Page 1

3URXGO\VHUYLQJ%XIIDOR&HQWHU/DNRWD5DNH7KRPSVRQDQGWKH1RUWK,RZD&RPPXQLW\6FKRRO'LVWULFW

%XIIDOR

Volume One Hundred Twenty Two Number 39 12 Pages September 25, 2013



7 &HQWHU ULEXQH

+RPHRIWKHILUVWFRQVROLGDWHGVFKRROZHVWRIWKH0LVVLVVLSSL5LYHU

(QWHUHGDV3HULRGLFDOVLQWKHSRVWRIILFHDW %XIIDOR&HQWHU,RZD 8636

Little Bison names Homecoming Royalty

O’Connor and Hovland take Homecoming crowns

Lucas O’Connor and Krista Hovland took the titles of Homecoming King and Queen during the coronation ceremony held last Thursday, Sept. 19 at North Iowa High School. O’Connor is the son of Tim and Kim O’Connor of Buffalo Center, and Hovland is the daughter of Bruce and Vivian Hovland of Thompson. The couple presided over the 2013 Homecoming activities, which included the parade and football game on Friday and the Homecoming dance on Saturday.

Carter Koppen, left, and Bella Langfald were the Homecoming King and Queen this year for Little Bison Childcare Center. Carter is the son of Ross and Jessi Koppen of Buffalo Center, and Bella is the daughter of Josh Langfald and Sophia Rodriguez of Thompson.

more Homecoming on page 12

News Events

School supports new teacher as she braves battle with breast cancer North Iowa Community Schools held a “Pink Out� for their Homecoming dress up day last Tuesday, Sept. 17, in support of a teacher who is battling breast cancer. Mrs. Darrelleen Lewis, who joined North Iowa just this year as a new second grade teacher, was recently diagnosed with the disease, and Tuesday was her last day at school before going in for surgery on Wednesday. “In her short time at North Iowa, Mrs. Lewis has already built a strong

rapport with her students and our staff,� said North Iowa Supt. Cory Myer. “She has a strong personality, and I am confident she will fight and win this battle. We are truly blessed to have her at North Iowa, and it has been wonderful to see everyone rally around her in support. She has constantly been thinking about her students and how to best meet their needs while dealing with her own medical issues.� Myer says he received word from

Lewis’ family that her surgery went well, and she is now recovering at home. School staff members have been organizing meals to take to the family over the next few weeks. Lewis hopes to be back in the classroom after three weeks of recovery, and a retired North Iowa teacher, Mrs. Diane Jacobson, is filling in for her in the meantime. Lewis and her husband, Randy, live in Forest City with their two sons, JimBob and Gabriel.

TSB Bank opens new Titonka building Titonka Savings Bank and Boyken Insurance Agency in Titonka will open for their first day of business in a new building on Monday, Sept. 30. New banking hours are Monday thru Friday, 8 a.m. - 5 p.m. and Saturday, 9 a.m. to 12 p.m. The old bank building on Main Street was destroyed by a fire last April. The bank has been operating out of a temporary trailer on 2nd Ave. NW, while the insurance agency has been housed at the school. The new bank building is located at the same site as the former bank at 173 Main St. N.

Content Page 2 ...........................Local News Page 3 .................................. Society Page 4 .................................. Church Page 5 ......................Local/Obituary Page 6 ...........................Local News Page 7 ................. Legals/Classifieds Page 8 .............................Classifieds Page 9 .......................... Marketplace Page 10 ........................ Marketplace Page 11 ..................................Sports Page 12 .......................... Area News

Casey’s Grand Opening is Friday and Saturday

The brand new Casey’s General Store opened for business last Wednesday, Sept. 18 in Buffalo Center. The spacious new store features an expanded food and drink menu, including softserve ice cream, slushies and sub sandwiches, along with tables for customers to enjoy their meals. Store manager Darcy Roeder says the ice cream was a highlight of opening day, and customers are enjoying the new lunch options. Manning the checkout on Wednesday were Roeder, left, and Jill Lampman. The store has added about 12 new employees to staff the new location. Casey’s will hold a grand opening at the store this Friday and Saturday from 10 a.m. to 6 p.m. each day, featuring special promotions and taste testing of the new items. There will also be a ribbon cutting ceremony on Friday at 1 p.m. Store hours remain the same, as Casey’s will be open daily from 5 a.m. to 11 p.m.

Mrs. Lewis’ second graders found something pink to wear during the “Pink Out� held in her honor last Tuesday, Sept. 17 at North Iowa. Front from left are: Lisa Heyer, Eleanor Smith, Sophia Hagen, Jeffery Gerber, Mia Kothenbeutel and Anthony Eisele. Back row: Charlie Schaefer, Mrs. Darrelleen Lewis, Keegan Roberts, Kaden Holt, Jason Peterson, K’lyn Sahl, Hesveldi Lopez, Max Burkhow, Kaiden McGrady, David Whitney.

Dino’s Place is now Road Runners Bar & Grill Lakota’s one-and-only restaurant has a new name and new owners. Donna and Greg Heidecker of Lakota have taken over Dino’s Place from Doug and Sally Price – renaming the restaurant Road Runners Bar & Grill. The establishment reopened last Wednesday, Sept. 18, after being closed for a couple of weeks for remodeling. Donna says this is their first time owning and managing a restaurant, but she has been working at the restaurant as a bartender since the

Prices took it over last year. “I enjoy it. I have a good time when I’m up here,� said Donna. Several other staff members are staying on, which should make for an easy transition, and the former owners have also been a big help. “Doug and Sally have been great about coming in and helping when I can’t figure out what’s what,� said Donna. Donna says her husband is happy to let her be the one in charge, but he’s behind her 100%. Lakota is Greg’s hometown, and they’ve made

some changes to the restaurant to make it more like it was back in the 70’s and 80’s when he was growing up. This includes opening up the front of the building with windows. “Wednesday, when we opened up, people were like, ‘I remember this and this,’� said Donna. “It’s fun listening to people reminisce about the way it used to be.� There have been some changes to the menu, and people are invited to stop in and see what’s new. Daily specials include taco bar night on

Tuesdays, chicken on Thursdays and Italian on Fridays. Happy Hour is 4-7 p.m., Monday through Friday. The Heideckers are still in the process of decorating the restaurant, and they are asking for memorabilia from servicemen from Lakota and Germania. Photos will be copied and posted on a wall to honor local servicemen, and original photos will be returned. Donna and Greg are planning a grand opening for sometime this fall, after field work is complete.

Greg and Donna Heidecker are the new owners of the renamed Road Runners Bar & Grill in Lakota.


LOCAL

10 Years Ago Tribune Files of Thursday, Sept. 25, 2003 The 2003 Homecoming King and Queen were crowned Thursday evening, September 18 during Fun Night activities in the North Iowa High School gymnasium. The North Iowa Royalty crowned was King Matt Gary and Queen Kayla Arnevik. Matt is the son of Larry and Kim Gray while Kayla’s parents are Dan and Lonnie Arnevik of rural Thompson. Grand Marshals of the 2003 Homecoming parade at the North Iowa Community Schools were Joe

Letters to the Editor Over the years I have had many people ask me what I would like to see done on the immigration issue. 1 - Enforce our immigration laws. They haven’t been enforced for the last 25 years or more. 2 - Secure our borders. 3 - Stop illegal immigration. Remember, illegal aliens come from every country on the planet. All illegal aliens should be deported. Tell them they have 60 days to leave on their own or we will round them up and send them back home at their expense. This would be the cheapest in the long run. The government says there’s 11 million, but they’ve been saying that for about 12 years. According to Barron’s Financial magazine, it is 20-25 million. It would free up about 8 million jobs. We don’t need these law breakers. If we took away all the freebies they get, most of them would self deport! 4 - From 1928-1965 we let in about 178,000 legal immigrants per year. Now it is up to over 1 million per year. We don’t need all these people, and our resources are finite. 5 - Let’s not import poverty. Let’s let in people who have the talents to make the U.S. a better country, not people who drag us down. Limit immigrants to 200,000 per year. I have worked on this issue since 1994 and have had the same goals since then! Paul Westrum Albert Lea, MN

Butterflies in the winter As the days get shorter, and the autumnal chill sets in, we see many changes taking place. Squirrels begin gathering nuts and storing them away, birds head south to warmer climes, and the leaves turn magnificent colors. Most of us are also aware that, like many birds, Monarch butterflies head south to Mexico to spend the winter. But, do you know where the rest of the butterflies go? Surprisingly enough, most of them stay right around here! Of course, butterflies, like all insects, are ectotherms, or coldblooded. That means that their body temperature changes with the environment; so, when it’s cold outside, their body temperature plunges. That’s not good if they live in an area that routinely falls below freezing because, if the liquid in cells freezes, the cells will break and die; then the animal dies, as well. So, cold-blooded animals cannot stay active during the winter months around here. They either have to migrate out of the area or find a place to hibernate. Monarch butterflies, of course, migrate long distances and spend their winters in Mexico. Other butterflies also migrate, but not nearly so far. Painted lady butterflies will migrate to the Gulf Coast, and other butterflies, such as red admirals, sulphurs, skippers, and question marks, will also migrate. Most only migrate far enough south to escape winter’s freezing temperatures, which doesn’t always mean traveling very far. But, most butterflies, like most other insects, hibernate in one form or another. Butterflies go through four phases in their life cycle—egg, larva (caterpillar), pupa (chrysalis), and adult. And, depending upon the species, most butterflies hibernate in

one of these stages. Very few butterflies overwinter as eggs, although some species lay their eggs in the fall in a sheltered location; then the adults die, leaving the eggs to hatch out in the spring. Many species, though, will overwinter as hibernating caterpillars. These include checkerspots and viceroys, as well as the well-known “wooly bear� caterpillars that are so common in the fall months. (Actually, “wooly bears� don’t turn into butterflies at all, but instead become Isabella tiger moths.) Most of these caterpillars burrow into the ground, bury themselves under leaf litter, or seal themselves up in leaves by spinning silk. However they do it, they are well-protected and usually stay safe throughout the winter. Yet other butterflies form a chrysalis in the fall and remain there until spring. Hairstreaks will do this, but swallowtails are probably best known for overwintering in the pupal stage. Swallowtail caterpillars are actually quite large. But, in the fall, they find a spot to pupate, attach themselves there, shrink up considerably, and then turn into a chrysalis. They remain in that state all winter long, emerging in the spring just as flowers are beginning to bloom on trees. Finally, some butterflies actually hibernate as adults. Commas and question marks do this, as do mourning cloaks and some red admirals. In fact, that’s why you will often see some of these butterflies flying around on the first warm day in March; they have been hibernating as adults all winter, just waiting for the weather to warm up. When spring arrives, they don’t have to complete their metamorphosis, they are already fully grown! Of course,

we don’t see them during the winter months because they hibernate in sheltered areas such as under tree bark, in rock crevices, or under decks. It’s hard to believe when you look out at a January blizzard but, somewhere out there, there are butterflies hunkered down and hibernating! No matter what life stage they hibernate in, all butterflies need to stay sheltered to fight off the harsh winter weather. But, many of them also have another way of surviving winter. They convert glycogen in their bodies to glycerol which prevents cells from freezing and rupturing when the temps drop below 32 degrees. In other words, many butterflies are able to keep from freezing in the winter by producing their own antifreeze! So, when you see butterflies flying around this fall, you’re watching them get ready for the winter months ahead. And, when winter arrives, and the snow, wind, and cold temps dominate the forecast, remember that not all butterflies migrate south. Somewhere out there are butterfly eggs, caterpillars, chrysalises, and butterflies all sleeping away the winter, ready to emerge in the spring to grace us with their beauty!

+DQFRFN&RXQW\+HDOWK6\VWHP¡V

)OX&OLQLF6FKHGXOH

'DWH 7KXUVGD\6HSW  6DWXUGD\6HSW 0RQGD\6HSW  7XHVGD\2FW :HGQHVGD\2FW 7KXUVGD\2FW  6DWXUGD\2FW 0RQGD\2FW  7XHVGD\2FW  :HGQHVGD\2FW )ULGD\2FW 

7LPH WRDP WRSP WRDP WRDP WRSP DPWRSP WRDP WRDP WRSP WRDP WRDP WRDP WRDP WRSP WRSP WRDP WRSP

/RFDWLRQ *DUQHU0HGLFDO&OLQLF %ULWW0HGLFDO&OLQLF *DUQHU0HGLFDO&OLQLF *DUQHU0HGLFDO&OLQLF %ULWW0HGLFDO&OLQLF 6W-RKQ¡V&KXUFK&RUZLWK /LEUDU\.OHPPH *DUQHU0HGLFDO&OLQLF %ULWW0HGLFDO&OLQLF %ULWW0HGLFDO&OLQLF 6U&LWL]HQ&WU&U\VWDO/DNH 6U&LWL]HQ&WU:RGHQ %ULWW0HGLFDO&OLQLF *DUQHU0HGLFDO&OLQLF .DQDZKD0HGLFDO&OLQLF %ULWW0HGLFDO&OLQLF *DUQHU0HGLFDO&OLQLF

)OXVKRWVDUH0HGLFDUHDQG :HOOPDUN3UHYHQWDWLYH6HUYLFHV FRYHUDJHZLOOEHĂ€OHG3OHDVHEULQJ \RXU0HGLFDUHRULQVXUDQFHFDUG  )OXYDFFLQDWLRQDSSRLQWPHQWVFDQEHPDGHDWRQHRIWKH+&+6PHGLFDOFOLQLFV %ULWW  *DUQHU   .DQDZKD  DQG:HVOH\  

24

$ P lluus

99

MONTH

For 12 Months After Instant Savings

140 CHANNELS

OVER

ENTERTAINMENT Package

LOCK IN YOUR SAVINGS FOR 2 YEARS! SAVE $10/mo. for 24 months!

On Advanced Receiver Service (reg. $25/mo.) with Auto Bill Pay, valid email address and Paperless Billing with selection of a Genie HD DVR. ALL DIRECTV OFFERS REQUIRE

TH AGREEMENT.

NYMAN T V & FURNITURE 102 E. Ramsey Bancroft, IA

85-2422 515-8 Call your authorized DIRECTV dealer for details.

Offers end 10/2/13. New approved customers only (lease required). Other conditions apply. Š2013 DIRECTV.

%XIIDOR

7ULEXQH +A\>@CJPMN &HQWHU

/QP(TK CORO

ENQUGFPQQPRO

#FXGTVKUKPI #TVKENGUPGYU FGCFNKPG`(TK0QQP

7ULEXQH

Location: 124 N Main Street Mailing Address: PO Box 367, Buffalo Center, IA 50424 Telephone: 641-562-2606 Fax: 641-562-2636 Email: bctrib@wctatel.net Website: thebuffalocentertribune.com Office Hours: 8:30 a.m. to 4:30 p.m., Monday through Friday, except holidays Weekly Coverage in Buffalo Center and Surrounding Communities Founded 1892 We reserve the right to edit any and all copy presented to our news department. We reserve the right to reject any advertising, request pre-payment and cancel at any time. Contract rates available on request. Quantity discounts available. Newsroom News Editor: Andrew Shaw, 641562-2606, sports@wctatel.net, use this contact to offer story tips or send letters to the editor. People/Social News: Olivia Doden, 641-562-2606 or email bctrib@wctatel.net. Use this contact for engagements, anniversaries, weddings, new arrivals, achievers and other such items. Obituaries: Inquiries and billing information to bctrib@wctatel.net. Circulation & Subscriptions Deb Chaney, 1-800-558-1244, ext. 122 or email mapcirculation@ iowaconnect.com, subscriptions and rewnewals can take up to two weeks to process, and may cause lags in service if not planned ahead. Didn’t Get Your Paper? If you do not receive your paper in Wednesday’s mail, call the Buffalo Center Post Office 641-562-2343 or Buffalo Center Tribune at 641-5622606. Billing & Accounting Pam DeVries, 1-800-558-1244, ext. 119 or email pamdevries@iowaconnect.com. Classified Advertising: Call Olivia Doden, 641-562-2606 or email bctrib@wctatel.net. Paper or Internet Advertising Ryan Harvey, 515-689-1151, ryanharvey.map@gmail.com. Olivia Doden, 641-562-2606 or email bctrib@wctatel.net. Administration Publisher: Ryan Harvey, 515-6891151 or email ryanharveymap@gmail. com. Office Coordinator: Olivia Doden, 641-562-2606 or email bctrib@wctatel.net. News Tips The Buffalo Center Tribune welcomes any and all news tips. At the office, call 641-562-2606 or email sports@wctatel.net. To request a photographer, please give at least a day’s notice. Deadlines Legal Notices..............12 noon, Friday Classified Ads .............12 noon, Friday Display Ads ................12 noon, Friday Submitted News ........12 noon, Friday Obituaries ................10 a.m., Monday Breaking News ......... 9 a.m., Monday* Event coverage requests..........24 hours *This news may not be published in the current issue. Buffalo Center Tribune Staff Regular employees in order of continuous years of service: Andrew Shaw, Editor; Ryan Harvey, Publisher; Laurie McBride, Composition; Olivia Doden, Office Coordinator. OďŹƒcial newspaper for Winnebago County City of Buffalo Center City of Rake City of Thompson City of Lakota North Iowa School District Member of Iowa Newspaper Assn. National Newspaper Assn. A Division of Mid-America Publishing Corp. P.O. Box 29 Hampton IA 50441 Ryan L. Harvey, President and CEO Published weekly at 124 N Main Street, Buffalo Center, IA and Periodicals Postage paid at Buffalo Center, IA 50424. Postmaster: Send address changes to: Buffalo Center Tribune, PO Box 367, Buffalo Center, Iowa 50424 USPS #069-400

Ć%XIIDOR&HQWHU7ULEXQHĆ%XIIDOR&HQWHU7ULEXQH

Ć%XIIDOR&HQWHU7ULEXQHĆ%XIIDOR&HQWHU7ULEXQH

:DONLQV:HOFRPH

Package offers starting at

and Pam Angstman. The Angstmans have retired after each acquiring thirty-plus years of teaching experience in the local school system. Winnebago County was represented well at the Clay County Dog Show in Spencer on Wednesday, September 10. Jenny Wiedemeier earned the District Dog Obedience Champion trophy with her dog “Kodiâ€?, a Golden Retriever, with a score of 154.5 points out of a possible 160. 20 Years Ago Tribune Files of Thursday, Sept. 23, 1993 Jennifer Gerzema, a member of the Bison FFA Chapter, has been selected as a national finalist in the National FFA award program. Work was underway at the BCRL Elementary School playground recently where the BCRL Space Pod was added for the elementary children to enjoy. Much of the funding had come from the children and the elementary staff. Installation of the natural gas lines and mains in Buffalo Center is continuing at a rapid pace. As of Monday, September 20, the majority of residential and business gas hookups have been completed. 30 Years Ago Tribune Files of Thursday, Sept. 22, 1983 Mr. and Mrs. Raymond Smith, Jr. are the happy parents of a baby daughter, Amanda Kathleen, born on September 14, at the Methodist Hospital in Rochester, MN. A Square Dance Fun Night will be held Thursday at the Rake gymnasium. There will be no admission charge for the event. It is sponsored by the Rake Rocking R’s Square Dance Club. It is being held to introduce interested person to square dancing. Gene Lackore of Garner will be the caller. Bill and Delores Hansen will hold an open house at their Buffalo Center Hardware Store Friday and Saturday. The event will celebrate their opening of the business. Free coffee and cookies will be served on Friday. Saturday, free ham sandwiches, baked beans, potato chips and coffee will be served. 40 Years Ago Tribune Files of Thursday, Sept. 27, 1973 Three girls vie for the Homecoming Queen Crown. They are all seniors: Jane Land, Joan Berschman, and Kay Kiewiet. Escorts for queen candidates are Kevin Helin, Steve Dudding, and Bruce Venteicher. Gary Fisk will escort last year’s queen, Kathy Eastvold, who is expected to be here to crown her successor. “Britt will challenge Bison Homecoming Friday night,â€? said Coach Alan Jones. Shop our Bumper Crop of Food Values --Fresh fryers, 59¢ lb., Snoboy lettuce, 2 for 49¢. Tokay Grapes, 35¢ lb. --Dell-Ray’s Superette -- Andy Larson, Owner. 50 Years Ago Tribune Files of Thursday, Sept. 26, 1963 Edward Hippen has completed almost two years of Army service. He received his separation papers on September 16 at Fort Hood, Texas. He plans to return to his chosen work, that being a farmer. Mr. and Mrs. Dennis Yegge of Buffalo Center are the parents of a son born at the Buffalo Center Hospital, September 23. He has been named Danny Mark. Special on evergreen plantings reduced to half price this week. -Hall’s Flower’s at Buffalo Center.

