Issuu on Google+

1112 clevelandorchestra.com

THE CLEVELAND ORCHESTRA F R ANZ WELSER-MÖST M U SIC DI R ECTOR November 25, 26, 27 FABIO LUISI CONDUCTS MOZART AND STRAUSS


Hermès, contemporar y artisan since 1837.

18 East Orange Street Chagrin Falls, Ohio (440) 247-2828


It’s never too early to appreciate great music. 7KDW¶VZK\ZH¶UHVRSURXGWRVXSSRUW7KH&OHYHODQG 2UFKHVWUD¶VPXVLFHGXFDWLRQSURJUDPVIRUFKLOGUHQPDNLQJ SRVVLEOHWKHUHZDUGVDQGEHQHILWVRIPXVLFLQWKHLUOLYHV

AUTO GROUP

LEXUS, BMW, MINI, LINCOLN, CADILLAC. BUICK, CHEVROLET, CHRYSLER, DODGE, FIAT, FORD, GMC, HONDA, HYUNDAI, JEEP, KIA, MAZDA, NISSAN, SCION, TOYOTA, VW. WILLOUGHBY HILLS, MENTOR, PAINESVILLE, STREETSBORO, MADISON.


THE CLEVELAND ORCHESTRA O F

C O N T E N T S

WEEK 6 9

About the Orchestra

1112

CO V E R P H OTO G R A P H BY R O G E R MA S T R O I A N N I

TA B L E

Musical Arts Association . . . . . . . . . . . . . . . . . . . . . . 9 Music Director . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 13 Conductors . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 17 Roster of Musicians . . . . . . . . . . . . . . . . . . . . . . . . . 18 Guest Information . . . . . . . . . . . . . . . . . . . . . . . . . . 73 Severance Hall . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 91 The Cleveland Orchestra . . . . . . . . . . . . . . . . . . . . 92

21

In the News Perspectives . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Orchestra News . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Community and Education . . . . . . . . . . . . . . . . . . In Focus: A Look Back . . . . . . . . . . . . . . . . . . . . . . .

35

21 22 69 93

Concert — Week 6 Concert Previews . . . . . . . . . . . . . . . . . . . . . . . . . . . Program . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Introducing the Program . . . . . . . . . . . . . . . . . . . . R. STRAUSS Till Eulenspiegel’s Merry Pranks . . . . . . . . . . . .

33 35 37 39

MOZART

Piano Concerto No. 17 . . . . . . . . . . . . . . . . . . . . 45 R. STRAUSS Aus Italien . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 51

Copyright © 2011 by The Cleveland Orchestra and the Musical Arts Association Eric Sellen, Program Book Editor E-MAIL: esellen@clevelandorchestra.com Program books for Cleveland Orchestra concerts are produced by The Cleveland Orchestra and are distributed free to attending audience members. Program book advertising is sold through Live Publishing Company at (216) 721-1800 The Musical Arts Association is grateful to the following organizations for their ongoing generous support of The Cleveland Orchestra: National Endowment for the Arts, the State of Ohio and Ohio Arts Council, and to the residents of Cuyahoga County through Cuyahoga Arts and Culture.

Conductor: Fabio Luisi . . . . . . . . . . . . . . . . . . . . . . . 57 Soloist: Jonathan Biss . . . . . . . . . . . . . . . . . . . . . . . 59

48

Future Concerts Concert Calendar . . . . . . . . . . . . . . . . . . . . . . . . . . . 48 In the Season Spotlight . . . . . . . . . . . . . . . . . . . . . 61 Upcoming Concerts . . . . . . . . . . . . . . . . . . . . . . . . 94

62

Donors and Sponsors Endowed Funds . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Heritage Society . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Corporate Support . . . . . . . . . . . . . . . . . . . . . . . . . . Foundation & Government Support . . . . . . . . . Individual Support. . . . . . . . . . . . . . . . . . . . . . . . . . .

4

The Cleveland Orchestra is proud of its long-term partnership with Kent State University, made possible in part through generous funding from the State of Ohio. The Cleveland Orchestra is proud to have its home, Severance Hall, located on the campus of Case Western Reserve University, with whom it has a long history of collaboration and partnership.

62 64 77 79 80

This program book is printed on paper that includes 10% recycled post-consumer content. All unused books are recycled as part of the Orchestra’s regular business recycling program.

Table of Contents

The Cleveland Orchestra


Enjoy the best of University Circle Choose Judson today

Independent living at Judson Manor or Judson Park, both located in the heart of University Circle, can be a rewarding experience for you 365 days a year. After all, the “Circle” is where it’s happening in Cleveland. Both the Park and Manor offer something for everyone. Come now while you can enjoy all of the benefits. Declare your independence from all the chores, taxes and expenses of your home—start living smart at Judson. Visit us today. Call (216) 791-2004 or visit www.judsonsmartliving.org.

Judson Manor Judson Park South Franklin Circle Smart LivingTM at Home


    

  

 

 !     


Photo by Roger Mastroianni

Exceptional

We are proud to sponsor

The Cleveland Orchestra in helping to build audiences for the future through an annual series of Baker Hostetler Guest Artists

CHICAGO CINCINNATI CLEVELAND COLUMBUS COSTA MESA DENVER HOUSTON LOS ANGELES NEW YORK ORLANDO WASHINGTON, DC

www.bakerlaw.com Š 2011 Baker & Hostetler LLP


OUR INDEPENDENCE IS YOUR PEACE OF MIND :HDUH*OHQPHGH³ZH·UHVWURQJÀQDQFLDOO\VRXQGDQGSURXGO\LQGHSHQGHQW $QGZHLQWHQGWRVWD\WKDWZD\ %HLQJ SULYDWHO\ RZQHG SODFHV XV LQ D SRVLWLRQ RI VWUHQJWK 8QOLNH SXEOLFO\ KHOG FRPSDQLHVZHDUHQRWGULYHQWRFKDVHVKRUWWHUPSURÀWV,QVWHDGLQGHSHQGHQFH JLYHVXVDVHFXUHORQJWHUPRXWORRN2XUDFKLHYHPHQWLVPHDVXUHGVROHO\E\KRZ ZHPDQDJHZHDOWKIURPRQHJHQHUDWLRQWRWKHQH[W )RXQGHG DV D WUXVW FRPSDQ\ PRUH WKDQ  \HDUV DJR ZH·YH JXLGHG IDPLOLHV IDPLO\ RIÀFHV DQG HQGRZPHQW DQG IRXQGDWLRQ FOLHQWV ZLWK WLPHWHVWHG DGYLFH DQGVRSKLVWLFDWHGLQYHVWPHQWPDQDJHPHQW7RGD\ZHKDYHELOOLRQLQDVVHWV XQGHUPDQDJHPHQWIRUFOLHQWVDFURVVWKHFRXQWU\DQGDEURDG 7RZRUNZLWKDSDUWQHUGHGLFDWHGWRLQVSLULQJWUXVW³FRPHWR*OHQPHGH

*OHQPHGH·VVHUYLFHVDUHEHVWVXLWHGIRUWKRVHZLWKPLOOLRQRUPRUHWRLQYHVW 3OHDVHFDOO/LQGD2OHMNRIRUDSHUVRQDOFRQYHUVDWLRQ __OLQGDROHMNR#JOHQPHGHFRP


B O A R D O F T R U S T E E S as of Setember 2011

T H E M U S I C AL ARTS AS SOCIATION operating The Cleveland Orchestra, Severance Hall, and Blossom Festival O F F I C E R S A ND E X E C UT I VE C O MMIT T E E Dennis W. LaBarre, President Richard J. Bogomolny, Chairman The Honorable John D. Ong, Vice President

Norma Lerner, Honorary Chair Raymond T. Sawyer, Secretary Beth E. Mooney, Treasurer

Jeanette Grasselli Brown Matthew V. Crawford Michael J. Horvitz Douglas A. Kern

Virginia M. Lindseth Alex Machaskee Nancy W. McCann John C. Morley

Larry Pollock Alfred M. Rankin, Jr. Audrey Gilbert Ratner Barbara S. Robinson

R E S I D E NT TR U S T E E S Gay Cull Addicott George N. Aronoff Dr. Ronald H. Bell Richard J. Bogomolny Charles P. Bolton Jeanette Grasselli Brown Helen Rankin Butler Scott Chaikin Paul G. Clark Owen M. Colligan Robert D. Conrad Matthew V. Crawford Alexander M. Cutler Bruce P. Dyer Terrance C. Z. Egger Hiroyuki Fujita Paul G. Greig Robert K. Gudbranson Jeffrey A. Healy Stephen H. Hoffman David J. Hooker Michael J. Horvitz Marguerite B. Humphrey

David P. Hunt Christopher Hyland James D. Ireland III Clifford J. Isroff Trevor O. Jones Jean C. Kalberer Nancy F. Keithley Douglas A. Kern John D. Koch S. Lee Kohrman Charlotte R. Kramer Dennis W. LaBarre Norma Lerner Virginia M. Lindseth Alex Machaskee Robert P. Madison Nancy W. McCann Thomas F. McKee Samuel H. Miller Beth E. Mooney John C. Morley Donald W. Morrison Meg Fulton Mueller

Gary A. Oatey Katherine T. O’Neill The Honorable John D. Ong Larry Pollock Alfred M. Rankin, Jr. Clara T. Rankin Audrey Gilbert Ratner Charles A. Ratner James S. Reid, Jr. Barbara S. Robinson Paul Rose Steven M. Ross Raymond T. Sawyer Luci Schey Neil Sethi Hewitt B. Shaw, Jr. David L. Simon Richard K. Smucker R. Thomas Stanton Thomas A. Waltermire Geraldine B. Warner Paul E. Westlake Jr. David A. Wolfort

NO N- R E S I D E NT T RUS T E E S Virginia Nord Barbato (NY) Laurel Blossom (SC) Richard C. Gridley (SC)

George Gund III (CA) Loren W. Hershey (DC) Mrs. Gilbert W. Humphrey (FL)

Herbert Kloiber (Germany) Ludwig Scharinger (Austria)

TR U S TE E S E X- O FFI C I O Iris Harvie, President, Volunteer Council of The Cleveland Orchestra Beth Schreibman Gehring, President, Women’s Committee of The Cleveland Orchestra Phyllis Knauf, State Chair, Blossom Women’s Committee TR U S TE E S E M E RI T I David A. Ruckman Naomi G. Singer

H O N O RARY T RUS T EES FOR LIFE Robert W. Gillespie Francis J. Callahan Dorothy Humel Hovorka Mrs. Webb Chamberlain Robert F. Meyerson Oliver F. Emerson Allen H. Ford

PA S T PR E S I D E NT S D. Z. Norton 1915-21 John L. Severance 1921-36 Dudley S. Blossom 1936-38 Thomas L. Sidlo 1939-53

Percy W. Brown 1953-55 Frank E. Taplin, Jr. 1955-57 Frank E. Joseph 1957-68 Alfred M. Rankin 1968-83

THE CLEVELAND ORCHESTRA Gary Hanson, Executive Director

clevelandorchestra.com

Severance Hall 2011-12

Carolyn Dessin, Chair, Cleveland Orchestra Chorus Operating Committee Dr. Lester Lefton, President, Kent State University Barbara R. Snyder, President, Case Western Reserve University

Ward Smith 1983-95 Richard J. Bogomolny 1995-2002, 2008-09 James D. Ireland III 2002-08

SEVERANCE HALL 11001 Euclid Avenue Cleveland, Ohio 44106 Telephone (216) 231-7300

Musical Arts Association

9


DECEMBER

HOLIDAY 11-23 FESTIVAL

Visit clevelandorchestra.com for full concert details.


Pediatric emergency care is right in your neighborhood. Available 24/7 at six locations. You’re now closer than ever to emergency services designed specifically for babies and children with kid-focused physicians, nurses and support staff and backed by the most trusted name in children’s health care – as well as the region’s only Level I Pediatric Trauma Center, if a higher level of care is required. All in six convenient locations with staff dedicated to getting you and your family the care you need as quickly as possible.

UH Rainbow Babies & Children’s Hospital 11100 Euclid Avenue, Cleveland UH Ahuja Medical Center 3999 Richmond Road, Beachwood UH Geauga Medical Center 13207 Ravenna Road, Chardon UH Twinsburg Health Center 8819 Commons Boulevard, Suite 101, Twinsburg St. John Medical Center 29000 Center Ridge Road, Westlake Southwest General 18697 Bagley Road, Middleburg Heights

There’s only one Rainbow. 216-UH4-KIDS (216-844-5437) | RainbowBabies.org Facebook.com/UHRainbowBabies | Twitter.com/UHRainbowBabies © 2011 University Hospitals

RBC 00438


Franz Welser-Möst Music Director Kelvin Smith Family Endowed Chair The Cleveland Orchestra

marks Franz Welser-Möst’s tenth year as Music Director of The Cleveland Orchestra, with a long-term commitment extending to the Orchestra’s centennial in 2018. Under his direction, the Orchestra is acclaimed for its continuing artistic excellence, is enlarging and enhancing its community programming at home, is presented in a series of ongoing residencies in the United States and Europe, continues its historic championship of new composers through commissions and premieres, and has re-established itself as an important operatic ensemble. Concurrently with his post in Cleveland, Mr. Welser-Möst became General Music Director of the Vienna State Opera in September 2010. With a committed focus on music education in Northeast Ohio, Franz Welser-Möst has taken The Cleveland Orchestra back into public schools with performances in collaboration with the Cleveland Metropolitan School District. The initiative continues and expands upon Mr. Welser-Möst’s active participation in community concerts and educational programs, including the Cleveland Orchestra Youth Orchestra and partnerships with music conservatories and universities across Northeast Ohio. Under Mr. Welser-Möst’s leadership, The Cleveland Orchestra has established an ongoing biennial residency in Vienna at the famed Musikverein concert hall and at the Lucerne Festival in Switzerland. Together, they have appeared in residence at Suntory Hall in Tokyo, Japan, and at the Salzburg Festival, where a 2008 residency included five sold-out performances of a staged production of Dvořák’s opera Rusalka. In the United States, Mr. Welser-Möst has established an annual multi-week Cleveland Orchestra Miami Residency in Florida and launched a new biennial residency at New York’s Lincoln Center Festival in 2011. Under Franz Welser-Möst’s direction, The Cleveland Orchestra has performed thirteen world and fifteen United States premieres. Through the Roche Commissions project, he and the Orchestra have premiered works by Harrison Birtwistle, Chen Yi, Hanspeter Kyburz, George Benjamin, and Toshio Hosokawa in partnership with the Lucerne Festival and Carnegie Hall. In addition, the Daniel R. Lewis Young Composer Fellow program has brought new voices to the repertoire, including Marc-André Dalbavie, Matthias Pintscher, Susan Botti, Julian Anderson, Johannes Maria Staud, Jörg Widmann, and Sean Shepherd. Franz Welser-Möst has led opera performances each season during his P H OTO BY D O N S N Y D E R

T H E 2 01 1 - 1 2 S E A S O N

Severance Hall 2011-12

Music Director

13


P H OTO BY R O G E R MA S T R O I A N N I

tenure in Cleveland, re-establishing the Orchestra as an important operatic ensemble. Following six opera-in-concert presentations, he brought fully staged opera back to Severance Hall with a three-season cycle of Zurich Opera productions of the Mozart-Da Ponte operas. He leads concert performances of Strauss’s Salome at Severance Hall and at Carnegie Hall during the 2011-12 season. Franz Welser-Möst became General Music Director of the Vienna State Opera with the 2010-11 season. His long partnership with the company has included acclaimed performances of Tristan and Isolde, a new production of Wagner’s Ring cycle with stage director Sven-Eric Bechtolf, and, in his first season in the post, critically praised new productions of Hindemith’s Cardillac and Janáček’s Katya Kabanova. During the 2011-12 season, he continues his survey of the operas of Janáček with a new production of From the House of the Dead and also leads a new production of Verdi’s Don Carlo. Mr. Welser-Möst also maintains an ongoing relationship with the Vienna Philharmonic. Recent performances with the Philharmonic include appearances at the Lucerne Festival and Salzburg Festival, in Tokyo, and in concert at La Scala Milan, as well as leading the Philharmonic’s 2011 New Year’s Day concert, viewed by telecast in seventy countries worldwide. Across a decade-long tenure with the Zurich Opera, culminating in three seasons as General Music Director (2005-08), Mr. Welser-Möst led the company in more than 40 new productions and numerous revivals. Franz Welser-Möst’s recordings and videos have won major awards, including the Gramophone Award, Diapason d’Or, Japanese Record Academy Award, and two Grammy nominations. With The Cleveland Orchestra, he has created DVD recordings of live performances of four Bruckner symphonies, presented in three accoustically distinctive venues: Symphony No. 5 in the Abbey of St. Florian in Austria, Symphony No. 9 in Vienna’s Musikverein, and Symphonies Nos. 7 and 8 at Severance Hall. With Cleveland, he has also released a recording of Beethoven’s Ninth Symphony as well as an all-Wagner album featuring soprano Measha Brueggergosman. DVD releases on the EMI label have included Mr. Welser-Möst leading Zurich Opera productions of The Marriage of Figaro, Così fan tutte, Don Giovanni, Der Rosenkavalier, La Bohème, Fierrabras, and Peter Grimes. For his talents and dedication, Mr. Welser-Möst has received honors that include recognition from the Western Law Center for Disability Rights, honorary membership in the Vienna Singverein, appointment as an Academician of the European Academy of Yuste, a Gold Medal from the Upper Austrian government for his work as a cultural ambassador, and the Kilenyi Medal from the Bruckner Society of America. He is the co-author of Cadences: Observations and Conversations, published in a German edition in 2007.

14

Music Director

The Cleveland Orchestra


EVS\WbQ][Sab]bVSTcbc`S]T g]c`TO[WZgยนaeSOZbV g]c`dWaW]\Wa]c`W\a^W`ObW]\ :SbยนabOZYOP]cbg]c`ZSUOQg /b4W`ab4O[WZgeSc\RS`abO\RbVSRSZWQObSQ][^ZSfWbWSaW\d]ZdSReWbV[O\OUW\UeSOZbV7bยนaeVg eSยน`SRSRWQObSRb]ZWabS\W\UO\RZSO`\W\UOa[cQVOP]cbg]c`dWaW]\Oa^]aaWPZSPST]`S]TTS`W\U ]c`^S`a]\OZWhSR]PXSQbWdSORdWQSAS`dW\UOag]c`TO[WZg14=eSยน`S^`S^O`SRb]OQbW\g]c` TO[WZgยนaPSabW\bS`SabObOZZbW[SaยตQOZZW\Uc^]\OeWRS`O\US]TQcab][aS`dWQSaO\RQ]]`RW\ObW\U Q][[c\WQObW]\aO\Rab`ObSUWSaPSbeSS\g]c`ORdWa]`a/ZZeVWZSYSS^W\UW\[W\RbVObbVS[]ab dOZcOPZSOaaSbW\[O\OUW\Ug]c`TO[WZgยนaeSOZbVWag]c`dWaW]\T]`WbaTcbc`S 4]`O^`WdObSQ]\acZbObW]\Q]\bOQb2]cUZOa4`WSa;O\OUW\U2W`SQb]`Ob $'% ''#

2 = C 5 : / A  1   4 @ 7 3 A       ; / < / 5 7 < 5  2 7 @ 3 1 B = @        $  ' %   ' ' # / 9 @ = <      1 / < B = <      1 6 7 1 / 5 =      1 : 3 D 3 : / < 2      1 = : C ; 0 C A

4W`ab4O[WZgWaO^`OQbWQSO`SO]T4W`ab;S`Wb0O\Y</


Itâ&#x20AC;&#x2122;s time to start building towards an economic crescendo.

