Support
MY WEEKLY
PREVIEW
FREE Take me home
Crystal ball 2021 property predictions
New year New you make self-care a priority this year ISSUE 636 JANUARY 7, 2021 SUNSHINE COAST >> 100% LOCALLY OWNED
01.indd 1
plus LETTERS PUZZLES TV GUIDE PROPERTY LOCAL NEWS
TAKE CARE
1.5 metres
23/12/2020 9:19:57 AM
02.indd 1
4/01/2021 2:21:30 PM
03.indd 1
4/01/2021 2:21:52 PM
EXPERIENCE THE ŠKODA SUV RANGE One for every lifestyle
Cricks ŠKODA Sunshine Coast 88 Sugar Road, Maroochydore (07) 5450 3300 1806686 www.cricksskodasunshinecoast.com.au
04.indd 1
22/12/2020 2:19:07 PM
FIRST WORD
Win!
My style Local finds you will love. 38 > ON THE COVER Look great, feel great and be your best self in 2021 with tips from our health, style and mindfulness gurus.
From the editor A pair of sustainable sandals Win one of two pairs of Flipslide sandals by Biome – the simple and sustainable alternative to flip-flops. Flipslides are made of renewable materials, manufactured in a way to keep waste low and are affordable. All FlipSlide components are made of natural rubber, sustainably tapped from rubber trees in a similar manner as maple syrup is extracted from a maple tree. This differs to the materials commonly found in flip-flops; synthetic rubber and polyurethane foam, which are both derived from petroleum, damage our environment and clog our oceans. Flipslides are kind to the earth, your feet and your wallet, priced at only $34.00. Visit biome.com.au.
Welcome to our first edition of 2021. The new year is a great time to pause, think and most likely resolve to do things a little better than last year. We acknowledge the start of the year with a cover story focusing on how we can get the best out of this year through taking care of our mind, body, style and spirit. Following on from these practical tips, columnist Sami Muirhead gives us a hilarious, truthful and kind account of her relationship with new year’s resolutions. Her thoughts definitely resonate with my own style of resolution making. Additionally, our news pages start with a pictorial of the big moments in 2020. I’m sure these pictures will provide you with another opportunity to look back as you plan for the future. In terms of our editorial content, I believe
we share a common goal on the Sunshine Coast to protect and better our environment and provide a lifestyle that values education, health, work and leisure opportunities. I also know there are diverse opinions about how we go about achieving these goals. With that mind, this year I look forward to reflecting varying perspectives in our stories and on our letters page. It’s fine to disagree in a respectful and courteous manner, that’s what democracy is all about. Through reading, listening and understanding another’s viewpoint, we have the opportunity of broadening our own perspectives and that’s good for everyone. To quote John Lennon: “Happy New Year, let’s hope it’s a good one, without any fear”. Wishing all our readers a wonder-filled year. Gail Forrer gforrer@myweeklypreview.com.au
More local news See page 30 >
My health See page 42 >
Your property See page 45 >
Trades & services See page 69 >
TV guide See page 70 >
A family pass Magical World of Crazy Science is the ultimate in science on stage for all ages. It incorporates science, magic, comedy, mime and music and is hosted by Richard Scholes. We have one family pass (four tickets) to see the show at Venue 114 on Thursday, January 14 at 10am. For your chance to win, visit our website myweeklypreview.com.au.
THIS WEEK Facts – Wrap your head around 8 Fast these fascinating facts.
10
Cover Story – Reinvent yourself this year with tips from our experts.
26
What’s On – Find out what’s happening in your neighbourhood.
35
Puzzles – Grab a cuppa and get stuck into our puzzles page.
37
My Body – Beauty trends and new products launching in 2021.
– Get up-to-date with the 42 Health latest health news.
editorial@myweeklypreview.com.au | sales@myweeklypreview.com.au PO Box 6362, Maroochydore BC, Qld 4558. PHONE: 5444 0152 PUBLISHERS: Anar Higgins, Darryl Olson, Michael Kramer, Noel Olson DISTRIBUTION: distribution@myweeklypreview.com.au. For publishers’ statement see the TV guide.
facebook.com/myweeklypreview facebook.com/scnews2020 facebook.com/saltmagazine-232603834545/ facebook.com/yourtimemagazine @myweeklypreview @sunshinecoastnews @saltmag @mystyle_mwp @my_renovation
Add on Xbox Series X with Xbox All Access. $0 upfront. $46/mth when you stay connected for 24 mths. Exclusive to Telstra customers, excluding pre-paid and business. Min cost $1,104 + existing plan charges. Come in to Telstra Stores Caloundra, Kawana, Nambour & Birtinya to find out more.
myweeklypreview.com.au
05.indd 1
My Weekly Preview | January 7, 2021 5
4/01/2021 2:07:54 PM
AGENDA
MARCH 26,, 2020
APRIL 6,, 2020
APRIL 10,, 2020
C Crew on b board d th the R Ruby b P Princess i as th the cruise i li liner d docks k att Port Kembla, Wollongong.
THE YEAR IN
pictures
Th Pacific The P ifi Highway Hi h near the th New N South S th Wales/Queensland W l /Q l d border as authorities try to stop the spread of coronavirus.
We made it through one of the worst years in living memory and as we head into 2021 with hope for a better year, we look back at some of the key moments of 2020. Images: AAP.
APRIL 25,, 2020
Catholic Mark Coleridge delivers aG Good Friday C th li archbishop hbi h M kC l idg d li dF id mass to an empty St Stephen’s cathedral in Brisbane.
NOVEMBER 1, 2020
MAY 26,, 2020
Tammy Concannon stands outside her home at dawn to commemorate Anzac Day in Brisbane.
Lex and June Frew walk in their burnt property Yaminon in Bendalong. Both were badly burnt in the bushfires.
Queensland Premier Annastacia Palaszczuk celebrates winning a third term at The Blue Fin Fishing Club, Brisbane.
HOP ON BOARD A HERITAGE
TRAIN JOURNEY COME AND EXPLORE THE HISTORIC
GYMPIE STATION
ENJOY A COFFEE & BITE TO EAT AT THE
PLATFORM NO. 1 CAFE
@maryvalleyrattler Historic Gympie Station 10 Tozer Street Gympie, QLD. 07 5482 2750 6 My Weekly Preview | January 7, 2021
06.indd 1
Visit the website for tickets to our upcoming events:
www.maryvalleyrattler.com.au myweeklypreview.com.au
22/12/2020 12:37:00 PM
50
%
OFF
SHUTTERS!
40
and
%
OFF
AWNINGS, BLINDS AND CURTAINS!
WHY FACTORY DIRECT? Professional service and advice at the best price. And as you see, we have a truly extensive range of shutters, awnings, blinds and curtains.
Tra nsf orm your
y! a d o t e hom
FACTORYDIRECT shutters, awnings & blinds
Sale ends Saturday 30 January, 2021.
CALL US TODAY ON 1300 077 125 | www.fdshutters.com.au 07.indd 1
22/12/2020 2:20:08 PM
FAST FACTS
Did you know?
How do you celebrate?
The people of Denmark practice throwing dishes on people’s doorsteps. This is believed to bring many new friends to the person who cops the dishes on their doorstep.
View of Mount Everest, Nepal with prayer flags in the foreground The tallest mountain on Earth is under the ocean. Mauna Kea in Hawaii is 10,200 metres (33,465 feet) high. Mount Everest is 8,848 metres (29,029 feet) high.
108 Quote of the week. “Cheers to a new year and another chance for us to get it right.� – Oprah Winfrey
In Japan, the bells in Buddhist Temples are rung 108 times. They do this to welcome the God of New Year known as Toshigami.
What is it worth?
January 1 was accepted as New Year in 46 BC by Julius Caesar. England and the American colonies of England adopted the date a long time later in 1752. In Greece, you will find kremmida or onions hanging on the front doors. They hang onions on their doors on New Year’s Eve, wishing their children goodwill.
The first Holden to be made in Australia (1948), was a prototype for the country’s first massproduced car the 48-215 or Humpy, sold for $668, 750 in October 2013. The car was formerly owned by West Australian property developer Peter Briggs, who bought it for about $15,000 in 1980.
Today in history – January 7 1848 – Gas lights first installed at the White House.
12 Spanish tradition is to eat 12 grapes at midnight of December 31. While eating these grapes, Spaniards make wishes. This tradition is believed to bring good luck for those who practice it. This grape eating tradition started back in 1895.
1891 – Edison patents “transmission of signals electrically� (radio). 1933 – Sons of the Desert film directed by William A. Seiter starring Stan Laurel and Oliver Hardy is released. 1949 – Hungary nationalised its industries. 1952 – First transistorised hearing aid offered for sale (Elmsford NY). 1965 – Thunderball, the fourth James Bond film starring Sean Connery and Claudine Auger premiers in Tokyo.
Word of the day. Deipnosophist A person with excellent dinner table conversation skills.
Providing essential hearing services for locals SERVICES INCLUDE: z
Complimentary hearing check*
z
Trials of the latest hearing aids - including NEW LIVIO EDGE AI!
z
FREE Hearing aids and services for eligible** Pensioners and Veterans (on behalf of the Hearing Services Program)
z
Onsite hearing aid repairs and batteries
z
Noise Protection
z
Friendly Professional Service
CALL NOW TO BOOK AN APPOINTMENT ON 5492 6939 Shop 2, 45-47 Minchinton Street, CALOUNDRA z z z z z 8 My Weekly Preview | January 7, 2021
08.indd 1
* for over 26 years of age ** As per the Government Hearing Services Program guidelines
myweeklypreview.com.au
22/12/2020 12:38:15 PM
$ UP TO
$25,000 NEW HOME CASH BACK*
+
Platinum RANGE
FREE LUXURY UPGRADES*
A perfect summer lifestyle.
UP TO $10,000
At Nature’s Edge Buderim, the summer lifestyle is resort-style, every day! What better way to enjoy this summer
spacious outdoor areas are perfect for our
than with a luxury Leisure Centre
enviable Queensland climate.
precinct right on your doorstep? Cool
A range of brand new designer homes
off in the 20-metre indoor pool, escape
are ready to more into right now! PLUS,
the heat in the air-conditioned cinema
with up to $25,000 New Home Cash Back
and catch up for twilight drinks on the
and up to $10,000 in Platinum upgrades
rainforest deck after a fun filled day.
on offer, now’s the perfect time to secure
With summer social activities now
your summer resort-style lifestyle.*
in full swing at Nature’s Edge Buderim, there’s always plenty to do … social bowls,
No entry or exit fees
water aerobics, table tennis, stretch and
No stamp duty
relaxation classes, workshop, art and
Keep 100% of capital gain
craft, beach walks and much more. The Nature’s Edge home collection has
No rentals
been architecturally designed to make
Call one of the Nature’s Edge Buderim
the most of the tranquil rainforest setting
lifestyle advisers on 1800 218 898
and carefully considered floorplans with
or visit naturesedgebuderim.com.au
Visit our new display homes any day at 25 Owen Creek Road, Forest Glen Open Monday to Friday 9am-5pm Saturday 10am-4pm, Sunday 10am-3pm *Terms and conditions apply. Offer available only on unconditional contracts signed on a selected range of homes while stocks last. Platinum range inclusions up to the value of $10,000. Photos: Display home images for illustrative purposes only.
09.indd 1
Telephone 1800 218 898 info@naturesedgebuderim.com.au www.naturesedgebuderim.com.au
22/12/2020 2:20:26 PM
COVER STORY
New year new you Want to reinvent yourself this year? We spoke to four experts in their fields to get their top tips on getting fit and losing weight, revamping your style, reducing stress, becoming more mindful and cleaning up your diet. Compiled by Leigh Robshaw.
NUTRITION By Cyndi O’Meara Author and founder of Changing Habits changinghabits.com.au
A
better way of eating isn’t a diet, it becomes a way of life. It will enhance your lifestyle, allowing you to stay active, and physically and mentally well, leading to a happier sense of self. A common story I hear is people sticking to a diet for six weeks or so, losing some weight, and then going back to their old ways, believing that they won’t regain the weight. Delusion sets in, thinking that they can do the same thing and get a different result. People start a diet because, for the most part, they need to lose weight and they are in that predicament because of the food and lifestyle choices they have
10 My Weekly Preview | January 7, 2021
10.indd 1
previously made. Therefore, going back to the old ways of eating means that the predicament will return. There are two types of diets out there. The first is the quick-fix diet (such as the prepared-meal or meal-replacement diet). These do not educate about food. The second type of diet is a teaching diet, where you are asked to move away from any processed foods that you have been consuming, like white bread, margarine and other refined foods, towards a more real food diet. This kind of diet means you get back into the kitchen to feed and nourish yourself to heal any health and/or weight issues. My advice for those trying to lose weight is to consider a supported lifestyle program like the Changing Habits Healthy Keto Way or Fat Loss Protocol. These strip back your food choices before slowly reintroducing foods. This allows you to understand if a specific food causes weight gain or illness, and to truly realise which foods heal and nourish your body. Education is the key – changing habits and maintaining those new habits create lifelong change. When the higher brain is in control we make better decisions (as opposed to when the lower reptilian brain is in control and we make decisions based on survival, rather than thriving). Stop blaming the diet and start taking responsibility for what you are consuming.
STYLE By Nikki Parkinson Founder of fashion blog Styling You stylingyou.com.au
B
lanket style rules are disappearing from the world of fashion. Trends are no longer being set purely on the international (virtual) fashion catwalks. We are more likely to take our fashion cues from women around us – on Instagram and Pinterest, best friends and work colleagues. No longer do we reach a certain age, only to be pigeonholed into wearing what our grandmothers did at our age. Thank goodness! What it took me a long time to understand was that life is made up of many ‘seasons’, if you like. And we might change as the seasons do. And that’s okay.
If you’re sitting at the start of 2021 after a year when you’ve fully embraced leisure wear (no judgement here), you might feel like you’re at the start of a new season. I certainly do. Your style might not go back to pre-COVID times, but you might want to change things up a bit. My surefire method for doing this comes with three easy steps: 1. Spend quality time editing and de-cluttering your wardrobe. Pull everything out and only put back in pieces that make you feel fabulous when wearing them. Sentimental pieces can be boxed away. 2. Do you have your wardrobe basics covered? That amazing pair of jeans? That perfect white tee? That little black dress? Your list of basics might differ from another, but if you make sure you have these wardrobe warrior pieces, the daily ‘what to wear’ question will never be stressful. 3. Sprinkle your wardrobe with showpony pieces. Clothing and accessories in different colours, textures and prints help to show your personality to the world. Choose wisely and they will give you immediate confidence boosts. If you always come back to how you feel in an outfit, rather than following fashion rules or trends, then you’ll be better able to face whatever your day dishes up at you. myweeklypreview.com.au
22/12/2020 12:43:43 PM
COVER STORY
MIND By Erin Lee Founder of The Mindful Yoga School themindfulyogaschool.com
O
ne of the biggest reasons I hear, when people struggle to create a consistent yoga or meditation practice, is they think they’re too busy and that it’s going to take time away from all the other things they should be doing. Yet so much of our ‘dis-ease’ in broader society is stress related, with the mind overworking and being lost in the world of so many things going on. Mindful practices like yoga and meditation are wonderful antidotes for busyness. With consistent practise we can refocus and get back in control of our relationship with our physical, mental, emotional and spiritual wellbeing. We become less busy, yet more fulfilled and satisfied with our doing. In this way,
mindful practices can actually help us to feel like we’re enjoying life more – even achieving more, and on a deeper level. Author Dan Millman says, “Dream big, start small, and then connect the dots.” Beginning a shorter, yet more frequent practice of yoga and/or meditation is the key to making a difference in your life sooner. A three-minute breathing space meditation, or a 15-minute yoga practice is all you need to begin with, and preferably at the beginning of each day. Set up a time for it in your calendar, just as you would with any other important appointment. Those who opt for longer, hour-long practices when first starting may be quicker to lose motivation because not only will they find so many other activities to fill that hour with, it can also be very confronting when we first turn the attention inwards. We can uncover all sorts of ‘interesting’ sensations of constriction, long-held beliefs, unpleasant emotions and a very busy mind. Not the most enjoyable experience to begin with! True mindfulness mastery is when you can carry the ‘less-busy’ and more calm, connected version of you out into everyday life – into your relationships, your work, and how you relate to life’s unfolding events – pleasant or unpleasant. It can be a matter of only weeks, or even days before you’ll start noticing the ripple effect of your regular, shorter practice out into everyday life. Easing your way in with small yet consistent bites of time is the key to reaping the rewards sooner than you might imagine.
DID YOU KNOW? Motivational speaker and author Tony Robbins says most people ditch their New Year’s resolutions by February, so it’s better to set goals. “A goal is a series of calculated steps designed to help you achieve the resolution,” he writes. “By this definition, it may be more straightforward to think of goals as the planned-out process of achieving your resolution.” So, what’s the point of New Year’s resolutions? Mr Robbins says they create a result to focus your goal-setting on. “Goals, not resolutions, are the key to long-term growth and success. And the secret to setting compelling goals is knowing why it is you want what you want – finding purpose and meaning in your goals.”
BODY By Leon Stensholm Bodybuilder and personal trainer bodybyleon.com.au
G
oal number one when starting a fitness journey is knowing your why. Write it down so if you ever lose your way, you can go back to your why. When starting an exercise routine, you first must train to specificity. This simply means designing a plan specific to your goal. So, if your goal is to be fit and improve your running, you would primarily focus on running. If your goal is to build muscle, then resistance training is a must for this to happen. If your goal is fat loss, then you will need a combination of resistance training and look at expending more energy daily by simply moving more. To lose fat, we need to burn more calories than we consume so we are in a caloric deficit, as it enables our body to burn more fat. Muscle controls our metabolism and that is the biggest key to fat loss and long-term weight management. A great starting point with your nutrition is simply start by tuning up your diet. Less alcohol, drop the sugary drinks, have less butter and oils in your cooking, grill don’t fry. Simple changes to start will go a long way and this will create a calorie deficit alone and encourage fat loss.
Add in lean protein sources, lean meats, chicken, fish, turkey and eggs, along with great carbohydrate sources like fruits, grains, vegetables, rice, sweet potato and potatoes just to name a few. It is also essential we add unsaturated fats, like avocados, seeds, almonds, salmon and whole eggs, as these are great for our hormones, insulate us and help protect our vital organs. You then can go another level and start by weighing your food and tracking what you eat using apps like MyFitnessPal. If you know your daily intake of calories, you then know that if you are not losing weight, you can make slight adjustments. A builder does not build a house without knowing his/her measurements, so it makes sense with fat loss to know your variables. But the most important thing is that you enjoy the journey you choose. It’s
“Muscle controls our metabolism and that is the biggest key to fat loss and long-term weight management” way easier to stay motivated if you enjoy your chosen exercise. Always strive for progression over perfection. Look at improving and progressing on one new behaviour or exercise weekly. Start with just a few times a week and build the process up weekly. This will help build momentum at a steady consistent pace. Rome was not built in a day. Lastly, switch your focus to your wins and the great things you achieved that week over what you felt didn’t go to plan. This is immensely powerful for motivation moving forward.
BO
M O C A DE L!
2 x Lunch Size Pies + 3 x Sausage Rolls Combo FOR ONLY $19.95 (normally up to $32.40)
Your tastebuds will thank you... ANY 2 x Award Winning Lunch Size Pies + ANY 3 x Sausage Rolls FOR ONLY $19.95. Including Gluten Free. Gluten Free e Options
myweeklypreview.com.au
11.indd 1
Not valid with any other offer. Hand in this coupon in store to redeem. Hurry... this deal must finish Thursday 14th January 2021.
My Weekly Preview | January 7, 2021 11
22/12/2020 12:43:26 PM
We work for our clients, the investors and home buyers, in helping ďŹ nd the very best property, in the right location and time the market for the best advantage.
12.indd 1
4/01/2021 9:37:25 AM
events
RST FIR HOME OWNERS BOOTCAMP
13.indd 1
4/01/2021 9:37:36 AM
NEWS SUMMARY
NEWS
PREVIEW
4232 TONNES James Stickland’s Mooloolaba Dawn Service was a finalist in 2020 art prize.
A solar-powered ‘water battery’ that keeps the entire University of the Sunshine Coast campus cool has saved more than 4232 tonnes of carbon dioxide emissions in its first year of operation. The carbon dioxide saving at the campus is believed to be the equivalent of planting almost 70,000 trees and growing them for 10 years. USC partnered with environmental solutions company Veolia to build a thermal energy storage tank and install more than 6500 solar panels across campus rooftops and carpark structures. Vice-chancellor and Professor Helen Bartlett says the system’s success is a major milestone towards the university’s goal of becoming carbon neutral by 2025.
LOCAL GOOD ROOT BEER LAUNCHED
UP TO $13,500 FOR ARTISTS
GET OUT AND ABOUT
Just in time for summer, Good Root Beer has officially launched at North Arm’s Terella Brewing. Tarella is the first brewery in the world to offer the beer on tap, produced using sustainably sourced barley roots. “Good Root Beer is made from Australian barley that has Australian Sustainable Produce Certification and we’re keen for Australian consumers to learn more about regenerative farming systems, and how great management – and good roots – can vastly reduce agricultural emissions and start accumulating carbon back into the soil,” Good Root Beer spokesperson Miriam Neilson says. A University of Queensland study shows ASP Certified wheat has more than 75 per cent fewer emissions than conventional wheat production. The Good Root Beer company is now working with the same group of scientists to specifically calculate emissions and environmental savings on barley as well.
Entries for the Local Artists – Local Content 2021 Art Prize are now open. In its seventh year, the Friends Regional Gallery Caloundra, in partnership with the Caloundra Regional Gallery, is inviting artists to submit two and threedimensional works that speak to what makes our region special. A total prize package of $13,500 is on offer. Open to any artist living on the Coast, the prize attracts hundreds of entries. Only the top 40 finalists will be selected to go on exhibition at Caloundra Regional Gallery from March 19 to May 2. Entries are open until January 15. Visit gallery.sunshinecoast.qld.gov.au.
Sunshine Coast residents and visitors will be spoiled for choice with plenty of places to see and things to do these holidays, with hundreds of beaches, parks and playgrounds to experience in our own backyard. Sunshine Coast Council’s Beaches and Parks directory features detailed information on more than 300 barbecues, 220 beach access points, 35 fenced and unfenced dog exercise areas, seven community gardens, 1145 parks and 350 playgrounds. Highlights include the newly patrolled Bokarina Beach and upgraded Russell Family Park in Montville.
AUSTRALIAN MADE QUALITY SCREENS & CURTAINS AT GREAT PRICES SHUTTERS - Up to 35% off
AWNINGS - 20 % off
BLINDS - Up to 35% off
CURTAINS - 20% off all fabrics
Poly Vinyl Shutters, Basswood, Vogue Polyresin.
Automatic, Folding Arm, Ziptrak, Motorised, Wire Guide, Fixed Frame, Pivot Arm, Multistop. All Australian Made
Roller Blinds, Romans, Venetians, Vertical Blinds, Panel Glides, Verishade, Ziptrak internal all Australian Made
Sheer, Blockout, Valances, Pelmets, Bedheads, Lined fabrics, Un-lined fabrics, Silicone coated, Linen, Natural Fibres, Machine washable
Locally Made available 4 week turnaround
We’ve been providing quality blinds, screens and curtains that are made to withstand the Sunshine Coast climate since 1982. Our loyal customers receive end-to-end service that includes local manufacture, installation and after-sales support. Our local team of over 20 specialised staff are based in our interactive showroom.
Covering the Coast from Caloundra to Gympie
Book your free quote today! Phone 5327 3414.
Visit our 100m2 interactive showroom
homepoint.com.au/Preview *Installers fee a minimum of $55 applies to all orders under $1,000. ^ Limited liability 5 year warranty.
14 My Weekly Preview | January 7, 2021
14.indd 1
myweeklypreview.com.au
22/12/2020 3:25:52 PM
NEWS SUMMARY
NEWS
REVIEW
6500
NICKLIN WAY UPGRADE COMPLETE
Works on the $7-million Nicklin Way bus and bike upgrade at Minyama are complete. The state government earlier this year partnered with Sunshine Coast business GRC Civil to deliver the works, which include a southbound bus priority lane, on-road bike lanes and road resurfacing. Transport and Main Roads Minister Mark Bailey says the project is about getting buses, bike riders and the 56,000 drivers who use this road everyday home sooner and safer. The priority lanes will help drivers, commuters and bike riders users travelling southbound to get through the Jessica Boulevard intersection quickly and safely. Importantly, it means drivers will no longer be slowed or stopped by buses picking up and dropping off passengers. The new lane has been created in the existing wide shoulder, while the on-road bike lanes are marked on the existing corridor from the Mooloolah River bridge crossing southbound to Koorin Drive, and northbound between Lutana Street and the Mooloolah River bridge crossing.
Maroochydore MP Fiona Simpson with Rush Adventureland owner Edwina Caesar
Qantas is now operating daily services between the Sunshine Coast and Melbourne for the first time in more than three years. The QantasLink service is operated by a two-class 110 seat Boeing 717 and is set to deliver more than 6500 seats a month in and out of the region. Tourism Minister Stirling Hinchliffe say the Flying Kangaroo service is a boost for Sunshine Coast tourism and jobs, helped along by the state government’s $15-million Aviation Recovery Fund. “It’s an investment that supports 21 local jobs and more than $2.6 million in overnight visitor spending straight into the pockets of Sunshine Coast businesses.”
JUST IN TIME FOR THE HOLIDAYS
DART FROGS A NEW ADDITION TO AUST ZOO
The Sunshine Coast’s largest indoor family and adventure centre recently opened in Maroochydore with a variety of inclusive play spaces and creating 50 new jobs. Rush Adventureland has the first indoor coaster of its kind in Australia, as well as an immersive sensory room specifically for children living with autism and special needs. The 1100 square-metre space includes a multi-level soft-play indoor playground, toddler zone, sensory room, indoor air coaster, ninja and high ropes courses, climbing walls as well as hyper bumper cars and a virtual reality simulator. Maroochydore MP Fiona Simpson officially opened the venue in December. Rush Adventureland is located opposite Woolworths at Sunshine Plaza.