&HQWHU

Ć%XIIDOR&HQWHU7ULEXQHĆ%XIIDOR&HQWHU7ULEXQH

:D\EDFNZKHQ

%XIIDOR

Ć%XIIDOR&HQWHU7ULEXQHĆ%XIIDOR&HQWHU7ULEXQH

PAGE 2 — Buffalo Center (Iowa) Tribune— Wednesday, September 25, 2013


SOCIETY

Buffalo Center (Iowa) Tribune — Wednesday, September 25, 2013 — PAGE 3

Horak to appear in Waldorf play Alex Horak of Buffalo Center, will appear in the classic comedy Arsenic and Old Lace at Waldorf College in Forest City. The show runs Wednesday, Oct. 2 through Saturday, Oct. 5 in the Smith Theatre. Show time starts at 7:30 p.m. Horak is a senior and the son of David and Annie Horak. He will play the role of Mortimer Brewster. “Arsenic and Old Lace is an American favorite. It’s a bit like the Addams Family 20 years before there was an Addams Family,� said the play’s director and Waldorf’s associate professor of theatre Dr. Robert AuFrance. “Over the years, I’ve had a lot of requests from people to present it.�

Cami Bradley gets feedback from the judges following a recent performance on America’s Got Talent. With her at left is the show’s host, Nick Cannon. (Photo courtesy NBC)

Bradley places sixth on AGT Cami Bradley came in sixth place on the season finale of America’s Got Talent last Wednesday, Sept. 18 on NBC. She is the daughter of Paul Miller and the granddaughter of Don and Carmen Miller, formerly of Buffalo Center. Bradley sang the Beatles’ “I Want to Hold Your Hand� as a member of the Top Six in the final night of com-

petition last Tuesday before being eliminated on Wednesday’s results show. The winner of the show was martial arts dancer Kenichi Ebina, who received the top prize of $1 million and his own show in Las Vegas. America’s Got Talent is a reality competition show, where the public calls in and votes online for their favorite acts.

Rake SHARE Iowa September Rake SHARE Iowa orders will be available for pick up on Saturday, Sept. 28 from 10-11:30 a.m. in the Rake City Hall. Those who are unable to pick up their order during that time are encouraged to

make arrangements for a friend or family member to pick up the package for them. For questions, or for more information, contact Rake SHARE Iowa volunteer, Illa Roth, at 566-3558.

North Iowa Communities List of Events October 6 Orphan Train Program, Heritage Museum, 2 p.m. October 9 Christian Women’s Club, First Reformed Church, 9:30 a.m. October 13 7th Annual Family Fall Festival, Winnebago Co. Fairgrounds, 2 4:30 p.m. October 19 Holiday Shopping Expo, HTC October 20 First Presbyterian Mission Festival with guests John and Connie Pedersen October 25 Senior Citizen Soup Supper, Freewill Donation, Bison Senior Center, 5-7 p.m. October 26 Adult Halloween Party, HTC October 27 Kids Halloween Party, HTC November 2 Lakota Fall Festival, Lakota Eagle Center Fall Bazaar, Ramsey Reformed Church of Titonka, 3 p.m. November 10 BC Historical Society Meeting, HTC, 4 p.m. Wounded Warrior Banquet, Eagle Center-Lakota, 5:30 p.m. November 12 Ladies Night Out, Downtown Buffalo Center Businesses, 5-7 p.m. November 14 Fall Luncheon, Bethlehem Lutheran Church, 11 - 1 p.m. November 16-17 Annual Bible Conference, Community Chapel December 7 Lakota Santa Claus Day, Lakota Fire Station, 1 p.m. December 8 BC Historical Society meeting, HTC, 4 p.m. Holiday Tour of Homes December 14 Buffalo Center Old Fashion Christmas, 9 a.m. to 1 p.m. Snow Date: December 15 Murra Hardware Christmas Open House, 9 a.m. to 1 p.m.

The ladies that came to Spa Day, front from left: Ardella Berndt, Irma Lockrem, and Bertha Irons. Back row: Mary Mathews and Pauline Westrum.

1HZVIURP

TMNH %\&DPPL$QGHUVRQ$FWLYLW\'LUHFWRU It sure was nice to finally get some much needed rain, let’s hope we get some more this week. On Sunday, Pastor Ron Wheeler came in from Community Chapel in Lakota to have worship services here at TMNH. Thank you, Ron Wheeler, for spending your afternoon here with us. Monday, we had You Be the Judge. Here are a few stories we covered: Was This the Best Buy, Who is Responsible and The Beauty and The Cop. For my sensory teasers, we took a country drive in Roadsters and Rumble seats. A nostalgic look back at America’s love affair with the automobile featuring highways and byways: Route 66, Lincoln Highway and The National Road. In the afternoon, we played The Price is Right and volleyball. During Man Cave, we played UNO and had brats and beer. Thank you to Greg Geerdes for providing our brats. Tuesday, we exercised to Myron Floren’s Greatest Hits. Doug Hanson and I worked on some new pictures to put on our board. For both sensory groups today, we played Mind Stretchers. This activity is designed to encourage verbal participation and provide light-hearted mental stimulation. The game of the day was Juca. Wednesday, we exercised to Please Don’t Shoot the Piano Player. At 9:30 a.m., Windy Creek came in and performed for us. Thank you Windy Creek, we look forward to this every month. We also had donuts from Casey’s. For my senso-

ry group today, we ribbon danced to Lawrence Welk Milestones. We had 17 residents for bingo, and they won 16 prizes. Monica played the dice game and read the Buffalo Center Tribune to the residents for her evening programs. Thursday, we exercised to Clete Goblish Band. Pastor Peake came at 9:30 a.m. for our weekly Bible Study Class: Jer. 8: 18-9:1, 1 Tim. 2: 1-7 and Luke 16: 1-13. Thank you Pastor Peake. For our morning sensory group, we took a tour to beautiful Wyoming. During dinner, we had a pizza party and assorted desserts that the staff brought in. Thank you to my co-workers for the delicious desserts. During the afternoon and evening, we had our Spa Day, played Cover-Up and Monica gave hand massages during her sensory group. On Friday, we listened to Willie and Conway during our Sit and Get Fit class. Jo Meinders was the winner of both Wii bowling games again today. She bowled a 167 for the first game and a 193 for the second game. For both sensory groups, we read some short stories and poems from the Good Old Days. With this being Homecoming week, we went outside to watch the Homecoming Parade, made popcorn and had root beer. Thank you, Paul Armstrong, for bringing in the Purple Cane Road root beer. We here, at TMNH, would like to thank Betty Coxson, Gerald Maass, Harlan Melz, Melinda Ellierson, Tom Geeseman and Bill Jensvold for all the fresh vegetables. They’ve gone great with all of our meals.

5HWLUHPHQW3DUW\IRU 3DXOHWWH$OPHOLHQ

DW0HUF\)DPLO\&OLQLF%XIIDOR&HQWHU )ULGD\2FWREHU SP

&DNHDQGFRIIHHZLOOEHVHUYHG +RVWHGE\KHUFRZRUNHUVIULHQGV

Heartwarmers Quilt Guild to meet The Heartwarmers Quilt Guild will meet at 6 p.m. for a potluck supper on Thursday, Sept. 26 at the Bethlehem Lutheran Church in Buffalo Center. Special guests will be the volunteers who assisted the guild with staffing the arts and crafts booth at the county fair. Members will be demonstrating the technique of making a braided finish on fleece blankets.

VFW Auxiliary Meetings VFW Auxiliary will hold their Buddy Poppy Sale from September 24 to October 11. Remember the men that served their country. Buy a poppy and wear it proudly!

Mercy Medical Center and clinics offer new flu vaccine Mercy Medical Center - North Iowa and all Mercy Clinics are offering a new influenza vaccine that protects against four strains of influenza. This includes protection against one additional strain compared to past vaccines. The vaccine Mercy will offer protects against two strains of Influenza subtype A and two strains of Influenza subtype B. “We want

Orphan Train program at HTC The Buffalo Center Historical Society will host a program about the Orphan Train and its relevance to the area on Sunday, October 6, from 2-4 p.m. at the Heritage Town Center. The program includes a video, discussion, dessert and a chance to visit the Heritage Museum. The museum will be open from 1-4 p.m. on Saturday, October 5, and 1-2 p.m. and 4-5 p.m. on Sunday, October 6. This will be the last chance to see the exhibit “Doctors, Dentists and Drug Stores�, all about the medical history of Buffalo Center.

everyone to be protected against the flu. So the number one thing to do is to get your vaccine,� said Maria Mathis, Clinic Quality and Practice Leader. “But when scheduling your vaccination appointment, or before receiving your vaccine at another facility, ask how many strains it protects against.� The Centers for Disease Control and Prevention (CDC) recommends that certain people should get vaccinated each year. Most of these people are recommended for vaccination because they are at high risk of having serious flu complications or they live with or care for people at high risk for serious complications.

3RVW2IĂ€FH +RXUV %XIIDOR&HQWHU 0RQGD\)ULGD\ DPSP SP 6DWXUGD\DP

(OPRUH

0RQ)ULDP

)RUHVW&LW\

0RQGD\)ULGD\ DPSP 6DWXUGD\DP

/DNRWD

0RQ)ULDPSP 6DWXUGD\DP

/HG\DUG

0RQ)ULDPSP 6DWXUGD\DPSP

7KDQN<RX  , ZRXOG OLNH WR VD\ D VLQFHUH WKDQN \RX WR HYHU\RQH WKDW KDV VHQW FDUGV RU DQ HPDLO EURXJKWIRRGJLYHQPHDULGHRUVWRSSHGLQWR VHH PH VLQFH KDYLQJ P\ VXUJHU\ DQG VWDUWLQJ WUHDWPHQWV,DPVRIRUWXQDWHWROLYHLQVXFKD FDULQJ FRPPXQLW\ ,WÂśV LQ WLPHV OLNH WKLV WKDW \RXUHDOO\UHDOL]HKRZOXFN\\RXDUH /RUL2VODQG

Thursday, September 26 7/8 VB (H) Lake Mills, 4:15 p.m. JV/V VB @ Forest City, 6 p.m. Friday, September 27 NIB Ribbon Cutting, Caseyâ&#x20AC;&#x2122;s, 1 p.m. V FB (H) West Bend-Mallard, 7 p.m. Saturday, September 28 V VB Tournament @ Algona Garrigan, 9 a.m. Sunday, September 29 Hymnsing, First Reformed Church, 7 p.m. Monday, September 30 First half of property taxes DUE 7/8 FB @ Rockford, 4:15 p.m. G/B CC @ Garner Golf course, 5 p.m. JV VB Triangular @ Armstrong 6 p.m. JV FB @ Rockford, 6 p.m. Tuesday, October 1 7/8 VB @ Kanawha (West Hancock), 4:15 p.m. JV/V VB @ Belmond (Belmond-Klemme), 6 p.m. Wednesday, October 2 Creative Spirits Painting, Lakota Community Room, 6:30-8:30 p.m.

5DNH

7KHÂżUVWGD\RIEXVLQHVV LQRXUQHZEXLOGLQJDW 0DLQ6W1LQ7LWRQND LV0RQGD\6HSW 1HZ%DQNLQJ+RXUV 0RQGD\)ULGD\DPSP 6DWXUGD\DP1RRQ

0RQGD\)ULGD\ DPSPSP 6DWXUGD\DP

7KRPSVRQ

0RQGD\)ULGD\ DPSPSP 6DWXUGD\DP


CHURCH

Services and Announcements of activities in our area

Churches

â&#x20AC;&#x153;Not forsaking the assembling...together BETHANY LUTHERAN CHURCH Thompson, Iowa Thursday, September 26: WISH open, 5-7 p.m. Sunday September 29: Confirmation meets, 9:15 a.m. Fellowship/Sunday School, 9:30 a.m. Traditional Worship, 10:30 a.m. --------------------------------------BETHLEHEM LUTHERAN CHURCH Buffalo Center, Iowa Mark Brickzin, Pastor Sunday, September 29: Worship, 9:30 a.m. Fellowship, 10:30 a.m. --------------------------------------COMMUNITY CHAPEL Lakota, Iowa Ron Wheeler, Pastor Sunday, September 29: Sunday School, 9:30 a.m. Worship Service, 10:30 a.m. Evening Service - Video: â&#x20AC;&#x153;God Provides - Jeremiahâ&#x20AC;&#x2122;s Call!â&#x20AC;? based on Jeremiah 29:1-14 Wednesday, October 2: Bible Study and Prayer, 7:00 p.m. -------------------------------------FIRST BAPTIST CHURCH Buffalo Center, Iowa Sunday, September 22: Worship, 9:00 a.m. --------------------------------------FIRST CONGREGATIONAL CHURCH Buffalo Center, Iowa Pastor Brad DeVries Thursday, September 26: Prayer Time, 6:30 a.m. GriefShare, 7:00 p.m. Sunday, September 29: Worship, 9:00 a.m. Fellowship, 10:15 a.m. Sunday School, 10:30 a.m. Meditations-Blue Earth Radio 1560, 12:05 p.m. Community Hymnsing, First Reformed Church, 7 p.m. Wednesday, October 2: Choir practice, 6:30 p.m. --------------------------------------FIRST PRESBYTERIAN CHURCH Lakota, Iowa Sunday September 29: Sunday School, 9:00 a.m. Worship Service, 11:00 a.m. Community Hymnsing, First Reformed Church, Buffalo Center, 7:00 p.m. --------------------------------------FIRST REFORMED CHURCH Buffalo Center, Iowa Pastor Bill Peake Wednesday, September 25: Pastor Bill will be out of town this morning. Thursday, September 26: TMNH Bible Study - all are welcome to attend, 9:30 a.m. Friday, September 27: Pastor Bill is out of town today for continuing education in Fort Dodge Saturday, September 28: Pastor Bill is out of town today for continuing education in Fort Dodge Sunday, September 29: September Acolyte is Laura Wubben; Flower coordinators are Vern and Arlene Risius, Joyce Landheer; Ushers are Dean Balvance and Don Gruis. September church project is the North Iowa Food for Families food pantry (see RCWM book for details.) Worship with live broadcast on KIOW-FM 107.3 and simulcast world-wide on www.kiow.com, 9:30 a.m. Today we will see our church grow and celebrate the Sacrament of Baptism. A special offering to assist the Hispanic outreach in northern Iowa will be received during the

final hymn. Fellowship Hour in the narthex classroom, 10:30 a.m. Childrenâ&#x20AC;&#x2122;s Choir practices in the sanctuary, 10:45 a.m. Chancel Choir Fellowship in the church kitchen, 10:45 a.m. Catechism class meets with Pastor Bill in the youth lounge, 10:45 a.m. Sunday School Classes meet for children and youth, 11:00 a.m. Chancel practice in the sanctuary, 11:00 a.m. All Classes and choirs are released - parents should be prompt to pick up children, 11:30 a.m. Fall hymnsing in the Sanctuary with a special devotional message of reaching all Godâ&#x20AC;&#x2122;s children shared by Pastor Antonio Pichardo. A free will offering will be received to assist Christian outreach to Spanish speakers in northern Iowa. A fellowship hour will follow the musical hour, 7:00 p.m. Monday, September 30: Pastor Bill will be out of town this morning. Consistory will meet in the narthex classroom - elders and deacons are asked to contact Pastor Bill ASAP if you will be late or unable to attend, 7:00 p.m. Tuesday, October 1: Lectionary text study in the church study - all clergy are welcome to attend, 10:00 a.m. Spirit Lifterâ&#x20AC;&#x2122;s meets in the church study - all are welcome to this weekly devotional Bible Study which requires no preparation. Our lesion (taken from the Upper Room Devotional - available for free in the church narthex) this week is â&#x20AC;&#x153;The Ministry of Hospitalityâ&#x20AC;? drawn from 3 John 1-12. All are welcome and encouraged to attend. â&#x20AC;&#x153;Spirit Liftersâ&#x20AC;? is intended to lift the spirits of real people living real lives in a world that isnâ&#x20AC;&#x2122;t always nice, 1:00 p.m. Wednesday, October 2: Pastor Bill will be out of town this morning. --------------------------------------IMMANUEL LUTHERAN CHURCH Rural Titonka Wednesday, September 25: Confirmation at Immanuel, 6:00 p.m. WOW for Kids at St. Johns, 6:30 p.m. Thursday, September 26: Adult Bible Study at St. Johnâ&#x20AC;&#x2122;s, 6:30 p.m. Friday, September 27: Missionary-Elizabeth Johnson Sunday, September 29: Noisy Offering Worship at St. Johnâ&#x20AC;&#x2122;s, 8:00 a.m. Immanuel Sunday School, 8:50 a.m. Fellowship at St. Johnâ&#x20AC;&#x2122;s, 9:00 a.m. Worship at Immanuel, 10:00 a.m. --------------------------------------RAMSEY REFORMED CHURCH Titonka, Iowa Pastor Perry DeGroot Saturday, September 28: Community Menâ&#x20AC;&#x2122;s Bible Study, 6:00 a.m. Sunday, September 29: Sunday Morning Worship, 9:30 a.m. Coffee Fellowship, 10:30 a.m. --------------------------------------ST. JOHNâ&#x20AC;&#x2122;S LUTHERAN CHURCH Woden, Iowa Wednesday, September 25: Confirmation at Immanuel, 6:00 p.m. WOW for Kids at St. Johns, 6:30 p.m. Thursday, September 26: Adult Bible Study at St. Johnâ&#x20AC;&#x2122;s,