Like a world-class orchestra, business in Cleveland works best when itâ&#x20AC;&#x2122;s well conducted. And with its convenient proximity to downtown, Burke Lakefront Airport is a vital destination for the corporations, executives, and health care systems that are growing their business here. Which should be music to all of our ears. www.burkeairport.com


1112 clevelandorchestra.com

THE CLEVELAND ORCHESTRA

Franz Welser-Möst MUSIC DIREC TOR Kelvin Smith Family Chair

Christoph von Dohnányi MUSIC DIRECTOR LAUREATE

Giancarlo Guerrero PRINCIPAL GUEST CONDUCTOR THE CLEVELAND ORCHESTRA MIAMI RESIDENCY

James Feddeck ASSISTANT CONDUCTOR Elizabeth Ring and William Gwinn Mather Chair

MUSIC DIRECTOR, CLEVELAND ORCHESTRA YOUTH ORCHESTRA

Sasha Mäkilä ASSISTANT CONDUCTOR Sidney and Doris Dworkin Chair

Robert Porco DIRECTOR OF CHORUSES Frances P. and Chester C. Bolton Chair

Lisa Wong P H OTO BY R O G E R MA S T R O I A N N I

ASSISTANT DIRECTOR OF CHORUSES

Ann Usher DIRECTOR, CLEVELAND ORCHESTRA CHILDREN’S CHORUS

Frank Bianchi DIRECTOR, CLEVELAND ORCHESTRA YOUTH CHORUS

Lisa Manning ASSISTANT DIRECTOR, CLEVELAND ORCHESTRA YOUTH CHORUS


T H E

C L E V E L A N D

FRANZ WELSER-MÖST M U S I C D I R E C TO R Kelvin Smith Family Chair

FIRST VIOLINS William Preucil CONCERTMASTER

Blossom-Lee Chair

Yoko Moore

ASSISTANT CONCERTMASTER

Clara G. and George P. Bickford Chair

Peter Otto

FIRST ASSOCIATE CONCERTMASTER

Jung-Min Amy Lee

ASSOCIATE CONCERTMASTER

Gretchen D. and Ward Smith Chair

Lev Polyakin

ASSISTANT CONCERTMASTER

Dr. Jeanette Grasselli Brown and Dr. Glenn R. Brown Chair

Takako Masame Paul and Lucille Jones Chair

Wei-Fang Gu Drs. Paul M. and Renate H. Duchesneau Chair

Kim Gomez Elizabeth and Leslie Kondorossy Chair

Chul-In Park Harriet T. and David L. Simon Chair

Miho Hashizume Theodore Rautenberg Chair

Jeanne Preucil Rose Dr. Larry J.B. and Barbara S. Robinson Chair

Alicia Koelz Oswald and Phyllis Lerner Gilroy Chair

Yu Yuan Patty and John Collinson Chair

Isabel Trautwein Trevor and Jennie Jones Chair

Mark Dumm Gladys B. Goetz Chair

Alexandra Preucil Katherine Bormann Ying Fu

SECOND VIOLINS Stephen Rose * Alfred M. and Clara T. Rankin Chair

Emilio Llinas

2

James and Donna Reid Chair

Eli Matthews

1

Patricia M. Kozerefski and Richard J. Bogomolny Chair

Elayna Duitman Ioana Missits Carolyn Gadiel Warner Stephen Warner Sae Shiragami Vladimir Deninzon Sonja Braaten Molloy Scott Weber Kathleen Collins Beth Woodside Emma Shook Jeffrey Zehngut VIOLAS Robert Vernon * Chaillé H. and Richard B. Tullis Chair

Lynne Ramsey 1 Charles M. and Janet G. Kimball Chair

Stanley Konopka 2 Mark Jackobs Jean Wall Bennett Chair

Arthur Klima Richard Waugh Lisa Boyko Lembi Veskimets Eliesha Nelson Joanna Patterson Zakany Patrick Connolly

CELLOS Mark Kosower* Louis D. Beaumont Chair

Richard Weiss 1 The GAR Foundation Chair

Charles Bernard 2 Helen Weil Ross Chair

Bryan Dumm Muriel and Noah Butkin Chair

Tanya Ell Ralph Curry Brian Thornton David Alan Harrell Paul Kushious Martha Baldwin Thomas Mansbacher BASSES Maximilian Dimoff * Clarence T. Reinberger Chair

Kevin Switalski 2 Scott Haigh 1 Mary E. and F. Joseph Callahan Chair

Mark Atherton Thomas Sperl Henry Peyrebrune Charles Barr Memorial Chair

Charles Carleton Scott Dixon HARP Trina Struble * Alice Chalifoux Chair

FLUTES Joshua Smith * Elizabeth M. and William C. Treuhaft Chair

Saeran St. Christopher Marisela Sager 2 Austin B. and Ellen W. Chinn Chair

Mary Kay Fink

18

The Orchestra

The Cleveland Orchestra


1112 clevelandorchestra.com

O R C H E S T R A

PICCOLO Mary Kay Fink Anne M. and M. Roger Clapp Chair

HORNS Richard King *

TIMPANI Paul Yancich *

George Szell Memorial Chair

Michael Mayhew §

Otto G. and Corinne T. Voss Chair

Tom Freer 2

Knight Foundation Chair

OBOES Frank Rosenwein * Edith S. Taplin Chair

Jeffrey Rathbun 2 Everett D. and Eugenia S. McCurdy Chair

Robert Walters ENGLISH HORN Robert Walters Samuel C. and Bernette K. Jaffe Chair

CLARINETS Franklin Cohen * Robert Marcellus Chair

Robert Woolfrey Daniel McKelway 2 Robert R. and Vilma L. Kohn Chair

Linnea Nereim E-FLAT CLARINET Daniel McKelway Stanley L. and Eloise M. Morgan Chair

Jesse McCormick Hans Clebsch Richard Solis Alan DeMattia TRUMPETS Michael Sachs * Robert and Eunice Podis Weiskopf Chair

Jack Sutte Lyle Steelman2 James P. and Dolores D. Storer Chair

CORNETS Michael Sachs * Mary Elizabeth and G. Robert Klein Chair

Michael Miller TROMBONES Massimo La Rosa* Gilbert W. and Louise I. Humphrey Chair

Richard Stout

BASSOONS John Clouser *

Shachar Israel 2

Louise Harkness Ingalls Chair Sandra L. Haslinger Chair

Jonathan Sherwin CONTRABASSOON Jonathan Sherwin

Margaret Allen Ireland Chair

Donald Miller Tom Freer Marc Damoulakis KEYBOARD INSTRUMENTS Joela Jones * Rudolf Serkin Chair

Carolyn Gadiel Warner Marjory and Marc L. Swartzbaugh Chair

Michael Miller

BASS CLARINET Linnea Nereim

Barrick Stees 2

PERCUSSION Jacob Nissly *

Alexander and Marianna C. McAfee Chair

BASS TROMBONE Thomas Klaber EUPHONIUM AND BASS TRUMPET Richard Stout TUBA Yasuhito Sugiyama*

LIBRARIANS Robert O’Brien Donald Miller ORCHESTRA PERSONNEL Carol Lee Iott DIRECTOR

Rebecca Vineyard MANAGER

ENDOWED CHAIRS CURRENTLY UNOCCUPIED ASSISTANT PRINCIPAL HARP

Sunshine Chair

* Principal § 1 2

Associate Principal First Assistant Principal Assistant Principal

Nathalie C. Spence and Nathalie S. Boswell Chair

Severance Hall 2011-12

The Orchestra

19


Hold the hand of this generation and the next Doing the Most Good

4.4% - 9.8%

Charitable Gift Annuities Call

1-866-364-6446


Perspectivesfrom the Executive Director “A pure-bred elegance is transmitted to all sections; the brilliance of the winds is inspired by the transparency of the strings, though their sound is never overpowering. Are American orchestras too flashy, too thundering? Cleveland is the dream antidote to this persistent cliché. Here is the most refined of orchestras, where the supernatural cohesion of the attacks never turns into a power show by an advancing army.” —Le Figaro, October 28, 2011 Conquering musical Europe isn’t easy for an American orchestra. But once again our own Cleveland musicians under Franz’s direction came home last weekend triumphant from a demanding concert tour in some of the most competitive music centers anywhere, including Madrid, Paris, and Vienna. Winning the championship, in music no different than in sports, and doing so year after year, takes talent, dedication, and hard work. It also takes practice. Over the course of a three-week roadtrip, within a packed schedule of rehearsals, concerts and travel, Cleveland’s musicians stole time to practice scales, arpeggios, and etudes so that with the downbeat of each evening’s performance their collective artistry was at its peak. It’s an extraordinary aural experience to walk down the hotel hallway on the afternoon of a concert. The space is alive with music emanating from behind the doors to the rooms. Disconnected musical phrases rise and fall as you pass by. A tricky viola passage gives way to a clarinet melody, followed by a set of challenging, high register doublestops from a cello. Members of the Orchestra also found time on tour to share their talents with others outside the concert hall. Musicians taught masterclasses in Lisbon, Granada, Valencia, and Venice among other cities, and also came together to perform chamber music for generous sponsors. This hard work and dedication on tour is no less than what these musicians do here at home. Cleveland Orchestra players have a tradition of giving back to the community and to the institution wherever they are. Musicians generously organize and support fundraisers for a variety of worthy causes. They support the United Way annually, and when called upon, they organize benefit concerts in response to natural disasters, as they did for recent earthquake victims in Haiti and Japan. They teach students of all levels in Northeast Ohio, serve as volunteer leaders in non-profits, and contribute to charities of all kinds. There is even a group of ace orthographers who are renowned as winners of the annual spelling bee fundraiser that supports the Cleveland Heights-University Heights public schools. Franz and I, together with our Trustee leaders, admire and appreciate all the time and effort that the members of The Cleveland Orchestra devote to their art form and to the many important needs of the community. And I know that the musicians join with us in thanking you for your generous support of The Cleveland Orchestra.

Severance Hall 2011-12

Gary Hanson

21


THE CLEVELAND ORCHES-

News

OrchestraNews Franz Welser-Möst and Orchestra receive accolades throughout European Tour and Vienna Residency

A

CLEVELAND ORCHESTRA THE CLEVELAND ORCHESTRA THE CLEVELAND ORCHE

THE CLEVELAND ORCHESTRA

Music Director Franz Welser-Möst and The Cleveland Orchestra returned home on November 6 from their eleventh international tour together, including the Orchestra’s fifth biennial residency at Vienna’s historic Musikverein concert hall. Throughout the tour, press reviews — excerpted on these pages — extended praise and accolades to the Orchestra for its precision and musicality. In addition to the Vienna Musikverein Residency, the tour featured two concerts in Madrid, Paris, and Luxembourg, and single concerts in Valencia, Cologne, and Linz. During the four-concert Musikverein Residency, the Orchestra gave two performances of Mozart’s “Great” Mass in C minor, featuring soprano Malin Hartelius, soprano Juliane Banse, tenor Martin Mitterrutzner, baritone Ruben Drole, and the Vienna Singverein. Cellist Truls Mørk was soloist with the Orchestra in Luxembourg. The thirteen-concert, seven-city tour began with performances in Madrid, Spain, on October 20 and 21 and ended in Vienna on November 5. Tour sponsors included Raiffeisenlandesbank Oberösterreich, Tele München Group, Jones Day, LNE Group / Lee Weingart, Miba AG, and SEMAG GmbH, with additional support from a group of generous individuals. “And in fact, the music sounded fabulous — with the weapons that Welser-Möst handles so scrupulously: precision, rhythmic control, a certain highly effective minimalism. All that, plus the assurance of having an orchestra like Cleveland at his command: compact, secure, even luminous.” —El Pais, October 22, 2011 “Welser-Möst was restrained in Mendelssohn, dominating in Stravinsky, and brilliant in Ravel. His gestures are sober, his movements a bit mechanical; his image ranges from timid to robot-like, from subtle to introverted. The analytic part takes precedence over the expressive. The artistic results are overwhelmingly effective. It is the art of perfection, pure and simple. No excessive emphases, no special effects, none of those ‘strokes of genius’ that are so often arbitrary. He even smiled in the Ravel, completely won over by the work’s rhythmic and timbral richness. All sections of the orchestra responded homogeneously and with great class.” —El Pais, October 22, 2011 “We were immediately won over by the agility of the strings, the warmly streaming sound of the woodwind, the unshakable security of the brass. The true miracle, then, occurred in the two major works on the program, Tchaikovsky’s Fourth Symphony and, before intermission, the Doctor Atomic Symphony by John Adams.” —KlassikInfo.de, October 30, 2011

22

Cleveland Orchestra News

The Cleveland Orchestra


HE CLEVELAND ORCHESTRA HESTR

News

THE CLEVELAND ORCHESTRA

“Franz Welser-Möst navigated his orchestra, which cannot be called anything but fantastic, with a secure sense of control and great restraint. At no time did he give in to sensationalism in this music, which is so rich in contrasts between pandemonic eruptions and soothing major-mode consonance. Some members of the orchestra distinguished themselves with impressive solos; above all, trumpeter Michael Sachs knocked our socks off with his sovereign technique.” —KlassikInfo.de, October 30, 2011 “In concerts Tuesday and Wednesday at Salle Pleyel, an historic hall near L’Arc de Triomphe, the orchestra and music director Franz Welser-Möst more than proved themselves worthy of a long-term presence here, dazzling two nearly sold-out crowds and leaving audiences eager for more. Both nights, in fact, they were regaled with multiple rounds of synchronized clapping.”

THE CLEVELAND ORCHESTRA

—Zachary Lewis, The Plain Dealer, October 27, 2011 “This pure-bred elegance is transmitted to all sections; the brilliance of the winds is inspired by the transparencey of the strings, though their sound is never overpowering. Are American orchestras too flashy, too thundering? Cleveland is the dream antidote to this persistent cliché. Here is the most refined of orchestras, where the supernatural cohesion of the attacks never turns into a power show by an advancing army.” —Le Figaro, October 28, 2011 “The triumph of the evening, marked by a prolonged acclaim, was due to Mozart’s great C-minor Mass (K. 427). Here Welser-Möst gradually unveiled an overall plan that was as comprehensive as it was successful, dashing and radiant, expressive and stylish.” —Vienna Kurier, November 2, 2011

—Die Presse, November 1, 2011

Severance Hall 2011-12

Cleveland Orchestra News

23

THE CLEVELAND OR-

“Yet for all the technical craftsmanship, one can also bring out the eloquence of this music, if one lets true emotions resonate. Franz Welser-Möst has succeeded in doing just that, since he has the finest string playing to build upon and is thus able to turn a breathtakingly beautiful study in sound into a moving, expressive musical statement without forcing the interpretation in the least.”


THE CLEVELAND ORCHES-

News

OrchestraNews Family Concerts continue with “Scenes from The Nutcracker” on Friday, December 2

A

CLEVELAND ORCHESTRA THE CLEVELAND ORCHESTRA THE CLEVELAND ORCHE

THE CLEVELAND ORCHESTRA

The Cleveland Orchestra’s 2011-12 Family Concert Series, for young people ages 7 and older, began with a special Halloween Spooktacular! in October and continues on December 2 with Scenes from The Nutcracker featuring the Joffrey Academy Trainees from The Joffrey Ballet. This favorite holiday story comes to life on the Severance Hall stage with all the fun and magic of the Christmas season as these talented young dancers add a special sparkle to Tchaikovsky’s music. In addition to the concert, each of the season’s four Family Concerts features free pre-concert activities and post-concert treats. The series features two more concerts after The Nutcraker: Carnival of the Animals in April and Beethoven Lives Upstairs (with Classical Kids Live!) in May. Family Concert Series subscriptions and individual tickets are now available at clevelandorchestra.com or thru the Severance Hall Ticket Office.

A.R.O.U.N.D T.O.W.N Recitals and presentations featuring Orchestra musicians Upcoming performances by members of The Cleveland Orchestra in Northeast Ohio include: Cleveland Orchestra musicians Joanna Patterson Zakany (viola) and Robert Woolfrey (clarinet) join together with pianist Robert Cassidy to perform a recital at Cleveland State University’s Drinko Recital Hall on Tuesday evening, November 29, beginning at 8:00 p.m. The program, featuring works by Mozart, Schumann, and Bruch, is free and open to the public.

24

Cleveland Orchestra and partner Conn-Selmer provide violins to El Sistema@Rainey Thirty very excited students received brand-new violins at a special event in October as part of the inaugural year of El Sistema@Rainey, a comprehensive afterschool orchestral music program launched by the Rainey Institute and Cleveland Orchestra violinist Isabel Trautwein with the 2011-12 school year. The Cleveland Orchestra with its partner Conn-Selmer are the official providers of Scherl & Roth violins for the El Sistema@Rainey program. In its first year, El Sistema@ Rainey is providing ten hours of weekly group violin instruction and educational support to 30 children in Cleveland in grades 1-4, with plans to expand to more students in future years. Young musicians will also have opportunities to perform onstage at Severance Hall and participate in masterclasses with Cleveland Orchestra musicians. Isabel Trautwein, who serves as the artistic director of El Sistema@Rainey, was granted a year-long leave of absence from The Cleveland Orchestra last season to participate in a formal training program to study the methods of El Sistema (“the system”) in Venezuela and Boston, with the goal of building an El Sistema “nucleo” in Cleveland. El Sistema was founded more than 35 years ago in Venezuela by economist, musician, and social reformer Dr. José Antonio Abreu. Today, the program serves more than 350,000 children through neighborhood-based daily music instruction. El Sistema@Rainey joins El Sistema programs worldwide, including those based in Atlanta, Baltimore, Boston, Chicago, Los Angeles, and Philadelphia.

Cleveland Orchestra News

The Cleveland Orchestra


HE CLEVELAND ORCHESTRA HESTR

News

OrchestraNews

$5 million gift from Alexander and Sarah Cutler announced, to subsidize student attendance for Orchestra concerts at Severance Hall

P H OTO G R A P H BY R O G E R M A S T R O I A N N I

Alexander and Sarah Cutler at Severance Hall for the pre-concert announcement of their gift. audiences is a critical element in that evolution. The opportunity to attend the performances of a truly world-class orchestra right here in our own community has meant a great deal to us and we are hopeful that our gift will enhance the opportunity of students to have this same experience.” 8,000 students attended concerts last year at Severance Hall, making up an average of 8% of the current audience. With full subsidy, student attendance should increase to 15% by the Orchestra’s centennial in 2018. Among programs serving student audiences are: an annual student weekend that launched this weekend with deeply discounted tickets available in advance, and a new Student Ambassadors program that engages college students to invite their friends and peers. The current Student Advantage Program attendance will be increased through enhanced partnerships with colleges and universities.

THE CLEVELAND ORCHESTRA

O R C H E S T R A

CENTER FOR FUTURE AUDIENCES Endowed by the Maltz Family Foundation

Severance Hall 2011-12

Cleveland Orchestra News

25

THE CLEVELAND OR-

T H E C L E V E L A N D

THE CLEVELAND ORCHESTRA

On Saturday night, November 12, Cleveland Orchestra Executive Director Gary Hanson announced a pledge to The Cleveland Orchestra’s Endowment Fund of $5 million from Alexander and Sarah Cutler. The Alexander and Sarah Cutler Fund for Student Audiences will support existing and new programs that encourage and facilitate student attendance in perpetuity to Cleveland Orchestra concerts in Severance Hall. The Cutlers’ gift is another step toward fully funding the Orchestra’s Center for Future Audiences at $60 million, increasing the current total to $25 million. The Center, endowed by the Maltz Family Foundation, is a multi-faceted and long-term audience development initiative announced in 2010 with a lead gift from the Foundation. The Center aims to increase audiences, including more young people, each season. The Center is taking the Orchestra in a new strategic direction where the primary goal is to create broader access for the Northeast Ohio community. In announcing the gift, Hanson said, “We are grateful to Sandy and Sally for their extraordinary philanthropy and their belief in the future of The Cleveland Orchestra. This generous gift is an endorsement of our mission to transform the institution and our audience. We are committed to becoming an even more relevant and responsive community resource for Northeast Ohio.” Alexander Cutler has been an Orchestra Trustee since 2000. “Sally and I are honored to help the Orchestra evolve,” he said. “Outreach to younger


THE CLEVELAND ORCHES-

News

OrchestraNews

A

CLEVELAND ORCHESTRA THE CLEVELAND ORCHESTRA THE CLEVELAND ORCHE

THE CLEVELAND ORCHESTRA

New Cleveland Orchestra recording features live performance of “Rusalka” from Salzburg Festival The Cleveland Orchestra’s newest recording is a live audio recording of Dvořák’s opera Rusalka, performed under Franz Welser-Möst’s direction as part of the 2008 Salzburg Festival. The album on the Orfeo label was released at the end of September and New! comes in CD format or as a music download. The CD version is available from the Cleveland Orchestra Store at Severance Hall. The August 2008 performances of Rusalka marked the first time that The Cleveland Orchestra played from the orchestra pit for an opera production at the Salzburg Festival. The five sold-out Rusalka performances were part of a Festival Residency that also included WelserMöst conducting the Orchestra in three different concert programs. Prior to the staged Salzburg performances, WelserMöst and the Orchestra presented in-concert performances of Rusalka in Cleveland in June 2008. The reviewer for London’s Sunday Times praised the Salzburg production, calling it “the most spellbinding account of Dvořák’s miraculous score I have ever heard, either in the theatre or on record. . . . I doubt this music can be better played than by the Clevelanders, the most ‘European’ of the American orchestras, with wind and brass soloists to die for and a string sound of superlative warmth and sensitivity.” The London Sunday Telegraph review said, “the playing of the Cleveland Orchestra under Franz WelserMöst is sumptuously beautiful and exquisitely detailed, allowing Dvořák’s operatic masterpiece to weave a strong spell at its first-ever Salzburg showing.”