Australia Zoo now has five dart frogs on display in their new enclosure in the Reptile House. Dyeing dart frogs, also known as Dendrobates tinctorius, are one of the most poisonous tree frogs and found in the wet forests of South America. This cohort of frogs originally arrived from Adelaide in 2018 and have been part of a highly successful breeding program. Dart frogs absorb toxins from their prey, which can then be secreted through their skin when threatened. Given the frogs feed on different ants here in Australia, they lack the toxins that make them poisonous.
8th Jan - 26th Jan, 2021
myweeklypreview.com.au
15.indd 1
My Weekly Preview | January 7, 2021 15
22/12/2020 3:25:36 PM
NEWS
HANGING UP THEIR LEATHERS
After 19 years of fundraising the Bras N Bikes ladies are calling it a day. WORDS: Caitlin Zerafa.
I
t started as a way for female motorcyclists to socialise, transformed into an annual fundraising event, and will now go down in history after 19 years helping hundreds of women on their breast cancer journey. The annual Bras N Bikes charity rally held its final lap in October with more than 600 motorcyclists turning out in their best pink for one last hooray to raise money for Bloomhill Cancer Care. Sunshine Coast ladies motorcycle group Girl Torque have run the event since its inception in 2001. Founder Helen Maurovic began the group in 2000, after gaining her motorcycle licence and wanting to meet other ladies to ride with. She left her mobile number at motorcycle shops across the Coast asking people to contact her for social rides. Being part of the group for 15 years, and Bras N Bikes group leader for six, Judy Carroll says she has loved watching the event evolve. “There were seven [ladies] for the very first ride in May 2000, simply from word of mouth,” Ms Carroll says. “One was a volunteer up at Bloomhill and a year later the girls said: ‘Why don’t we give something back to the community’. “About two or three years into it, the Girl Torque girls started wearing bras on the outside and then slowly people started decorating their bikes as well.” Across the 19 years the event has raised roughly $175,000 for Bloomhill. “For a little, small group who rely on those who we can to give sponsorship -–
Bloomhill (after 19 years, Girl Torque’s Bras N Bikes event has had its final ride. Pictured here is Kathy Harris, Lorna Willis, Judy Carroll, Valda Queenin, Sandi Simpson and Suzanne Hamson with a cheque for $20,829 in 2019 and the biking community – it’s pretty amazing,” Ms Carroll says. During the years, Ms Carroll has come to appreciate the importance of Bloomhill’s work after her husband was diagnosed with prostate cancer nine years ago. “We then used Bloomhill, so all of a sudden it completely changed my feelings about the importance of this ride,” she says. “I’ve had so many people who have turned up every year… and just say they were so glad to have somewhere to go and show support because their mother, wife, sister has breast cancer. “But boy oh boy, when it hit home
Choose iQ Shutters for all your INTERNAL SHUTTERS
CURTAINS
personally my whole understanding changed.” Unfortunately, due to the sheer level of organising and the small number of women who put the event together, 2020 marks the end of an era with Bras N Bikes and it will not continue into 2021. Despite this, Ms Carroll says it was wonderful to see so much support for the final ride. “[2020] was the biggest one we’ve ever had,” Ms Carroll says. “I think what has been hammered home to me, especially this year, is how much the biker community likes the opportunity … to help out Bloomhill.” The Bras N Bikes event has made a
Window Furnishings ROLLER BLINDS
AWNINGS
With over 25 years experience in window furnishings, we believe in supporting Australian suppliers and giving our customers the opportunity to buy locally while providing quality products at the best possible prices.
CALL TODAY FOR AN OBLIGATION FREE QUOTE. Your business means everything to us. If our pricing is more than expected or you have a cheaper price, please give us the opportunity to revisit your quotation and see what we can do.
100%
LOCAL LY
MADE
significant difference in the lives of breast cancer patients, and Bloomhill clinical services director Trish Wilson says the organisation is grateful for the donations over the years. “That long-term relationship has been so important between Bloomhill and Bras N Bikes,” Ms Wilson says. “The funds they have raised for us each year have really been able to significantly continue our service. “The money has helped to fund our exercise physiologist – because we know that women who have a diagnosis of breast cancer and have been treated – that there is an average of 30 per cent reduction in recurrence of breast cancer for people who exercise up to 150 minutes per week.” Funds from Bras N Bike have also established Bloomhill’s BLISS (Bloomhill Lymphatic Information and Support Services) program. “Secondary lymphoma is often a very undesirable side effect of have breast cancer surgery and breast cancer treatment,” Ms Wilson says “Sometimes it’s unavoidable because the lymph nodes have to be removed. “We try and keep our cost for that service as low as possible because it’s not something that goes away – once you’ve got lymphoma you live with it for life.” Each year Bloomhill support about 1200 clients going through cancer treatment, 37 per cent of those with breast cancer. Despite this, Ms Wilson says the survival rate of breast cancer is 92 per cent thanks to early detection and advances in technology and treatment.
Proudly AUSTRALIAN... PANEL GLIDE BLINDS
EXTERNAL SHUTTERS
EXTERNAL SHADE BLINDS
SECURITY
Sourced Materials
✓
Construction & Manufacture
✓
Local Staff
✓
5437 6405 www.iqshutters.com.au Visit our factory showroom Unit 3, 28 Premier Cct, Warana
16 My Weekly Preview | January 7, 2021
16.indd 1
AWNINGS+BLINDS
myweeklypreview.com.au
22/12/2020 12:37:34 PM
INFLUENCES OF THE HEART WITH VIEWS FOREVER 2 , 3 & 4 B E D R O O M O C E A N F R O N T A PA R T M E N T S N O W S E L L I N G Inspired by the stunning Mediterranean landscape of Italy’s Amalfi Coast, breathtakingly suspended between the blue sky and sparkling sea, AZZURE Bokarina Beach presents a sensual blend of natural and cultural wonders. Now is your opportunity to secure your very own oceanfront apartment, perfectly positioned in a vibrant coastal community, at AZZURE Bokarina Beach. From its commanding oceanfront position, AZZURE Bokarina Beach provides residents with a new perspective on luxury beachfront living.
Don’t miss your opportunity, visit our on-site display at Bokarina Boulevard, Bokarina Beach Call our Sales Team on 0417 572 559 or register your interest at azzurebokarinabeach.com.au ANOTHER PROJECT CREATED BY
INSPIRED BUILDING EXCELLENCE
17.indd 1
4/01/2021 9:38:14 AM
NEWS
IMAGE: AIMEE CATT PHOTOGRAPHY
WEBSITE BRIDGES GAP BETWEEN SUNSHINE COAST MAKERS AND BUYERS A Palmwoods mum has created a website that features hundreds of products made on the Sunshine Coast.
A
web designer has created an online directory of Sunshine Coast makers after finding that buying local is sometimes easier said than done. Miranda Hailes, of Palmwoods, launched sunnycoastmade.com.au this month to connect local makers and potential customers. The website, which comes just in time
for Christmas shopping, has started with some 90 makers grouped into 12 main categories and 56 sub-categories. They include artists, coffee roasters, jewellery makers, clothing designers, and gourmet food producers. A big believer in buying local, Ms Hailes came up with the idea for the website during the height of COVID-19 restrictions in Queensland when buying local at markets was not an option. “My husband and I looked at what products we were purchasing and looked at opportunities where we might be able to buy something locally,� Ms Hailes says. “I realised that there might have been a lot of products to buy locally but it wasn’t always easy to find them, and that’s when I had the idea for the directory – one place that focused on products made and designed on the Sunshine Coast, and on Sunshine Coast brands as well,� she says. “I just wanted to bring it all together in one place that was easy for locals to find what they wanted and that would raise awareness of what’s made on the
Sunshine Coast.� With a background in website design and online marketing, Ms Hailes had the skills and experience to put it together. Supported by her husband, Ron, she spent months working on the website and researching Sunshine Coast makers, designers, producers and brands. What she found was that there were twice as many people making original products on the Sunshine Coast than she thought. “There are so many talented people making so many wonderful products. We discovered in excess of 800 makers on the Sunshine Coast,� she says. “I’m constantly blown away. There’s so many unique and incredible things made here.� The website divides the greater Sunshine Coast into 15 areas so that shoppers can find products closest to them.
Visit sunnycoastmade.com.au for more information.
2020 Billy Thorpe Scholarship recipient, Harry Phillips
MUSIC SCHOLARSHIP QMusic announced the return of the Billy Thorpe Scholarship, funded by the Queensland Government through Arts Queensland, with applications open until 11:59pm (AEST), Thursday January 14, 2021 for all Queensland early-career artists to apply. The Billy Thorpe Scholarship provides $10,000 for an emerging artist to record with an established producer and receive career-planning advice from Chugg Entertainment. The winner of the Billy Thorpe Scholarship will be announced at the 2021 Queensland Music Awards announced this week to be taking place on Tuesday April 20 at The Fortitude Music Hall in Brisbane’s Fortitude Valley. Applications are open now for the 2021 Billy Thorpe Scholarship via qmusic.com.au.
!
"#$ % $ &##'
2YHUVHDVPRGHOVKRZQ6SRUWVEDUQRWLQFOXGHGDFWXDOIURQWJULOOHLVGLႇHUHQW<HDU8QOLPLWHG.0:DUUDQW\IRUSULYDWHEX\HUVIRUFRPPHUFLDOXVH:DUUDQW\LV<HDUVXSWR.00HWDOOLFSDLQW 9HKLFOHVPXVWEHRUGHUHG DQGGHOLYHUHGE\VW-DQXDU\RUZKLOVWVWRFNVODVW7 &VDSSO\( 2(
18 My Weekly Preview | January 7, 2021
18.indd 1
myweeklypreview.com.au
22/12/2020 2:24:55 PM
NEWS
UNITYWATER SPREADS CHRISTMAS CHEER
LIVING THE DREAM Demand for absolute beachfront property in Bokarina is high, as Oceanus developer secures another site.
A
fter the success of his Oceanus apartments in red-hot Bokarina Beach, a top developer has secured a second site around the corner. Walter Iezzi’s Oceanus project is 95 per cent sold – the value of sales hitting $73 million – with only six units left out of 104. Still up for grabs are three one-bedroom units (from $419,000), two three-bedroom units (from $859,000) and a solitary two-bedroom plus media room apartment for $1.149 million. The strong demand has inspired Mr Iezzi to secure a second development site
on Bokarina Boulevard, right around the corner from Oceanus, an eight-level development currently under construction. “I have not seen demand for property like this in a long time,” Mr Iezzi says. “Oceanus is now sitting at around 95 per cent of units sold and enquiry from both locals and interstate is very strong. “What I believe is driving demand in this area, is the liveability of the beautiful masterplanned community that Stockland has created that is incredibly appealing… “Of course, there is the beach and beautiful walking and bike tracks at your doorstep, the hospital is nearby and the
shopping centres are five to 10 minutes by car – but it’s more than that – it is a really beautifully planned estate that will only improve with time, Mr Iezzi says. This new project will be the biggest Walter Iezzi has taken on, with residential apartments built over eight levels and a mix of retail shops, commercial and dining on the ground floor. “With this project I really wanted to create something special and beautifully designed shopping and dining spaces add extra convenience and appeal to owners and tenants alike,” Mr Iezzi says. “Everything I design and build is all about accommodating the changing needs and demands of the community who will live there – it must be designed to be beautiful and endure for decades. I ask myself every single time I create a design – ‘would I live there?’ and the answer is always ‘yes’! With Oceanus expected to be completed by Christmas 2021, work on the new project, named Azzure Bokarina Beach, is likely to commence early 2022. The project will be released to the market over the coming weeks. From sunshinecoastnews.com.au.
Open for dad
Unitywater is helping out ahead of Christmas by giving five lucky customers a $500 Visa gift card. Customers who register for Unitywater’s online customer platform, My Account, or simply log into an existing account, can enter the draw to win. Unitywater executive manager customer and community Katherine Gee says there are many reasons for customers to sign up and make the switch to online. “It’s instant and easy, and allows customers to access their account, on tap,” Ms Gee says. “Customers can check their account balance, view their bills, set up automatic payments and even track water usage, all from the convenience of their computer or smartphone.” “For more information, visit unitywater. com/tap-in-to-win. Competition closes December 21, winners drawn December 22. Terms and conditions apply.
•
Noosa’s first 5 - star aged care residence
•
90 suites with respite & dementia care
•
Award winning Relationship - First care model, where each resident has their own support team
Arcare Noosa • Opening January 18 • 52 Goodchap Street Book a personal tour on 1300 272 273 or at arcare.com.au myweeklypreview.com.au
19.indd 1
My Weekly Preview | January 7, 2021 19
23/12/2020 10:38:46 AM
NEWS
NEWS
PREVIEW
Get free news as it happens by visiting sunshinecoastnews.com.au THE ADDICTIVE ‘ANIMAL’BASED CLASS THAT’S A BEAST OF A WORKOUT
WORLD-CLASS WAVE PARK PROPOSAL FOR MOBY VIC’S An application to build a world-class wave park at Glass House Mountains has been lodged with Sunshine Coast Council. Surf Parks Australia wants to develop what would be the biggest tourist attraction the region has seen in decades on the western side of Moby Vic’s. According to the application, it is the Australian franchise of American Wave Machines, which “has delivered similar economically-viable facilities around the world with their technology and business case established and proven’’. The company’s most famous creation is the BSR Surf Ranch in Waco, Texas. – More online at sunshinecoastnews.com.au
A Sunshine Coast fitness coach is making people roar with a beast of a workout that incorporates animal moves. Mark Gordon, owner of Iron Zuu Kawana, will have you crawling like a bear, stomping like a komodo – and sweating like a pig. The popular fitness movement, which was created for athletes and military trainees, features animal movements in high-intensity workouts that also combine yoga, break dancing, parkour and “human evolution”.
THE GENIUS DECISION THAT SAVED MAN’S LIFE IN SEA ORDEAL The man who sparked a massive water search off Bribie Island after a simple blunder later secured his own rescue with a genius decision. After falling off the stern of his boat while trying to better secure his tender almost four kilometres offshore, David Simpson swam about one kilometre to a navigation beacon where he tried waving at passing ships to get attention. When this failed, night fell and three or four hours passed, the 64-year-old from Mooloolaba had a lightbulb moment. The MacGyver of the high seas started using his hands to cover the light beacon to signal Morse code to ships in the area. In the meantime, a widespread search had been initiated after a 14-metre motor cruiser with only a dog aboard ran aground near Caloundra. – More online at sunshinecoastnews.com.au
LIKE THESE STORIES? Get more just like it direct to your inbox by subscribing to our free daily news feed on our website sunshinecoastnews.com.au.
– More online at sunshinecoastnews.com.au
Central NEW YEAR - NEW HOME CONSTRUCTION UNDERWAY • Stage 1 now 80% sold • 2 bedroom apartments from $435,000 • The best value apartments in the heart of the Sunshine Coast • Opposite the Sunshine Plaza Shopping Centre, the hotspot of Maroochydore • Close to cafes, restaurants, world class beaches and so much more • Expected completion last quarter 2021 Sales office open 9am to 4pm, Tuesday to Saturday (or by appointment) 12 Amaroo Street, Maroochydore For more information call Cathie Price on 1800 752 630 ARTISTS IMPRESSION
PLAZACENTRAL.COM.AU • 10-18 PIKKI STREET, MAROOCHYDORE
*Terms and Conditions: Up to $30,000 for eligible purchasers only. Includes $15,000 HomeBuilder Grant and $15,000 First Home Owner Grant. Buyers should make their own enquiries to determine eligibility. Price, availability & incentives are subject to change without notice. Visit the website for more information.
20 My Weekly Preview | January 7, 2021
20.indd 1
myweeklypreview.com.au
4/01/2021 1:34:04 PM
CONSTRUCTION COMPLETE
DISPLAY UNIT NOW OPEN
MARCH 2021
VIEW BY APPOINT.ENT
THE SUNSHINE COAST’S MOST ICONIC NEW RESIDENCES ARE NEARING COMPLETION
LIMITED OPPORTUNITIES REMAIN - PRICED FROM $2.4 MILLION
O N LY 1 6 R E S I D E N C E S • 2 P E R F L O O R • A B S O L U T E W AT E R F R O N T W I T H PA N O R A M I C R I V E R & O C E A N V I E W S E AC H R E S I D E N C E I S OV E R 3 1 0 M 2 • E X T E N S I V E G A R D E N S D E S I G N E D BY AWA R D -W I N N I N G L A N D S C A P E A R C H I T E C T
SALES & ENQUIRIES
21.indd 1
108 – 112 Duporth Avenue, Maroochydore
T 0419 944 400
sales@botanicariverside.com.au
botanicariverside.com.au
4/01/2021 2:19:40 PM
PROFILE
Michael Wearing and Lance Bergman
GIVE ME SHELTER A humble Maleny home has been saving lives for 25 years, thanks to the passion and compassion of one gifted man. WORDS: Leigh Robshaw.
T
he house in Fig Street is 135 years old and built from local timber. Out the back is a flourishing vegetable garden built by one of its long-term residents, Lance Bergman. Out the front is a porch where men can sit. Inside is a safe space, mostly for men but also for women and children. Five spare bedrooms and a shared living room and kitchen, where emotions are expressed, meals are shared meals, stories are heard and lives are saved. In the past 25 years, the Maleny Community Men’s House has
welcomed thousands of people through its doors, offering them solace and solidarity. The house has seen some stuff and so has its custodian, Michael Wearing. A Vietnam veteran who arrived in Maleny in 1992, Mr Wearing stands tall and proud at 72 years old. Like the house, he is available day and night for anyone who needs him, male or female, adult or child. Mr Wearing knows pain. In 1969 he married his first wife Christine, a rebellious girl who wore a black wedding dress. Ten days later she died after complications
from an ectopic pregnancy and was buried in the same dress. His father committed suicide while he was serving in Vietnam, leaving a note blaming him. He suffered PTSD and grapples with self-acceptance. “My wife died, my father suicided and my mother went insane, all before I was 21,” he says. “It wasn’t until I was 45 that I could feel anything. It took me until 55 until I could cry.” Mr Wearing went on to marry twice more and father five children. He worked in insurance and provided for the family, but struggled with alcoholism. When he came to Maleny, he was searching for a new life. “When I first got to Maleny I read an opinion piece in The Australian about the horrendous suicide rate of men and boys – suicide among the veterans is about 45 per cent higher. It made me so angry and then I read the book Manhood by Steve Biddulph. The first line is the book is, ‘Most men don’t have a life.’ I started to see what we were doing to ourselves.” Mr Wearing started one of the first men’s groups in the region in 1992. He has facilitated men’s groups ever since, for the past 25 years operating them from the Fig Street house. He receives no government funding and keeps the house going with his pension. Maleny IGA occasionally donates food. The house is old, but it’s clean, tidy and an alcohol and drug-free zone. Mr Wearing has rented it for years, but a new owner bought it eight years ago and has now handed it over to Mr Wearing to continue the great work being done there. “We put aside Monday evenings for a cup of tea, a feed and a yarn around the fire,” he says. “Once men get going, they’re good, but getting them going is hard. That’s what we do. That’s what I’m apparently very good at. I say very little. Once they crack, once they get the tears, once it gets real for them and they’re not avoiding their own emotional issues, then it’s their responsibility to do something about it. “We get suicidal men referred by doctors, psychologists and psychiatrists,” he says. “They’re not mentally ill; that’s the first thing I tell them. You’re not
mentally ill mate. You just need to know a lot of man stuff. Once they find out there’s more to them than this little box that goes to work every day, there’s a whole lot more to them, the moment they realise that, they fix themselves.” Mr Wearing has won awards for his work and been invited to speak in the UK and Canada. He says he could get “grants like crazy” if he became affiliated with large men’s support networks and government agencies, but doesn’t like the rules and regulations that go along with it. “I can tell people to get f**ked, it’s not a counselling service. It’s just men being men. There’s no bulls**t here. No booze – if you come here and you’re an alcoholic, p*** off. We’re not interested. We’re not a rehab, there are places for that. If you’re a drug addict, there are places for that.” A rule Mr Wearing asks all those who enter the house to follow is written on a chalkboard in the kitchen: ‘Respect, responsibility and kindness for self, to family and Mother Earth.’ “That’s how we live,” he says. “Being real, being clear, being clean. If someone is being an a***hole, we tell them. If we see women with bruises and we know the guy, we slam him up against the wall and say ‘hey, you don’t do that to women, ever’.’” Mr Wearing welcomes both male and female victims of domestic and family violence and sexual assault into the house and perpetrators are dealt with in no uncertain terms. “Our whole male reason for being, in my understanding, is to be the protector. That’s why we’re big and strong. We don’t dominate them. We treat women as our queens, properly, with respect and kindness and giving. That’s what we tell our men. There’s a lot of hope. There are thousands of men out there doing their own thing to find out what it is to be a man and to help other men too. We know there’s a problem. Women and kids are suffering. We do know that and it’s time for us to stand up and do something. That’s what I’ve been doing for 25 years, doing the best I can to keep them breathing.”
Lyric, the only 100% invisible hearing aid Imagine a hearing aid you can wear day and night, allowing you to hear 24 hours a day, 7 days a week and no need for removal during sleep.*
To book your complimentary hearing check call us today on 1300 547 138 *Please note that an appointment will be required every 8-12 weeks for a replacement device.
22 My Weekly Preview | January 7, 2021
22.indd 1
myweeklypreview.com.au
22/12/2020 12:51:46 PM
Vehicles depicted have been modified to customer specifications.
Celebrating 25 years of Sprinter. Made in Germany, built for Australia. The Mercedes-Benz Sprinter has supported Australian businesses - big and small - for more than two decades. Whether it’s delivering furniture, kitted out as a motorhome, ferrying fresh food - or forming the backbone of Ambulance Australia’s lifesaving fleet the Sprinter is the heartbeat of successful Australian business. Contact Mercedes-Benz Sunshine Coast to enquire about the Sprinter today. www.mbsunshinecoast.com.au
Mercedes-Benz Sunshine Coast 65-73 Maroochy Boulevard, Maroochydore (07) 5409 0100 4214912
23.indd 1
23/12/2020 9:31:48 AM
SUNSHINE COAST COUNCIL PROMOTION
CHOOSE YOUR NEXT OUTDOOR ADVENTURE
Solve the mystery at Mary Cairncross Scenic Reserve’s new exhibit These school holidays, kids are invited to become a Junior Ranger Detective and go undercover to solve the mystery at the new Mary Cairncross Scenic Reserve Operation Botanica exhibit.
S
ome of the plants in the rainforest are under threat and others are strangling each other, so visitors need to follow the clues to solve the botanica mystery. Along the way they’ll meet a cast of botanical characters – the good guys, the villains, the stranglers, the victims – and learn about the amazing plants that fight for survival in the tough rainforest environment. Environmental education officer Dr Lisa Ryan said the team at Mary Cairncross changed the exhibits every five to six months to keep it fresh for returning visitors. Each year more than 180,000 people visit Mary Cairncross and the exhibits are an opportunity to inspire a sense of wonder and amazement in nature by highlighting the many
24 My Weekly Preview | January 7, 2021
24.indd 1
unique species that live in the reserve and their incredible life histories. A significant amount of time is spent choosing a central theme that ties the stories together into a cohesive narrative and preparing interactive displays that best tell them in engaging, entertaining ways. Operation Botanica tells the story of a significant, but fragmented, patch of rainforest. The aim is to inspire amazement at the many ways rainforest plants have adapted to survive the unique conditions of the rainforest including low light and high rainfall and humidity and raise awareness about some of the key threats our rainforest plant species are facing. One of these little-known threats is myrtle-rust, a fungal pathogen that is invading
Australia’s forests and attacking members of the myrtaceae family (gum trees, lilly pillies, tea trees, bottlebrushes etc.). Indeed, two of our rainforest species are critically endangered due to this threat. These stories lend themselves perfectly to an overarching narrative of a murder mystery in the rainforest, allowing us to tell the individual stories of the victims, the suspects, the detectives and the cast of other botanical characters all fighting for survival. The hope is that visitors will enjoy the experience as much as they would a good detective thriller and maybe their visit will be all the more memorable for it. This exhibit is on display until April 2021. Head to Council’s ‘what’s on’ calendar for details.
Summer is a great time to get outdoors and explore our spectacular region and all it has to offer. And there’s no better way than visiting Adventure Sunshine Coast to find all your free outdoor adventures, no matter your age or fitness level. Head online to Adventure Sunshine Coast for man than 200 local walking, cycling, paddling and horse-riding trails right at your fingertips, covering every corner and crevice of our beautiful region. The hardest part will be choosing which one to do first!
THE REFINERY Start something remarkable. Turn your idea into a sustainable business with The Refinery. A creative incubator that joins the dots between creativity and business. Eight weeks of workshops, mentoring and new connections are designed to refine and grow your creative business. An initiative of Sunshine Coast Council in partnership with SunCentral Marcoohydore and Sunshine Coast Creative Alliance, applications for 2021 open January 18 and close March 1. Visit therefinerysunshinecoast.com for further details.
myweeklypreview.com.au
4/01/2021 9:45:28 AM
SUNSHINE COAST COUNCIL PROMOTION
DID YOU KNOW Council has a BushCare community and we are looking for volunteers. What’s BushCare? It’s a group of like-minded people who care for the bushland near them – who like to enjoy the outdoors, with the company of others; keep active and connect with nature; and have the flexibility to volunteer when it suits them! Morning tea, equipment, gloves and guidance are all provided. Join your local BushCare working bee. Search “bushcare” on Council’s website to register your interest.
LUNCH WITH LAYNE BEACHLEY You’re invited to Venue 114’s next In Conversation series on March 5 with the ‘Queen of Surf’, Layne Beachley. Local personality Nikki Fogden-Moore will emcee the special event, where audiences will hear from history’s most successful female surfer A traumatic childhood ignited a flame of desperation to prove she was worthy of love. Her affinity for the ocean and competition created the perfect storm to achieve her dream of becoming the best of the best. Hurry, $99 early bird tickets available now. Head to www.venue114.com.au.
FACT 635 volunteers of all ages removed a massive 560 kg of litter from our beaches at last year’s Clean up for Hatchings events. The turtle hatchlings need your help again to get a clear run to the ocean! Meet at 6am January 30 at several locations from Caloundra to Coolum. Sign up via Council’s ‘what’s on’ calendar.
JOIN THE CONVERSATION @sunshinecoastcouncil @councilscc @sunshinecoastcouncil Sunshine Coast Council www.sunshinecoast.qld.gov.au
myweeklypreview.com.au
25.indd 1
OUR SUNSHINE COAST
FROM THE MAYOR It’s a busy time of year when we need to share our Sunshine Coast. Even more than before, we need to prepare and take care. We’re asking everyone across our region to be kind, considerate and allow a little more time to reach your destination, because keeping our community safe is everyone’s responsibility. Visit Council’s website for a one-stop-shop for all the information you’ll need to be prepared for a safe and enjoyable summer on our Sunshine Coast.
HEALTHY AGEING FORUM Registrations are now open for a groundbreaking chronic disease health forum at the University of the Sunshine Coast (USC) on February 20. Held in partnership with Sunshine Coast Council and USC, the Healthy Ageing Forum – Getting Old is not a Disease! will feature some of the latest chronic disease research and lifestyle recommendations from a range of renowned health experts. This free forum is strictly limited, and designed for people over the age of 50. Visit Council’s website for more information.
Some of our unsung heroes who always go above and beyond to help and inspire others are members of our community organisations, run by dedicated volunteers who always go the extra mile. One way our Council supports these groups is through our grants programs. Council has a range of grants available to help community groups reach their full potential, including the major grants program, which provides funding of up to $30,000 for not-for-profit groups as well as our minor grants program, providing funding of up to $2,000 for individual projects. Applications for Council’s major grants program open on February 1, along with applications for minor grants in the events category. Applications for minor grants in all remaining categories open on March 29. I want to encourage any community organisation with a great project that might be eligible for funding to start reviewing the selection criteria and preparing their next application. Let’s make 2021 a terrific year for everyone in our community. Mark Jamieson Mayor Sunshine Coast Council
My Weekly Preview | January 7, 2021 25
4/01/2021 9:42:25 AM
MY TIME
on
Jan 8
W H AT ’ S There’s loads to explore and things to do on the Sunshine Coast. Here are a few events to pop in your diary.
THE GOOD BAND: ‘HOT AUGUST NIGHT’ AT NIGHTQUARTER After the massive success of the sold out The Good Band performing Neil Diamond’s Hot August Night show at Gold Coast Home of the Arts, the boys have decided to bring the epic show to the Sunshine Coast. The Good Band is a Queensland six-piece supergroup with top players including Hayden Andrews and Scott Bignell from Brisbane horn heavy big hitters Cheap Fakes, Geoff Green of Aria awardwinners George and Ben Mackay from the genre defying LeSuits. They’ll be performing the hits of Neil Diamond including the massive hits Sweet Caroline, Cracklin’ Rosie, Solitary Man, and heaps more. Supporting is HaydenGoSeek with his own mix of original easy listening melodic pop from his forthcoming album. Where: NightQuarter, 8 The Avenue Birtinya. When: Friday January 8 at 5pm. Tickets: From $39.90 visit nightquarter.com.au.
SUNSHINE COAST JAZZ AND BREWS FEST Jazz Sessions along with the Glass House Brewery are hosting the Coast’s first jazz and beer festival. The Sunshine Coast Jazz & Brews Fest will be six hours of jazz, craft beers, fine wines and gourmet food. Sit under the marquee or under the stars, sip a smooth brew as you enjoy swinging classics, gypsy jazz, New Orleans horns, smooth grooves, soulful singers and incredible world jazz. The Sunshine Coast Jazz & Brews fest will feature some of the top jazz artists in Queensland. Where: Glass House Brewery, Forrest Glen. When: Sunday January 24 at 3pm. Tickets: From $59. Search Sunshine Coast Jazz and Brews Fest on Facebook.
Jan 24
BOTANICAL ECO-RESIN EARRINGS DUO WORKSHOP Take part in an eco-resin botanical earring workshop. Create your own mini-floral universe in each earring. As this is a starter workshop, you do not need to have any previous skills. Please note: the workshop will be delivered across two sessions – January 11 and 15. This is to allow the resin to cure prior to polishing and completing your designs. Where: 33 Palm Creek Road, Tanawha. When: January 11 and January 15, 3pm-4:40pm. Tickets: $50. Visit Sunshine Coast Council website.
Feb 7
EUMUNDI HOTEL VIVA LA VINTAGE MARKET Lovers of vintage treasures are in for a fine time at the Viva La Vintage market, held on the first Sunday of every month at The Brewery. Please note, Viva La Vintage will be taking a break in January, so the next market date will be Sunday February 7. Stallholders please contact Lisa on 0403 265 196 or email vivalavintagemarket@gmail.com. Where: 1 Etheridge Street, Eumundi. When: 9am–1pm Sunday February 7. Tickets: Entry Is free. No need to book.
/CMGVJGUYKVEJVQSWCNKV[CIGFECTGVQFC[ /E-GP\KG#IGF%CTGRTQXKFGUYCTOCPFYGNEQOKPIJQOGU YJGTGRGQRNGCTGECTGFHQTCPFECTGFCDQWV/E-GP\KGKUJGTGVQ CUUKUVCPFIWKFG[QWVJTQWIJVJGRTQEGUUQHUYKVEJKPIVQDGVVGT ECTGVJCVOGGVU[QWTYCPVUCPFPGGFU %CNNWUVQFC[VQ NGCTPOQTGCDQWVQWTHQWTDGCWVKHWNJQOGU QPVJG5WPUJKPG%QCUV
1300 899 222 | mckenzieacg.com 26 My Weekly Preview | January 7, 2021
26.indd 1
myweeklypreview.com.au
4/01/2021 9:43:27 AM
NIGHTQUARTER
PROMOTION
MONTHLY SUNDAY SESSIONS HAVE GONE TROPICAL! Your escape from reality.
S
unday Sessions are all about island vibes, music, pop-up bars, local brews, colourful cocktails, craft workshops and live tunes. Join us once a month on a Sunday afternoon from 12-7pm for furry friend outings, family-friendly fun and foodie adventures. Most Sundays will include the best finds of clothing or vinyl markets and Paint-n-Sip Workshop! Next Sunday trading is 17th January 2021 featuring Her Wardrobe Markets with vintage clothing and accessories and our first Paint-n-Sip series.
Cnr Kawana Way & The Avenue, Birtinya Between Spotlight & Malt Shovel Taphouse
Dora!
Something for the young or young at heart! Don't miss out on a visit from everyone's favourite cartoons this January!
Dutch Pancakes!
Fluffy Dutch pancakes topped with all your favourites. They are perfect to share – or not!
Neil Diamond Show, 5pm January 8.
WHAT’S ON Friday 8/1
See nightquarter.com.au for more information
NQ LIVE (Ticketed)
Vibes Stage
Enchanted Garden
Busking
5pm Neil Diamond Show
4-6.30pm Tony Boyd 6.30-9.30pm 7-10pm A Bridge In September Madeleine Roulston
4-6pm Jakey Cakes
Vibes Stage
Enchanted Garden
Enchanted Garden
4-6.30pm Dan Horne 7-10pm The Inadequates
6.30-9.30pm Miss Elm
4-6pm Adam Snyder
Roving Dora 5-7pm Pork Sliders!
Saturday 9/1
Try something new. Why not try our juicy Chinese pork sliders!
Roving Dora 5-7pm
NIGHTQUARTER PRESENTS
cabaret nights
KINGDOM SENSATION BURLESQUE SHOW 14TH-11TH MARCH
DICKO’S COUNTRY SPIT ROAST AUSTRALIA DAY SPECIAL 28TH JANUARY
DINNER & SHOW TICKETS ON SALE NOW FROM NIGHTQUARTER.COM.AU/CABARET-NIGHTS - 8 The avenue birtyina - 1300 264 448
27.indd 1
4/01/2021 3:45:10 PM
MY TIME
PLENTY OF BEACHES AND PARKS TO EXPLORE THIS SUMMER multi-age group playground, a fitness station and picnic facilities. There is a large grassed area for ball games or a run around. There is a community garden on the Amber Drive side of the park.
ALEX BLUFF FORESHORE PARK (CHURINGA PARK)
BUDERIM FOREST PARK AND FALLS Buderim Falls, also known as Serenity Falls, is one of those rare natural treasures that you can experience in as little as 20 minutes. Equally, you could just as easily spend an entire day soaking up this natural wonderland as you enjoy a picnic with your family or partner. The waterfall flows year-round but looks particularly spectacular after rainfall, when the water from Martins
Creek transforms the falls from a trickle into a strong cascade of water down the rock face into the shallow waterhole below. The falls are set in 45 hectares of the Buderim Forest Park, on the northern side of Buderim Mountain. Visit buderim.com/buderim-fore.
ACTIVE PARK Address: 36-58 Indigo Road, (Bellsreach) Caloundra West. This 1.4-hectare park has a large
Address: Alexandra Parade, Alexandra Headland. Located in this park is the HMAS Brisbane Memorial, the Korean War Memorial and the Australian War Dog Memorial. The park stretches for one kilometre along the length of the headland and features multiple picnic shelters and lookouts. The children’s playground has several spring toys. There is a fitness station on the Mooloolaba Esplanade end. The park is a popular ceremony site with great ocean views.
BALMORAL RIDGE LOOKOUT PARK Address: Montville Service Road via Maleny-Montville Road This park presents a window to magnificent views across the coast. It also provides a picnic shelter, seating and a grassy open space
BLI BLI SKATE PARK Address: Muller Park, 319-323 David Low Way, Bli Bli. Bli Bli Skate Park forms part of Muller Park and offers a smooth ride for skaters of all skill levels. The park provides a small variety of basic elements that can comfortably accommodate seven to nine skaters.
ANCHORAGE DRIVE PARK Address: Anchorage Drive Birtinya. The park located on the corner of Hideaway Street and Anchorage Drive has a playground, picnic facilities and public amenities. The park borders the Currimundi Creek North Arm Environment Reserve to the west.
SCO E
Maroochydore’s Best Kept Secret Experienced, Family Owned Specialty Coffee Roaster, Barista Training School & Commercial Equipment Provider Since 2009. Bring a copy of this ad and pay
ONLY $30
Ample Parking. Espresso Bar in front of Roastery. Mon - Fri 7.30am-3pm Scan here to see our full range of products & services.
for a kilo of freshly roasted Specialty Grade Coffee Beans
www.mambocoffee.com.au PH: 1300 062626 . 2/100 Sugar Road Maroochydore (Located at the intersection with Centenary Crescent)
28 My Weekly Preview | January 7, 2021
28.indd 1
myweeklypreview.com.au
4/01/2021 2:33:45 PM
29.indd 1
23/12/2020 9:32:46 AM
Local
WELL DONE 2020’S GRADUATING CLASS
news
Despite the challenges of 2020, the region’s Year 12 cohort have done their schools proud. WORDS: Caitlin Zerafa. of one day becoming a doctor. “This year has been a challenge to say the least, but Immanuel has been my second home since I started kindy here 13 years ago,” Adrienne says. Luke and Adrienne make up the 18 per cent of Immanuel students who achieved an ATAR above 95 and principal Colin Minke says it is a pleasing result as 100 per cent of students achieved their Queensland Certificate of Education (QCE). “In the arts, both Josh Linnett and Hunter Smith were accepted into Griffith University’s Queensland Conservatorium; Josh for their jazz program and Hunter for acting,” Mr Minke says. “In visual art, artist Matthew Hattrick was accepted into RMIT’s (Royal Melbourne Institute of Technology) fine arts program.” At Sunshine Coast Grammar School Grace Thomas, with a score of 99.95, is
2020 Year 12 graduates from Matthew Flinders Anglican College
Y
ear 12 graduates of 2020 are ready to take on the world after successfully facing remote learning and navigating the first year of the Australian Tertiary Admission Rank (ATAR) grading system in Queensland. Matthew Flinders Anglican College graduate Justin Holland is one of only 30 students in Queensland to receive the highest ATAR of 99.95.
Congratulating him on his efforts, principal Stuart Meade says the Flinders class of 2020 achieved a median ATAR of 93.15. At Immanuel Lutheran College Luke Bindon was named Dux, receiving and ATAR of 99.9. He is keen to pursue advanced mathematics. Meanwhile 2020 college captain Adrienne Halpin, who achieved 98.05, wishes to study medicine with dreams
Delicious Gourmet Food
Immanuel Lutheran College 2020 captains Hayden Morris and Adrienne Halpin
CENTRAL/NORTH SUNSHINE COAST REGION
Sunshine Coast Grammar School’s Grace Thomas one of 32 students who received a ranking of 95 or above. Principal Maria Woods says 11.11 per cent of students achieved an ATAR of 98.9 or above, with 47.78 per cent scoring above 91.5. “The results achieved are a reflection of the hard work, commitment and positive attitude these students have displayed towards their studies,” Mrs Woods says. “We are incredibly proud of our Year 12 cohort and congratulate them on their outstanding achievements.”
We do amazing Coffee!
ALL DAY DINING MENU
FAST. FRESH. HEALTHY
OPEN MON TO SAT 7.30AM-3PM
OPEN MONDAY TO WEDNESDAY 11AM-2.30PM, 4.30PM-7PM THURSDAY TO SUNDAY 11AM-7PM Phone orders welcome or order online with Bopple
Ph 0477 225 668 . River Markets, Bli Bli Ph 5445 2055 . 3/104 King Street, Buderim
30 My Weekly Preview | January 7, 2021
30.indd 1
myweeklypreview.com.au
4/01/2021 3:02:52 PM
LOCAL NEWS
SHARE WITH US TODAY
THAT’S ENTERTAINMENT: CELEBRATING 75 YEARS OF LIND LANE
Are you a local Rotary or Lions club, men’s or women’s shed or similar group or association and would like to have your news and events shared in My Weekly Preview’s new local news pages or contribute as one of our regular columnists? Email us at localnews@ myweeklypreview.com.au
This Nambour theatre with a long history has a bright future.
N
ambour’s Lind Theatre has marked a significant milestone recently celebrating 75 years. Current president Glenda Campi says the theatre, which is now simply referred to as ‘The Lind’, has had several homes over the years, and a few name changes. “The Lind came from one of those locations, on Lind Lane, these days underneath Nambour Plaza,” Ms Campi says. “On December 6, 1945, a meeting was held to establish the Nambour Amateur Theatrical Society. “75 years later … past and present members gathered to celebrate at the theatre in Mitchell Street, Nambour.” Ms Campi and long-time treasurer Gwen Griffin presented a trip down memory lane for the anniversary. “Foyer plaques with names of presidents and life members were unveiled by the longest-reigning life
member, Win Lindsay,” Ms Campi says. One lady who attended the very first meeting in 1945 is still part of the group today. “It was a wonderful surprise for all that 93-year-old Norma Dickson, who was at that very first meeting, is still very much around, lively and funny – and even did a little dance,” Ms Campi says. This year is looking promising with more live theatre returning. “2020 [was] a lean year for theatre, but the Lind managed to stage two COVID-safe shows; one with an audience maximum of 20 per show, and one with 50 per cent capacity. “Plans for [2021] are well underway. The first play for 2021 will be George Bernard Shaw’s funny and sharp Arms and the Man.” That show will run from February 26 to March 6. Tickets via lindlane.com.au or phone 1300 732 764.
GARDEN PLAYSCAPE These school holidays why not visit Summertime Playscape at the Maroochy Regional Bushland Botanic Garden in Tanawha. Explore a secret garden full of nature play fun – play in tiny mud houses, dig in a giant turtle sandpit, explore a secret garden, become a butterfly plus lots more. All children need is water, a sense of adventure and their imagination. The playscape is on until January 24 during daylight hours.
LOCAL NEWS Long-time Lind Theatre members Norma Dickson and Lea-Anne Grevett at the 75th anniversary celebration
Do you have a news tip? Let journalist Caitlin Zerafa know about it! Phone 5444 0152 or email: localnews@myweeklypreview.com.au
RENOVATION
EXCELLENCE ■
@ Get Set Footw Footwear
■
■
5%
■
Seniors Discount
■
Over 30 years in construction Local builder using quality local trades & suppliers All aspects of the build is organised from concept to completion Professional in-house carpenters Outstanding customer service, where the client’s input is encouraged
Renovations . New Homes . Body Corporate Call Tim today! Mob. 0413 948 975. info@tmgcon.com.au tmgcon.com.au
Registered Builder QBCC# 1179913
“Kiss Cramps Goodbye” @ Buderim Magnesium House We sell a wide range of fast acting: ng g:: g
M Mens Ladies
myweeklypreview.com.au
31.indd 1
Warm Magnesium Massages Are Back!
Shop Sh op O Open p Mon-Fri 9am - 4.30pm & Sat 9am - 11am Order Online & get FREE delivery for orders over $60
Like us Follow
BUDERIM MAGNESIUM HOUSE
............
Noosaville 230 Gympie Tce 5447 1755 Caloundra 82A Bulcock St 5492 7185 Shop Online - @getsetfootwear.com.au
• Magnesium Spray On • Massage Gel • Bath/foot soak flakes • Moisturising lotions and tablets
5476 5454
Rejuve Health Products P/L 1/86 Burnett St (Opp Buderim Tav) | Visit us at Cotton Tree Markets Sundays www.rejuvehealth.com | www.buderimmagnesiumhouse.com.au My Weekly Preview | January 7, 2021 31
4/01/2021 3:19:26 PM
LOCAL NEWS
NEW HOMES AHEAD The Sunshine Coast electorate of Fisher is among 10 regions nationwide to have benefitted most from the federal HomeBuilder scheme. On the Coast, there were 670 new building approvals, worth $41.9 million, for dwellings in Fisher during the three months to October 2020. During that same period, the electorate had 439 approvals for new detached houses and 231 approvals for medium-density dwellings. There was a further 129 per cent increase in approvals for home alterations and additions covered by the HomeBuilder scheme. Member for Fisher Andrew Wallace says this has been critical to the local economy, stimulating more than $6 billion and employing around 20,000 locals. “Local builders who had contacted me in May saying that they were facing an economic cliff in the second half of this year are contacting me again right now to say that they are receiving more enquiries than they ever have before,” she says. AVID Property Group’s Queensland project director Anthony Demiris says there have been “phenomenal” sales at Harmony in Palmview since the grant started in June. The HomeBuilder grant has been extended until March 31, with at $15,000 grant available to eligible applicants.
A LITTLE BIT OF LUXURY
A
fter searching for a creative outlet, Alexandra Headland local Christine Toovey is now bringing the best of Australian-made and local products to her newly launched luxury hamper business Coastal Hampers. Ms Toovey has spent many years curating special gifts for friends and family, always making them special, and is now using that passion to spread that love to the rest of the Sunshine Coast. “They are the perfect, elegant gift for corporate businesses to share with their colleagues or clients … and a beautifully presented gift for teachers, coaches, mum or dad, and anyone who deserves a special thank you or birthday treat. “I source and choose carefully all the best Australian and local products that I have come to know and love … I then decide which things would pair nicely, colour co-ordinate them, and create a hamper as elegantly as possible. “My aim is to collaborate with more Australian and local businesses, bringing
Christine Toovey of Alexandra Headland has launched her new luxury hamper business a style of luxury gift giving and home delivery to the Coast.” Her hampers have been ordered by Audi, local lawyers, Bathersby Legal and Imagine Hotels & Resorts Ms Toovey also recently donated a hamper to charity
Wishlist, in the hope of giving back to someone unsuspecting over the holidays. “The look on people’s faces when they open a gift box, especially when it’s unexpected, is priceless.” Visit coastalhampers.com.au
GET MORE $$$ FOR YOUR CAR! DO YOU HAVE A CAR FOR SALE?
Happy Holidays from the Consign a Car Team We look forward to seeing you in 2021 whether buying or selling a car
Do you want maximum exposure Australia wide for minimum expense? Take the hassle out of selling your car... LET US SELL IT FOR YOU! Better $$$ than trade-in or wholesale, you’re the ‘Boss” we work for you!
2012 Kia Grande Carnival $13,990
2019 Mazda 2 $16,990
2012 Mitsubishi Triton $19,990
8 Seater People Mover! Full Service History! Dual Climate Control Aircon! Cruise Control, ABS Brakes.
Zoom into a Great Deal! 6 Speed Manual with Low K’s! Full Service History! Push Button Start with Key Proximity!
Built for Work & Play Dual 4x4 Ute! Economical Turbo Diesel! Full Service History! Hard Lid, Roof Racks.
2015 Jeep Compass $23,990
2014 Lexus ES $33,990
Great Value Family SUV! Heated Leather 1 Elderly Owner Since New! Extremely Low Trim! Sunroof! Reverse Camera! GPS, Dvd k’s! Just Been Serviced! Blind Spot Monitor! Player, Climate Control Aircon,18” Alloys. Sunroof! Radar Cruise Control, 17” Alloys.
• 12 MONTH WARRANTY • DRIVE AWAY PRICES • SAFETY CERTIFICATE & CAR HISTORY PROVIDED
CALL OR VISIT US TODAY! 460 Gympie Road, Kedron | Ph: 07 3359 2477 A/H: 0421 047 286 | www.consignacar.com.au A U S T R A L I A’ S L A R G E S T C O N S I G N M E N T D E A L E R Q U E E N S L A N D ’ S B E S T VA R I E T Y 32 My Weekly Preview | January 7, 2021
32.indd 1
myweeklypreview.com.au
4/01/2021 3:22:04 PM
LOCAL NEWS
WESTFUND CELEBRATES BRAND REFRESH AT COMMUNITY DAY
Cr Christian Dickson
T
he Maroochy Neighbourhood Centre benefited from the generosity of Westfund Health Insurance at its recent Community Day to celebrate the fund’s brand refresh. Local Westfund employees gave their time to support a public garden program and were kept busy packing hampers and wrapping gifts before the festive season. Westfund’s regional manager in Maroochydore, Janine Curran, says it is an opportunity for local staff to support and foster a community-based initiative.
“Our staff had a great time helping Simon [Rixon] and the team�
Westfund Maroochydore’s Kathleen Quijano, Janine Curran and Jaide Vanneste
happyholiday cruising NOW TAKING BOOKINGS FOR: PRIVATE FUNCTIONS • WEDDINGS • LUNCH CRUISES • SEAFOOD DINNER CRUISES • SUNSET CRUISES *Numbers subject to Covid compliant. www.mooloolabacruises.com.au 0428 576 474 33 - 45 Parkyn Parade, Mooloolaba
“It’s great to be able to support a worthwhile community organisation who gives back to the Sunshine Coast area,� Ms Curran says. “Our staff had a great time helping Simon [Rixon] and the team at Maroochy Neighbourhood Centre for the afternoon. “It certainly feels good to do good.� Westfund’s brand refresh rolled out across digital channels from December 1 with Westfund Care Centres and other physical touchpoints to be updated gradually over the coming months and years.
Division six (Buderim, Mountain Creek, Palmview, Sippy Downs) Steady and sustainable growth continues for Sippy Downs Development is continuing to gain momentum at the Sippy Downs Town Centre with nine separate developments under construction. Sippy Downs was designed as an education and research hub and the development demonstrates council’s commitment to the area being a catalyst for attracting knowledge-based employment opportunities. The residential, commercial and civic developments help maximise the area as a launchpad for health and technology start-ups, incubators, entrepreneurs, accelerators, mentors and investors. These new developments are bringing us closer to realising the vision outlined in the Sippy Downs local area plan and it is steadily becoming a vibrant and active town centre. Stay informed about developments or future proposals at developmenti.sunshinecoast.qld.gov.au. Alfriston Drive, Buderim Advocating for the delivery of pathway networks that enable safe pedestrian and cycle access is something I find extremely rewarding. This new pathway will provide a safe and functional way for local residents to use sustainable transport options, like walking or cycling, all while taking in the beautiful scenery around Buderim. Together, council and the federal government will deliver more than $250,000 worth of pathway for division six.
q
Selling soon? Call now for your complimentary home appraisal or scan here.
myweeklypreview.com.au
33.indd 1
My Weekly Preview | January 7, 2021 33
4/01/2021 3:10:43 PM
Local
SAFE ACCOMMODATION THE KEY TO CONTINUED LEARNING
news
Thanks to a group of Coast locals, East Timorese teenagers can go to high school. WORDS: Caitlin Zerafa.
Elizabeth Dickson, former student and current border force soldier Jake, John Shadforth, Robert Dickson and Deo da Costa at Encouragement House in East Timor
T
welve years ago, a small group of Sunshine Coast businesspeople set out to help teenagers in a remote East Timorese village attend high school. Today, what is now known as Encouragement House, has grown to help hundreds of local students in the Lolotoe
district receive an education in the city of Maliana. Charity founder and Kawana resident Robert Dickson and his wife Elizabeth began the initiative after a chance meeting with Timorese local Deo da Costa in 2006. Mr Dickson had made a sizeable contribution to a charity, visiting East
Timor to see the work they do on the ground. “The person leading that was Deo; we just had a friendship from there,” Mr Dickson says. After violence erupted in 2006, the Dicksons invited Mr da Costa to live with them and take a three-month English course at the University of the Sunshine Coast. When they asked what he was going to do once he returned home, his idea came to fruition. “Deo’s dream was to provide a safe place in Maliana where children from his remote village could come to continue their secondary school studies,” Mr Dickson says. “At that time only some of the seven villages in the Lolotoe subdistrict had a primary school and the nearest high school was an overnight walk away in Maliana. “[Mr da Costa’s] experience as a young man had been to live, unsupervised in Maliana, caring for himself, while he completed his high school years. “In consultation with the local people, it was decided that hostel accommodation for village boys and girls equally be provided close to the high school.” Thanks to the generosity of the Sunshine Coast community, the Dicksons were able to raise $600,000 to build the facility, initially for 160 students each school year. “With the December 2020 graduation of Year 12 students, EH [Encouragement
SOUTHERN SUNSHINE COAST REGION
House] has now provided accommodation for hundreds of village students,” Mr Dickson says. “Some of our previous students now include a radiographer, nurse, teachers, soldiers, scientists, policemen, drivers, farmers, IT specialists and, of course, students who have returned to their village but with knowledge to help with their family farm.” Encouragement House is run by the da Costa family and now accommodates students from all six sub-districts, which include several language groups. The organisation also teaches English and computer skills after school hours and has accommodated many Australia high school students on immersion visits over the years. In 2021, Encouragement House is hoping to fundraise for urgent renovation on the building, caused by the harsh climate over the years. “Our major thrust this year after all the students commence school again in early January 21, will be to continue our building maintenance program to ensure the buildings in the tropical weather keep going,” Mr Dickson says.
WE PAY CASH
LOVED BY LOCALS Locals trust Sunstate Jewellers for everything jewellery related.
• GOLD • PLATINUM • SILVER • PALLADIUM any condition, any quality
Enjoy factory direct shopping, where you never pay full retail on our beautiful original designs available in our beachside showroom. howroom. Talk direcly to award winning artisans and designers and let’s work together to create jewellery that’s unique to you.
Mention this ad for y a FREE jewellery clean & polish.
Mention this ad to recieve an additional 8%
Valued $40
5491 1733 Sunstate Jewellers, Sunstate House, 2 Allen Street, Moffat Beach www.sunstatejewellers.com.au 30 My Weekly Preview | January 7, 2021
30.indd 1
myweeklypreview.com.au
4/01/2021 3:13:43 PM
LOCAL NEWS
THE GOOD PLACE KAWANA WINS RESILIENCE AWARD Despite opening days before lockdown, this cafe survived and thrived.
A
The Good Place Kawana head barista Isabella Keyte
fter opening just two weeks before the national COVID lockdown in March last year, a Kawana restaurant has been recognised with an inaugural resilience award. The Good Place Kawana took out top spot in the community category for the SmartCompany Australia Resilience Awards. The Good Place co-founder James McGovern says the win is just as much a credit to the Sunshine Coast community as it is to his business. “We were only open for two weeks before the nationwide shutdown in March,” he says. “Being located at a shopping centre with significantly slower foot traffic, we knew takeaways weren’t going to be enough to keep us afloat. “However, local businesses, especially gyms, became such loyal supporters and advocates of our brand. “Really, without the continued support of these businesses as well as
Trades & services
THE ANGRY BAKER 90 Bulcock St. Caloundra www.angrybaker.com.au
07 5341 8844 Proudly at the dodgy end
■
■
■ ■
31.indd 1
KIWI LADIES BACK IN 2021 The Kiwi Ladies morning tea will resume in 2021 with the first meeting scheduled for on January 28. The group meets on the last Thursday of every month from 10am at Caloundra RSL. The group of New Zealand ladies’ welcome others who might like to join for a cuppa and chat. Phone 0438 844 350 for more information.
LOCAL NEWS Do you have a news tip? Let journalist Caitlin Zerafa know about it! Phone 5444 0152 or email: localnews@myweeklypreview.com.au
@ Get Set Footw Footwear 5%
Seniors Discount
EXCELLENCE ■
myweeklypreview.com.au
Are you a local Rotary or Lions club, men’s or women’s shed or similar group or association and would like to have your news and events shared in My Weekly Preview’s new local news pages or contribute as one of our regular columnists? Email us at localnews@ myweeklypreview.com.au
Turn to page 69
RENOVATION
Renovations . New Homes . Body Corporate Call Tim today! Mob. 0413 948 975. info@tmgcon.com.au tmgcon.com.au
sporting clubs and community groups, there’s no way we could have done it.” The health food cafe sources sustainable and ethical ingredients for its menu, using local suppliers such as Forage Farms, Voodoo Bacon, Sunshine Coast Organic Meats, Suncoast Fresh and more. The Good Place is also teaming up with Buddina Community Garden, planting two garden beds and growing produce to use in the cafe kitchen. After taking a break from its Smart50 Awards in 2019, SmartCompany Australia decided to relaunch its nationwide awards in 2020. A SmartCompany spokesperson says they wanted to change their criteria to reflect the harsh conditions of 2020 and in turn celebrate entrepreneurial agility. “We wanted to celebrate the businesses that withstood the challenges of the coronavirus pandemic and spotted new opportunities; that deepened their ties to their communities; that put their people first.”
SHARE WITH US TODAY
Over 30 years in construction Local builder using quality local trades & suppliers All aspects of the build is organised from concept to completion Professional in-house carpenters Outstanding customer service, where the client’s input is encouraged
M Mens Ladies Noosaville 230 Gympie Tce 5447 1755 Caloundra 82A Bulcock St 5492 7185 Shop Online - @getsetfootwear.com.au
Like us Follow
Registered Builder QBCC# 1179913
My Weekly Preview | January 7, 2021 31
4/01/2021 3:15:30 PM
LOCAL NEWS
PETE THE PEBBLE HITS THE AIRWAVES
A
fter his success at the Queensland Poetry and Song Writing Competition last year, Peachester’s Angus Joyce now has his song available for download on music streaming services.
10-year-old Angus Joyce has released his song Pete the Pebble
The 10-year-old’s song about a pebble named Pete was written and produced from his lounge room during lockdown in March, using his keyboard, keytar and looper. “Well during lockdown I was messing around with my old keyboard and I came up with the riff so then I wrote the words,” Angus says. “At the time I was listening to a lot of The Cat Empire – Harry [James Angus] has inspired me a lot.” Angus began with the words: “One day when I was walking down the street I saw a pebble drop at my feet. So, then I picked the pebble up. He said, hi, my name is …” “I thought, what rhymes with feet and the name Pete came to mind,” Angus says. Pete has become quite famous in the local community, with the character taking on its own persona with painted pebbles being left around town for people to find. “Mum told me that kids were putting painted rocks around the neighbourhood and I decided to make Pete a character,” Angus says. Pete has since found himself into a few post bags and defied border lockdowns to make appearances in
Pete the Pebble Broome, London, Cologne and Berlin. Thanks to support from the community and sales from Pete the Pebble T-shirts, which were screenprinted at home by Angus’s mum Sally, they were able to self-fund recording the song. The song, which includes a guitar solo by Angus’s 11-year-old friend Micha, was recorded in the studio of Russian-born local artist Innessa and sent to the Ukraine to be mixed. Pete the Pebble is available to download on Apple Music, Spotify and Amazon. Did you know? The name Peter means rock or stone and is derived from the Greek word Petros.
GCSCC LUNCHEON Glasshouse Country Senior Citizens Club (GCSCC) met at Landsborough Hotel last month for its Christmas Party luncheon. The club’s Janette Barnes says it was a wonderful day with a morning tea and quiz, followed by a lunch and raffle prizes. “A great time was had by all,” she says. “Marie Klose won the major prize. Well done, Marie. We look forward to seeing new and familiar faces in 2021.” GCSCC will recommence on February 9. Seniors aged 50 and over are welcome. Contact 5496 9260.
STADIUM MAKEOVER Caloundra Indoor Stadium is undergoing a New Year makeover with amenities, change room and kiosk upgrades and resealing of the sprung timber floor. The renovations will benefit several sporting and community groups who regularly use the facility on North Street, Golden Beach. The stadium will be closed through the duration of the upgrades, reopening January 27. All community groups using the stadium have been notified and the team at Caloundra Indoor Stadium looks forward to welcoming sporting enthusiasts back in late January.
GET MORE $$$ FOR YOUR CAR! DO YOU HAVE A CAR FOR SALE?
Happy Holidays from the Consign a Car Team We look forward to seeing you in 2021 whether buying or selling a car
Do you want maximum exposure Australia wide for minimum expense? Take the hassle out of selling your car... LET US SELL IT FOR YOU! Better $$$ than trade-in or wholesale, you’re the ‘Boss” we work for you!
2012 Kia Grande Carnival $13,990
2019 Mazda 2 $16,990
2012 Mitsubishi Triton $19,990
8 Seater People Mover! Full Service History! Dual Climate Control Aircon! Cruise Control, ABS Brakes.
Zoom into a Great Deal! 6 Speed Manual with Low K’s! Full Service History! Push Button Start with Key Proximity!
Built for Work & Play Dual 4x4 Ute! Economical Turbo Diesel! Full Service History! Hard Lid, Roof Racks.
2015 Jeep Compass $23,990
2014 Lexus ES $33,990
Great Value Family SUV! Heated Leather 1 Elderly Owner Since New! Extremely Low Trim! Sunroof! Reverse Camera! GPS, Dvd k’s! Just Been Serviced! Blind Spot Monitor! Player, Climate Control Aircon,18” Alloys. Sunroof! Radar Cruise Control, 17” Alloys.
• 12 MONTH WARRANTY • DRIVE AWAY PRICES • SAFETY CERTIFICATE & CAR HISTORY PROVIDED
CALL OR VISIT US TODAY! 460 Gympie Road, Kedron | Ph: 07 3359 2477 A/H: 0421 047 286 | www.consignacar.com.au A U S T R A L I A’ S L A R G E S T C O N S I G N M E N T D E A L E R Q U E E N S L A N D ’ S B E S T VA R I E T Y 32 My Weekly Preview | January 7, 2021
32.indd 1
myweeklypreview.com.au
4/01/2021 3:23:46 PM
LOCAL NEWS
CALOUNDRA EVENING VIEW CLUB CELEBRATES THE YEAR THAT WAS
Back row: Caloundra Evening VIEW Club zone co-ordinator Clodagh Barwise-Smith presented service medals to Pat Greenwood, Dal Connolly, Ruth Honzatko, Pam Round, Lesley Doyle, Dianne Sutton Front row: president May Thomas, Pat Boulton and Noela Nolan
E
ntertainer Billy Guy kept toes tapping while members enjoyed the recent Caloundra Evening VIEW Club meeting.
The celebration of a year’s worth of fundraising included guests Danelle Wiseman and Jonathan Pattinson of Better Homes and Gardens Real Estate
Caloundra, who donated $500 to the club. “Danelle remarked that when they heard about the work of VIEW and the Smith Family they knew they had found a truly worthy cause,” the club’s Glenda Galway says. “President May Thomas expressed gratitude for their support in also supplying the Better Homes and Garden magazines, which were delivered free to members’ homes during the COVID period.” During the December event, zone co-ordinator Clodagh Barwise-Smith presented service badges to eight ladies. Across Australia, VIEW Clubs raise money to sponsor disadvantaged students, in the hope of breaking the poverty cycle, and regardless of the challenges of 2020, the local club was able to continue fundraising efforts. “In spite of this year’s unprecedented changes, the club’s trading table of made, baked or grown products raised $500 for the month and members’ donations totalled $3000 this year,” Ms Galway says. The club’s next function is a friendship dinner at the Caloundra Golf Club on Tuesday, January 19. Phone 0403 504 408.
Cr Peter Cox
Division three (Aroona, Bokarina, Birtinya, Currimundi, Little Mountain, Meridan Plains, Warana, Wurtulla) Happy New Year I hope you all found some time to unwind over the festive period, and I look forward to continuing to positively represent division three. I encourage you to reach out via email at peter.cox@sunshinecoast.qld. gov.au or call my office on 5420 8978. Park improvements Pre-Christmas our team was busy delivering a number of small, yet important improvements to division three parks. Grahame Stewart Park in Currimundi received some additional seating, drinking fountain, dog water bowl and drainage improvements. Over 100 trees were planted around the AFL fields at Meridan Sports Fields. Jasmin Circle Park, Bokarina received a minor facelift, and we delivered a connective pathway from the shower at Beach Access 240 in Warana. Help the hatchlings We’re keen to foster a turtle-friendly community, so come along to a Clean-up for the Hatchlings event at 6am on Saturday, January 30 at several beach locations from Caloundra to Coolum.
by
47 CALOUNDRA ROAD, CALOUNDRA. TEL 07 5492 7188 * Conditions apply. At participating stores for a limited time. Discounts off the recommended retail price. Discounts off selected products. Excludes gift cards.
myweeklypreview.com.au
33.indd 1
My Weekly Preview | January 7, 2021 33
4/01/2021 3:18:11 PM
SOCIALS
Engineering a fun Christmas In true festive spirit The Barlow Shelley Consulting Engineers put work on hold and zoomed into end-ofyear celebrations at The Rooftop Bar Maroochydore. Images: Elle Patterson
WORST WORDS AND PHRASES OF 2020 When times got tough, people got into creative writing, with some exceptional results.
VERTICAL CONSUMPTION When South Australia announced it would allow people to drink in bars while standing up, the SA government described it as “vertical consumption”.
DISCRETIONARY ESSENTIALS This oxymoron of the year emerged from the retail sector and refers to spending on “discretionary essentials” for home renovations and office supplies.
ZUMPING Dumping a romantic partner on Zoom. Cameron Landreth, Lilly Nikolic, Jamie Page
SHE-SESSION This word was invented by someone to describe how the COVID-19 recession is disproportionately impacting women.
HIPSTURBIA A real estate sector-driven word that describes suburbs that attract ‘hip’ residents.
A MAGNETIC AND EUPHONIC BUILDING The real estate sector also generated the mixed metaphor of the year: “A magnetic building both lyrical and euphonic, driven by pizzazz and charm”.
WITHDRAWN AS A MATTER OF PRIORITY
Tony Shelly, Peter Barlow, Heather Bradbury
Need to stop a wild animal from harassing people? Make sure it is “withdrawn as a matter of priority”. That means kill it.
SENSITIVE RECEIVERS A tunnel construction project described how its noise abatement was “designed to minimise noise and vibration impacts on sensitive receivers” – that is, homes, schools and hospitals.
REVERSE PORK BARELLING Daniel Kenna, Dean Bisset
Jeremy Lawrance, Vincent Vicic
Former federal minister Bridget McKenzie defended her decision to allocate sports
grant money to projects in marginal seats as “reverse pork-barrelling”. She also reversed her cabinet spot.
EFFORTING OUTREACH White House press secretary Kayleigh McEnany explained President Trump was trying to contact the family of a police shooting victim by saying: “We are efforting outreach”.
HEALTH DICTATORSHIPS Former Australian PM Tony Abbott railed against so-called COVID-19 “health dictatorships” when Victoria imposed restrictions while battling a second wave outbreak.
APOLOGISED FOR THE DISTRESS THE EVENT CAUSED A Rio Tinto executive was recorded commenting on the destruction of two 46,000-year-old landmarks in the Juukan Gorge, saying: “We haven’t apologised for the event itself, per se, but apologised for the distress the event caused”. SOURCE: Annual list of the worst words and phrases, compiled by Australia’s Plain English Foundation.
Two weeks free respite care with IRT Woodlands * To help put your mind at ease about moving into residential aged care, we’re offering a free* two week respite care trial at IRT Woodlands. Your loved one can experience living in an aged care community, meet new people and join in daily activities, while being cared for 24/7 by our compassionate and experienced team. *We will waive the care fee for the first 14 days of an eligible stay. To be eligible, you must have a current ACAT approval for respite care and a respite care allowance balance of at least 14 days. This offer can only be redeemed once during the offer period and is subject to availability. Full terms of offer at irt.org.au/respiteoffer.
Visit irt.org.au/respiteoffer or call 134 478 34 My Weekly Preview | January 7, 2021
34.indd 1
myweeklypreview.com.au
4/01/2021 10:33:36 AM
MY FUN
HOROSCOPES
13
14
15
16 17
18
19
20
21
22
23
ACROSS
DOWN
1 8 9 10 11 12 14
2 3 4 5 6 7 8 13 15 16 18 20
17 19 21 22 23
The easy alternative (4,6) Passionate (5) A profligate (7) Raise siege of (7) Try hard to persuade (5) Sister’s son (6) Name of eight English kings (6) Wrath (5) Smallest of the Great Lakes (7) Accuse (7) Tolerate (5) Toughened by experience (4-6)
SUDOKU
4 5
Partly cover (7) A culinary herb (5) Tin and lead alloy (6) Lacking taste (7) Boldness (5) Totally unfamiliar subject (6,4) By a wide margin (3,3,4) Previous (7) Halo (7) Mix socially (6) Circumference (5) Autonomous region of China (5)
4
2
SCORPIO (OCT 24-NOV 22) The new moon encourages you to reach out and help others, both within your circle of family and friends and within your neighbourhood. The close community connections you foster now will prove beneficial in the future. But steer clear of negative thinkers!
SAGITTARIUS (NOV 23-DEC 21)
CAPRICORN (DEC 22-JAN 20)
AQUARIUS (JAN 21-FEB 19)
PISCES (FEB 20-MAR 20)
Relationships at work and within your local community will be a veritable minefield this week as your patience and diplomatic skills are tested. Trying to rush matters (and people) won’t help. Smart Sagittarians will strive to be extra tolerant and understanding.
Capricorns are set for a big week as Venus, Pluto and the new moon all activate your sign. You’re keen to contribute your money, time or talents to a worthy cause, but Saturn saps confidence on Wednesday, when your energy is curbed.
With four planets (including the new moon) highlighting your humanitarian zone, it’s time to step up and give back. Your motto for the week is from birthday great Muhammad Ali: “Service to others is the rent you pay for your room here on Earth.”
Your involvement with a group, class, club or organisation has other people looking to you for extra inspiration. Use your networking skills to drum up support, and don’t be afraid to ask others for assistance when you need it.
WORD STEP Complete the list by changing one letter at a time to create a new word at each step. One possible answer shown below.
_ _ _ _
9
1 4 9
LIBRA (SEP 24-OCT 23) Many Librans will commence an exciting new chapter involving home or family, which could include renovating, relocating or welcoming an additional family member. It’s also time to express yourself as you write, paint, perform or play up a storm.
5 1 6 8 6 4
_ _ _ _
_ _ _ _
_ _ _ _
_ _ _ _
CLONK
2 1
QUIZ 1. What do the films Gremlins, It’s a Wonderful Life and Love Actually have in common? 2. Gorgeous George was famous in which sport in the 1940s and 1950s? 3. On Christmas Eve and Day of what year did Cyclone Tracy devastate Darwin? 4. What was Patti Smith’s (pictured) 1975 debut album called? 5. In the film Babe, Babe the pig sings what Christmas song?
0405 504 514 www.tarotbuderim.com
SOLUTIONS
SINCLAIR TOUR & TRAVEL Day Tours - with Pick ups 26 Jan 31 Jan 2 Feb 11 Feb 12 Feb 20 Feb 10 Mar 16 Mar 21 Mar 31 Mar 24,28 Apr 17 Dec 21
myweeklypreview.com.au
35.indd 1
Ph: 5494 5083
Extended Tours - Small Groups!
Australia Day Lunch Cruise Outback Spectacular Lunch Bayside Drive North Stradbroke Island Scenic Drive to Mount Mee Rock the House QPAC - Glen Shorrock, John Paul Young Lychee Farm Tour & Lunch Tamborine’s Glow Worm Sanctuary Singalong Sound of Music Cliff Richard – Marty Rhone Come From Away QPAC Keith Urban in Concert
LIKE US ON FACEBOOK
6. What postal code did Canada Post assign for seasonal mail addressed to Santa Claus at the North Pole? 7. Actor Mark Wahlberg was a member of which 1990s hip-hop band? 8. What was the island of Kiritimati formerly known as? 9. Australian lizards of the genus Varanus are better known by which common name? 10. What is a plantain?
0801
8 7 3 7 2 9 4 5 1 1 3 9
VIRGO (AUG 24-SEP 23) This week, make sure your talent for criticism (constructive and otherwise) doesn’t go into overdrive as you critique those around you. If you empathise with a frustrated child or friend, it will help them to calm down and recalibrate.
DRIVE
MEDIUM
6 1
LEO (JUL 24-AUG 23) You’re keen to make professional decisions and connections as the new moon highlights your job zone. It’s a good week to create waves within your circle of influence. Attached cats, get talking and collaborating with your partner.
CROSSWORD: Across: 1 Soft option 8 Fiery 9 Wastrel 10 Relieve 11 Press 12 Nephew 14 Edward 17 Anger 19 Ontario 21 Arraign 22 Brook 23 Hard-bitten Down: 2 Overlap 3 Thyme 4 Pewter 5 Insipid 6 Nerve 7 Closed book 8 Far and away 13 Earlier 15 Aureole 16 Hobnob 18 Girth 20 Tibet
12
Partnerships (romantic and platonic) receive a boost when Venus and the new moon increase optimism and help you reform a rickety relationship. Positive new patterns of behaviour see the union move to a more stable and satisfying level.
QUIZ: 1. A Christmas-time setting 2. Professional wrestling 3. 1974 4. Horses 5. Jingle Bells 6. H0H 0H0 7. Marky Mark and the Funky Bunch 8. Christmas Island 9. Goanna 10. A green-skinned, banana-like fruit
11
CANCER (JUN 22-JUL 23)
Wednesday’s new moon heralds a fresh financial or sexual chapter. Smart twins will initiate a strategic savings plan, attract a new business partner or love interest or reboot a stale relationship. 2021 is a good year to study and investigate.
WORD STEP: DRIVE DROVE DRONE CRONE CLONE CLONK
10
GEMINI (MAY 22-JUN 21)
This week, friendships are particularly favoured as you link up with pals from home and far away (in person and online). You’re in the mood to help a loved one through a rough patch or cheer up a work colleague who is down in the dumps.
3 9 2 5 6 8 4 7 1
9
TAURUS (APR 21-MAY 21)
Eager rams love starting projects but often lack follow-through, so you can miss the Career Success Boat because you rarely finish things. Be inspired by birthday great, writer Benjamin Franklin: “Energy and persistence conquer all things.”
8 6 4 7 1 3 9 5 2
7 8
ARIES (MAR 21-APR 20)
1 7 5 9 4 2 6 3 8
6
6 8 1 4 9 7 3 2 5
5
2 5 9 1 3 6 8 4 7
4
7 4 3 2 8 5 1 6 9
3
9 1 7 6 5 4 2 8 3
2
5 3 6 8 2 1 7 9 4
1
4 2 8 3 7 9 5 1 6
CROSSWORD
9 Feb 18 Feb 25 Feb 14 Mar 24 Mar 1 Apr 18 Apr 26 Apr 29 Apr 24 May 12 Jun
Batemans Bay’, Lakes Entrance, Eden, Mogo Zoo 5 Day Mystery Tour Be Quick! Lady Elliott & Fraser Islands - 5 Days Kangaroo Island & Murray River Cruise Silo Art Trail Adelaide to Albury Lightning Ridge Easter Festival - BE QUICK! Outback Along Kidman Way High Country/Autumn Colours Lord Howe Island O’Reilly’s - 4 Days Norfolk Island – 8 Days
31 August – Tangalooma Island Resort – 3 Days Inclusions: Dolphin Feeding, Whale Watching Cruise with Lunch, Fish Feeding Cruise, 4WD Northern Safari Tour.
info@sinclairtours.com | www.sinclairtours.com
SMALLER GROUPS MORE FUN! My Weekly Preview | January 7, 2021 35
4/01/2021 2:58:07 PM
THAT’S LIFE
THE PLAN FOR 2021
THE ONLY WAY IS UP
For Ashley Robinson, Christmas is always a time for reflection, and he’s making resolutions he intends to keep.
Sami Muirhead has a definite spring in her step as she contemplates giving herself a break in the New Year.
W
e are nearly there 2021; I wonder how long I will last before I break any New Year’s resolutions? I often write about my mum dying at Christmas, with her timing being pretty good. She left me with great memories, and she had a great life, beating cancer at 42 and living to 90, with only one hiccup when her beloved husband Len died 28 years before – she never stopped talking about him until the day she passed. Dear old Dad’s passing is a real issue for me. I am turning 63 and Dad died at 66, which means I could have just three to go? If that’s the case, a few resolutions are in order. A new diet, no fried or processed food if possible, and if I do weaken only on one day a week, with the intention of losing eight kilos and keeping it off without sacrificing my love of a cold beer or robust shiraz. Don’t sweat the little things is going to the top of my list, along with you can’t change what you can’t change so let it go. Pretentious people will not get my time unless I am getting to paid to be nice to them and material possessions unless somehow hooked to my soul go to the
W
bottom of the list, unless it’s a Ducati. That goes for reality television as well – I refuse to spend my last three years watching the imperfections of the human race which seems to actually make them famous, which shows what a sad lot we are and no more for me. If I have only three years to
hat is your relationship with making a New Year’s resolution? I do not bother most years because I am rubbish at keeping them! Last year I embraced a word for 2020 and it was ‘Vision’. I thought the year would teach me all sorts of lessons as I tried to have clearer clarity when it came to friendships and relationships and my own approach to work and family. The year went nothing to plan, of course, thanks to COVID-19, and 2020 could have been called ‘Glen 20’ because it was full of pesty stuff. I am not sure my word was fitting or not in the end, but I do love that Ralph Waldo Emerson quote: “The years teach us much, which the days never knew.” So, this year I am not having a resolution to break or beat myself up over because I am probably not destined to lose weight or clean out my super-messy bottom kitchen draws. Instead, I am going to try to live by the sayings “ride the lift more often” and “eat more spring rolls”. My friend sent me an unexpected text thanking me for getting in the lift six
“Pretentious people will not get my time unless I am getting to paid to be nice” go, I am not going to watch some loser on television backstab their way through the show and end up on national radio. Finally, as a wise person once said, if you give 20 per cent of your time or your wealth to someone or something in need you will get it back twofold so that’s my plan. But I don’t want anything back apart from maybe getting above that 66 number. I really would like to be around to watch my grandkids grow up, but only If I’m having fun. Happy New Year.
Ashley Robinson is the manager of Alex Surf Club and the chairman of the Sunshine Coast Falcons.
months ago to check if she was okay as she had been crying at work. It obviously meant so much to her and I replied to her that she had often got in my lift in a metaphoric way. We are all in this together right and checking on each other as we go up and down in life is a huge part of humanity. This is the same lift we all use at work and it is the direct path to heaven: spring rolls! Our local Vietnamese takeaway shop makes the most delicious pork spring rolls. They are life changing. They are a hug for your soul. Money cannot buy you happiness, but it can fill your belly with hot springies. Another friend and I at work have talked about having lunch together for two years. Two whole years! So, there is a lesson in my rave today: ride the lift more often and eat more spring rolls in 2021. And yet again I will quote Emerson as he famously said: “What lies behind us and what lies before us are tiny matters compared to what lies within us.” I get it. May more spring rolls and more time with friends and family lie within you in 2021.
Sami Muirhead is a radio announcer, blogger and commentator. For more from Sami tune into Mix FM.
The opinions expressed above are those of the authors. These are not the views of My Weekly Preview publishers.
Breaking up with your bank? Be part of something better. Find out more about the Ord Minnett difference With over 28 years experience offering prudent financial advice on the Sunshine Coast, we provide peace of mind that you deserve. Ord Minnett Limited Australian Financial Services Licence 237121
Call 07 5430 4444 for an obligation free consultation 36 My Weekly Preview | January 7, 2021
36.indd 1
buderim@ords.com.au myweeklypreview.com.au
22/12/2020 2:25:40 PM
MY BODY
2021
beauty trends Beauty editors are calling Maybelline’s Lash Sensational Sky High Mascara a lash extension in a bottle. It will be available at Chemist Warehouse, Priceline, Target and B Big W.
IMAGE: INSTAGRAM @NIKKI_MAKEUP I_MAKEUP
Celebrity makeup artists like Nikki Wolff are predicting a big return to colour and glamour in 2021. The no-makeup makeup look has had its day and we’ll be seeing saturated jewel shadess for eyes, particularly lilac, purple and electric blue and strong lip shades. Get this look with the Huda Beauty Obsessions Eyeshadow Palette in Gemstone, $48 from Sephora.
Chantecaille’s new Luminescent Eye Shade is a Chantec ca gel powder powd d with a multidimensional shimmer. This shade is Crane, a deep, shimmering berry. It’s $83 Mecca Maxima. from Mec
Standard St d d blush bl h isn’t enough. The Gold Rush Blush from Benefit Cosmetics also adds pretty golden flecks to your cheeks, $54 from Sephora.
WE
love Launching in 2021 is the Peace Out La Retinol Eye Stick, a serum-balm that Re targets fine lines under the eyes with tar retinol and peptides. The lipstick-style ret packaging makes application easy. It pa will be available at Sephora. wi
MAC has done the hard work in choosing a lipstick from its hundreds h ndreds of shades by b combining its three bestsellers into a package. The MAC Cosmetics Lipstick Bestsellers Kit includes Ruby Woo (retro matte blue-red), Chilli (brownish orange-red) and Velvet Teddy (matte beige), $75 from Mecca Maxima.
New year. New start. New home? Whether you're buying, selling or renting... we take care of property. Here at Adams & Jones, we believe if our clients win – we can’t lose ... and so we continue to build on from our success by winning for our clients. -J]SYǓVIVIEH]XSQEOIERI[WXEVXMRXLIRI[]IEVTPIEWIGSRXEGXSYVSɦGIER]XMQIERHSYVXIEQ[MPPXEOIGEVISJ]SYERH]SYVTVSTIVX]
SUNSHINE COAST
myweeklypreview.com.au
37.indd 1
•
BRISBANE
•
EMERALD
T. 1800 875 875
adamsandjones.com.au
My Weekly Preview | January 7, 2021 37
22/12/2020 12:45:25 PM
PROMOTION
my
style. SPOIL YOURSELF WITH SOME RETAIL THERAPY AND SUPPORT OUR LOCAL STORES
Amazing anti-ageing serum New store in Mooloolaba Explore exclusive limited edition designs or rare one-of-a-kind pieces, uncover a newly made item to cherish or something meaningful from a bygone era. Treasure Store – The Wharf Mooloolaba Opening mid-December, info@treasurestore.com.au au
The bestseller in the Wendy Christina premium skincare range is their Kakadu Plum & Hyaluronic Acid Anti-Ageing Serum. Your ultimate vitamin C fix. Wendy Christina’s products can be purchased online: wendychristina.com Follow on Facebook: wendychristina.skincare.
Gorgeous fashion Bring bright colours to your wardrobe this summer with gorgeous Australian-made clothing. Available in store at BY EARTH fashion and homewares a new boutique in Buderim 0432 533 954.
Perfect for summer Friend’s Boutique in Buderim has gorgeous styles in store, like this Orientque Evora dress $109. Shop now for summer. Friends Boutique 5476 9653
We love Humidity Shop these stunning Humidity Freya shorts now at Yellow Oak Clothing & Homewares 0400 768 197
38 My Weekly Preview | January 7, 2021
38.indd 1
Victorian 18-carat yellow gold sapphire 1/2 hoop ring $7600
Antique & modern jewellery
Summer vibes Eyes on Buderim has a colourful selection of frames and sunglasses in various shapes and sizes. See the team in beautiful Buderim – they would love to help you. Eyes on Buderim 5477 0293
Shop in store or online now at Avenue J Jewellery 5444 4422 avenuejjewellery.com.au
18-carat white gold oval ruby & Australian pink Argyle diamond cluster ring P.O.A. myweeklypreview.com.au
4/01/2021 2:51:23 PM
PROMOTION
Unique jewellery to treasure Shop this gorgeous jewellery now at To Hold & To Have. Turquoise 9-carat yellow gold drop earrings. To Hold & To Have, 5477 0561
Pure footwear Aeria by Effegie in sand or mulberry. The cushioned leather lining and flexible footbed make them perfect for all-day wear. Available in store now. Pure Footwear Buderim, 5456 4440
Volumising root spray Volumising root spray is perfect for fine, brittle and thin hair to give volume at the roots, strengthen and add body. Available now at Eco Organic Hair & Body 5451 1300
Soft and light Shop beautiful new season styles now at Gingers. The Wharf, Mooloolaba 5373 6476, Buderim 5373 6398
Opals Down Under
Stunning New Arrivals Onyx Poppy welcomes new summer styles for 2021 in store. Shop this gorgeous Ruby Yaya Valradero maxi dress now. Onyx Poppy Boutique 5370 9222
Black opal and boulder opal ring in white gold with a diamond at opalsdownunder. com.au
WE
Opals Down Under 5494 5400
love
Feel beautiful
Summer accessories Shop new season spring styles and accessories now at Think Pinq in Moooloolaba. Follow Think Pinq on Facebook for regular style and accessory updates. Think Pinq Mooloolaba 5478 4001
Amoena’s designers introduce a new kind of convertible bra: the Celine non-wired bra, with an adjustable centre front, features two different wearing options – you can decide how you want to wear it. Of course, the Celine bra also includes Amoena’s signature soft pocketed interior cups which can hold a breast form or breast shaper. 0466 828 144 or traceyg.com
HAVE YOU BEEN AFFECTED BY BREAST CANCER?? WE CAN HELP YOU FEEL COMFORTABLE AND LOOK BEAUTIFULL IN YOUR OWN CLOTHES To save you time, Tracey G Prosthetics and Lingerie is a true one stop shop having the largest range of prosthesis, beautiful lingerie and mastectomy apparel available. We have trained fitters who understand what needs to be done to ensure your comfort is achieved first time.
• We help you understand your Medicare re paperwork and claims process • All cup sizes AA-K in sizes 6-30 in all leading brands • Mobile service, we can come to you
NOW OPEN AT 967 STANLEY ST, EAST BRISBANE 0466 828 143
9 FIRST AVENUE, MAROOCHYDORE • 0466 828 144 | myweeklypreview.com.au
39.indd 1
967 STANLEY ST, EAST BRISBANE • 0466 828 143
WWW.TRACEYG.COM My Weekly Preview | January 7, 2021 39
4/01/2021 2:55:20 PM
EDUCATION FEATURE
FLINDERS CLASS OF 2020 ACHIEVE TOP ACADEMIC RESULTS through a disrupted final year. “We are thrilled to have our Flinders class of 2020 cohort achieve a median ATAR of 93.15, especially after all they have endured in 2020,” Mr Meade says. “It is wonderful to learn that more than 91.5 per cent of our students achieved an ATAR greater than 65.5,
“The Flinders class of 2020 has demonstrated positivity and determination”
L
eading Queensland independent school Matthew Flinders Anglican College is celebrating top ATAR results for its class of 2020, announced statewide on Saturday, December 19. The Flinders class of 2020 achieved
40 My Weekly Preview | January 7, 2021
40.indd 1
a strong median ATAR of 93.15. All graduating students were invited to a morning tea event at the college to celebrate their remarkable achievements. Principal Stuart Meade says the college is immensely proud of its students for remaining committed to their study
which is the old OP15 cut-off,” he says. “Early university offers have already been accepted by 31 of our students, and we anticipate the majority being accepted into their chosen tertiary courses. “As a college community, we celebrate the efforts of Justin Holland [pictured], one of only 30 students in Queensland to
receive the very highest ATAR of 99.95. “It is also inspiring to have nine students achieve 100 per cent in a variety of subjects, with Louisa Travers Jones achieving in two subjects; and a total of 24 students achieving straight A grades in all of their subjects. “Our college is committed to providing a quality education so that our students may achieve excellence in learning and life. “A major focus is to support students to develop the character traits and skills so that they may experience a fulfilled, healthy and successful life, and contribute to making the world a better place. “The Flinders class of 2020 has demonstrated positivity and determination to succeed this year, and we are excited for their next chapter beyond our College gates. “I acknowledge and thank all staff at the college, teaching and administration, who have played a part in our Year 12 leavers’ success.” Visit mfac.edu.au
myweeklypreview.com.au
4/01/2021 3:46:45 PM
EDUCATION FEATURE
GRAMMAR STUDENTS MAKE THE GRADE approximately 11.11 per cent of students achieving an ATAR of 98.9 or above. A further 47.78 per cent scoring above an ATAR of 91.5 or above and over 95 per cent above a ranking of 65.5. The realisation of hard work and commitment has finally paid off for these students as the journey they once only dreamed of is now about to become a reality, which for many of these young
“We are incredibly proud of our Year 12 cohort and congratulate them”
T
he results are in. A time of great anticipation for thousands of school-leavers, as they eagerly await their Australian Tertiary Admission Rank (ATAR) for the first time in Queensland. 2020 has seen eligible Year 12 students across Queensland awarded with results ranging in decreasing increments of 0.05 from 99.95 down to
30. With only approximately 30 students across the state receiving the maximum of 99.95. Sunshine Coast Grammar School is delighted to acknowledge Grace Thomas as one of those top-performing students along with 32 other students who received a ranking score of 95 or above. The graduating class of 2020 has excelled in their academic pursuits with
men and women is going on to pursue their passion in medicine, law, performing arts or finance. Principal at Sunshine Coast Grammar School, Mrs Maria Woods is delighted with the results, which are some of the best in the state. “The results achieved are a reflection of the hard work, commitment and
positive attitude these students have displayed towards their studies. We are incredibly proud of our Year 12 cohort and congratulate them on their outstanding achievements,” Mrs Woods says. “2020 has been an extraordinary year and we are incredibly proud of all our students and their efforts this year. Parents have expressed their deep gratitude to the Grammar staff for their dedication to their sons and daughters. Our goal has been to encourage, challenge and nurture students so that they can pursue their dreams beyond school.” “Success comes in many forms and as a school it is our goal for every graduating Year 12 student to be working or studying towards a career that not only values their talents, but for which they also have a real passion and purpose,” says Mrs Woods. “We encourage each and every student to go confidently in the direction of their dreams, to work hard and to realise their full potential in the next phase of their unique journey. Congratulations to the Class of 2020,” she says.
BACK TO SCHOOL shoes! Specialists in Shoes from Prep to Year 12 Great Brands . Great Service Air-conditioned Mega Store Easy parking . Avoid the crowds Open Monday to Friday 9am to 5pm Saturday 9am to 2pm
LOCALLY OWNED & OPERATED FOR OVER 45 YEARS 16 TRINDER AVENUE MAROOCHYDORE QLD 4558 PH: 5443 3610 myweeklypreview.com.au
41.indd 1
My Weekly Preview | January 7, 2021 41
4/01/2021 2:57:24 PM
HEALTH & WELLBEING
BREASTSCREEN IS AT BUNNINGS THIS JANUARY Christmas is over and it’s time to start thinking about all the routine things we need to organise for ourselves – including our routine health checks. To assist busy women to make time for one of their health checks BreastScreen Queensland Sunshine Coast is taking its free mobile screening service to Bunnings Maroochydore from January 12–15, 2021. Queensland women can’t afford to skip breast screens. Statistics show they have one in eight chances of being diagnosed with breast cancer by the age of 85. Clinical director of BreastScreen Queensland Dr Alison Roper says it can be hard for women to find time for themselves, but it’s important they do so. “A 30-minute breast screen every two years could literally save a woman’s life and ensure they are there for their family in the future,” Dr Roper says. “What screening does is bring forward the time at which breast cancer can be diagnosed, so that the cancer can be found when it’s small, confined to the breast and hasn’t spread to the lymph nodes.” The BreastScreen Queensland Service is free, female, fast and friendly. Women aged 50 to 74 are strongly
42 My Weekly Preview | January 7, 2021
42.indd 1
encouraged to have regular screens however the service is free to women aged 40 and over.
To make an appointment at any of the BreastScreen Services on the Sunshine Coast call 13 20 50 or visit the website. Referrals are not required.
PUSH BACK THE AGEING PROCESS – HEAR BETTER, THINK BETTER, LIVE BETTER Ageing is the inevitable result of having too many birthdays. Avoiding it is something that modern society has developed into an art form. Whether it be cosmetic treatments or surgery, exercise regimes, diets, food supplements, multiple types of vitamins and minerals or any number of other wild and wonderful processes. Hearing loss is not always associated with the ageing process, but its effects are certainly tagged into the whole viewpoint of being or feeling old. Hearing loss is tiring for the person who has it and those who want to communicate with you. Sadly, untreated hearing loss has been directly linked with early onset dementia in many studies. At Hear4Good we have been working with hearing loss since 1983 and have always looked at hearing rehabilitation as a family centred process. Recent technological advancement has led us to develop a system utilising Bluetooth digital technology that connects with Smartphones and devices that provide an amazing connection to family and the world. Being directly in touch with
multiple inputs keeps the plasticity of the brain intact so you can hear better, think better, live better. From a functional perspective the technology is now available in a completely in-the-ear style, smaller than any retail Bluetooth ear pods and with far greater functionality. It certainly isn’t the fountain of youth but keeping your brain in tip top shape can certainly reduce the impact of the ageing process.
Mark Paton is the senior clinician at Hear4Good, an independent and local hearing rehabilitation clinic in Golden Beach, phone (07) 54770144 or visit hear4good.com.au.
myweeklypreview.com.au
22/12/2020 12:45:53 PM
HEALTH & WELLBEING
MILTON’S STORY
UNDERSTANDING HEARING LOSS
Author Milton Milligan leads a busy life at home, which he would not be able to do without the support of Suncare. Milton and his wife keep themselves very busy at home. At 91, he still writes and spends a great deal of time on his computer. Milton’s latest book Bondi Pioneer chronicles the inspiring story of his great-great-grandfather from a young boy working in an English workhouse to a man who influenced the formation of Sydney’s Eastern suburbs. Milton says connection to family and home is important to him and the support he receives from Suncare enable him to pursue his interests. “I couldn’t see myself going into a retirement village… when you grow older, your whole life changes. You depend on people like Suncare for a lot of things. They are more like our family, the connection is so important, and they do so much for us. Nothing’s a trouble,” says Milton. Milton and his wife have received Suncare help at home for more than four years. “I like everything about Suncare – we couldn’t have had more support if we’d tried.” Leading the way for our customers, Suncare is a leading provider offering
A common misconception is that hearing loss is mostly caused by ageing. This isn’t always true, with research showing that 37 per cent of Australians have noise related ear damage and more than 1.3 million people live with a hearing condition that could have been prevented by visiting their local hearing clinician. With one in six Australians currently suffering from hearing loss, including one in three people over the age of 50, and this number rising to one in two after the age of 60, early detection and care is key. Connect Hearing is a leading hearing care provider, offering hearing tests, advanced hearing aid technology and access to an approachable team of clinicians on the Sunshine Coast.
Home Care Packages, Commonwealth Home Support Program services, Short Term Restorative Care and NDIS Support Coordination Services. At Suncare it is important for us to understand what’s important to you. We will work together and design a support plan that will assist you to live life your way.
For more details of services that will assist you to live life your way, please contact us on 1800 786 227 or email info@suncare.org.au.
With their goal to provide the best hearing solutions for all Australians, Connect Hearing offers the latest technology, and ensures clients are armed with the confidence to use it. There is also a common misunderstanding that hearing aids are hook-shaped devices that make minimal improvement to a person’s hearing. Modern hearing aids are almost invisible to the eye and offer incredibly advanced technologies including Wi-Fi and Bluetooth connectivity, allowing people to connect directly to their smart devices.
You can book in a quick and free 15-minute hearing screen with your local Connect Hearing team by calling 1800 693 277 to book an appointment or visit connecthearing.com.au.
Anti-Ageing Revolutionary Treatment WANTED 10 people between the age of 55 and 70 to undertake a 30 day trial of a New Bluetooth Digital hearing system that can counteract some of the effects of ageing.
This approach to hearing involves high quality speech processing and connection to external information sources via smart phones and devices in a completely in the ear format. Better and simpler connection to the world and family, leading to improved communication outcomes.
Ph: (07) 5477 0144 The Hearing Centre, 5/56 Landsborough Parade, Golden Beach www.hear4good.com.au
myweeklypreview.com.au
43.indd 1
My Weekly Preview | January 7, 2021 43
22/12/2020 12:46:33 PM
HEALTH & WELLBEING
Warren Blee OAM, accredited consultant pharmacist
POISONS AND MEDICATION ERRORS IN SCHOOLS
A recent study undertaken by Dr Rose Cairns of the School of Pharmacy, University of Sydney and reported in the journal Archives of Diseases in Childhood, looked at poisonings in schools in NSW, the ACT and Tasmania. Of the 1751 calls relating to exposures at school made to the Poisons Information Centre, 61 per cent concerned accidental exposures, 12 per cent concerned deliberate self-poisonings and 12 per cent were from medication dosing errors. The most common pharmaceutical exposures were to paracetamol, the ADHD medications methylphenidate and clonidine, and ibuprofen, the majority being deliberate self-poisoning. Most self-poisoning exposures were
from over-the-counter products such as paracetamol, and most accidental exposures occurred from stings and bites, exposures to plants and products in science class, potentially resulting in anaphylaxis. A recent ABC radio program highlighted the number of poisonings with the copper sulphate crystals which had been made in school science laboratories. Poisoning exposures at school appear to be increasing, with 81 calls per quarter in 2014-2016, and 129 calls per quarter in 2017-2018. “Younger children are at risk of accidental exposures, while adolescents are at risk of self-harm poisonings. Deliberate self-poisoning (self-harm exposures/overdose) is increasing in children and adolescents in Australia, and victims were more likely to be girls (79 per cent). For medication errors, 150 involved a dosing error, while 40 cases involved administering to the wrong child. Just over half of poisoning cases were male, and accidental exposures, dares, pranks and recreational exposures occurred more frequently in this group. So, while schools are seeking to better train the teachers and staff in identifying medication related issues, parents and carers of students can also raise the question with prescribers of having a dosing regimen that does not require medication being taken during school hours. If medication does need to be taken to school, supply the minimum quantity in a well labelled container. Ask your pharmacist to assist. Enquire from your school if a small passport photo, to be kept with the medication, would assist them. Children who are highly allergic and may suffer anaphylactic reactions should always carry an adrenalin autoinjector pen (Epipen) at all times.
MORE GREEN TIME LESS SCREEN TIME THIS SUMMER By Jagrut Lallu, optometrist and founding member of the Australia and New Zealand Child Myopia Working Group Giving children less time on devices and more outdoor time, plus more frequent breaks from screens, is an area that we now have the opportunity to improve. Screen time has become a big part of everyday learning and interaction. It has had huge benefits in helping us to stay in touch. However, parents are often not aware of the association with low levels of outdoor activity and associated factors including low levels of light exposure and prolonged near tasks such as reading and screen time, which may influence the development of myopia. What is myopia? Myopia, also commonly referred to as shortsightedness is a common eye condition that causes blurred distance vision which usually starts during childhood and typically progresses until a child stops growing.
44 My Weekly Preview | January 7, 2021
44.indd 1
Lifestyle factors including low levels of outdoor activity may influence the development of myopia. What is proven is that there is a link between outdoor time and its benefit to a child’s myopia development. Given that outdoor play is free, ‘more green time less screen time’ is a timely reminder for moderation in an increasingly digital world. What can parents do to help reduce the likelihood of their child developing myopia? There are two main factors which can mean your child is more at risk of developing myopia: lifestyle and family history. The likelihood of developing myopia, particularly high myopia increases when one or both parents are myopic. You can’t influence genetics but parents can feel empowered when it comes to lifestyle factors.
Visit childmyopia.com.
WELLNESS EXPERTS NEUROSURGERY
EXERCISE
Maintaining a healthy spine
It’s ok to not be ok – but ask for help
We are fortunate enough to be living in one of the most beautiful areas of the world here in the Sunshine Coast. It is no wonder that we have a health conscious, relaxed and diverse population, many of whom have moved from other parts of Australia and the far corners of the world. Not so long ago, the very idea of having advanced medical specialists right here on our doorstep at the $1.8 billion Sunshine Coast University Private Hospital precinct in Birtinya was unheard of and many patients had to travel to Brisbane for treatment that is now available locally. Thankfully, most people will not need to see a specialist neurosurgeon and even fewer will have to undergo surgery. Regular exercise, controlling your weight, giving up smoking and looking after your body is often all that is required to maintain a healthy spine. For others, following the advice of you GP or physio and prompt referral to an appropriate specialist helps to educate and empower patients to do what is right for them.
People often fall short of their goals due to their own personal challenges. Experiencing hardship can impact your dreams and goals and make you less motivated to keep chasing them. One of the things I address a lot with my clients is ways in which they can overcome adversity so they can focus on their goals and achieve the life they always wanted. In my latest book, It’s How You Think, which was released last week, I tell my very personal story of losing people I have loved through tragic circumstances, the friends I have lost through suicide and how I overcame four knee reconstructions and two broken ankles. Learning to focus on what you can control is something we all must learn to do. Speaking about your feelings with your support network, family and friends is crucial as it will help you to avoid feelings of loneliness and isolation. It is important to acknowledge that it is okay to not be okay, so if you are not coping with what is going on in your life, please utilise all the support you have in your network or contact a therapist for help – because there is always help available if you are willing to ask for it.
DR STEPHEN BRYNE SUNSHINE COAST NEUROSURGERY SUITE 17 SUNSHINE COAST UNIVERSITY PRIVATE HOSPITAL. 3 DOHERTY STREET, BIRTINYA. PHONE: 5437 7256 SCNEUROSURGERY.COM.AU
LEON STENSHOLM BODY BY LEON 2/18 PREMIER CIRCUIT WARANA, 0499 099 733 BODYBYLEON.COM.AU
myweeklypreview.com.au
23/12/2020 9:33:51 AM
PROPERTY PREVIEW
CONTEMPORARY FAMILY LIVING SEE PAGE 55>
myweeklypreview.com.au
45.indd 1
My Weekly Preview | January 7, 2021 45
23/12/2020 11:02:06 AM
PROPERTY
LOREN WIMHURST NEXT PROPERTY GROUP
Property predictions 2021 You might be surprised to hear that with all that is going on down south, the road ahead for the Sunshine Coast residential property market is still paved with gold. Nine of the Coast’s top agents tell us there is a lot to look forward to, with 2021continuing to deliver a surge in property sales and prices. They also share their thoughts on the real estate challenges ahead and tips for top Coast suburbs. Compiled by: Tracey Johnstone
JAMES GOLDSWORTHY RAY WHITE MOOLOOLABA & KAWANA
ws
I believe the end of 2020 acted as a great predictor for the start of this year. We expect to see the same level of heightened enquiries and competition which will put upward pressure on prices, especially across our central in-demand suburbs. Despite media reports of a southern buyer rush on the Coast, we are still reporting upwards of 80 per cent of our sales to buyers within Queensland and subdued investor activity. I predict we will see a lift in investment activity and southern buyers into this year. Peter King, who specialises in Mooloolaba, is expecting to see an increased number of sellers coming to market, capitalising on the price gains of the latter half of 2020. He has noticed more enquiry from interstate buyers seeking a more relaxed lifestyle. Beachside sales specialist Adam Budd has seen local buyers driving the market with record sale prices taking place in the Kawana Waters market with an increase in off-market sales. Mr Budd says that COVID-19 has transformed work and how it is done.
46 My Weekly Preview | January 7, 2021
46.indd 1
KATE JEWRY HOME SUNSHINE COAST It’s hard to say what this year will be like as no one has a crystal ball, but from what I am experiencing, I believe the Coast market is looking bright. We have seen great growth and confidence in the market and that doesn’t seem to be slowing down. We are blessed to live in an exceptionally beautiful part of the world. Now with so many people realising that they can work remotely, we are seeing more people and families looking for a seachange. We are in the middle of a pandemic and ‘recession’, yet our housing market is still very strong and will remain so. Beachside properties are in very high demand, as well as family homes in school catchment areas. Borrowing is affordable, banks are keen to write new business and the ‘guarantee’ of rates remaining low for at least three years gives even more confidence. I don’t believe the property bubble is going to burst – quite the opposite. We are lucky to live on the Coast and I think that feeling is clearly contagious. Being surrounded by locals that support locals is truly amazing.
LUKE CARTER HARCOURTS CALOUNDRA This year will have an extremely strong start as buyers hit frenzy level over summer to secure quality property. This will place upward pressure on prices. I am uncertain if this is a reflection of true value or a flow-on effect from COVID-19, which has produced a swelling in interstate migration and an exodus from inner-city hubs. Only time will tell if the population growth maintains enough pressure on available listing numbers to keep supply at all-time low levels. The strength of a region’s market is linked to its employment. Any big changes in availability may take some of the heat out of our market. One of the biggest changes in Caloundra is traffic congestion. We have peak traffic periods and intense pressure on weekend parking. Prices have risen sharply as buyers push to get within a short walk to the beach. As Caloundra’s population expands this access problem will worsen, which will ultimately make property that is close to these precincts ultimately become more desirable and that will put pressure on supply and pricing.
What a year we have just had! The market has been active with lots of local movement, so what will happen in 2021? Well, we feel that the southern wave hasn’t really started yet, which is why our local buyers have been moving fast. With stock becoming harder and harder to find, we feel that competition will become fierce and will almost certainly drive up the prices. We have certainly seen decisions being made much more quickly than usual, with the multiple interest on properties making buyers jump in. As far as suburb growth and hot spots, it seems that buyers aren’t as stuck on one particular area anymore and are happier to move around the Coast. Anywhere that reflects good value and is within an easy reach of the beaches are selling fast. We have seen a lot of movement in Landsborough and Beerwah with time on market becoming less and our waterfront and beachside homes also extremely popular. If we have a similar year to 2020, buckle up because it is going to get interesting.
ROSS CATTLE DEFINE PROPERTY The Coast property market may surpass the 2002-3 years boom when there was a huge surge in prices. This year could be even hotter. We will see big increases and new levels reached; levels some people will find hard to get their heads around. Buyers are going to have lots of competition. This will get frustrating and could slow people from moving to the area. They may have to settle for their second or third suburb of choice. Sellers will be buying back into the same market. Some may sell to step up only to find buying back in the same level due to the buyer competitiveness. Some sellers may not list to sell from fear of not getting the next property and this will starve agents of properties to offer buyers. Relocation finance might be the saviour allowing sellers to buy before they sell and with responsible lending being wound back, this will open the door for this type of lending. The growth suburbs offer beach and acreage. People live here for the unique lifestyle that both these styles of properties offer.
myweeklypreview.com.au
22/12/2020 3:21:08 PM
PROPERTY
WILLIAM EMMS PROPERTY LANE
THE RANGE/ HINTERLAND JESS LUTHJE MALENY REALTY Last year was interesting for hinterland real estate, to say the least. It began in a fairly standard way and then the six weeks of lockdown saw very few sales. Not many buyers will buy sight unseen in a regional area like ours. However, as soon as the travel restrictions between Brisbane and outer areas were lifted, we saw sales really take off. The volume of listings has retracted to the lowest level I’ve ever seen in my 20-year career. There was a definite increase in super fund investor interest in our market due to falling interest rates driving self-funded retirees to invest in property instead. For the first time I started selling to buyers in their thirties, as employers increased the ability to work from home. I believe the hinterland market will continue to perform well and limited stock come onto the market this year due to sellers not wanting to leave an area where the global pandemic has had a relatively low impact on lives.
KEITH BLANCHARD NORTH SHORE REALTY
In 2020, there is no denying that real estate showed outstanding resilience, which is expected to continue for the next 12 months at least, given the extraordinary level of interest both locally and interstate. A standout sector for us has undoubtedly been small to medium sized acreage properties, which happens to be our speciality, with extraordinary numbers at our open inspections for the last six months. To the surprise of many, it is made up of about 80 per cent local buyers and about 20 per cent interstate. The biggest challenge in real estate for the next 12 months will simply be keeping up with unprecedented demand and for those looking to get into the market. It is imperative that they reach out to their most trusted agencies and register their interest to be kept in the loop. The industry has taken a step back into the past where about 50 per cent of our listings alone are sold off market. Strap yourself in for another crazy year as 2021 is going to be a bumper across all industries on the Coast.
The turmoil of last year’s lockdown and the uncertainty of what life would be like going forward for the community was certainly very scary on all levels. Prior to the end of the March lockdown, the market was behaving normally with regular sales and a steady growth in prices. The three months off without the opportunity to conduct sales in our normal way saw sales drop by 70 per cent. The last six months has seen an unprecedented record activity. The combination of lowest-ever interest rates and the knowledge that we can work from home has seen record numbers of people wishing to move to the Coast. Everyone has had a good look at what is important to them with family and lifestyle coming out on top. The following couple of years, considering the current interest rates with money being cheap to borrow and changes in lifestyle, will see continued demand resulting in a growth period not unlike the early 2000s. Properties are in very short supply and while this continues, there is only one way for prices to go and that is up.
KAREN JONES ADAMS & JONES
After 20 years in the business on the Coast, selling everything from $300,000 villas to $5-million plus properties, I predict interest in our Coast real estate is only going to continue. I am seeing a very strong movement of people to lifestyle properties – beachfront, beachside and waterfront. As there won’t ever be more waterfront or beachfront and we are faced with a rapidly growing population, I can only see the pressure of demand having a positive impact on prices for the foreseeable future. The shocks delivered in 2020 caused a big rethink. It could also be due to the amount of time people spent in their homes this year that has driven them to look at where they live, how suitable their property is to their current needs and even what lifestyle they would like to be living in the near future. In past ‘booms’ I noticed many retiree buyers, but now I am seeing many families with children also relocating to the Coast and many buyers who were never able to leave a capital city before now, deciding to relocate their family here and work from home.
SO
LD
VANTAGE - YAROOMBA
Yaroomba Beach 3 mins
Maroochydore CBD 15 mins
OU
T!
Sunshine Coast Airport 15 mins
Artist’s impression.
Serene Awaits. Sunshine Motorway 3 mins Coolum Town Centre 5 mins
Set in the leafy surrounds of the Vantage gated community in Yaroomba, Serene offers the chance to secure one of only 25 enticing terrace homes in one of the Sunshine Coast’s most desirable locations. With completion forecast for mid 2021, Serene is an opportunity not to be missed.
1 VANTAGE DRIVE, YAROOMBA
SERENEYAROOMBA.COM.AU Contact RCQ Sales Executive Sharna on 07 5459 1818 or enquiries@sereneyaroomba.com.au
myweeklypreview.com.au
47.indd 1
My Weekly Preview | January 7, 2021 47
23/12/2020 10:42:43 AM
PROPERTY
CHARMING & ELEGANT A be beautiful beau auti tifu full ho home me a and nd llifestyle ifes if esty tyle le a awaits wait wa itss th the e lucky character luck lu cky y buyer buye bu yerr of tthis hiss ch hi char arac acte ter filled, filled generously proportioned Maleny residence. Mature and stately trees welcome you to an expansive 1.6-acre holding, set privately off a quiet lane. This remarkable dual living home is nestled within lush, leafy gardens and rolling lawns, impeccably positioned in one of Maleny’s most desirable blue ribbon streets. It is immaculately presented and complete with stunning timber floors and spacious entertaining areas.
5 AVOCADO LANE, MALENY 5 bed, 3 bath, 2 car AUCTION ON SITE 3PM SAT 16 JAN RE/MAX Hinterland 07 5408 4220 RE/MAX Hinterland Team 0447 737 737
Feel at home with... Amber Fox 0405 357 735
Leanne King 0439 910 235
Darren Rix 0416 188 259
Margie Deighton 0411 399 514
Neil Bourke 0417 721 602
Barbara Banks 0419 760 492
PRIME LOCATION – ON BUDERIM – QUIET CUL-DE-SAC 5 Gosford Court, BUDERIM
Auction on site Saturday 16th January 2pm
Perfect modern residence situated in a prestige area in a quiet cul-de-sac. Approx. 6 kilometres to Mooloolaba beach, only minutes to Buderim Village. • 4 large bedrooms, 2 with spacious ensuites, walk-in robe plus office • Open plan kitchen / dining / living area, high ceilings, timber floors • North facing covered entertaining area, large salt inground pool • Separate pavilion, 5kw solar plus heating for pool, gas hot water
4 Bed 3 Bath 2 Car 1067m2
Inspect: Saturday 9th January ry 1-1.45pm Margie Deighton 0411 399 514
DID YOU KNOW IT’S CURRENTLY A VERY STRONG
SELLERS MARKET WITH LIMITED HOMES FOR SALE IN YOUR AREA! If you have been thinking of selling, there is no better time to get things moving! There are plenty of buyers, but a lack of listings means a very strong market for sellers. Imagine the buyers fighting it out to own your home – fighting it out means getting top dollar.
BIRTINYA
Magnificent East Facing Water Views
8/81 BIRTINYA BOULEVARD, BIRTINYA 4575
This spacious 3 bedroom apartment located on the 1st floor of the sought after Island Waters Apartment complex provides relaxed and peaceful living right on the water. The quality fittings throughout are sure to impress and the complex amenities want for nothing with a pool, gym and BBQ areas as well as plenty of visitor parking. PRICE:
Call now to benefit from combining a fixed fee with an experienced, results driven agent and find out how this equates to more $$$$$$ in your pocket.
Greg Pratt 0413 624 308 greg@coastaledgerealestate.com.au
Low $600,000’s
INSPECT: Saturday 9 January 10:00-10:30am
Greg Pratt 0413 624 308
3
2
2
LOCAL KNOWLEDGE, YEARS OF EXPERIENCE, STRIVING TO SURPASS YOUR EXPECTATIONS, PROVIDING YOU WITH THE EDGE IN REAL ESTATE
P.O. Box 650, Buddina, QLD, 4575
www.coastaledgerealestate.com.au 48 My Weekly Preview | January 7, 2021
48.indd 1
myweeklypreview.com.au
4/01/2021 9:49:28 AM
this week’s auctions Saturday 2pm
Please call the agent for details to register for online aucঞons.
Thursday 14th 5pm PRIVATE ONLINE AUCTION 5/77 Buderim Avenue, Mooloolaba Peter King 0408 798 346 Jade Mooney 0488 247 880
Sold prior to auction Open from 1:30pm 17 Possumwood Place, Buderim Rob Horne 0429 508 705 Sally Horne 0409 561 638
this week’s open homes & private inspections You are welcome to aend our open homes or please call the agent to arrange your private inspecঞon or virtual tour. Alexandra Headland 14/18 Edward Street
Kings Beach 3 bed 2 bath 2 car
4 Arthur Street
Pam Thomas 0438 272 096
Bir nya 6 Reef Court
614 Yandina Bli Bli Road 22 Constellaঞon Way
4 bed 2 bath 2 car
Sat 11-11:30am
7 Cockatoo Street
4 bed 2 bath 2 car
Sat 11:30am-12pm
6 Aries Court
4 bed 2 bath 2 car
Natasha Hackenberg 0401 601 691
19 Ringtail Place
4 bed 2 bath 2 car
Rachel Meyers 041 699 619
Bli Bli
3 bed 2 bath 2 car
Natasha Hackenberg 0401 601 691
12 Caitlin Place
935m2
Ed Hackenberg 0499 199 360
11/152 Burne Street
3 bed 2 bath 2 car
Sat 9-9:30am
4 Besley Street
3 bed 2 bath 1 car
Sat 10-10:30am
‘Elevate’ 7/4 Ballinger Road
3 bed 2 bath 2 car
Sat 10-10:30am
1/61 Power Road
4 bed 2 bath 1 car
Sat 10:30-11am
4/21 Amaroo Drive
2 bed 1 bath 1 car
Sat 11-11:30am
40 Sage Street
3 bed 2 bath 2 car
Sat 11-11:30am
53 Orme Road
Land
Sat 11-11:30am
5/17 Amaroo Drive
2 bed 2 bath 1 car
Sat 11:30am-12pm
4/19 Amaroo Drive
2 bed 1 bath 1 car
Sat 12-12:30pm
2/80 Burne Street
3 bed 2 bath 1 car
Sat 12-12:30pm
11/143 Burne Street
3 bed 3 bath 2 car
Sat 12-12:45pm
14 Sunnyridge Rise
5 bed 4 bath 3 car
Sat 1-1:30pm
40 Sage Street
3 bed 2 bath 2 car
Tues 12th 11-11:30am
Buderim
5/46 Boongala Terrace 13 Meridien Drive 32 Banfield Place 17 Round Bush Circuit 302/313 Bradman Avenue 6/27 Baden Powell Street
29 Buccleugh Street 32 Russell Street 1/3 Benne Street 29 Buccleugh Street 32 Russell Street 1/3 Benne Street
Sat 10-10:45am Natasha Hackenberg 0401 601 691
2 bed 1 bath 1 car 4 bed 2 bath 2 car 4 bed 2 bath 2 car 4 bed 3 bath 2 car 2 bed 2 bath 1 car 2 bed 1 bath 1 car
Sat 10-10:30am Sarah-Louise Anderson 0418 200 471 Sarah-Louise Anderson 0418 200 471 Sarah-Louise Anderson 0418 200 471 Natalie Tink 0408 439 147 John Bartsch 0407 637 717
5 bed 3 bath 3 car 4 bed 3 bath 2 car 2 bed 1 bath 1 car 5 bed 3 bath 3 car 4 bed 3 bath 2 car 2 bed 1 bath 1 car
Fri 8th 11-11:30am Fri 8th 12-12:30pm Fri 8th 1-1:30pm Sat 11-11:30am Sat 12-12:30pm Sat 1-1:30pm
3 bed 2 bath 1 car 5 bed 2 bath 2 car 3 bed 2 bath 2 car
Sat 11-11:30am Mandy Leahy 0425 709 442 Pam Thomas 0438 272 096
4 bed 2 bath 2 car 4 bed 2 bath 2 car 4 bed 2 bath 3 car 4 bed 2 bath 2 car 2 bed 1 bath 1 car
Sat 10-10:30am Sat 1-1:30pm Sat 2:30-3pm Wed 13th 5-5:30pm Kathy Mulheron 0481 313 336
3 bed 2 bath 1 car 4 bed 2 bath 2 car 6 bed 4 bath 4 car
Sat 9-9:30am Sat 11-11:30am Sat 12-12:30pm
6 bed 3 bath 3 car
Ed Hackenberg 0499 199 360
4 bed 3 bath 5 car
Natalie Tink 0408 439 147
4 bed 2 bath 2 car
John Bartsch 0407 637 717
4 bed 2 bath 2 car
Sat 10-10:30am
Mooloolaba 5/77 Buderim Avenue 76 Palm Drive 2/31 Buderim Avenue
Nambour 4 Observaঞon Circuit 4 Observaঞon Circuit 11 George Street 4 Observaঞon Circuit 1/7 Bradley Street
3 bed 2 bath 2 car
Tues 12th 12-12:30pm
4 Besley Street
3 bed 2 bath 1 car
Thurs 14th 10-10:30am
40 Sage Street
3 bed 2 bath 2 car
Thurs 14th 11-11:30am
‘Elevate’ 7/4 Ballinger Road
3 bed 2 bath 2 car
Thurs 14th 12-12:30pm
14 Sunnyridge Rise
5 bed 4 bath 3 car
Thurs 14th 4-4:30pm
Palmwoods
4 bed 2 bath 2 car
Sat 12-12:30pm
1 & 2/15 Bonaparte Place 72 Dunning Street 146 McKees Road
3 bed 1 bath
Sat 1:30-2pm
Cooroy Eudlo
Rosemount 1 Rosemount Close
Tanawha
Forest Glen 11 Spoonbill Drive
6 bed 2 bath 2 car 4 bed 2 bath 6 car
Moffat Beach
‘Elevate’ 7/4 Ballinger Road
87-95 Robinsons Road
Sat 11-11:30am
Maroochydore
14 Butcherbird Crescent
79 Straker Drive
4 bed 2 bath 6 car
Maroochy River
4 bed 2 bath 2 car
25 Mannikin Road
Sat 10-10:30am
Twin Waters
Glenview
41/80 North Shore Road
308 Glenview Road
4 bed 2 bath 3 car
Sat 10-10:30am
308 Glenview Road
4 bed 2 bath 3 car
Sat 2-2:30pm
Woombye
308 Glenview Road
4 bed 2 bath 3 car
Wed 13th 5-5:30pm
8 Tamarind Court
Bli Bli
5450 8111
Golden Beach
5492 2100
Mooloolaba
5444 3455
Noosa River
5449 8800
Buderim
5445 6088
Kawana
5354 6012
Mountain Creek
5477 7600
Pelican Waters
5343 6900
Caloundra
5491 5055
Maroochydore
5443 2000
Nambour
5354 6000
Sippy Downs
5354 6002
49.indd 1
4/01/2021 10:21:20 AM
Auction 5
29 Buccleugh Street, Moffat Beach This beauঞful beachside home with separate one bedroom luxury villa is situated on a massive elevated 1,072m² allotment. The wonderfully private and impeccably appointed lowset 4-bedroom execuঞve or family beach residence has been renovated and extended from the ground up to ensure easy beachside living at its best. Blessed with ducted air condiঞoning and new first-class fixtures and fiমngs throughout, there is nothing to do but move in and relax. To be sold at aucঞon.
Auc on In Rooms The Events Centre, Caloundra Thursday, January 28 at 11am
3
3
Andrew Garland 0403 851 777
View Friday & Saturday 11-11:30am
raywhitecaloundra.com.au 50.indd 1
4/01/2021 9:50:11 AM
Sold prior to Auction 5
17 Possumwood Place, Buderim Peace, Privacy and the Perfect Buderim home. • Bespoke character home in Waterfall Park • Prime central posi on, walk to village centre • No expense spared refurbishment • Two storey with mul ple living zones • Dedicated guest, music room or home office • Self-sufficient, private & gated 1215 sqm site
Aucঞon On site Saturday, January 9 at 2pm View Saturday from 1:30pm
2
2
Rob Horne 0429 508 705 Sally Horne 0409 561 638
raywhitebuderim.com.au
Auction 3
40 Sage Street, Buderim The ul mate in livability. It’s no compromise luxury living with low maintenance. The designer kitchen with butler’s pantry makes entertaining effortless, the outdoor kitchen and north facing pa o embraces our sub-tropical weather. High ceilings, abundant natural light, it feels spacious and upli ing. It’s no steps day to day living on the ground floor including master bedroom. Upstairs is a two bedroom guests’ retreat with a second living area.
Aucঞon On site Saturday, January 16 at 2pm View Saturday Jan 9, Tuesday Jan 12 & Thursday Jan 14, 11-11:30am
2
2
Judy Wild 0419 798 905 Lew Poমnger 0419 788 547
raywhitebuderim.com.au 51.indd 1
4/01/2021 10:49:57 AM
Auction 2
5/17 Amaroo Drive, Buderim As new Villa right on top of Buderim within an easy walk to the shops and cafés. Be a real part of the vibrant Buderim Village atmosphere and then return home to a peaceful and secure environment in one of Buderim’s best street. Modern, air-condiঞoned and with its own private courtyard, this Villa in Amaroo on Buderim gives you a choice of 2 bedrooms with ensures and 2 living areas. Live life as you deserve with this great lifestyle choice.
2
1
Lloyd Edwards 0419 672 902
Aucঞon On site Saturday, January 30 at 1pm View Saturday 11:30am-12pm
raywhitebuderim.com.au
Auction 5
14 Sunnyridge Rise, Buderim Discretely posiঞoned in the lush subtropical rainforest on Buderim Mountain is this sprawling Spanish influenced home featuring space, volume and charm. There’s a self-contained bungalow plus an addiঞonal guest suite. Built on 5,044 sq metres of land, the piece de resistance is the wet-edge pool set in expansive decks overlooking the tranquil rainforest. The perfect place to revitalise the body and soul far from the hustle and bustle.
Aucঞon On site Saturday, January 30 at 2pm View Saturday 1-1:30pm & Thursday 4-4:30pm
4
3
1
1
Judy Wild 0419 798 905 Lew Poমnger 0419 788 547
raywhitebuderim.com.au 52.indd 1
23/12/2020 10:53:25 AM
Auction 4
11 Spoonbill Drive, Forest Glen Time for a Cool Change • Pavillion Home for the family or entertainer • Mul ple living zones on offer plus study • Summer ready ducted climate control • Resort lifestyle including heated pool • Energy saving solar power and rainwater supply
Aucঞon On site Saturday, January 16 at 10am View Saturday 10-10:30am
2
2
1
1
Rob Horne 0429 508 705 Sally Horne 0409 561 638
raywhitebuderim.com.au
3
‘Elevate on Buderim’ 7/2 Pioneer Crescent, Buderim ‘Elevate on Buderim’ sets a new benchmark in luxury. Penthouse 7 will take your breath away – spacious living areas, high soaring ceilings, a huge master suite, purpose designed home office and a perfectly appointed designer kitchen with an array of Miele appliances including built-in espresso machine and steam oven. Located only footsteps away from the bustling heart of the Buderim Village, ‘Elevate on Buderim’ offers a lifestyle without compromise.
raywhitebuderim.com.au
myweeklypreview.com.au
53.indd 1
2
Sale Contact Agent
Judy Wild 0419 798 905
View Saturday 10-10:30am, Tuesday & Thursday 12-12:30pm
Lew Poমnger 0419 788 547
2
My Weekly Preview | January 7, 2021 53
4/01/2021 9:54:48 AM
Auction 4
11 Spoonbill Drive, Forest Glen Time for a Cool Change • Pavillion Home for the family or entertainer • Mul ple living zones on offer plus study • Summer ready ducted climate control • Resort lifestyle including heated pool • Energy saving solar power and rainwater supply
2
2
1
1
Rob Horne 0429 508 705
Auc on On site Saturday, January 16 at 10am
Sally Horne 0409 561 638
View Saturday 10-10:30am
raywhitebuderim.com.au
Auction 4
32 Russell Street, Moffat Beach This beau ful and private home sits discreetly on an elevated 774m² allotment and designed with relaxed open plan beachside living in mind. To be sold at auc on. • 4 generous bedrooms, the main with ensuite and walk-in robe • Gourmet kitchen with a sea of Caeserstone benchtops and cathedral ceilings • Separate self-contained bungalow & rear access to vacant Council land reserve • Poten al for a home office in the front with separate entrance • Close to shops and dog friendly Shelly Beach
raywhitecaloundra.com.au My Weekly Preview | January 7, 2021 54 54.indd 1
Auc on In Rooms, The Events Centre, Caloundra Thursday, January 28 at 11am
3
2
1
Andrew Garland 0403 851 777
View Friday & Saturday 12-12:30pm myweeklypreview.com.au
4/01/2021 8:53:47 AM
PROPERTY
IMMACULATE STYLING From page 45
T
his Master Builders awardwinning home showcases immaculate design and fine attention to detail. Simply gorgeous from top to bottom, there will be no shortage of buyers vying to call this stunning property home. Nestled on a good-size block with plenty of space for the kids and an outdoor entertaining oasis for the adults, this two-storey home offers plenty of room for everyone to spread out and relax. This must-see home effortlessly combines impeccable design, immaculate styling and luxurious features to offer the very best in contemporary family living.
6 LANGSFORD CRESCENT, MAROOCHYDORE 4 bed, 2.5 bath, 2 car $1,100,000 Rowling & Co Property 5375 5781 Kelly Rowling 0437 443 013 Daniel Rowling 0421 456 776
Auction 2
Unit 1/3 Benne Street, Moffat Beach Move quickly to secure this original light-filled ground floor beachside unit situated on top of the Moffat Headland with beau ful ocean views to the north along the beach to Point Cartwright and beyond. All of this situated just a short stroll to cafés, restaurants and the coast’s best surf break at Moffat Beach. • Generous open plan layout in a small complex of just 3 apartments • Direct internal access to the large lock-up garage • To be sold at auc on
Auc on In Rooms, The Events Centre, Caloundra Thursday, January 28 at 11am
1
1
Andrew Garland 0403 851 777
View Friday & Saturday 1-1:30pm
raywhitecaloundra.com.au myweeklypreview.com.au
55.indd 1
My Weekly Preview | January 7, 2021 55
23/12/2020 11:04:53 AM
AUCTION ONCE IN A LIFETIME OPPORTUNITY – ARCHITECTURAL BEACHFRONT HARBOURSIDE HOME 23 Pacific Boulevard, Buddina Never to be repeated and most definitely a one-off, we are excited and proud to present 23 Pacific Boulevard, located in highly sought-after Buddina. With stunning views over the Mooloolaba Wharf, the Pacific Ocean and beyond, prestigious properties rarely surpass this. As you enter the home you are greeted by the expansive sweeping staircase and outstanding architecture. Throughout the home there are 5 bedrooms on offer with 3 ensuites. On the third floor the magnificent master suite exudes luxury, with ample space to relax and take in the ocean views. Entertaining will be a must with the impressive games room and bar area where you will enjoy many sunsets overlooking the wharf and harbour of Mooloolaba. The stunning kitchen with modern stainless-steel appliances flows into the grand living room offering a beautiful space for the family to gather.
N E X T
56.indd 1
G E N
R E A L
• • • • • • • •
Premium 1st class location Lift access to all levels Stunning views over Mooloolaba Sweeping views to the Pacific Ocean Ducted/zoned air conditioning Private inground pool Suspended slab construction 5 private decked areas
E S T A T E
23/12/2020 10:49:17 AM
E 5
3
3
Auction: Forthcoming Auction Inspect: Strictly by prior appointment Loren Wimhurst 0415 380 222 Richard Scrivener 0416 799 188
57.indd 1
23/12/2020 10:49:46 AM
PROPERTY
BUYERS FLOCK TO SUNSHINE COAST’S PLAZA CENTRAL DEVELOPMENT NOW UNDER CONSTRUCTION
B
uyers are flocking to secure the competitively affordable urban-coastal residences on offer at new Sunshine Coast development Plaza Central in Maroochydore, with limited availability in stage one. The Plaza Central apartment project on Pikki Street, which is currently under construction and being developed by leading national property and construction group Pindan, is attracting strong interest from homebuyers and investors alike. “Plaza Central is coming along quickly; basement works have started and the slab has been poured, so it’s on track to be finished in the last quarter of next year,” says Pindan acquisition manager Remi Rafter. “The well-advanced nature of this exciting development, which offers the best of the vibrant Sunshine Coast lifestyle, has sparked a huge level of buyer interest such that over 80 per cent of stage one is now sold, with only two-bedroom apartments still available.
nature spots, and thriving shopping, dining and entertainment scenes,” she says. “Plaza Central, which features two five-level buildings with lift access and secure underground parking, is only 100 metres from the newly-expanded Sunshine Plaza shopping centre. It’s also within walking or riding distance of the Maroochydore CBD, Ocean Street’s popular restaurants and cafes, the Cotton Tree waterfront dining area and a short drive to the breathtaking coast, so the lifestyle offering is simply incredible.” “Eligible buyers have also rushed to take up the $25,000 Federal Building Package and Queensland’s $15,000 First Home Buyer Grant to save up to $40,000 on these low-maintenance residences in an enviable location. For those looking to purchase in the new year, the Federal Building Package has been extended until March 31, 2021 although reduced to $15,000. Pindan sales manager Cathie Price
says the group was not surprised dozens of the conveniently located contemporary one and three-bedroom apartments had been snapped up so quickly. “The Sunshine Coast is one of the strongest property markets at present with upwards growth and good rental returns; the area is still affordable but boasts a healthy, growing local economy and population, stunning beaches and
AT A GLANCE Plaza Central Maroochydore Visit the sales office at 12 Amaroo Street, Maroochydore. Open Tuesday to Saturday 9am to 4pm . Price: Two-bedroom apartments start from $435,000. Contact: Cathie Price 1800 752 630 or 0413 068 602. plazacentral.com.au.
OFFICE:
2/66 Maple Street, MALENY. PH: 07 5429 6411.
Conondale
Land
LOT 1 • 25 ha of fertile river flat country with frontage to the Mary River • A 12-hectare irrigation license • Around 700 metres of underground irrigation mains with several locations with onsite access to mains power to install an irrigation pump in the river • A separate pump dedicated to pumping up to elevated tanks, that then allows water to be gravity fed to troughs that are located throughout the property
Lot 1 & Lot 12, 787 Aherns Road View: By Appointment – Contact Agent | For Sale: Offers Considered LIVE THE LIFE AND SURVEY YOUR KINGDOM FROM THE ELEVATED, COOL, HOUSE SITE TO THE EAST! Located in the very fertile headwaters of the Mary Valley, ‘Banksia’ is one of the most productive cattle properties in the district with kikuyu, paspalum, setaria and white clover based improved pastures throughout. Current stocking rates of around 2 beasts per hectare makes this the ideal lifestyle property for people wanting to retire to a location - which is only 20 minutes’
58 My Weekly Preview | January 7, 2021
58.indd 1
drive to the iconic tourism hub at Maleny and 40 minutes to the Sunshine Coast beaches at Caloundra and Mooloolaba. The property contains: • 2 separate titles with bitumen road frontage to both blocks • 4 paddocks • Permanent water from the Mary River and a spring fed dam
LOT 12 • 53 ha of undulating to hilly high country providing several ideal house sites to build a “dream home”. This property is part of a larger aggregation that is being “down sized” to reduce the work load on “ageing” vendors, who are wanting to spend more time with their children and grandchildren. As the property is being down sized it also provides an opportunity for buyers to acquire more land from the vendor, who will be selling more blocks in the future.
Contact Peter on 0429 061 444 Hinterland Sales Realestate realestate.com.au/133675562
For Sale
myweeklypreview.com.au
4/01/2021 11:07:38 AM
Coolum 5446 2500 | Marcoola 5448 7444 www.northshorerealty.com.au
AUCTION
1-2 27 Joanne Street, Marcoola
5
3
4
ONE OF A KIND BEACHFRONT DUPLEX, IN THE HEART OF MARCOOLA First time for sale in over 30 years, this spectacular offering of two separately titled beach houses sit tucked away directly behind the sand dune at Marcoola Beach. Solid rendered brick construction with suspended concrete floors, Colorbond roofing and remote controlled gated driveway access. To be sold as one package. BEACH HOUSE 1 • 3 a/c bedrooms, 2 bathrooms, single lock up garage. Ground level main opens to undercover area overlooking landscaped courtyard • Stunning entertainer’s kitchen with stone island bench, white tiled splashback & plentiful soft close cabinetry • Outstanding lounge with dual stacker doors providing stunning outlook to the dunal background plus natural light and breezes • Plantation shutters and Crimsafe screening throughout
Osprey Ramada, 923 David Low Way, MARCOOLA
4
BEACH HOUSE 2 • 2 a/c bedrooms, 1 bathroom, soaring raked ceilings, tiled kitchen/living through to wrap around upstairs deck with manual awning • Single lock up garage, separate laundry accessing spacious undercover outdoor entertaining area overlooking landscaped courtyard Beachfront property now more than ever is better than money in the bank with future capital gains guaranteed. This is a once in a lifetime chance to own adjoining beachfront homes in the centre of the Sunshine Coast.
4
2
BEACHFRONT LUXURY HOME • 5 star living in this prestigious, absolute beachfront position • Entry through the secure beachfront gate access reveals your own private sanctuary, with huge courtyard and manicured gardens • Media room and guest bedroom on ground floor. Modern kitchen with granite benchtops and easy access to front courtyard • Three generous bedrooms upstairs, one with combined office, each boasting own bathroom and balcony • Master bedroom showcasing an inviting wrap-around balcony overlooking dunal beach access • Beach access 30 steps to the East. Resort facilities 30 steps to the North myweeklypreview.com.au
59.indd 1
Unit 3111 Ramada, 923 David Low Way, MARCOOLA
View Saturday 11:00-11:30am Auction On Site Saturday 30th January @ 10am Jay Pashley 0407 119 355 jay@northshorerealty.com.au
3
2
1
SETTLE IN AND SOAK UP THE SEA BREEZE View Saturday & Wednesday 1:00 -2:00pm For Sale $1,295,000 Jay Pashley 0407 119 355 jay@northshorerealty.com.au
• Pinnacle position, footsteps to everything and featuring exclusive courtyard approximately 80m2 • Largest ground level terrace in the building and perfectly nestled in-between the gardens for privacy • Legitimately footsteps from the pool and just beyond that to the beach • Size and space is a consistent theme for this property with open floor plan flowing from kitchen, living and through to courtyard • Located in RAMADA Marcoola you’re right in the centre of town, easy walk to patrolled beach, local restaurants, parks and cafés • Only minutes to the new Sunshine Coast Airport • Refreshingly presented, property is ready to live in or rent
View Contact Agent For Sale $595,000 Jay Pashley 0407 119 355 jay@northshorerealty.com.au My Weekly Preview | January 7, 2021 59
4/01/2021 9:55:20 AM
AUCTION
5 Avocado Lane, Maleny
5
2
3
RELAXED COUNTRY LIVING AT ITS CHARMING, ELEGANT BEST! A beautiful home and lifestyle await the lucky buyer of this character-filled, generously proportioned Maleny residence. Mature and stately trees welcome you to an expansive 1.6 acre (6,529m2) holding, set privately off the quiet lane. This remarkable dual living home of 5 bedrooms, 3 bathrooms, is nestled within lush, leafy gardens and rolling lawns, impeccably positioned in one of Maleny’s most desirable and tree-lined blue-ribbon streets. Immaculately presented and complete with expansive living areas, a gorgeous swimming pool, alfresco entertaining areas and easy care, established grounds – you will enjoy this stunning family home year-round!
60.indd 1
Auction: On site 3pm, Saturday Jan. 16th Inspect: Saturday 9th from 11am, Wednesday 13th from 3pm & Saturday 16th from 2pm prior to Auction View: remaxhinterland.com.au RE/MAX Hinterland 0447 737 737
remaxhinterland.com.au
ADDRESS 2/10 Maple Street Maleny QLD 4552
Each office independently owned and operated
OFFICE 5408 4220
23/12/2020 10:52:12 AM
FOR SALE
154 Burgum Road, North Maleny
4
NORTH MALENY HOMESTEAD ON 39 ACRES - OBI OBI CREEK FRONTAGE Set in the sought-after enclave of North Maleny, this acreage property is a RARE FIND in today’s market! Situated on a no through country lane, this appealing acreage retreat could be just what you have been waiting for. The rolling green acres are truly unique with Obi Obi Creek frontage across the entire eastern boundary, with babbling streams, waterfalls, swimming holes and towering Basalt cliffs. They are a SIGHT TO BE SEEN! The spacious home enjoys a couple of acres of established gardens and fabulous views over the property and beyond – taking in a perfect North East aspect. Ideally set up for running cattle or horses, the property comes complete with yards, machinery sheds, fenced paddocks and acres of Maleny pasture. The owners have bought elsewhere. The property is now ready for you and your family.
61.indd 1
2
9
Price Guide: $2,200,000 Inspect: By Appointment View: remaxhinterland.com.au RE/MAX Hinterland 0447 737 737
remaxhinterland.com.au
ADDRESS 2/10 Maple Street Maleny QLD 4552
Each office independently owned and operated
OFFICE 5408 4220
23/12/2020 10:52:55 AM
PROPERTY PROMOTION
BADDERAM SITE SEEKS NEW OWNER & EXPERIENCED DEVELOPER
P
ictured for sale is the Badderam resort development site in Buderim, also known locally for some 50-plus years as Malumba Estate. Malumba Estate currently operates as one Australia’s most prestigious and romantic Hamptons-style retreats and is currently the Sunshine Coast’s most luxurious private-hire accommodation. Whilst operating Malumba Estate, property owners Mrs Heidi Meyer and Mr Kim Carroll, have for six years successfully progressed the Badderam resort project. A project capable of serving the Sunshine Coast community some 100 years into the future. During this time they also purchased neighbouring rainforest acreage and guest house – Aquila Retreat. The pair have since fully renovated and transformed Aquila to become a second stand-out, luxe accommodation for the Coast. Heidi and Kim are proud of Buderim, the Sunshine Coast and the guests they bring to their impressive hillside to enjoy with them their stunning panoramic views across the Sunshine Coast.
62 My Weekly Preview | January 7, 2021
62.indd 1
“They are not making land or views like this anymore – it really is spectacular,” explains Kim. The 111-room Badderam Resort DA is important to the couple, as this will see their rare and large land parcel used responsibly to provide their community with an ecologically built luxury infrastructure, jobs for future generations and an increased footfall to the businesses of Buderim village. Heidi and Kim are clear about the legacy they wish to leave. Badderam is recognised as the most community supported development application in Sunshine Coast Council’s history. Only 27 native trees are removed from the site to build Badderam with over 500 put back. Badderam is built in the already cleared areas of the site where existing large buildings are located. On site remnant vegetation will be regenerated in the Badderam plan. The outcome for fauna and flora across the site is extremely positive. Since the DA was approved in 2018, Heidi and Kim have worked tirelessly, engaging with international resort operators, potential developers and
myweeklypreview.com.au
4/01/2021 9:00:40 AM
PROPERTY PROMOTION
“It is my absolute desire to remain fully involved with the project as its creator and visionary.” Heidi Meyer
“My work has been accomplished this past six years in connecting the moving parts of this project; our community, the DA, a five-star resort operator and finally the finance to construct. I am proud of all that we have achieved to date.” myweeklypreview.com.au
63.indd 1
financiers the world over, bringing together the project’s moving parts. Having led a team of over 45 consultants to progress this new and exciting ecological and Indigenous inspired five-star resort development, project lead Heidi says she and Kim have now brought the project as far as they can until an experienced developer is found. “My work has been accomplished this past six years in connecting the moving parts of this project; our community, the DA, a five-star resort operator and finally the *finance to construct. I am proud of all that we have achieved to date,” says Heidi. “It is my absolute desire to remain involved with the realisation of the project as its creator and visionary.” Whilst COVID-19 has created uncertainty for global resort and hotel markets generally, what it has meant for the Sunshine Coast is an unprecedented number of tourists flocking here to enjoy paradise. Bookings and enquiries for Malumba Estate and Aquila Retreat are at an all-time high, reports Heidi.
“Now is the time to build a new luxury resort on the Sunshine Coast – build it and they will come, just as they already are,” Kim advises. Queensland and the Sunshine Coast are currently the envy of the world. The Sunshine Coast’s infrastructure pipeline, liveability and natural assets are astounding, and the rest of the world is now starting to take notice of this superior region. *Finance subject to due diligence.
TENDER Close Thursday, January 28, 2021 5pm
INSPECTIONS By appointment
CONTACT Matt Diesel 0412 053 117 Damien Michael 0413 024 124 Chris Pace 0417 196 600
AT A GLANCE SITE SIZE 10 acres (4.04 ha) boasting panoramic views over the Sunshine Coast. LOCATED a one-hour drive from Brisbane, an 11-minute drive to the new Sunshine Coast International Airport, and an eight-minute drive to the new Maroochydore CBD and Mooloolaba Beach.
RESORT DA is valid until 2025 and is supported by market and financial projections. Five-star luxury resort operator, development finance, development manager and experienced team of consultants on standby to work with purchaser. malumbaestate.com.au badderam.com.au aquilaretreat.com.au mcgrath.com.au
My Weekly Preview | January 7, 2021 63
4/01/2021 9:02:32 AM
RESIDENTIAL | RURAL | COMMERCIAL
140 Gerrard Road, Eudlo
4
2.5
5
| Land 4.9 acres
‘FIG TREE HILL’: A VERY PRIVATE HINTERLAND ESCAPE After winding your way through tree-lined country lanes and upon entering the peaceful and secluded haven of ‘Fig Tree Hill’ you’ll forget that you’re just minutes from the charming village of Eudlo. Nestled amongst spectacular 150 year old Moreton Bay Fig trees and boasting a stunning hinterland and ocean vista, this unique residence on 4.9 acres offers the ultimate escape for those seeking a truly distinctive retreat. Thoughtfully designed in modern Australian style to embrace the coastal breezes and offer a low maintenance lifestyle, this home also captures the relaxed flavour of the European countryside with rustic timber doors, outdoor fireplace and bathtub, and colourful drifts of bougainvillea.
Athena Law 0408 884 104
OFFERS FROM $979,000
Matthew Wotton 0404 840 071
WHO DO YOU TRUST TO MANAGE YOUR PROPERTY?
“ BERNADETTE MEREDITH
“
If considering Property Lane to manage your property, I will
Ensuring communication is maintained to an absolute premium
personally be looking after your property
is at the heart of how we manage our
and with a background in marketing,
properties best. Our landlords and
horticulture, landscape design, business
tenants have a very clear understanding
management/ownership and real estate investing over 30 years, you can rest assured that your property is in very
TRACEY WILSON
of the process and legislation and thus any disputes are generally minor or eradicated completely.
good hands.
TRUST the team at PROPERTY LANE (07) 5442 1855 | admin@propertylane.com.au | 1/40 Wilson Avenue, Woombye 64.indd 1
4/01/2021 10:07:40 AM
35 Mooloolah Island, Minyama
4
3
3
913m2
SENSATIONAL OPPORTUNITY – ENTRY LEVEL DEEP WATER ON PRESTIGIOUS MOOLOOLAH ISLAND! Boasting a stunning main river position and superb easterly aspect, 35 Mooloolah Island is waterfront living at its finest. A stunning entry level opportunity to acquire this elite Island position; one of the most desirable precincts on the Sunshine Coast! The home is positioned well on the large 913m2 parcel of land, which features a generous 22m river frontage, along with 12m pontoon and riverfront deck, all capturing the ideal easterly aspect. This stunning Island position needs to be experienced first-hand to be fully appreciated. Within just moments to every possible amenity, yet it feels like you’re in your own private paradise. The owner is encouraging all offers to be brought forward immediately, so don’t miss out! Contact Craig Porter or Alan Riley to register your interest or to arrange your viewing today.
For Sale $3 million plus buyers View Sunday, January 10th, 11-11:45am Agent Craig Porter 0411 554 880 Alan Riley 0422 723 719 mooloolaba.ljhooker.com.au LJ Hooker Mooloolaba
myweeklypreview.com.au
65.indd 1
My Weekly Preview | January 7, 2021 65
23/12/2020 10:57:02 AM
66 My Weekly Preview | January 7, 2021
66.indd 1
myweeklypreview.com.au
23/12/2020 10:57:49 AM
PROPERTY SALES & MANAGEMENT
It’s how we roll..... Rowling & Co Property is a boutique Sunshine Coast real estate agency for everyone. We are real people who are driven by a passion and commitment to providing an outstanding level of service while achieving exceptional results.
BUY | SELL | RENT Dan Rowling 0421 456 776
Kelly Rowling 0437 443 013
Adam Dunlop 0404 880 869
S h o p 12 69-79 At te n u ata D r, M o u nta i n Cre e k T: 07 5375 5781 r ow l i n g a n d c o.co m .a u
myweeklypreview.com.au
67.indd 1
My Weekly Preview | January 7, 2021 67
23/12/2020 10:58:48 AM
PROPERTY
GREAT VALUE WITH DUAL LIVING
P
roudly situated on a massive elevated 1,072m2 allotment, this private and impeccably appointed lowset executive or family beach residence has been renovated and extended from the ground up to ensure easy beachside living. Boasting ducted air conditioning and new first-class fixtures and fittings throughout, there is nothing to do but move in. A separate luxury one-bedroom villa has also been constructed adding to the flexibility and appeal of this outstanding property and it is ideal for parents or older children or an amazing source of additional income.
29 BUCCLEUGH STREET, MOFFAT BEACH 5 bed, 3 bath, 3 car Auction In Rooms, The Events Centre, Caloundra Thursday, January 28 at 11am Ray White Caloundra 07 5491 5055 Andrew Garland 0403 851 777
leadingrealty.com.au 202/47-51 Mooloolaba Esplanade
MOOLOOLABA 2
2
1
This apartment in the much-admired Zanzibar building could not be better located to maximise outlook, lifestyle, and convenience in a central position. Elevated one floor above shops, the ocean and beach views are spectacular and when you sit in your exclusive outdoor spa with a glass of bubbles you will truly know that life doesn’t get better than this!
PRICE Contact Agent VIEW As Advertised or By Appointment CONTACT Lee Sutherland 0499 993 311 Grant Cheratham 0497 845 598
68 My Weekly Preview | January 7, 2021
68.indd 1
myweeklypreview.com.au
23/12/2020 11:09:04 AM
TRADES & SERVICES DRIVEWAY CLEANING
MAINTENANCE
JUST DRIVEWAYS WAYS
Trades & services AUTO
Sunshine Coast Car Buyers NEED TO SELL???
Your Car or Commercial If you have a surplus vehicle, can no longer drive or going O/S maybe I can help. NO RWC needed & I come to you! NO waiting around for people who don’t turn up. I’m a local motor dealer with 40 years experience. Call if you think I can help.
Steve 0407 788 999
FROM $35 Phone Peter for a quote Jobs up to $3300 only
ELECTRICIAN
Terry Healion
NO CALL OUT FEE
Licensed Electrical Contractor tor Lic: 36780 30 Years Experience
■ ■ ■ ■
Locally owned, meaning the person you speak to is the person doing your work. Prompt & friendly service. Servicing Caloundra to Maroochy and West to the Ranges.
■
Specialising in: Household Repairs • Installations • Lights • Fans Power Points • Safety Switches
QBCC 15049318
■ ■
GROUT CLEANING & RESTORATION
Construction Cost Estimators
Sick of Scrubbing with NO RESULT?
www.totalestimatingservices.com.au
CONCRETE SERVICES
Domestic & Commercial Specialising in DECORATIVE & STENCILLED CONCRETE
Leaking Shower Solutions Silicone Seal Replacement Slippery Surface Treatment Tile, Grout, Stone & Hard Surface Cleaning & Sealing Epoxy Grouting & Tile Re-Grouting Glass Restoration & Glass Protection s Low Cost Shower Restorations
CALL 0434 685 009 FREEFRASER QUOTES & ADVICE 07) 5456 4603
Phone Darren 0418 157 998 info@fixmeplumbing.com.au livingstoneconcrete@hotmail.com www.fixmeplumbing.com.au www.facebook.com/FIXMEPLUMBING A/H 5496 7155 QBCC Lic No. 700727
For a FREE Quote Call 0421 201 769
GARAGE FLOORING SPECIALISTS Decorative Seamless Flooring • Wide Colour Range • 20 Years Experience
Phone Dave: 0488 003 869
QBCC Lic: 076033
www.floortec.com.au
myweeklypreview.com.au
69.indd 1
NAMBOUR HANDYMAN SERVICES We Love the Jobs You Hate! Servicing Nambour and neighbouring communities over all trades. Willem Lombard 0435 576 822
Member
Covering the Coast from Caloundra to Gympie Book your free quote today!
Phone 5327 3414 Visit our 100m2 interactive showroom
homepoint.com.au/Preview
From Concept to Creation Competitive pricing, all quoting and fitting done by owner.
info@fixmeplumbing.com.au www.fixmeplumbing.com.au www.facebook.com/FIXMEPLUMBING
QBCC 15041423
PLUMBING Quality Service - Affordable Price
0407 738 025
QBCC 1162630
Lic No 19698
MOWING GARDEN MAINTENANCE HANDYMAN LANDSCAPING
PHONE PAUL 0420 693 993
COASTLAND ARBOR SERVICES Small jobs, palms, large & confined space, tree removals, stump grinding, land clearing, excavator, chipper, bob cat, cherry picker. Qualified arborist, fully insured, local business, 6th generation, Father & Sons.
Jeff 5446 6373 / 0413153 076
A1
Contact Rob 0401 655 011
• No job is too small • All work inside & outside • Pensioner discounts • Carpentry, Painting, Tiling, Roofing, Bathrooms and Kitchenss • FREE quotes • 25 years in the building and design industry
TREE SERVICES
A1 PROPERTY CARE SERVICES
Own ABN. Fully Insured
QBCC rules apply
0481 215 422 www.bespokeshuttersblinds.com.au
WASTE REMOVAL
PROPERTY MAINTENANCE
FREE QUOTES!
HANDYMAN / MAINTENANCE
Work up to $3,300 only
CALL FRASER 0434 685 009 07) 5456 4603
Commercial & Residential Blocked Drains • Leaking Taps • Hot Water Units • Renovations 24hr Maintenance
Ask us about our Stain Free Grout Option
MAINTENANCE
Plain & Exposed Aggregate Decorative Seamless Flooring Concrete Cleaning & Resealing
SHUTTERS AWNINGS BLINDS CURTAINS SECURITY SCREENS
• Shutters • Blinds • Awnings • Security Screens • Roller Shutters Servicing Gympie to Brisbane
MICK BURKE
www.groutwizards.com.au
DRIVEWAYS PATHWAYS SLABS
Blocked drains-cleared fast with high pressure jetter & camera inspection
QUALITY SCREENS & CURTAINS AT GREAT PRICES
CALL NOW for a FREE measure & quote
Have your Tiles, Grout & Hard Surfaces Restored to Perfection GUARANTEED!!
TOTAL ESTIMATING SERVICES Phone David 0411 603 330
Hot Water Systems, Taps ■ Toilets Water Filters Gasfitting Maintenance Work Water Leaks & Detection
AUSTRALIAN MADE
SENIOR and PENSIONER Card holders discount. Eftpos | Credit Card Available
BUILDING ESTIMATORS
since 1990
Call Jet 0412 691 258
PLUMBING
0432 278 487 | 07 5353 0417 www.electricianhealion.com.au
specialising in
Locks • Doors • Carpentry Sliding Screens • Painting • Maintenance Repair. 20 years experience on the Coast.
driveway!
steve@buyriteautos.com.au NO Obligation - LMD
Architectural Renovation or New Home Building Work Preliminary Cost Advice & Detailed Tenders
HOME HANDYMAN
PRESSURE CLEANING NG It’s nice to come e!! fre l Chemica home to a clean
0466 557 255
SCREENS, BLINDS & SHUTTERS
RUBBISH REMOVALS
2-GO Clear-Space!! RUBBISH CLUTTER CLEARED
SEPTIC SYSTEM Locally Owned TREATMENT PLANTS & Operated. Since 1980 GREASE TRAPS HYDRO EXCAVATION LIQUID WASTE COMMERCIAL & DOMESTIC
Ph: 5447 6477 www.suttonscleaning.com.au
Fridges • Beds • Lounges etc. Monday - Friday 6am - 6pm Saturday morning by arrangement For Good Service & FREE Quote CALL NOW!
0477 772 138
Trades & services To advertise here call 5444 0152 My Weekly Preview | January 7, 2021 69
4/01/2021 3:53:07 PM
TV GUIDE
SEVEN (CH6)
NINE (CH5)
WIN (CH8)
SBS (CH3)
FRIDAY
6pm Julia Zemiro’s Home Delivery. 6.30 Anh’s Brush With Fame. (PG) 7.00 ABC News. 7.30 Nigella’s Cook, Eat, Repeat. 8.05 Vera. (PG) The son of a prominent family is murdered. 9.35 Mystery Road. (M) Two unannounced visitors arrive in town. 10.35 ABC Late News.
6pm Seven Local News. 6.30 Seven News. 7.00 Better Homes And Gardens Summer. 8.30 MOVIE The Fugitive. (1993) (M) Harrison Ford, Tommy Lee Jones. A man is wrongly convicted of murder. 11.15 MOVIE Fallen. (1998) (M)
6pm Nine News. 7.00 A Current Affair. 7.30 Country House Hunters Australia. 8.30 MOVIE The Firm. (1993) (M) Tom Cruise, Jeanne Tripplehorn. A naive lawyer uncovers a conspiracy. 11.35 MOVIE The Kingdom. (2007) (MA15+)
6pm WIN News. 6.30 The Project. 7.30 The Living Room. 8.30 The Graham Norton Show. (PG) Guests include Tom Hanks. 9.30 Hughesy, We Have A Problem. (M) Hosted by Dave Hughes. 10.30 The Project. 11.30 WIN News.
6pm Mastermind Australia. 6.30 News. 7.30 Planet Of Treasures. (PG) 8.30 Kevin McCloud: Rough Guide To The Future: Eco Town, Future Farming, Robot Cemetery. Part 2 of 3. 9.30 D-Day: The King Who Fooled Hitler. (PG)
SATURDAY
6pm Ask The Doctor: Exercise. 6.25 Landline Summer. 7.00 ABC News. 7.30 Midsomer Murders. (M) A former supermodel is murdered. 9.00 Endeavour. (M) Morse investigates an assassination. 10.30 Call The Midwife. (PG) 11.30 Deep Water. (M)
6pm Seven News. 7.00 Cricket. Big Bash League. Game 34. Perth Scorchers v Sydney Thunder. From Optus Stadium, Perth. 10.00 MOVIE Just Cause. (1995) (MA15+) Sean Connery, Laurence Fishburne. A death-row inmate insists he is innocent.
6pm Nine News Saturday. 7.00 A Current Affair. 7.30 Tipping Point. (PG) 8.30 MOVIE Gone Girl. (2014) (MA15+) Ben Affleck, Rosamund Pike. A man reports his wife missing. 11.30 MOVIE Secret In Their Eyes. (2015) (M)
6pm The Dog House. (PG) 7.00 MOVIE Shrek Forever After. (2010) (PG) Mike Myers. Shrek signs a deal with Rumpelstiltskin. 8.45 MOVIE Bruce Almighty. (2003) (M) Jim Carrey, Jennifer Aniston. A man is given supernatural powers. 10.40 MOVIE I, Tonya. (2018) (MA15+) Margot Robbie.
6pm Grand Tours Of Scotland’s Lochs. 6.30 News. 7.35 Robson Green’s Australian Adventure: Northern Territory. (PG) 8.30 MOVIE The Godfather: Part II. (1974) (MA15+) Al Pacino. A Mafia don expands his empire.
SUNDAY
6pm Antiques Roadshow. 7.00 ABC News. 7.40 Fight For Planet A: Our Climate Challenge. (PG) Part 3 of 3. 8.45 Miniseries: The Cry. (M) Part 4 of 4. 9.45 Stateless. (M) Clare Kowitz arrives at Barton. 10.40 Killing Eve. (M)
6pm Seven News. 7.00 Cricket. Big Bash League. Game 35. Sydney Sixers v Brisbane Heat. From Metricon Stadium, Queensland. 10.00 MOVIE Blow. (2001) (MA15+) Johnny Depp, Penélope Cruz. A small town hoodlum becomes a drug kingpin.
6pm Nine News. 7.00 60 Minutes. 8.00 RBT. (PG) 8.30 MOVIE Mission: Impossible – Ghost Protocol. (2011) (M) Tom Cruise, Jeremy Renner. A rogue spy pursues a madman. 11.10 5 Mistakes That Caught A Killer. (MA15+)
6.30pm The Sunday Project. 7.30 I’m A Celebrity… Get Me Out Of Here! Hosted by Julia Morris and Dr Chris Brown. 9.00 The Graham Norton Show. Guests include Anya Taylor-Joy. 10.00 The Graham Norton Show. (M) 11.00 The Sunday Project.
6pm Grand Tours Of Scotland’s Lochs: A Mystical Journey. (PG) Presented by Paul Murton. 6.30 SBS World News. 7.30 Egypt With The World’s Greatest Explorer: Hidden Treasures. Part 1 of 3. 10.05 Untold Australia: Love Me As I Am. (PG) Part 1 of 4.
7.30pm 7.30. 8.00 Stan Grant’s One Plus One. 8.30 Australia Remastered: Ancient Forests. 9.25 Griff’s Great Australian Rail Trip: Uluru to Adelaide Find What Makes Australia Extraordinary.
6pm Seven Local News. 6.30 Seven News. 7.00 Cricket. Big Bash League. Game 36. Adelaide Strikers v Melbourne Stars. 10.00 Motorway Patrol. (PG) Follows the work of a police unit. 10.30 Station 19. (M) 11.30 Criminal Confessions. (M)
6pm News. 7.00 ACA. 7.30 GC Cops. (M) 8.00 Driving Test. (PG) 8.30 MOVIE Deepwater Horizon. (2016) (M) Mark Wahlberg. 10.35 The First 48. (M) 11.30 Generation X. (M)
6pm News. 6.30 The Project. 7.30 I’m A Celebrity… Get Me Out Of Here! 9.00 Montreal Comedy Fest. (MA15+) 10.00 Hughesy, We Have A Problem. (M) 11.00 Kinne Tonight. (M) 11.30 WIN News.
6pm Mastermind Australia. 6.30 SBS World News. 7.35 The Architecture The Railways Built: Kings Cross. (PG) Presented by Tim Dunn. 8.30 24 Hours In Emergency: Go Your Own Way. (M) A 32-year-old is brought to emergency. 10.15 SBS World News Late.
TUESDAY
6.30pm Anh’s Brush With Fame. (PG) 7.00 ABC News. 7.30 7.30. 8.00 You Can’t Ask That. (PG) 8.35 Shaun Micallef’s On The Sauce. (M) Part 2 of 3. 9.35 Big Weather (And How To Survive It) Into The Firestorm. (PG)
6pm Seven Local News. 6.30 Seven News. 7.00 Cricket. Big Bash League. Game 37. Perth Scorchers v Hobart Hurricanes. From Optus Stadium, Perth. 10.00 Chicago Fire. (M) Brett is faced with a monumental decision. 11.00 Beat The Chasers UK.
6pm Nine News. 7.00 A Current Affair. 7.30 To Be Advised. 8.30 Kath & Kim. (PG) Sharon goes out on a date. 9.40 Hamish & Andy’s Gap Year Asia. (PG) 11.35 Law & Order: Criminal Intent. (M)
6pm WIN News. 6.30 The Project. 7.30 I’m A Celebrity… Get Me Out Of Here! Hosted by Julia Morris and Dr Chris Brown. 9.00 NCIS. (M) Gibbs becomes acting director of the NCIS. 10.00 NCIS: Los Angeles. (M) 11.00 WIN’s All Australian News.
6pm Mastermind Australia. 6.30 News. 7.30 Great Continental Railway Journeys. 8.40 Birdsville Or Bust: Untold Australia. (M) Follows the story of Birdsville. 9.40 Travel Man’s Greatest Trips. (PG)
WEDNESDAY
6.30pm Anh’s Brush With Fame. (PG) 7.00 ABC News. 7.30 7.30. 8.00 Hard Quiz. (PG) 8.35 Spicks And Specks. (PG) Hosted by Adam Hills. 9.30 QI. 10.00 Would I Lie To You? (PG)
6pm Seven Local News. 6.30 Seven News. 7.00 Cricket. Big Bash League. Game 38. Sydney Thunder v Sydney Sixers. From GIANTS Stadium, Sydney. 10.00 MOVIE Skiptrace. (2016) (M) Jackie Chan. A man takes on a mission to bring down a gangster.
6pm Nine News. 7.00 A Current Affair. 7.30 Paramedics. (M) 8.30 The InBetween. (M) Tom and Damien race to stop a serial pyromaniac. 9.30 Chicago Med. (MA15+) Noah doubts his abilities as a doctor. 11.20 New Amsterdam. (M)
6pm WIN News. 6.30 The Project. A look at the day’s news. 7.30 I’m A Celebrity… Get Me Out Of Here! Hosted by Julia Morris and Dr Chris Brown. 9.00 Bull. (M) Bull defends a religious leader. 11.00 WIN’s All Australian News.
6pm Mastermind Australia. 6.30 SBS World News. 7.35 Britain’s Most Historic Towns: Restoration London. (PG) 8.30 The Last Journey Of The Vikings. Part 1 of 4. 9.30 Vikings. It is election day in Kattegat. 10.20 SBS World News Late.
7pm ABC News. 7.30 7.30. 8.00 Scottish Vets Down Under. (PG) 8.30 Rick Stein’s Secret France. Rick arrives in the Périgord region. 9.30 Miriam Margolyes Almost Australian: The Australian Dream. (M)
6pm Seven Local News. 6.30 Seven News. 7.00 Cricket. Big Bash League. Game 39. Brisbane Heat v Melbourne Renegades. From Marvel Stadium, Melbourne. 10.00 MOVIE Lost In Space. (1998) (PG) Gary Oldman, William Hurt. A family’s spaceship is sabotaged.
6pm Nine News. 7.00 A Current Affair. 7.30 Great Getaways. (PG) 8.30 Race Across The World. (M) The teams have reached the halfway mark. 11.00 World’s Worst Flights: Landings. (M) 11.50 The Horn: The Mountain. (M)
6pm WIN News. 6.30 The Project. 7.30 I’m A Celebrity… Get Me Out Of Here! 9.00 Law & Order: SVU. (M) Rollins goes undercover. 10.00 Blue Bloods. (M) 11.00 This Is Us.
6pm Mastermind Australia. 6.30 SBS World News. 7.30 The World’s Greatest Palaces: Hampton Court Palace. 8.25 The Rise Of The Nazis: Politics. (M) Part 1 of 3. 9.30 World On Fire. (M) Tom finds himself on board the Exeter.
MONDAY
ABC (CH2)
THURSDAY
YOUR PRIME TIME TV GUIDE
0801
Programs are correct at the time of print and are subject to change by the networks.
We make home care more local, trustworthy and loving. 70 My Weekly Preview | January 7, 2021
70.indd 1
myweeklypreview.com.au
4/01/2021 10:28:53 AM
TV GUIDE
7TWO (CH62)
7MATE (CH63) 9GO! (CH53)
9GEM (CH52)
BOLD (CH81)
PEACH (CH82)
FRIDAY
7pm Children’s Programs. 7.30 Spicks And Specks. 8.00 Doctor Who. 8.45 MOVIE Proof. (1991) (M) 10.15 Brush With Fame. 10.45 George Clarke’s Amazing Spaces.
6.30pm Bargain Hunt. (PG) 7.30 Dog Patrol. (PG) 8.30 Escape To The Country. 9.30 Selling Houses Australia. 10.30 Property Ladder UK. (PG)
6pm American Pickers. 7.00 Pawn Stars. 7.30 MOVIE The Last Starfighter. (1984) (PG) 9.40 MOVIE The Osiris Child: Science Fiction Volume One. (2016) (MA15+) 11.45 American Dad!
6pm MOVIE The Cat In The Hat. (2003) (G) Mike Myers. 7.40 MOVIE Rise Of The Guardians. (2012) (PG) Hugh Jackman. 9.40 MOVIE Miami Vice. (2006) (MA15+) Jamie Foxx, Colin Farrell.
5.20pm Heartbeat. (PG) 6.30pm Antiques Roadshow. 7.30 Planet Earth II. (PG) 8.40 MOVIE Rob Roy. (1995) (M) Liam Neeson. 11.25 Our Lives: Extraordinary People. (PG)
6.30pm Bondi Rescue. (PG) 7.30 NCIS. (M) A petty officer is found murdered. 8.30 Law & Order: SVU. (M) 10.30 CSI: Crime Scene Investigation. (M)
6pm Friends. (PG) 6.30 Neighbours. (PGS) 7.00 Friends. (PG) 8.00 Big Bang. (PG) 9.30 MOVIE Beaches. (1988) (M) Bette Midler. 11.55 MOVIE Friends With Money. (2006) (M)
SATURDAY
7.05pm Children’s Programs. 7.30 Spicks And Specks. 8.00 QI. 8.30 Melbourne Comedy Festival: Allstars Supershow. 10.35 Would I Lie To You? 11.05 Whose Line Is It Anyway?
6.30pm The Yorkshire Vet In Spring. (PG) 8.30 Escape To The Country. 11.30 Greatest Outdoors. (PG)
6pm Big Bash League. Game 34. Perth Scorchers v Sydney Thunder. 7.00 Building Giants. 8.00 Mighty Ships. 9.00 Air Crash Investigation: Special Report. (PG) 10.00 Air Crash Investigation.
7pm MOVIE Charlotte’s Web. (2006) (G) 9.00 MOVIE Step Up. (2006) (PG) Jenna Dewan, Channing Tatum. 11.10 Japandemonium. (M) 11.40 Stunt Science. (MA15+)
4.05pm MOVIE Solomon And Sheba. (1959) (PG) Yul Brynner. 7pm MOVIE The Great Escape. (1963) (PG) Steve McQueen. 10.30 MOVIE The Secret Invasion. (1964) (M) Stewart Granger.
6.30pm Scorpion. (PG) 7.30 NCIS. (M) 8.30 NCIS: New Orleans. 9.25 NCIS: New Orleans. (M) 10.20 Hawaii Five-0. (M) 11.20 L.A.’s Finest. (M)
6pm Columbo. (PG) 8.00 Kojak. (M) 9.00 Spyforce. (M) 10.00 The Big Bang Theory. (PG) 10.30 The Middle. (PG)
SUNDAY
DIGITAL CHOICE
7pm Children’s Programs. 7.30 Spicks And Specks. 8.00 Compass. 8.30 Louis Theroux: Life On The Edge. 9.25 The Misadventures Of Romesh Ranganathan. 10.25 Catalyst.
6.30pm M*A*S*H. (PG) 8.30 MOVIE Bullitt. (1968) (M) Steve McQueen, Robert Duvall, Jacqueline Bisset. 11.00 World’s Most Amazing Videos. (M)
7pm Border Security. 8.30 MOVIE Lock, Stock And Two Smoking Barrels. (1998) (MA15+) 10.50 MOVIE Kick-Ass 2. (2013) (MA15+)
7.30pm MOVIE The Peacemaker. (1997) (M) George Clooney, Nicole Kidman, Armin Mueller-Stahl. 10.00 MOVIE The Gunman. (2015) (MA15+) Sean Penn, Jasmine Trinca, Javier Bardem.
5.30pm MOVIE That Touch Of Mink. (1962) (PG) 7.30pm Death In Paradise. (M) 8.40 Chicago P.D. (MA15+) 9.40 Chicago Fire. (MA15+) 10.40 Chicago Med. (M) 11.40 License To Kill.
6.30pm Bondi Rescue. (PG) 7.30 NCIS. A naval officer’s death is linked to a US senator. (M) 9.25 NCIS: Los Angeles. (M) 10.20 48 Hours. (M) 11.20 NCIS: Los Angeles. (M)
6pm The Big Bang Theory. Sheldon decides to head to Las Vegas to raise money for a science experiment. (PG) 9.00 Friends. (PG) 10.00 2 Broke Girls. (M)
7pm Children’s Programs. 7.30 Spicks And Specks. 8.00 Doctor Who. 8.45 David Attenborough’s Galapagos. 9.40 George Clarke’s Amazing Spaces.
6.30pm Bargain Hunt. (PG) 7.30 Doc Martin. (PG) 8.30 Foyle’s War. (M) 10.40 Inside Belmarsh Prison. (MA15+) 11.50 World’s Most Amazing Videos. (M)
6pm Big Bash League. Game 36. Adelaide Strikers v Melbourne Stars. 7.00 Pawn Stars. 7.30 SAS UK. (M) 8.30 MOVIE The Man From U.N.C.L.E. (2015) (M) 10.55 American Dad!
6pm Malcolm. (PG) 7.00 The Nanny. (PG) 7.30 MOVIE The Dilemma. (2011) (M) 9.40 MOVIE The Switch. (2010) (M) 11.40 Paranormal Caught On Camera. (M)
5.20pm Heartbeat. (PG) 6.30pm Antiques Roadshow. 7.30 Grantchester. (M) 8.40 DCI Banks. (M) 10.40 See No Evil. (M) 11.40 ER. (M)
6.30pm Bondi Rescue. (PG) 7.30 NCIS. Gibbs runs into an old friend from the FBI. (M) 10.20 Law & Order: SVU. (M) 11.15 NCIS: New Orleans.
6pm Friends. (PG) 6.30 Neighbours. (PG) 7.00 Friends. (PG) 8.00 The Big Bang Theory. (PG) 9.30 Seinfeld. (PG) 10.00 Two And A Half Men. (M) 11.00 The Middle. (PG)
7pm Children’s Programs. 7.30 Spicks And Specks. 8.00 Doctor Who. 8.45 Whose Line Is It Anyway? 9.10 Rosehaven. 9.35 The IT Crowd. 10.00 Frontline.
6.30pm Bargain Hunt. (PG) 7.30 Pie In The Sky. (PG) 8.30 Inspector George Gently. (M) 10.30 The Bay. (M) 11.30 Brit Cops. (M)
6pm Big Bash League. Game 37. Perth Scorchers v Hobart Hurricanes. 7.00 Pawn Stars. 7.30 Highway Patrol. 8.00 Motorway Patrol. 8.30 Outback Opal Hunters. 9.30 Yukon Gold.
6pm Malcolm. (PG) 7.00 The Nanny. (PG) 7.30 MOVIE The Truman Show. (1998) (PG) Jim Carrey. 9.30 MOVIE Road Trip. (2000) (MA15+) Breckin Meyer. 11.30 The Nanny. (PG)
5.20pm Heartbeat. (PG) 6.30pm Antiques Roadshow. 7.30 New Tricks. (M) 8.40 MOVIE All The Money In The World. (2017) (MA15+) Christopher Plummer, Michelle Williams. 11.25 ER. (M)
6.30pm Bondi Rescue. (PG) 7.30 NCIS. A frozen corpse is delivered to a naval base. (M) 8.30 CSI: Crime Scene Investigation. (M) 10.25 CSI: Miami. (M)
6pm Friends. (PG) 6.30 Neighbours. (PG) 7.00 Friends. (PG) 8.00 The Big Bang Theory. (PG) 8.30 The Big Bang Theory. (M) 9.00 The Big Bang Theory. (PG) 9.30 Seinfeld. (PG) 10.00 Mom. (M)
7pm Children’s Programs. 7.30 Spicks And Specks. 8.00 Doctor Who. 8.45 David Stratton’s Stories Of Australian Cinema. 9.45 Restoration Australia.
6.30pm Bargain Hunt. (PG) 7.30 Frankie Drake Mysteries. (M) 8.30 Lewis. (M) 10.30 Jonathan Creek. (M) 11.40 Cop Squad. (M)
6pm Big Bash League. Game 38. Sydney Thunder v Sydney Sixers. 7.00 Pawn Stars. 7.30 The Simpsons. 8.30 Family Guy. 9.30 American Dad! 10.00 American Dad!
6pm Malcolm. (PG) 7.00 The Nanny. (PG) 7.30 Paranormal Caught On Camera. (M) 8.30 MOVIE Kill Bill: Vol. 2. (2004) (MA15+) 11.15 Japandemonium. (M) 11.45 The Nanny. (PG)
5.20pm Heartbeat. (PG) 6.30pm Antiques Roadshow. 7.30 As Time Goes By. (PG) 8.50 Midsomer Murders. (M) 10.50 Silent Witness. (MA15+)
6.30pm Bondi Rescue. (PG) 7.30 NCIS. Lee tries to free her kidnapped daughter. (M) 8.30 NCIS: Los Angeles. (M) 10.20 NCIS. (M)
6pm Friends. (PG) 6.30 Neighbours. (PG) 7.00 Friends. (PG) 8.00 The Big Bang Theory. (PG) 9.30 Seinfeld. (PG) 10.00 2 Broke Girls. (M)
7pm Children’s Programs. 7.30 Spicks And Specks. 8.00 Doctor Who. 8.45 Would I Lie To You? 9.15 Penn & Teller: Fool Us. 10.00 Hard Quiz. 10.30 You Can’t Ask That.
6.30pm Bargain Hunt. (PG) 7.30 Father Brown. (M) 8.30 Murdoch Mysteries. (MA15+) 9.30 Murdoch Mysteries. (M) 11.30 Andrew Denton’s Interview. (PG)
6pm Big Bash League. Game 39. Brisbane Heat v Melbourne Renegades. 7.00 Pawn Stars. (PG) 8.30 MOVIE V For Vendetta. (2005) (MA15+) 11.10 Family Guy. 12am Swamp People.
6pm Malcolm. (PG) 7.00 The Nanny. (PG) 7.30 MOVIE Jaws 2. (1978) (M) Roy Scheider. 9.55 MOVIE The Replacement Killers. (1998) (MA15+) Yun-Fat Chow. 11.40 The Nanny. (PG)
5.20pm Heartbeat. (PG) 6.30pm Antiques Roadshow. 7.30 Poirot. (PG) 9.30 The First 48. (M) 10.30 The Disappearance. (M) 11.30 Westside. (MA15+)
6.30pm Bondi Rescue. (PG) 7.30 NCIS. The team investigates the death of a petty officer in a car crash. (M) 8.30 Hawaii Five-0. (M) 9.30 L.A.’s Finest. 10.30 NCIS: Los Angeles. (M) 11.30 NCIS. (M)
(CH22)
SURF REPORT
with MWP’s man in the water
Well, this time last year we were carefree and not fully appreciating how lucky we are living on the Sunshine Coast. Fast forward 12 months and how life has changed? Yep, shit got real with no end in sight. Our lives changed in a second. So, with this knowledge, how about lightening up and stop being cranky? You have won life’s gold lotto so pull your head in and be kind to all. You could one day be on the opposite side and a bit of kindness could help you get through it. Just surf and be cool. My Weekly Preview (“MWP”) is locally owned by Sunshine Coast Alliance Publishing Ltd ACN 124 476 142 and is published by 20/20 Publishing Pty Ltd ACN 131 089 793 (the “Publisher”). The contents of MWP are subject to copyright. Reproduction in whole or in part without the written permission of the Publisher is prohibited. The publication of editorial in MWP does not necessarily constitute endorsement of the views or opinions expressed by the Publisher. The Publisher does not accept responsibility for statements made by advertisers. All prices in MWP are correct as at the time of printing but are subject to change. Refusal to publish in print and or online The Publisher reserves the right to and may without prior notice refuse to publish; or cease to publish any advertising material in print and or online or inserted material within the publication without providing a reason. Please dispose of this magazine responsibly, by recycling after use.
6pm Friends. (PG) 6.30 Neighbours. (PG) 7.00 Friends. (PG) 8.00 The Big Bang Theory. (PG) 9.00 The Big Bang Theory. (M) 9.30 Seinfeld. (PG) 10.00 The Middle. (PG)
0801
THURSDAY
WEDNESDAY
TUESDAY
MONDAY
ABC CO
Switch your Home Care Package today. Home Care Assistance are changing the way we age through respect, compassion and real support. When you switch your Home Care Package to Home Care Assistance a highly qualified carer will be at your door to help you with whatever you need most. Call us to make the switch and get real help from a real person, 24 hours a day.
5491 6888
Kendall Morton Director
homecareassistancesunshinecoast.com.au myweeklypreview.com.au
71.indd 1
My Weekly Preview | January 7, 2021 71
4/01/2021 10:29:21 AM
Y L N READY O S K STOCKTAKE E E W 2 ALE S R A E Y NCE AALL PRODUCTS
O
Y L N O S K E E W 2 E L A S R A Y E L Y N A O E C S N 2O WEEK E L A S R A E CE A Y
ON
ALUMINIUM SHUTTERS
1/2 PRICE
½ PRICE* ½ PRICE* ½ PRICE* ½ PRICE*
PLANTATION SHUTTERS
BARCELONA SEMI CASSETTE* 3500x3000 = $3290 MOTORISED 4500x3000 = $3790 MOTORISED 5500x3000 = $4290 MOTORISED FOLDING ARM AWNINGS
½ PRICE*
½ PRICE*
½ PRICE*
½ PRICE*
½ PRICE*
½ PRICE*
½ PRICE* ½ PRICE*
ROLLER BLINDS
½ PRICE*
½ PRICE* ½ PRICE*
*
½ PRICE call 1300 303 391 for a complimentary measure & quote
Servicing the Sunshine Coast * and Hinterland
½ PRICE ½ PRICE*
ALL VENETIANS
½ PRICE* U ZIP STRAIGHT DROP
ALL FABRIC AWNINGS
AUSTRALIAN OWNED & OPERATED
½ PRICE* ½ PRICE*
½ PRICE* CURTAINS
½ PRICE*
½ PRICE*
½ PRICE* ½ PRICE*
½ PRICE* www.ublinds.com.au ½ PRICE*
OUR SALES/INSTALLERS FOLLOW HYGIENIC & DISTANCE PRACTICES OUR SALES/INSTALLERS FOLLOW
*Conditions apply, selected materials and fabrics. Offer ends 31/10/20 or while stocks last. Electrician and Installation not included. HYGIENIC & DISTANCE PRACTICES * Conditions apply, selected materials and fabrics. Off er ends 15/01/21 or while stocks last. Electrician and Installation not included.
72.indd 1
SALE
23/12/2020 9:35:47 AM
Published on Jan 5, 2021
My Weekly Preview is a high-quality magazine delivering more of what matters to the Sunshine Coast. It features news, business, regular colu...
Published on Jan 5, 2021
My Weekly Preview is a high-quality magazine delivering more of what matters to the Sunshine Coast. It features news, business, regular colu...