WK%LUWKGD\ -R\FH/DQGKHHUWXUQV RQ2FWREHUWK 3OHDVHMRLQKHUIDPLO\LQ FHOHEUDWLQJKHUVSHFLDOGD\ &DUG6KRZHU QRJLIWVSOHDVH

32%R[ %XIIDOR&HQWHU,$

6:30 p.m. Friday, September 27: Missionary-Elizabeth Johnson Sunday, September 29: Noisy Offering Worship at St. Johnâ&#x20AC;&#x2122;s, 8:00 a.m. Immanuel Sunday School, 8:50 a.m. Fellowship at St. Johnâ&#x20AC;&#x2122;s, 9:00 a.m. Worship at Immanuel, 10:00 a.m. --------------------------------------ST. PAUL LUTHERAN CHURCH Lakota, Iowa Sunday, September 29: Worship Service, 8:45 a.m. --------------------------------------SOLID ROCK MINISTRIES Pastor Van Davis Friday, September 27: (Fridays at Blue Earth Library meeting room. First Friday every month meets at 3024 360th St., Buffalo Center) Supper, 6:00 p.m. Praise and Worship/Prayer, 7:00 p.m. Lesson and Discussion, 7:30 p.m. --------------------------------------UNITED METHODIST CHURCH Buffalo Center, Iowa Pastor Deb Devine Wednesday, September 25: Ecumenical Bible Study, 1:00 p.m. Sunday, September 29: Sunday School, 9:10 a.m. Worship Service, 10:15 a.m. Fellowship and coffee, 11:15 a.m. Monday, September 30: Pastoral Interview in Webster City, 1:00 p.m. Tuesday, October 1: Text Study, 10:00 a.m. Womenâ&#x20AC;&#x2122;s Study Group at Thompson Public Library, 6:00 p.m. Wednesday, October 2: Ecumenical Bible Study, 1:00 p.m. Nomination Committee, 7:00 p.m. --------------------------------------UNITED METHODIST CHURCH Thompson, Iowa Pastor Deb Devine Wednesday, September 25: Ecumenical Bible Study, 1:00 p.m. Sunday, September 29: Worship Service, 8:30 a.m. Fellowship and Coffee, 9:30 a.m. Sunday School, 10:00 a.m. Monday, September 30: Pastoral Interview in Webster City, 1:00 p.m. Tuesday, October 1: Text Study, 10:00 a.m. Womenâ&#x20AC;&#x2122;s Study Group at Thompson Public Library, 6:00 p.m. Wednesday, October 2: Ecumenical Bible Study, 1:00 p.m. --------------------------------------ZION LUTHERAN CHURCH Rake, Iowa Terry Mahnke, Pastor Sunday, September 29: Worship, 9:30 a.m. Sunday School, 9:45 a.m.

Community Hymnsing at First Reformed Church The North Iowa Community Hymnsings will celebrate the change of seasons and the start of harvest time with faith and inspiration on Sunday, September 29. The group will gather at First Reformed Church in Buffalo Center at 7:00 p.m. The hymn sings are a north Iowa tradition and gather men and women, boys and girls from several area churches. The congregations who sponsor the hymn sings are an ecumenical mix of First Baptist, First Congregational, both of Buffalo Center, and Ramsey Reformed of rural Titonka and First Presbyterian of Lakota, in addition to First Reformed Church. The community hymnsings continue a rotation through the participating churches â&#x20AC;&#x201C; on those months containing five Sundays. Each church contributes to the mix with someone from their congregations to sing or play. The host churches

always provide a â&#x20AC;&#x153;Community Special.â&#x20AC;? Sunday eveningâ&#x20AC;&#x2122;s â&#x20AC;&#x153;Community Specialâ&#x20AC;? is Marvella Blome. A special mission emphasis is shared at each hymnsing along with a devotional message. The groups will welcome Pastor Antonio Pichardo, who pastors a Spanish language outreach ministry in Clear Lake, Garner, Belmond, Eagle Grove and Clarion. Antonioâ&#x20AC;&#x2122;s message will be in Spanish with an English translator present to share his message with non-Spanish speakers. An offering will be received on this Sunday for the Hispanic ministry in our own backyard. The evening is concluded with singing and fellowship time to be held in the church basement. The community at large is cordially invited to share this hour with the sponsoring churches at First Reformed Church in Buffalo Center.

Call for entries for competitive craft exhibition The Charles H. MacNider Art Museum in Mason City is putting out a call for entries for the competitive craft exhibition Iowa Crafts: 41. Entries must be e-mailed or postmarked by Wednesday, Oct. 23, to be considered for the show. The purpose of Iowa Crafts: 41 is to provide the public with further enriching arts experiences and to promote interest in and recognition of the accomplishments of Iowa artists. The competition is open to all residents of Iowa above high school age. Entry categories are clay, fiber, metal/wood, jewelry, and other craft media. Each artist may submit up to four entries. All works are to be

CONGREGATE MEALS Monday, September 30: Swiss Style Ground Beef, Baked Potato, Triple Salad, Blushing Pears Tuesday, October 1: Egg and Potato Casserole, Broccoli, Banana Half, Fruit Oat Muffin Wednesday, October 2: Lemon-Herbed Chicken, Scalloped Corn, Tomatoes Florentine, Mandarin Oranges Thursday, October 3: Hearty Veg Beef Soup, Corn Bread, Celery Sticks, Peaches, Trail Mix Friday, October 4: Turkey Roast, Potatoes w/Gravy, Peas and Carrots, Pumpkin Custard Please RSVP for a meal by 6:00 p.m. the night before by calling 5622495, and leave a message on the answering machine.

original, entirely by the entering artist, and completed since September 2011. Cash awards total $1,000, along with a one-person exhibition. Iowa Crafts: 41 opens on Friday, Dec. 6, in the Kinney-Lindstrom Gallery with an artistsâ&#x20AC;&#x2122; reception scheduled for Saturday, Dec. 7, starting at 2 p.m. Awards will be presented at 2:30 p.m. The public is invited to attend and meet the representing artists. The exhibition remains on display through Mar. 1, 2014. For more information or to receive an entry form, visit the Upcoming Exhibitions page on the Museumâ&#x20AC;&#x2122;s website, www.macniderart.org, or call the Museum at 641421-3666. Iowa Crafts: 41 is sponsored by NSB Bank.

First half of property taxes due The Winnebago County Treasurer reminds tax payers that the first half of property taxes, special assessments, drainage and mobile home taxes are due by September 30. October 1, 2013 postmarks will be returned for interest.

(9(5<21(NQRZV 'DOH6FKXPDQQULJKW" 6RFRPHDQGKHOS'DOH$ 6FKXPDQQFHOHEUDWHKLV

WKELUWKGD\ 6HSWHPEHU IURPSPDWWKH )R[/DNH*ROI/DNH*ROI &RXUVH6KHUEXUQ01

+RVWHGE\0$1<RI'DOHÂśVIDPLO\DQG IULHQGV)RRGZLOOEHVHUYHG <RXUSUHVHQFHZRXOGEHWKHJUHDWHVW JLIWIRU'DOH

+HOSVSUHDGWKHZRUG

,I\RXFDQÂśWMRLQXVWKDWGD\FDUGVFDQ UHDFK'DOHDW32%R[(WK 6W)DLUPRQW01

:LQQHEDJR&RXQW\3XEOLF+HDOWKZLOOEHRIIHULQJĂ XFOLQLFV ,I\RXDUHXQDEOHWRDWWHQGWKHRQHVDWWKH6HQLRU&HQWHUZHDUH DOVRKDYLQJĂ XFOLQLFVDWRXURIĂ&#x20AC;FH0RQGD\WKUX)ULGD\¡VIURP SP3OHDVHEULQJ\RXU0HGLFDUHRU0HGLFDLGFDUG&RVW LI \RX GRQ¡W KDYH FRYHUDJH LV  ,I LW LV GLIĂ&#x20AC;FXOW IRU \RX WR ZDON ZH ZLOOFRPHRXWWR\RXUFDURUJRWR\RXU KRPH&DOOLI\RXKDYH DQ\TXHVWLRQV



7LPHO\0LVVLRQ1XUVLQJ+RPH 0HGLFDUH6NLOOHG&HUWLILHG1XUVLQJ)DFLOLW\ 352$'9$17$*(6(59,&(6,1&

  QG$YH1(%R[7LWRQND,$  %XVLQHVV3KRQH)D[

,1685$1&( ,19(670(176 48$/,7<&$5()2548$/,7</,)( /(52<%5816 0LVVLRQ'U %XIIDOR&HQWHU

$GPLQLVWUDWRU +RPHHPDLOOEUXQV#QHWLQVQHW 352$'9$17$*(6(59,&(6,1& )DUPHUV7UXVW 6DYLQJV ,1685$1&( ,19(670(176 /(52<%5816 %DQN QG$YH1(%R[7LWRQND,$

<285+20(72:1%$1. %XVLQHVV3KRQH)D[ %XIIDOR&HQWHU²/DNRWD²%ULWW²/DNH0LOOV +RPHHPDLOOEUXQV#QHWLQVQHW

)DUPHUV7UXVW 6DYLQJV%DQN <285+20(72:1%$1.

)RUDOO\RXU5HILQHG)XHODQG3URSDQH1HHGV

&DOO %XIIDOR&HQWHUÂł/DNRWDÂł%ULWWÂł/DNH0LOOVÂł%ULFHO\Q01 &+5,67,$15$',2 :,7+$0(66$*(

.-/<)06WHUHR e can never buy or acquire enough to make us happy â&#x20AC;&#x201C; or at least happy for very long. Thatâ&#x20AC;&#x2122;s because â&#x20AC;&#x153;stuffâ&#x20AC;? doesnâ&#x20AC;&#x2122;t fill our inner need. Only the things of God can do that.

%HDPLQJWKH*RVSHOLQ:RUG DQG6RQJKRXUVDGD\

$OSKV6HUYLFH 6XSSOLHV 6WDWH%DQNRI/HG\DUG 3OXPELQJ²+HDWLQJ²(OHFWULFDO 0HPEHU)',& )DUP²+RPH²&RPPHUFLDO )XOO6HUYLFH%DQN 3KRQH 3KRQH/HG\DUG,RZD %XIIDOR&HQWHU,RZD

6WDWH6DYLQJV%DQN

Be filled this week in church.

0HPEHU)',& &RPSOHWH%DQNLQJ ,QVXUDQFH6HUYLFHV 3KRQH²5DNH,RZD

Âł0F*XLUH$OO'D\ Âł&DUOVRQDP0F*XLUHSP Âł.HOOHUDP&/26('SP Âł&/26('$//'$< Âł0F*XLUH$OO'D\ 7R PDNH DQ DSSRLQWPHQW IRU D VSH FLDOW\FDOOWKH0DVRQ&LW\&OLQLFDW  ,Q D PHGLFDO HPHUJHQF\ DIWHU KRXUV FDOOWKH0HUF\)DPLO\&OLQLFLQ)RUHVW &LW\DW  XQWLOSP &DOO  RU JR WR WKH QHDUHVW HPHU JHQF\ URRP )RU RWKHU PHGLFDO DGYLFH SOHDVH FDOO WKH 0HUF\ )DPLO\ +HDOWK/LQHDW

The Thompson Community Blood drive will be held next Friday, Oct. 4, at the Thompson Public Library from 2-5:30 p.m. The library is located at 102 Jackson St. Eligible, volunteer blood donors are needed every day to help ensure cancer patients, newborn babies, trauma patients, and patients undergoing various surgeries receive the life-saving blood products they need. Blood donors make a difference, and in just one hour, they can help save the lives of up to three hospital patients. Appointments can be scheduled online at www.lifeservebloodcenter.org or by calling 800-287-4903.

6HSW)RUHVW&LW\6HQLRU&HQWHUDWDP 2FW5DNH/LEUDU\DWDP 2FW/DNH0LOOV6HQLRU&HQWHUDW   DP 2FW7KRPSVRQ%DQNDP 2FWDW%XIIDOR&HQWHU6HQLRU  &HQWHUDP



6HSWHPEHU2FWREHU

Thompson blood drive Oct. 4

)OX&OLQLF'DWHVIRU:LQQHEDJR&RXQW\

SKJOLD PHOTOS

PAGE 4 â&#x20AC;&#x201D; Buffalo Center (Iowa) Tribune â&#x20AC;&#x201D; Wednesday, September 25, 2013

)ULHQGO\DQG )XOO6HUYLFH%DQN

 1 Timothy 6:6-19 Jeremiah 32:1-3a, 6-15

Luke 16:19-31

Psalm 91:1-6, 14-16

Revised Common Lectionary Š 1992 by the Consultation on Common Texts for

Sunday, September 29, 2013 Nineteenth Sunday After Pentecost

+<%5,'6 %(5**5(16(('6 60LOO5RDG +Z\

%XIIDOR&HQWHU7ULEXQH %XIIDOR&HQWHU7ULEXQH 10DLQ  -RLQ2XU)DPLO\RI ,QWHUHVWHG6XEVFULEHUV


LOCAL

Obituary

Buffalo Center (Iowa) Tribune â&#x20AC;&#x201D; Wednesday, September 25, 2013 â&#x20AC;&#x201D; PAGE 5

WCFB brings agriculture to forefront for students

Marie Nuehring Marie Nuehring, age 94, Klemme, Marie Nuehring most recently a resident of the Hiawatha Care Center, Hiawatha, died, September 12 at the Hiawatha Care Center. Funeral services were held at 2:00 p.m. Sunday, September 15 at the Immanuel Reformed United Church of Christ, Klemme. The Reverend Donna Buckman officiated. Burial was in the Ell Township Cemetery, Klemme. Marie Meinders was born February 5, 1919, near Buffalo Center on the Meinders family farm home, the daughter of Henry and Nellie (Reikens) Meinders. She was baptized and confirmed at the 1919-2013 Ramsey Reformed Church, near Services: Titonka. She attended country Funeral services were held at school through the 8th grade. She 2:00 p.m. Sunday, September continued to help with various farm 15 at the Immanuel Reformed and household duties until she met United Church of Christ, Earl W. Nuehring. The couple was Klemme. united in marriage on March 6, 1941 Burial was in the Ell Township at the Ramsey Reformed Church. Cemetery, Klemme. Following their marriage, the couple farmed near Klemme. Marie became a member of the Immanuel United Church of Christ, located in Klemme, shortly after their marriage. In her pastime, Marie enjoyed sewing, baking, gardening, camping, reading novels and writing about her life experiences while raising four children on the Nuehring family Century Farm-spanning 25 plus years. In 1968, Earl and Marie built their dream home in Klemme. Marie and Earl also spent their winter months in Weslaco, TX at Pine to Palm Trailer Park for over 25 years. In the spring of 1996, Marie moved to the Prairie View Retirement Apartments and continued to reside there until moving to the Concord Care Nursing Home, Garner, in August 2006. In order to reside closer to family, Marie moved to Hiawatha Care Center near Cedar Rapids in September, 2011. Marie was preceded in death by: her husband, Earl W. Nuehring; one son, Harley Nuehring; a great-grandson, Christopher Gowan-Nuehring; her parents, Henry and Nellie Meinders; brothers, Dick and Alvin Meinders; sister, Iola Steffensen; sisters-in-law, Catherine Meinders and Maxine Meinders. Those left to cherish her memory are: her son, Darryl Nuehring and wife Leslie of Oskaloosa; her daughter-in-law, Mrs. Harley (Lynette) Nuehring of Cedar Rapids; her daughter, Cindy Weil and husband, David of Englewood, CO; and daughter, Joyce Kelly-Lapides and husband, Michael of Castle Rock, CO. Marie is also survived by eight grandchildren: Mark (Margaret) Nuehring of Rochester, MN; Brian Nuehring of St. Peterâ&#x20AC;&#x2122;s, MO; Corey (Michelle) Nuehring of Marion; Tarah (Tom) Kuna of Castle Pines, CO; Nicole Gugliardo of One Tree, CO; Taylor Kelly of Castle Rock, CO; and Whitney and Camryn Weil of Englewood, CO. Marie is also blessed with 13 great-grandchildren: Alex, Julia, and Ryan Gowan-Nuehring; Jade, Madeleine and Hunter Nuehring; Caitlyn, Cole, and Claire Nuehring; Keller, Avery, and Asher Kuna; and Mia Gugliardo. Additional survivors in the Buffalo Center and Mason City areas include: Marieâ&#x20AC;&#x2122;s brothers, Wilbert and wife Gertrude Meinders and Jim Meinders of Buffalo Center; and sister-in-law, Mrs. Alvin (Johanna) Meinders, also of Buffalo Center; a brother-in-law, Harlan and wife, Ione Nuehring of Mason City; and sister-in-law, Charlotte (Mrs. Charles) Rink, also of Mason City. The family would like to thank the Hiawatha Care Center staff and Dr. Mary Anne Nelson for their loving care and support. Memorials are suggested to donorâ&#x20AC;&#x2122;s choice. Andrews Funeral Home, Klemme, assisted the family with arrangements.