26

Joshua Smith featured in new recording from Marlboro Music A new album in a series of recordings titled “Live from the Marlboro Music Festival” features Cleveland Orchestra principal flute Joshua Smith. Among three albums of live performances released this year in conjunction with ArchivMusic to celebrate Marlboro’s 60th anniversary, the recording includes Smith’s performance in Ravel’s Introduction et Allegro from the 2010 festival in Vermont. Also on the album are the string quartets of Ravel and Debussy. The performances chosen for the three albums were selected by Marlboro artistic directors Mitsuko Uchida and Richard Goode.

Orchestra violist has new CD release Following the success of her Grammy award-winning last album, Cleveland Orchestra violist Eliesha Nelson has a new album titled Russian Viola Sonatas, featuring the music of Varvara Gaigerova, Alexander Winkler, and Paul Juon and released this past July on the Sono Luminus label. The CD is available for purchase at the Cleveland Orchestra Store at Severance Hall.

Committed to Accessibility Severance Hall is committed to making performances and facilities accessible to all patrons. For information about accessibility or for assistance, call the House Manager at (216) 231-7425.

Cleveland Orchestra News

The Cleveland Orchestra


THE CLEVELAND ORCHESTRA THE CLEVELAND ORCHESTRA TRA THE CLEVELAND ORCHESTRA

News

OrchestraNews

Women’s Committee continues a holiday tradition with Silver Bells raising money for The Cleveland Orchestra

The Cleveland Orchestra’s season of Celebrity Series concerts was announced over the summer and is now on sale as series subscriptions or on an individual concert basis. The Celebrity Series features the Orchestra and guest artists performing popular, film, and jazz music. The season’s four programs are: Singer-songwriter Randy Newman (December 3), known for his scores for such films as Toy Story and hit singles such as “Short People,” performs with The Cleveland Orchestra. The Colors of Christmas (December 20), featuring vocalists Peabo Bryson, Jennifer Holliday, Lea Salonga, and Ben Vereen performing Christmas and holiday favorites with the Orchestra. Charlie Chaplin’s City Lights (March 31), a timeless romantic comedy, shown on a large screen with the film score performed live by The Cleveland Orchestra, with guest conductor William Eddins. John Pizzarelli (April 10), jazz guitarist and vocalist, joins the Orchestra to pay tribute to Nat “King” Cole with favorites from the Great American Songbook.

Silver Bells and The Cleveland Orchestra have gone hand in hand for more than four decades, and they’re ringing in another year. Reed & Barton silver bells inscribed with “Christmas 2011” are being sold to benefit Community and Education programs of The Cleveland Orchestra. A project of the Women’s Committee of The Cleveland Orchestra, the Silver Bells sale is also a labor of love for Beth Schreibman Gehring, president of the Women’s Committee, whose parents began selling the bells to benefit the Orchestra more than 40 years ago. Silver-plated Reed & Barton bells to benefit the Orchestra cost $20. The bells can be purchased from the Cleveland Orchestra Store and from several local gift shops. In addition, Women’s Committee members will be selling the bells in the lobbies of Severance Hall at many Cleveland Orchestra concerts throughout November and December.

3099 MAYFIELD ROAD CLEVEL AND HEIGHTS, OH 216 | 321.0477

tuesday through saturday 4pm to 1am Severance Hall 2011-12

Cleveland Orchestra News

27

THE CLEVELAND ORC

restaurant+ lounge

THE CLEVELAND ORCHESTRA

2011-12 Celebrity Series on sale now — featuring variety of artists with The Cleveland Orchestra


THE CLEVELAND ORCH

News

OrchestraNews Read and watch more Cleveland Orchestra news online . . .

THE CLEVELAND ORCHESTRA

Looking for the latest news about The Cleveland Orchestra? Or behind-thescenes information about an upcoming artist or event? Photographs from a recent event? Learn more online on the Orchestra’s facebook page or at clevelandorchestrablog.com. Check out recent postings to: — Listen to this week’s soloist, pianist Jonathan Biss, in audio clips and videos; — View photos and read reports from the Orchestra’s recent European Tour and Vienna Residency; — Visit the Cleveland School of the Arts via photos from The Cleveland Orchestra’s recent school concert there; — Watch a video of Randy Newman, coming to Severance on December 3 to

perform with The Cleveland Orchestra; — Read about former members of the Cleveland Orchestra Youth Orchestra and how this youth ensemble helped shape their life and values; Read all this and more at our Blog. You can post your own comments, too. Or visit the Orchestra on Facebook, follow us on Twitter, and watch us on YouTube!

The Cleveland Orchestra Blog

Sfmfbtf!Zpvs!Joofs!Dsjujd!gps!b!Dibodf!bu!%2-111

bu!uif!Pcfsmjo!Dpotfswbupsz!pg!Nvtjd

Jobvhvsbm!Tfbtpo!Kbovbsz!29!.!33-!3123!!! B!hspvoe.csfbljoh!tfsjft!pg!qvcmjd!fwfout!gpdvtjoh!! po!qfsgpsnbodf!boe!qfsgpsnbodf!dsjujdjtn/ Dpodfsut!cz!Uif!Dmfwfmboe!Psdiftusb-!! qjbojtu!Kfsfnz!Efol-!BqpmmpÖt!Gjsf-!boe!JDF Lfzopuft!boe!ejtdvttjpot!cz!mfbejoh!dsjujdt!Bmfy!Sptt-! Ujn!Qbhf-!Boof!Njehfuuf-!boe!Ifjej!Xbmftpo

%21-111!Svcjo!Qsj{f! bxbsefe!up!bo!Jotujuvuf!! Tuvefou!Gfmmpx!gps!! dpoujovfe!tuvez!jo!! nvtjd!dsjujdjtn %2-111!Bvejfodf!Bxbse!! gps!uif!ßoftu!sfwjfx!pg!! bo!Jotujuvuf!dpodfsu!cz!! bo!bvejfodf!nfncfs 2.911.482.1289!ps!! xxx/pcfsmjo/fev0! svcjojotujuvuf/! Tvctdsjqujpo!qbdlbhft!! bsf!bwbjmbcmf/

Uif!Svcjo!Jotujuvuf!gps!Nvtjd!Dsjujdjtn!jt!nbef!qpttjcmf!cz!uif!hfofsptjuz!pg!!Tufqifo!Svcjo-!Qsftjefou!boe!Qvcmjtifs!pg!Ifosz!Ipmu!'!Dp/

28

Cleveland Orchestra News

The Cleveland Orchestra


OrchestraNews

IN THE SCHOOLS

P H OTO G R A P H BY R O G E R MA S T R O I A N N I

Cleveland Orchestra Chorus offers special thanks with new Christmas CD

Music and the holidays are a perfect match. The Cleveland Orchestra Store offers a host of musical performances this holiday season, including the Orchestra’s latest DVDs and CDs, as well as releases by Orchestra musicians. Music boxes and music-themed holiday ornaments, stationery, books, stuffed toys and musical gifts for children of all ages, fashion scarves, jewelry, and Cleveland Orchestra logo apparel are also on sale at the Store. In addition, Cleveland Orchestra Gift Certificates and Blossom Lawn Ticket Books for the Orchestra’s 2012 Blossom Festival are available at the Severance Hall Ticket Office by calling 216-231-1111 or 800686-1141, or at clevelandorchestra.com.

Cleveland Orchestra News

29

THE CLEVELAND OR-

Severance Hall 2011-12

THE CLEVELAND ORCHESTRA

The Cleveland Orchestra Chorus has a brand-new Christmas album — available only to donors contributing a new gift of $25 or more to the Chorus Fund. Titled Spirit of the Season, the CD features selections from recent Christmas Concerts with the Chorus and The Cleveland Orchestra under the direction of Robert Porco. This new album is one in a long line of special Christmas CDs produced to help raise money for the Chorus’s touring and educational activities. The private label CD is not available for purchase, but is offered as a special thank-you gift for donations of $25 or more. Donations can be made at any of this season’s Cleveland Orchestra Christmas Concerts at Severance Hall, or by calling the Chorus Office at 216-231-7374.

Cleveland Orchestra offers gift ideas for the holidays, including new recordings, gift certificates, and more . . .

THE CLEVELAND ORCHESTRA

The Cleveland Orchestra has performed concerts in two area high schools this season. Franz Welser-Möst led the Orchestra in a presentation at Saint Ignatius High School (left) that featured John Adams’s “Doctor Atomic Symphony” on October 14, and Sasha Mäkilä led a performance at the Cleveland School of the Arts titled “American Journey” on November 16. These performances marked the Orchestra’s third season of Cleveland Orchestra concerts in high schools, launched in 2009 by Welser-Möst.

HE CLEVELAND ORCHESTRA HESTR

News


THE CLEVELAND ORCHES-

News

OrchestraNews

THE CLEVELAND ORCHESTRA

P H OTO G R A P H BY R O G E R M A S T R O I A N N I

Cleveland Orchestra now available as an app for mobile phones

A

CLEVELAND ORCHESTRA THE CLEVELAND ORCHESTRA THE CLEVELAND ORCHE

Franz Welser-Möst given “Key to the City” by Cleveland Mayor at Opening Night Gala The Cleveland Orchestra’s Opening Night Gala at Severance Hall on October 1 featured a special surprise moment for Franz Welser-Möst, when Cleveland Mayor Frank Jackson presented the Orchestra’s conductor with a ceremonial “key to the city” (above). The award was given to recognize the value of Franz’s work in extending and enhancing Cleveland’s reputation internationally. The gala evening, presented under the leadership of gala chair Norma Lerner and gala corporate chair Beth Mooney, marked the official start of Franz WelserMöst’s tenth season as music director. The event, which included an hour-long concert by The Cleveland Orchestra, raised $650,000. Proceeds from the evening will be used to create an education fund in Franz’s name, honoring his initiatives on behalf of music education. Of Ravel’s Boléro from the evening’s concert, The Plain Dealer wrote: “Proving he holds the key to Ravel as well as Cleveland, Welser-Möst offered a hardhitting performance, one that began with near-silent tapping . . . and ended with a cataclysmic punch.”

30

The Cleveland Orchestra’s website is now available in a streamlined format as an application for cell phones. The “app” can be downloaded in versions for iPhone or Android phones, and many of its features also display on other webready mobile phones. The new app offers fans a convenient and streamlined way to purchase tickets, listen to Cleveland Orchestra radio broadcasts, and connect to the Orchestra’s social media. Created in partnership with InstantEncore.com, a leading performing arts digital platform, the app connects fans to The Cleveland Orchestra Blog, Facebook, YouTube, and information about the Orchestra (including musicians’ photos and biographies) and venues. The app also allows on-demand, streaming broadcasts from WCLV of performances by The Cleveland Orchestra and Cleveland Orchestra Youth Orchestra. This latest tech innovation is an addition to the Orchestra’s ongoing social media platforms and website, including The Cleveland Orchestra Blog (viewed by readers in all 50 states and more than 100 countries), Facebook, Twitter, Flickr, and YouTube. The Cleveland Orchestra’s website offers convenient online seat selection and print-at-home ticketing. Additional features to the mobile app will be added in the coming months. The app can be downloaded free from the iTunes Stores or Android Marketplace. Links for downloading can also be found on the Orchestra’s homepage.

Cleveland Orchestra News

The Cleveland Orchestra


Beautifully restored and updated, Washington Place Bistro & Inn is the perfect spot for business, entertaining, relaxing or romance. Intimate, comfortable dining rooms, a warm attractive lounge, exquisite patio, and well-appointed sleeping rooms round out this charming gem in Little Italy.

â&#x20AC;&#x201D; 2011 AWARDS â&#x20AC;&#x201D;

north W point portfolio managers c o r p o r a t i o n

Best New Restaurant Best Romantic Resturant 2011 Top Cleveland Patio 2011

Ronald J. Lang Diane M. Stack Daniel J. Dreiling

2203 Cornell Road | Cleveland, OH 44106 216-791-6500 washingtonplacelittleitaly.com

440.720.1102 440.720.1105 440.720.1104

Larchmere Boulevard Clevelandâ&#x20AC;&#x2122;s Art and Antique District (one block north of Shaker Square) A remarkable ass

A remarkable assortment of more than 50 shops â&#x20AC;&#x201C; art, antique, and craft galleries; restaurants; services; designer and vintage clothing; and specialty shops.

Corcoran  Arts & 

Appraisals  

Views    of Brittany and    Paris 

   14 Recently Discovered Oil Paintings  

    Abel Warshawsky (Cleveland 1883-1962)

 Monday,    

Tuesday & Thursday 12-5 p.m.  Wednesday, Friday & Saturday 12-6 p.m.       CorcoranFineArts.com  !" Larchmere # $  Blvd. %& 216-767-0770 !'!'"''" 12610 K?<

8E:@E>,?<<G

WEARABLEART CONTEMPORARYCRAFT GIFTS

/RJDQEHUU\%RRNVFRP

/DUFKPHUHÂ&#x160;

Qbujp!Tfbujoh

xxx/dppmqmbdftupfbu/dpn

Ibqqz!Ipvs; Uvft/Ă&#x2019;Gsj/!5qnĂ&#x2019;8qn

/NE OF A KINDAND LIMITEDEDITIONCLOTHING

,ARCHMERE"LVD    #ALLFORUPCOMINGEVENTS

-ON &RIAMTOPMq3ATAMTOPMq3UNTOPM

Severance Hall 2011-12

Sftfswbujpot!Bddfqufe

Xfeoftebzt;!Bqqfuj{fs-!Fousff!BOE!Efttfsu!pomz!%33"

Sfwfstf!Ibqqz!Ipvs; Gsj/!'!Tbu/!21qnĂ&#x2019;2bn

Vscbo!Dbgf Mbsdinfsf Uvftebzt;!ibmg!pgg!BOZ!cpuumf!pg!xjof"

Ejoofs; Uvft/Ă&#x2019;Uivst/!5qnĂ&#x2019;21qn Gsj/!'!Tbu/!5qnĂ&#x2019;23bn Csvodi; Tbu/!'!Tvo/!21bnĂ&#x2019;5qn

23613!Mbsdinfsf!Cmwe/-!Dmfwfmboe-!PI!55231!Â&#x2021; 327.8:2.1:29

31


1.9.12

12.12.11

Town Hall Speaker Series

Gifts and musical items for every occasion . . .

CAPITOL STEPS “The Lighter Side of Politics”

AARON DAVID MILLER

2.6.12

“ Gulliver’s Troubles: How America Will Fare in a Changing Middle East”

LARRY ELDER

2.27.12

“American Exceptionalism: Is America Still a Land of Opportunity”

ERSKINE B. BOWLES “Practical Implications of the Debt Ceiling Level”

Tickets are $45 each. Ohio Theatre 6:00 PM

Call for tickets at

216.241.1919 or order online at www.townhallofcleveland.org

Open before and after every Cleveland Orchestra performance, at intermissions, and daytimes 11-6 Tuesday-Friday. Or visit us online at clevelandorchestra.com

Academic Sponsor

32

The Cleveland Orchestra


1112

LEARNING MORE ABOUT THE MUSIC

clevelandorchestra.com

Concert Previews The Cleveland Orchestra offers a variety of options for learning more about the music before each concert begins. For each concert, the program book includes program notes commenting on and providing background about the composer and his or her work being performed that week, along with biographies of the guest artists and other information. You can read these before the concert, at intermission, or afterward. (Program notes are also posted ahead of time online at clevelandorchestra.com, usually by the Monday directly preceding the concert.) The Orchestra’s Music Study Groups also provide a way of exploring the music in more depth. These classes, professionally led by Dr. Rose Breckenridge, meet weekly in locations around Cleveland to explore the music being played each week and the stories behind the composers’ lives. Free Concert Previews are presented one hour before most subscription concerts throughout the season at Severance Hall. The previews (see listing at right) feature a variety of speakers and guest artists speaking or conversing about that weekend’s program, and often include the opportunity for audience members to ask questions.

Severance Hall 2011-12

Cleveland Orchestra Concert Previews are presented before every regular subscription concert, and are free to all ticketholders to that day’s performance. Previews are designed to enrich the concert-going experience for audience members of all levels of musical knowledge through a variety of interviews and through talks by local and national experts. Concert Previews are made possible by a generous endowment gift from Dorothy Humel Hovorka. November 25, 26, and 27 “Symphonic Opera, Vocal Piano” with Michael Strasser, professor of musicology, Baldwin-Wallace College Conservatory of Music

December 8 and 10 “Musical Splendor and Radiance” with Rabbi Roger Klein, The Temple – Tifereth Israel

January 12, 13, and 14 “Beloved Favorites” with Rose Breckenridge, Cleveland Orchestra Music Study Groups administrator and lecturer

January 19, 20, and 21 “Conversation Between Composers” with composer Sean Shepherd in conversation with Keith Fitch, head of composition at the Cleveland Institute of Music For future Concert Preview details, visit clevelandorchestra.com

Concert Previews

33


TAKES THE STAGE

::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::

PNC supports those who make the world a more beautiful place. That’s why we’re proud to sponsor The Cleveland Orchestra’s Mozart & Strauss Concert. Because we know that achievement is an art form all its own.

visit: www.pnc.com ::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::::

©2011 The PNC Financial Services Group, Inc. All rights reserved. PNC Bank, National Association. Member FDIC. ACHIEVEMENT is a registered mark of The PNC Financial Services Group, Inc.

COMMSERV AD JUN 2010 013


T H E C L E V E L A N D O R C H E S T R A F R A N Z

W E L S E R - M Ö ST M U S I C Severance Hall

Friday evening, November 25, 2011, at 8:00 p.m. Saturday evening, November 26, 2011, at 8:00 p.m. Sunday afternoon, November 27, 2011, at 3:00 p.m.

D I R E C T O R

1112 clevelandorchestra.com

Fabio Luisi, conductor RICHARD STRAUSS (1864-1949)

W. A. MOZART (1756-1791)

Till Eulenspiegel’s Merry Pranks, Opus 28 Piano Concerto No. 17 in G major, K453 1. Allegro 2. Andante 3. Allegretto JONATHAN BISS, piano

INTERMISSION RICHARD STRAUSS

Aus Italien [From Italy], Opus 16 Symphonic Fantasy 1. In the Country: Andante 2. Amid the Ruins of Rome; Fantastic Scenes of Vanished Splendor; Feelings of Sadness and Grief in the Midst of Sunniest Surroundings: Allegro molto con brio 3. On the Shores of Sorrento: Andantino 4. Neapolitan Folk Life: Allegro molto

These concerts are sponsored by PNC, a Cleveland Orchestra Partner in Excellence. Jonathan Biss’s appearance with The Cleveland Orchestra is made possible by a contribution to the Orchestra’s Guest Artist Fund from The Hershey Foundation. The concert will end at about 10:00 p.m. each evening and at about 5:00 p.m. on Sunday afternoon. LIVE RADIO BROADCAST

Saturday evening’s concert is being broadcast live on WCLV (104.9 FM). The concert will be rebroadcast as part of regular weekly programming on WCLV on Sunday afternoon, January 22, at 4:00 p.m.

Severance Hall 2011-12

Concert Program — Week 6

35


If you don’t stop, you don’t have to stop.

Staying fit through dance has allowed Nancy to maintain her physical independence through the years. “I like independence in every sense of the word... [it] is one of the common threads between dancing and Kendal at Home.” Wherever you call home, Kendal gives you the independence you need to live the life you want.

KENDAL ®

Together, transforming the experience of aging.®

Kendal at Oberlin

Kendal at Home

www.kao.kendal.org

www.kendalathome.org

1-800-548-9469

1-877-284-6639

Be part of our community wherever you live.


INTRODUCING THE PROGRAM

Instrumental Song & Operatic Symphony MOZART AND STRAUSS

remain among classical music’s most popular and enduring composers. They each began writing music as children. If Mozart’s fame took hold earlier — as a young wunderkind performer — Strauss more than made up for his delay across a lifetime of accolades spanning nearly three times longer than Mozart’s short life. Both Mozart and Strauss helped lead music in new directions. For a time, each man’s newest work was eagerly awaited by an adoring public — although Strauss, to be sure, had his detractors (too much “noise,” too much dissonance). Yet both Wolfgang and Richard tapped effortlessly into a neverending reservoir of pleasing melodies, sure to soothe audience and critic alike. Alone among classical music’s major composers, Mozart and Strauss were equally successful in writing opera and music for the concert hall. Each would be well-known today if he had written only operas or concert works. The combined output of each remains unprecedented and unequaled. This week’s guest conductor, Fabio Luisi, also strides the two worlds of opera and concert hall. So it cannot be surprising that he has chosen concert works by these two inestimable operatic composers. If the week’s two tone poems are from early in Strauss’s career, they nevertheless show Strauss’s mastery of orchestration, instrumental coloring, and — especially with Till Eulenspiegel — storytelling. Just as Mozart’s Piano Concerto No. 17, from the middle of his most productive decade as a composer, clearly showcases the singing lines of Wolfgang’s best musical works. Pianist Jonathan Biss returns to Severance Hall as soloist in this masterful concerto. This week, onstage as well as off, despite many challenges in the world, there is much to be thankful for. —Eric Sellen

Severance Hall 2011-12

About the Music

37


THE CLEVELAND MUSEUM OF ART

Chinese Art in an Age of Revolution

FU BAOSHI OCTOBER 16, 2011– JANUARY 8, 2012 Presenting sponsor:

Additional support from:

Organized by the Cleveland Museum of Art with the Nanjing Museum. Heaven and Earth Glowing Red, 1964. Nanjing Museum.

