, mengucapkan selamat

datang bertugas bagi Widhihandoko di Kota 1000 Kelenteng ini. Selain itu, ia yakin jika di kepemimpinan Widhihandoko dapat membawa Singkawang lebih baik lagi. “Jika ada pergantian dan tentunya saya yakin pejabat baru lebih baik lagi,” ujar Prianto. Selain itu, Prianto yang memimpin selama dua tahun dua bulan kurang dua hari ini mengingatkan agar jajaran lainnya dapat bersikap baik dan membantu pimpinan baru dalam menjalankan tugasnya. “Apa yang rekan berikan ke-

pada saya, maka berikan juga kepada pimpinan yang baru. Begitu jug sebaliknya, tunjukan yang telah saya berikan kepada rekan-rekan,” pesan dia. Prianto mengatakan banyak event besar di Kota Amoi ini, seperti Cag Go Meh dan Pilkada yang telah berlangsung sukses. Tidak lama lagi akan berlangsung Pileg dan Pilpres, karena itu ia mengingatkan agar bawahannya agar memberikan dukungan dan melakukan kerjasama yang baik agar even itu berlangsung Ke Halaman 27 kolom 5

Tangan Remuk Terlindas Zonder SINTANG- Astuti (42) warga Dusun Kemangai Desa Nanga Kemangai Kecamatan Ambalau. Sudah hampir dua minggu berada di Rumah sakit Umum Ade Mohammad Djoen Sintang. Lantaran Tangan kanannya Remuk terlindas zonder. Kejadian tersebut terjadi Selasa, (4/6) pada saat dirinya pulang kerja. Khatiman (47) suami Korban mengatakan kejadian itu berawal ketika ia bersama istrinya pulang kerja di PT Sinar Sawit Andalan

(PT SSA). Kala itu, seperti biasa ia, istri dan karyawan perusahaan selalu menaiki Jhonder ketika hendak pulang dan berangkat kerja. Tepat di persimpangan di daerah perkebunan Kondisi cuaca hujan dan Jalan licin sehingga jhonder tersebut tak bisa berjalan. Terlebih di daerah tersebut kondisi tanah agak sedikit curam. Namun naas, zonder tersebut oleng. Akibatnya Astuti terjatuh

dan tertelungkup ke bawah jhonder sehingga ban belang Jhonder tersebut menggilas tangan korban. Atas Kejadian itu Sopir bersama karyawan yang kebetulan ikut menumpang di dalam zonder langsung menolong korban. Korban langsung dibawa kerumah sakit Nangan Kemangai. Namun Rumah sakit Nangan Kemangai menyarankan untuk dibawa Ke Halaman 27 kolom 5

SINTANG—Usai mencuat kasus pembobolan ATM BRI memberikan dampak psikologis ke warga Sintang. Warga mengaku menjadi takut bertransaksi melalui ATM, khawatir bakal mengalami nasib serupa. Pihak bank juga diminta meningkatkan keamanan guna menjamin nasabah saat bertransaksi di ATM. “Terus terang saya agak sedikit menjadi takut untuk bertransaksi di ATM. Apalagi saya juga biasa menarik uang melalui ATM BRI di Simpang Lima,” kata Udin, salah seorang warga Sintang, yang juga nasabah BRI. Menurut dia, paling penting juga yakni jaminan keamanan dari bank, sebagai penyedia ATM. Misal, transaksi nasabah harus bisa terkontrol dengan baik melalui rekaman CCTV yang terpasang di dalam gerai ATM. Sementara, lanjut dia, berdasar informasi yang


diperoleh, CCTV ATM BRI di Simpang Lima sedang mengalami gangguan, saat kejadian. Ke Halaman 27 kolom 1

Tabrak Lari, Suyati Tewas Avanza vs Motor SINGKAWANG-Suyati (36), warga Kelurahan Sedau, Kecamatan Singkawang Selatan ini menjadi korban tabrak lari pengemudi mobil Avanza merah marun di depan Pos

polisi Jalan Raya Sedau, Rabu (12/6) sekitar pukul 04.02. Ibu rumah tangga ini meninggal dunia dengan kondisi tubuh luka parah. Kedua paha, tangan kanannya patah Ke Halaman 27 kolom 1


TABRAK: Petugas memperlihatkan motor yang remuk serta pecahan mobil penabrak.

Melihat Perayaan Hari Bakcang di Singkawang

Kisah Qu Yuan Bunuh Diri Melompat ke Sungai Warga Tionghoa di Kota Singkawang, Rabu (12/6) kemarin, atau tanggal 5 bulan 5 Imlek 2564, merayakan hari Bakcang. Ada menu khusus saat perayaan berlangsung. Kue pulut berisikan kacang atau daging. Atau sering disebut Bakcang. AHMAD FAHROZY, Singkawang

BAKAR KERANDA: Warga yang demo membakar keranda atas kasus pembunuhan Novia, yang tak terungkap.


BOBOL: Mesin ATM BRI di Simpang lima Sintang, lokasi awal terjadinya pembobolan

BERJALAN di kota Singkawang, amat mudah menembukan bakcang yang dijual dengan cara digantung. Ya, sama dengan di daerah lain, warga Tionghoa di Kota Singkawang, kemarin Rabu (12/6) juga memeringatinya. Berbagai cara merayakan salah satu hari besar warga Tionghoa, diantaranya makan-makan bersama keluarga dekat,


KUE BAKCANG: Kue bakcang menjadi menu khusus saat perayaan Bakcang buat warga Tionghoa di Kalbar.





kemudian diakhiri dengan mandi di sungai, yang dikenal dengan nama 5 chi sui (hakka). Salah satu warga yang merayakan yang juga Anggota DPRD Kota Singkawang, Sumberanto Tjitra mengatakan dalam merayakan hari raya ini, makanan yakni sebut bakcang menjadi menu utama. “Dalam merayakan hari besar ini, biasanya makan bersama keluarga ataupun sanak saudara dekat. Makanan yang menjadi menu utama adalah Bakcang, ada makna yang terkandung dalam makanan tersebut,” kata Sumberanto Tjitra, Rabu (12/6). Bakcang, dikatakan Sumberanto, ada empat sudut, dimana setiap sudut ada artinya. Sudut pertama mengartikan suami istri saling mencintai dan akur damai. Ke dua mengartikan keluarga selalu dalam damai sejahtera,sehat selalu. Pada sudut ketiga, lanjutnya, semua rezeki tidak ketinggalan dan sudut ke empat senantiasa usahanya sukses, karier nya meningkat. Diceritakan Sumberanto, perayaan ini berawal ketika Ke Halaman 27 kolom 1


Hari Pertama Minim Pendaftar

HARI pertama, Rabu 12 Juni proses pendaftaran bakal pasangan calon bupati dan calon wakilbupatipadapemilihanumumkepaladaerah (Pemilukada) Kubu Raya pada 19 September mendatang masih minim pendaftar. Dari Pantauan Pontianak Post di Sekretariat KPU Kabupaten Kubu Raya di Jalan Adisucipto Sungai Raya berbagai persiapan teknis telah disiapkan, diantaranya tempat Pemilihan Umum (KPU), pukul 08.00 sampai dengan 16.00 wib suasanamasihtampaksepisepertibiasadantidak adatanda-tandakedatangandaribakalpasangan calon yang akan mendaftarkan diri. Divisi Teknis Pemilu KPU Kabupaten Kubu Raya, Encep Endan mengatakan sampai memasuki tahapan pendaftaran memang belum ada tim bakal pasangan calon bupati dan wakil bupati Kubu Raya, baik dari jalur perseorangan ataupun dari partai polilitik dan gabungan partai politik yang datang. “Kami tentu siap menerima kapan saja bakal pasangan calon akan mendaftar,” katanya, Rabu (12/6). Sejauh ini, lanjut dia memang ada beberapa tim bakal pasangan calon yangtelahdatanguntukmenanyakanpersyaratan danapasajaprosesyangharusdipersiapkanuntuk mendaftar. “Sampai hari ini memang belum ada konfirmasi baik dari tim ataupun bakal pasangan calonkapanmerekaakanmendaftarkandiri.Akan tetapi kami berharap, minimal sebelum mendaftar telah ada informasi yang disampaikan kepada KPU,” ucapnya. Untuk itu, lanjut Encep pihaknya mengimbau kepada setiap bakal pasangan calon bupati dan wakil bupati Kubu Raya, baik dari partai politik, gabungan partai politik atau dari jalur perseorangan untuk dapat memberikan informasi kepada pihaknya satu hari sebelum melakukan pendaftaran. Menurut dia, informasi itu perlu disampaikan agar setiap pasangan calon yang akan mendaftar tidak bertepatan dengan bakal pasangan calon lain. “Yang kita hindari adalah jangan sampai antara bakal pasangan calon mendaftar pada waktu yang bersamaan. Ini untuk menghindari hal-hal yang tidak diinginkan mengingat pengalaman pelaksanaan Pemilu, baik Pemilukada Kubu Raya sebelumnya dan Pemilihn Gubernur tahunlalusetiapbakalpasanganmembawamasa pendukung,” terangnya. Encepkembalimengingatkanbagisetiapbakal pasangancalonbupatidanwakilbupatiyangakan mendaftar, selain menyerahkan kelengkapan administrasisyaratpencalondanpemenuhansyarat calon yang paling penting adalah menyerahkan daftar nama tim kampanye mulai dari tingkat kabupaten hingga tingkat kecamatan dan rekening khusus dana kampanye dan visi misi serta program kerja yang dibuat secara tertulis. (adg)


Pontianak Post

Kamis 13 Juni 2013

Dukungan Calon Perseorangan Susut


PENJUAL DURIAN: Marlan (25) salah satu penjual durian membuka lapak dagangannya di pinggir Jalan Tengku Umar. Beberapa penjual durian pun juga sudah membuka lapak. Jalan ini memang sudah dikenal ramai penjual durian setiap tahunnya.

Pemkab Sediakan Seragam Gratis SUNGAI RAYA-Siswa tidak mampu tidak perlu khawatir tidak bisa mengenyam bangku sekolah jika alasanya karena ekonomi. Pasalnya, Pemerintah Kabupaten Kubu Raya telah menyediakan dana dari APBD untuk pendidikan warga tidak mampu untuk tingkat SD, SMP dan SMA, seperti untuk seragam gratis dan biaya formulir pendaftaran. Kepala Dinas Pendidikan Kabupaten Kubu Raya, Frans Randus mengatakan APBD yang disediakan untuk membantu calon siswa tidak mampu, khususnya untuk pakaian seragam mengalami peningkatan, yakni pada 2011 anggaran yang disediakan hanya Rp11 miliar sedangkan tahun ini mencapai Rp19 miliar. Frans menjelaskan, sebagai bentuk keseriusan pemerintah kabupaten di dunia pendidikan, jika sebelumnya seragam gratis hanya diberikan bagi siswa baru di SD, SMP, dan SMA negeri maka tahun ini untuk SD negeri dan swasta kecuali sekolah agama, SMP Negeri dan swasta kecuali sekolah agama, dan SMA negeri, swasta dan agama akan menda-

patkan bantuan tersebut. “Ini sifatnya swakelola, dana akan langsung masuk ke kepala sekolah tanpa ada intervensi dari dinas,” tegasnya. Dalam pelaksanaannya nanti, lanjut Kadis Pendidikan yang harus dipahami adalah terkadang ada perubahan data jumlah siswa yang akan mendapatkan pakaian seragam gratis tersebut. karena data yang disampaikan sekolah adalah data murid ajaran baru 2012-2013, sementara yang akan diberikan saat ini adalah siswa 2013-2014 yang bisa saja kurang dan bisa saja lebih. Selain menyiapkan seragam gratis bagi siswa baru dan berbaga program pendidikan yang diperuntukan bagi anak-anak tidak mampu, dia menuturkan maka tidak ada lagi alasan siswa tidak mampu tidak dapat mengenyam pendidikan hanya karena alasan ekonomi.“Semua anak di Kubu Raya wajib mengenyam pendidikan tanpa adanya alasan ekonomi,” tegasnya, Rabu (12/6). Seperti yang sempat tersiar, salah seorang anak warga Desa Punggur Kapuas

Kecamatan Sungai Kakap tidak dapat mengenyam pendidikan dikarenakan tidak memiliki kartu keluarga. Frans pun memastikan itu tidak akan terjadi lagi, karena semua anak di Kabupaten Kubu Raya baik yang tergolong tidak mampu maupun mampu berhak mendapatkan pendidikan, karena itu kewajiban pemerintah untuk memenuhinya. Menurut Frans, dalam dunia pendidikkan itu tidak perbedaan antara siswa tidak mampu dan mampu. Karena anak-anak Indonesia itu wajib belajar 12 tahun dan itu merupakan program dari Kementerian Pendidikan. “Mau anak itu miskin ataupun kaya tidak ada perbedaanya. Intinya sebagai warga negara Indonesia wajib mengenyam dunia pendidikan,” pungkasnya. Dia memastikan dalam proses penerimaan siswa baru nanti tidak akan ada sekolah yang melakukan pungutan liar yang dapat mempersulit calon siswa. Karena, pemerintah kabupetan telah menyediakan dana dari APBD untuk biaya formulir dan alat tulis kantor yang dibutuhkan sekolah. (adg)

SUNGAIRAYA-Dukunganyangdiserahkanbakal pasangan calon bupati dan wakil bupati Kubu Raya dari jalur perseorangan kian menyusut. Hasil dari verifikasi administrasi dan faktual yang dilakukan 117 Panitia Pemungutan Suara (PPS) se Kabupaten KubuRayauntukpasanganMuda-Harjodari122.222 menyisakan 87.476 dan Tukirin-Nur Rahmat dari 28.542 menyisakan 17.356 dukungan. Ketua PPK Sui Raya, Yanto Hasanah mengatakan pihaknya telah juga melakukan penelitian kembali terhadap hasil verifikasi PPS kemudian diplenokan. Namun dalam hasil penelitian itu masih juga ditemukan diantaranya dukungan dari PNS dan TNI/ Polri. “Kita masih temukan adanya dukungan yang masih berstatus PNS dan TNI/ Polri. Itukan tidak boleh. Tapi sudah dicoret,” katanya, Rabu (12/6). Untuk Kecamatan Sui Raya, lanjut Yanto Hasanah hasil pleno verifikasi bahwa dukungan pasangan Muda - Suharjo yang memenuhi syarat sebanyak 35.668 dari 40.676 yang diajukan ke KPU. Sedangkan yang tidak memenuhi syarat 5.008 dukungan. Sementara dukungan pasangan Tukirin - Nur Rahmat yang memenuhi syarat sebanyak 8.380 dukungan dari 12.741 yang diajukan KPU. Dan yang tidak memenuhi syarat 4.361. Sementara itu Ketua PPK Sui Ambawang, Basar, juga akui pihaknya masih menemukan dukungan ganda. Jika yang bersangkutan mengaku atau diketahui memilih kedua-duanya surat dukungan suara tersebut langsung dicoret. Jika hanya satu diantaranya bahwa orang yang bersangkutan menyertakan dukungan suaranya, maka yang bersangkutan harus menyertakan surat pernyataan dukungannya kepada salah satu pasangan. “Jumlah dukungan ganda yang ditemukan memang kecil. Tapi langsung dikonfirmasi ke warga yang bersangkutan,” ucapnya. PPK Ambawang sendiri memiliki 15 PPS tersebar di masing-masing desa. Di Kecamatan Sui Ambawang, dukungan Muda - Suharjo yang memenuhi syarat 8.879 dari 9.231 yang diajukan KPU. Sedangkan yang tidak memenuhi syarat 325 dukungan. Sementara dukungan pasangan Tukirin - Nur Rahmat yang memenuhi syarat 8.879 dari 9.231yangdiajukanKPU.Danyangtidakmemenuhi syarat 371 dukungan. Jika hasil verifikasi administrasi dan faktual ternyata ada dukungan salah satu pasangan calon tidak memenuhi syarat minimal 24.707, pasangan itu tetap berhak untuk mendaftar ke KPU yang dibuka mulai tanggal 12 - 18 Juni. Namun calon diberi kesempatan untuk melakukan perbaikan dan memenuhikembalidukunganyangkurangtersebut agar lebih dari syarat minimal yang ditetapkan yakni 24.707. Kesempatan itu diberikan selama seminggu mulai tanggal 3 - 11 Juli. (adg)

Pontianak Post


Kamis 13 Juni 2013


Pematangan PENGURUS Cabang Federasi Olahraga Karate-Do Indonesia (Forki) Kabupaten Pontianak tinggal melakukan pematangan persiapan jelang turnamen Dandim Mempawah Cup 2013, yang akan dilaksanakan selama tiga hari di Gedung Kartini Mempawah, 28-30 Juni 2013 mendatang. “Persiapan sudah maksimal, makanya besok (hari ini-red) kita akan melaksanakan rapat untuk mematangkan persiapan jelang turnamen, baik dari persiapan penginapan, akomodasi, hingga peralatan serta personel,” kata Ketua Letkol Kav Bambang S Fo r k i Ka b u p a t e n Pontianak, Letkol Kav Bambang Sulistyo, saat ditemui di ruang kerjanya, Selasa (11/6). Menurut pria yang juga Komandan Kodim 1201/Mempawah ini, turnamen karate skala provinsi yang baru pertama dilaksanakan di Kabupaten Pontianak tersebut merupakan salah satu upaya dirinya untuk memajukan olahraga karate di Kalbar, khususnya di Kabupaten Pontianak. Sebab olahraga bela diri ini masih belum menunjukkan prestasi yang begitu menonjol “Ini merupakan event pertama kali diadakan oleh Forki Cabang Kabupaten Pontianak. Sebagai ketua terpilih, saya mencoba menggeliatkan kembali karate di Kabupaten Pontianak. Karena saya melihat sudah ada beberapa olahraga yang sudah menonjil seperti anggar, sepakbola, tinju dan olahraga lainnya. Namun karate merupakan olahraga yang belum mendapatkan prestasi mengagumkan. Diharapkan event ini dapat menambah jam terbang dan pemanasan sebelum ajang Porprov,” jelasnya. Persiapan yang dilakukan panitia, lanjut Dandim, sudah dilaksanakan sejak enam bulan lalu, mendapatkan respon yang luar biasa dari seluruh pengurus Forki di Kalbar. Sehingga mengharuskan pihaknya mempersiapkan segala sesuatu, agar kegiatan tersebut dapat berjalan lancar. Karena Dandim mengharapkan Dandim Mempawah Cup nantinya dapat menjadi event tahunan di Kabupaten Pontianak. “Makanya dalam tahun pertama ini, akan kita laksanakan sebaik mungkin dengan persiapan matang. Sehingga diharapkan dapat berkelanjutan di masa yang akan datang. Saya juga berharap mendapatkan dukungan pemerintah Kabupaten Pontianak untuk mewujudkan hal tersebut. Agar perkembangan olagraga karate di Kabupaten Pontianak semakin meningkat,” tukas dia. (wah)


PSB Serentak 1-4 Juli


MACET: Akibat demo kasus Novia, sebagian jalan Mempawah pun macet. Polisi pun ambil bagian demi lancarnya lalulintas.

PINYUH- Sekolah Menengah Pertama (SMP) Negeri I Sui Pinyuh akan membuka Penerimaan Peserta Didik Baru (PPDB) 1 hingga 4 Juli mendatang. Terkait hal itu, pihak sekolah, mulai kemarin sudah memasang pengumuman (PPDB) tahun ajaran 2013-2014. “PPDB serentak diberlakukan mulai TK, SD, SMP, SMA/ SMK dan SLB yakni 1 hingga 4 Juli 2013,” terang Thamrin S.Pd Kepsek SMPN I Jalan Pendidikan Sui Pinyuh. Sedangkan pengumumannya adalah 6 Juli bagi mereka yang dinyatakan lulus dan proses daftar ulang bagi peserta didik baru yang diterima dilaksanakan mulai 8 hingga 11 Juli 2013. Dia mengakui, kalau pengumuman PPDB baru saja dilakukan, lantaran baru menerima Edaran Kadis Pendidikan Pemuda dan Olahraga Kabupaten Mempawah. Thamrin memastikan, untuk tahun ajaran baru, sekolah yang dipimpinnya akan menerima peserta didik baru sebanyak 6 kelas yang ratarata kelas 32 dikurangi jumlah anak yang tidak naik kelas. “Jumlah itu sesuai jumlah pelajar yang ikut ujian nasional yakni 218 murid dan lulus 100 persen,” ujarnya. Dia dan guru lainnya tentu saja

puas seraya bangga melihat capaian kelulusan tahun ini. Yang pasti lanjut Thamrin, ada satu kepuasan, lantaran Risca Prizillya tak hanya meraih nilai tertinggi ujian yakni 36,40. Melainkan juga meraih sempurna yakni 10 untuk mata pelajaran matematikan. Sementara IPA 9,0, Bahasa Inggris 9,33 dan bahasa Indonesia 8,20. Kepsek menjelaskan, lazim diberlakukan sekolah pada waktu menerima muird baru memberlakukan sistim rangking nilai murni ujian nasional (MUN). Dengan cara itu, tentu sekolah tidak dipersalahkan orangtua murid jika ada anak mereka yang tidka diterima, lantaran NUM nya berada dibawah anak yang lain. Dilain pihak, ketentuan itupun merujuk dari Surat Edaran no 421.137.4/Dikpora-A, tanggal 5 Juni 2013 yang ditandatangani Drs H Zulkifli Salim MS.i Kadis Dikpora Kabupaten Mempawah.dalam SE itu disebutkan, seleksi calon peserta didik dilakukan berdasarkan peringkat nilai ujian nasional (NUN). “Sebagai pelaksana pendidikan, kami tetap melaksanakan penerimaan sesuai prosedur yag sudah ditetapkan,” aku Thamrin didampingi wakil kepala Sekolah dan guru lainnya. (ham)

Optimis Menangkan Pilkada

Pasangan Menawan Daftar ke KPU MEMPAWAH-Pasangan bakal calon bupati dan wakil bupati dari jalur independen, Muchtaria dan Edy Gunawan melakukan pendaftaran di KPU Kabupaten Pontianak. Bakal calon yang menamakan dirinya pasangan menawan ini merupakan pasangan yang pertama mendaftarkan diri ke KPU di hari pertama, Rabu (12/6). Diantar ratusan pendukung setianya, diiringi musik tanjidor, pasangan tersebut langsung disambut ketua KPU Kabupaten Pontianak dan Ketua Pokja pemilihan Bupati dan Wakil Bupati Kabupaten Pontianak. Didampingi ketua tim Menawan, Maman Suratman, pasangan tersebut langsung menyerahkan berkas pendaftaran.

Meskipun ruangan yang disediakan KPU terbatas, namun tak menyusutkan antusias pendukungnya untuk masuk ke ruangan pendaftaran, untuk melihat langsung pasangan yang dinilai telah lama bersosialisasi di masyarakat tersebut mendaftarkan diri sebagai bakal calon bupati dan wakil bupati. “Inilah bentuk dukungan dan apresiasi masyarakat Kabupaten Pontianak, untuk menantikan sosok pemimpin baru yang tentunya sangat dekat dan berpihak kepada masyarakat. Makanya mereka sangat antusias mengantar pasangan menawan mendaftar, bahkan sampai harus berhimpitan memenuhi kantor KPU,” jelas Maman. Usai penyerahan berkas, Pokja

pemilihan Bupati dan Wakil Bupati Kabupaten Pontianak langsung memeriksa semua kelengkapan. Satu persatu surat dikeluarkan dan di cek keabsahannya. Dengan setia, pendukung menunggu proses tersebut hingga selesai. “Kita sudah menyerahkan semua berkas, kekurangannya akan dilengkapi kemudian, terutama bukti dukungan, serta akan memenuhi semua persyaratan pada proses selanjutnya, seperti arahan ketua KPU,” ungkap Muchtaria, didampingi Edy Gunawan atau yang akrab di sapa Acun. Muchtaria mengatakan, pihaknya sangat optimis dapat memenangkan Pilkada kali ini. Melihat dukungan yang diberikan masyarakat Kabu-


DAFTAR : Pasangan menawan, Muchtaria dan Edy Gunawan atau yang akrab disapa Acun saat mendaftarkan dari jalur independen ke KPU.

paten Pontianak. Sebab dia mengatakan, program yang telah disusun kedua pasangan ini, merujuk kepada kesejahteraan masyarakat dalam berbagai bidang. “Kami adalah pasangan yang sangat pas, dimana saya seorang akademisi, didamp-

ingi sosok yang sangat dikenal sebagai pengusaha muda di Kabupaten Pontianak. Kami akan memadukan itu, untuk membawa Kabupaten Pontianak sebagai Kabupaten yang sangat maju dan berjaya dalam segala bidang,” tukasnya.(wah)


Gaya Hidup Sehat PELAKSANA Tugas Kepala Dinas Kesehatan Kota Singkawang, Achmad Kismed mengatakan jika pribadi yang tidak higienis juga memicu terkena diare. “Mau makan kue, tidak cuci tangan, maen bantai jak.Itusudah pola atau gaya hidup kita dan kurang memperhatikan kebersihan,” jelas Kismed,Selasa (11/6). Meski demikian ia tak menampik, jika jajanan yang tidak bersih, baik Achmad Kismed itu minuman maupun makanan juga menjadi faktor terjangkit diare. Diantaranya seperti makanan atau minuman yang dijual di warung, yang tidak tertutup sehingga mudah terkena bakteri penyakit diare. “Memang juga kebanyakan faktor dari air dan makanan. Seperti makanan yang dijual tidak tertutup, bisa menempel mikroorganismes, kemudian termakan dan berkembang biak di dalam tubuh,” ucapnya. Lainnya halnya, kata Kismed jika ada satu keluarga yang terkena diare, maka ada faktor jika caramemasakyangtidakbetulataubahan-bahan yang akan dimasak itu sudah tercemar. Karena itu iamengingatkanagarberhati-hatibaikjajanmaupunmemasakmakanan.Selainituwaspadaijuga kondisicuacayangbelakanganhariini.Minimnya curah hujan, maka minim juga ketersediaan air bersih yang dibutuhkan masyarakat. “Faktor resikoyangdapatmenimbulkandiareharusdapat dihindari,” ucapnya. (mse)


Kamis 13 Juni 2013

Puluhan Orang Daftar IPDN SINGKAWANG- Meski belum secara resmi ada pengumuman dimulainya pendaftaran penerimaan calon praja IPDN tahun 2013. Sekitar 34 nama pendaftar, telah masuk ke Badan Kepegawaian Daerah Kota Singkawang. “Sampai saat ini belum ada informasi resmi tentang penerimaan IPDN tahun 2013, tapi sudah ada orang yang mendaftar di BKD,” kata Kasubid Pembinaan dan Pengembangan BKD Singkawang, Abdul Hadi, Senin (10/6). Menyikapi sudah adanya namanamapendaftaryangadasekarangini sementara pengumuman resminya belum diketahui. Dikatakan Abdul Hadi, diminta untuk meninggal kan nomorHandphoneagarnantinyajika sudahdiketahuitanggalpastinya,bisa

langsungdihubungi.Kalaupengumuman resmi sudah keluar, pihaknya akan menyampaikannya kepada seluruh SMA/MA di kota ini. “Kitamintanomorteleponmasingmasing pendaftar yang sudah ada, agar mempercepat pemberitahuan jika sudah ditetapkan tanggal mulai pendaftarannya,” kata Abdul Hadi, Senin (10/6). Pengalaman tahuntahun sebelumnya, lanjut Abdul Hadi, memang pendaftaran IPDN dilaksanakan pada Mei. Namun tahun ini diperkirakan agak meleset yang pihaknya tidak mengetahui apa penyebabnya. “Kalau biasanya pendaftaran dilaksanakan pada Mei, jadi yang nama yang sudah mendaftar di BKD ini mungkin berdasar pengalaman

tahun-tahun lalu, dan ini sebuah upaya bagus, artinya mereka ada niat mencari informasi dengan langsung ke BKD,” katanya. Ketika ditanya berapa kira-kira dari Kota Singkawang bisa dikirim ke Jatinangor. Abdul Hadi menyebutkan mengenai jumlah berapa itu tidak menggunakan kuota, hanya saja menyesuaikan dari Pemerintah Provinsi Kalimantan Barat. “Seumpama di Kalimantan Barat memperoleh jatah seratus, dari Singkawang ini akan diambil berapa orang dengan nilai tertinggi yang memenuhi batas dari Provinsi, artinya semakin banyak orang pintar dengan nilai tertinggi di kotaini,akansemakinbanyakorangdi kirim ke Jatinangor (kampus IPDN),” katanya. Tapi sesuai jumlah di tahun-


IDOLA: Pendidikan ikatan dinas IPDN tetap diburu para pelajar dari berbagai daerah.

tahun sebelumnya, dari Kota Singkawang kurang lebih tujuh orang dikirim ke IPDN. Menunggu pengumuman resmi, Abdul Hadi meminta kepada nama yang sudah ke BKD atau yang belum, untuk mempersiapkan segala sesua-

tunya, paling tidak legalisir Akta Kelahiran. “Syarat-syarat mulai dari sekarang harus dipenuhi, paling tidak mengurus legalisir Akta Kelahiran di Disdukcapil, sementara syarat lainnya bisa dilengkapikalauakanberangkat ke Jatinangor,” katanya. (fah)

SINGKAWANG- Peran Posyandu meningkatkan derajat kesehatan warga Singkawang sangat penting. Jika kinerja menurun di unit pelayanan tersebut akan berdampak pada terhambatnya pencapaian status kesehatan masyarakat yang lebih baik. “Meski kader posyandu bekerja secara sukarela, saya memberikan apresiasi lantaran perannya sangat membantu pemerintah dalam pengabdian yang tulus meningkatkan derajat kesehatan di Bumi Bertuah Gayung Bersambut ini,” kata Wali Kota Singkawang, Awang Ishak, Rabu (12/6) saat membuka jambore Kader Posyandu tingkat Kota 2013, yang diikuti seluruh kader di lima kecamatan di Palm Beach Pasir Panjang. Menurut Awang, posyandu merupakan garda terdepan dan terdekat dengan masyarakat yang memiliki peranan penting dalam meningkatkan derajat kesehatan. Keberhasilan sebuah posyandu tidak terlepas dari peran penting kader posyandu itu sendiri. “Kinerja posyandu itu sendiri, sangat tergantung dengan peran, motivasi dan kemampuan para kader dalam melaksanakan kegiatan posyandu. Hal inilah yang perlu disadari mengingat timbulnya berbagai faktor yang memengaruhi kinerja dan motivasi kader posyandu, baik secara internal maupun eksternal,” katanya.

Awang menyebutkan diantara masalah yang dirasakan dalam pelaksanaan kegiatan posyandu, salah satunya adalah drop out-nya para kader. “Ini dapat dimaklumi karena pekerjaan tersebut didasari atas rasa sukarela sehingga tidak ada ikatan yang kuat dan formal,” katanya. Meskipun banyak yang drop out, lanjut Awang, masih banyak juga para kader yang tetap melaksanakan pengabdiannya dengan tulus. Ditambahkan Awang, jambore kader posyandu bukan hanya merupakan ajang pertandingan dalam memperebutkan juara, tetapi ajang silaturahmi, tukar informasi dan berbagai pengalaman lapangan sehingga hal ini merupakan kesempatan yang baik untuk menambah ilmu dan pengalaman bagi para kader posyandu. Plt. Kadis Kesehatan Kota Singkawang selaku Ketua Panitia kegiatan, Achmad Kismed mengatakan jambore kader posyandu dilaksanakan tiga hari, diikuti seratus peserta dan satu pendamping masing-masing kecamatan. Para peserta, lanjut Kismed, akan mengikuti berbagai perlombaan, seperti masak, cerdas cermat, mengisi KMS dan gizi, reproduksi sehat, kesehatan lingkungan, perilaku hidup bersih dan sehat, dan penyuluhan materi gizi, imunisasi, kesling dan kesehatan ibu dan anak.(fah)

Posyandu Jadi Garda Terdepan


Penunggu Paggong Sebedang


BARU: Kapolres Singkawang yang baru, AKBP A. Widhihandoko SH menyalami pejabat dan perwira saat datang ke Polres Singkawang. Berita di Halaman 17.

FILM daerah kian marak, Berbagai film baru bermunculan di masyarakat. Salah satunya film Penunggu Paggong Sebedang sebuah film indie. Film tersebut bercerita tentang kehidupan masyarakat miskin yang tetap mempertahankan kelestarian hutan lindung dan dibumbui cerita adegan komedi. Film tersebut secara tidak langsung penonton mendapat pesan moral dalam film tersebut. Helmy selaku pemeran utama dalam film tersebut menuturkan film tersebut mampu menambah apresiasi perfilman daerah di Kabupaten Sambas, sehingga wawasan bagi masyarakat pedesaan dan perkotaan pada umumnya. “Masyarakat bisa menikmati film tersebut,” kata Helmy yang juga PNS di Kota Singkawang ini. Senada dengan hal tersebut, Romi Bujang selaku sutradara menambahkan, diharapkan film ini mampu menambah apresiasi perfilman daerah Kalbar khususnya Sambas. Selain itu, kata dia, film ini tentu mampu melestarikan bahasa dan budaya Melayu Sambas yang kian memudar di kalangan anak muda. Ke depan, kata dia, hendaknya pemerintah daerah, pengusaha, dan masyarakat lebih memperhatikan seniman untuk berkarya dan berkreasi. (zrf)

Pontianak Post

Panen Perdana Jagung di Desa Caong KEBUTUHAN jagung untuk pakan ternak di Kota Singkawang sebanyak delapan ton perbulannya. Guna mencukupi kebutuhan jagung bagi peternak ayam di Kota Singkawang terpaksa mengimport jagung dari Amerika Serikan, Cina, Pakistan dan India. Hal itu diungkapkan Sangian Sujono Anggi kepada Pontianak Post, Pengusaha Ternak Ayam di Kota Singkawang dan Penampung Jagung disela-sela panen

perdana jagung di Dusun Pelanjau Desa Caong, Kecamatan Mempawah Hulu Kabupaten Landak. Menurut Aang, biasa dia dipanggil, dengan digalakkannya penanaman jagung di Kalimantan Barat, dipastikan pihaknya tidak lagi akan melakukan import. “Paling tidak kita bisa menghentikan importuntukmendatangkanjagungdari luarnegeri.Sekarangkebutuhandengan


PERDANA : Kelompok Tani bersama pengusaha melakukan panen perdana jagung. Jagung saat ini masih diimpor dari luar negeri.

hasil tidak imbang,” kata Aang. Bila perlu kedepannya, kata Aang,denganmengalakkansektor penanaman jagung tersebut, Kalimantan Barat bisa menjadi lumbung jagung dan alhasil bisa mengeksport ke negara lain atau paling tidak hasil pertanian tersebut dibawa ke luar daerah. Aang juga mengungkapkan, petani jangan khawatir soal pemasaran jagung. Setiap tahunnya selalu saja meningkat kebutuhan jagung. “Kalau soal pemasaran kita siap menampung,” tuturnya. (zrf)

Pontianak Post

Kamis 13 Juni 2013



14 Juni, Hatta Rajasa Sambangi Sambas

Meresmikan Pasar Rakyat dan Gerattak Sabok


SAMBAS – Pemkab Sambas akan membangun pasar rakyat di Desa Kartiasa, Sambas. Untuk pemantapan rencana tersebut, Asisten II Setda Pemkab Sambas Chifni B dan Kepala Dinas Koperasi, UMKM, Perindustrian, dan Perdagangan (Diskumindag) Kabupaten Sambas, Uray Tajuddin, baru-baru ini meninjau lokasi pembangunan pasar rakyat dan Gerattak Sabok. Kedua fasilitas umum tersebut rencananya akan diresmikan dan dilakukan peletakan batu pertama oleh Menko Perekonomian Hatta Rajasa, 14 Juni mendatang di Sambas. Chifni menjelaskan, rencananya pernikahan putri Bupati Sambas Juliati Djuhardi Alwi, akan dihadiri tiga menteri dari Kabinet Indonesia Bersatu II. Mereka adalah Menteri Perekonomian Hatta Rajasa, Menteri Kehutanan Zulkifli Hasan, dan Menteri Pendayagunaan Aparatur Negara dan Repormasi Birokrasi (PAN dan RB) Azwar Abubakar. “Dalam waktu tersebut, dijadwalkan Menteri Ekonomi akan meletakan


TINJAU LOKASI: Asisten II Setda Pemkab Sambas Chifni Burhanuddin dan Kadiskumindag Kabupaten Sambas Uray Tajuddin, meninjau lokasi pembangunan pasar rakyat dan Gerattak Sabok, kemarin.

batu pertama pembangunan pasar rakyat dan Gerattak Sabok, serta pembangunan Tugu Tenun di komplek perkantoran Sambas, “ ungkap

Chinfi, ditemui sejumlah media usai meninjau lokasi. Dalam acara tersebut, menurut dia, juga akan dilangsungkan penandatangan nota

kesepahaman (MoU) tentang Reformasi Birokrasi oleh Menteri PAN dan RB. Penandatanganan tersebut, ditambahkan Chifni, lantaran Kabupaten

Sambas merupakan salah satu daerah percontohan reformasi birokrasi di Indonesia. “Kami berharap seluruh rangkaian kegiatan ini dapat terlaksana

dengan baik, sehingga pelaksanaannya juga akan baik, dalam hal ini kita juga berharap dukungan dari masyarakat,” ungkapnya.

Di tempat yang sama, Uray Tajuddin, kepala Diskumindag Kabupaten Sambas, menjelaskan tentang pembangunan pasar rakyat. Dikatakannya, konsep pembangunan pasar rakyat yang berlokasi di Desa Kartiasa tersebut, memiliki panjang lokasi pembangunan pasar sekitar 200 meter dan lebar 45 meter. Di atas lahan tersebut, dijelaskan dia, akan berdiri 45 kios, 30 los, 4 kamar daging, sedangkan sisanya untuk tempat parkir dan bersantai bagi pengunjung pasar rakyat. Selain peresmian pasar rakyat, agenda lainnya, menurut dia, adalah peresmian Tugu Kain Tenun yang merupakan program instansinya. “Untuk pembangunan Tugu Kain Tenun berlokasi di simpang tiga menuju Kantor Bupati Sambas. Rencananya peletakan batu pertama dan peresmian akan di lakukan Ibu Okke Hatta Rajasa, ketua Cita Tenun Indonesia (CTI). Semoga dengan dibangunnya Tugu Tenun ini, akan memotivasi penenun Sambas meningkatkan aktivitas, kreasi, dan pengembangan modelmodel kain tenun Kabupaten Sambas,” harap Tajuddin didampingi Slamet, sekretaris Dinas PU Bina Marga Kabupaten Sambas, saat ditemui di lokasi pembangunan Gerratak Sabok. (har)


Ricky; Siswa dengan Nilai Tertinggi se-Kabupaten Sambas

Keterbatasan Ekonomi Mengancam Cita-citanya

Untuk bidang g SMK, Ricky y menjadi siswa terbaik dari seluruh siswa SMK negeri da an swasta di Kabupaten Sambas. Be erdasarkan n nilai ujian nasional dan ujian sek kolah, dia peraih nilai tertinggi se-Kabupaten untuk biidang SMK. Namun kini langkahny ya terhen nti. Kondisi perekonomian orangtua anya membuat impian melanjutkan n ke perguruan tinggi terhenti. HARI KURN NIATHAM MA, Sambas SIANG itu cuaca panas. Kami berteduh di sebuah warung kecil di Jalan Raya Lumbang. Warung tempat berjualan minuman ringan. Tepatnya di RT 11 RW 6 Jalan Lumbang Dusun Lumbang Sari Desa Pendawan, Sambas. Di situlah Ricky, siswa SMKN 1 Sambas menetap bersama kedua ayahnya, Chai Mui On (56) dan Lilianti (39), serta ketiga saudaranya. Remaja kelahiran 10 November 1995 ini namanya tenar karena prestasinya. Dari seluruh peserta ujian nasional (Unas) untuk SMK, Ricky menjadi yang terbaik dari yang

terbaik. Di sekolahnya, SMKN 1 Sambas, dari 190 siswa peserta Unas, Ricky adalah yang terbaik, dengan perolehan nilai yang sangat baik. Nilai mata pelajaran yang diunaskan seperti Bahasa Indonesia ditorehkannya dengan angka 9,20. Kemudian Bahasa Inggris, 9,20; Matematika, 10; Nilai Kompetensi Akutansi, 9,33. Dari total nilai yang dikumpulkannya, untuk nilai ujian nasional dia mendapat 37,73, dengan rata rata nilai akhir (NA) 9,3. Dia pun ditahbiskan sebagai siswa dengan peraiahan nilai unas tertinggi se-Kabupaten Sambas. Di atas kertas, tentu hal ini membuat bangga dirinya dan kedua orangtuanya, bahkan pihak sekolah. Bahkan Ricky bercita-cita ingin melanjutkan kuliah ke luar negeri, Australia. Namun apa boleh buat, keinginannya tak seindah ke-

nyataan. Keterbatasan ekonomi mematahkan langkahnya untuk mengenyam pendidikan tinggi ke negeri kangguru tersebut, tanpa mematikan motivasinya. Bahkan ekonomi keluarga membuat Ricky tak mendaftar ke satu pun perguruan tinggi negeri. Itu lantasan khawatir jika lulus, tak ada biaya buat melanjutkan belajar. Chai Chon Nen, begitu biasa ia dipanggil, bercita-cita menja-

di seorang ekonom. Dari citacitanya tersebut, dia berharap masih ada secercah harapan untuk dapat melanjutkan belajar hingga ke bangku kuliah. Sementara itu, Chai Mui On (56) dan Lilianti (39), kedua orang tuanya, mengaku berat rasanya ingin melanjutkan sekolah buah hatinya tersebut ke tahapan perguruan tinggi. Ini lantaran mengingat adikadiknya juga masih sekolah.

“Kalau soal keinginan, saya tahu anak saya ini kuat melanjutkan ke perguruan tinggi, namun kondisi ekonomi kami seperti ini,” kata mereka. Selaku orang tua, mereka berharap ada bantuan dari Pemkab Sambas, seperti beasiwa ke perguruan tinggi. Hal sama menjadi harapan, tokoh pemuda Tionghoa Sambas, Yakob Pujana. Mendampingi Ricky dan kedua


BERSAMA KELUARGA: Ricky diapit kedua orang tuanya, saat ditemui koran ini di kediamannya di Jalan Raya Lubuk Lagak, Sambas, kemarin. Keinginannya untuk melanjutkan pendidikan ke perguruan tinggi terganjal kemampuan ekonomi keluarga.






orangtuanya, dia berharap bagaimana Bupati selaku kepala daerah dan Pemda Sambas dapat memberikan perhatian lebih kepada siswasiswa berprestasi yang orang tuanya tidak mampu. Sayang sekali gara-gara keterbatasan ekonomi, siswa tidak dapat melanjutkan ke jenjang yang lebih tinggi, padahal siswa ini berprestasi. Semoga ada perhatian Bupati Sambas seperti adanya beasiswa,” harapnya. Apalagi saat ini, diingatkan dia, bagaimana Pemkab Sambas gencar untuk terus meningkatkan IPM Sambas, di mana salah satunya adalah perhatian lebih pada bidang pendidikan. Sementara itu, kepala SMKN 1 Sambas, Robiman, memaparkan bagaimana dalam kesehariannya, siswanya yang satu ini baik, aktif, dan selalu memperlihatkan sikap baik kepada guru. Bahkan, dia menambahkan, Ricky pun dicalonkan mereka untuk mengikuti Lomba Keterampilan Siswa (LKS) tingkat Provinsi Bidang Akutansi. Namun dia menyayangkan lantaran perhelatan tersebut diundur hingga Oktober mendatang, sehingga terpaksa keikutsertaan Ricky dibatalkan karena sudah bukan lagi siswa terdaftar di SMK. Sewaktu kelulusan sekolah, kata Robiman, sekolah juga memberikan reward dan piagam atas prestasinya. Harapan mereka agar prestasi yang dicapai siswanya tersebut dapat dilanjutkan ke jenjang pendidikan yang lebih tinggi. Ia mengatakan bahwa Ricky

yang diasuh oleh wali kelasnya, Uray Huzaifah, selama ini menjadi siswa yang tak pernah mengeluh, apalagi menyangkut kondisi perekonomian keluarganya. Namun terlepas dari itu semua, ia berharap agar Pemda bisa mempertimbangkan prestasi siswa bersangkutan, untuk mungkin memperoleh beasiswa ke perguruan tinggi. . Sekadar informasi, untuk tahun ini, dari 20 besar nilai tertinggi tingkat SMK negeri/swasta se-Kabupaten Sambas Tahun Anggaran (TA) 2012/2013, siswa SMKN 1 Sambas mendominasi peraihan nilai, mulai dari ranking I hingga ranking 16, dari 20 besar mereka merupakan siswa SMKN 1 Sambas. Di mana, ternyata tujuh di antaranya merupakan siswa SMKN 1 Sambas yang berhasil meraih nilai Matematika dengan angka 10,00. Hal ini pun dibenarkan kepala Dinas (Kadis) Pendidikan Kabupaten Sambas, Jusmadi. Dia mengaku bangga atas prestasi Ricky. Dia menambahkan bahwa dinas yang dipimpinnya berencana menggelar malam penganugerahan atas prestasi siswa mulai SMA hingga SD. “Akan tetapi reward ini sebatas pemberian uang tunai dan belum ada pemberian beasiswa misalkan ke perguruan tinggi,” katanya. Jikapun ada, kata dia, itupun berasal dari program Kemendikbud yang didapat dari usulan, dengan memperlihatkan nilai siswa sejak di semester awal hingga terakhir sewaktu di SMA/SMK, seperti beasiswa bidik misi. (*)




Pontianak Post

Kamis 13 Juni 2013

IINFO BERLANGGANAN H Hubungi Kantor Biro Sanggau J Jl Jenderal Sudirman No 4

Telp. 0564.21323 T

DIARAK: Lambok-Yusri saat diarak keliling Kota Sanggau sebelum mendaftar di KPU Sanggau, Rabu (12/6). SUGENG/PONTIANAKPOST

Lambok-Yusri Daftar ke KPU

SANGGAU--Delapan koalisi Partai Golongan Karya (Golkar) Kabupaten Sanggau akhirnya resmi mengusung pasangan Bakal Calon (Balon) Bupati dan Wakil Bupati, Lambok SiahaanGusti Yusri untuk maju dalam Pemilu Kada Sanggau 2013. Rabu (12/6) kemarin pasangan yang menyebut dirinya LARIS (Lambok-Gusti Yusri) juga mendeklarasikan diri di Kantor DPD Partai Golkar Sanggau. Pasangan LARIS mendeklarasikan diri sekitar pukul 11.00 WIB di depan pendukung-

nya. Usai melakukan deklarasi, pasangan LARIS tersebut kemudian diarak keliling kota Sanggau sebelum akhirnya langsung mendaftarkan diri ke KPU Sanggau bertempat di Gedung Pertemuan Umum (GPU) Sanggau sekitar pukul 14.00 WIB dengan dijaga ketat aparat Kepolisian Resor Sanggau. Adapun koalisi partai pengusung pasangan LARIS yakni Partai Golkar, Partai Gerindra, Partai Buruh, Partai Pemuda Indonesia, Partai Peduli Rakyat Nasional, Partai Kedaulatan,





Partai Persatuan Nahdatul Umat Indonesia, dan Partai Matahari Bangsa. Ketua DPD Partai Golkar Sanggau, Fransiskus Ason menyampaikan dukungan masyarakat terhadap pasangan LARIS sangat besar, karena itu harus menjadi semangat tersendiri dalam pertarungan Pemilu Kada 2013. Ketua DPC Gerindra Kabupaten Sanggau, Ahmad Rohansyah menyampaikan bahwa partainya bersepakat untuk bersama-sama berjuang untuk yang terbaik .

Sementara itu, Balon Bupati Sanggau dari koalisi partai Golkar, Lambok Siahaan menyampaikan bahwa pihaknya optimis dengan kekuatan serta tim yang ada saat ini. Harapannya tentu saja semua tim bekerja dengan baik dan sesuai petunjuk yang telah diberikan. “Membangun Sanggau dengan kebersamaan dan kejujuran. Diatas kebersamaan tanpa melihat suku etnis warna kulit agama. Siapapun punya kesempatan. Dalam arti kejujuran, saya datang dengan hati

yang tulus bertarung di pilkada sanggau, saya akan membangun tanah anak istri saya, saya harapkan dukungan bapakbapak sekaian. Bisa kita mulai dengan hal baik sekarang,� katanya. Balon Wabup Sanggau, Gusti Yusri juga menyampaikan rasa optimisnya melihat peluang dan kesempatan yang ada di depan mata. Bersama pasangannya, Lambok Siahaan, ia akan bekerja maksimal dalam melaksanakan pembangunan yang adil dan merata. (sgg)

Pontianak Post

Kamis 13 Juni 2013

Bangga Toleransi Masyarakat KOMANDAN Kodim 1205 Sintang akan segera berganti. Dandim 1205 Sintang, Letkol Inf. Parlindungan Hutagalung akan melaksanakan serah terima jabatan (Sertijab) pada Selasa (18/6) di Makorem 121/Abw Sintang. Penggantinya Letkol Inf. Anggit Exton Yustiawan. Dia sebelumnya menjabat sebagai Dansecaba/Gumil Juang Rindam XII/TPR di Singkawang. Pelaksanaan sertijab Dandim 1205 Sintang ternyata bertepatan dengan hari kelahiran Dandim 1205 Sintang, Letkol Inf. Parlindungan Hutagalung. “Saya sangat senang sekali sertijab Dandim 1205 Sintang bertepatan dengan hari kelahiran saya yaitu pada Selasa, 18 Juni. Saya lahir pada tanggal 18 Juni 1972. Pada pelaksanaan sertijab nanti, usia saya genap 41 tahun,” ungkap Parlindungan seraya tertawa. Dia mengatakan waktu pelaksanaan sertijab yang bertepatan dengan hari ulang tahun dirinya bukan atas permintaannya tapi ditentukan oleh Danrem 121/Abw. “Ini hanya kebetulan saja, karena Danrem juga tidak tahu hari Selasa nanti merupakan hari ulang tahun saya,” ujarnya. Parlindungan mengungkapkan ia akan menjabat sebagai Pabandya-3/Jianstra Spaban I/Jakrenstra Srenad di Mabes TNI AD. Bapak tiga anak kelahiran Jambi ini mengaku sangat senang bertugas di Sintang selama 1,6 tahun. (tra)



BPP Sintang Bangun 8 Jalan di Perbatasan SINTANG – Badan Pengelola Perbatasan (BPP) isolasi. Pembangunan jalan tahun ini dipusatkan pada Kabupaten Sintang tahun ini akan membangun Lokpri I. Rencananya tahun depan akan dilaksanakan delapan ruas jalan daerah perbatasan di Ketun- di Ketungau Tengah. gau Hulu. Demikian disampaikan Pembangunan jalan di perKepala BPP Kabupaten Sintang, Abbatasan ini, lanjutnya sebagai dul Rani. Ia mengatakan delapan upaya pemerintah pusat untuk ruas jalan yang akan dibangun ini membangun daerah perbatasan diantaranya dari Simpang Senanyang selama ini tertinggal daing ke Muakan Petinggi, Simpang jalan-jalan yang dibangun lam hal infrastruktur. Daerah Enteli ke Dusun Enteli, Sungai tersebut untuk membuka perbatasan yang mengalami Pisau ke Desa Sebadak, Simpang ketertinggalan pembangunan dusun-dusun yang Sejawak ke Sebetung Palu, Simpang infrastruktur jalan akan mulai terisolasi” Lubuk Tapang ke Lubuk Tapang, mengejar ketertinggalannya. Sungai Tanju ke Nanga Bayan, dari Berbagai program pembanguAbdul Rani Sebadak ke Nyelawai, Rasau ke Jasa nan di wilayah perbatasan sudah Kepala BPP dan membangun jembatan ganmulai digenjot tahun ini dengan tung di Desa Nanga Bayan. harapan lima sampai 10 tahun “Jalan-jalan yang dibangun ini menghubungkan ke depan, daerah perbatasan yang merupakan wajah antar dusun dan antar desa. Total panjang jalan 85,3 negara ini akan menampilkan kecantikannya. km dengan panjang jembatan 40 meter,” ungkapnya. “Di tahun ini, untuk mendandani daerah perbatasan Abdul Rani mengungkapkan jalan-jalan yang diban- di Ketungau Hulu dan Ketungau Tengah, Kabupaten gun tersebut untuk membuka dusun-dusun yang ter- Sintang, Pemerintah Pusat melalui Badan Pengelola





Perbatasan (BPP) Sintang mengucurkan dana sebesar Rp27 miliar,” ungkapnya. Dana tersebut hanya untuk membangun infrastruktur jalan dari desa ke desa yang ada di perbatasan sehingga jalannya bukan lagi sekedar jalan tikus atau jalan bebek yang berlumpur. Tapi sudah menjadi jalan manusia yang layak untuk dilalui manusia. “Jalan yang akan dibangun tersebut rata-rata berjarak antara 8-12 km dari titik perbatasan. Sekarang paket-paket pembangunan tersebut masih dalam proses tender,” jelasnya. Dia menegaskan jalan yang akan dibangun merupakan jalan yang non status. Artinya bukan jalan nasional, jalan provinsi atau jalan kabupaten tetapi jalan-jalan tikus atau jalan antar desa dan jalan kebun. “Dengan adanya jalan antar desa di perbatasan diharapkan dapat mempermudah mobilitas masyarakat,” harapnya. Abdul Rani mengatakan setelah pembangunan infrastruktur jalan dilaksanakan barulah dilaksanakan program-program pembangunan infrastruktur ekonomi sehingga potensi-potensi di perbatasan dapat dikembangkan. (tra)


24 Pelajar Ingat Masa Depan



Waspada Teroris AKSI terorisme yang makin marak terjadi di berbagai belahan negeri akhir-akhir ini menyektak khalayak ramai. Sontak teror itu menyimbolkan bahwa aksi nekat pelaku teror bisa terjadi kapan dan dimana saja. Untuk menghindari hal ini, semua pihak perlu meningkatkan kewaspadaan, termasuk masyarakat Sekadau. Himbauan datang dari berbagai pihak. “Terus terang kita cukup terkejut mendengar berita ledakan bom yang meledak bahkan di kantor polisi sekalipun (bom Poso),” ujar Zainal, aktivis Muslim Forever Sewa, kemarin. Ledakan bom tersebut, menurut Zainal, merupakan bukti bahwa ancaman teroris sangat nyata, termasuk di Kalbar. Apalagi beberapa waktu lalu pernah terjadi penangkapan teroris di Kalbar, tepatnya di Kabupaten Melawi. “Kita selaku warga tentu harus meningkatkan kewaspadaan. Jika mendapati orang yang mencurigakan, segera laporkan ke pihak berwajib,” tandas Zainal. (bny)

Kamis 13 Juni 2013

Dikeluhkan Listrik Sering Padam


WAKIL Bupati Sekadau, Rupinus, menghimbau kalangan pelajar sebagai generasi penerus bangsa untuk tidak menyia-nyiakan masa mudanya. Menjadi keprihatinan publik kala kaum pelajar terjerat kasus narkoba, asusila, bahkan menjadi korban kecelakaan jalan raya. “Adik-adik pelajar mesti berhati-hati dalam bergaul dan bertindak. Karena, apa yang dilakukan saat ini pasti berdampak buat masa depan kelak,” himbau Rupinus. Ia mencontohkan, jika saat ini pelajar sungguh-sungguh menunaikan tugasnya sebagai seorang anak didik, maka hamRupinus pir dipastikan masa depannya cerah. Sebaliknya, jika saat ini kaum muda menyia-nyiakan masa keemasannya dengan tindakan yang tidak baik, maka hal itu akan berdampak negative bagi kehidupan di masa mendatang. “Jauhilah yang namanya narkoba, pergaulan bebas, atau kebut-kebutan di jalan raya. Semua itu tidak ada gunanya, hanya kesenangan sesaat. Nanti dihari tua baru merasakan akibatnya,” pesan Wabup. Peran orangtua, lanjut Wabup, sangat penting dalam memberikan bimbingan kepada anaknya. Orangtua tidak boleh terlalu memanjakan anaknya. Dikhawatirkan, saking sayangnya apapun yang diminta anak akan dipenuhi, termasuk hal yang kurang baik sekalipun. “Anak jangan terlalu dimanja. Yang wajar-wajar saja menyayangi anak. Hal-hal yang tidak baik untuk mereka jangan dituruti, nanti kalau ada apa-apa orangtua juga yang susah,” tandas Wabup. (bny)

Pontianak Post

Biasanya listrik mati pas mau masuk waktu Maghrib. Ini tentu sangat mengganggu aktivitas kita. Padahal disaat Maghrib itu kita membutuhkan penerangan lampu agar bisa lancar menunaikan Salat Maghrib.


WISATA ALAM: Potensi pariwisata Kabupaten Sekadau cukup banyak kalau dikembangkan. Salah satu diantaranya adalah Air Terjun Batu Sumpit. Promosi dan insfrastruktur perlu disiapkan pemerintah demi memudahkan warga mengunjungi lokasi wisata alam tersebut.

Giliran BPD Belitang Hilir Dilantik SEKADAU - Wakil Bupati Sekadau, Rupinus, kembali melantik 73 orang anggota Badan Permusyawaratan Desa se-Kecamatan Belitang Hilir, Selasa (11/6), kemarin. Turut hadir mendampingi Wabup, sejumlah kepala SKPD, Muspika Belitang Hilir, serta para Kepala Desa. Camat Belitang Hiit, Paulus Misi, menyatakan, 73 anggota BPD yang dilantik berasal dari 9 Desa yakni Sei Ayak I, Sei Ayak II, Tapang Pulau, Merbang, Empajak, Menawai Tekam, Semadu, Kumpang Bis dan Desa Entabuk. “Kami berterimakasih atas kehadiran Pak Wakil Bupati yang bersedia secara langsung melantik anggota BPD se-Kecamatan Belitang Hilir. Momen ini sudah ditunggu-tunggu para anggota BPD,” ujar Misi. Dalam amanatnya saat melantik anggota BPD, Wakil Bupati Sekadau, Rupinus,

meminta anggota BPD agar melaksanakan tugas dengan sungguh-sungguh dan penuh tanggung jawab sesuai dengan fungsi dan tugas berdasarkan peraturan perundang-undangan yang berlaku. “Saudara telah diangkat sumpah dihadapan Tuhan, maka dari itu jalankan tugas dengan sungguh-sungguh dan penuh tanggungjawab,” pesan Rupinus. Rupinus mengingatkan, BPD merupakan mitra kepala desa dalam menjalankan roda pemerintahan. Untuk itu, BPD dan Kades mesti menjalin komunikasi yang harmonis serta bersinergi dengan tetap melakukan koordinasi serta bekerjasama dalam penyelenggaraan pemerintahan. “BPD ini ibarat DPR-nya Pemerintah. Maka dari itu, BPD dan Kades harus kompak supaya pembangunan berjalan lancar,” ingatnya. (bny/Humas)


S E K A D AU - I m p i a n masyarakat Sekadau mendapatkan layanan listrik yang prima dari PT PLN, tidak selamanya bisa terwujud. Beberapa pekan terakhir, warga sering mengalami byar pet (hidup-mati) aliran listrik. Yang paling parah terjadi di sekitaran kawasan Jalan Sekadau-Sintang dan sekitarnya. Hampir tiap hari warga harus merasakan hidup tanpa listrik. “Sudah hampir sebulan ini listrik di daerah kami sering hidup mati,” keluh Syahrul Maulana, warga Jalan Sekadau-Sintang KM 7, kemarin. Pria yang akrab disapa Arul itu menceritakan, hampir set-

iap hari selalu ada mati aliran listrik. Celakanya lagi, listrik sering mati diwaktu-waktu dimana warga sangat membutuhkan aliran listrik. “Biasanya listrik mati pas mau masuk waktu Maghrib. Ini tentu sangat mengganggu aktivitas kita. Padahal disaat maghrib itu kita membutuhkan penerangan lampu agar bisa lancar menunaikan salat maghrib,” ucap Arul. Arul mengaku heran atas mati hidupnya aliran listrik PLN ini. Apalagi waktu mati listrik tersebut seperti dijadwal, yakni saat beranjak malam. “Apa penyebabnya, kenapa seperti terjadwal,” tanya Arul. Terhadap berbagai pertan-

yaan itu, Arul berharap pihak PLN tidak tinggal diam. Artinya, PLN harus menjelaskan kepada masyarakat apa yang menyebab sering terjadi mati lampu itu. “Harus ada keterbukaan dari PLN. Kalau memang daya tidak mampu, harus jelaskan kepada masyarakat. Kalau memang ada kerusakan, juga harus diberitahukan, agar masyarakat bisa mempersiapkan diri mencari penerangan alternative,” pinta Arul. Pria berperawakan ceking ini juga berharap PLN bisa mengatasi kondisi tersebut. “Kedepan kita harapkan harus ada perbaikan. Jangan ada pembiaran dari pihak PLN,” tukas Arul. (bny)


Tomas Dukung Relokasi Pasar SEKADAU - Rencana relokasi pasar emperan ke Pasar Flamboyan II oleh Pemkab Sekadau lewat Disperindagkop dan UKM mendapat sambutan baik dari sejumlah tokoh masyarakat. Salah satu tokoh masyarakat Sekadau, Paulus Lion, menyatakan dukungannya terhadap rencana Pemkab itu. Namun, Lion meminta proses pemindahan lokasi harus merata tanpa pandang bulu. "Kita mendukung rencana relokasi pasar emperan yang berada di tepian sungai Kapuas. Tapi, kita harapkan mereka juga dapat tempat pasti,” ungkap Paulus Lion, (11/6) kemarin. Lion panggilan akrabnya, mengatakan relokasi pasar merupakan langkah yang tepat demi keindahan dan ke-

nyamanan kota sekadau. Karena itu ia menyarankan agar instansi terkait melakukan pendekatan persuasif kepada pedagang guna memberikan penjelasan maksud dan tujuan relokasi agar tidak menjadi masalah dikemudian hari. Usai direlokasi, kawasan pasar lama akan digurus, termasuk bangunan-bangunan milik pedagang yang tidak sesuai dengan aturan. Penggusuran dikhawatirkan menimbulkan gejolak. "Maka dari itu, perlu diberikan pemahaman dan pendekatan persuasive kepada pedagang bahwa bangunannya menyalahi aturan sehingga harus digusur kemudian hari. Takutnya pedagang kaget dan bereaksi. ," sarannya. Tokoh masyarakat Sekadau

Hilir, H. Bahtiar, juga menyatakan dukungan rencana relokasi pasar. "Kita mendukung rencana ini yang bermasud baik. Yang terpenting Pemkab memberikan pengertian kepada pedangang emperan supaya tidak terjadi masalah atau ada keributan ketika relokasi nanti. Namun saya yakin ditempat kita ini aman karena masyarakat terutama pedagang yang cinta damai," katanya ditanyai disela-sela sosialisasi relokasi pasar, kemarin. Pensiunan PNS ini yakin kalau ada pendekatan persuasif dari Pemkab lewat intansi terkait kepada para pedagang emperan, maka rencana bisa diterima masyarakat terutama pedagang dengan lapang dada. (bny)






Pontianak Post

Kamis 13 Juni 2013


Nihil Caleg Ganda


KOMISI Pemilihan Umum (KPU) Kabupaten Ketapang tidak menemukan adanya calon legislatif (caleg) yang diusung oleh dua atau lebih partai politik (parpol). Hal ini dikemukakan ketua KPU Kabupaten Ketapang, Juardhani, kemarin, usai pertemuan dengan para pimpinan atau penghubung partai politik. “Kami memastikan tidak ditemukan adanya caleg ganda yang diusung oleh 12 parpol peserta Pemilu tahun 2014. Baik yang dicalonkan oleh lebih dari satu parpol maupun menjadi caleg di daerah lain,” katanya. Ia mengatakan kepastian tidak adanya caleg ganda ini, setelah dilakukan sinkronisasi dengan KPU Provinsi Kalbar serta KPU dari kabupaten/kota lainnya di Kalbar, yang dilakukan beberapa waktu lalu di Pontianak. Dia menambahkan, sebelum mengumumkan daftar Kami calon sementara (DCS), KPU sendiri telah meminta paraf atau memastikan persetujuan terhadap DCS dari tidak parpol peserta Pemilu. “Berdasarkan hasil sinkroditemukan nisasi yang dilakukan di Ponadanya caleg tianak, tidak terdapat satupun calon anggota DPRD Kabupaten ganda yang yang dicalonkan lebih diusung oleh 12 Ketapang dari satu parpol atau menjadi parpol peserta calon di daerah lain, termasuk calon di Provinsi dan bakal Pemilu tahun calon DPD. 2014. Baik yang Dalam sinkronisasi, telah dilakukan penelusuran bakal dicalonkan calon, (di mana) memang banoleh lebih dari yak terdapat nama yang hampir satu parpol sama dengan nama calon di daerah lain,” ungkap Juardmaupun hani. menjadi caleg Pria murah senyum ini tak menampik adanya kesamaan nama, di daerah lain namun setelah dikroscek meruJuardhani pakan orang yang berbeda. Hal ini, menurut dia, berdasarkan pada nomor induk kependudukan (NIK) dan identitas yang bersangkutan. Dikatakannya, berdasarkan tahapan Pemilu bahwa pada pada 13 Juni, hari ini, daftar calon sementara (DCS) akan diumumkan secara terbuka ke publik, baik melalui media cetak maupun elektronik, agar masyarakat mengetahui siapa saja caleg yang diusung oleh parpol berdasarkan daerah pemilihan. “Pada masa perbaikan kemarin, jumlah caleg memang bertambah walaupun tidak signifikan, dari 503 menjadi 505. Ada beberapa caleg yang diganti karena syarat yang kurang. Sebelum diumumkan, KPU Kabupaten Ketapang akan menggelar rapat pleno mengenai penetapan DCS ini,” paparnya. (afi)



Nelayan Minta Penambahan Kuota Solar SPDN Dijatahi 40 Ribu Liter Perbulan


TERBALIK: Truk tangki industri yang terbalik saat melintas di Jalan Pelang, Matan Hilir Selatan. Saat ini kondisi ruas jalan di sana sudah mulai memrihatinkan.

Ketapang Akan Ramaikan Potensi Daerah

Bidik Pertasi Kencana di Kota Pontianak KETAPANG – Selain pada Ketapang Expo yang rencananya akan dilaksanakan pada Juni ini, maka potensi yang dimiliki Kabupaten Ketapang kembali akan dipromosikan pada kegiatan Pertasi Kencana di Kota Pontianak, 1 – 4 Juli mendatang. Kepastian Ketapang meramaikan kegiatan Peringatan Hari Krida Pertanian, Hari Koperasi, Hari Keluarga Nasional, Hari Lingkungan Hidup, Hari Pangan Sedunia, dan Hari Menanam Pohon Indonesia tahun 2013 (Pertasi Kencana), terungkap dalam rapat yang berlangsung di Kantor Bupati Ketapang, kemarin (12/6) pagi. Dalam rapat yang dipimpin asisten I Setda Pemkab Ketapang, Gurdani Achmad tersebut, terungkap bahwa kegiatan Pertasi Kencana merupakan momentum yang sangat tepat dan strategis, untuk mendukung pelaksanaan pem-

bangunan perekonomian di Kalbar. Karena itu, Gurdani berpesan, demi mematangkan keikutsertaan Ketapang, diminta agar SKPD yang ambil bagian, saling bersinergi antara satu bidang dengan bidang lainnya, dalam rangka mencapai hasil yang maksimal. Dalam pertemuan tersebut dibahas sejumlah agenda dalam kegiatan Pertasi Kencana, di antaranya meliputi kegiatan, upacara pembukaan dan penutupan, dialog interaktif Gubernur Kalimantan Barat dengan petani berprestasi, pameran pembangunan, gelar teknologi/festival karya penyuluh pertanian, penanaman pohon, seminar kebijakan pembangunan pertanian, koperasi, keluarga berencana, dan lingkungan hidup. Demikian juga pembahasan bazar meliputi lomba menu beragam, bergizi, dan berimbang (menu 3B) berbasis pangan lokal Kalbar yang diikuti oleh TP PKK. Karena itu, Gurdani meminta agar daftar untuk calon peserta


SKPD yang akan ikut serta di Kota Pontianak. Daftar tersebut, menurutnya, disampaikan ke Bagian Perekonomian Setda Pemkab Ketapang, untuk diteruskan ke panitia. Dia juga meminta data peserta yang berprestasi masing-masing SKPD sebanyak dua orang. “Saya harap instansi terkait menyiapkan segala perlengkapan untuk mengikuti kegiatan dan selalu berkoordinasi dengan dinas instansi,” kata Gurdani. Diterangkannya, dengan persiapan yang matang, diharapkan agar pada saat pelaksanaan, kontingen Ketapang tidak menemukan kendala lagi. Sementara itu, kepala Bagian (Kabag) Perekonomian Setda Pemkab Ketapang, Nurwanti, menuturkan bahwa kegiatan yang diikuti mereka tersebut merupakan salah satu perwujudan sinergitas atau keterpaduan antar berbagai bidang kegiatan, dalam melaksanakan program atau kebijakan, dalam rangka membangun perekonomian. (ads/afi)

KENDAWANGAN – Keberadaan Solar Paket Dealer Nelayan (SPDN) di Kecamatan Kendawangan selama kurun waktu dua tahun ini, sangat membantu nelayan dalam memperoleh bahan bakar jenis solar. Hal ini sebagai penunjang dalam menjalankan aktivitas para nelayan, untuk mencari ikan. Terlebih pekerjaan sebagai nelayan tersebut merupakan mata pencaharian sehari-hari. Akan tetapi, disayangkan jatah solar yang didapatkan nelayan begitu terbatas. “Jatah yang didapat hanya 50 liter saja perminggu atau sekali datang mobil tangki dari Ketapang. Sementara untuk kebutuhanya untuk nelayan pukat seperti saya mencapai 25 liter permalam atau sekali melaut,” kata seorang nelayan asal Desa Mekar Utama, Kendawangan, Syahrial, kemarin. Menurutnya, idealnya kalau setiapharinya melaut, dia membutuhkan antara 300 – 350 liter perminggu atau persekali mobil tangki solar datang. Dengan kondisi seperti ini, dia bersama rekan-rakan nelayan lainnya berharap kepada Pertamina, untuk memberikan penambahan kuota BBM jenis solar untuk SPDN Kendawangan. “Kalau harus membeli solar di luar SPDN, harganya jauh lebih mahal,” lanjutnya. Keterbatasan jatah nelayan dalam memperoleh BBM bersubsidi dari pemerintah tersebut, juga diakui oleh pengelola SPDN Kendawangan, Hendri Gunawan. Dia mengatakan, dibatasinya jatah nelayan tersebut lantaran kuota pengiriman dari Jobber Ketapang juga terbatas. “SPDN Kendawangan hanya mendapat 5 tangki/DO perbulanya. Artinya hanya 40 ribu liter saja perbulanya atau 10 ribu liter perminggu,” jelas Hendri. Sementara nelayan yang telah mendapat izin rekomendasi dari UPT Dinas Perikanan dan Kelautan Kendawangan mencapai 350 nelayan yang dapat melakukan pembelian

solar dari SPDN Kendawangan. “Kami terpaksa harus membagi jatah untuk nelayan sesuai dengan stok yang ada. Agar semua bisa mendapat jatah,” kata Hendri. Dia juga menjelaskan, hal ini dijamin tidak akan terjadi kalau saja terjadi penambahan kuota Pertamina sebesar 10 DO/tangki atau 80 ribu liter perbulanya, untuk SPDN Kendawangan. Dengan demikian diharapkan agar jatah nelayan dapat terpenuhi semua, di mana para nelayan tentu dapat melaksanakan aktivitasnya melaut, tanpa harus takut kekurangan BBM jenis solar. Usulan penambahan kuota untuk SPDN Kendawangan juga didukung banyak pihak. Salah satunya Nano Romansyah, tokoh pemuda Desa Kramatjaya. Dia mengatakan, Pertamina melalui Dinas Perikanan dan Kelautan, perlu menambah kuota BBM jenis solar untuk SPDN Kendawangan. “Selama ini kebutuhan akan solar jauh dari mencukupi,” ujarnya. Bahkan dia menilai masih banyak nelayan, khusunya dari Desa Keramatjaya, Kendawangan Kanan, dan Seriam, yang belum sepenuhnya dapat menikmati BBM bersubsidi dari pemerintah. Untuk itu, Nano berharap, perlu adanya tambahan kuota, agar masyarakat nelayan dapat menikmati BBM bersubsidi. Dia juga mengatakan, pengelolaan SPDN Kendawangan selama ini cukup maksimal dalam pelayanan terhadap nelayan. Terbukti, menurut dia, dengan keterbatasan stok, sehingga mampu menyalurkan solar kepada hampir seluruh nelayan, khususnya nelayan lokal dari Kendawangan. Meskipun konsekwensinya mereka harus berbagi jatah dengan sesama nelayan. Hal senada juga disampaikan Hasman dari Forum Pemuda Peduli Kendawangan (FP2K). Dia akan mendukung terhadap penambahan kuota BBM jenis solar untuk SPDN Kendawangan. “Karena ini menyangkut hajat hidup orang banyak. Tentunya harus didukung pula dengan data nelayan yang valid dan up to date dari instansi yang berwenang,” tutur Hasman. (afi)








Buku Kurikulum Murah KEMENTERIAN Pendidikan dan Kebudayaan sudah bisa bernafas lega karena Kementerian Keuangan telah mencairkan Daftar Isian Perencanaan Anggaran (DIPA) untuk Kurikulum 2013 senilai Rp 829 miliar. Dengan demikian, penandatanganan kontrakpun telah dilakukan dengan pemenang tender pencetakan buku Kurikulum baru tersebut. “Sudah kontrak dengan perusahaan percetakan pemenang tender, dan semua sudah ada jadwal serta prosedurnya,” kata Mendikbud M Nuh, Rabu (12/6) di Jakarta. Dia memastikan tanggal 15 Juli saat tahun ajaran 2013/2014 dimulai, buku Kurikulum baru tersebut sudah ada di sekolah. Saat ini pengaadaan buku tersebut dilakukan oleh masingmasing direktorat. Untuk menghindari kasus yang terjadi saat pelaksanaan Ujian Nasional (UN), Nuh telah memerintahkan Inspektorat Jendral Kemdikbud untuk melakukan pengawasan secara menyeluruh. Ditegaskannya juga bahwa mekanisme pengadaan buku sudah dilakukan sesuai dengan prosedur yang ada. Menurutnya, pengadaan buku kurikulum tersebut untuk menata politik perbukuan. Bahkan harga buku yang dicetak lebih murah di banding harga di pasaran. Namun bukan berarti proyek ini menguntungkan bagi kementerian.“Sebelum menentukan harga, kita sudah melakukan survei ke penerbit, toko buku, dan sekolah, dan kita pastikan harganya jauh lebih murah. Misalnya buku Matematika kelas X, isinya 392 halaman, harganya hanya Rp 18.700. Buku bahasa Indonesia hanya sepuluh ribu, itu sudah sampai disekolah,” ungkap Nuh. Ditambahkannya, buku tersebut masih bisa direvisi b e rd a s a rk a n kritik dari pembaca dan masyarakat untuk menyempurnakannya. Apabila harus direvisi, maka akan dilakukan pada edisi cetak tahun ajaran berikutnya. (Fat/jpnn)


Pontianak Post


Kamis 13 Juni 2013

Giliran Teluk Melano jadi Pusat Hiburan dan Pameran

Songsong HUT ke-6 Kabupaten Kayong Utara

TELUK BATANG – 26 Juni mendatang, usia Kabupaten Kayong Utara sebagai daerah otonomi baru di Republik Indonesia, genap menginjak enam tahun. Menyongsong usianya yang keenam, Pemkab Kayong Utara akan menggelar berbagai kegiatan untuk menyemarakkannya. Berbeda dengan tahun-tahun sebelumnya, untuk tahun ini pameran dalam rangka memperingati acara tahunan ini, akan dipusatkan di Teluk Melano, Simpang Hilir. “Kegiatan pameran dan hiburan akan dipusatkan di Teluk Melano,” ungkap sekretaris Panitia Peringatan Hari Ulang Tahun (HUT) Kabupaten Kayong Utara ke-6, Nazarudin, ditemui saat ikut mendampingi Bupati Kayong Utara Hildi Hamid, yang membawa rombongan Komandan Pangkalan TNI AL (Danlanal) Pontianak, Kolonel Laut (P) Dwika Tjahya Setiawan, di Teluk Batang, dua hari lalu (11/6). Menurut Nazarudin, terdapat sekitar 40 stan pameran yang akan dipersiapkan, untuk pemerintah daerah atau SKPD, demi menampilkan berbagai hasil dan program pembangunan ke depan. Selain FOTO DARI PUTRASIMPANG.BLOGSPOT.COM itu, jumlah tersebut, menurutnya, ditambah sekiPASAR MELANO: Kawasan Pasar Melano di Simpang Hilir menjadi kawasan perekonomian teramai di Kabupaten tar 50 stan khusus untuk kegiatan usaha kecil dan Kayong Utara. Keramaian Teluk Melano akan semakin bertambah dengan bakal didirikannya stan pameran serta hiburan menengah (UKM). “Puncak acara ditandai dengan kegiatan upacara untuk perayaan HUT kabupaten ini, 26 Juni mendatang. yang akan dilaksanakan di halaman kantor Dinas Pendidikan Kabupaten Kayong Utara pada 26 Juni nanti,” katanya. Sejauh ini, diakui Nazarudin, panitia sudah bekerja secara maksimal dalam melakukan persiapan untuk menyukseskan peringatan HUT ke-6 Kabupaten Kayong Utara. Seperti biasa, ketua Panitia Peringatan HUT dari pemukiman jauh, hanya saja Sementara itu, ketua Badan PerKabupaten Kayong Utara dipimpin langsung oleh ada sedikit keberatan dari pihak musyawaratan Desa (BPD) Riam Sekretaris Daerah (Sekda) Hendri Siswanto. Taman Nasional Gunung Palong Berasap Jaya, Burhan, menyebutkan, Terpisah, pemuka masyarakat Simpang Hilir, Ba(TNGP) yang menyebut pemuki- untuk Riam Berasap Jaya mendapat harudin, menyampaikan ungkapan syukur kepada man warga tersebut masuk sebagai bagian 100 sertifikat. Rianciannya, SUKADANA – Program prona hutan penyangga kawasan,” ujarnya. disebutkan dia, 34 sertifikat untuk Tuhan Yang Maha Esa, karena atas kasih dan pertodan redistribusi di Dusun Pangkalan Menurut Misjan, 34 usulan serti- warga Dusun Pangkalan Tapang, selongan Tuhan pula, Kabupaten Kayong Utara yang Tapang, Riam Berasap Jaya, Sukadana, fikat itu adalah areal pemukiman mentara Dusun Pematang Baros serta tidak beberapa lama lagi segera memasuki gerbang sedikit mengalami hambatan. Seban- masyarakat. Artinya, dijelaskan dia, Dusun Sungai Cina masing-masing usia ke-6. “Saya atas nama pribadi dan masyarakat, yak 34 usulan sertifikat di dusun terse- di atas tanah tersebut telah berdiri mendapat 33 sertifikat. khususnya Simpang Hilir, mengucapkan selamat but dikabarkan belum dapat diproses rumah-rumah masyarakat serta kebun hari ulang tahun ke-6, kepada segenap komponen “Yang bermasalah hanya Pangkarena terkendala status kawasan. milik masyarakat, seperti tanaman kalan Tapang, sedangkan Pemasyarakat Kayong Utara,” ujarnya. Kepala Dusun Pangkalan Tapang, karet dan lainnya. Menurut ketua DPC Partai Bintang Reformasi matang Baros dan Sungai Cina Misjan, ditemui usai menghadiri (PBR) Kabupaten Kayong Utara ini, dalam momen“Dari 34 yang diusulkan itu sebagian tidak ada masalah,” kata Burhan. acara di kantor Desa Riam Berasap sudah memiliki SKT (surat keterangan Burhan juga menyambut baik adanya tum ulang tahun daerah, dia mengajak semua pihak Jaya, kemarin (12/6), membenarkan tanah) dan sebagian lagi belum ada program prona ini. Menurutnya, dengan untuk terus berjuang dan berkarya mengukir sejakabar tersebut. Menurut Misjan, SKT. Dan di Pangkalan Tapang belum adanya program ini, sangat membantu rah, untuk membangun masyarakat yang semakin tanah pemukiman yang diusulkan ada satupun warga yang tanahnya masyarakat, terutama kalangan ekonoberbudaya, berdaya saing, dan sejahtera, dengan warganya dikabarkan masuk sebagai memiliki sertifikat. Maka kami san- mi lemah. “Program prona ini sangat mengandalkan potensi serta kearifan lokal yang hutan penyangga kawasan (HPK). gat menyambut baik adanya pro- bermanfaat sepanjang yang meneridimiliki, disertai kemampuan untuk meraih pelu“Dari pihak Dinas Kehuatanan gram prona ini karena sangat mem- manya adalah benar-benar orang yang ang demi terwujudnya Kayong Utara yang aman, dan Perkebunan sudah tidak ada bantu masyarakat kami,” ujarnya. kurang mampu,” ucapnya. (mik) maju, unggul, berdaya saing, dan sejahtera. (mik) masalah karena letak hutan lindung

Sertifikat Prona Pangkalan Tapang Terhambat

Terkendala Status Kawasan





Pontianak Post

Kamis 13 Juni 2013



Bumi dan Bangunan Jadi Pajak Daerah

BERLANJUT: Kegiatan perbaikan jalan swadaya yang dilakukan warga Masuka masih terus berlanjut. HERI MUSTARI

Diumumkan Hari Ini Sambungan dari halaman 17

tahapan masukan dan tanggapan dari masyarakat berlangsung 14-27 Juni atas DCS yang diumumkan KPU. Tanggapan ataupun masukan mengenai nama-nama yang tercantum dalam DCS, bisa disampaikan secara tertulis disertai identitas lengkap. Jika ada masukan atau tanggapan dari masyarakat, lanjut Ramdan, KPU akan menindaklanjutinya dan meminta klarifikasi kepada Parpol yang bersangkutan (28 Juni- 4 Juli). “Setelah itu partai politik bersangkutan menyampaikan ke KPU secara tertulis (5 - 18 Juli), kemudian akan dilakukan pemberitahuan pengganti DCS (19- 25 Juli).Serta para 26

Juli - 1 Agustus Parpol mengajukan nama calon sebagai pengganti untuk kemudian diverifikasi,” katanya. Ramdan juga mengingatkan jika ada penggantian, nama yang diserahkan Partai politik harus sudah lengkap karena tidak ada perbaikan lagi. “Nama pengganti DCS yang sudah masuk kita verifikasi (2- 8 Agustus), setelah itu KPU baru menyusun dan menetapkan Daftar Calon Tetap (9-22 Agustus) dan akan diumumkan pada 23-25 Agustus,” katanya. Dalam hal penggantian, dikatakan Ramdan, DCS bisa berubah jika ada masukan dari masyarakat terkait tidak terpenuhi syarat administrasi calon yang bersangkutan

serta dikarenakan meninggal dunia. Namun ada pengecualian ketika terjadi pada Calon perempuan, jika mengundurkan diri sehingga 30 persen keterewakilannya dari parpol tidak terpenuhi. Parpol bisa mengajukan pengganti yang juga perempuan dengan ketentuan secara otomatis akan menempati nomor urut dan Dapil calon yang digantinya. “Misalkan ada calon dari perempuan mendapat nomor urut tiga di Dapil Singkawang, penggantinya secara otomatis akan mendapatkan nomor urut dan dapil tersebut, namun secara umum mengenai pengunduran diri dari DCS bisa dilakukan oleh parpol bukan KPU,” kata Ramdan. Sementara itu, sesuai den-

gan Surat Edaran KPU Nomor 229 Tahun 2013 tentang petunjuk teknis pencalonan Anggota Legislatif. Dimana khusus caleg yang saat ini masih duduk di kursi dewan, ataupun menjabat sebagai PNS. Apabila sampai dengan 26 Juli - 1 Agustus tidak menyerahkan surat keputusan pemberhentian atau surat keterangan bahwa surat pemberhentian yang bersangkutan sedang diproses bagi PNS atau surat keterangan Sekwan bahwa pemberhentian yang bersangkutan sebagai anggota dewan tidak diserahkan ke KPU. Maka calon yang bersangkutan tidak memenuhi syarat dan tidak bisa diganti. (fah)

motor berpatahan. Pengendaranya Suyati tewas di tempat, Mila yang diboncengi pun mengalami luka serius. Sedangkan Mobil Avanza usai menabrak sepeda motor yang dikendarai Suyati dan Mila, langsung menabrak “pulau” jalan hingga bemper depan bagian kiri mobil pecah dan tertinggal di lokasi kejadian. Melihat kedua korban terkapar, pengemudi avanza sempat menghentikan sebentar mobilnya. Namun kemudian langsung melarikan diri ke arah Pontianak dan tidak memberikan pertolongan kepada kedua korban. Polisi yang menerima laporan warga mengenai insiden itu langsung mendatangi lokasi kejadian. Setiba di lokasi polisi dan warga mengevakuasi mayat korban. Setelah itu polisi melakukan penyisiran untuk mencari pengemudi mobil yang melarikan diri. Saat dikonfirmasi, Kapolres Singkawang, AKBP A Widhi-

handoko SH melalui Kasat Lantas, AKP Wahyu Jati Wibowo mengatakan, jika pihaknya datang setelah menerima laporan dari masyarakat, namun saat itu kondisi korban sudah tak bernyawa. “Hanya rekan korban yang masih selamat dan sempat dilarikan ke Rumah Sakit untuk mendapatkan perawatan medis,” kata Wahyu. Menurut Wahyu, saat itu juga pihaknya melakukan olah TKP di lapangan dan ditemukan barang bukti dari mobil pelaku, berupa pecahan bemper mobil warna merah maroon di dekat “pulau” jalan. “Selain barang bukti yang kita amankan, juga dikuatkan keterangan saksi yang menyebutkan jika mobil yang lari itu Avanza warna merah marun,” ujarnya. Selain itu, lanjut Wahyu, dari TKP juga terlihat bekas ban mobil yang menandakan jika mobil tersebut sempat mengerem sebelum menabrak kedua korban. Kuat dugaaan, jika sopir mobil

mengantuk dan tidak paham jalan. Wahyu mengatakan jika pihaknya sudah berupaya melakukan penyisiran dari lokasi kejadian hingga ke kawasan Mimi Land untuk mencari pelaku. Namun sayangnya tidak berhasil ditemukan.“Sudah kita sisiri, termasuk di kawasan Samudra Indah dan Mimi Land, tetapi tidak ditemukan,” ujarnya. Me s k i d e m i k i a n , l a n jut Wahyu, pihaknya sudah menyampaikan pesan ke masyarakat jika ada yang mengenali mobil mobil Avanza warna merah marun dengan bemper depan bagian kiri yang pecah agar segera melaporkan ke polisi. Selain mengimbau masyarakat, polisi juga mengingatkan pengemudi mobil untuk segera menyerahkan diri. “Sebaiknya pengemudi Avanza merah marun segera menyerahkan diri dengan baik-baik,” ingatnya. Sedangkan korban yang tewas, saat ini sudah dikebumikan pihak keluarganya. (mse)

Tabrak Lari, Suyati Tewas Sambungan dari halaman 17

terbuka dan mengalami pendarahan di mulut. Sedangkan rekannya yang dibonceng, Mila (27), mengalami luka lecet di tangan dan kaki kanannya. Saat ini menjalani perawatan intensif di Rumah Sakit dr Abdul Aziz, Singkawang. Insiden tragis itu berawal ketika Mila dan Suyati berangkat dari rumah dengan mengendarai sepeda motor Jupiter KB 3043 CV warna biru. Setibanya di tikungan depan Pos Polisi Sedau, dari arah berlawanan (Singkawang menuju Pontianak) meluncur mobil Avanza berkecepatan tingi. Diduga mengantuk dan tidak paham jalan, pengemudi mobil Avanza itu mengambil jalur yang dilalui Suyati dan Mila. Tak ayal, sepeda motor yang dikendarai Suyati menghantam bagian kiri mobil. Sepeda motor pun remuk di bagian depan, velg depan hancur, ban pecah dan stang

Kisah Qu Yuan Bunuh Diri Melompat ke Sungai Sambungan dari halaman 17

seorang sastrawan dan pejabat Negara Chu yang bernama Qu Yuan (Periode Negara Berperang/Zhan Guo atau Can Ket). Qu Yuan sangat berdedikasi dan berintegritas bagi negara atau kekaisaran pada saat itu. Namun dirinya difitnah sekelompok pejabat yang iri kepadanya. Atas perlakuan ini, dirinya mengasingkan diri ke negeri lain. Setelah men-

dengar Chu jatuh ke tangan Qin, lanjut Sumberanto, dia merasa berdosa bila masih tinggal di negeri lain sementara negeri sendiri telah hancur. Beliau ingin pulang, tetapi oleh penguasa Qin, diharuskan tunduk. Lantaran tidak kuasa melakukan perebutan kembali. Kemudian karena rasa bersalah nya meninggalkan negerinya, Qu Yuan memutuskan bunuh diri dengan melompat ke sungai. “Rakyat yang cinta kepa-

danya berusaha menemukan jenazahnya, ada yang menggunakan perahu berkeliling, Tapi tidak berhasil ditemukan,” katanya. Kawatir jenazahnya dimakan ikan. Maka warga memutuskan memasak nasi dari ketan yang kemudian ditaburkan ke sungai agar dimakan ikan sehingga tidak memakan jenazah Qu Yuan. “Dari tradisi tersebut turun temurun sampai sekarang ini. Makanya ada juga yang namanya Drag-

on Festival (Lomba Perahu Naga),” katanya. Sumberanto menyebutkan yang harus dipahami adalah nilai keteladanan dan semangat kecintaan yang sangat kuat kepada bangsa dan negara. “Perayaan bakcang bukan sekadar makan-makan, tetapi kandungan nilai yang harus mendapat tempat bagi kita. Disitu ada semangat nasionalisme, kebersamaan, solidaritas, pengharapan akan lebih baik setelah merayakan perayaan ini,” katanya.(*)

Hiburan Gratis Sambungan dari halaman 17

secara langsung acara hiburan dan lelang barang yang dipersembahkan oleh pengurus vihara yang dibangun sejak tahun 2000 lalu. “Tiap tahun kami mempersembahkan hiburan bagi masyarakat setempat dan yang pasti kita melelang sejumlah barang-barang,” kata Pengurus Vihara Fuk Tek Si, Solihin,

kepada Pontianak Post, malam kemarin. Menurut dia, setiap ulang tahun, warga Sui Pangkalan II yang sudah berhasil disejumlah daerah di Indonesia kembali ke kampung halaman. Mereka datang untuk merayakan ulang tahun sembari membeli barang-barang lelangan. “Uang lelang itu akan disumbangkan ke rumah iba-

dah tersebut untuk apa saja. Bisa untuk membangun, atau membuat drainase untuk perluasan areal vihara,” kata Solihin yang juga pengusaha tambak di Sui Pangkalan II ini. Beberapa tahun lalu, ketika vihara ini membutuhkan dana besar, maka lelang lebih mahal dan totalnya mencapai Rp1 miliar lebih. “Seiring dengan kebutuhan vihara berkurang, maka lelang

pun tak sampai miliaran. “Bisa mencapai Rp600 juta saja, untuk operasional,” kata Solihin. Solihin juga mengungkapkan, guna memberikan hiburan bagi masyarakat, pengurus vihara sengaja mendatangkan Huang Cia Cia dari Surabaya. Selain Huang Cia Cia didatangkan, Sakura Band milik Edy Lim yang juga pengusaha travel di Bali menghibur masyarakat. (zrf)

Enggan Transaksi via ATM Sambungan dari halaman 17

“Sebagai masyarakat sekaligus nasabah bank, mungkin saya hanya bisa berharap, jika memang sedang mengalami gangguan, ATM sebaiknya jangan difungsikan. Lantaran bisa berdampak kepada masyarakat. Ini harus menjadi perhatian, demi keamanan nasabah,” kata dia. Ia menambahkan, terlebih kini sudah mendekati masa

bulan ramadan. Kemudian berlanjut ke lebaran. Transaksi keuangan melalui ATM atau perbankan sulit dihindarkan. Apalagi gaji bulannya juga dikirim via transfer melalui bank. ”Tiap bulan saya pasti mengecek rekening. Memastikan gaji sudah dikirim atau belum. Jadi sangat takut kalau aksi pembobolan ATM bisa sampai marak di Sintang,” kata dia.

Seperti diberitakan, aksi kawanan penjahat berhasil membobol ATM BRI. Uang puluhan juta milik korban , Sofian Hamzah, warga Desa Baning Kota digondol, kemarin Sabtu (8/6) ketika kartu ATM korban sangkut di mesin ATM BRI Simpang Lima Sintang. Pembobolan bermula ketika korban ingin menarik uang melalui ATM BRI di Simpang lima. Kemudian kartu

ATM miliknya dimasukkan ke mesin ATM. Namun penarikan gagal. Uang tak kunjung keluar dari mesin ATM, termasuk chipnya. Pjs Kepala Cabang BRI Sintang Herlan Manudi juga tidak menyanggah jika CCTV di ATM BRI Simpang Lima sedang mengalami gangguan. Namun dia memastikan ATM BRI, usai kejadian kemarin, aman untuk bertransaksi. (stm)

SANGGAU--Sosialisasi Pelaksanaan Pengalihan Pajak Bumi dan Bangunan Perdesaan dan Perkotaan (PBB–P2) sebagai Pajak Daerah di Kantor Bupati Sanggau, Rabu (12/6) kemarin resmi dibuka Bupati Sanggau, Setiman H.Sudin dengan dihadiri Dirjen Perimbangan Keuangan Kementerian Keuangan, Berlin Panjaitan; Kanwil Dirjen Pajak Kementerian Keuangan, Eddy Marlan; Ditjen Perimbangan Kementerian, Sjamsudin Bahri. Direktur Jenderal Perimbangan Keuangan Kementerian Keuangan, Marwanto Harjowiryono melalui Berlin Panjaitan mengatakan bahwa berdasarkan Undang Undang (UU) Pajak Daerah dan Retribusi Daerah yang baru, yaitu UU Nomor 28 Tahun 2009 yang menggantikan UU Pajak Daerah dan Retribusi Daerah yang lama, yaitu UU Nomor 18 Tahun 1997 yang telah diubah dan ditambah dengan UU Nomor 34 Tahun 2000 terdapat beberapa perubahan yang signifikan. “Perubahannya seperti adanya pembatasan jenis pajak daerah yang dapat dipungut oleh daerah. Adanya peningkatan dalam sistem pengawasan atas pemungutan pajak daerah, serta adanya penegasan dalam sistem pen-

gelolaan pendapatan dari pajak daerah,” katanya. Sebagai konsekuensinya, kepada daerah diberikan kewenangan yang lebih besar di bidang perpajakan dalam bentuk kenaikan tarif maksimum, perluasan objek pajak, dan penambahan jenis pajak melalui pengalihan sebagian pajak pusat menjadi pajak daerah. D a l a m ma s a t ra n s i s i , Pemerintah sudah mempersiapkan tahapan pengalihan PBB-P2 dan BPHTB melalui dua peraturan bersama Menteri Keuangan dan Menteri Dalam Negeri, yaitu Peraturan Bersama Menkeu dan Mendagri Nomor 186/ PMK.07/2010 dan Nomor 53 Tahun 2010 tentang Tahapan Persiapan Pengalihan BPHTB menjadi Pajak Daerah (sekarang sedang dilakukan revisi) dan Peraturan Bersama Menkeu dan Mendagri Nomor 213/PMK.07/2010 dan Nomor 58 Tahun 2010 tentang Tahapan Persiapan Pengalihan PBB-P2 menjadi Pajak Daerah (sekarang sedang dilakukan revisi). “Kedua peraturan bersama ini pada prinsipnya mengatur tugas dan tanggung jawab Kementerian Keuangan, Kementerian Dalam Negeri dan Pemerintah Daerah. Selain itu, kedua peraturan bersama

tersebut sudah disosialisasikan ke sejumlah kabupaten dan kota di Indonesia sejak tahun 2011 yakni 160 daerah dan 2012 yakni 160 daerah. Dalam tahun 2013 ini, sosialisasi yang sama sudah dilaksanakan di sekitar 80 daerah dan masih akan dilaksanakan di sekitar 91 daerah yang belum termasuk 18 daerah pemekaran baru,” ungkapnya. Sementara itu, Anggota Komisi XI DPR RI, Lim Swi Kiang menambahkan bahwa dengan adanya pengalihan PBB-P2 sebagai Pajak Daerah diharapkan dapat meningkatkan PAD dan dengan meningkatnya PAD dapat meningkatkan pembangunan di daerah, termasuk nantinya di Sanggau. “Ini haraan yang harus diwujudkan untuk kesejahteraan masyarakat di daerah,” ujarnya. Bupati Sanggau, Setiman H. Sudin dalam sambutannya menyampaikan bahwa tujuan diadakannya sosialisasi pelaksanaan Pengalihan Pajak Bumi dan Bangunan Perdesaan dan Perkotaan menjadi Pajak Daerah ini adalah untuk memberikan bekal pemahaman tentang fungsi pajak serta memiliki kesiapan dalam melaksanakan peralihan pengelolaan PBB Perdesaan dan Perkotaan. (sgg)

Dialokasikan Lebih Rp200 Juta SANGGAU--Bupati Sanggau, Setiman H.Sudin menyampaikan bahwa APBD untuk kecamatan, telah dialokasikan dana masing-masing di atas Rp200 juta dengan harapan dapat menunjang operasional dan kegiatan di Kecamatan. Bahkan diberikan dana sebesar Rp10 juta untuk mendukung program Desa Fokus yang merupakan program unggulan Pemerintah Kabupaten dalam upaya meningkatkan kesejahteraan masyarakat khususnya di daerah terjauh dan terpencil. “Berkaitan dengan Dana ADD Pemerintah Kabupaten Sanggau sendiri telah mengalokasikan dana cukup be-

sar yaitu kurang lebih Rp22 Milyar dan berkaitan dengan hal tersebut yang terpenting adalah validasi data pembayar pajak. Sehingga terutama dalam hal penetapan nilai pajak. Pajak ini dari kita, oleh kita dan untuk kita,” katanya, Rabu (12/6) kemarin. Maka diharapkan khususnya kepada Kepala Desa (Kades) selaku penagih pajak harus bekerja dengan benar sehingga target pencapaian pajak terealisasi. Untuk itu Pemerintah Kabupaten Sanggau akan menerapkan Reward dan Punishment kepada para penagih pajak. Setiman menambahkan bahwa pendapatan dari sektor pajak tidak

sampai dua milyar rupiah. Sedangkan Insentif penagih Pajak sebesar Rp2,8 Miliar. “Hal tersebut merupakan suatu bentuk tindak lanjut kebijakan otonomi daerah dan desentralisasi fiscal. Sehingga proses pendataan, penilaian, penetapan, pengadministrasian, pemungutan/penagihan dan pelayanan PBB-P2 akan diselenggarakan oleh Pemerintah Daerah (Kabupaten/Kota),” ujarnya. Dalam menghadapi pengalihan pengelolaan PBB Perdesaan dan Perkotaan Pemerintah Daerah pada tanggal 1 Januari 2014 harus mempersiapkan SDM, Biaya dan teknologi yang tidak sedikit. (sgg)

Tangan Remuk Terlindas Zonder Sambungan dari halaman 17

kerumah sakit Umum Ade Mohammad Djoen Sintang. Selanjutnya pada Rabu (5/6) pagi, korban dibawa ke RSUD Sintang. namun pihak RSUD juga mengaku tidak mampu, karena tidak ada alat untu mengobati patah tulang. Pihak keluarga mengaku hingga kini korban belum dibawa kerumah sakit. Pihak keluarga tidak memiliki biaya untuk merujuk ke Pontianak. “Kami hanya dikasi 100 ribu dari perusahaan. Sehingga kami tidak mampu membawa

korban ke Pontianak,” kata dia. Pihaknya berharap Pihak Perusahaan PT SAA bertanggung jawab atas musibah tersebut. “Harapan saya perusahaan bertanggung jawab. Jangan lempar tanggung jawab,” tukasnya. Sementara Astuti (42) mengaku sudah bekerja di Perusahaan tersebut sejak tangal 3 Juli 2012. Ia bekerja sebagai buruh di PT SAA. Dalam satu bulan Suryati mengaku mendapat honor Rp 1,2 juta. “Gaji kami sehari hanya 50.000 400 rupiah sehingga gaji kami tidak menentu kadang 1,1 juta

dan kadang 1,2 Juta tergantung hari kerja,” kata dia. Astuti sendiri mengaku jika dirinya harus membiayai pengobatan sendiri hingga ke Pontianak, dirinya mengaku tidak mampu. Pasalnya Ia tidak memiliki uang. “Kalau kami nanggung biaya tak mampu anak kami juga masih kecil baru empat tahun,” kata dia. Sementara pihak terkait PT SSA hingga kini belum dapat dikonfirmasi SMS yang dikirim ke manager Lapangan bapak Yohanes juga belum ada tanggapan. (stm)

Widhihandoko Kapolres Singkawang Sambungan dari halaman 17

sukses. “Perlu kerjasama dan dukungan yang kuat dari rekan-rekan untuk kesuksesan even-even yang ada,” pesannya lagi. Selain menyampaikan pesan, Wadir

Lantas Polda Kalbar ini, meminta maaf kepada masyarakata Kota Singkawang dan rekanrekannya jika melakukan kesalahan selama bertugas di Kota Amoy ini. Ditempat terpisah Kapolres Singkawang,AKBP. A. Widhi-

handoko merasa terhormat diberi kesempatan bertugas di Kota yang terkenal dengan wisata pantainya ini. “Suatu kebanggaan bisa menjalankan tugas kepolisian dengan baik,” pungkasnya. (mse)

TDK Harus Dicari Sumber Masalahnya Sambungan dari halaman 28

Walau tidak bisa dapat sekarang, kedepan kita upayakan bisa masuk,” ungkap dia. Sedangkan masalah pemblokiran dan proses pencairan yang lambat, hal tersebut mungkin dikarenakan proses antarbank. Sebab, di Kapuas Hulu pencairan tunjangan tersebut melalui Bank Kalbar,

bukan BRI yang merupakan pemenang tender di pusat. “Jadi ada proses-proses antarbank itu yang mungkin lama, sehingga guru pun ada yang dapat, ada yang tidak. Sebetulnya BRI yang memenangkan tender untuk penyaluran tunjangan guru itu, tetapi hanya di Kapuas Hulu ini yang dialih ke Bank Kalbar,” tegas Ding.

Politikus PDIP ini pun menuturkan, DPRD akan mengawal penyelesaian masalah tersebut hingga mencapai titik temu. Dengan demikan hak-hak guru juga dapat dicapai sesuai dengan kewajiban yang telah diselesaikannya. “Melalui Komisi A akan kita kawal hingga ada titik temu,” tutup Ding. (wank)

Pertanyakan Rehab Sambungan dari halaman 28

harus memeriksa keberadaan dermaga tersebut urgen atau tidak,” kata dia. Ia menambahkan, selama ini keberadaan dermaga di Dedai sama sekali tidak dimanfaatkan. Padahal dermaga dibangun dengan menelan anggaran Rp40

juta terkesan hanya menjadi pajangan. Terlebih pada tahun ini mendapatkan rehab yang terkesan hanya menghamburhamburkan anggaran. “Dana Pembangunan dulu mencapai Rp40 juta kemungkinan dana untuk rehab mencapai setengahnya,” kata dia. Sementara Kepala Dinas

Perhubungan Kabupaten Sintang Hatta mengakui renovasi dermaga di kecamatan Dedai yang dilakukan Pemerintah Kabupaten Sintang diharapkan dermaga tersebut dapat difungsikan. “Harapan kami dengan dilakukan rehap agar dermaga tersebut dapat difungsikan,” kata dia. (stm)

Istri Diminta Doakan Suami Sambungan dari halaman 28

menerapkan faktor keamanan setiap melakukan patroli ataupun kegiatan lainnya. “Bantu masyarakat

serta hormati kearifan dan kebudayaan lokal setempat. Bina hubungan baik dengan masyarakat, tokoh-tokoh adat, kepala suku ditempat para prajurit bertugas nanti-

nya. Prajurit juga harus fokus kepada tugas yang diemban serta jangan lengah dalam situasi dan kondisi apapun,” kata dia.(stm)


PRO-KALBAR Pontianak Post


Harus Bentuk Badan SEBAGAI kabupaten konserfasi, Kapuas Hulu harus memberi porsi yang besar terhadap programprogram lingkungan. Oleh sebab itu, sangat dibutuhkan instansi teknis setingkat badan untuk peningkatan pembangunan di sektor lingkungan hidup. “Kabupaten konserfasi seperti Kapuas Hulu ini, memang membutuhkan Badan Lingkungan Hidup. Karena akan banyak program lingkungan yang bisa kita tata dengan struktur Agus Mulyana setingkat badan. Selama ini hanya bisa setingkat kantor saja,” kata Wakil Bupati Kapuas Hulu, Agus Mulyana disela waktunya berkunjung ke Datah Diaan belum lama ini. Pada sektor lingkungan hidup, di Kapuas Hulu ini bukan hanya dibutuhkan untuk pengayom izin Amdal (analisa dampak lingkungan) saja, tetapi betul-betul untuk menjaga potensi alam di Kapuas Hulu. “Karena itu, saya rasa Badan Lingkungan Hidup adalah kebutuhan sebagai instansi yang melakukan pemeliharaan dan peningkatan kekayaan alam di Kapuas Hulu ini. Sebab, upaya perhatian terhadap lingkungan masih kurang,” ungkap Wabup. Kendati demikian, pemeliharaan terhadap lingkungan juga merupakan tanggung jawab masyarakat. Dalam melestarikan kabupaten ini dengan alamnya tidak akan bisa tanpa dukungan dan peran serta masyarakat. “Saya juga imbau agar lingkungan disekitar kita dijaga secara bersama. Masyarakat, tokoh adat dan pemerintah juga harus saling mendukung turut memperhatikannya, tidak bisa hanya kalangan tertentu,” imbuh Agus. (wank)


KBPPP Mesti Miliki Pemimpin Mengayomi MELIHAT vakumnya kepemimpinan Keluarga Besar Putra Putri Polri (KBPPP) Kalimantan Barat saat ini, Komandan Siaga Bhayangkara PD KBPPP Kalbar, Indra Djafar mengatakan, sudah sepantasnya KBPPP Kalbar memiliki pemimpin yang dapat mengayomi seluruh anggota KBPPP Kalbar, yang notabene adalah anakanak putra putri polisi. Menurut Indra, posisi yang start-

egis memimpin KBPP Kalbar, adalah Sy. Abdurachman Alkadrie SE yang merupakan anak polisi dan putra terbaik Kalimantan Barat. “Saya melihat beliau (Sy. Abdurachman, Red) adalah sosok yang tepat karena low profile, pemikir yang baik serta mampu berinteraksi dan berkomunikasi dengan baik dari lapisan atas hingga lapisan bawah,” katanya. Sy. Abdurchaman Alkadrie atau bang Ma-

man pangilan akrabnya, diungkapkan Indra, merupakan sosok pemimpin yang sudah berpengalaman. Terlebih bang Maman mampu berkomunikasi dan meluangkan waktu untuk membangun dan membesarkan lagi KBPPP Kalbar. Indra berharap,dengan ke pemimpinan bang Maman dapat memimpin KBPPP Kalbar kedepanya. (d3/ser)

ekonomian dengan baik dan menjaga anak-anak selama suami tidak berada di tempat,” kata dia. Danpusterad selanjutnya memberikan pembekalan Teritorial didepan 650 Prajurit Yonif 642/Kps. Dalam pembekalannya Danpusterad menekankan hal penting yang harus dipedomani dan diwaspadai seluruh prajurit selama bertugas di perbatasan RI-PNG di Papua. Danpusterad meminta prajurit untuk selalu menjaga kesehatan dan mewaspadai penyakit Malaria yang memang menjadi khas daerah setempat. Prajurit juga ditekankan selalu

Ke Halaman 27 kolom 5

Ke Halaman 27 kolom 5

Ke Halaman 27 kolom 5

Istri Diminta Doakan Suami Prajurit Diingatkan Adaptasi Tempat Tugas SINTANG--Komandan Pusat Teritorial Angkatan Darat (Danpusterad), Mayjen TNI. Indra Hidayat.R memberikan pembekalan teritorial kepada Prajurit Yonif 642/Kps yang disiapkan untuk melakukan tugas Pengamanan Perbatasan RI-PNG di Papua, kemarin. Kedatangan Danpusterad disambut Kasrem 121/Abw, Danbrigif 19/KH, Dandim 1205/ Stg, Danyonif 642/Kps, serta

Dandenpom Sintang. Sementara Danpusterad didampingi Danrem 121/Abw Kolonel Inf. Tiopan Aritonang, Aster Kasdam XII/Tpr Kolonel Inf. M. Affandi serta Waasop Kasdam XII/ Tpr Letkol Inf. Hendri Batara. Danpusterad juga memberikan pembekalan kepada ibu Persit Yonif 642/Kps. Dalam arahannya, Danpusterad menyampaikan kepada istri yang ditinggal tugas suami sebagai konsekuensi dari seorang istri prajurit. “Doakan suami agar selalu dalam perlindungan Tuhan Yang Maha Esa selama bertugas. Doa ibu-ibu dapat memberikan ketenangan bagi suami yang akan melakukan tugas, dengan mengatur per-





Indra Djafar

PUTUSSIBAU--Tunjangan Daerah Khusus (TDK) yang diamanatkan Peraturan Pemerintah No. 41 Tahun 2009, di Kapuas Hulu menjadi permasalahan. Pasalnya, tidak semua guru di kawasan khusus seperti di kawasa perbatasan mendapatkan TDK tersebut. Terkait dengan permasalahan itu, Wakil Ketua DPRD Kapuas Hulu, Agustinus Ding mengatakan masalahnya ada di pemerintah pusat, karena keputusan kuota terkait TDK adalah wewenang Kemendikbud. Di tingkat kabupaten hanya bisa mengusulkan nama-nama guru di Kapuas Hulu yang masuk kawasan khusus, terpencil ataupun perbatasan. Selanjutnya yang memuAgustinus Ding tuskan adalah Kemendikbud. “Untuk mendalami masalah tunjangan daerah khusus di Kapuas Hulu, saya sudah limpahkan ke Komisi A yang membidangi hal ini. Masalah tersebut harus dicari sumbernya dari mana. Bila perlu minta kejelasan daftar yang telah diputuskan oleh Kemendikbud,” kata Ding saat dijumpai diruangkerjanya, Rabu (12/6). Terkait masalah TDK ini, lanjut Ding, sudah diadukan oleh sejumlah guru dari jalur selatan dan utara Kapuas Hulu pada Selasa (11/6) lalu. Guru-guru tersebut menuntut kejelasan terkait TDK yang tidak merata diperoleh semua guru, termasuk sejumlah tunjang yang kerap diblokir dan belum dibayar. “Kalau ada kesalahan yang kemarin sehingga hanya setengah yang dapat, dan setengahnya lagi diperbaiki.


KOORDINATOR Laskar Anti Korupsi (LAKI) Kecamatan Dedai Matyunus mempertanyakan rehab Pembangunan Dermaga di Kecamatan Dedai. Pengucuran dana tersebut dinilai terkesan mubajir. Pasalnya, dermaga yang sudah berdiri sejak tahun 2007 lalu tidak pernah dimanfaatkan oleh masyarakat setempat. “Untuk apa direhab kalau Dermaga tersebut tidak pernah difungsikan. Ini hanya akan menghabiskan anggaran,” kata dia. Menurutnya, dibanding harus melakukan rehab dermaga tersebut, masih banyak infrastruktur jalan di Dedai harus diperbaiki karena menjadi akses masyarakat. “Ketimbang mubajir hanya untuk memperbaiki dermaga yang tak pernah digunakan, lebih baik dananya untuk pembangunan jalan,” kata dia. Ia berharap pemerintah jeli dalam menganggarkan dana pembangunan. Minimal harus terjun ke lapangan langsung, sehingga tidak asal membangun. “Harus ada azas manfaatnya. Pemerintah

Sy. Abdurchaman Alkadrie

TDK Harus Dicari Sumber Masalahnya

BERANGKAT KE PAPUA: Pesan Danpusterad jelang keberangkatan Yonif 642/Kapuas ke Papua.

Pertanyakan Rehab

Kamis 13 Juni 2013

Pontianak Post


Kamis 13 Juni 2013

SOCCER Piala Konfederasi


AZZURI BELUM PERCAYA DIRI GAGAL : Pemain Italia Emanuele Giaccherini saat gagal mencetak gol ketika timnya berhadapan dengan Haiti dalam laga persahabatan di stadion Sao Januario, Rio de Janeiro’s. AFP PHOTO / VINCENZO PINTO


ITALIA RIO DE JANEIRO--Italia bukan momok di Piala Konfederasi 2013 yang mulai bergulir akhir pekan ini. Memang terlalu cepat untuk memberikan penilaian tersebut. Namun, jika melihat hasil uji coba terakhirnya kontra Haiti di Sao Januario, Rio de Janeiro, kemarin (WIB), superioritas Italia berbanding terbalik. Alih-alih memenangi laga uji coba pertamanya di Amerika Latin, Gli Azzuri tertahan 2-2. Hasil ini meneruskan tanpa kemenangan Italia dalam dua laga terakhir. Sebelumnya, Italia ditahan imbang tuan rumah Republik Ceko tanpa gol dalam babak kualifikasi Piala Dunia, beberapa waktu yang lalu. Padahal, Spanyol sempat unggul dua gol terlebih dahulu. Tidak perlu menunggu lama, pada detik ke-19 Italia sudah leading lewat gol Emanuele Giaccherini. Claudio Marchisio meng-

2 2

genapi keunggulan pada menit ke-70. Haiti hanya butuh waktu lima menit supaya membalikkan keadaan. Penalti Olrish Saurel di menit ke-85 dilengkapi oleh Jean Philippe Peguero di masa injury time. Ini jelas sinyal peringatan bagi allenatore Italia, Cesare Prandelli. Karena, Italia akhir pekan ini harus menghadapi juara Concacaf, Meksiko. Sekalipun dalam laga kemarin tim yang turun bukanlah kekuatan terbaik Azzuri, tidak bisa mengalahkan tim sekelas Haiti jelas hal memalukan. Dilansir dari Football Italia, Prandelli menyebut banyak faktor yang membuat skuadnya gagal menang. Selain banyak memasang pemain-pemain lapis kedua, Italia juga masih belum lama


Prediksi Wakil Ranking FIFA Performa terbaik di Piala Konfederasi

: Final : Runner-up Euro 2012 : 8

: Posisi kelima (2009)

Psywar “Piala Konfederasi adalah latihan yang bagus jelang Piala Dunia. Ajang ini untuk mengasah masa depan tim ini. Hasil memalukan seperti melawan Haiti (2-2) jangan terjadi lagi.” Cesare Prandelli, Pelatih Italia Cesare Prandelli adalah pelatih yang fanatik menggunakan pola 4-3-1-2. Otak permainan alias trequartista dan tiga gelandang bertahan menjadi inti dari strategi Italia. Namun sekarang Prandelli sedang mencoba taktik baru yakni 4-3-3 dengan mengandalkan kecepatan di sisi penyerang sayap.

Skuad Kiper: 1-Gianluigi Buffon (Juventus), 12-Salvatore Sirigu (PSG), 13-Federico Marchetti (Lazio). Belakang: 2-Christian Maggio (Napoli), 3-Giorgio Chiellini (Juventus), 4-Davide Astori (Cagliari), 5-Mattia De Sciglio (AC Milan), 15-Andrea Barzagli (Juventus), 19-Leonardo Bonucci (Juventus), 20-Ignazio Abate (AC Milan). Gelandang: 6-Antonio Candreva (Lazio), 7-Alberto Aquilani (Fiorentina), 8-Claudio Marchisio (Juventus), 16-Daniele De Rossi (AS Roma), 18-Riccardo Montolivo (AC Milan), 21-Andrea Pirlo (Juventus), 22-Emanuele Giaccherini (Juventus), 23-Alessandro Diamanti (Bologna), 17-Alessio Cerci (Torina). Depan: 9-Mario Balotelli (AC Milan), 10-Sebastian Giovinco (Juventus), 11-Alberto Gilardino (Bologna), 14-Stephan El Shaarawy (AC Milan)

Pemain Kunci

beradaptasi dengan kondisi di Brasil. Mereka baru tiba dua hari sebelum laga itu berlangsung. “Kami tiba kemarin dan membuat banyak perubahan di komposisi. Semangat kami hari ini sudah harusnya berubah. Ini tentu hasil yang buruk, dan salah satu yang memalukan. Karena, imbang dari Haiti adalah hal yang sangat memalukan,” ujar Prandelli kepada Rai Sport. Dari susunan pemain yang diturunkan, 80 persen merupakan pemain lapis kedua. Posisi Buffin digantikan Salvatore Sirigu. Sedangkan untuk posisi ujung tombak, dipercayakan kepada duet Alessandro Diamanti dan Alberto Gillardino. Pun demikian untuk jenderal di lini tengah yang menjadi milik Alberto Aquilani. Pran-





delli lebih mengedepankan kondisi fisik anak asuhnya ketimbang hasil akhir semata dari uji coba ini. “Banyak aspek yang perlu kami pertimbangkan. Yang paling penting bagi kami sekarang adalah bagaimana untuk mempertajam kondisi fisik pemain kami,” ungkapnya. Hasil ini memang bukan akhir bagi negara juara dunia 2010 itu. Masih ada waktu yang tersisa kurang dari sepekan bagi Italia untuk kembali ke jalur juaranya. “Saya berharap dalam lima hari yang tersisa kami bisa mengatasi kekurangan dari faktor fisik tersebut,” imbuhnya. Sementara itu, bek Italia, Christian Maggio meminta publik Italia supaya tidak khawatir menyikapi hasil perdana mereka setibanya di Brasil. Maggio tidak menganggap hasil ini sebagai pertanda awal bahwa Italia akan jeblok di Piala Konfederasi nanti. Ini hanyalah pertandingan persahabatan. “Tidak ada yang perlu dikhawatirkan. Ada sesuatu dari strategi permainan kami yang tidak bisa berjalan seperti rencana semula. Dan kami juga harus bermain hati-hati. Tapi kami yakin mampu mengatasinya pada saat latihan nanti,” klaim Maggio. Pada laga itu, Maggio menggantikan posisi Ignazio Abate di bek kanan. (ren)

Gianluigi Buffon

Andrea Pirlo

Mario Balotelli

Performa Tim Sejarah Prestasi Terkini Pelatih Kiper Bertahan Tengah Serangan

: : : : : : :

9 7 8 8 8 8 7

Strengths - Punya lini tengah berkualitas. - Pertahanan hebat di depan Gianluigi Buffon - Memiliki sayap lincah.

Weaknesses - Bingung bila Andrea Pirlo absen. - Bomber masih kurang tajam. - Pergerakan para pemain kaku.

Prandelli Mencari Formasi SEJAK ditunjuk menangani timnas Italia pada Juni 2010 silam, Cesare Prandelli bukanlah tipe pelatih yang fanatik dengan satu formasi. Pola 4-3-3 dan 4-3-1-2 paling sering diterapkan mantan pelatih Fiorentina tersebut. Apa kelebihan dan kelemahan dua formasi tersebut ? Serta apa formasi yang kira-kira akan diterapkan di Piala Konfederasi 2013 ?


30 Fuglsang Pimpin Astana, BMC Pilih Evans


PARIS- Tim Astana sudah meraih gelar juara dari grand tour musim ini. Mereka meraihnya di Giro d”Italia 2013 melalui kemenangan Vincenzo Nibali. Tak berlebihan jika mereka mengusung target yang sama saat melangkah ke grand tour berikutnya, Tour de France yang dimulai 29 Juni. Astana sudah mengonfirmasiJakobFuglsangsebagaileadertimnya diTour.Namun,Astanabelummengumumkansusunan lengkap skuadnya. Astana sudah memiliki 13 nama lain yang nantinya akan diseleksi lagi menjadi delapan nama pembalap. Hasil Tour de Suisse yang masih berlangsung akan jadi keputusan akhir. “Untukkepastian,Fuglsangakanmenjadikapten kamisaatTourstartdiCorsica29Juni.Tapi,masihada beberapa slot terbuka. Karena itu, penting bagi kami mengamati pembalap di Swiss sebelum memilih yang terbaik menuju Prancis,” kata Alexandre Vinokourov, general manager Astana pada Cyclingnews. Pengalaman Fuglsang di Tour jadi pertimbangan utama Astana. Ditambah lagi dengan pencapaiannya di Criterium du Dauphine yang berakhir pekan lalu. Climber asal Swiss itu berada di posisi keempat di general classification akhir. Penentuanteamleader jugasudahdilakukanoleh BMC.Merekasudahmenunjukduapembalap,yaitu juara Tour de France 2011 Cadel Evans dan Tejay van Garderen memimpin rekan-rekannya yang lain. Lebih maju lagi, BMC sudah memilih tujuh pembalaplainuntukmendukungduapembalaptersebut. Harian asal Belgia Het Nieuwsblad melaporkan, BMC akan membawa pembalap dari seleksi team time trial (TTT) di Nice, Prancis pekan lalu. Berarti, dalamskuadyangdibawaBMCadanamajuaradunia PhilippeGilbert,mathiasFrank,MichaelSchaar,Steve Morabito, Thor Hushovd, Marcus Burghardt, Amael Moinard, Brent Bookwalter, Dominique Nerz dan Manuel Quinzato. (ady)

Pontianak Post


Kamis 13 Juni 2013

Mencari Raja Spanyol di Catalunya

BARCELONA - Tiga pembalap Spanyol berada di posisi tiga besar klasemen sementara MotoGP 2013. Pembalap Repsol Honda Dani Pedrosa memimpin di puncak klasemen diikuti juara bertahan Jorge Lorenzo. Di bawah mereka, ada nama pembalap debutan yang dimiliki Repsol

Honda Marc Marquez. Lima balapan yang sudah berlangsung, hanya tiga pembalap itu yang mampu menjadi pemenang. Pedrosa dan Lorenzo menang dua kali, sementara Marquez satu kali. Saat balapan akhir pekan ini kembali ke Spanyol, yaitu di Sirkuit Catalunya, nama mereka kembali


diunggulkan untuk mencari raja di tanah Spanyol. Lorenzo memupus rentetan kemenanganHondasetelahmenjadi juara di Sirkuit Mugello, Italia dua pekan lalu (2/6). Karena seri berikutnya bakal digelar di kandang sendiri, Lorenzo berharap bisa menjaga momentum tersebut.

“Kembali meraih kemenangan adalah sesuatu yang sangat positif buat saya dan juga buat tim. Dan sekarang kami pergi ke Montmelo (Catalunya), grand prix kandang buat saya,” tutur Lorenzo seperti dikutip Crash. OptimismeLorenzodidasarkan pada performa Yamaha di sirkuit tersebut. Menurutnya, beberapa bagian lintasan cocok dengan karakter Yamaha M1. “Beberapa bagian lintasan cocok dengan kami, tapi keraguannya adalah apakah suhu lintasan akan bisa menguntungkan kami,” lanjutnya. Menurut Lorenzo, Sirkuit Catalunya lehih lambat dibandingkan Mugello. Tetapi di Catalunya tak ada tikungan yang membuat motor harus memulai dari gigi pertama. “Kami harus mengambil keuntungan dari hal tersebut, mencoba mengulang kemenangan. Itu akan hebat untuk kejuaraan ini. Sejauh yang saya tahu saya akan berusaha 100 persen untuk meraihnya,” tegas Lorenzo. Tahun lalu, Lorenzo menang di Catalunya. Namun, sejak musim 2007, tidak ada pembalap yang mampu memenangi MotoGP

Catalunya dua kali secara berurutan. Pedrosa tak menampik jika susah untuk memperkirakan siapa yang akan menjadi juaranya. “Susah untuk sekarang ini mengatakan apakah (balapan di Catalunya) itu akan menjadi sirkuit untuk Honda atau sirkuit Yamaha. Tapi, saya berharap motor kami bisa bekerja denga baik di sana dan kami bisa mempunyaibalapanyang bagus melawan para pembalap Yamaha,” kata Pedrosa kepada situs resmi MotoGP. Sayang, Marquez mungkin tak berada dalam kondisi terbaiknya saat berlaga di Catalunya. Dia mengalami pekan yang buruk di Mugello. Total empat kali Marquez terjatuh, dan yang kemudian membuat dia dikhawatirkan dapat cedera, adalah saat melaju dalam kecepatan tinggi pada sesi latihan bebas kedua dan kehilangan posisi kedua karena tergelincir di tiga lap terakhir. “Setelah jatuh di Mugello saya sungguh tak sabar untuk kembali ke atas motor dan tampil di Catalunya. Saya jauh lebih tenang setelah bertemu Dr. (Xavier) Mir pekan lalu dan dia memastikan tidak ada komplikasi dengan cedera saya. Saya dalam proses menuju 100 persen lagi,” tegasnya. (ady)



C cmyk




Pontianak Post


Kamis 13 Juni 2013

Tetap Bermain di Usia 40 JAVIER Zanetti dan Inter Milan seolah tak terpisahkan. Segera memasuki usia 40 tahun pada Agustus nanti, klub milik Massimo Moratti itu masih menginginkan tenagannya. Padahal, musim ini dia masih menjalani masa penyembuhan sejak dibekap cedera achilles tendo pada April silam. “Ini bukti kepercayaan klub kepada saya. Saya harus mengucapkan terima kasih atas ini semua,” kata Zanetti di situs resmi klub. Kontrak tersebut berdurasi 12 bulan. Pemain asal Argentina itu baru berpisah secara formal dengan satusatunya klub bergelar treble winner di Italia itu pada Juni 2014. Pemain kelahiran Buenos Aires itu mengaku masih punya passion terhadap tim yang sudah dia perkuat selama 18 tahun tersebut. Pihak klub juga sudah mengecek cedera yang dia alami. Zanetti baru bisa merumput pada Oktober mendatang. “Saya berharap bisa membalas kebaikan mereka di atas lapangan,” ungkapnya. Sejak mengalami cedera, dukungan buat Zanetti terus mengalir. Para fans mengirim surat dan hadiah agar dia cepat sembuh. Dukungan itu juga yang membuatnya merasa masa dia di Inter belum habis. “Fans telah mengirimkan cinta mereka selama beberapa pekan terakhir. Mereka juga sudah siap untuk memberi cinta yang sama kepada klub di musim depan. Kita masih bersama,” ujarnya. Dia juga siap berkolaborasi dengan pelatih anyar Walter Mazzarri. Dia akan membantu secara optimal bekas pelatih Napoli tersebut. Karena itu, dia ingin segera mengembalikan kebugarannya

agar bisa segera bertarung di lapangan hijau. Zanetti sudah seperti ikon Inter. Pemain yang serba bisa di segala posisi bek dan gelandang bertahan itu terlibat dalam pahit manis sejarah Inter sejak 1995. Dia ikut merasakan langsung bagaimana rasanya menjadi korban calciopoli ketika mereka gagal scudetto bersama sang fenomenal Ronaldo. Dia juga merasakan euforia treble winner bersama pelatih Jose Mourinho pada 2009-2010. “Saya masih memiliki cinta buat Inter Milan,” ujarnya. (aga) JAVIER ALDEMAR ZANETTI Tempat tanggal lahir: Buenos Aires, 10 Agustus 1973 Kebangsaan: Argentina KARIR: - Talleres - Atletico Banfield - Inter Milan

1991-1992 1992-1995 1995-sekarang

GELAR BERSAMA INTER MILAN: - Scudetto: 5 kali - Coppa Italia: 4 kali - Supercoppa Italia: 4 kali - UEFA Champions League: 1 kali - UEFA Cup: 1 kali - Piala Dunia Klub: 2010 GELAR INDIVIDUAL: - 100 pemain pilihan FIFA - Pallone d”Argento - Nominasi FIFA team of the year 2009 - Gelar loyalitas 2013


Barcelona, Rumahku BARCELONA - Jarang dimainkan sebagai starter musim lalu, membuat Cesc Fabregas diisukan bakal meninggalkan Barcelona. Kehadiran pemain muda berbakat asal Brasil Pablo Neymar memperkuat isu kepindahannya dari klub juara Primera Division 2012-2013 Spanyol itu. Namanya pun dikaitkan dengan beberapa klub yang mengincarkan. Paling santer tentu saja klub lama Fabregas, Arsenal. Apalagi klub Premier League Inggris yang bermarkas di London tersebut memegang klausul buy back, saat kepindahan Fabregas ke Barcelona 2011. Belakangan, juara Premier League 2012-2013 Manchester United pun mengincarnya. Legenda United Denis Irwin memberi bocoran bahwa Fabregas adalah target utama The Red Devils - julukan United - musim panas ini. “Posisi Cesc Fabregas meningkat dalam daftar transfer United ke posisi pertama. Sang juara (United) akan memindahkan langit dan bumi demi mendapatkannya,” ujar mantan pemain belakang itu, sebagaimana dilansir goal. Irwin melihat Fabregas terlihat sangat ingin meninggalkan Nou Camp markas Barcelona. Dengan kondisi seperti itu, menurut Irwin, proses transfer tersebut bakal mudah.





Manajemen Barcelona pun sepertinya tidak bakal menghalang-halangi kepergian Fabregas. Wakil Presiden Barcelona Josep menegaskan akan mempersilakannya pindah ke klub lain. “Hanya keinginannya yang bisa membuatnya pergi dari klub ini,” ungkapnya kepada The Mirror. Masalahnya, apakah Fabregas memang ingin pergi dari Barcelona? Sepertinya tidak. Dia menegaskan keinginanya untuk kembali merengkuh juara bersama Barcelona. “Banyak yang sudah saya lakukan agar bisa di tempat saya saat ini. Tidak terfikir untuk membuangnya begitu saja untuk sesuatu yang belum jelas,” katanya kepada The Sun. Baginya, Barcelona adalah mimpinya sejak kecil. Barcelona adalah rumahnya. Dia ingin mewujudkan mimpinya di sana. “Kecuali jika memang Barcelona tidak menginginkanku lagi. Itu akan menjadi masalah lain,” tambahnya. Setelah bergabung ke Barcelona, dia memang banyak mendapatkan kritik dari para suporter. Dia menegaskan kritik itu justru membuatnya semakin kuat. “Mungkin ada yang tidak suka permainannya. Jika fans mengejek saya, saya harus menerimanya. Saya merasakan itu sebagai tantangan penting dalam hidup saya. Saya hanya ingin bermain,” tegasnya. (ruk)

Cesc Fabregas

CLARK KENT “People are afraid of what they don’t understand.”


Pontianak Post ● Kamis 13 Juni 2013

- Man of Steel -


KRYPTONITE Curi Kesempatan Kedua Setelah Superman Returns Gagal

MAN OF STEEL PEMERAN: Henry Cavill, Diane Lane, Kevin Costner, Amy Adams, Russell Crowe SUTRADARA: Zack Snyder PRODUSER: Christopher Nolan, Charles Roven, Deborah Snyder, Emma Thomas PENULIS: David S. Goyer SINEMATOGRAFI: Amir Mokri EDITING: David Brenner STUDIO: Warner Bros DURASI: 143 menit RILIS: 14 Juni 2013

Did You Know? Ini adalah feature film Superman pertama yang tidak memunculkan kata Superman pada judulnya. Sama dengan film Batman, The Dark Knight. Sutradara film Zack Synder mendaftarkan Henry Cavill di Gym Jones untuk membentuk tubuh seperti Superman. Sama dengan yang dia lakukan pada aktor utama saat menyutradarai film 300. Ini adalah film pertama Superman yang tidak memunculkan feature kryptonite, kelemahan utama Superman. Film ini merupakan satu di antara tiga seri Superman yang tidak memunculkan musuh Superman, Lex Luthor. Dua seri lain adalah Superman III dan Superman and the Mole-Man.

BERASAL dari planet nun jauh yang bernama Krypton, lalu terdampar di bumi sejak kecil, Clark Kent menjalani hidup selayaknya manusia normal, berprofesi sebagai wartawan. Ketika menyadari kemampuannya, dia menjadi hero yang dicintai banyak orang. Itulah Superman dan itu pula inti Man of Steel yang akan menceritakan lagi darimana segalanya bermula. Harap-harap cemas mungkin jadi kata yang pas untuk menggambarkan perilisan film itu pada 14 Juni mendatang. Ya, gagalnya Superman Returns (2006) dalam memenuhi ekspektasi penonton tak ayal menjadi bayang-bayang kelam bagi catatan film franchise superhero yang satu itu. Siapa sangka niat Bryan Singer memilih Brandon Routh sebagai Clark Kent justru membawa petaka? Postur tubuh yang terkesan dimirip-miripkan dengan Christopher Reeve dan cerita yang dianggap terlalu dipaksakan kerap mencuat sebagai alasan kekecewaan penggemar. Lalu, apakah nasib Man of Steel akan sama kandasnya dengan Superman Returns atau justru sukses besar layaknya empat film Superman yang diperankanReevesebelumnya?Semuanya digantungkan pada pundak Zack Snyder, sang sutradara yang menjanjikan bahwa sosok pahlawan super kali ini akan tampil beda dan fresh. Diproduseri Christopher Nolan kabarnya membuat film itu akan dipenuhi warna yang serupa dengan trilogi Batman yang pernah digarapnya, yakni serius dan gelap. Rumor pun tak sekadar rumor ketika Snyder memberikan pernyataan kepada Los Angeles Times Hero Complex November lalu. ”Yang pasti, Superman kali ini akan lebih serius. Film ini tidak akan melulu membuat jantung Anda berdegup kencang. Kami membawanya dalam mitologi dan karakter yang serius,” ungkap pria yang terkenal sejak membidani 300 dan Watchmen tersebut. Meski bernuansa serius, Snyder juga menjelaskan bahwa Man

of Steel akan jadi film Superman dengan sajian modern. ”Ini adalah Superman era modern. Bukannya kami mengkhianati kisah Superman, tapi ini lebih terasa pas dengan realitas yang ada,” paparnya. Keseruan bertambah saat Henry Cavill yang memerankan tokoh Clark Kent ikut angkat bicara. ”Kami berusaha membuat film Superman yang membikin orang berpikir, ’Itulah yang akan kulakukan kalau aku jadi dia.’ Walaupun dia alien, karakternya akan terasa lebih manusia karena memiliki ikatan dengan kita,” tuturnya. Bentuk refresh lain pun hadir pada bentuk ”kelemahan” sang tokoh utama. Film dengan bujet 225 juta dolar AS itu akan jadi film Superman pertama dimana batu kryptonite tak jadi senjata andalan musuh saat menaklukkan Clark. ”Jujur saja kukatakan, tak ada lagi batu kryptonite, di sini hanya ada kryptonite emosional,”imbuh sang sutradara. Layaknya The Amazing Spider-Man (2012) yang juga merupakan film reboot, kisah Clark di sepanjang film berdurasi 143 menit itu pun akan tetap sama dengan sebelumnya. Hanya, disajikan intrik-intrik baru. ”Mengapa aku bisa berada di sini?” jadi pertanyaan utama sang tokoh yang diadopsi Jonathan Kent (Kevin Costner) dan Martha (Diane Lane). Keduanya mengajarkan banyak nilai kehidupan manusia hingga akhirnya Clark menemukan dirinya mempunyai kekuatan super. Ketika stabilitas bumi berada dalam bahaya, Clark pun harus menjadi ”manusia baja” untuk melindungi orang-orang yang dicintainya. Termasuk melindungi Lois Lane (Amy Adams) dari Jenderal Zod (Michael Shannon), musuh utama yang ingin membunuh Superman karena dendam kepada ayah kandungnya di planet Krypton, Jor-El (Russell Crowe). (*/det)











Tak Sembarangan Pilih Cast RUMOR yang merebak menganggap gagalnya Superman Returns pada 2006 terletak pada kesalahan sutradara dalam memilih Brandon Routh sebagai pemeran Clark Kent. Routh dicela tak mampu meneruskan takhta sang manusia super berkostum biru yang dulu diperankan Christoper Reeve. Tak mau jatuh ke lubang yang sama, pemilihan cast and crew di seri reboot kali ini akhirnya digarap sangat matang hingga memakan waktu lama. Saat casting pada akhir 2011, banyak nama terkenal yang digadang gadang akan menggantikan Routh. Mulai Matthew Goode, Armie Hammer, Matt Bomer, Joe Manganiello, Zac Efron, hingga Colin O’ Donoghue. Namun, akhirnya pilihan sutradara Zack Snyder jatuh pada Henry Cavill. Lucunya, dulu Cavill sebenarnya berada pada posisi kedua di bawah Routh saat pencalonan pemeran Superman di Superman Returns. Tak heran, kini dia tak akan menyianyiakan

kesempatan yang ada meski sempat diragukan publik. ’’Saya dengan senang hati menerima tanggung jawab tersebut. Ini kesempatan luar biasa yang saya dapatkan. Karena itu, saya tak akan membiarkan tekanan menghambat saya,” papar pria asal Inggris tersebut. Selain karakter Clark, peran-peran lain dalam film pun dipilih dengan banyak pertimbangan. Sebelum jatuh ke tangan Amy Adams, peran Lois Lane diperebutkan lebih dari 13 aktris. Antara lain, Natalie Portman, Kristen Stewart, Mila Kunis, dan Anne Hathaway. Tak hanya cast, pemilihan sutradara ternyata tak jauh berbeda. Darren Aronofsky, Duncan Jones, Ben Affleck, Tony Scott, Matt Reeves, dan Jonathan Liebesman masuk dalam nominasi sebelum Snyder dipilih pihak Warner Bross. Melihat begitu banyaknya usaha keras untuk film ini, kita tentu boleh optimistis bahwa Man of Steel tak akan terjerembap layaknya Superman Returns. (*/det)

Henry Cavill yang awalnya mengonsumsi 5.000 kalori harus menurunkannya menjadi 3.500 kalori untuk mendapatkan tubuh yang pas dalam film ini. Bahkan, dia juga menurunkannya menjadi 2.500 kalori untuk adegan telanjang dada di film tersebut. Film ini dirilis pada Juni 2013, tepat pada anniversary Superman ke-75. Superman kali pertama muncul pada tahun 1938.

Kecewa Tak Tayang DI BIOSKOP PONTIANAK DEMAM Korea masih membanjir di tanah air sobat Movie Freak X! Wuhuuu! Adakah satu atau beberapa bahkan semua dari sobat X yang K-Popers? Mulai dari lagu, dance, tren fashion, artis yang terkenal gantengganteng dan unyu sampai drama dan filmnya juga udah menjamur kayak panu di bumi pertiwi. Ada satu film Korea yang pernah ‘tampil’ nih. Membahas tentang belasan remaja Korea yang berjuang keras demi menjadi superstar yang hebat. Mulai dari audisi, masa training dan sampailah sekarang mereka menjadi artis terkenal. Semuanya dirangkum dalam I AM. BY : KANIA KAHARUNNISA

SM Entertaiment terkenal sebagai audisi yang paling ngetop artisartisnya. Nggak puas hanya dengan performa di atas panggung, agensi terbesar di Korea Selatan ini pun membuatkan para artisnya film tentang perjalanan hidup mereka. Hampir sama lah sobat dengan film dokumenter. Karena di film yang dibintangi hampir seluruh artisnya ini, benar-benar ditayangkan kehidupan mereka dari dulu sampai sekarang. Secara real! Wuih! Nowadays, kita remaja Pontianak tahu kalau nggak semua film yang rilis di pasaran akan ditayangkan juga di XXI. Ini juga terjadi sama film satu ini. Jadilah Dhea dan tementemennya harus rela gigit jari karena nggak kesampaian nonton secara live di bioskop kesayangan. “Sayang di Pontianak nggak ditayangin. Padahal banyak yang udah nunggu filmnya,” komentarnya dengan nada yang sedikit kecewa. Yup! Film I AM ini cuma disetel di Blitz Megaplex Jakarta dan juga beberapa bioskop di Jogja. Dhea yang

masih tercatat sebagai mahasiswa sih. Ada kaset, waktu bosen nggak ada semester 2 Fakultas Ekonomi ini harus kerjaan tinggal puter aja lagi kaset yang rela nonton lewat kaset yang dibelinya udah dibeli. Tapi jangan keterusan bersama temen-temen. Kasiaaan. beli ‘bajakan’ sobat. Kasian sama para Memang hasil gambar yang ditonton pemainnya yang udah capek-capek jauh dari kata bagus. Tapi mau gimana syuting tapi ternyata fansnya tetep beli lagi, namanya udah yang bajakan. ngebet pasti apapun Doi ternyata dilakuin. Doi yang ngefans berat lho ngaku terpaksa beli s a ma He n r y d a n kaset ‘bajakan’ ini Yesung Super Junior, sepanjang nonton Changmin DBSK , matanya harus teliti Yoona SNSD, dan juga dan jeli dengan setiap nggak ketinggalan adegan. Nggak capek si imut berjulukan apa itu mata? dancing machine “Mau nonton Taemin SHINee. “Suka secara langsung aja ngeliat mereka nggak mungkin. ngedance. Perjuangan Pasti udah berat mereka buat bisa jago diongkos pesawat nari dan nyanyi kayak sama penginapannya. sekarang lumayan Jadilah nonton yang berat, jadi terharu agak buram-buram, sendiri nontonnya. yang penting udah Apalagi waktu mulai puas nonton berkalidebut. Nonton mereka k a l i . H a h a h a ,” di atas panggung tuh Dhea Nur Aisyah guraunya. Bener juga sesuatu yang paling Mahasiswi Ekonomi Untan





ditunggu-tunggu,” bebernya. Dhea yang terlalu demen sama Korea ini keliatannya udah menjadi satu sama film. Sampai-sampai waktu diliatin cuplikan keluarga si artis datang berkunjung, doi juga ikutan terharu. Sampe mewek nggak ya? Hehehe. Terasa banget mungkin ya kangen sama keluarga? Secara selama dalam masa pelatihan atau bahasa kerennya training, mereka jarang bahkan nggak sempat mengunjungi keluarga. Kasian ya. So guys, kembali berdoalah kalian para pecinta film luar negeri agar pihak bioskop kesayangan kita lebih bijaksana dalam memilih film. Jadi ya boleh lah nyangkut-nyangkut dikit film Korea favorit kita yang bisa ditonton secara langsung. Just like I AM. Mulailah juga hargai karya para seniman-seniman yang bener-bener berusaha semampu mereka demi membuat sebuah hasil yang bisa kita nikmati tanpa harus bersusah payah ikut langsung dalam pembuatan filmnya.**

Di Thailand, ada sebuah restoran dengan konsep unik dan sedikit ‘nakal’. Adalah Cabbage & Condoms Restaurant, restoran bertemakan kondom yang mungkin menjadi satu-satunya di dunia. Sesuai namanya, restoran ini dipenuhi dengan ornamen yang terbuat dari kondom. Mulai dari hiasan lampion, bunga-bunga hingga patung Thailand yang dibuat dari kondom dengan sedikit tambahan pil pengontrol kehamilan.

SALAH satu peralatan penting untuk memasak dan membuat kue adalah timbangan makanan. Alat pengukur ini berfungsi untuk memastikan bahwa setiap bahan makanan yang akan Anda olah memiliki berat dan takaran yang pas. Karena itulah, timbangan makanan yang akurat menjadi salah satu kunci keberhasilan mengolah makanan. Ada dua jenis timbangan makanan yang banyak dipakai, yaitu timbangan dengan jarum pengukur dan timbangan digital. Keduanya samasama baik, sekalipun timbangan digital memang lebih akurat. Yang harus Anda perhatikan adalah penanganan dan perawatan timbangan (jenis apapun) agar tetap awet dan menghasilkan pengukuran yang akurat.



Pontianak Post Kamis 13 Juni 2013

1. Jauhkan timbangan makanan dari jangkauan anakanak.Simpanditempat yang tidak dapat mereka jangkau agar tidak dipakai sebagai mainan.

3. Lapisi piring timbangan saat harus dipakai bergantian untuk menimbang bahan. Penggunaan plastik atau piring tipis lebih disarankan.

2. Jika bagian atas timbangan memiliki wadah berupa piring, maka lepas piring tersebut saat menyimpan timbangan dan jangan menimpa timbangan saat proses penyimpanan.

4. Pastikan timbangan berada pada angka nol saat piring timbangan telah diletakkan pada timbangan.







5. Khusus untuk timbangan dengan jarum ukur, jangan

terlalu sering memutar tombol skala karena akan membuat timbangan tidak akurat. Pakai metode kurang atau tambah daripada memutar skala timbangan setiap kali menimbang dengan piring atau wadah lain (selain piring bawaan timbangan). 6. Tidak perlu mencuci seluruh bagian timbangan, baik timbangan yang memakai

skala jarum atau timbangan digital. Cukup cuci bagian piring timbangan dan lap dengan kain bersih jika ada noda bahan makanan yang menempel pada badan utama timbangan. Dengantipsdiatas,makatimbangan Anda tidak hanya awet secara fisik, tetapi juga keakuratan pengukuran yang tepat untuk menghasilkan berbagai hidangan lezat. (*/vem)


Pontianak Post


Kamis 13 Juni 2013





C cmyk





Pontianak Post


Kamis 13 Juni 2013





C cmyk




Pontianak Post


Kamis 13 Juni 2013


Kalbar Raih Juara III


PONTIANAK—Kejuaraan nasional persatuan atletik master Indonesia (PAMI) berakhir di Stadion Sultan Syarif Abdurahman, Minggu (9/6) lalu. “Hasil kejuaran tersebut cukup memuaskan. Sesuai yang diharapkan. PAMI Kalbar berhasil meraih juara tiga. Sedangkan juara umum dari DKI Jakarta,” ungkap Titin Fatimah, Ketua Panitia Kejurnas, Rabu (12/6). Dari kejuaraan itu DKI Jakarta memperoleh medali 55 emas, 38 perak, dan 19 perunggu. Juara II berhasil direbut atletik Jawa Timur dengan raih medali 49 emas, 38 perak, dan 22 perunggu. Untuk juara III berhasil diraih oleh altet dari tuan rumah Kalbar membawa medali 44 emas, 38 perak, dan 33 perunggu. Di peringkat keempat Jawa Barat dengan meraih medali28emas,25perak,dan20perunggu.Terakhir posisikelimadimenangkandariKalimantanSelatan yakni medali 15 emas, 6 perak, dan 11 perunggu. “Ajang ini dihelat selama dua tahun sekali dengan berbagai rangkaian perlombaan,” ujar Titin. Disamping itu, Serpani, Ketua Umum PAMI Kalbar menambahkan perolehan medali atlet master Kalbarsangatluarbiasa.Haltersebutmembuatnya bangga. Sebab kata dia diusia rata-rata diatas 50 tahun ternyata masih ada yang aktif mengikuti kejuaraan. Selain itu dia juga mengatakan ajang tersebut juga sebagai motivasi bagi atlet-atlet muda. Alhasil, mereka dapat melihatnya secara langsung perlombaan sehingga diharapkan dapat menjadi inspirasi untuk pemuda Indonesia untuk berprestasi lebih baik lagi. “Saya berharap semangat yang dimiliki oleh atlet master. Menjadi spirit generasi muda Indonesia. Diusia yang tidak muda mereka masih tetap komitmen meraih prestasi. Untuk itu kaula muda mesti lebih semangat lagi,”ungkapnya. (irn)



Pelindo dan Arsekon Saling Jegal


JEGAL : Dua tim tangguh yakni Pelindo II dan Arsekon sudah harus jegal di babak penyisihan grup. Begitu juga di kategori fans club, dua grup tangguh yakni Indo Barca dan Milanisti juga harus berjibaku.

Indo Barca dan Milan di Grup Neraka PONTIANAK--Lima tim tangguh memastikan bentrok di awal kompetisi dalam grup A, di ajang futsal bergengsi AJS-KONI LIFU-

MAR Cup VIII yang akan berlangsung 15-29 Juni mendatang di GOR Pangsuma Pontianak. Kelima tim tersebut yakni CBF, Dispenda A, Levis Kenzo A, Pelindo II dan Arsekon. “Pool A ini menjadi grup yang berat, sebab, didalamnya bercokol tim-tim kuat. Diprediksi persaingan di grup ini akan sangat ketat dan menarik,” ujar Drs Dedi Juzari,

Koordinator Wasit AJS-KONI Lifumar Cup VIII. Selain di grup A, di pool B dan C juga layak disebut sebagai grup neraka. Dalam acara cabut undi yangdilaksanakanRabukemarindi GOR Pangsuma Pontianak, empat tim tangguh masuk dalam pool ini. Di grup B bercokol Panthom, Garuda Jr, Gapikan dan Adhika. Sementara di grup C akan saling

jegal Bank Kalbar A, Alam Kita FC, POP dan Safani. Kemudian di grup D akan bersaing memperebutkan dua tiket ke babak selanjutnya yakni Bansai FC, Anuresi, Levis Kenzo B dan Ola. Di grup E, Arwana, Garuda, Surah Khatulistiwa, Tansil dan Jung-Jung. Di grup F, ada Bilal, Selasih, Pontianak Eleven dan Bank Kalbar B. Grup G, akan bentrok Three Lion,

Uzwa, Prodigio, Getika. Dan di grup H akan berjibaku Pandawa Jaya, AJC, Untan dan Dispenda B. Lagaserudanmenarikjugaakan tersaji di kategori internasional fans club. Di kategori ini, pool A layak disebut sebagai grup neraka. Sebab, disitu bercokol tiga tim tangguh yakni Arsenal, Indo Barca dan Milanisti. Kemudian di grup B, akan bersaing merebutkan dua tiket ke babak selanjutnya yakni, Inter Milan, PSG, Lazio dan Juventus. Sementara di grup C, akan saling bentrok UICP (MU), Indo Spurs Pontianak, Manchester City (MCSC) dan Romanisti. Di grup D, akan bertarung, Big Red Pontianak, Madridista, Chelsea Pontianak dan Bayern Muenchen. Ketua Panitia Pelaksana, Frendi Rahman mengungkapkan laga akan dimulai tanggal 15 Juni mendatang. Untuk jadwal pertandingan untuk kategori umum, SLTA, Fans Club dan SLTP bisa dilihat langsung di Sekretariat GOR Pangsuma Pontianak tanggal 14 Juni. “Jadwal akan ditempelkan di depan pintu masuk GOR Pangsuma atau di depan loket tiket,” tandasnya seraya mengatakan untuk technical meeting kategori antar pengcab akan dilaksanakan tanggal 14 Juni di GOR Pangsuma Pontianak. (bdi)


Madridista Target Final, Bank Kalbar Semifinal AJS-KONI Lifumar Cup VIII

PONTIANAK—Tim Futsal Real Madrid (Madridista) yang akan bertarung dalam kompetisi Internasional Fans Club AJS-KONI Lifumar Futsal Cup VIII, 15-29 Juni mendatang siap mempertahankan gelar juara yang direbutnya pada Seri keVII lalu. Kendati tanpa pemain

pilar karena para kontestan yang berlaga dibatasi, namun tim Los Blancos ini sudah menyatakan siap tempur dan menargetkan lolos ke babak final. “Ini target yang cukup berat, mengingat para pemain pilar kami banyak bermain di klub, sehingga yang memperkuat tim ini rata-rata adalah pemain baru,” ungkap Pratama Kiper Madridista. Selain merebut gelar juara di AJS KONI Lifumar Cup VII lalu,

Madridista juga meraih dua gelar lainnya, yakni the best player dan the best supporter. “Kemarin merupakan prestasi tertinggi kami. Mudah-mudahan bisa kami ulang kembali pada seri ini,” harap dia. Ditanya mengenai lawan berat yang akan dihadapi, Pratama mengatakan seluruh tim yang tampil di even ini merupakan tim yang tangguh. Terutama tim yang sering menjadi lawan tandingnya di

babak empat besar, seperti, MU dan Barcelona. “Tim ini memang selalu menjadi langganan final. Dan kita akui mereka merupakan lawan yang cukup tangguh,” ujar dia. Sementara itu, pelatih Bank Kalbar Yahya Busra mengatakan di kompetisi AJS-KONI Futsal Seri VIII ini, tim yang baru saja merebut posisi empat besar di kejurnas Bank Daerah se-Indonesia di Palembang beberapa waktu


lalu tampil berbeda. “Di seri ini kami menurunkan dua tim, yakni Bank Kalbar A dan Bank Kalbar B. Kami tak berani menargetkan yang mulukmuluk, hanya semifinal. Syukur-syukur lolos ke final,” katanya seraya mengucapkan terima kasih kepada jajaran direksi Bank Kalbar yang selalu mensupport keikutsertaan tim futsal Bank Kalbar di even-even bergengsi seperti ini. (bdi)


DUKUNG : Para madridista se-Kalbar siap kembali mendukung tim kebanggaanya dalam AJS-KONI Lifumar Cup VIII yang akan bergulir 15-29 Juni mendatang di GOR Pangsuma Pontianak.


C cmyk





Pontianak Post





Kamis 13 Mei 2013

1POUJBOBL1PTUrKamis 13 Juni 2013





1POUJBOBL1PTUrKamis 13 Juni 2013




1POUJBOBL1PTUrKamis 13 Juni 2013


1POUJBOBL1PTUrKamis 13 Juni 2013






1POUJBOBL1PTUrKamis 13 Juni 2013

Read more
Read more
Similar to
Popular now
Just for you