Kids today may not realize where their food and fiber products come from, but the Winnebago County Farm Bureau is working to change that. One of their major activities to highlight agriculture is their annual Ag & Safety Fair held for fourth grade students from North Iowa, Lake Mills and Forest City. The Ag Fair also offers teachers an exclusive opportunity to integrate agricultural information into the science, math, social studies, language arts and other classes they teach. Around 180 students attended this yearâ&#x20AC;&#x2122;s Ag Fair. They enjoyed presentations at 20 various stations, including: â&#x20AC;˘ Pig shown by Jenna Koppen (NI FFA) â&#x20AC;˘ Calves/Heifer shown by Landon Josten (FC FFA) and Rebecca Murray (NI FFA) â&#x20AC;˘ Sheep shown by Carle Main (NI FFA) â&#x20AC;˘ Horses shown by Megan Moklestad (NI FFA) and Nancy Moklestad â&#x20AC;˘ Baby chicks shown by Linda Anderegg â&#x20AC;˘ Hens/Guineas shown by Bob Nath (board member) â&#x20AC;˘ Dogs shown by Betsy Fickel (FB member) â&#x20AC;˘ Goat shown by Logan Eichenberger (NI FFA) â&#x20AC;˘ Rabbits (FC FFA) â&#x20AC;˘ Lawnmower/4-Wheeler Safety presented by Bison FFA â&#x20AC;˘ Machinery presented by Josh Mathahs and Dylan Voortmann (Bison FFA) â&#x20AC;˘ Electrical Safety presented by Ron Gaesteiger of Heartland Power â&#x20AC;˘ Thompson Fire/Ambulance

Libby Meyer with Winnebago County Extension presents tips on sun safety at this yearâ&#x20AC;&#x2122;s Ag & Safety Fair, hosted by the Winnebago County Farm Bureau. presented by Logan Swearingen, Justin Hassebroek and Rick Kofron â&#x20AC;˘ Grain Safety presented by Forest City FFA â&#x20AC;˘ Conservation (Wetlands) presented by Lisa Ralls, Conservationist â&#x20AC;˘ NRCES (waterways) presented by Lynn Kluver and Sharyl Anderson â&#x20AC;˘ Extension (Sun Safety) presented by Libby Myer â&#x20AC;˘ Corn station presented by Samantha Ehrhardt of Iowa Corn Growers Assoc. â&#x20AC;˘ Soybean station presented by Christian Miller (FB member) â&#x20AC;˘ Ag Trivia Bean Bag Toss game managed by LM FFA More than 25 additional FFA students from the three chapters served as group leaders and helped present information as well. Jenna Koppen of the Bison FFA shows her pig to students at the Ag & Safety Fair held at the Winnebago County Fairgrounds in Thompson.

Fourth graders check out the ambulance gurney at the Thompson Ambulance and Thompson Fire Dept. station.

City makes $2,500 contribution to NIB The Buffalo Center City Council approved a one-time contribution of $2,500 to North Iowa Betterment at its monthly meeting on September 11. NIB came to the Council last month, requesting $10,000 to help fund the position of NIBâ&#x20AC;&#x2122;s executive director. NIB board member Jerry Wiedemeier addressed the Council, sharing comments of support the group had received on Facebook. The comments were in response to the question of whether people supported the idea of tax dollars being used to help fund NIB. â&#x20AC;&#x153;Basically, we need you guys to get behind us,â&#x20AC;? said Wiedemeier. â&#x20AC;&#x153;Weâ&#x20AC;&#x2122;re going to need to go door to door to get people to support us, and if we can say the city is behind us, supporting us, it adds a lot of weight to what weâ&#x20AC;&#x2122;re doing.â&#x20AC;? â&#x20AC;&#x153;Small towns are dying, and weâ&#x20AC;&#x2122;ve got something really positive going here,â&#x20AC;? said NIB member Cory Myer. â&#x20AC;&#x153;Weâ&#x20AC;&#x2122;ve got young families that want to come back to town â&#x20AC;&#x201C; they want to be here. There are a lot of good things going on. We need to be progressive, and we need you as

Fall Kanawha 2013

GARAGE SALES

October 4 & October 5 Friday, Oct. 4: after school Saturday, Oct. 5: starting at 8 a.m. Free Map and Listings at Pronto

a city council to be the leaders that are going to get us there. As a city council, you can be a bridge to take that next step, or you can be a barricade, and ultimately thatâ&#x20AC;&#x2122;s the big question that it comes down to tonight.â&#x20AC;? Myer suggested a $5,000 contribution at this time for NIBâ&#x20AC;&#x2122;s services and for the Council to look at bumping that up to $10,000 a year when it works on next yearâ&#x20AC;&#x2122;s budget. â&#x20AC;&#x153;Thereâ&#x20AC;&#x2122;s obviously community support for it,â&#x20AC;? said Councilman Marty Schaefer. â&#x20AC;&#x153;Iâ&#x20AC;&#x2122;ve also heard from â&#x20AC;Ś a decent number of people in the community that donâ&#x20AC;&#x2122;t think that we should be funding it.â&#x20AC;? Schaefer said he thinks this issue

should be addressed at City budget time, but he acknowledged that itâ&#x20AC;&#x2122;s an urgent matter for NIB, as the organization is looking to hire a new person. Schaefer motioned to make a one-time donation of $2,500 to NIB and to send out surveys with the Cityâ&#x20AC;&#x2122;s water bills to find out what kind of support there is in the community for funding NIB with tax dollars. Following the survey, Schaefer said heâ&#x20AC;&#x2122;d like to revisit the issue at budget time. â&#x20AC;&#x153;I donâ&#x20AC;&#x2122;t think thereâ&#x20AC;&#x2122;s anybody at the table that doubts that this is a good thing for the community,â&#x20AC;? said Schaefer. â&#x20AC;&#x153;We have to deal with how we get it done. Itâ&#x20AC;&#x2122;s one thing to say

6WHDN1LJKW 6HSWHPEHU 2FWREHUDQG

â&#x20AC;&#x2DC;Do you support using tax dollars to fund this?â&#x20AC;&#x2122; Itâ&#x20AC;&#x2122;s another thing for us to say â&#x20AC;&#x2DC;Do you support us being involved if we have to raise property taxes to do it?â&#x20AC;? Paulson seconded, and the motion passed with yes votes from Jensvold and West, while Silber voted no.

Lakota Museum closes for season The Lakota Museum is now closed for the fall and winter season. Tours will continue to be available by appointment by contacting Char Spear at 515-538-0116.

Dylan Voortmann, left, and Josh Mathahs of the Bison FFA show the kids a tractor at their Ag & Safety Fair station.

25 years OF HOSPICE SERVICES

Celebrate with us. Thursday, September 26, 2013 11:00 a.m. â&#x20AC;&#x201C; 1:30 p.m. Home Health & Hospice Office 125 S. Main Street, Blue Earth, MN Open to the public. Complimentary hot dogs, hamburgers and root beer floats provided.

1LJKWO\6SHFLDOV 6XSHU6XQGD\:LQJV 6KULPS$OO'D\+DSS\+RXU $SSHWL]HU0RQGD\Â&#x201E;2II0HQX,WHPV 'RPHVWLF%HHU %ORRG\7XHVGD\%ORRG\0DU\V :KLWH:HGQHVGD\:KLWH5XVVLDQV %XOOGRJV 7KLUVW\7KXUVGD\&DSWDLQV %XFN,W,WÂśV)ULGD\%HHUVLQD%XFNHWIRU 6XSHU6KRW6DWXUGD\$Q\6KRW ([FOXGHVDQ\ERPEVKRW

WK$YH6:%XIIDOR&HQWHU

Committed to care. Committed to you. Home Health and Hospice 125 S. Main Street Blue Earth, MN (507) 526-7970


LOCAL

PAGE 6 â&#x20AC;&#x201D; Buffalo Center (Iowa) Tribune â&#x20AC;&#x201D; Wednesday, September 25, 2013

Winnebago County Courthouse News SENTENCES AND PLEAS Jesus R. Gallardo, 19, Lake Mills, pled guilty to Possession with Intent to Deliver a Controlled Substanceâ&#x20AC;&#x201C;Marijuana, a class D felony, and Possession of a Controlled Substance-Marijuana, a serious misdemeanor, stemming from an investigation by the Lake Mills Police Dept., Aug. 10, 2012. Gallardo is scheduled to be sentenced Oct. 29, 2013. Joshua J. Langfald, 36, Forest City, pled guilty to Driving While Revoked, a serious misdemeanor, stemming from a traffic stop by the Winnebago County Sheriffâ&#x20AC;&#x2122;s Office, May 9, 2013. Langfald was ordered to pay a $1,000 fine, applicable surcharges, and court costs. Terrell D. McGuire, 28,

Minneapolis, Minn., pled guilty to Assault, a simple misdemeanor, stemming from an investigation by the Lake Mills Police Dept., Dec. 5, 2012. McGuire was sentenced to serve five days in jail and ordered to pay court costs. Shamar L. McFarland-Ridley, 21, Forest City, pled guilty to Possession of a Controlled Substance-Marijuana, a serious misdemeanor, stemming from an investigation by the Forest City Police Dept., March 25, 2013. Ridley was sentenced to serve two days in jail (suspended), ordered to pay a $315 fine, applicable surcharges and court costs. Ridley shall follow through with all treatment recommendations and will have his license revoked by the DOT. James A. Nelson, 57, Forest City,

pled guilty to Possession of a Controlled SubstanceMethamphetamine, a serious misdemeanor, stemming from a traffic stop by the Iowa State Patrol, May 14, 2013. Nelson will be on probation to the Dept. of Correctional Services for one year. Nelson must follow through with all treatment recommendations. Tricia K. Penning, 27, Lake Mills, pled guilty to Public Intoxication-Second Offense, a serious misdemeanor, stemming from an investigation by the Lake Mills Police Dept., June 7, 2013. Penning was sentenced to serve 30 days in jail, with all but two days suspended, ordered to pay a $315 fine, plus applicable surcharges and court costs. The fine and surcharges were suspended. Penning must follow

through with all substance abuse treatment recommendations. Penning will be on probation for one year. Nathan A. Gremmer, 21, Forest City, had his deferred judgment revoked and was ordered to pay a $315 fine, applicable surcharges and court costs for a probation violation. LAND TRANSFERS Kevin Grothe and Christina Grothe to Wayne Sprecher and Arlene Sprecher, a tract of land in section 2, Center Township. Daniel Hall to Gntry Sorenson and Renee Sorenson, lot 13, block 3, Westgate 3rd Subdivision, Forest City. Dennis Hanna to Larry Hegel and Dorothy Hegel, lot 17, block A, Norman, section 12, Norway Township.

Judy Folven to Judy Folven Trust, lot 2, Eagle Lane Subdivision, section 24, Center Township. Robert Rupp Jr and Connie Rupp to Eugene Nerby, a portion of lot 4, block 2, Lake Mills. Richard Jensvold Estate to Debra Jensvold, lot 5, block 2, Jensvold Addition, Buffalo Center. Richard Jensvold DOD 2/18/2006. James Krutsinger to Lori Krutsinger, aka Lori Ewing, lot 5, block 11, Rebecca A Clarks Addition, Forest City. Gary Holst and Mariann Holst to David Albertson and Sheryl Albertson, Parcel B, section 23, Logan Township David Albertson and Sheryl Albertson to Gary Holst and Mariann Holst, Parcel A, section 23, Logan Township.

Dorothy Faber Trust, Dennis Faber trustee to Jeanne Garland Trust, a tract of land in section 12, Forest Township. James Oulman and Sharon Oulman to Brian Clark, lot 4, block 74, Forest City. Beverly Smithe to Jerry Adams, a portion of lots 88 and 89, all in auditorâ&#x20AC;&#x2122;s resurvey of section 11, Center Township. Anna Burke Estate, Beverly Sunde executor to Cheryl Burke, Unit C, lot 5, Central Plaza I Condo Assn, block 35, Forest City. Dorothy Faber Trust, Dennis Faber trustee to Wayne Johnson and Gloria Johnson, a tract of land in section 30, Mt. Valley Township. Jerry Sandry and Jean Sandry to Dale White, a portion of lot 5, section 25, Forest Township.

Bank says thanks with annual suppers

Bank customers came to the Heritage Town Center last Wednesday, Sept. 18, to enjoy a meal of pork loin sandwiches, potato salad, beans, chips, cookies, ice cream, lemonade and coffee.

A good-sized crowd gathered for the FTSB appreciation supper in Lakota, and customers enjoyed the Eagle Centerâ&#x20AC;&#x2122;s fall dĂŠcor, neighbors and food.

Have an idea for an interesting story?

The FTSB team serving the appreciation supper in Lakota last Wednesday included, from left: Jody Sachs, Julie Mabus, Sue Griese, Jill Engelbarts, Dayna Price, Kimberly Ruby and Dave Strueber.

Call Andrew at 562-2606 %HFRPHD IULHQGRI %XIIDOR &HQWHU

/07RZQ+DOO(YHQW

6HSWHPEHU²SPSP

/DNH0LOOV&RPPXQLW\6FKRRO $XGLWRULXP $SDQHORIORFDOSURIHVVLRQDOVDLPHG WRHGXFDWHDQGLQFUHDVHDZDUHQHVVRI FRPPXQLW\PHPEHUVRQWKHFRVWRI PDULMXDQDVRFLDOO\DQGHFRQRPLFDOO\ )RUPRUHLQIRUPDWLRQFRQWDFW6KDQQD(DVWYROGSURJUDP GLUHFWRURIWKH/07)DWRUOPWI#ZFWDWHOQHW (YHQWLV)5((WRWKHSXEOLF

7ULEXQH /,9( /2&$/5$',2

1RUWK,RZD1HZV,QIRUPDWLRQ(YHQWV

086,&0,;

'DLO\%HVW0XVLF9DULHW\ :HHNHQGV6XSHU+LWVRI·V ·V

Farmers Trust & Savings Bank held its annual customer appreciation suppers in Buffalo Center and Lakota on Wednesday, Sept. 18. Bank staff thanked their many customers by serving a free meal featuring pork loin sandwiches. Buffalo Center staff serving food at the Heritage Town Center included, from left: Connie Brooks, Dawn Meinders and Teresa Price.

:($7+(5

(YHU\0LQXWHV:DUQLQJV :KHQ7KH\+DSSHQ

5(0,1'(5

-XOLH6ZHQVRQ :LQQHEDJR&RXQW\7UHDVXUHU ZRXOGOLNHWRUHPLQGHYHU\RQHWKDW 67+DOI3URSHUW\7D[HV6SHFLDO $VVHVVPHQWV'UDLQDJHDQG 0RELOH+RPH7D[HVDUH'8( 6HSWHPEHU

2FWREHUSRVWPDUNVZLOO EHUHWXUQHGIRULQWHUHVW ,I\RXKDYHDQ\TXHVWLRQV SOHDVHFDOO -XOLH6ZHQVRQ:LQQHEDJR&RXQW\7UHDVXUHU

7+(%(670,;2)

0XVLFÂ&#x2021;1HZVÂ&#x2021;:HDWKHUÂ&#x2021;6SRUWV

173 Main Street N

101 Hwy 69 N

11723 Hwy 9

Titonka

Forest City

Thompson

.,2:0L[)0 )RUHVW&LW\

ZZZNLRZFRPNLRZ#NLRZFRP

%XVLQHVV&RQWHVW5HTXHVWV 


LEGALS/CLASSIFIEDS

Buffalo Center (Iowa) Tribune â&#x20AC;&#x201D; Wednesday, September 25, 2013 â&#x20AC;&#x201D; PAGE 7

Employment

City of Buffalo Center The Buffalo Center City Council met on Wednesday, September 11, 2013 at 7:00 p.m. at City Hall. Council present: Silber, Paulson, West, Jensvold, Schaefer. Citizens present were Andrew Shaw, Janet Jutting, Amy Walk, Kim Thompson, Jerry Wiedemeier, Jamie Price, Cory Meyer, Ben Parmater, Doug Hanson. Employees present: Paul Jutting, Public Works, and Matt Holmquist, Police. Mayor Troy Armstrong called the meeting to order. Paulson moved, seconded by Schaefer, to approve the agenda. All ayes, motion carried. West moved, seconded by Silber, to approve the minutes from the August 14th meeting. All ayes, motion carried. Schaefer moved, seconded by Paulson, to approve the payment of bills listed at the end of the Council notes. All ayes, motion carried. Schaefer moved, seconded by Silber, to approve the building permit for Lyle Hippen, deck. All ayes, motion carried. Silber moved, seconded by Paulson, to approve the alcoholic beverage permits for Buffalo Center Foods known as Johnson Food Center. All ayes, motion carried. Jerry Weidemeier, representative of North Iowa Betterment, visited about a $10,000 city contribution to the organizationâ&#x20AC;&#x2122;s funds. Schaefer moved, seconded by Paulson, to approve a one time donation of $2500 with a review at budget time after surveys have been tabulated from the residential responses. Four ayes, Silber nay. Motion carried. Surveys will be sent out with the October water bills. West moved, seconded by Silber, to accept the quote from Brandt Stump Removal for the amount of $1617.50 for the 28 stumps on city parcels. All ayes, motion carried. Doug Hanson asked for consideration on the removal of the sidewalk on his rental property at 101 Second Street NW. West moved, seconded by Jensvold, to allow the removal of sidewalk with the lawn to be seeded in that frontage area. All ayes, motion carried. West moved, seconded by Jensvold, to approve Resolution 12-2013 setting October 9 at 7:00 p.m. for the public hearing for the CDBG requirements in the application for funds for the construction of improvements for the cityâ&#x20AC;&#x2122;s water system. Roll call vote: five ayes. Resolution carried. The Council reviewed the contract agreement with WHKS Engineering Firm, Schaefer moved, seconded by West, to approve the contract subject to city attorneyâ&#x20AC;&#x2122;s recommendations. All ayes, motion carried. Other discussions included replacing a police vehicle and water tower inspection report. Jensvold moved, seconded by Schaefer, to adjourn the meeting. All ayes, meeting adjourned. Revenues for August 2013: General Fund, $4,785.43; Road Use Tax, $8,775.34; Library Fund, $146.00; Local Option Sales Tax, $6,757.85; Water Fund, $8,895.88; Sewer Fund, $6,054.47; Garbage Fund, $6,933.29; Interest, $.74 Disbursements for August 2013: General Fund, $31,921.22; Road Use Tax, $4,660.53; Library Fund, $1,449.90; Employee Benefit, $2,232.14; Water Fund, $11,575.30; Sewer Fund, $7,736.37; Garbage Fund, $11,304.78 Gross Payroll, $30,248.13; city contribution, $3,807.15 Troy Armstrong, Mayor ATTEST: Deb Jensvold, City Clerk SEPTEMBER 2013 BILLS AgSource Labs Service ...................... $48.00 Alliant Energy Service ...................$5,326.34 Allied Insurance Service ................... $238.00 Alphâ&#x20AC;&#x2122;s Plumbing Service ...................$332.65 Anderson Sanitation Service .........$1,042.50 Troy Armstrong Mileage ..................... $35.26 Austin Office Products Supplies ........ $194.83 B C Parcel Service ............................... $8.25 B C Repair Service .............................$60.00 B C Welding Service ........................... $90.00 Bison Graphics Supplies ..................$204.50 Bison Laser Wash Service ............... $100.00 Boeckholt Repair Service .................$702.77 Buffalo Center Post Office Supplies ..$267.10 Buffalo Center Tire Service Supplies ...................................$3,116.82 Caseyâ&#x20AC;&#x2122;s General Store Service ......... $738.05 Cemstone Materials Service ..........$2,630.50 Dakota Supply Group Supplies .........$375.78 Digital Ally Service ............................$120.59 H & S Autoparts Supplies ................... $93.87 Hawkins Inc Supplies ......................... $61.30 Healy Ruff Service ..............................$80.00 Hewett Wholesale Service ................ $122.01 Matt Howe Refund ..............................$53.43 Iowa Assoc Mun Utilities Service .......$422.48 Jackâ&#x20AC;&#x2122;s Ok Tire Service ......................$291.58 John Deere Financial Supplies ..........$247.39 Johnsonâ&#x20AC;&#x2122;s Food Center Supplies .......$209.82 Paul Jutting Mileage ...........................$56.50 K & H Cooperative Service ............$1,208.45 Kossuth County Auditor Service .....$3,867.05 Library WCTA Service ..............................$20.21 Parents Magazine Service ...............$7.99

%8))$/2&(17(5 &+,5235$&7,& 'U-HUU\:LHGHPHLHUa-XG\:LHGHPHLHU/07

&KLURSUDFWLFDQG0DVVDJH IRUWKH:KROH)DPLO\

&DOOIRUDSSW

:,17(5

Mid-America Publish Service ........$21.38 Johnson Foods Supplies ...............$12.34 Readers Digest Service ................$20.00 Sharon Hippen Supplies ...............$51.84 Logan Concrete Service ...................$390.00 Dave Low Service ............................$450.00 Marshall & Swift Service ................... $155.64 Mid-America Publishing Service ........$145.68 Mid America Research Supplies ........$107.82 Murra Hardware Supplies .................$973.18 Next Generation Technologies Service ..........................................$90.35 North Iowa Athletic Boosters Service ..$30.00 Radar Road Tech Service ................... $63.00 Spray Seal Service ........................$5,575.00 State Hygienic Lab Service ................$24.00 Thorson Tree Service Service ...........$300.00 USA Blue Book Service ....................$115.87 Verizon Wireless Service ....................$186.22 Winnebago Coop Telephone Service ..$897.66 Winnebago County Auditor Service ..$9,337.32 Heritage Town Center Paul Armstrong Service ...................$1,900.00 Heartland Paper Co Supplies .............$880.55 Main Fertilizer Refund ....................... $100.00 Gail Naumann Refund ........................$100.00 Published in the Buffalo Center Tribune on Wednesday, September 25, 2013.

Winnebago County Supervisors September 9, 2013 The Winnebago County Board of Supervisors met in session at 9:00 A.M. September 9, 2013 adjourned from September 3, 2013. Present: Supervisors Durby and Wubben Absent: Supervisor Stensrud On a motion by Durby and seconded by Wubben the Supervisors moved to approve the minutes for the September 3, 2013 Board Meeting and approve the agenda for September 9, 2013. All voted aye. Motion carried. The Secondary Road Association was advised by their legal advisor to not amend their current contract. The Board of Supervisors took no action. Discussion on the Veterans Affairs personnel matter was tabled until further notice. Discussion on the road paving project for Asmus Farm Supply was tabled until next week. On a motion by Durby and seconded by Wubben the Supervisors moved to approve the following Auditorâ&#x20AC;&#x2122;s Transfers: #3523 for $69,630.16 from Rural Basic to Secondary Roads and #3524 for $2,642.26 from Rural Basic to Winnebago County Fair Association. All voted aye. Motion carried. Scott Meinders, Engineer discussed Secondary Road projects including A16 and R60. Both projects are progressing and should be completed in October. Scott discussed a 5 year action plan which he puts together for the Service Bureau. Scott will bring in a copy of the report for the Supervisors to review. The session was adjourned until 9:00 A.M. September 16, 2013. Warren Wubben, Vice-Chairperson Attest: Kris Wempen, Finance Clerk Published in the Buffalo Center Tribune on Wednesday, September 25, 2013.

Public Notice PUBLIC HEARING NOTICE The City of Buffalo Center, Iowa, is hereby serving as Public Notice that on October 9, 2013, at 7:00 p.m., the City Council will hold a public hearing in the Council Chambers at City Hall to consider the submission of an application for a Community Development Block Grant. The grant application will request funding assistance for improvements to the water system. This meeting will be held to give residents information concerning the proposed project. Citizens are encouraged to attend and express their preferences about he proposed activities. Anyone having questions about this project or the upcoming hearing may call the City Clerk at 641-562-2505. Deb Jensvold City Clerk City of Buffalo Center Published in the Buffalo Center Tribune on Wednesday, September 25, 2013.

thebuffalocenter tribune.com

*GGVNCPF6CZKFGTO[ %UXFH+HHWODQG WK$YHQXH /DNRWD,$

WROOIUHH



6LOEHU V 3KRWRJUDSK\

DENTIST

%XIIDOR&HQWHU

New Patients Welcome!

 Â&#x2021;0RWRU2LO Â&#x2021;3DLQW

. +&223(5$7,9(2,/&2 %R[

-DFNVRQ6W1 32%R[ 7KRPSVRQ,$

GRFVOXPEHU#ZFWDWHOQHW

T   T 

Â&#x2021;3HWUROHXP Â&#x2021;/3*DV

)25$//<285/80%(51(('6

ID[



QG$YH1:

)RUDOO\RXUELJWURSKLHV



75$9,66,/%(5

:HVOH\,$ 

7ROO)UHH

'HQWLVW

5DQGDOO/:LQWHU''6 .\OH3:LQWHU''6 3KRQH  WK6WUHHW1:a%XIIDOR&HQWHU

Swenson Park gets redesign with pergola By Carol Mahnke Thanks to a $1,000 grant received by the Rake VFW Auxiliary and funds from the Rake Lutefisk Supper and the Tractor Ride, Swenson Park has been re-designed to make it more attractive to people who might have their lunch in the park or just sit and enjoy the greenery. Georgia Jacobson, who initiated the project, hopes the more attractive park will be used by more Rake residents and visitors than it has so far. The land for the park was donated by Marlys Swenson and her family in honor of the late Gordon Swenson, longtime Rake banker.

The redesign was accomplished by David Osmund of Landscaping by Design, Buffalo Center. All participants are pleased with the outcome, which features a pergola sheltering two park benches. â&#x20AC;&#x153;It looks nice,â&#x20AC;? commented Phil Benn. Benn annually organizes the Rake Tractor Ride which, with the lutefisk supper provided the balance of the $60,000 project. Vernon Jacobson, who is married to Georgia Jacobson, organizes the lutefisk supper. The two projects have provided new street lights in Rake, the welcome sign, the basketball court and now the park.

Probate

Services

IN THE IOWA DISTRICT COURT IN AND FOR WINNEBAGO COUNTY IN THE MATTER OF Probate No. ESPR010393 NOTICE OF PROBATE OF WILL, THE ESTATE OF OF APPOINTMENT OF EXECUTOR, Jeanne A. Hogard, Deceased, and NOTICE TO CREDITORS To All Persons Interested In The Estate Of Jeanne A. Hogard, Deceased, who died on or about May 8, 2013: You are hereby notified that on the 23rd day of July, 2013, the last will and testament of Jeanne A. Hogard, deceased, bearing the date of April 12, 1978, was admitted to probate in the above named court and that Steve Hogard was appointed executor of the estate. Any action to set aside the will must be brought in the district court of said county within the later to occur of four months from the date of the second publication of this notice or one month from the date of mailing of this notice to all heirs of the decedent and devisees under the will whose identities are reasonably ascertainable, or thereafter be forever barred. Notice is further given that all persons indebted to the estate are requested to make immediate payment to the undersigned, and creditors having claims against the estate shall file them with the clerk of the above named district court, as provided by law, duly authenticated, for allowance, and unless so filed by the later to occur of four months from the second publication of this notice or one month from the date of mailing of this notice (unless otherwise allowed or paid) a claim is thereafter forever barred. Dated this 16th day of September, 2013. Steve Hogard Executor of the Estate 3285 James Drive Forest City, Iowa 50436 Kristopher C. Duer Attorney for the Executor 11 Second Avenue NE P.O. Box 349 Buffalo Center, Iowa 50424 Date of second publication: 2 day of October, 2013. Published in the Buffalo Center Tribune on Wednesday, September 25, and October 2, 2013.

352)(66,21$/ ',5(&725<

)XQHUDO+RPH &UHPDWLRQ6HUYLFH ZLQWHUIXQHUDOKRPHFRP

VFW members Marlys Swenson, Cathy Quam, Dora Smith, Georgia Jacobson and Esther Haugen are pleased with the redesign of Swenson Park.

5(6,'(17,$/&200(5&,$/ )$50:,5,1*

0DUWLQVRQ(OHFWULF 7LP0DUWLQVRQ2ZQHU

 )UHH(VWLPDWHV

%XIIDOR&HQWHU

+$66(%52(.5()5,*(5$7,21 Â&#x2021;&RPPHUFLDO5HIULJHUDWLRQ (TXLS Â&#x2021;*(DQG+RWSRLQW$SSOLDQFHV Â&#x2021;+HDWLQJ Â&#x2021;&RROLQJ Â&#x2021;+HDW3XPSV Â&#x2021;:DWHU&RQGLWLRQLQJ Â&#x2021;:DWHU+HDWHUV %XIIDOR&HQWHU

3+21(

%DQN$JHQF\ ,QVXUDQFH

%/8(($57+9$//(<(<(&/,1,& 6RXWK*URYH6WUHHW6XLWH %OXH(DUWK01

3KRQH

+HOHQ)LQHU

For Sale

1HZ&XVWRPHUDQG6HQLRU'LVFRXQWV )UHH1DWLRQZLGH6KLSSLQJ

NEW OR USED appliances. Call or stop. Hassebroek Refrigeration, 562-2592. (10)3-tf

$921,QGHSHQGHQW 6DOHV5HSUHVHQWDWLYH

Triple dresser with detachable mirror with side shelves. Excellent condition. $100. 641-590-2174

)DVWORDGLQJDQGXQORDGLQJ *UDLQ6WRUDJH 165,000 bushel bin with new below grade 14â&#x20AC;? truck unloading auger for continuous hauling and ďŹ lling of a 9,000 bushel holding bin, which ďŹ lls the big bin with a new 6â&#x20AC;?, 75 hp, continuous, air ďŹ ll system. Side chute loading of semis on bin. 12 cents per bushel per yr plus elec. Will consider partial ďŹ ll of half full or more at slightly higher rate. Also, 12,000 bu bin for rent. Located at 36402, 15th St. Elmore, MN (3 miles west of Elmore) Call 507-240-0030 Larry Mages-Mages Land Co. 12:23(1

$DURQ*HUEHU 

7KRPSVRQ,$ 

%,*2560$//:(3285,7$// 'HFRUDWLYH3DWLRV%DVHPHQWV*DUDJHV 'ULYHZD\V*UDQLWH&UHWH&RXQWHUWRSV

2SWRPHWULVWV 'UV.OHSSHU 7UDLQHU

(\HV([DPLQHG *ODVVHV)LWWHG²&RQWDFW/HQVHV (DVW&DOO 

$OJRQD,RZD 

%RHFNKROW¡V &RWWDJHV QG6W6: DQGQG6W6: %XIIDOR&HQWHU

1HZO\UHPRGHOHGFRPSOHWHO\ IXUQLVKHGJXHVWFRWWDJHV 5HQWE\GD\ZHHNRUPRQWK )RUUHVHUYDWLRQVFRQWDFW

$ORU-XG\DW

 &HOO

ZZZERHFNKROWVFRWWDJHFRP

:DWNLQV 4XDOLW\3URGXFWVIRU\RXU )DPLO\ +RPH  ODUNDWJUD\#ZFWDWHOQHW

&(57,),('38%/,&$&&2817$176

WK$YHQXH7LWRQND,$

RU

%&5HSDLU

Â&#x2021; /DZQDQG*DUGHQ Â&#x2021; 7UDFWRUVDOOPDNHVDQGPRGHOV Â&#x2021; &RPELQHVDQG6NLGORDGHUV Â&#x2021; 2YHUKDXOV+\GUDXOLF(OHFWULFDO5HSDLUV :(0$.(6(59,&(&$//6

/$55<$*5$< +LZD\:HVW

RU

(USHOGLQJ9RLJW &R $OJRQD3KRQH

7,**(6&+,5235$&7,&&/,1,& )DPLO\3UDFWLFH 6SRUWV,QMXU\ '50(5/(7,**(6%DQFURIW,$ )25$332,170(17 Â&#x2021; ,QVXUDQFH$FFHSWHG Â&#x2021; 6SHFLILF6SLQDO&DUH Â&#x2021; +DQGVRQ$GMXVWLQJ Â&#x2021; 3UREOHP&DVHV

)HHOWKH'LIIHUHQFH

Â&#x2021;JURXQGOHYHOHDV\DFFHVV Â&#x2021;RIIVWUHHWSDUNLQJ Â&#x2021;RQVLWHODXQGU\ Â&#x2021;DOOXWLOLWLHVIXUQLVKHG H[FHSWHOHFWULFLW\ PR$YDLODEOH1RZ

:HVWZRRG&RXUW $SDUWPHQWV 10LOO5RDG %XIIDOR&HQWHU RU

PROCESS MEDICAL claims from home? Chances are you won't make any money. Find out how to spot a medical billing scam. Call the Federal Trade Commission. 1-877-FTC-HELP. A message from the Buffalo Center Tribune and the FTC. (36)37-tfn

,IQRDQVZHUFDOO

0U&DUSHW&OHDQHU DQG:LQGRZV

)255(17

2QHEHGURRPDSDUWPHQW

Notice

/DUU\ .DWK\*UD\

3KRQH

3KRQH FHOO

 5DQFK KRPH  EHGURRP  EDWK  FDU JDUDJH DWWDFKHG IXOO EDVHPHQWVTIWWK$YH 1: %XIIDOR &HQWHU        [

)RU5HQW

-RKQ6WRFN'90

5RG%RZHUVRZQHU

Real Estate

Rentals

%XIIDOR&HQWHUDQG7LWRQND

%UXFH9HQWHLFKHU$JHQW

'U%UHQW'-RKQVRQ 'U5RJHU+DQVRQ

&DOOWRGD\IRUEURFKXUH     RU KZILQH#ZFWDWHOQHW ZZZ\RXUDYRQFRPKILQHU

TT'6'4+0#4;.+0+%

/,)(+($/7++20(DQG$872  %XIIDOR&HQWHU

2SWRPHWULVWV

Look Beautiful For Less!

Movies Wanted

â&#x20AC;&#x153;THE MILLSâ&#x20AC;? THEATER SCHEDULE:

Appreciation

â&#x20AC;&#x2DC;The Millsâ&#x20AC;&#x2122; Theater Schedule: Screen 1-â&#x20AC;&#x153;Mortal Instruments: City of Bonesâ&#x20AC;?(PG-13), Sept. 27 - Oct. 3; shows M-F 7 p.m., Sat. 7 & 9:30 p.m., Sun. 3 & 7 p.m. Screen 2- â&#x20AC;&#x153;The Worldâ&#x20AC;&#x2122;s Endâ&#x20AC;?(R), Sept. 27 - Oct. 3; shows M-F 7:30 p.m., Sat. 7:30 & 10 p.m., Sun. 3:30 & 7:30 p.m. www.themillstheater.com or movie line at 641-592-6455.

Thank you so much for the wonderful gift. I pray you are as blessed as much as you have blessed me! Frances Meyer

kitchen ceiling fixture, 3 lights and fan, call 562-2912

WANTED TO BUY: Used sewing machine in working condition. 319541-4775

Free


PAGE 8 â&#x20AC;&#x201D; Buffalo Center (Iowa) Tribune â&#x20AC;&#x201D; Wednesday, September 25, 2013

TO CONTACT US

The Classifieds!

PHONE. . . . . . . . . . . . . . . . 641-562-2606 FAX. . . . . . . . . . . . . . . . . . . 641-562-2636 EMAIL . . . . . . . . . . bctrib@wctatel.net WEB . . www.buffalocentertribune.com MAIL. . . . . . . . . .Buffalo Center Tribune PO Box 367, Buffalo Center, IA 50424 STOP BY . . . . . . . . . . . .124 North Main, Buffalo Center, IA

TO PLACE AN AD ~ CALL 641-562-2606 Employment :LQQHEDJR&RXQW\-DLO FXUUHQWO\KDVDQ RSHQLQJIRUSDUWWLPH FRUUHFWLRQDORIĂ&#x20AC;FHUV

+RXUVZLOOEHRQDQDVQHHGHGEDVLV WRLQFOXGHGD\VKLIWQLJKWVKLIW ZHHNHQGVDQGKROLGD\V ,QWHUHVWHGSDUWLHVVKRXOG FDOODQGDVNIRUDQ DSSOLFDWLRQRUDSSO\LQSHUVRQDWWKH 6KHULIIÂśVRIÂżFHDW 6&ODUN6WLQ)RUHVW&LW\ &ORVLQJGDWH2FWREHUWKDWSP $SSOLFDWLRQVUHFHLYHGDIWHUWKHFORVLQJGDWH ZLOOQRWEHFRQVLGHUHG

:$17('

Agronomy Operator

Certified Nursing Assistants 1RZDFFHSWLQJDSSOLFDWLRQVIRUSDUWWLPH 0RUQLQJVDPSPVKLIW $IWHUQRRQVSPSPVKLIW 1LJKWVSPDPDQG SPDPVKLIW :HRIIHUFRPSHWLWLYHZDJHVOLIHLQVXUDQFH .SHQVLRQSODQ 8SWRVLJQRQERQXVLQPRQWKV +ROLGD\3D\9DFDWLRQ $VNDERXWRXUSD\PHQWLQ OLHXRIEHQHÂżWVSURJUDP )URPH[WUDSHUPRQWK $SSO\LQSHUVRQWR5REHUWD+DJHGRUQ51'21DW 7LPHO\0LVVLRQ1XUVLQJ+RPH 0LVVLRQ'ULYH%XIIDOR&HQWHU,$

Farmers Cooperative Company, a highly reputable and stable company that values high standards and rewards loyalty and excellence is looking for an agronomy laborer. This person will operate tender trucks, fill NH3 tanks and assist in loading products for customers. Must have or be able to obtain a Class A CDL with HazMat endorsement. Excellent benefits, and an opportunity to grow with the best. Please call (641) 566-3351 for an application or apply online at www.fccoop.com FC is an EEO/AA employer.

Employment Opportunities

(2(

Join the Lake Mills Care Center and Mills Harbour Independent & Assisted Living Teams

ELMORE TRUCK AND TRAILER SERVICE CONSTRUCTION HELP NEEDED

(OPRUH01

Gleeson Constructors & Engineers, L.L.C. will be accepting applications for the following positions beginning August 12th:

,PPHGLDWHRSHQLQJVIRU 'LHVHO0HFKDQLF

Laborers-$12.00 Carpentersâ&#x20AC;&#x201D;$17.00 Iron Workersâ&#x20AC;&#x201D;$17.00 &HUWLÂżHG:HOGHUV² Concrete Finishersâ&#x20AC;&#x201D; $17.00 &HUWLÂżHG&UDQH2SHUDWRU² Please apply in person only with Gleeson Superintendent Jacob Gookin at the jobsite trailer located at: 1260 US 18 %ULWW,$ 35,25&216758&7,21(;3(5,(1&(,65(48,5(' Must be able to pass pre-employment physical Post Offer Pre-Employment Drug Testing & E-Verify Required Gleeson Constructors & Engineers, L.L.C. is an (TXDO2SSRUWXQLW\$IÂżUPDWLYH$FWLRQ(PSOR\HU www.gleesonllc.com

x

x

236 State St. S

x

2107 325th St.

219 N Main St Commercial/Retail Bldg

x

518 N Main

x

613 1st Ave NE Business Opportunity D & D Greenhouse

Bancroft

x

305 3rd Ave NE

x

111 North Clay St.

x

Residential Building Sites

x

401 N. Walnut St.

x

411 E. Oak St.

Built in 2007. Gorgeous 3 BR home with custom kitchen.

Well maintained home with several updates

Lots 1, 2, 3 Block 43

Spacious split level home. 4 BR, 2 baths.

Lots 10, 11, 12 Block 43

x

205 3rd St. NE

x

616 1st St. NE

Swea City

2 BR, 1 bath home with a great location

SOLD!

3 BR home located on a large corner lot. Spacious Kitchen.

x

205 2nd St. S Move in ready home. Spacious kitchen. Double detached garage.

Ledyard

x

Lakota

Apply online at www.christensenfarms.com Equal Opportunity Employer

Services

SOLD!

3 BR with double attached garage.

(Same block as St. Patrickâ&#x20AC;&#x2122;s Church)

&DGLQ¡V/DZQ&DUH 7KDWFKLQJEDJJLQJ WULPPLQJPRZLQJ

4807 150th Ave Attractive acreage North of Ledyard. 3 BR, 2 baths. Lots of updates.

110 Brewer St.

wages, medical plan, dental, vision, and 401K.

Contact Stephanie at 641-592-4900 to apply.

ABCM is an Equal Opportunity Employer

Services 

Spacious acreage at a great location. 3 BR, 2 baths. Open Layout. Includes adjacent 13 acres of CRP Land.

Great location!

competitive

is hiring

2 story home. Metal Siding. Newer shingles. Personal property included.

Leibrandâ&#x20AC;&#x2122;s Appliance Store

compensation,

Christensen Farms

Homes For Sale

Large 4 BR home located on nice corner lot. Lots of updates.

Benâ&#x20AC;&#x2122;s Specials of the Week (QTF'FIG

(QTF(QEWU

/LPLWHG6890LQHUDO*UD\0HWDOOLF PLOHV/9'2+&9$XWR:'

'5%ODFNPLOHV //'2+&9$XWR):'

$GPĹ?U5RGEKCN2TKEG

$GPĹ?U5RGEKCN2TKEG





6Q[QVC%COT[

2QPVKCE)TCPF2TKZ

/('5%OXH5LEERQ0HWDOOLF PLOHV/9'2+&9$XWR):'

*73'5*ROGPLOHV /92+99$XWR):'

&DOO7KRPSVRQ

Farmland For Sale

Rake

x

Certified Nursing Assistant

experience

Animal Care Workers in various locations in Iowa.

REALTOR ÂŽ

x

Now Hiring at Mills Harbour Assisted Living:

Competitive wage and advancement opportunities Excellent benefit package Full Time - Day Hours No experience required. Titonka

increase, years of

Now Hiring

Real Estate

Buffalo Center

Annual merit

Certified Nursing Assistant, RN/LPN, Cook, Dietary Aide,

5HVSRQVLELOLWLHVLQFOXGH %HLQJDWHDPSOD\HU 2SHQDQGFORVLQJZRUNRUGHUVNHHSDFFXUDWHQRWHV RQUHSDLURUGHUVWRLQVXUHDFFXUDF\LQELOOLQJ 0DLQWDLQDFOHDQDQGVDIHZRUNHQYLURQPHQW 0DNHDOOQHFHVVDU\UHSDLUVWRNHHSWUDFWRUVLQVDIH RSHUDWLQJFRQGLWLRQE\GLDJQRVLQJUHSDLULQJRU UHSODFLQJFRPSRQHQWVRQWKHHTXLSPHQWDQGRWKHU GXWLHVDVDVVLJQHG 0XVWKDYHDJRRGVHWRIEDVLFZRUNLQJKDQGWRROV 0XVWEHZLOOLQJWRZRUNĂ&#x20AC;H[LEOHVKLIWVDQGRYHUWLPHDV QHHGHG 0XVWEHDEOHWRPHHWSK\VLFDOUHTXLUHPHQWVRI SRVLWLRQ OLIWLQJXSWROEVEHQGLQJFOLPELQJ VWDQGLQJIRUGXUDWLRQRIVKLIWHWF

3OHDVHFRQWDFW0LNH/LEUDDW WRVHWXSDQLQWHUYLHZ

7+,638%/,&$7,21'2(6127.12:,1*/<$&&(37DGYHUWLVLQJZKLFKLVGHFHSWLYHIUDXGXOHQWRUZKLFK PLJKWRWKHUZLVHYLRODWHWKHODZRUDFFHSWHGVWDQGDUGVRIWDVWH+RZHYHUWKLVSXEOLFDWLRQGRHVQRWZDUUDQW RUJXDUDQWHHWKHDFFXUDF\RIDQ\DGYHUWLVHPHQWQRUWKHTXDOLW\RIWKHJRRGVRUVHUYLFHVDGYHUWLVHG5HDGHUVDUH FDXWLRQHGWRWKRURXJKO\LQYHVWLJDWHDOOFODLPVPDGHLQDQ\DGYHUWLVHPHQWVDQGWRXVHJRRGMXGJPHQWDQGUHDVRQ DEOHFDUHSDUWLFXODUO\ZKHQGHDOLQJZLWKSHUVRQVXQNQRZQWR\RXZKRDVNIRUPRQH\LQDGYDQFHRIGHOLYHU\RIWKH JRRGVRUVHUYLFHVDGYHUWLVHG

x x

Now Hiring at Lake Mills Care Center:

13 acres of CRP Land Section 9, Buffalo Township, Range 27

49563 30th Ave Completely remodeled home MOVE IN READY!

Listings

â&#x20AC;˘

Auctions

â&#x20AC;˘

Farm Management

For more information and pictures of our listings go to:

www.centralstatesrealestate.com

<28%5,1*,7 :(Âś//%8<,7

- -5HF\FOLQJ

+RXUV 0RQ)UL DPSP &ORVHGRYHU OXQFKIURP DPSP &ORVHG6DWXUGD\ 6XQGD\

+Z\(OPRUH01 52//2))6(59,&($9$,/$%/(

DQG\DUGER[HV %X\LQJDFURVVWKHVFDOHE\WKHWRQLURQFDUVWUXFNVWLQZLUHPDFKLQHU\ IDUPHTXLSPHQWDQGDQ\RWKHUPHWDOV\RXPD\KDYHRQWKHIDUPRUDURXQG WKH VKRS $OVR EX\LQJ DOXPLQXP FDQV FRSSHU EUDVV EDWWHULHV FDVW LURQ UDGLDWRUVVWDLQOHVVVWHHOZLUHHWF

3KRQH

$GPĹ?U5RGEKCN2TKEG

$GPĹ?U5RGEKCN2TKEG



 )XOO/LVWLQJ2QOLQHDW ZZZIRUHVWFLW\IRUGFRP /RFDWHGDW-XQFWLRQ+Z\  )RUHVW&LW\,$




MID AMERICA MARKETPLACE

Buffalo Center (Iowa) Tribune â&#x20AC;&#x201D; PAGE 9

Wed.-Thurs., September 25-26, 2013 â&#x20AC;˘ Buffalo Center Tribune, Butler County Tribune-Journal, Clarksville Star, Eagle Grove Eagle, Kanawaha Reporter, The Leader, Grundy Register, Hampton Chronicle, Pioneer Enterprise, ShefÂżeld Press, Wright County Monitor, The Reporter

M

id-America

ARKETPLACE

â&#x20AC;&#x17E;Where We Put Your Business on the Map!â&#x20AC;°

Classified

www.midammarketplace.com

Buy a line classiÂżed ad at any participating Mid-America newspaper and get it listed here for just $5 more!

ADOPTION HELP WANTED- TRUCK DRIVER ADOPTION: Childless, loving couple pray to adopt. Stay at home mom, successful dad, great dogs & devoted grandparents. Legally allowed expenses paid. Bill & Debbie 800311-6090 (INCN)

$6000 Sign On Bonus for new lease purchase drivers at Hirschbach Motor Lines. Midwest regional and OTR positions available. New trucks. Great miles. 888-5146005 drive4hml.com (INCN)

BUSINESS OPPORTUNITIES TanTara Transportation is now hiring OTR Company Flatbed Drivers and Owner Operators. Competitive Pay and Home Time. Call us @ 800-650-0292 or apply online at www.tantara.us (INCN)

ATTN: COMPUTER WORK. Work from anywhere 24/7. Up to $1,500 Part Time to $7,500/mo. Full Time. Training provided. www.WorkServices7.com (INCN)

7+,638%/,&$7,21'2(6127.12:,1*/<$&&(37DGYHUWLVLQJZKLFKLVGHFHSWLYHIUDXGXOHQWRUZKLFK PLJKWRWKHUZLVHYLRODWHWKHODZRUDFFHSWHGVWDQGDUGVRIWDVWH+RZHYHUWKLVSXEOLFDWLRQGRHVQRWZDUUDQW RUJXDUDQWHHWKHDFFXUDF\RIDQ\DGYHUWLVHPHQWQRUWKHTXDOLW\RIWKHJRRGVRUVHUYLFHVDGYHUWLVHG5HDGHUVDUH FDXWLRQHGWRWKRURXJKO\LQYHVWLJDWHDOOFODLPVPDGHLQDQ\DGYHUWLVHPHQWVDQGWRXVHJRRGMXGJPHQWDQGUHDVRQ DEOHFDUHSDUWLFXODUO\ZKHQGHDOLQJZLWKSHUVRQVXQNQRZQWR\RXZKRDVNIRUPRQH\LQDGYDQFHRIGHOLYHU\RIWKH JRRGVRUVHUYLFHVDGYHUWLVHG A Fantastic shopping event.

IOWAâ&#x20AC;&#x2122;S LARGEST

SEPT. 27-29

Over

ARTS & Crafts SHOW 3

0 Exhi0 bitors

VARIED INDUSTRIES BLDG. IOWA STATE FAIRGROUNDS DES MOINES, IOWA Fri. 5-9; Sat. 9-5; Sun. 10-4 FREE PARKING ADM. Just $6.00 Free Shuttle Bus (10 & under free) Service from 3-day re-entry stamp North Parking Lot Next Show Nov. 15-17 on both Fri. & Sat.

Over 300 Talented Exhibitors Present & Sell 1,000â&#x20AC;&#x2122;s of Unique Creations. Callahan Promotions, Inc., 563-652-4529

This weekâ&#x20AC;&#x2122;s Crossword and Sudoku puzzles

IOWA BASED REEFER company hiring OTR Class A CDL teams and solos. E-logs. Late model equipment, scheduled home time, excellent miles. Call Chuck 800-645-3748. (INCN) â&#x20AC;&#x153;Partners in Excellenceâ&#x20AC;? OTR Drivers APU Equipped Pre-Pass EZ-pass passenger policy. 2012 & Newer equipment. 100% NO touch. Butler Transport 1-800-528-7825 (INCN) Drivers: CDL-A Train and work for us! Professional, focused CDL training available. Choose Company Driver, Owner Operator, Lease Operator or Lease Trainer. (877) 3697895 www.CentralTruckDrivingJobs.com (INCN)

Bonus! Home regularly, bonuses. and full beneÂżts. Call today for details 1-888-9293466 or apply at www.heyl.net (INCN) Get more home time on Transport Americaâ&#x20AC;&#x2122;s regional runs. Great miles, equipment + extras. Enjoy Transport Americaâ&#x20AC;&#x2122;s great driver experience! TAdrivers.com or 866204-0648 (INCN) MISCELLANEOUS This classiÂżed spot for sale. Advertise your product or recruit an applicant in over 250 Iowa newspapers! Only $300/week. Call this paper or 800-227-7636 www.cnaads.com (INCN) SPORTING GOODS

Drivers: IMMEDIATE OPENINGS, REGIONAL and OTR Experienced Drivers and Owner Ops. Competitive Pay Scale, Students Welcome. deBoer Transportation 800-825-8511 www.drivedeboer.com (INCN)

GUN SHOWS: Davenport 2815 W. Locust October 11-12-13 Dubuque 1469 Old HWY 20 October 18-19-20 Fri. Night 5-9 Sat 9-5 Sun 9-3 Bigboreenterprise.com (INCN)

Now Hiring Regional Class CDL-A Drivers. New Pay Package and $2500 Sign-On

FOR SALE

ACREAGE between Hampton & Iowa Falls: 3 BR, 2 BA New 1177 sq. ft. modular home with 1.4 acre. 3oss. 2wner Ă&#x20AC;nance More info call (214) 683-8385

1994 Lincoln Continental Executive Series. white exterior, blue leather interior, 85,533 miles, 3.8 liter engine, runs great, excellent tires, new Interstate battery, now reduced to $3,500. Contact: David Ackerman at (515) 532-6982 or (563) 5801407 (Clarion area). (39) MRKT

Bring this ad to show for $1.00 OFF One Admission

HEALTHCARE REFORM TOWNHALL MEETINGS SCHEDULED IN YOUR AREA Changes are coming in 2014. Are you ready? Learn about your rights and responsibilities under federal law.

For More Information: Visit: insuranceca.iowa.gov, Call: 1-877-955-1212, Email affordablecareact@iid.iowa.gov Presented by the Iowa Insurance Division, the Iowa Department of Human Services and the Iowa Department of Public Health

5)"//6"-/035)&"45*08""35*454 

â&#x20AC;˘ "35*454

at

â&#x20AC;˘ -0$"5*0/4

CLUES ACROSS 1. Belaya river port city 4. Arbitrageur businessman 7. Leavened bread 8. Exploiters 10. 7 deadly 12. Minimal unit of metrical time 13. 12th Jewish month 14. Our 50 states 16. Fiddler crabs 17. Them in Spanish 19. Texas Gov. Richards 20. Single integers 21. Areas of a city 25. Goat and camel hair fabric 26. Misery resulting from afĂ&#x20AC;iction 27. Icelandic island 29. Publisher Adolph 30. Oxalis crenata 31. A major division of geological time 32. Edith Bunker actress 39. Parent organizations 41. Express pleasure 42. Entrap 43. Fabric with a corded surface 44. A food additive to enhance Ă&#x20AC;avor 45. Database management system 46. Betel palm genus 48. Notch 49. Hungarian is a Finno-_____ language 50. A right angle building extension 51. Burgh on the Firth of Clyde 52. Owed as a debt

'*/%640/ '"$&#00,

0$50#&3  

"TDFOJDGSFFESJWFZPVSTFMGUPVS BMMXJUIJONJMFTPG%FDPSBI

XXX*PXB"SU5PVSDPN

How You Can Avoid 7 Costly Mistakes if

Hurt at Work

Experience the QSI Advantage

Why Choose QSI? MORE LUMBER ENGINEERED A+ BETTER RATING

800-374-6988

Specializing in Complete Post Frame Buildings.

www.qualitystructures.com

Each year thousands of Iowans are hurt at work, but many fail to learn the Injured Workers Bill of Rights which includes: 1. Payment of Mileage at $.555 per mile 2. Money for Permanent Disability 3. 2nd Medical Opinion in Admitted Claims. . . . A New Book reveals your other rights, 5 Things to Know Before Signing Forms or Hiring an Attorney and much more. The book is being offered to you at no cost because since 1997, Iowa Work Injury Attorney Corey Walker has seen the consequences of clientâ&#x20AC;&#x2122;s costly mistakes. If you or a loved one have been hurt at work and do not have an attorney claim your copy (while supplies last) Call Now (800)-707-2552, ext. 311 (24 Hour Recording) or go to www.IowaWorkInjury.com.

WE WANT YOUR CLASSIC CARS!!

Paying you the maximum for your car!

Camaros â&#x20AC;˘ Corvettes â&#x20AC;˘ Chevelles â&#x20AC;˘ Mopars â&#x20AC;˘ Mustangs Pontiacs â&#x20AC;˘ Classics â&#x20AC;˘ Caddys â&#x20AC;˘ Convertibles â&#x20AC;˘ Exotics

Flint Hills Resources Job Fair Iowa Falls Ethanol Plant 21050 140th Street

Monday, October 7, 2013 3:00-7:00 P.M. Come learn about exciting opportunities in Operations and Maintenance available at our Iowa Falls Ethanol plant. Take a tour of our facility and learn ďŹ rst-hand about the ethanol production process.

QUALITY CARS ONLY, NO RUSTY CRUSTIES AMERICAN DREAM MACHINES 1500 Locust St. Des Moines, IA 50309 Call (515)245-9100 or email photos & info to sales@admcars.com

We are an equal opportunity employer. M/F/D/V Except where prohibited by state law, all offers of employment are conditioned upon successfully passing a drug test.

Answers from:

09/18/13

Hereâ&#x20AC;&#x2122;s How It Works: Sudoku puzzles are formatted as a 9x9 grid, broken down into nine 3x3 boxes. To solve a sudoku, the numbers 1 through 9 must Âżll each row, column and box. Each number can appear only once in each row, column and box. You can Âżgure out the order in which the numbers will appear by using the numeric clues already provided in the boxes. The more numbers you name, the easier it gets to solve the puzzle!

CLUES DOWN 1. Not visible or perceived 2. A ribbed woven fabric of silk, rayon or cotton 3. Growth rings 4. Volcanic mountain in Japan 5. Rebroadcasts a show 6. A British suspender 8. Fringe-toed lizard 9. Oceans 11. Molten metal scum residue 14. Atomic # 106 15. Mountain peak covering 18. Request for quiet 19. Macaws 20. Lyric poems 22. #8 potassium rich fruits 23. Star Warsâ&#x20AC;&#x2122; __-Wan Kenobi 24. Express wonder 27. Works a gardenâ&#x20AC;&#x2122;s soil 28. Alias 29. Opening 31. Bones 32. Harlenquinade clowning (Mid. Eng.) 33. Lose resilience 34. Syrian pound 35. Finishes 36. Held over 37. Brass that looks like gold 38. Cuddle 39. Small sailboat 40. Dorsal plates on anthropods 44. A waterproof raincoat 47. Latin: around time of


MID AMERICA MARKETPLACE

PAGE 10 â&#x20AC;&#x201D; Buffalo Center (Iowa) Tribune

Buffalo Center Tribune, Butler County Tribune-Journal, Clarksville Star, Eagle Grove Eagle, Kanawaha Reporter, The Leader, Grundy Register, Hampton Chronicle, Pioneer Enterprise, ShefÂżeld Press, Wright County Monitor, The Reporter â&#x20AC;˘ Wed.-Thurs., September 25-26, 2013

Iowa Department of Natural Resource weekly Âżshing report The Iowa Department of Natural Resources issues a weekly Âżshing report on Thursdays in an effort to provide the latest information heading into the weekend. The weekly Âżshing report is compiled from information gathered from local bait shops, angler creel surveys, and county and state parks staff. For current information, contact the district Âżsheries ofÂżce at the phone number listed at the end of each district report. NORTHWEST Crawford Creek Impoundment Fishing has been slow. Moorehead Park Pond Fishing has been slow. Brushy Creek Lake Water clarity is decent. Anglers are focusing on panÂżsh around the submerged trees. Try Âżshing in 10 to 20 feet of water. There are lots of bluegills around 9 inches. Storm Lake (including Little Storm Lake) Fishing remains the same as last week. Channel CatÂżsh - Good: Drift Âżshing with night crawlers have been working. White Bass - Fair: White bass can be caught pulling plugs, crankbaits, or casting white twisters. Walleye - Slow: Pulling plugs or shad raps continue to be the best producers. The dredge machine on Storm Lake is in operation. Stay clear of the dredge, booster pump, and pipeline that runs from the dredge to the east shore. North Twin Lake Fishing for yellow bass and crappie is starting to pick up. Anglers are focusing their efforts around docks. Swan Lake Fishing has been slow. Water clarity has been reduced due to algae blooms. Black Hawk Lake The lake is about six inches below crest. Water clarity has been reduced in some areas due to algae blooms. Black Hawk Lakeâ&#x20AC;&#x2122;s Âżshery was renovated last fall. Although we have been restocking the lake with sport Âżsh, there are not a lot of harvestable size Âżsh in the lake yet. Browns Lake Anglers are catching catÂżsh using Sonnyâ&#x20AC;&#x2122;s stink bait and dead shad. Fishing for other species has been slow. Snyder Bend Lake Fishing has been slow. Little Sioux River (Linn Grove to Correctionville) Good sized catÂżsh are taking chicken livers and chicken guts. Use a slip sinker and hook and look for the current breaks along high banks preferably or the standard snags. Anglers should really focus on the current breaks. For more information on lakes and rivers in the Black Hawk District contact the Black Hawk District OfÂżce at 712-657-2638. Lake Smith Channel CatÂżsh - Good: Try cutbait, worms, or stinkbait. Fish are probably biting best the last hour of sunlight to an hour after sunset. Bluegill - Slow: Largemouth Bass - Good: A few largemouths are being caught in the evening and early morning. Lake Catherine Channel CatÂżsh - Good: Cats are biting on minnows or chicken liver. Try early morning or right at dark. They are decent size with some running 7-9 pounds. Largemouth Bass - Good: Largemouth are biting on spinners. Clear Lake Channel CatÂżsh - Good: CatÂżsh are still hitting quite well. Fish can be caught just about anywhere on the lake. Try the edges of the reeds and

Âżsh in the morning or evening with worms, cutbait or stinkbait. Bluegill - Fair: Target the jetties by Ventura. Dangle a worm right on the edge of the rocks off the tips of the jetty in the evening hours. Crappie - Fair: Reports of anglers catching crappies by Dodgeâ&#x20AC;&#x2122;s Point. Walleye - Slow: Anglers are catching a few walleyes trolling or drifting along the north shore, from the state dock area to the east. Muskellunge - Good: Muskies are still hitting. People are hooking them mostly by docks. Yellow Bass - Good: Anglers are still catching good numbers of yellows out from the state dock area in the middle of the main lake. On strong south wind days, shore anglers can pick up good numbers by the boat harborage and reed edges.

Maddie Disney makes this nice tap to return the ball into the Humboldt court in a recent Clarion-GoldÂżeld Cowgirls match with the Wildcats. The sophomore tallied four kills and 7 of 7 serving in the match, and went 36 of 36 with eight aces for the day in a recent tournament in Webster City (photo by Les Houser-Eagle/ Monitor Sports)

Crystal Lake Bluegill - Good: Anglers are picking bluegills up in 7-8 feet of water but some deep, too. Largemouth Bass Good: Anglers have reported catching lots of largemouth. Fish on the outside edges with a bobber and live bait or try a weedless spoon. Walleye - Slow: Walleyes are around 1620 inches. Fish deep during the day, then a little shallower during the evening.

Fall Kanawha 2013

GARAGE SALES October 4 & October 5

Iowa River (Iowa Falls to Marshalltown) Channel CatÂżsh - Good: Fish the logjams and deeper holes and move often. Fish with cutbait or stinkbait. Flathead CatÂżsh - Good: A few reports of anglers catching Ă&#x20AC;atheads on dough balls. If you can get a boat or kayak on the river and Âżnd some of the deeper holes to spend the night with some live bait, you should have good success. Winnebago River Anglers are catching pike, smallmouth bass, and catÂżsh on artiÂżcial lures on the Winnebago from Mason City to Rockford. Northern Pike Good: Anglers are catching their limits on artiÂżcial lures. Channel CatÂżsh - Good: CatÂżsh should be biting well. Try whatever you have available: worms, cutbait, stinkbait, live bait. Some of the best action can be had by throwing a slip sinker rig right in front of a snag/logjam and waiting for a bite. Smallmouth Bass - Good: Smallmouth are also hitting well on a variety of artiÂżcial baits. East Fork Des Moines (Algona to Humboldt) Water is low and anglers are using kayaks. Northern Pike - Good: Pike are also being caught on crankbaits. Channel CatÂżsh - Good: CatÂżsh are good size (3-8 pounds) and can be caught on a variety of bait (worms, cutbait, live bait, stinkbait). Some anglers have had good luck using a purpledescent crankbait. Smallmouth Bass - Good: Smallmouth (most are 10-14 inches though some may push the 20-inch mark) hitting gold and black crankbaits. For lake updates and Âżshing information in the north central area contact the Clear Lake Fish and Wildlife ofÂżce at 641-357-3517. Big Spirit Lake Smallmouth Bass - Slow: Look around rock piles and weed lines with a combination being even better. Largemouth Bass - Slow: Fish have been found in a few different areas but there doesnâ&#x20AC;&#x2122;t seem to be a clear cut pattern. Pitching docks, cranking weed lines, and top water early and late have all caught a few Âżsh. Walleye - Slow: Fishing con-

Â&#x2021; FrL Oct 4 aIter Vchool Â&#x2021; Sat Oct 5 VtartLnJ at  aP

M

id-America

ARKETPLACE

www.midammarketplace.com www.facebook.com/ MidAmericaMarketplace

Â&#x2021; Free 0aS & LLVt at 3ronto

M Miguel Pacheco (Sr.) led the Eagle Grove football team with 107 yards rushing and two touchdowns in their recent 56-36 loss at Nashua-PlainÂżeld. (photo by Les Houser-Eagle/Monitor Sports)

tinues to be slow but a few more Âżsh are starting to come in. Trolling live bait rigs as well as crankbaits early and late in the day seems to be the best. Shore anglers are also catching a few. East Okoboji Lake Yellow Bass - Fair: Try a pilkie tipped with wigglers over rock piles.

 CLIP & SAVE

WE'RE THE MILLERS SEPT. 27 - OCT. 3

STARRING: ED HELMS & JENNIFER ANISTON

R

For more information contact the Spirit Lake Hatchery at 712-3361840.

www.midammarketplace.com

NEW

Tues.: Lunch 11a-1:30p Wed.: Lunch / Supper 5-8p Thu.: Lunch /Supper 5-8p Fri.: Lunch/ Fine Dining 5-9p Sat.: Lunch / Fine Dining 5-9p Sun.: Brunch 10:30-1:30 / Pizza Night 3-8p

MENU

*** MANY NEW ITEMS! ***

SUNDAY NIGHTS FROM 3-8

6+2:7,0(6 7:00 p.m. Nightly (Closed Monday Nights) 1:00 p.m. Matinee on Sunday

PIZZA NIGHT

*******

All Pizzas made on a 12â&#x20AC;&#x2122;â&#x20AC;&#x2122; thin crust Cheese, Sausage, Pepperoni, Canadian Bacon, Meatlovers

7,&.(735,&(6 IRU\RXWK  XQGHU IRUDGXOWV 6HQLRU6XQGD\ V  XS

7XHV 7KXUV$//

Add Extra Toppings: 6aXsagH Â&#x2021; 3HppHroni Â&#x2021; &anadian %aFon Â&#x2021; 0XsKrooPs Â&#x2021; 2nions %OaFN 2OiYHs Â&#x2021; ToPatoHs Â&#x2021; *rHHn 3HppHr Â&#x2021; &KHHsH Including as well Breadsticks, Appetizers, Pretzel Bread with Beer Cheese.

A Night Like It Used To Be III 6DtXUdD\ 2Ft th Â&#x2021;  30 *******

***********************

SIGNATURE ITEM ON FINE DINING: PRIME RIB

Mon., Oct. 7th,  Â&#x2021;    S.P. 0$50#&3 t*/4*%*064$)"15&3t1(Ĺą 0$50#&3 t$-06%:8*5)"$)"/$&0'.&"5#"--4t1( 0$50#&3 t13*40/&34tR 0$50#&3 t(3"7*5:t1(Ĺą FOR MORE INFO: WWW.WINDSORTHEATRE.COM OR

Your Road to Savings

Sunday Brunch 10:30 a.m to 1:30 p.m.

*******

Little Sioux River (state line to Linn Grove) The water is low and Âżsh are concentrated in deeper holes. Try a white twister tail for walleye and a worm on bottom should catch just about anything.

ARKETPLACE

HOURS

No One Under 17 Admitted Without a Parent!!!

West Okoboji Lake Bluegill - Slow: Look for bluegills in and around weeds, with open pockets and weed edges being the most productive. Live bait rigged on a slip bobber rig suspended just above the weeds has been good as well as jigging pilkies and small jigs. A few perch and yellow bass are also being picked up with this presentation.

id-America

3rHparHd E\ +Had &ooN AntKon\ +ansHn ZitK oYHr  \Hars or HxpHriHnFH )orPHr &ooN at &attOHPanÂśs 5HstaXrant in %HOPond

Season Special on Golf: 18 holes and a Cart $27 per person.

FIND US IN FACEBOOK AT WINDSOR HAMPTON

 CLIP & SAVE

f%5,&.<$5'52$'f6+()),(/'

$UHD5HVWDXUDQW

DES MOINES, IA

Iowa Events Center â&#x20AC;˘ Des Moines, IA

October 2â&#x20AC;&#x201C;5, 2013 www.AQSshows.com

Wayne, NE www.hhoa.net 888-200-4460

NOW IS THE TIME TO BUILD!!! Build Your New Home for as little as $1,000 down & lock in the interest rate of a lifetime! RESIDENTIAL CONSTRUCTION & PERMANENT MORTGAGE FINANCING AVAILABLE

Homestead has helped thousands of families build their new home for less.

*8,'(

'LQLQJ JXLGH VSRWV DUH  SHU ZHHN GRXEOHVSRWV IRU  SHU ZHHN RU  VSRWV IRU  SHU ZHHN SUHSDLG 6SRWV DUH ERRNHG ZLWK D ZHHN FRPPLWPHQW

Old Bank Winery Â&#x2021;2SHQWR7XHV6DW Â&#x2021;/RFDWHGLQ'RZQWRZQ.DQDZKD Â&#x2021;)UHHZLQHWDVWLQJ David & Nancy Litch â&#x20AC;˘ 641-762-3406

Â&#x2021;0D\ZHFDWHU\RXUHYHQW" Â&#x2021;2SHQ0RQ)ULWR 6DWWR %LJ%UDG¡V%%4 *URFHU\ Â&#x2021;'RZQWRZQ.DQDZKD

Â&#x2021;$SOLQJWRQ +RXUV7XHVGD\)ULGD\ DPSPSP 6DWXUGD\DPSP /RXQJH+RXUVSP&ORVH /XQFK(YHQLQJ :HHNHQG6SHFLDOV 6HQLRU0HDOVXQWLOSP


SPORTS Boys take one and two spots, girls place second at Emmetsburg

Buffalo Center (Iowa) Tribune â&#x20AC;&#x201D; Wednesday, September 25, 2013 â&#x20AC;&#x201D; PAGE 11

Trevor Aukes returns the opening kickoff of the Bisonâ&#x20AC;&#x2122;s Homecoming game against CAL last Friday.

Tristan Boehm makes a tackle in the Bisonâ&#x20AC;&#x2122;s Homecoming win over CAL last Friday night.

Alex Paulson runs in the Bisonâ&#x20AC;&#x2122;s first touchdown of the evening last Friday, Sept. 20 against CAL.

Austin Haisman carries the ball for the Bison as Austin Paden provides cover last Friday, Sept. 27 in Buffalo Center.

Derek Yegge throws a pass to Austin Paden during last weekâ&#x20AC;&#x2122;s Homecoming game at North Iowa.

Bison celebrate Homecoming with a shut out The North Iowa Bison won a resounding Homecoming victory last Friday night, Sept. 20, as they shut out the CAL Cadets, 53-0. Alex Paulson and Austin Haisman each ran in a touchdown for the Bison in the first quarter, followed by two more by Austin Paden in the second. Combined with three PAT kicks by Derek Yegge, the Bison held a 27-0 advantage heading into halftime. Yegge ran for two touchdowns in the third, complemented by a touchdown run by Trevor Aukes. Noah Paulson scored the final touchdown for the Bison in the fourth, with Spencer Armstrong running in the two-point conversion. â&#x20AC;&#x153;Basic football for us,â&#x20AC;? said Bison Head Coach Don Anderson. â&#x20AC;&#x153;Our offensive line controlled the line of scrimmage; therefore, we were able to run the ball very effectively. We had six different guys score TDs, which is great. I thought all of our backs ran well, and some donâ&#x20AC;&#x2122;t have a lot of experience.

Bison League

September 9, 2013 W L K & H Coop Oil 43 17 Ronâ&#x20AC;&#x2122;s Electric 38 22 Ollenburg Motors 34 26 Berggren Seeds 33 27 Lake Mills Motel 32½ 24½ Timber Tree Service 26 34 Bison Graphics/ AJ Em 21 39 Peteâ&#x20AC;&#x2122;s Plumbing 12½ 47½ Highs Posted: team game, Timber Tree Service (681), team series, Bison Graphics/AJ Embr (1818), ind. game, Larry Blomster (254), ind. series, Eric Knudson (693)

Twin City League

September 12, 2013 W Ag Performance 47 Stateline Coop 43

L 22 26

â&#x20AC;&#x153;The team rushing total was 351 yards, which is pretty good,â&#x20AC;? added Anderson. â&#x20AC;&#x153;That type of total usually means you will win the game. Our overall passing games needs to improve â&#x20AC;&#x201C; blocking, catching, route running and decision-making. We are going to have to throw the ball effectively down the stretch to beat some of the teams we play. Defensively, we played better but still need to play with a lower pad level and attack blocks better. I was really happy with our young kids in the way they played in either half. One of our goals was to shut out CAL, which meant everyone had to contribute.â&#x20AC;? The Bison host a top-five ranked team this week, as they face West Bend-Mallard on Friday, Sept. 27 in Buffalo Center. North Iowa CAL

13 0

14 18 0 0 Cadets Passes attempted 9 Completed 1 Yards gained 5 Rushing plays 37 Yards gained 61 Total yards 66

8 0

53 0 Bison 5 3 11 49 351 362

Lofstrom Seeds 40 29 Nickâ&#x20AC;&#x2122;s Auto Body 40 29 Murra Hardware 31 38 Buffalo Lanes 26 40 Team 7 19 38 BYE 21 48 Highs Posted: team game, Ag Performance (864), team series, Ag Performance (2343), ind. game, Lefty Knudson (257), ind. series, Lefty Knudson (701)

Wed. Ladies Night

September 18, 2013 W L Emporium 15 5 Heidiâ&#x20AC;&#x2122;s Hair Care 11 9 K & H Coop Oil 11 9 Pioneer Bank 10 10 Parts Plus 9 11 BYE 4 16 Highs Posted: team game, Heidiâ&#x20AC;&#x2122;s Hair Care (511), team series, K & H Coop Oil (1404), ind. game, Nicole Baumann (216), ind. series, Nicole Baumann (552)

First downs Turnovers Penalties

6 18 1 1 4/29 4/22 RUSHING Austin Paden 13/110, Alex Paulson 4/68, Austin Haisman 11/61, Derek Yegge 8/47, Noah Paulson 6/38, Trevor Aukes 3/29, Jesse Boehm 1/1, Spencer Armstrong 3/-3 PASSING Derek Yegge 4/3/75, Spencer Armstrong 1/0/0 RECEIVING Austin Paden 2/4, Derrick Wubben 1/7 SCORING Derek Yegge 12 rushing points, 3 PAT points, Austin Paden 12 rushing points, Trevor Aukes 6 rushing points, Austin Haisman 6 rushing points, Alex Paulson 6 rushing points, Noah Paulson 6 rushing points, Spencer Armstrong 2 2-pt conv. points. KICKOFFS Derek Yegge 9/334 KICKOFF RETURNS Trevor Aukes 1/10, Derek Yegge 2/10 PUNT RETURNS Derek Yegge 1/25, Tristan Boehm 1/0 INTERCEPTIONS Austin Paden 1 SACKS Josh Mathahs 2, Jesse Boehm 1 TACKLES Solo/assist: Jesse Boehm 7/3, Tristan Boehm 5/4, Josh Mathahs 4/4, Hunter Gelhaus 3/2, Austin Paden 0/5, Logan Eichenberger 2/1, Steven Milbrandt 0/3, Derek Yegge 3/0, Trevor Aukes 1/1, Alex Paulson 0/2, Sam Hassebroek 0/1, Noah Paulson 0/1, Derrick Wubben 0/1 DISTRICT RESULTS 9-20-13 Laurens-Marathon 30, CWL 26 Newell-Fonda 50, Northeast Hamilton 24 North Iowa 53, CAL 0 West Bend-Mallard 66, GTRA 8

The North Iowa cross country teams each took three medalist spots at the Emmetsburg Invitational held Monday, Sept. 16. The North Iowa boys fielded an incomplete team but took the top two spots in the race. Connor Smith was the meet champion with a time of 16:57, followed by Daniel Miller in second place with a time of 17:22. Taylor Ostermann also medaled in 15th place. The Lady Bison squad also produced three medalists, as Madison Blodgett took third, Brooke Hovland was fourth, and Krista Hovland placed 13th. The girls took second place overall, with a team score of 53 points. â&#x20AC;&#x153;Both [Madi and Brooke] were nearly ninety seconds faster this year than last, which is a testament to their summer training,â&#x20AC;? said Head Coach Jonathan Potter. â&#x20AC;&#x153;Krista ran a solid race to earn medalist honors. We need to cut the gap between our #3 and #5 runners to about 30 seconds in order for us to be more com-

petitive as a team. The kids have been working hard, so hopefully weâ&#x20AC;&#x2122;re able to make the adjustments necessary as the year progresses. â&#x20AC;&#x153;On the boysâ&#x20AC;&#x2122; side, both Connor and Dan ran phenomenal races,â&#x20AC;? said Potter. â&#x20AC;&#x153;Connor took the lead early and dictated the pace and never relinquished the lead, earning his first high school meet championship. Dan ran a great back half of the race and closed the gap with the second place runner and out-gutted him the last 400m. To go 1-2 in a meet with the times we posted is quite an accomplishment. Taylor ran a lifetime best and earned his first medalist honors in the process; while Josh ran a personal record by roughly a minute. Overall, despite not fielding a team for the boys due to injury, they came out and competed well.â&#x20AC;? While this was a small meet, with only six schools, Potter says there was quality competition. â&#x20AC;&#x153;The key training points for our squads now are to stay healthy and continue to

Ladies clinch first win versus Newman The North Iowa Lady Bison picked up their first win of the volleyball season last Tuesday, Sept. 17, as they defeated Newman Catholic 3-0 in Buffalo Center. Set scores were 25-22, 25-18 and 25-15. Rachel Boekelman led the Lady Bison in kills with 10, followed by Rebecca Murray 7, Shelby Berte 5, Paige Hassebroek 4, Carly Main 3 and Mica Johnson 2. Scoring aces were Johnson with 4, Berte and Boekelman with 3 each, Main with 2 and Murray with 1. Boekelman and Hassebroek each had two blocks, and Main and Ashley Huntington each had 6 digs. â&#x20AC;&#x153;I think we came out this night a little too confident or unfocused due to all the Homecoming festivities, and maybe a combination of the two,â&#x20AC;? said Head Coach Carissa Judge. â&#x20AC;&#x153;The first set, we jumped ahead 5-0, but then ended up getting down by four or five points mid-way through the game. I was proud of our girls that they did not give up and kept fighting back until we pulled off the win. After the first set, the girls stepped up their game in the next two and played well. â&#x20AC;&#x153;This game was supposed to be on the road, but due to Newmanâ&#x20AC;&#x2122;s gym floor not being completed yet, we were able to host them this year,â&#x20AC;? explained Judge. â&#x20AC;&#x153;It was great to play this game at home, especially during Homecoming week and get a win on top of it all.â&#x20AC;? The Lady Bison traveled to Forest City on Saturday, Sept. 21, where they tallied two wins and three losses in tournament action. Opponents and scores included: Webster City: 13-21, 10-21 North Union: 19-21, 15-21 Saint Ansgar: 19-21, 16-21 Clarion Goldfield: 21-12, 14-21, 15-8 Clear Lake: 19-21, 22-20, 17-15

Kill leaders on the day for North Iowa included Boekelman with 15, Hassebroek 13, Berte 10, Johnson 9, Murray 8, Main 6 and Melz 1.

Scoring aces were Murray with 7, Main 4, Berte 2 and Hassebroek and Johnson with 1 each. â&#x20AC;&#x153;The Forest City Tournament is always a long day, but a great tournament because you get a lot of games in against some different teams we donâ&#x20AC;&#x2122;t usually see throughout the season,â&#x20AC;? said Judge. â&#x20AC;&#x153;We started off the day with Webster City, who is ranked 10th in 4A. They were a tough team to start off the day. I thought we played well, but their tall front row made it difficult for us to hit around the block.â&#x20AC;? Next, North Iowa lost some close matches to North Union and Saint Ansgar. â&#x20AC;&#x153;In the first set of both of these games, we jumped out to an early lead,â&#x20AC;? said Judge. â&#x20AC;&#x153;Unfortunately, we got stuck in a rut on a server or two and had a hard time returning the ball; allowing them to catch back up and eventually get the win. We struggled at times with communication between each other and keeping the control of the game in our hands, with keeping the serve and being the aggressive team. â&#x20AC;&#x153;We ended the day on a great note, beating Clarion-Goldfield and Clear Lake in three sets each,â&#x20AC;? said Judge. â&#x20AC;&#x153;This made for an exciting end to our day. The girls played very well. We served great. We were the aggressive team, dug the ball up, and blocked better than we had all day. It was a lot of fun to watch them play. The last game of the day was one of the most exciting. We got down 9-2 right away, then 11-6, until Shelby Berte went on a 7-serve run; putting us ahead, 13-11. Paige Hassebroek was hot during that run, getting about 4-5 kills in a row. â&#x20AC;&#x153;I was so proud of how our girls never gave up and kept believing that we could win that game,â&#x20AC;? added Judge. â&#x20AC;&#x153;They fought to the end, and it was a great way to end our day. Overall, it was a good day, and the girls kept improving as the day went on.â&#x20AC;?

apply ourselves as we have in practice,â&#x20AC;? said Potter. Varsity Girls Madison Blodgett [16:28/3rd (medalist)], Brooke Hovland [16:52/4th (medalist)], Krista Hovland [18:00/13th (medalist)], Christa Miller [18:52/16th], Samantha Sevley [19:10/17th], Kayla Limberg [20:22/22nd], Lexis Julsrud-Wertjes [20:37/23rd] Varsity Boys Connor Smith [16:57/1st (meet champion)], Daniel Miller [17:22/2nd (medalist)], Taylor Ostermann [20:48/15th (medalist)], Josh Clarke [22:35/19th] Junior Varsity Girls Megan Davis [21:20/8th (medalist)] Junior High Boys Jackson Berte [16:08/31st]

Opsui!Jpxb! Tdippm!Nfov Monday, September 30: B: WG breakfast pizza and banana or WG cereal, WG toast, banana K-8 L: Sock-rockinâ&#x20AC;&#x2122; chili, applesauce, fresh cucumber and tomato dip, whole-grain roll 9-12 L: Pizza wrap, carrots, California blend, pears, applesauce, whole-grain cookie Tuesday, October 1: B: WG pancakes and hot cinnamon apples or WG cereal, WG toast and hot cinnamon apples K-8 L: Sweet and sour chicken nuggets with brown rice, fresh red grapes, carrots, corn 9-12 L: Wokinâ&#x20AC;&#x2122; orange chicken with brown rice, green beans, mandarin oranges, pineapple Wednesday, October 2: B: Cheese omelet, WG toast and orange smiles or WG cereal, WG toast and orange smiles K-8 L: Chicken alfredo with a twist, pears in cherry Jell-O, garlic broccoli 9-12 L: Chicken alfredo with a twist, tossed side salad, garlic broccoli, fresh banana, mixed fruit, whole-grain roll Thursday, October 3: B: Oatmeal w/blueberries and WG toast or WG cereal, WG toast and blueberries K-8 L: Mexican pizza, peach cup, tossed side salad 9-12 L: Quirky quesadilla, golden corn, peaches, fresh grapes, tortilla scoops with salsa Friday, October 4: B: Yogurt w/WG pumpkin chocolate chip muffin and pears or WG cereal, WG toast and pears K-8 L: Turkey and ham deli sub, fresh banana, baby carrots with hummus 9-12 L: Grilled chicken on a bun, fresh cucumber and tomato dip, baked beans, fresh pear, strawberry cup

6HHXVIRUDOO\RXU %DQNLQJ1HHGV 6WDWH6DYLQJV%DQN  

1RUWK0DLQ 5DNH,RZD

%HQ.UDPHUKDVDFFHSWHGWKH7HUULWRU\ 0DQDJHU SRVLWLRQ LQ %XIIDOR &HQWHU %HQKDVGRQHDQH[FHOOHQWMREVHOOLQJ IRU (UQLH :LOOLDPV /7' RXW RI WKH $OJRQD ORFDWLRQ IRU WKH SDVW \HDU DQGZHORRNIRUZDUGWRKLPJURZLQJ VDOHV ZLWKLQ WKH %XIIDOR &HQWHU DUHD &RQJUDWXODWLRQVRQ\RXUQHZWHUULWRU\ %HQ

.%(:$0

SOD\V\RXUIDYRULWHROGLHVDQGNHHSV\RX LQIRUPHGRIWKHODWHVW QHZVZHDWKHUVSRUWVDQGPDUNHWV

.%(:)0

LV\RXUSODFHIRUWRGD\·VFRXQWU\DQG\HV WHUGD\·VIDYRULWHVKRXUVDGD\GD\V DZHHN-RLQXVDVZHFRYHUDUHDVSRUWV


PAGE 12 â&#x20AC;&#x201D; Buffalo Center (Iowa) Tribuneâ&#x20AC;&#x201D; Wednesday, September 25, 2013

HOMECOMING/LOCAL NEWS

Hunting with Heroes returns

The third annual Hunting with Heroes event is coming to Lakota during Veteranâ&#x20AC;&#x2122;s Day weekend, thanks to the efforts of many donors and volunteers. A new donor this year is StateLine Cooperative, who is donating the meat for an estimated 500 guests at this yearâ&#x20AC;&#x2122;s veteransâ&#x20AC;&#x2122; banquet, which will be held Sunday, Nov. 10. From left are: John Stelter of StateLine Coop., Hunting with Heroes organizer Bernie Becker, and George Vaske of StateLine Coop. Organizers will once again welcome several marines from the Wounded Warrior Battalion at Camp Lejeune, NC for a weekend of pheasant hunting and fellowship. The event is capped off by a Veterans Appreciation Banquet. All area veterans, spouses and surviving veteransâ&#x20AC;&#x2122; spouses are invited to the all-expenses-paid banquet on Sunday, Nov. 10 beginning at 5:30 p.m. in the Lakota Eagle Center. Anyone wishing to attend should RSVP to Cathy Kelly at 515-538-0572 or Denny Murra at 319-269-4124 by November 1.

  

Â&#x2021;1HZ*HO%HGV Â&#x2021;7UDGLWLRQDOFRLOEHGV Â&#x2021;1DWXUDO/DWH[EHGV

Â&#x2021;6SDFHDJH0HPRU\)RDPEHGV Â&#x2021;$GMXVWDEOHEHGVZLWKPDVVDJH

YYY'ORQTKWO(WTPKVWTG1PNKPGEQO 2J%GNN

Candidates file for city office City elections will be held Tuesday, Nov. 5 in Buffalo Center, Lakota, Rake and Thompson, and numerous candidates have filed to run for the positions up for election. In Buffalo Center, Mayor Troy Armstrong is seeking reelection to his position. Also seeking reelection are City Councilmen Chuck Silber and Pete Paulson, who will be challenged by Les Wubben for one of the two seats up for election. In Lakota, incumbent Debra Steven was the only candidate to file election papers for city council, with a total of three seats up for election this year. Rake Mayor Louise Hagedorn is seeking another term as the only

candidate for mayor. Three city council seats are up for election, and incumbents Melissa Duve and Phil Benn are in the running, along with Ronald Johnson. In Thompson, Robert Johnson will be on the ballot for another term as mayor. Incumbent councilmen Todd Hughes and Fred Fiebelkorn are also seeking reelection unopposed.

0,66,1* 0,66,1*)520+$03721,2:$6,1&( (WKDQ.D]PHU]DN $JH 0LVVLQJ6LQFH 'DWHRI%LUWK (WKQLFLW\:KLWH 6H[0DOH +DLU&RORU'DUN%ORQGH (\H&RORU%OXH :HLJKWOEV +HLJKWϫ 0LVVLQJ)URP+DPSWRQ,RZD

First trial begins in sexual abuse case The first of three trials begins next week for a Thompson man accused of sexual abuse. Clarence Miller, 80, faces charges of six counts of second-degree sexual abuse. Millerâ&#x20AC;&#x2122;s attorney requested a change of venue for the trial last month, which was granted along with the severing of the trial into three parts, due to separate victims. The first trial will begin Monday, Sept. 30 in Butler County. Other trials are scheduled for Oct. 14 in Bremer County and Oct. 28 back in Butler County. Miller turned himself in to authorities last August when charges were filed following an investigation by the Iowa Division of Criminal Investigation, Department of Human Services and Winnebago County Attorneyâ&#x20AC;&#x2122;s Office.

27+(5,1)250$7,21 'LVWLQJXLVKLQJ0DUNV,QFOXGH%HDUG*UDWHIXO'HDG7DWWRRRQOHIWXSSHUDUP +HZDVUHSRUWHGO\ZHDULQJRUDQJHRUSHDFKFRORUHGVKRUWVDQGDZKLWH  RUWHDOSULQWHGVKLUW +HPD\EHGULYLQJDVLOYHU9RONVZDJRQ-HWWDZLWKDQ,RZDOLFHQVHSODWH  RI$8= 3/($6(&217$&7<285 /2&$/32/,&( '(3$570(17,)<28 6((7+,60$125 +$0372132/,&($7




Bctsept25th2013  
Advertisement
Read more
Read more
Similar to
Popular now
Just for you