Baker Hostetler

Fu Baoshi Exhibition Programs MODERN CHINA: A Multidisciplinary Exploration Saturday, October 29, 1:30–4:00. Wen-hsin Yeh, University of California, Berkeley, Peter Galassi Museum of Modern Art, and Julia Andrews, Ohio State University. Book Club: The White-Haired Girl 3 Wednesdays, November 2, 9, 16, 1:30–2:45. China: Art and Technology Art Cart 3 Sundays, November 6, December 4, January 8, 1:00–3:00. Perspectives on Contemporary Chinese Art Wednesday, November 30, 6:30. Artist Ji Yunfei and Paola Morsiani, Curator of Contemporary Art

Two films on the Three Gorges Dam Up the Yangtze Friday, December 2, 7:00 and Still Life Sunday, December 4, 1:30. Holiday Film Festival: Recent Chinese Cinema 1:30 each afternoon, December 26–31. Chinese Art Music: Yang Wei and Ensemble Friday, December 9, 7:30. Mandarin and Cantonese language tours Sunday, October 23, Saturday, November 26, and Wednesday, December 28, 1:00–2:00 (Mandarin) and 2:00–3:00 (Cantonese). Chinese Painting Demonstration Sunday, December 4, 1:30-3:30 The Art of Reinvention: China, Ohio, and the New Global Economy January 4, 2012.

11150 East Blvd. University Circle ClevelandArt.org 216-421-7350 1-888-CMA-0033

Rembrandt in America February 19–May 28, 2012 This exhibition brings together about 50 autograph paintings by Rembrandt as well as others thought to be by the artist when they entered American collections. Adults $14, members free. Organized by the Cleveland Museum of Art, the North Carolina Museum of Art, Raleigh, and the Minneapolis Institute of Arts. The exhibition is supported by an indemnity from the Federal Council on the Arts and the Humanities. Additional support provided by the Samuel H. Kress Foundation. Sponsored by KeyBank. Self-Portrait, 1659. Rembrandt van Rijn. National Gallery of Art, Washington 1937.1.72


Till Eulenspiegel’s Merry Pranks, Opus 28

After the Old Rogue’s Tale, Composed in Rondo Form for Large Orchestra composed 1894-95

by

Richard

STRAUSS born June 11, 1864 Munich died September 8, 1949 Garmisch-Partenkirchen, Bavaria

Severance Hall 2011-12

A C E N T U R Y A G O , Richard Strauss was often known as “the other Strauss.” He was, in fact, no relation at all to Johann Strauss Jr. and that popular Viennese musical family. For some, he was also known as “the third Richard,” the first being Richard Wagner, “after whom there could be no second,” or so said those who coined the term and who cared passionately about Wagner yet liked Strauss well enough to offer him only a bronze medal of praise. Strauss was born in Munich and had an invigorating, supportive, and thoroughly musical upbringing by solidly middle-class parents. He began piano lessons at age four, started composing at six, and took up violin at eight. His father, Franz, was the principal horn player in the Munich Court Orchestra — and widely acknowledged as the best horn player in all of Germany (some called him “the Joachim of the horn,” comparing him to the era’s greatest violinist). Papa Strauss also served as conductor of a respected amateur orchestra and, although his tastes were conservative, exposed his son to a range of music and premiered a number of Richard’s earliest compositions. Richard Strauss’s professional career rose first as a conductor. He apprenticed under Hans von Bülow, one of the greatest conductors of the 19th century, serving as Bülow’s assistant and then briefly taking over the Meiningen Orchestra upon Bülow’s resignation. Additional posts followed at the Munich Opera and in Weimar, as well as guest conducting engagements across central Germany and assisting with the Wagnerian summer festival at Bayreuth. Until his success as an opera composer (after the age of 40) guaranteed him sufficient money to live on, much of Strauss’s income derived from ongoing work as a guest conductor, often including one of his own pieces at symphonic concerts. He led many opera performances during two decades in Berlin, and undertook a conducting tour to the United States in 1904, where his appearances included a performance in Cleveland of his tone poem Till Eulenspiegel’s Merry Pranks with the visiting Pittsburgh Symphony Orchestra. Although he was intensely interested in writing his own operas, Strauss’s first great successes as a composer came with About the Music

39


))'$  " #$!!#

"  % #+$"# '

"$ *(  '$"&$ $&#" % 

"#"  " $ $ # #"$' "

KEN LUDWIGâ&#x20AC;&#x2122;S

THE GAMEâ&#x20AC;&#x2122;S AFOOT

(O R H O L M E S F O R T H E H O L I DAY S)

EXTRA PERFORMANCES ADDED! NOW NOV 25 - DEC 24, 2011

Itâ&#x20AC;&#x2122;s Sherlock Holmes meets Noises Off in the world premiere of a hilarious holiday whodunit by Ken Ludwig, author of Crazy For You.

ph o n e 216.241.6000

40

o n lin e CLEVELANDPLAYHOUSE.COM The Cleveland Orchestra


orchestral tone poems. Franz Liszt had evolved this idea into its own genre of music through his intense desire to express musically all that he experienced in other arts, such as literature. But it was Richard Strauss who raised it into high symphonic art. He created half a dozen masterpieces, each of which can be held up as a definitive example of the genre, including Don Juan, Till Eulenspiegel, Also sprach Zarathustra, and An Alpine Symphony. In each, his exceptional abilities as an orchestrator allowed him to masterfully color, depict, and portray an astonishingly wide range of topics, ideas, and dramatic action. Similarly, his knowledge and understanding of musical forms allowed him to create each tone poem as a unique work, written with a different, carefully crafted musical structure — and not just as a series of lovely melodies “about” a particular new subject. The premiere of Till Eulenspiegel in 1895 confirmed Strauss’s reputation as the hottest young orchestral composer of his era. He had leapt onto the international stage in 1889 (at age 22) with his tone poem Don Juan. And although his next work, Death and Transfiguration, had been less enthusiastically embraced, Strauss was clearly a young man everyone had their eyes on. His next major work, however, was an opera titled Guntram, which opened to unfavorable reactions and reviews in 1894. At the time of Guntram’s premiere, Strauss was already contemplating his next opera. Among the subjects he was considering was Till Eulenspiegel, a semi-comic character from German folktales. The name Eulenspiegel in German means “owl mirror,” and it is thought that the name itself is related to an old folk saying: “One sees one’s own faults no more clearly than an owl sees its own ugliness in a looking glass.” Based perhaps in part on a real-life figure from the 13th or 14th centuries, Till’s

GILMOUR

ACADEMY TM

Where Inspiration Happens

Family Open House Wednesday, October 12 Sunday, November 20 Co-ed Preschool – Grade 12 gilmour.org A Catholic, independent school sponsored by the Congregation of Holy Cross, Notre Dame, Indiana

Severance Hall 2011-12

About the Music

41


Great people.

Great clients.

Great results.

www.tuckerellis.com

The Plain Dealerâ&#x20AC;&#x2122;s #1 Top Midsize Workplace


life and antics had been embellished through successive generations of storytelling (the first written accounts date from the late 15th century). An able practitioner of practical jokes, Till had become something of a folk-hero, who boastfully chooses to do things his own way and to thumb his nose at those who disagree with him. Dejected from his opera’s failure, Strauss seized upon Till Eulenspiegel as a worthy subject for a new tone poem. Like Till himself, Strauss appears to have enjoyed the possible double meaning — that Strauss as a composer would do things his own way and thumb his own nose at those critics who had disparaged his operatic writing. Thus, his new tone poem could be seen as a work of art and a practical joke. Strauss chose to write Till Eulenspiegel in “rondo” form, in which a principal musical subject (representing Till) is alternated with one or more musical “episodes” (depicting particular adventures from Till’s life). This masterful choice for structure gives the work cohesion and flexibility. The piece begins with a quiet motif in the strings, which many have suggested echoes the German words “Es war einmal” (“Once upon a time”), the traditional start to any tale. The solo horn then introduces Till’s main angular theme. A second theme, sounding very much like laughter, is soon announced on clarinet and shaped in syncopation. Although Strauss did not release a description of which episodes from Till’s life he had chosen to write into music, various correspondence and interviews have established that these include (in this order): galloping through a town market and upsetting the goods onto the ground, poking fun at some clergymen, flirting with a girl (and being rejected), mocking some university teachers, and then being hanged for blasphemy. After the music ably paints the early adventures, a drumroll announces Till’s march to the gallows, and we clearly hear him hanged and dead. Then the “once upon a time” theme returns, followed by Till’s laughter — leading us to understand via a musical wink that Till’s spirit lives on, always challenging traditions, and laughing with delight at human folly.

At a Glance Strauss began writing Till Eulenspiegel’s Merry Pranks in late 1894, and completed the score in May 1895. Franz Wüllner conducted the world premiere on November 5, 1895, in Cologne. Till received its United States premiere just ten days later, with the Chicago Symphony Orchestra. Strauss dedicated the published score to Anton Seidl. This work runs about 15 minutes in performance. Strauss scored it for piccolo, 3 flutes, 3 oboes, english horn, 3 clarinets, bass clarinet, 3 bassoons, contrabassoon, 4 horns (4 more ad libitum, if desired), 3 trumpets (plus 3 more ad libitum), 3 trombones, tuba, percussion (snare drum, bass drum, cymbals, triangle, ratchet), timpani, and strings. The Cleveland Orchestra first performed Till Eulenspiegel in December 1923, conducted by Nikolai Sokoloff. It has been performed frequently since then, in performances by all the Orchestra’s music directors, and on tour domestically and internationally. The Orchestra’s most recent performances were in May 2009, conducted by Jahja Ling at Severance Hall.

—Eric Sellen © 2011

Severance Hall 2011-12

About the Music

43


Kulas Series Keyboard ConversationsÂŽ Kulas Series of of Keyboard ConversationsÂŽ with Siegel withJeffrey Jeffrey Siegel

24th Season 2011-2012 24th Season 2011-2012

Presented by Cleveland State Universityâ&#x20AC;&#x2122;s Center for Arts and Innovation

Presented by Cleveland State Universityâ&#x20AC;&#x2122;s Center for Arts and Innovation

Masterly Masterly

Sunday, Sunday,October 2,2,2011 October Sunday, October 2, 2011 2011 Sunday, October 2, 2011 AA A Beethoven BeethovenBonanza! Bonanza!The Themany many Beethoven Bonanza! The many

AABeethoven Bonanza! The many B Beethoven moods moods ofof ofgenius! genius!Bonanza! The many moods genius! moods of genius! moods of genius! Enthralling Enthralling B Sunday, Sunday, November November 20, 20,2011 2011 Sunday, November 20, 2011 Charming Charming The The Romantic Romantic Music Music of of Franz Franz Liszt The Romantic Music of Franz The Romantic Music of FranzLiszt LisztLiszt B Scintillating Sunday, March 4, 2012 Scintillating Sunday, Sunday, March March 4,4,2012 2012 Rachmaninoff and Tchaikovsky a Rochmaninoff Rochmaninoff and andTchaikovsky Tchaikovsky â&#x20AC;&#x153;An afternoon of entertaining talk and â&#x20AC;&#x153;An afternoon of entertaining talk and Sunday, May 6, 2012 exhilarating music.â&#x20AC;? exhilarating music.â&#x20AC;? Sunday, March 2012 2012 y 6,6,6, Sunday, March 2012 A musical love triangle: Robert, Clara â&#x20AC;&#x201C;The Washington Post - The Washington Post A musicallove lovetriangle: triangle:Robert, Robert,Clara Clara Aand A musical musical love triangle: Robert, Clara Johannes! and Johannes! and andJohannes! Johannes!

All concerts at 3:00 All concerts beginbegin at 3:00 pmpm at at Cleveland State Universityâ&#x20AC;&#x2122;sWaetjen Waetjen Cleveland State Universityâ&#x20AC;&#x2122;s Auditorium, EuclidAve. Ave.and and E. E. 21st Auditorium, Euclid 21stSt. St. For more information call 216.687.5018 For more information call 216.687.5018 visitwww.csuohio.edu/concert www.csuohio.edu/concertseries/kc ororvisit series/kc series/kc



         

Call Alan Weinberg, Managing Partner, at 216-685-1100. Weltman, Weinberg & Reis Co., LPA

44

The Cleveland Orchestra


Piano Concerto No. 17 in G major, K453 composed 1784 THE FIRST

by

Wolfgang Amadè

MOZART born January 27, 1756 Salzburg died December 5, 1791 Vienna

Severance Hall 2011-12

golden years of Viennese music were, of course, those that saw the birth of the great classical masterpieces of Haydn, Mozart, and Beethoven. Likewise, Mozart’s own “golden years” were those during which he composed his unparalleled series of piano concertos for the Imperial capital. Among these works, the Concerto No. 17 in G major, K453, is unusual in that Mozart wrote it with a performer other than himself in mind; the first performance was given by his pupil Barbara (Babette) von Ployer on June 10, 1784. The overall mood of this concerto in G major is warm and upbeat, despite occasional darker moments. As in most of Mozart’s mature concertos, the woodwind players act consistently as co-soloists, adding a richness to the orchestral writing that was otherwise almost unheard of at the time. The concerto begins with a cheerful opening theme, consistent with the general consensus about the emotional character of that key. Darker harmonies soon appear, accompanied by plaintive, sigh-like melodies. After the entrance of the solo piano, the same duality between lightness and emotional depth continues, with frequent shifts to minor keys and highly expressive modulations. The woodwinds are treated as solo instruments throughout; in a special touch, the bassoon part, almost always different from the string bass (rather than merely doubling it) is particularly significant. The middle movement, marked Andante, has a main melody that combines simplicity and intimacy in a way unique even to Mozart. It then evolves into one of his harmonically boldest and most intricate pieces, with some more beautiful soloistic writing for the woodwinds and some heart-gripping passagework for the piano. Like the first movement, it is written in sonata form, and includes a piano cadenza at the end. In this concerto, Mozart cast the finale as a theme with variations. The cheerful theme, marked Allegretto, has reminded some listeners of Papageno in The Magic Flute, who sings his opening aria in the same key of G major. Although there is no direct connection (the opera was not written until seven years later), the naïve, popular nature of the melody is certainly emotionally related to the genial bird-catcher in the opera. The variations are six in number, but after the first, each variation is About the Music

45


Dad’s my hero. He can fix everything from hot water tanks to BB guns. My son has the only two-story tree fort in the neighborhood thanks to him. He’s my go-to guy. Ask him about the big Cleveland game in ` 64, stocks, deep frying turkeys-he knows it all. But he doesn’t get around like he used to. He’s getting older and he can’t fix that. Wonder what he wants for the future? How do I bring it up?

What should our game plan be?

Have you ever thought about what your loved ones want in their final years of life? Thinking about it is the first step to talking about it. At Hospice of the Western Reserve, we believe discussing it early will help you and your family make the right decisions when the time comes. That’s why we encourage you to talk about it now. Contact us for a booklet that explains our services and helps you start the conversation. hospicewr.org/plan 855.852.5050


really two variations, effectively giving us eleven. While there are repetitions in the theme, the variations contain different versions for both the first and the second playing, in order to permit an alternation between the piano and the orchestra. Like most Classical works in this form, each variation concentrates on one rhythm, style, or instrument. The movement thus explores a wide range of characters, from tragic sentiments in the minor mode to a military march full of energy. The last variation is in a faster tempo than the others, bringing the concerto to an ebullient close. It is worth noting one amusing story about this concerto, according to which Mozart had taught his pet starling to whistle the main theme of the last movement. Mozart noted with amusement, however, that there was one note the bird could never quite get right, consistently singing G-sharp instead of G-natural. He didn’t rewrite the concerto to match the bird, however. —Peter Laki © 2011 Peter Laki is a musicologist and frequent lecturer on classical music and a visiting associate professor at Bard College.

At a Glance Mozart composed this piano concerto in G major (later cataloged as K453 and designated as No. 17) in the spring of 1784, completing it on April 12. It was first performed on June 10 of that year, by Mozart’s pupil Babette Ployer. This concerto runs about 30 minutes in performance. Mozart scored it for flute, 2 oboes, 2 bassoons, 2 horns, strings, and solo piano. The Cleveland Orchestra first performed this concerto in April 1948, with George Szell

LPC

Have It Both Ways...

conducting and Rudolf Serkin as soloist. Among later performances, Peter Serkin (Rudolf’s son) was the soloist with the Orchestra in September 1990 under the direction of Christoph von Dohnányi. The most recent performances were in the autumn of 2006, at Severance Hall and at Carnegie Hall, with Leif Ove Andsnes as soloist and with Franz Welser-Möst as the conductor.

Upper demographic readers with lower

cost per reader — buy advertising in The Cleveland Orchestra Programs! Call John Moore at

Severance Hall 2011-12

About the Music

216-721-1800 ext. 124 216-721-4300 47


THE CLEVELAND C O N C E R T

C A L E N D A R

FALL SEASON Friday November 25 at 8:00 p.m. Saturday November 26 at 8:00 p.m. Sunday November 27 at 3:00 p.m. THE CLEVELAND ORCHESTRA Fabio Luisi, conductor Jonathan Biss, piano

R. STRAUSS Till Eulenspiegel MOZART Piano Concerto No. 17 R. STRAUSS Aus Italien Concert Sponsor: PNC

Friday December 2 at 7:00 p.m. THE CLEVELAND ORCHESTRA James Feddeck, conductor FAMILY CONCERT:

Scenes from The Nutcracker The Joffrey Academy Trainees join The Cleveland Orchestra to capture the magic of the holiday season in scenes from Tchaikovsky’s beloved Nutcracker ballet. Concert Sponsor: Giant Eagle

Saturday December 3 at 8:00 p.m. THE CLEVELAND ORCHESTRA James Feddeck, conductor with Randy Newman CELEBRITY CONCERT:

Randy Newman

Academy Award-winning songwriter Randy Newman joins the Orchestra for one special evening to perform such chart-toppers as “You’ve Got a Friend in Me” and “Short People.” Plus music from The Natural, Avalon, and more!

Thursday December 8 at 8:00 p.m. Saturday December 10 at 8:00 p.m. THE CLEVELAND ORCHESTRA Marin Alsop, conductor Peter Otto, violin Joela Jones, organ

BARBER Symphony No. 1 BERNSTEIN Serenade (for violin) SAINT-SAËNS “Organ” Symphony Concert Sponsor: Medical Mutual of Ohio

Friday December 9 at 7:00 p.m. THE CLEVELAND ORCHESTRA

KeyBank Fridays@7 Concert BERNSTEIN Serenade (for violin) SAINT-SAËNS “Organ” Symphony

Sunday December 11 at 3:00 p.m. Friday December 16 at 8:00 p.m. Saturday December 17 at 3:00 p.m. Saturday December 17 at 8:00 p.m. Sunday December 18 at 3:00 p.m. Sunday December 18 at 7:00 p.m. Thursday December 22 at 8:00 p.m. Friday December 23 at 3:00 p.m. Friday December 23 at 8:00 p.m. THE CLEVELAND ORCHESTRA Robert Porco, conductor Cleveland Orchestra Chorus and guest choruses

CLEVELAND ORCHESTRA CHRISTMAS CONCERTS Celebrate the holiday season with The Cleveland Orchestra and Chorus in these annual offerings of music for the season, including sing-alongs and special guests.

Thursday December 15 at 8:00 p.m. Burning River Brass

BURNING RIVER BRASS Tuesday December 20 at 8:00 p.m. Wednesday December 21 at 8:00 p.m. THE CLEVELAND ORCHESTRA Herman Jackson, conductor with Peabo Bryson, Jennifer Holliday, Lea Salonga, and Ben Vereen

THE COLORS OF CHRISTMAS PNC Holiday Musical Rainbows for young people ages 3 and up

Wednesday December 14 10 a.m. Saturday December 17 11 a.m.

CHRISTMAS BRASS QUINTET Thursday December 15 10 a.m.

CELEBRATION OF KWANZAA Sunday December 18 12:30 p.m.

MUSIC OF CHANUKAH

followed by post-concert music with Magda Giannikou and Banda Magda

48

Concert Calendar

The Cleveland Orchestra


1112

ORCHESTRA

clevelandorchestra.com

I N

T H E

S P O T L I G H T

BRYSON

Thursday January 12 at 8:00 p.m. Friday January 13 at 11:00 a.m. Saturday January 14 at 8:00 p.m. THE CLEVELAND ORCHESTRA Franz Welser-Möst, conductor Lisa Batiashvili, violin

BRAHMS Violin Concerto SAARIAHO Orion SMETANA from Má Vlast [“My Homeland”] — Vysehrad, The Moldau, and Sárka

VEREEN

WINTER SEASON

HOLLIDAY

Concert Sponsor: Eaton Corporation

Sunday January 15 at 7:00 p.m. THE CLEVELAND ORCHESTRA Chelsea Tipton, conductor Central State University Chorus Martin Luther King Jr. Celebration Chorus

MARTIN LUTHER KING JR. CELEBRATION CONCERT The Cleveland Orchestra’s 32nd annual concert celebrating the spirit of Dr. King’s life, leadership, and vision. Presented in collaboration with the City of Cleveland. TICKETS: Admission is free, but tickets are required. Tickets become available beginning January 3, 2012. Sponsored by KeyBank, with additional support from The Cleveland Foundation.

Thursday January 19 at 8:00 p.m. Friday January 20 at 8:00 p.m. Saturday January 21 at 8:00 p.m. THE CLEVELAND ORCHESTRA Franz Welser-Möst, conductor Yefim Bronfman, piano

BRAHMS Piano Concerto No. 2 SHEPHERD Wanderlust SHOSTAKOVICH Symphony No. 6 Concert Sponsor: FirstMerit Bank

For a complete schedule of future events and performances, or to purchase tickets online 24/ 7 for Severance Hall concerts, visit www.clevelandorchestra.com. Cleveland Orchestra Radio Broadcasts: Radio broadcasts of current and past concert performances by The Cleveland Orchestra can be heard as part of regular weekly programming on WCLV (104.9 FM), with programs broadcast on Saturday evenings at 8:00 p.m. and Sunday afternoons at 4:00 p.m. Program Notes for each regular concert are usually posted in advance online at clevelandorchestra.com.

THE COLORS OF CHRISTMAS Tuesday December 20 at 8 p.m. Wednesday December 21 at 8 p.m. THE CLEVELAND ORCHESTRA Herman Jackson, conductor with vocalists Peabo Bryson Jennifer Holliday Lea Salonga Ben Vereen

One of the most festive and memorable Christmas programs comes to Cleveland for two unforgettable evenings filled with music and singing. Featuring legendary vocalists joining together with The Cleveland Orchestra in such holiday favorites as “Joy to the World” and “It’s the Most Wonderful Time of the Year” alongside solo performances of chart-topping hits from all four star performers.

CLEVELAND ORCHESTRA TICKETS PHONE

(216) 231-1111 800-686-1141

clevelandorchestra.com Severance Hall 2011-12

Concert Calendar

49


+ + + + +

IF YOU’RE DRIVING ONE OF OUR CARS, YOU’VE ALREADY EXPERIENCED A GREAT PERFORMANCE TONIGHT.

of North Olmsted

of North Olmsted

North Olmsted

Mercedes-Benz Sprinter of North Olmsted

of North Olmsted

of North Olmsted

of Cleveland

Airport Acura

Airport Infiniti

Beachwood Buick

Beachwood GMC

of Cleveland

of Cleveland

of Cleveland

Collection Auto Group has more #1 dealers than any other dealer group in Ohio.

www.collectionautogroup.com


Aus Italien [From Italy], Opus 16

Symphonic Fantasy composed 1886

“THE PERFORMANCE

by

Richard

STRAUSS born June 11, 1864 Munich died September 8, 1949 Garmisch-Partenkirchen, Bavaria

Severance Hall 2011-12

of my Italian Fantasy,” Richard Strauss wrote to his uncle soon after conducting the work’s premiere in Munich on March 2, 1887, “has evoked a great uproar here — general bewilderment and rage; because I am beginning to go my own way, creating my own forms, and giving lazy people mental perplexity.” Strauss would later tell conductor Hans von Bülow that the performance had been “the first step towards independence.” In hindsight, however, Aus Italien is perhaps better described not as the first, but as the final step toward Strauss’s independence as a composer. In it, he had finally managed to blend — if not quite perfectly — all of the musical elements that he would so deftly combine in the great tone poems of the next decade. The “Italian Fantasy” was, as Strauss subsequently recalled, “the connecting link between the old and the new methods” — the first product of a newly liberated master and the last efforts of a struggling apprentice. If Richard Strauss was destined to become a great composer, one can hardly imagine better preparation for that destiny than the experiences afforded him as a child and young adult. Music was, from the first, central to family life. Richard’s father, a virtuoso horn player in the Munich Court Orchestra, was a leading figure in the city’s music circles and conductor of its amateur orchestra. Richard’s mother, born of a prosperous brewing family, brought sufficient wealth to free her husband and children from financial concerns. Into these comfortable circumstances arrived a charming and precocious child, who, as early as age six, tried to write music — which his father indulgingly copied down. As Richard undertook formal lessons in music theory and harmony, his attempts at composition ripened. We may disparage his early works as student-ish exercises in copying the styles of earlier masters, but what better way to fully understand the underpinnings of 19th-century composition? The only real gap in his education resulted from father Franz’s conservative musical tastes — “Mozart (above all the others), Beethoven, and Haydn” as well as the early works of Liszt and Schumann. The operas of Wagner, for whom Franz played in the first perforAbout the Music

51


medium is the message.” “The

— Marshall McLuhan, 1911-1980

Photo by Roger Mastroianni

World-Class venue. World-Class advertisers.

Cleveland Orchestra Program Book Advertising information: John Moore • 216-721-4300 • jmoore@LPCpub.com


mances of both Tristan and Isolde and Die Meistersinger, were not tolerated at home. An older Richard Strauss would vividly remember having been intoxicated by the score to Tristan after studying it “against my father’s orders” at age 17. Perhaps most remarkable of all is the fact that by 1885, the 21-year-old Strauss had composed nearly 150 pieces, in all of the standard genres — instrumental and vocal works, solo and chamber music, concertos, choral pieces, works for orchestra and band — and in some surprising combinations as well. What’s more, several of the pieces had already been published and many of them performed — by friends, by his father’s orchestra, and even by the Dresden State Orchestra and Bülow’s Meiningen Court Orchestra. All of this enabled the budding composer to sharpen his mind’s ear to such an extent that the score of Tristan, which had so intoxicated him in his head, sadly disappointed him on live hearing, “until I realized at last that it was the discrepancy between a mediocre performance and the intentions of the great master.” In the fall of 1885, Strauss took up his first full-time position, as second conductor to Bülow at Meiningen. It would prove an eventful year. Following a quarrel with Brahms over the first performances of that composer’s Fourth Symphony, Bülow resigned, and the young Strauss suddenly became first conductor of one of Central Europe’s finest orchestras. Even more important, Alexander Ritter (one of the orchestra’s violinists) introduced the young composer to a whole world of new ideas — from philosophy and Romantic literature to the previously forbidden music of Wagner and Berlioz (as well as the later works of Liszt and Schumann). In subsequent years, Strauss recalled that Ritter’s influence, “in the nature of a whirlwind,” shifted all creativity “toward the poetic and the expressive in music.” At the end of March 1886, Strauss left his post at Meiningen, rushed home to Munich, and, using some kindly advice given by Brahms “as reason enough,” convinced his father to bankroll a long-hoped-for trip to Italy. Although he couldn’t really read or speak Italian — so that he twice lost his laundry and had his luggage stolen altogether — Strauss seems to have had a wonderful holiday. He filled notebook after notebook with musical sketches, and in Rome his thinking came clearly into focus. “I have never had much faith in inspiration through the beauties of nature,” he wrote to Bülow. “In the ruins at Rome I learned Severance Hall 2011-12

About the Music

Although this is a youthful work, all the musical ingredients of a mature Strauss tone poem are here, especially in the first movement: the almost endless melodic line, the unmistakable horn phrases, the carefully crafted contrapuntal writing that so effortlessly passes melody and countermelody from instrument to instrument.

53


better.” A four-movement symphonic poem soon took shape, which Strauss worked on over the summer and then finished orchestrating during the fall in Munich. THE MUSIC

At a Glance Strauss completed the “symphonic fantasy” Aus Italien in Munich in 1886, having compiled sketches throughout a tour of Italy during the late spring and early summer. He conducted the work’s premiere in Munich on March 2, 1887. Dedicated to the pianist-conductor Hans von Bülow, the work was published in 1886. This four-movement fantasy runs about 45 minutes. Strauss orchestrated it for 2 flutes and a piccolo, 2 oboes and an english horn, 2 clarinets, 2 bassoons and a contrabassoon, 4 horns, 2 trumpets, 3 trombones, timpani, percussion (snare drum, triangle, cymbals, tambourine), harp, and strings. The Cleveland Orchestra has performed Aus Italien on only two prior occasions, at a weekend of concerts in March 1950, conducted by music director George Szell, and at a 1989 Blossom Festival concert, conducted by Vladimir Ashkenazy.

54

It is clear — even upon first hearing — that the completed Aus Italien isn’t yet a mature work. But it comes very close. Indeed, we can almost smell the aromas of an authentic Strauss tone poem, if only it had been mixed together a little differently, or “cooked” a little longer! All the musical ingredients are here, especially in the first movement: the almost endless melodic line, the unmistakable horn phrases, the carefully crafted contrapuntal writing that so effortlessly passes melody and counter-melody from instrument to instrument. The second and third movements, however, disturb our reverie in what may have seemed an unjustly neglected masterpiece. Here the writing, while still anticipating the mature Strauss, too closely resembles that of the young Wagner (such as the Faust Overture) and some of the more static symphonic works of Liszt. And yet, all of this helps us better appreciate Strauss’s later works. Aus Italien is, in effect, a collection of four sketches for the later tone poems. Like the sketchbooks of da Vinci in relation to that master’s completed paintings and frescoes, this four-movement Italian Fantasy gives us a new and not entirely incomplete perspective on what the young Strauss thought his mature musical style was going to be. Aus Italien is, at its best, four beautifully hand-colored picture postcards sent by a young man intoxicated by his stay in Italy. Each depicts a particularly enchanting scene, nicely drawn out in two dimensions. Not until his later works (Macbeth, Don Juan, Death and Transfiguration, Don Quixote, and the rest) does Strauss add the third dimension, of depth and changing perspective, and — far more important — the fourth, of events happening over time (as in a story, such as in Till Eulenspiegel). Only then can we clearly discern the earmarks and ultimate structure of the mature Strauss tone poem. (Not that the tone poems are merely stories set to music; Aus Italien, which, unlike the later works, does not include any “real” people in its pictures — only the generalized “merry throng” in the final movement — also lacks the psychological depth inherent in all of Strauss’s later tone poems.) Of the fourth movement, much has been written about About the Music

The Cleveland Orchestra


Strauss’s mistaking Luigi Denza’s “Funiculì, Funiculà!” for a real Italian folksong rather than a momentarily popular hit song of 1886. That the inclusion of this potentially banal tune within the movement (or rather its role as the substance of the entire movement) may ruin the whole of Aus Italien for some listeners is unfortunate. Strauss’s youthful craft at variation is, to be sure, less than perfect, and we may yearn for more moments like those near the end when the tune disappears long enough to give an unobscured view of future genius. But as the American composer Philip Greeley Clapp (1888-1954) said, “Strauss can hardly be charged with any grave error — the tune is now familiar the world over, though its origin is forgotten; thus it may be said to have become a folksong, and Strauss to have been a true prophet in calling it one.” —Eric Sellen © 2011

THE CLEVELAND ORCHESTRA

7 @ ys

a d i r F

t+ cer

er @ft

con

ty

par

y hon

1112 clevelandorchestra.com

m9p y rto S e n c ber a m n OrFrgiday Dece no Co this d ions ar ty r t i a t a en rP eb Pih 16 r i pres n @f te stage g e F r e o c a i on m e h GrFriday Mar ree on, and formal music T h t in i s si ky wi th orld less s ues interm r ts are cer t, w b o r a t e ng n n i i t i n v 1 o a s co time, n 7 conce tra con t o c o l l r eve n erie s u Stra May 1 t 7s che tar ists t yo ays@ ays@ early s d, Frid land Or o f a r t n d o u n! d i r an ve rou ion e fu elan nk F yBa aturing in Clev ach Cle s e l e c t s i c t o and th e K . u The on. Fe ng else wing e i t e s a e a t m sic . . i u s r o sea e any th . Foll a d i nv i o n . G r the m d e t k o i g d a f l r e un of fsta e y H a el e b C om c and r t J a m u s i c al izons. r e e x p i qu e m your ho n a u expand and Fri d

ay


0DNLQJWKHZRUOGD EHWWHUSODFHNQRZV QRUHOLJLRQ

7KDW·VZK\ODVW\HDUWKH-HZLVK)HGHUDWLRQRI&OHYHODQGUDLVHGDQG DOORFDWHGPRUHWKDQPLOOLRQWRVRFLDOVHUYLFHHGXFDWLRQDODQG KXPDQLWDULDQRUJDQL]DWLRQVWKDWVXSSRUW&OHYHODQG·V-HZLVKDQGJHQHUDO FRPPXQLWLHVDVZHOODVWKRVHLQPRUHWKDQFRXQWULHVDURXQGWKH ZRUOG7KURXJKWKHJHQHURVLW\RIRXUGRQRUVWKH-HZLVK)HGHUDWLRQRI &OHYHODQGLV2KLR·VODUJHVWJUDQWPDNLQJRUJDQL]DWLRQ



7RJHWKHUZH·UHKHOSLQJWRPDNHWKHZRUOGDEHWWHUSODFHIRUDOOSHRSOH   " $ $& ( !&!" # 

   ( ''' '%!&!" #$

Jewish Federation  


Fabio Luisi Italian conductor Fabio Luisi currently serves as principal conductor of the Metropolitan Opera in New York and chief conductor of the Vienna Symphony Orchestra. Since 2010, he has also served as music director of the Pacific Music Festival in Sapporo, Japan. Next season, he begins his tenure as music director of the Zurich Opera. He is making his Cleveland Orchestra debut with this weekend’s concerts. Born in Genoa in 1959, Fabio Luisi began studying piano at age four. He received his diploma in piano in 1978 from the Conservatorio Niccolò Paganini, and later studied conducting with Milan Horvat at the Graz Conservatory. Mr. Luisi was named principal guest conductor of the Metropolitan Opera in 2010 and became principal conductor in September of this year. He has held his position as the Vienna Symphony’s chief conductor since 2005. His previous posts include music director of the Dresden Staatskapelle and Saxon State Opera (2007-2010), artistic director of the MDR Sinfonieorchester in Leipzig (19992007), music director of the Orchestre de la Suisse Romande (1997-2002), chief conductor of the Tonkünstler Orchestra in Vienna (1995-2000), and artistic director of the Graz Symphony (1990-1996). He also maintains an active schedule of guest engagements with international orchestras and opera companies. Mr. Luisi made his American debuts in 2000, with the New York Philharmonic and the Lyric Opera of Chicago. His subsequent guest engagements in this country have included appearances with the Boston Symphony Orchestra, Chicago Symphony Orchestra, Philadelphia Orchestra, and San Francisco Symphony. Internationally, his guest appearances have included Amsterdam’s Royal Concertgebouw Orchestra, Bavarian Radio Symphony Orchestra, Mahler Chamber Orchestra, Munich Philharmonic, NHK Symphony, Orchestre de Paris, London’s Philharmonia Orchestra, and the Vienna Philharmonic. He is a frequent guest at the Bavarian State Opera, Berlin State Opera, Deutsche Oper, and the Vienna State Opera. He has also conducted at London’s Royal Opera House and at the Salzburg Festival. Fabio Luisi’s recent and upcoming engagements include his debut with the Teatro alla Scala for Massenet’s Manon, and with the Filarmonica della Scala. At the Metropolitan Opera, he conducts new productions of Mozart’s Don Giovanni, Verdi’s La Traviata, and Wagner’s Siegfried and Götterdämmerung. Fabio Luisi’s discography includes Bellini’s I Puritani, Rossini’s William Tell, Salieri’s La Locandiera, a number of rare Verdi operas (Alzira, Aroldo, Jérusalem), and symphonic repertoire of Honegger, Liszt, and Respighi. He has also recorded all the symphonies and the oratorio The Book of the Seven Seals by Franz Schmidt, works by Richard Strauss, and Bruckner’s Ninth Symphony. Severance Hall 2011-12

Conductor

57


Music

Conservatory of Music Ring in the season with a B-W Conservatory Concert

The Cleveland Orchestra

Guide to Fine Schools

Consistently ranked among “Best Communities for Music Education” in the Nation!

216-898-8300 www.berea.k12.oh.us

2WKHUÀQHVFKRROVDGYHUWLVLQJLQ7KH&OHYHODQG2UFKHVWUD·V 6HYHUDQFH+DOOSURJUDPVLQFOXGH

B-W Men’s Chorus Holiday Concert and the Cleveland Orchestra Youth Chorus with a guest appearance by B-W’s “Mr. Sun’s Echo”

Sat., Dec. 10, 3 and 8 p.m. Frank Bianchi, conductor Works by: Gretchaninoff, Helvey, Wilberg, Rutter, Willan, Thompson and seasonal favorites. All seats $10 (general admission) Call 440-826-8541

Conservatory Holiday Concert Sun., Dec. 11, 2 and 5 p.m. Conservatory ensembles present music of the season in this popular annual event.

Baldwin-Wallace College Conservatory of Music 440-826-2369 Cleveland Institute of Music 216-791-5000 Cleveland State University Kulas Series of Keyboard Conversations with Jeffrey Siegel 216-687-5018 Gilmour Academy 440-473-8050 The Oberlin Conservatory of Music 440-775-8413

THE CLEVELAND ORCHESTRA

Tickets: $10 for adults, $2 for students Call 440-826-8070 Both concerts will be held in Gamble Auditorium, Kulas Musical Arts Building, 96 Front St., Berea

Conservatory of Music 1-866-BW-MUSIC 440-826-2368 music@bw.edu www.bw.edu/conservatory

58

clevelandorchestra.com 24/7 news, tickets & more

The Cleveland Orchestra


Jonathan Biss American pianist Jonathan Biss is known for his prodigious technique, diverse repertoire, artistic maturity, and versatility. He made his Cleveland Orchestra debut in November 2007; his most recent appearances were in November 2009. Jonathan Biss represents the third generation in a family of professional musicians that includes his grandmother, cellist Raya Garbousova, and his parents, violinist Miriam Fried and violist-violinist Paul Biss. Jonathan Biss began piano at age six, and his first musical collaborations were with his parents. He studied at Indiana University with Evelyne Brancart and at the Curtis Institute with Leon Fleisher. Among Jonathan Biss’s many honors are the 2002 Gilmore Young Artist Award, Wolf Trap’s Shouse Debut Artist Award, Andrew Wolf Memorial Chamber Music Award, Lincoln Center’s Martin E. Segal Award, an Avery Fisher Career Grant, 2003 Borletti-Buitoni Trust Award, and the Leonard Bernstein Award at the 2005 SchleswigHolstein Festival. In repertoire ranging from Beethoven to Schoenberg, Jonathan Biss has performed with the orchestras of Baltimore, Boston, Detroit, Houston, New York, Philadelphia, Pittsburgh, and Toronto, and with the Orpheus Chamber Orchestra. Internationally, he also has appeared with Amsterdam’s Royal Concertgebouw, London Philharmonic, NDR Hamburg, NHK Orchestra, Philharmonia Orchestra, Royal Stockholm Philharmonic, Scottish Chamber Orchestra, and Swedish Radio Symphony Orchestra. The current season includes a residency with the Saint Paul Chamber Orchestra and his debut with the Dresden Staatskapelle. Mr. Biss has been a member of Chamber Music Society Two at Lincoln Center, a participant at the Marlboro Music Festival, and collaborator with such ensembles as the Borromeo and Mendelssohn quartets, as well as with Midori and cellist Johannes Moser. In 2010, he was appointed to the piano faculty of the Curtis Institute. For EMI Classics, Jonathan Biss has recorded works by Mozart and Schumann. He received an Edison Award for his disc of Beethoven’s piano sonatas and a Diapason d’Or de l’année for an album of music by Schumann. He can also be heard on a Wigmore Hall Live disc of works by Kurtág and Schubert. In January 2012, Onyx Classics releases the first album in a nine-year, nine-album recording cycle of Beethoven’s piano sonatas. For more information, visit www.jonathanbiss.com. CD SIGNING Pianist Jonathan Biss will sign compact discs at the Cleveland Orchestra Store (ground floor) during the intermission of each concert this weekend. A selection of his current CDs are for sale at the Store.

Severance Hall 2011-12

Soloist

59


CUYAHOGA ARTS & CULTURE IS PROUD TO SUPPORT APOLLO'S FIRE ‡ BAYARTS ‡ BECK CENTER FOR THE ARTS ‡ CLEVELAND BOTANICAL GARDEN ‡ CLEVELAND INTERNATIONAL FILM FESTIVAL‡ CLEVELAND MUSEUM OF ART‡ CLEVELAND MUSEUM OF NATURAL HISTORY‡THE CLEVELAND ORCHESTRA‡ CLEVELAND PLAY HOUSE‡CLEVELAND PUBLIC THEATRE‡ DANCECLEVELAND‡ GREAT LAKES SCIENCE CENTER‡ GREAT LAKES THEATER FESTIVAL‡

SHAKER LAKES ‡ OPERA CLEVELAND ‡ ROCK AND ROLL HALL OF FAME AND MUSEUM ‡ SPACES ‡ WESTERN RESERVE HISTORICAL SOCIETY‡& MANY OTHERS

WWW.CACGRANTS.ORG 216 515 8303

60

P H OTO BY R O G E R MA S T R O I A N N I

GROUNDWORKS DANCETHEATER‡HEIGHTS YOUTH THEATRE‡IDEASTREAM‡KARAMU HOUSE‡MALTZ MUSEUM OF JEWISH HERITAGE‡MUSEUM OF CONTEMPORARY ART CLEVELAND‡NATURE CENTER AT

The Cleveland Orchestra


season spotlight

Brahms

CONCERTOS

January-February 2012 at Severance Hall

In January 2012, The Cleveland Orchestra and Franz Welser-Möst embark on a three-week program of presenting the three solo concertos of Johannes Brahms at Severance Hall, with violinist Lisa Batiashvili and pianist Yefim Bronfman. The mini-festival — featuring the Violin Concerto and both Piano Concertos — reunites Welser-Möst and Bronfman, who performed together in Franz’s debut here as a guest conductor in 1993. More recently, they performed together last year in a special outdoor concert with the Vienna Philharmonic that was televised internationally and released on the Deutsche Grammophon label. “I’m really overwhelmed with excitement to play with Franz and The Cleveland Orchestra,” says Bronfman. “Franz has always been a great conductor, but he has also become such a great personality, with so much knowledge. He has grown into a major figure in music.” Playing the Brahms concertos is probably among “the greatest experiences I’ve ever had,” he continues. “Especially playing the second one, which is so majestic. There is Beethoven’s ‘Emperor’ Concerto, but maybe Brahms Two is also an Emperor.” “From the very first note,” says Bronfman, “you can tell this is a journey, that this requires a collaboration between the soloist and the orchestra at all times. It’s always an exchange of ideas, back and forth. And the cello solo is arguably the most famous in the repertoire. I cannot think of a better orchestra than Cleveland to play with, for the chamber music character of the Second Concerto.’’ For tickets, visit clevelandorchestra.com. Severance Hall 2011-12

Brahms Concerto Festival

61


Endowed Funds

funds established as of June 2011

Generous contributions to the endowment have been made to support specific artistic initiatives, ensembles, educational programming and performances, facilities maintenance costs, touring and residencies, and more. These funding opportunities currently represent new gifts of $250,000 or more. For information about making your own endowment gift to the Orchestra, please call (216) 231-7549.

ARTISTIC endowed funds support a variety of programmatic initiatives ranging from guest artists and radio broadcasts to the all-volunteer Cleveland Orchestra Chorus. American Conductors Fund

Guest Artist

Douglas Peace Handyside Holsey Gates Handyside

The Eleanore T. and Joseph E. Adams Fund Mrs. Warren H. Corning The Gerhard Foundation Margaret R. Griffiths Trust The Virginia M. and Newman T. Halvorson Fund The Hershey Foundation The Humel Hovorka Fund Kulas Foundation The Payne Fund Elizabeth Dorothy Robson Dr. and Mrs. Sam I. Sato The Julia Severance Millikin Fund The Sherwick Fund Mr. and Mrs. Michael Sherwin Sterling A. Spaulding Mr. and Mrs. James P. Storer Mrs. Paul D. Wurzburger

Artist-in-Residence Malcolm E. Kenney

Artistic Collaboration The Keithley Fund

Young Composers Jan R. and Daniel R. Lewis

Friday Morning Concerts Mary E. and F. Joseph Callahan Foundation

International Touring Frances Elizabeth Wilkinson

Cleveland Orchestra Chorus Jerome and Shirley Grover Meacham Hitchcock and Family

Radio Broadcasts Robert and Jean Conrad

Concert Previews

Unrestricted

Dorothy Humel Hovorka

John P. Bergren and Sarah S. Evans

EDUCATION endowed funds help support programs that deepen connections to symphonic music at every age and stage of life, including training, performances, and classroom resources for thousands of students and adults each year. Education

Education Programs

Anonymous, in memory of Georg Solti Hope and Stanley I. Adelstein Kathleen L. Barber Isabelle and Ronald Brown Dr. Jeanette Grasselli Brown and Dr. Glenn R. Brown Alice B. Cull Memorial Frank and Margaret Hyncik Junior Committee of The Cleveland Orchestra Mr. and Mrs. David T. Morgenthaler

Cleveland Orchestra Youth Orchestra The George Gund Foundation Christine Gitlin Miles, in honor of Jahja Ling Jules and Ruth Vinney Touring Fund

Classroom Resources Charles and Marguerite C. Galanie

Musical Rainbows

Education Concerts Week The Max Ratner Education Fund, given by the Ratner, Miller, and Shafran families and by Forest City Enterprises, Inc.

62

The William N. Skirball Endowment

Pysht Fund

Endowed Funds

The Cleveland Orchestra


Supporting The Cleveland Orchestra THE CLEVELAND ORCHESTRA

SEVERANCE HALL endowed funds support performance initiatives for the Orchestra’s winter season in Cleveland and maintenance of Severance Hall: Severance Guest Conductor

Organ

Roger and Anne Clapp James and Donna Reid

D. Robert and Kathleen L. Barber Arlene and Arthur Holden Kulas Foundation Descendants of D.Z. Norton Oglebay Norton Foundation

Keyboard Maintenance William R. Dew The Frederick W. and Janet P. Dorn Foundation Mr. and Mrs. Richard A. Manuel Vincent K. and Edith H. Smith Memorial Trust

Severance Hall Preservation Severance family and friends

BLOSSOM MUSIC CENTER and BLOSSOM FESTIVAL endowed funds support the Orchestra’s summer performances and maintenance of Blossom Music Center. Blossom Festival Guest Artist

Landscaping and Maintenance

Dr. and Mrs. Murray M. Bett The Hershey Foundation The Payne Fund Mr. and Mrs. William C. Zekan

The Bingham Foundation Emily Blossom family members and friends The GAR Foundation John S. and James L. Knight Foundation

Blossom Festival Family Concerts David E. and Jane J. Griffiths

CENTER FOR FUTURE AUDIENCES — Announced in October 2010, the Center for Future Audiences will transform the way The Cleveland Orchestra attracts and welcomes audiences to Severance Hall, throughout Northeast Ohio, and around the world. The Center was created with a generous naming lead gift of $20 million from the Maltz Family Foundation providing onethird of the $60 million endowment that will eventually help fully fund these activities. T H E C L E V E L A N D

O R C H E S T R A

CENTER FOR FUTURE AUDIENCES Endowed by the Maltz Family Foundation

Severance Hall 2011-12

Endowed Funds

63


Legacy & Planned Giving THE CLEVELAND ORCHESTRA

H E R I TAGE S O C I ET Y The Heritage Society honors donors who support the Orchestra through their wills, life income gifts, or other types of deferred giving. The following listing of members is current as of October 2011. The Cleveland Orchestra and Musical Arts Association thank those members below in bold who have declared to us their specific estate intentions. For more information, please call Jim Kozel, Director of Legacy Giving at (216) 231-7549. Lois A. Aaron Leonard Abrams Shuree Abrams* Gay Cull Addicott Stanley and Hope Adelstein Sylvia K. Adler Gerald O. Allen Norman and Marjorie* Allison George N. Aronoff Herbert Ascherman, Jr. Jack and Darby Ashelman Mr. and Mrs. William W. Baker Ruth Balombin* Mrs. Louis W. Barany* D. Robert* and Kathleen L. Barber Jack Barnhart Margaret B. and Henry T.* Barratt Norma E. Battes Rev. Thomas T. Baumgardner and Dr. Joan Baumgardner Fred G. and Mary W. Behm Dr. Ronald and Diane Bell Bob Bellamy Joseph P. Bennett Ila M. Berry Howard R. and Barbara Kaye Besser Dr.* and Mrs. Murray M. Bett Dr. Marie Bielefeld Raymond J. Billy Dr.* and Mrs.* Harold B. Bilsky Robert E. and Jean Bingham Claudia Bjerre Mr. William P. Blair III Mrs. Flora Blumenthal Mr. Richard J. Bogomolny and Ms. Patricia M. Kozerefski Mr. and Mrs. Charles P. Bolton Kathryn Bondy* Loretta and Jerome* Borstein Mr. and Mrs.* Otis H. Bowden II Ruth Turvy Bowman Drs. Christopher P. Brandt and Beth Brandt Sersig Mr. D. McGregor Brandt, Jr. David and Denise Brewster Richard F. Brezic* Robert W. Briggs Dr. Jeanette Grasselli Brown and Dr. Glenn R. Brown

64

Ronald and Isabelle Brown* Mr. and Mrs. Clark E. Bruner* Harvey and Penelope* Buchanan Rita W. Buchanan* Joan and Gene Buehler Gretchen L. Burmeister Stanley and Honnie Busch Milan and Jeanne* Busta Mrs. Noah L. Butkin* Mr. and Mrs. William C. Butler Minna S. Buxbaum* Gregory and Karen Cada Roberta R. Calderwood* Jean S. Calhoun Harry and Marjorie M. Carlson Janice L. Carlson Dr. and Mrs. Roland D. Carlson Barbara A. Chambers, D.Ed. Ellen Wade Chinn* NancyBell Coe Kenneth S. and Deborah G. Cohen Ralph M. and Mardy R. Cohen Victor J. and Ellen E. Cohn Robert and Jean* Conrad Mr. and Mrs. Gerald A. Conway James P.* and Catherine E.* Conway Rudolph R. Cook The Honorable Colleen Conway Cooney John D. and Mary D.* Corry Dr.* and Mrs. Frederick S. Cross Dr. William S. Cumming* In Memory of Walter C. and Marion J. Curtis Mr. and Mrs. William W. Cushwa Howard Cutson Mr. and Mrs. Don C. Dangler Mr. and Mrs. Howard J. Danzinger Barbara Ann Davis Carol J. Davis Charles and Mary Ann Davis William E. and Gloria P. Dean, Jr. Mary Kay DeGrandis and Edward J. Donnelly Neeltje-Anne DeKoster Carolyn L. Dessin William R. Dew Mrs. Armand J. DiLellio James A. Dingus, Jr. Dr. and Mrs. Richard C. Distad

Legacy & Planned Giving

Maureen A. Doerner and Geoffrey T. White Henry and Mary Doll Gerald and Ruth Dombcik Mr.* and Mrs. Roland W. Donnem Nancy E. and Richard M. Dotson Mrs. John Drollinger Drs. Paul M. and Renate H. Duchesneau George* and Becky Dunn Warren and Zoann Dusenbury* Mr. and Mrs. Robert Duvin Paul and Peggy Edenburn Robert and Anne Eiben Mr. and Mrs. Alfred M. Eich, Jr. Mr. and Mrs. Ramon Elias* Roger B. Ellsworth Oliver and Mary Emerson Lois Marsh Epp Patricia Esposito Margaret S. Estill Dr. Wilma McVey Evans* C. Gordon and Kathleen A.* Ewers Patricia J. Factor Susan L. Faulder* Dr. and Mrs. Frederick Fennell* Mrs. Mildred Fiening Gloria and Irving B. Fine Jules and Lena Flock* Joan Alice Ford Dr. and Mrs.* William E. Forsythe Mr.* and Mrs. Ralph E. Fountain Gil and Elle Frey Arthur and Deanna Friedman Mr.* and Mrs. Edward H. Frost Dawn Full Henry S. Fusner Stephen and Nancy Gage Charles and Marguerite C. Galanie* Barbara and Peter Galvin Mr. and Mrs. Steven B. Garfunkel Donald* and Lois Gaynor Barbara P. Geismer Albert I. and Norma C. Geller Carl E. Gennett* John H.* and Ellen P. Gerber Frank and Louise Gerlak Dr. James E. Gibbs In Memory of Roger N. Gifford Dr. Anita P. Gilger*

The Cleveland Orchestra


Legacy & Planned Giving THE CLEVELAND ORCHESTRA

H E R I TAGE S O C I ET Y S. Bradley Gillaugh Mr. and Mrs. Robert M. Ginn Fred and Holly Glock Ronald* and Carol Godes William H. Goff Mr. and Mrs. Henry J. Goodman John and Ann Gosky Mrs. Joseph B. Govan* Elaine Harris Green Richard C. Gridley Nancy Griffith David E.* and Jane J. Griffiths David G. Griffiths* Ms. Hetty Griffiths Margaret R. Griffiths* Bev and Bob Grimm Judd and Zetta Gross* Candy and Brent Grover Mrs. Jerome E. Gover* Thomas J.* and Judith Fay Gruber Mr. and Mrs. David H. Gunning Mr. and Mrs. William E. Gunton Joseph E. Guttman* Mrs. John A Hadden Jr. Richard and Mary Louise Hahn James J. Hamilton Kathleen E. Hancock Douglas Peace Handyside* Holsey Gates Handyside Norman C. and Donna L. Harbert Mary Jane Hartwell William L.* and Lucille L. Hassler Peter and Gloria Hastings* Mrs. Henry Hatch (Robin Hitchcock) Virginia and George Havens Gary D. Helgesen Clyde J. Henry, Jr. Ms. M. Diane Henry Wayne and Prudence Heritage Rice Hershey* T. K. and Faye A. Heston Gretchen L. Hickok Mr. and Mrs.* Daniel R. High Edwin R. and Mary C. Hill* Ruth Hirshman-von Baeyer* Mr.* and Mrs. D. Craig Hitchcock Goldie Grace Hoffman* Mary V. Hoffman Feite F. Hofman MD Mrs. Barthold M. Holdstein Leonard* and Lee Ann Holstein David and Nancy Hooker Gertrude S. Hornung* Patience Cameron Hoskins Elizabeth Hosmer Dorothy Humel Hovorka Dr. Randal N. Huff Adria D. Humphreys*

Ann E. Humphreys and Jayne E. Sisson Karen S. Hunt Ruth F. Ihde Mr. and Mrs. Jonathan E. Ingersoll Pamela and Scott Isquick Mr. and Mrs.* Clifford J. Isroff Mr. and Mrs. Donald M. Jack, Jr. Carol S. Jacobs Milton* and Jodith Janes Jerry and Martha Jarrett Merritt Johnquest E. Anne Johnson Nancy Kurfess Johnson, M.D. Paul and Lucille Jones* Mrs. R. Stanley Jones* William R. Joseph David and Gloria Kahan Julian and Etole Kahan Drs. Julian* and Aileen Kassen Milton and Donna* Katz Patricia and Walter* Kelley Bruce and Eleanor Kendrick Malcolm E. Kenney Nancy H. Kiefer Charles M. and Janet G. Kimball* Mr. Kevin F. Kirkpatrick Mrs. Virginia Kirkpatrick James and Gay Kitson Julian H. and Emily W. Klein* Mary Elizabeth and G. Robert Klein* Thea Klestadt* Gilles and Malvina Klopman Paul and Cynthia Klug Martha D. Knight Mr. and Mrs. Robert Koch Dr. Vilma L. Kohn Elizabeth Davis Kondorossy* Mr. and Mrs. James G. Kotapish, Sr. LaVeda Kovar* Margery A. Kowalski Bruce G. Kriete* Mr. and Mrs. Gregory G. Kruszka Thomas and Barbara Kuby Eleanor and Stephen Kushnick Mr. and Mrs. Dennis W. LaBarre James I. Lader Mr. and Mrs. David A. Lambros Dr. Joan P. Lambros* Mrs. Carolyn Lampl Marjorie M. Lamport Louis Lane Charles and Josephine Robson Leamy Fund Teela C. Lelyveld Mr. and Mrs. Roger J. Lerch Gerda Levine Dr. and Mrs. Howard Levine

Bracy E. Lewis Mr. and Mrs. Thomas A. Liederbach Ruth S. Link Dr. and Mrs. William K. Littman Jeff and Maggie Love Dr. Alan and Mrs. Min Cha Lubin Ann B. and Robert R. Lucas* Kate Lunsford Mr. and Mrs. Thomas E. Lynch* Patricia MacDonald Alex and Carol Machaskee Jerry Maddox Carol and Steve* Madsen Alice D. Malone Mr. and Mrs. Donald Malpass, Jr. Lucille Harris Mann Mr. and Mrs. Richard A. Manuel Clement P. Marion Mr. Wilbur J. Markstrom Dr. and Mrs. Sanford E. Marovitz David C. and Elizabeth F. Marsh Duane and Joan* Marsh Florence Marsh, Ph.D.* Mr. and Mrs. Anthony M. Martincic Kathryn A. Mates Dr. Lee Maxwell and Michael M. Prunty Alexander and Marianna McAfee Nancy B. McCormack Mr. William C. McCoy Marguerite H. McGrath* Dorothy R. McLean Jim* and Alice Mecredy James and Viginia Meil Mr. and Mrs.* Robert F. Meyerson Brenda Clark Mikota Christine Gitlin Miles Chuck and Chris Miller Edith and Ted* Miller Leo Minter, Jr. Mr. and Mrs. William A. Mitchell Robert L. Moncrief Beryl and Irv Moore Ann Jones Morgan Mr. and Mrs. Stanley L. Morgan* George and Carole Morris Mr. and Mrs. Thomas W. Morris Mr. and Mrs.* Donald W. Morrison Joan R. Mortimer, PhD Florence B. Moss Susan B. Murphy Dr. and Mrs. Clyde L. Nash, Jr. David and Judith Newell Russell H. Nyland* Charles K. Laszlo and Maureen Oâ&#x20AC;&#x2122;Neill-Laszlo Katherine T. Oâ&#x20AC;&#x2122;Neill LISTING CONTINUES

Severance Hall 2011-12

Legacy & Planned Giving

65


Legacy & Planned Giving THE CLEVELAND ORCHESTRA

H E R I TAGE S O C I ET Y Be forever a part of what the world is talking about! L I S T I N G C O N T I N U ED

Mr. and Mrs. John D. Ong Aurel Fowler-Ostendorf* R. Neil Fisher and Ronald J. Parks Nancy and W. Stuver Parry Mrs. John G. Pegg* Dr. and Mrs. Donald Peniero Mary Charlotte Peters Mr. and Mrs. Peter Pfouts* Janet K. Phillips* Florence KZ Pollack Julia and Larry Pollock Victor and Louise Preslan* Mrs. Robert E. Price* Lois S.* and Stanley M. Proctor Mr. David C. Prugh Leonard and Heddy Rabe M. Neal Rains Mr. George B. Ramsayer Joe L. and Alice* Randles Mrs. Alfred M. Rankin Mrs. Theodore H. Rautenberg* Dr. Sandford Reichart* James and Donna Reid Mrs. Hyatt Reitman* Mrs. Louise Nash Robbins* Dr. Larry J.B.* and Barbara S. Robinson Dwight W. Robinson Margaret B. Babyak* and Phillip J. Roscoe Dr. Eugene and Mrs. Jacqueline Ross Helen Weil Ross* Marjorie A. Rott Dr. and Mrs. Howard E. Rowen Florence Brewster Rutter Mr. James L. Ryhal, Jr. Renee Sabreen Marjorie Bell Sachs Vernon Sackman Sue Sahli Mr. and Mrs. James A. Saks Larry J. Santon Stanford and Jean B. Sarlson Sanford Saul Family James Dalton Saunders Patricia J. Sawvel Ray and Kit Sawyer Richard Saxton* Alice R. Sayre In Memory of Hyman and Becky Schandler Robert Scherrer Sandra J. Schlub Ms. Marian Schluembach Robert and Betty Schmiermund Mr.* and Mrs. Richard M. Schneider

66

Lynn A. Schreiber* Jeanette L. Schroeder Mr. Frank Schultz Roslyn S. and Ralph M. Seed Nancy F. Seeley Edward Seely Oliver E. and Meredith M. Seikel Russell Seitz* Eric Sellen Andrea E. Senich Thomas and Ann SepĂşlveda Elsa Shackleton* B. Kathleen Shamp Jill Semko Shane David Shank Dr. and Mrs. Daniel J. Shapiro Norine W. Sharp Norma Gudin Shaw Elizabeth Carroll Shearer Dr. and Mrs. William C. Sheldon Frank * and Mary Ann Sheranko Kim Sherwin Mr. and Mrs. Michael Sherwin Reverend and Mrs. Malcolm K. Shields Rosalyn and George Sievila Mr. and Mrs. David L. Simon Dr.* and Mrs. John A. Sims Naomi G. and Edwin Z. Singer Lauretta Sinkosky Ellen J. Skinner Ralph* and Phyllis Skufca Janet Hickok Slade Alden D. and Ellen D.* Smith Mr.* and Mrs. Ward Smith M. Isabel Smith* Margaret C. Smith* Nathan Snader* Sterling A.* and Verdabelle Spaulding Sue Starrett and Jerry Smith Lois and Tom Stauffer Willard D. Steck* Merle Stern Dr. Myron Bud and Helene* Stern Mr. and Mrs. John M. Stickney Nora and Harrison Stine* Mr. and Mrs. Stanley M. Stone Mr. and Mrs. James P. Storer Ralph E. and Barbara N. String The Irving Sunshine Family Vernette M. Super* Mr.* and Mrs. Herbert J. Swanson In Memory of Marjory Swartzbaugh Lewis Swingley* Lorraine S. Szabo Norman V. Tagliaferri Susan* and Andrew Talton

Legacy & Planned Giving

Frank E. Taplin, Jr.* Charles H. Teare and Clifford K.* Kern Mr. Ronald E. Teare Pauline Thesmacher* Dr. and Mrs. Friedrich Thiel Mrs. William D. Tibbetts* Mr. and Mrs. William M. Toneff Alleyne C. Toppin Janice and Leonard Tower Dorothy Ann Turick Mr. and Mrs. Robert A. Urban Robert and Marti Vagi Robert A. Valente J. Paxton Van Sweringen Mary Louise and Don VanDyke Elliot Veinerman* Nicholas J. Velloney* Steven Vivarronda Hon. William F.B. Vodrey Pat and Walt* Wahlen Mrs. Clare R. Walker John and Deborah Warner Mr. and Mrs. Russell Warren Charles D. Waters* Etta Ruth Weigl Lucile Weingartner Eunice Podis Weiskopf* Max W. Wendel William Wendling and Lynne Woodman Marilyn J. White Alan H. and Marilyn M. Wilde Elizabeth L. Wilkinson* Helen Sue* and Meredith Williams Carter and Genevieve Wilmot Miriam L. and Tyrus W.* Wilson Mr. Milton Wolfson* and Mrs. Miriam Shuler-Wolfson Nancy L. Wolpe Mrs. Alfred C. Woodcock Mr. and Mrs.* Donald Woodcock Henry F. and Darlene K. Woodruff Marilyn L. Wozniak Nancy R. Wurzel Michael and Diane Wyatt Mary Yee Emma Jane Yoho, M.D Libby M. Yunger Dr. Norman Zaworski William L. and Joan H. Ziegler Carmela Catalano Zoltoski Roy J. Zook* Anonymous (80)

*deceased

The Cleveland Orchestra


Meet Nancy Dotson Cleveland Orchestra Heritage Society member, former State Chair of the Blossom Womenâ&#x20AC;&#x2122;s Committee, and Heritage Society radio ambassador on WCLV When did you begin attending Cleveland Orchestra concerts? Dick and I have lived in the area for 33 years and have been attending concerts for most of those years. What is your favorite concert experience with The Cleveland Orchestra? Without a doubt, we will never forget the concert at Severance Hall several years ago with Sir Colin Davis and Mitsuko Uchida and the Mozart Piano Concerto. Sitting in the dress circle and seeing the interaction of these two icons and The Cleveland Orchestra is something I will never forget. What is your favorite memory of The Cleveland Orchestra or Blossom Festival? Dick and I have so many wonderful memories of Blossom and Severance Hall. Living in Hudson and only 20 minutes from Blossom, our summer revolves around the lyrical weekend evenings at Blossom. Sitting on the Lawn with a glass of wine under the stars is our idea of a perfect date! Meeting various members of The Cleveland Orchestra at the summer Gourmet Matinee Luncheons or the Orchestra Picnic sponsored by the Blossom Womenâ&#x20AC;&#x2122;s Committee have also been special treats. What reason do you suggest when extending an invitation to join the Heritage Society? It is a very special privilege to have The Cleveland Orchestra so readily accessible and convenient to attend. It is for these reasons that we made a decision to include the Orchestra in our estate planning several years ago. Leaving a legacy for future generations to enjoy this music and for the musicians to carry on the music is someFor information on membership in the Heritage Society, contact Jim Kozel, Director of Legacy and Planned Giving, by calling 216-231-7549 or via email at jkozel@clevelandorchestra.com or go to clevelandorchestra.com and click on Support, then Heritage Society THE CLEVELAND ORCHESTRA

H ER I TAGE SO C I ET Y Severance Hall 2011-12

67


Be a part of one of Northeast Ohioâ&#x20AC;&#x2122;s favorite holiday traditions. Reserve your space in the

2011 Holiday Festival Program Book. Call John Moore, 216-721-4300

The Cleveland Orchestra guide to

Fine Shops & Services Michael Hauser DMD MD

IMMIGRATION LAW THE CAXTON BUILDING 812 HURON ROAD SUITE 601 CLEVELAND, OH 44115

Implants and Oral Surgery For Music Lovers Beachwood 216-464-1200

www.drhauser.com >VYSKJSHZZ performances. >VYSKJSHZZ audiences. Advertise among friends in The Cleveland Orchestra programs.

),1($57 $17,48(6

Letâ&#x20AC;&#x2122;s talk.

EXQUISITE PIECES VISIT OUR NEW IN A SURPRISING SHOWROOM SETTING

AAVery verySurprising special place Place

on Chagrin Blvd., across across from from Eton. Eton

\

v   

ROSNERLAWCOM

$63,5( $8&7,216

contact John Moore 216.721.4300 jmoore@LPCpub.com

LPCpublishing.com

Ă&#x152;    i IMMIGRATION

\

WWWROSNERLAWCOM

ZZZDVSLUHDXFWLRQVFRP

$XFWLRQHHUV $SSUDLVHUVRI )LQH$UW$QWLTXHVDQG-HZHOU\ 6XSHULRU$YH6WH &OHYHODQG2+ 3KRQH

Â&#x192; Â&#x192; Â&#x192; Â&#x192;

Ă&#x201C;n{näĂ&#x160; Â&#x2026;>}Ă&#x20AC;Â&#x2C6;Â&#x2DC;Ă&#x160; Â?Ă&#x203A;`°]Ă&#x160;7Â&#x153;Â&#x153;`Â&#x201C;iĂ&#x20AC;iĂ&#x160;6Â&#x2C6;Â?Â?>}iĂ&#x160;UĂ&#x160;Ă&#x201C;ÂŁĂ&#x2C6;°nĂ&#x17D;Â&#x2122;°Ă&#x2C6;£ää °]Ă&#x160;Ă&#x160; Â?iĂ&#x203A;i°Ă&#x160;Ă&#x152;Ă&#x192;°Ă&#x160;UĂ&#x160;Ă&#x201C;ÂŁĂ&#x2C6;°Â&#x2122;Ă&#x17D;Ă&#x201C;°xxĂ&#x17D;x >Ă&#x17E;wiÂ?`Ă&#x160;EĂ&#x160;iiĂ&#x160;,`Ă&#x192;°Ă&#x160; >Ă&#x17E;wiÂ?`Ă&#x160;EĂ&#x160;iiĂ&#x160;,`Ă&#x192;°Ă&#x160; Â?iĂ&#x203A;i°Ă&#x160;Ă&#x152;Ă&#x192;°Ă&#x160;UĂ&#x160;Ă&#x201C;ÂŁĂ&#x2C6;°Â&#x2122;Ă&#x17D;Ă&#x201C;°xxĂ&#x17D;x



9F6;4";6<; )XOO6HUYLFH&DWHULQJ





3HUVRQDO&KHI6HUYLFH

999T(.;+0)10+10T%1/ FEJTIHLTJJMM 'HEUD.UDXV&KHIa&KULV:R]QLDN&KHI

68

Insulation Systems 

Recognized experts re-insulating period-built homes using the latest Green Technology â&#x20AC;&#x201C; featuring Thermal Imaging 440.975.1122 www.insulationsystems.net

The Cleveland Orchestra


The Cleveland Orchestra: Serving the Community The Cleveland Orchestra’s Education and Community programs provide shared musical experiences that engage, inspire, support, and deepen connections with audiences throughout Northeast Ohio

P H OTO G R A P H Y BY R O G E R M A S T R O I A N N I

T H E C L E V E L A N D O R C H E S T R A has a long and proud history of sharing the value and joy of music with citizens throughout Northeast Ohio. Education and community programs date to the Orchestra’s founding in 1918 and have remained a central focus of the ensemble’s actitivities for over ninety years. Today, with the support of many generous individual, foundation, corporate, and governmental funding partners, the Orchestra’s educational and community programs reach more than 70,000 young people and adults annually, helping to foster a love of music and a lifetime of involvement with the musical arts. On these pages, we share photographs from a sampling of these many programs. For additional information about these and other programs, visit us at clevelandorchestra.com or contact the Education & Community Programs Office by calling (216) 231-7355.

School buses delivering students to Severance Hall. More than four million schoolchildren have been introduced to symphonic music in nine decades of Cleveland Orchestra education concerts. Severance Hall 2011-12

Education & Community

69


T H E

The Cleveland Orchestra helps celebrate the seasons and special events throughout the year. On October 30, the season’s first Family Concert featured the second annual “Halloween Spookatcular!” including a special audience costume contest.

C L E V E L A N D

Music Study Groups provide a way of exploring the Orchestra’s music in depth. These professionally led classes meet weekly to explore the music being played each week and the stories behind the composers’ lives.

A Family Concert featuring Stravinsky’s Firebird Suite brought audiences up close for a thrilling performance by Academy Trainees of the Joffrey Ballet and performers from the Cleveland School of Dance. The Joffrey Academy returns in December to Severance Hall for the season’s second Family Concert, “Scenes from Tchaikovsky’s Nutcracker.”

70

Education & Community

The Cleveland Orchestra


O R C H E S T R A

The Cleveland Orchestra is creating “Musical Neighborhoods” in Cleveland preschools as part of PNC Grow Up Great, using music to support pre-literacy and school readiness skills.

THANK YOU

Cleveland Orchestra clarinetist Robert Woolfrey leads a Learning Through Music program at H. Barbara Booker School in Cleveland.

The Cleveland Orchestra’s Education programs are made possible by many generous individuals, foundations, and corporations, including: The Abington Foundation The Eva L. and Joseph M. Bruening Foundation Chubb Group of Insurance Companies Cleveland Clinic The Cleveland Foundation Conn-Selmer, Inc. Dominion Foundation The Harry K. Fox and Emma R. Fox Charitable Foundation Giant Eagle Muna & Basem Hishmeh Foundation Martha Holden Jennings Foundation JPMorgan Chase Foundation The Laub Foundation The Lincoln Electric Foundation The Lubrizol Corporation The Nord Family Foundation Ohio Arts Council Ohio Savings Bank PNC The Reinberger Foundation Albert G. & Olive H. Schlink Foundation The Sherwin-Williams Foundation The South Waite Foundation Surdna Foundation Thomas H. White Foundation, a KeyBank Trust The Edward & Ruth Wilkof Foundation Women’s Committee of The Cleveland Orchestra

Severance Hall 2011-12

Education & Community

More than 1,000 talented young musicians have performed as members of the Cleveland Orchestra Youth Orchestra in the 25 years since its founding in 1986.

71


72

The Cleveland Orchestra


11001 Euclid Avenue, Cleveland, Ohio 44106 CLEVELANDORCHESTRA.COM

AT S E V E R A N C E H A LL CONCERT DINING AND CONCESSION SERVICE Severance Restaurant at Severance Hall is open for concert dining. For reservations, call (216) 231-7373, or click on the reservations link at clevelandorchestra.com Concert concession service of beverages and light refreshments is available before most concerts and at intermissions in the Smith Lobby on the street level, in the Bogomolny-Kozerefski Grand Foyer, and in the Dress Circle Lobby.

FREE PUBLIC TOURS Free public tours of Severance Hall are offered on select Sundays during the year. Free public tours of Severance Hall are being offered this season on November 27, February 12, March 18, and May 13. For additional information or to book for one of these tours, please call the Cleveland Orchestra Ticket Office at (216) 231-1111. Private tours can be arranged for a fee by calling (216) 231-7421.

THE CLEVELAND ORCHESTRA STORE A wide variety of items relating to The Cleveland Orchestra — including logo apparel, compact disc recordings, and gifts — are available for purchase at the Cleveland Orchestra Store before and after concerts and during intermission. The Store is also open Tuesday through Friday from 11 a.m. to 6 p.m. Cleveland Orchestra subscribers receive a 10% discount on most items purchased. Call (216) 231-7478 for more information, or visit the Store online at clevelandorchestra.com

RENTAL OPPORTUNITIES Severance Hall, a Cleveland landmark and home of the world-renowned Cleveland Orchestra, is the perfect location for business meetings and conferences, pre- or post-concert dinners and receptions, weddings, and social events. Exclusive catering provided by Sammy’s. Premium dates are available. Call the Facility Sales Office at (216) 231-7420 or email to hallrental@clevelandorchestra.com

BE FO R E T H E CONC E R T GARAGE PARKING AND PATRON ACCESS Parking can be purchased for $10 per vehicle when space in the Campus Center Garage permits. However, the garage often fills up well before concert time; only ticket holders who purchase prepaid parking passes are ensured a parking space. Overflow parking is available in CWRU Lot 1 off Euclid Avenue, across from Severance Hall; University Circle Lot 13A on Adelbert Road; and the Cleveland Botanical Garden. Pre-paid parking for the Campus Center Garage can be purchased in advance through the Ticket Office for $14 per concert. This pre-paid parking ensures you a parking space, but availability of prepaid parking passes is limited. To order pre-paid parking, call the Cleveland Orchestra Ticket Office at (216) 231-1111.

FRIDAY MATINEE PARKING

For our patrons’ convenience, an ATM is located in the Lerner Lobby of Severance Hall, on the ground floor across from the Cleveland Orchestra Store.

Due to limited parking availability for Friday Matinee performances, patrons are strongly encouraged to take advantage of convenient off-site parking and round-trip shuttle services available from the Cedar Hill Baptist Church (12601 Cedar Road). The fee for this service is $10.

QUESTIONS

CONCERT PREVIEWS

ATM — Automated Teller Machine

If you have any questions, please ask an usher or a staff member, or call (216) 231-7300 during regular weekday business hours, or email to info@clevelandorchestra.com

Severance Hall 2011-12

Guest Information

Concert Previews at Severance Hall are presented in Reinberger Chamber Hall on the ground floor, except when noted, beginning one hour before the start of most subscription concerts.

73


AT T H E CO NC E R T COAT CHECK Complimentary coat check is available for concertgoers. The main coat check is located on the street level midway along each gallery on the ground floor.

PHOTOGRAPHY, VIDEO, AND AUDIO RECORDING For the safety of guests and performers, photography and videography are strictly prohibited during performances at Severance Hall.

REMINDERS Please disarm electronic watch alarms and turn off all pagers, cell phones, and mechanical devices before entering the concert hall. Patrons with hearing aids are asked to be attentive to the sound level of their hearing devices and adjust them accordingly. To ensure the listening pleasure of all patrons, please note that anyone creating a disturbance of any kind may be asked to leave the concert hall.

LATE SEATING Performances at Severance Hall start at the time designated on the ticket. In deference to the comfort and listening pleasure of the audience, late-arriving patrons will not be seated while music is being performed. Latecomers are asked to wait quietly until the first break in the program, when ushers will assist them to their seats. Please note that performances without intermission may not have a seating break. These arrangements are at the discretion of the House Manager in consultation with the conductor and performing artists.

SERVICES FOR PERSONS WITH DISABILITIES Severance Hall staff are experienced in assisting patrons to find seats that meet their needs. Wheelchair seating is available on the Orchestra Level, Box Level, and Dress Circle, and in Reinberger Chamber Hall at a variety of prices. For patrons who prefer to transfer from a wheelchair, seats with removable arms are available on the Orchestra Level in the Concert Hall. ADA seats are held for those with special needs until 48 hours prior to the performance, unless sell-out conditions exist before that time. Severance Hall features seating locations for people with mobility impairments and offers wheelchair transport for all performances. To discuss your seating requirements, please call the Ticket Office at (216) 231-1111. TTY line access is available at the public pay telephone located in the Security Office. Infrared Assistive Listening Devices are available from a

74

Head Usher or the House Manager for all performances. If you need assistance, please contact the House Manager at (216) 231-7425 in advance if possible. Service animals are welcome at Severance Hall. Please notify the Ticket Office when purchasing tickets.

IN THE EVENT OF AN EMERGENCY Contact an usher or a member of the house staff if you require medical assistance. Emergency exits are clearly marked throughout the building. Ushers and house staff will provide instructions in the event of an emergency.

SECURITY For security reasons, backpacks, musical instrument cases, and large bags are prohibited in the concert halls. These items must be checked at coat check and may be subject to search. Severance Hall is a firearms-free facility. No person may possess a firearm on the premises.

CHILDREN Regardless of age, each person must have a ticket and be able to sit quietly in a seat throughout the performance. Season subscription concerts are not recommended for children under the age of eight. However, Family Concerts and Musical Rainbow programs are designed for families with young children. Cleveland Orchestra Youth Orchestra performances are recommended for older children.

T IC K ET SE RV IC ES TICKET EXCHANGES Subscribers unable to attend on a particular concert date can exchange their tickets for a different performance of the same week’s program. Subscribers may exchange their subscription tickets for another subscription program up to five days prior to a performance. There will be no service charge for the five-day advance ticket exchanges. If a ticket exchange is requested within 5 days of the performance, there is a $10 service charge per concert. Visit clevelandorchestra.com for details and blackout dates.

UNABLE TO USE YOUR TICKETS? Ticket holders unable to use or exchange their tickets are encouraged to notify the Ticket Office so that those tickets can be resold. Because of the demand for tickets to Cleveland Orchestra performances, “turnbacks” make seats available to other music lovers and can provide additional income to the Orchestra. If you return your tickets at least 2 hours before the concert, the value of each ticket can be used as a tax-deductible contribution. Patrons who turn back tickets receive a cumulative donation acknowledgement at the end of each calendar year.

Guest Information

The Cleveland Orchestra


Meet Margaret Mitchell Cleveland Orchestra Heritage Society Co-Chair, member, and Heritage Society ambassador on WCLV How many years have you been attending Orchestra concerts? Bill and I have been going to Orchestra concerts ever since we were married and came to Cleveland — sixty years. We spent many family summer evenings at Blossom when our children were young. Your favorite composer? I really love the ability of the Orchestra to play any music well, so I have to say I like whatever the Orchestra plays. But Mahler and Bruckner are classical favorites; Ives and Adams, among more recent composers. Your most memorable concerts? Because of the different venues, Dvořák’s “New World” Symphony in old Lucerne; Shostakovich in Miami. Prokofiev’s Fifth Symphony — the final movement encore in the Canary Islands. It’s difficult to pick out a favorite at Severance. I love most all of them. And, in Margaret’s own words, from her WCLV invitation to Orchestra lovers everywhere . . . Bill and I think The Cleveland Orchestra makes Cleveland a great place to live. — the superb concerts. — the talented orchestra musicians who contribute much to our community and represent us so well around the world. — the education programs building future audiences. These are some of the reasons we created a planned gift, securing lifelong income for us. It also makes sense for the Orchestra, helping to build the endowment. We want The Cleveland Orchestra that we love to enrich the lives of our children and grandchildren as it has for us. With your own planned gift, please join us as proud members of the Heritage Society. To learn how you can become a member of the Heritage Society, contact Jim Kozel, Director of Legacy and Planned Giving, by calling 216-231-7549 or via email at jkozel@clevelandorchestra.com or go to clevelandorchestra.com and click on Support, then Heritage Society THE CLEVELAND ORCHESTRA

Severance Hall 2011-12

H ER I TAGE SO C I ET Y

75


216.791.8000 www.benrose.org A leader in service, research, and advocacy for older adults

The Cleveland Orchestra guide to Fine Dining

photo by Hernan Herrero

World-class performances. World-class audiences. Advertise among friends in The Cleveland Orchestra programs.

*APANESE)ZAKAYA!SIAN"ISTRO 3HAKER3QUARE 3HAKER3QUARE\\ \\WWWSASAMATSUCOM WWWSASAMATSUCOM /PENUNTIL-IDNIGHT-ON 3AT PM3UN

WWW.CLUB

ISABELLA.COM

2175 CORNELL ROAD CLEVELAND, OHIO 44106 216.229.1111

www.livepub.com

Letâ&#x20AC;&#x2122;s talk.

contact John Moore 216.721.4300 jmoore@livepub.com

TheCanopy MediterraneanGrille Mediterranean & Middle Eastern Cuisine The Tudor Arms Hotel, 10660 Carnegie Avenue 216-456-2684 t Free valet parking with Orchestra ticket! Join us for dinner before or after the orchestra. Reservations â&#x20AC;&#x2122;til 11pm on Thurs. ~ 216.721.0300 2198 Murray Hill Rd. U Cleveland, OH 44106 U mangelos.com

Open for lunch Tuesday ~ Friday

two great restaurants minutes from Severance Hall...

In the heart of Little Italy!

university circle 216.231.1234 shaker square 216.295.1200 www.sergioscleveland.com

76

The Cleveland Orchestra


THE CLEVELAN D ORCHESTRA

Corporate Support The Cleveland Orchestra gratefully acknowledges and salutes these corporations for their generous support toward the Orchestra’s Endowment, Annual Fund, Special Projects, and/or Programs. Additional legacy gifts from these organizations and others are recognized through The Cleveland Orchestra Heritage Society.

Lifetime Giving

Annual Support

JOHN L. SEVERANCE SOCIETY

The Partners in Excellence program salutes companies with annual contributions of $100,000 and more, exemplifying leadership and commitment to artistic excellence at the highest level.

$5 MILLION AND MORE

KeyBank $1 MILLION TO $5 MILLION

Baker Hostetler Bank of America Eaton Corporation FirstEnergy Foundation Forest City Enterprises, Inc. The Goodyear Tire & Rubber Company The Lubrizol Corporation / The Lubrizol Foundation Merrill Lynch NACCO Industries, Inc. Parker Hannifin Corporation The Plain Dealer PNC Bank PolyOne Corporation The J. M. Smucker Company The Severance Society recognizes generous contributors of $1 million or more in lifetime giving to The Cleveland Orchestra. Listing as of September 2011.

gifts of $2,500 or more during the past year, as of September 20, 2011

PARTNERS IN EXCELLENCE $300,000 AND MORE

KeyBank The Lubrizol Corporation NACCO Industries, Inc. PNC Raiffeisenlandesbank Oberösterreich (Europe) PARTNERS IN EXCELLENCE $200,000 TO $299,999

Baker Hostetler Eaton Corporation Forest City Enterprises, Inc. The Plain Dealer PARTNERS IN EXCELLENCE $100,000 TO $199,999

The J. M. Smucker Company Medical Mutual of Ohio $50,000

TO

$99,999

FirstMerit Bank The Goodyear Tire & Rubber Company Jones Day Parker Hannifin Corporation The Sage Cleveland Foundation Tele München Group (Europe) $25,000 TO $49,999 Conn-Selmer, Inc. Giant Eagle JPMorgan Chase Foundation Northern Trust Bank of Florida (Miami) Quality Electrodynamics (QED) Richard L. Bowen & Associates, Inc. Squire, Sanders & Dempsey (US) LLP Thompson Hine LLP

$2,500 TO $24,999 Akron Tool & Die Company American Fireworks, Inc. American Greetings Corporation Arnstein & Lehr LLP (Miami) Bank of America

Severance Hall 2011-12

Corporate Support

BDI Brouse McDowell Eileen M. Burkhart & Co. LLC Buyers Products Company Calfee, Halter & Griswold LLP The Cliffs Foundation Community Behavioral Health Center Consolidated Graphics Group, Inc. Dealer Tire LLC Dollar Bank Dominion Foundation Ernst & Young LLP Evarts-Tremaine-Flicker Company Feldman Gale, P.A. (Miami) Ferro Corporation Fifth Third Bank Frantz Ward LLP Gallagher Benefit Services Genovese Vanderhoof & Associates Great Lakes Brewing Company Gross Builders Hahn Loeser + Parks LLP Higer Lichter & Givner LLP (Miami) Houck Anderson P.A. (Miami) Hyland Software, Inc. Keithley Foundation The Lincoln Electric Foundation C. A. Litzler Co., Inc. Live Publishing Company LNE Group / Lee Weingart (Europe) Macy’s Miba AG (Europe) MindCrafted Systems MTD Products, Inc. Nordson Corporation North Coast Container Corp. Northern Haserot Oatey Co. Octavia Press Ohio CAT Ohio Savings Bank, A Division of New York Community Bank Olympic Steel, Inc. Park-Ohio Holdings Corp. PolyOne Corporation The Prince & Izant Company Richey Industries, Inc. RPM International Inc. SEMAG GmbH (Europe) The Sherwin-Williams Company Stearns Weaver Miller Weissler Alha (Miami) Stern Advertising Agency Summa Health System Swagelok Company Towers Watson TriMark S.S. Kemp Trionix Research Laboratory, Inc. Tucker Ellis & West LLP Ulmer & Berne LLP Ver Ploeg & Lumpkin, P.A. Westlake Reed Leskosky Anonymous (3)

77


Live Publishing helps you

break through the marketing clutter to deliver powerful, memorable messages

Live Publishing provides comprehensive communications and marketing services to a who’s who roster of clients, including the world-renowned Cleveland Orchestra. Our unsurpassed client satisfaction is built on decades of hard-earned experience, in all the various aspects of magazine publishing and custom marketing communications. We know how to deliver the most meaningful messages in the most effective media, all in the most cost-effective manner. We’re easy to do business with, and our experienced crew has handled every kind of project – from large to small, print to web.

2026 Murray Hill Road, Suite 103, Cleveland, Ohio 44106 216.721.1800 email: info@livepub.com web: www.lpcpublishing.com


THE CLEVELAN D ORCHESTRA

Foundation & Government Support The Cleveland Orchestra gratefully acknowledges and salutes these Foundations and Government agencies for their generous support toward the Orchestraâ&#x20AC;&#x2122;s Endowment, Annual Fund, Special Projects, and/or Programs. Additional legacy gifts from these organizations and others are recognized through The Cleveland Orchestra Heritage Society.

Lifetime Giving

Annual Support

JOHN L. SEVERANCE SOCIETY

$1 MILLION AND MORE

$10 MILLION AND MORE

The Cleveland Foundation Maltz Family Foundation State of Ohio Ohio Arts Council The Kelvin and Eleanor Smith Foundation $5 MILLION TO $10 MILLION

Cuyahoga County residents through Cuyahoga Arts & Culture Kulas Foundation $1 MILLION TO $5 MILLION

Ann and Gordon Getty Foundation The GAR Foundation The George Gund Foundation The Louise H. and David S. Ingalls Foundation Martha Holden Jennings Foundation John S. and James L. Knight Foundation (Miami) Andrew W. Mellon Foundation John P. Murphy Foundation David and Inez Myers Foundation National Endowment for the Arts The Payne Fund The Reinberger Foundation

gifts of $2,000 or more during the past year, as of September 20, 2011

The Cleveland Foundation Cuyahoga County residents through Cuyahoga Arts and Culture Maltz Family Foundation The Kelvin and Eleanor Smith Foundation $250,000 TO $500,000

Andrew W. Mellon Foundation David and Inez Myers Foundation Ohio Arts Council The Skirball Foundation $100,000 TO $249,999

Sidney E. Frank Foundation The GAR Foundation The George Gund Foundation Martha Holden Jennings Foundation Kulas Foundation The Mandel Foundation The Miami Foundation, from a fund established by the John S. and James L. Knight Foundation (Miami) John P. Murphy Foundation Surdna Foundation $50,000 TO $99,999

The George W. Codrington Charitable Foundation The Louise H. and David S. Ingalls Foundation Myra Tuteur Kahn Memorial Fund of The Cleveland Foundation National Endowment for the Arts The Payne Fund The Reinberger Foundation $20,000 TO $49,999

The Severance Society recognizes generous contributors of $1 million or more in lifetime giving to The Cleveland Orchestra. Listing as of September 2011.

The Abington Foundation Akron Community Foundation The Helen C. Cole Charitable Trust The Mary S. and David C. Corbin Foundation The Gerhard Foundation, Inc. Ann and Gordon Getty Foundation Elizabeth Ring Mather and William Gwinn Mather Fund The Nonneman Family Foundation

Severance Hall 2011-12

Foundation/Government Support

The Esther and Hyman Rapport Philanthropic Trust The Sisler McFawn Foundation

$2,000 TO $19,999 Ayco Charitable Foundation The Ruth and Elmer Babin Foundation Bicknell Fund The Eva L. and Joseph M. Bruening Foundation The Collacott Foundation The Frances G. and Lewis Allen Davies Endowment Fund Mary and Dr. George L. Demetros Charitable Trust Elisha-Bolton Foundation Fisher-Renkert Foundation The Harry K. Fox and Emma R. Fox Charitable Foundation Funding Arts Network (Miami) The Helen Wade Greene Charitable Trust The Hankins Foundation Muna & Basem Hishmeh Foundation Richard H. Holzer Memorial Foundation The Kangesser Foundation The Laub Foundation Victor C. Laughlin, M.D. Memorial Foundation Trust The G. R. Lincoln Family Foundation Margaret Clark Morgan Foundation Miami-Dade County Department of Cultural Affairs (Miami) Laura R. & Lucian Q. Moffitt Foundation The Nord Family Foundation Paintstone Foundation The Charles E. & Mabel M. Ritchie Memorial Foundation The Leighton A. Rosenthal Family Foundation SCH Foundation Albert G. & Olive H. Schlink Foundation The Sherwick Fund Lloyd L. and Louise K. Smith Memorial Foundation The South Waite Foundation Jean C. Shroeder Foundation The Taylor-Winfield Foundation The George Garretson Wade Charitable Trust The S. K. Wellman Foundation The Wells Family Foundation, Inc. Thomas H. White Foundation, a KeyBank Trust The Edward & Ruth Wilkof Foundation Wright Foundation The Wuliger Foundation Anonymous (2)

79


THE CLEVELAN D ORCHESTRA

Individual Support The Cleveland Orchestra and Musical Arts Association gratefully recognize the individuals listed here, who have provided generous gifts of cash or pledges of $2,500 or more in annual operating, endowment, special project, or benefit event support.

Lifetime Giving

Annual Support

JOHN L. SEVERANCE SOCIETY

gifts during the past year, as of September 20, 2011

$10 MILLION AND MORE

INDIVIDUAL GIFTS OF $500,000 AND MORE

Daniel R. and Jan R. Lewis (Miami)

Mr. and Mrs. Alexander M. Cutler Daniel R. and Jan R. Lewis (Miami)

$5 MILLION TO $10 MILLION

INDIVIDUAL GIFTS OF $200,000 TO $499,999

Mr. Richard J. Bogomolny and Ms. Patricia M. Kozerefski Mr. and Mrs. Alexander M. Cutler Mrs. Norma Lerner and The Lerner Foundation Mr. and Mrs. Albert B. Ratner Anonymous

Irma and Norman Braman (Miami) The Walter and Jean Kalberer Foundation Susan Miller (Miami) Mr. and Mrs. Albert B. Ratner James and Donna Reid

$1 MILLION TO $5 MILLION

Irma and Norman Braman (Miami) Mr. and Mrs. Francis J. Callahan Mrs. Anne M. Clapp Mr. George Gund III Mr. and Mrs. Michael J. Horvitz Mr. James D. Ireland III The Walter and Jean Kalberer Foundation Mr. and Mrs. Joseph P. Keithley Mr. and Mrs. Dennis W. LaBarre Susan Miller (Miami) Sally S. and John C. Morley The Family of D. Z. Norton The Honorable and Mrs. John Doyle Ong Mr. and Mrs. Alfred M. Rankin, Jr. Charles and Ilana Horowitz Ratner James and Donna Reid Barbara S. Robinson Anonymous (2) The Severance Society recognizes generous contributors of $1 million or more in lifetime giving to The Cleveland Orchestra. As of September 2011.

80

INDIVIDUAL GIFTS OF $100,000 TO $199,999

Ben and Ingrid Bowman Francie and David Horvitz (Miami) Mr. and Mrs. Michael J. Horvitz Mr. and Mrs. Joseph P. Keithley Dr. and Mrs. Herbert Kloiber (Europe) Mrs. Norma Lerner Mr. and Mrs. Herbert McBride Sally S. and John C. Morley Ms. Ginger Warner (Cleveland, Miami) Janet and Richard Yulman (Miami) INDIVIDUAL GIFTS OF $75,000 TO $99,999

Robert and Jean* Conrad Trevor and Jennie Jones Mr. and Mrs. Douglas A. Kern Mr. and Mrs. Dennis W. LaBarre The Honorable and Mrs. John Doyle Ong Julia and Larry Pollock Barbara S. Robinson

Leadership Council The Leadership Council salutes those extraordinary donors who have pledged to sustain their annual giving at the highest level for three years or more. Leadership Council donors are recognized in these Annual Support listings with the Leadership Council symbol next to their name:

Individual Donors

Severance Hall 2011-12


INDIVIDUAL GIFTS OF $50,000 TO $74,999

John P. Bergren* and Sarah M. Evans Mr. William P. Blair III Mr. Richard J. Bogomolny and Ms. Patricia M. Kozerefski Mr. and Mrs. Charles P. Bolton Hector D. Fortun (Miami) James D. Ireland III R. Kirk Landon and Pamela Garrison (Miami) Peter B. Lewis and Janet Rosel (Miami) Toby Devan Lewis Mrs. Emma S. Lincoln Ms. Nancy W. McCann Mr. and Mrs. Alfred M. Rankin, Jr. Mr. and Mrs. Richard K. Smucker David A. and Barbara Wolfort Anonymous INDIVIDUAL GIFTS OF $30,000 TO $49,999

Dr. and Mrs. Wolfgang Berndt (Europe) Blossom Women’s Committee The Brown and Kunze Foundation Jeanette Grasselli Brown and Glenn R. Brown Mrs. Gerald N. Cannon Mr. and Mrs. Matthew V. Crawford Mr. and Mrs. Geoffrey Gund George Gund Mrs. Marguerite B. Humphrey Giuliana C. and John D. Koch Foundation (Cleveland, Miami) Dr. Vilma L. Kohn Charlotte R. Kramer Mr. and Mrs. Jon A. Lindseth Ms. Beth E. Mooney Mrs. Alfred M. Rankin, Sr. Brian and Patricia Ratner Charles and Ilana Horowitz Ratner Luci and Ralph* Schey Mr. and Mrs. Franz Welser-Möst Women’s Committee of The Cleveland Orchestra Anonymous INDIVIDUAL GIFTS OF $25,000 TO $29,999

Sheldon and Florence Anderson (Miami) Mr. and Mrs. Gerald A. Conway Tati and Ezra Katz (Miami) Mr. and Mrs. S. Lee Kohrman Dr. and Mrs. David Leshner Mr. and Mrs. Alex Machaskee

Severance Hall 2011-12

Individual Donors

Mrs. Jane B. Nord Mr. and Mrs. James A. Ratner Hewitt and Paula Shaw Richard and Nancy Sneed R. Thomas and Meg Harris Stanton Rick, Margarita and Steven Tonkinson (Miami) Judy and Sherwood Weiser (Miami) INDIVIDUAL GIFTS OF $20,000 TO $24,999

Gay Cull Addicott Mr. and Mrs. Daniel M. Bell (Miami) Martha and Bruce Clinton (Miami) Bruce and Beth Dyer Dr. Edward S. Godleski Andrew and Judy Green Margaret Fulton-Mueller and Scott Mueller William J. and Katherine T. O’Neill Dr. and Mrs. Ronald J. Ross Marc and Rennie Saltzberg Dr. and Mrs. Neil Sethi Paul and Suzanne Westlake Anonymous gift from Switzerland (Europe) Anonymous INDIVIDUAL GIFTS OF $15,000 TO $19,999

Mr. and Mrs. William W. Baker Randall and Virginia Barbato Jayusia and Alan Bernstein (Miami) Scott Chaikin and Mary Beth Cooper Do Unto Others Trust (Miami) Colleen and Richard Fain (Miami) Mr. Allen H. Ford Richard and Ann Gridley Mrs. John A Hadden Jr. Gary Hanson and Barbara Klante Jack Harley and Judy Ernest Iris and Tom Harvie Joan and Leonard Horvitz Richard and Erica Horvitz (Cleveland, Miami) Elizabeth B. Juliano Mr. Thomas F. McKee Mrs. Stanley L. Morgan* Lucia S. Nash Mr. Gary A. Oatey Mr. and Mrs. James A. Saks Raymond T. and Katherine S. Sawyer Nancy and Neil Schaffel (Miami) David and Harriet Simon Mary M. Spencer (Miami) Dr. and Mrs. William P. Steffee Dr. Kenneth F. Swanson Mr. Joseph F. Tetlak listings continue

81


THE CLEVELAN D ORCHESTRA

INDIVIDUAL GIFTS OF $12,500 TO $14,999

Mr. and Mrs. George M. Aronoff Mr. and Mrs. David J. Carpenter George* and Becky Dunn Robert M. Maloney and Laura Goyanes Mrs. David Seidenfeld Mrs. Jean H. Taber Mr. and Mrs. Alfred Umdasch (Europe) INDIVIDUAL GIFTS OF $10,000 TO $12,499

Fred G. and Mary W. Behm Marsha and Brian Bilzin (Miami) Dr. Christopher P. Brandt and Dr. Beth Sersig Mr. D. McGregor Brandt, Jr. Mr. and Mrs. Eugene A. Buehler J. C. and Helen Rankin Butler Augustine* and Grace Caliguire Richard J. and Joanne Clark Mr. Bruce Coppock (Miami) Judith and George W. Diehl Mr. and Mrs. Robert P. Duvin Mike S. and Margaret Eidson (Miami) Dr. and Mrs. Lloyd H. Ellis Jr. Mr. and Mrs.* David K. Ford Ms. Dawn M. Full Mr. Francisco A. Garcia (Miami) Mr. and Mrs. Richard T. Garrett

Crescendo

Annual Campaign Patrons

Barbara Robinson, chair Robert Gudbranson, vice chair Gay Cull Addicott William W. Baker Ronald H. Bell Henry C. Doll Judy Ernest Nicki Gudbranson Jack Harley

Iris Harvie Brinton L. Hyde Randall N. Huff Elizabeth Kelley David C. Lamb Raymond T. Sawyer

Ongoing annual support gifts are a critical component toward sustaining The Cleveland Orchestra’s economic health. Ticket revenues provide only a small portion of the funding needed to support the Orchestra’s outstanding performances, educational activities, and community projects. The Crescendo Patron Program recognizes generous donors of $2,500 or more to the Orchestra’s Annual Campaign. For more information on the benefits of playing a supporting role each year, please contact Hayden Howland, Manager of Leadership Giving, by calling (216) 231-7545.

82

Albert I. and Norma C. Geller Mr. and Mrs. Robert W. Gillespie Sondra and Steve Hardis Henry R. Hatch and Robin Hitchcock Hatch Mr. and Mrs. Jeffrey Healy Mary and Jon Heider (Cleveland, Miami) David and Nancy Hooker Mr. and Mrs. Richard A. Janus Mr. and Mrs. Ferdinand Jereb Janet and Gerald Kelfer (Miami) Jonathan and Tina Kislak (Miami) Mrs. Elizabeth R. Koch Tim and Linda Koelz Mr. and Mrs. Edward A. Lozick Mr. and Mrs. Richard A. Manuel Mrs. Robert H. Martindale Mr. and Mrs. Arch J. McCartney William and Eleanor McCoy Mr. and Mrs. Stanley A. Meisel Mr. Walter N. Mirapaul Elisabeth and Karlheinz Muhr (Europe) Brian and Cindy Murphy Claudia and Steven Perles (Miami) Mr. and Mrs. George M. Rose Mr. and Mrs. David A. Ruckman David M. and Betty Schneider Rachel R. Schneider, PhD Mr. and Mrs. Oliver E. Seikel Kim Sherwin Lois and Tom Stauffer Mrs. Blythe Sundberg Dr. Russell A. Trusso Clara and David Williams INDIVIDUAL GIFTS OF $7,500 TO $9,999

Mr. William Berger Laurel Blossom Dr. and Mrs. Jerald S. Brodkey Dr. Ben H. and Julia Brouhard Dr. Thomas Brugger and Dr. Sandra Russ Ellen E. & Victor J. Cohn Supporting Foundation Mr. Owen Colligan Mr. and Mrs. William E. Conway Mr. and Mrs. