Sail Nauticus Academy & Carnival Sunshine launch student-built miniboat for ocean tracking
PressRelease
NORFOLK, Va A powerful partnership betweenSailNauticusAcademyandCarnival CruiseLinesetsail—literally—whenCarnival
Sunshine relaunched a student-built miniboat, igniting a new chapter in a hands-on STEMlearningjourneyforNorfolkyouth.
The custom-built miniboat, equipped with GPS tracking and weather sensors, was designed by students in the Sail Nauticus Academy—a year-round afterschool program that empowers Norfolk Public Schoolstudentsthroughsailingandmaritime exploration.PartoftheinternationalEducational Passages network the vessel will drift across oceans collecting real-time data and fostering global connections between young explorersworldwide
“This relaunch represents more than just a boat in the water—it’s a symbol of opportunity, curiosity, and what happens when education and industry unite,” said Nate Sandel,directorofeducationandcommunity engagement at Nauticus. “We are incredibly grateful to Carnival Cruise Line for helping extendourstudents’learningjourneybeyond thehorizon.
To celebrate the launch, Sail Nauticus Academy students boarded the Carnival Sunshine during its September 20 call to Norfolk. Students received a behind-thescenes tour of the cruise ship and met with the ship’s Captain, where they presented a specialthank-yougiftasatokenofappreciationforCarnival’spartnership
The miniboat’s progress can be tracked in real time at www.educationalpassages.org/ boats/foreversea, where students and the public alike can follow its journey across the Atlantic.Thishands-oninitiativebuildsconfidence, sharpens STEM skills, and connects Norfolk students with a global community ofoceanexplorers
About Nauticus: Nauticus is a maritime discovery center located along the waterfront in downtown, Norfolk, VA, offering a unique form of experiential learning for all ages Through interactive exhibits and STEM to STERN programming, Nauticus usesthemuseum,BattleshipWisconsin,sailing center, and Schooner Virginia to tell the story of the maritime environment, industry and the military The Nauticus Foundationisthenonprofit,501©3thatsupportsthe mission and activities of Nauticus Nauticus’ missionistobenefitthecommunitythrough education, impactful experiences, and sharing access to maritime resources For more information,visitwww.nauticus.org About Sail Nauticus: Support for Sail
NauticusdirectlybenefitstheNauticusFoundation,a501(c)3nonprofit.Fundingprovides a life-changing experience for underserved youth in our local community Our mission is to inspire, instruct, and impact Hampton
Roads kids through the use of sailing and maritimesciences For more information, visit https://nauticus.org/sail-nauticus/youth-programs/ sail-nauticus-academy/
PressRelease
VIRGINIA BEACH, Va The Virginia Aquarium & Marine Science Center Foundation’s largest fundraiser of the year and annual online auction, Ocean Commotion, is open for bids now through October 4. On the last night of the auction, the Aquarium will host an unforgettable private invite onlyfundraisingeventwithspecialrefreshments and entertainment Presented by CapitalGroup,thefundraiser’sproceedswill supporttheAquarium’sconservationinitiatives,researchwork,animalcare,education programs, and the Aquarium’s nationally recognizedStrandingResponseProgram
The Ocean Commotion auction presents an impressive breadth of exciting opportunities Aquarium experiences, and one-ofa-kind items Most notable experiences include diving with the sharks, observing a rayphysical,watchingasealpaintart,lowerlevelNFLtickets,triptoFinland,andmore. Among the auction items there will also be animalpaintings,abeachcruiser,andmore
“Whether through youth education programsorsupportinglocalspecies;when youparticipateinOceanCommotion,you’re ultimately putting those funds back into the community,” said Aquarium president and CEO, Cynthia Whitbred-Spanoulis Making a bid means supporting science education,seaturtlerehabilitation,research, andconservationprogramsforanimalslike osprey, sharks, sea turtles, corals, and so muchmore.”
Ocean Commotion is presented by title sponsorCapitalGroupandauctionsponsor CheckeredFlagMotorCo AdditionalsponsorsincludeBob&LeslieFort,TowneBank, andVirginiaNaturalGas.
Sponsorshipsarestillavailablestartingat
$1,000andincludesfourticketstotheOcean Commotion private fundraiser event. The Ocean Commotion evening event from 6 p.m. to 9 p.m. is themed “Owls Creek After Dark”andwillbeintheAquarium’soutdoor amphitheater The event will include valet parking cocktails a delicious sustainable seafood watershed menu, photobooth, and entertainment including music by Vinyl Headlights and stargazing with Virginia
SpaceFlightAcademy. For more information about Ocean Commotion and how to make a gift to the Foundation, visit VirginiaAquarium.com Donationsarealsoacceptedinpersonorby mail and can be addressed to the Virginia AquariumFoundationat717GeneralBooth Blvd.,Suite10,VirginiaBeach,VA23451.
About Virginia Aquarium & Marine Science Center: The Virginia Aquarium & Marine Science Center’s mission is to connectpeopletothemarineenvironment, inspiring a more sustainable future The Aquarium aspires to be a driver in conser-
vation, education tourism, and sustainability, leading the charge to save wildlife and their ecosystems Owned by the City of Virginia Beach, the Aquarium operates as a city department in partnership with the VirginiaAquarium&MarineScienceCenter Foundation. The Aquarium is proud to be anaccreditedmemberoftheAssociationof Zoos and Aquariums, and the World AssociationofZoosandAquariums TheVirginiaAquarium&MarineScience Center Foundation is a 501(c)(3) nonprofit organization that supports the work of the Virginia Aquarium. The Foundation
procures and maintains the Aquarium’s exhibits, including the animals and habitats It is also responsible for annual and capital fundraising, administration and funding for the Virginia Aquarium Stranding Response Program, conservation and scientific research efforts, and the
You
Choose fresh cherries for healthy and sweet back-to-school snacking
ByFamilyFeatures
Source: Northwest Cherry Growers
This year provided a long sweet cherry season, which means fresh sweet cherries will be available in produce aisles during the back-to-school season. Cherries, which are a superfruit packed with nutrients and antioxidants, areperfectforlunchboxes,after-schoolsnackingandgraband-gomunchinginthecaronthewaytoandfromactivities.
Sweet cherries’ high antioxidant content, beneficial effects on inflammation and natural ability to improve sleep quality make them a must-add to your grocery list Even picky eaters can enjoy this nutritious snack. It’s a sweettreatthatwon’tspikesugarlevels providingsteady nutrition as cherries boast a lower glycemic index than almostanyotherfruit.
Sweet cherries are also loaded with vitamin C to help boost immune systems and keep skin glowing Studies have found sweet cherries are packed with serotonin, which is an important neurotransmitter that plays a role inmanagingstressandstabilizingmood.Cherriesarealso a great source of fiber adding to their benefits during the back-to-schoolseason.
Cherries are not only a healthy snack; they are also convenient Foryoungerkids,cherriescanbeeasilypitted foreasyandsafesnacking Ifyoudon’thaveacherrypitter, cherriescanbepittedwithaknifeorkidscantryremoving thestemandgentlypushingastraworchopstickthrough the middle of the cherry until the pit pops out. For older kids, cherries only need to be rinsed before adding them toalunchbox.Cherriesalsoeasilykeepforhourswithout beingrefrigerated.
In addition to school lunches and snacking cherries can also be added to many breakfast foods like pancakes, granola,yogurt,smoothiesortheseCherryOvernightOats
Give your family a jumpstart on the day with a healthy cherrybreakfastfeaturingsweetcherriestodelivernutritional benefits, a natural sweetness and bright color that issuretodelight.
The benefits of this wholesome fruit can be accessed anytimebydrying,canningandfreezingcherriesattheir peak ripeness to preserve their goodness for year-round enjoyment.
More recipes, from breakfasts and entrees to desserts anddrinks,canbefoundatnwcherries.com/recipe.
CherryOvernightOats
Recipe courtesy of Northwest Cherry Growers
2cupsrolledoats
4tablespoonschiaseeds
1½cupsmilk
2teaspoonspurealmondextract
4tablespoonspuremaplesyrup
½cupNorthwestCherries,roughlychopped,plus additionalforserving(optional)
Greekyogurt(optional)
slicedalmonds(optional)
Inmixingbowl,stiroatsandchiaseedstocombine
Add milk, almond extract and maple syrup. Stir to combineuntiluniformlymixed.
Using¼cupmeasuringcup,divideoatsmixtureamong four small jars, adding layer of cherries between scoops Topwithremainingcherries Sealjarsandtransfertorefrigeratorovernight,oratleast 6hours,beforeserving ServeontheirownortopwithGreekyogurt,additional driedcherriesandslicedalmonds,ifdesired.
Add real flavor and simplicity to ‘busy season’ meals
ByFamilyFeatures
Source: Real California Milk
Make a smooth shift into the fall busy season with this LoadedPhillyCheesesteakBakedPotato Ittakesatraditionalsidedishanddeliversaneasymealfullofflavorand nutrientsfromCaliforniadairyfoods
Whenlifeisbusy,addthisdishbothkidsandadultswill lovetoyourweeklymeal-planninglist.TherealCalifornia sour cream, milk, butter and cheese offer real flavor, real protein,realsimplicityandrealconvenience,plustheyare madewithsustainablysourcedmilkfromdairyfarmfamilies LookfortheRealCaliforniaMilksealonyourfavorite dairyfoodsatthegrocerystore. Findmorerecipesatrealcaliforniamilk.com/recipes
LoadedPhillyCheesesteakBakedPotato
Recipe courtesy of Real California Milk
Prep time: 10 minutes | Cook time: 1 hour, 11 minutes
Servings: 4
4largerussetpotatoes,washed 1cupRealCaliforniasourcream
1-2tablespoonsRealCaliforniawholemilk
¼cupRealCaliforniaunsaltedbutter divided
1smallgreenbellpepper,thinlysliced
½smallyellowonion,thinlysliced
koshersalt,totaste
freshlygroundblackpepper,totaste
1poundfreshshavedsirloinsteak
2cupsshreddedRealCaliforniaprovolonecheese
Preheatovento425Fandlinebakingsheetwithaluminumfoil.
Prickpotatoesalloverwithfork.Bakeuntilpotatoesare tender and fork inserted easily comes out, 45 minutes-1 hour Splittopsofpotatoesopenwithknifeandfluffpotato fleshwithfork.Setaside In small bowl, combine sour cream and milk, adding more milk as needed, until sour cream is pourable. Set aside In large skillet or on griddle over medium-high heat, heat 1 tablespoon butter Add peppers and onions; cook until tender 3-4 minutes. Season with salt and pepper, to taste Transfertoplateandsetaside Cleanskilletthenmeltremainingbutter Addsteakand cookuntilfullycookedandlightlybrowned,3-4minutes. Seasonwithsaltandpepper,totaste Returnvegetablesto skilletandtosstocombine
Evenly top each potato with 1 tablespoon butter, steak mixtureandcheese Transfertoovenandbakeuntilcheese ismelted,2-3minutes Drizzlewithsourcreamandserve
3 ways to minimize back-to-school meal prep stress
ByFamilyFeatures
Source: Borden
Back-to-schooloftenmeansafew“ugh”momentsfor parents From early wakeup calls and forgotten lunchboxes to extracurricular chaos, meltdowns at homework time and picky dinner eaters, easy solutions in the kitchen can help lighten the to-do list. Turn those groan-worthy moments into “no big deal”
with Borden cheese - a versatile protein that adds both flavor and fun to your meals Whether it’s shredded, sliced or in snack form, cheese provides simple ways to helpkeepmealprepstresstoaminimumonschooldays Pack Lunches the Night Before: Preparing sandwiches salads or wraps in advance can streamline your morningroutineandensureyourfamilymembershavea nutritiousmealreadytotaketoschoolorwork.Aturkey and cheddar sandwich will hold up well in the fridge overnight. Add grab-and-go options like string cheese, fruit or whole-grain crackers to go with their favorite sandwiches to create a balanced and satisfying lunch. Cheese sticks also fit perfectly in a pencil slot in backpacks to combat hangry kids after school. Rely on One-Pot Dishes at Dinnertime: One-dish dinnerscanbealifesaverwhentryingtobalancepacked schedules and get everyone to and from their activities With easy prep and only a single pot or pan to clean up, you can cut down on the time spent in the kitchen and enjoy more moments with your family Delicious and satisfying one-dish recipes, like Skillet Chili Mac, elevateafamilyfavoritebyaddingBordencheese.Made with real milk from American dairy farmers, it provides wholesomegoodnessyoucanfeelconfidentservingyour family
Embrace‘BatchandFreeze’Cooking: Insteadofpreppingafullweek’sworthofmeals focusoncookinglarge batches of a few key components For example, cheese serves as a delicious protein in baked dishes that freeze and reheat well for busy weeknights such as lasagna or macaroni and cheese. Or freeze individual servings of
homemadeburritosorquesadillasfilledwithcheeseand other family-favorite ingredients
Find more tips and recipes to save time during the school year at bordencheese.com
SkilletChiliMac Cook time: 15 minutes | Servings: 10
1poundgroundbeef
1cupchoppedonion
1can(14ounces)crushedtomatoes
1tablespoonchilipowder
1teaspooncumin
½teaspoonsalt
2cupselbowmacaroni(8ounces),cookedand drained
1package(2cups)BordenCheeseThickCutFour CheeseMexicanShreds,divided
1package(2cups)BordenCheeseSharpCheddar Shreds,divided
2greenonions,thinlysliced
2tablespoonschoppedcilantro
Inlargeskilletovermediumheat,cookgroundbeefand onion5-7minutes,oruntilmeatisbrowned,stirringoccasionally Drainfat,ifnecessary Stir in tomatoes chili powder cumin and salt Stir in cookedmacaroni;reduceheattomedium-low. Top with cheeses, saving some for topping; cover and cook until cheese is melted. Remove from heat; top with green onions and cilantro. Add final layer of reserved cheesesontop
SKILLET CHILLI MAC
ByTRICARECommunications
FALLSCHURCH,Va
Note:Ifyou,your child,orsomeoneyouknowisstrugglingor incrisis,helpisavailable Callortext988or chat988lifeline.org Thisresourceconnects you with trained counselors who can help yougetthehelpyouneed,24/7.
Childhood and teen years can be full of upsanddowns It’snormalforkidstobesad or irritable or to have trouble paying attention or interacting with others at times But sometimes, these feelings and behaviors are signs that your child could need mental healthcare.
“Your child’s mental health affects all aspectsoftheirphysicalhealthanddevelopment, said Thomas Turnbaugh, LCSW-C, abehavioralhealthspecialistattheDefense Health Agency “By knowing the signs of mentalhealthproblemsinchildrenandhow togethelp,youcanhelpyourchildthrive.”
As a parent or caregiver, you play a criticalroleinrecognizingwhenyourchildmay be struggling If your child needs help, you andyourfamilymembersaren’talone.Keep readingtolearnhowTRICAREcansupport your child’s mental health and find tips and resources for supporting your child’s well-being
Signs of mental health challenges
Children can develop a variety of mental healthconditions AccordingtotheCenters forDiseaseControlandPrevention:
Common mental health conditions that can be diagnosed in childhood are anxiety disorders, depressive disorders, and behaviordisorders
Symptomsforsomeconditionscanstartin earlychildhood.Symptomsforotherconditions may start later in childhood or during theteenageyears
Signsofpossiblementalhealthproblems inkidsandteenscanvary Theycanbemild andbrieformoreseriousandpersistent So, it’simportanttoknowwhattolookoutfor
According to the National Institute of MentalHealth,youngerkidsmayneedhelp ifthey:
Have frequent tantrums or are intensely irritablemuchofthetime
Oftenseemfearfulorworried
Areinconstantmotionandcan’tsitquietly (except when they’re watching videos or playingvideogames)
Sleeptoomuchortoolittle havefrequent nightmares orseemsleepyduringtheday
Aren’t interested in playing with other kidsorhavedifficultymakingfriends
Struggle in school or have experienced a recentdeclineingrades
Olderkidsandteensmayneedhelpifthey:
Havelowenergy,orsleeptoomuchortoo little
Have periods of highly elevated energy andactivity
Spend more and more time alone and avoidsocialactivities
Say that they think someone is trying to control their mind or that they hear things thatotherpeoplecan’thear
Diet or exercise excessively or fear gainingweight
Smoke,drink,orusedrugs
Engage in risky or destructive behavior aloneorwithfriends
Engage in self-harm behaviors (such as cuttingorburningtheirskin)
Havethoughtsofsuicide
If your child’s behavior is unsafe, or if yourchildtalksaboutwantingtohurtthemselves or others, get help immediately If yourchildisstrugglingorhavingthoughtsof suicide call or text the 988 Suicide & Crisis
Lifeline at 988 or chat at 988lifeline.org. In life-threateningsituations,call911.
Howtogetmentalhealthcare
Whocanyouturntoifyourchildisstruggling? The NIMH recommends contacting a health care professional if your child’s behavioral signs and symptoms last weeks or months and they interfere with your child’s daily life at home and at school or withfriends
Your child’s primary care manager or primary care provider may be a good place tostart.Youcantalktotheirproviderabout your concerns, ask questions, and request a mental health screening. The NIMH has tips for talking to a provider about mental healthonlineatwww.nimh.nih.gov/health/ publications/tips-for-talking-with-yourhealth-care-provider The provider may recommend that your child see a mental healthprofessional. Your child doesn’t need a referral or pre-authorization for most outpatient mental health care They may be able to get mental health care through one or more of theseoptions: Military hospitals and clinics: Some military hospitals and clinics offer mental healthservicesforkidsandteens. TRICAREnetworkproviders:Youcan make an appointment with a TRICARE network mental health provider no matter whathealthplanyourchildhas Ifyouneed helpfindingaprovider,youcanusetheFind a Doctor tool (online at www.tricare.mil/
finddoctor) or call your TRICARE regional contractor
Virtual health: Your child may also be able to speak with a mental health professional by audio or video in the comfort of your home Your military hospital or clinic may offer virtual mental health services
Additionally yourregionalcontractorhasa networkofvirtualhealthproviders
Note: Your child may also be able to get mental health care from a TRICARE-authorized non-network provider Be sure to follow your plan’s rules for getting care from non-network providers Learn more about how to get mental health care with yourplan.
Other ways to support your child’s well-being
There’smoretoyourchild’smentalhealth than whether they have a mental health condition. It’s also about their well-being andabilitytothrive,saystheCDC.Andchildren can experience mental health challengeseveniftheydon’thaveamentalhealth condition. Here are other ways to support your child’swell-being: Talktoyourchild.Askhowthey’redoing and if there’s anything they want to talk about. Let your child know you care about themandwanttohelp Checkoutthesetips online for talking about mental health with your child at www.samhsa.gov/mentalhealth/what-is-mental-health/how-to-talk/ parents-and-caregivers Getnonmedicalsupport Yourchildmay be able to get free, confidential counseling throughMilitaryOneSourceortheMilitary and Family Life Counseling Program. Learn more about Military OneSource resources for kids and teens online at www.militaryonesource.mil/parenting/ children-youth-teens/. Remember that mental health is a vital part of your whole family’s health and well-being If you’re struggling with your mental health, don’t be afraid to seek help Learnmoreaboutgettingmentalhealthcare withTRICAREonlineathttps://newsroom. tricare.mil/News/TRICARE-News/Article/4200573/unlock-your-health-how-toget-mental-health-care-with-tricare. Would you like the latest TRICARE news sent to you by email? Visit TRICARE Subscriptions to get benefit updates,
Stop wasting time searching fortalent. Find the right talent with tribunepublishing recruitment services.
We work hardtomakeyour talent search easy. With our expansive network of distinguished print and online publications andtheir respectivereach andreadership you’ll have access to toptalent from coast-to-coast.
Plus, enjoyadvanced jobmatching and ad targeting technology,accessprint and digital advertising opportunities, careerfairs and more.
Extend your reach. Access customized technology. Simplify your search
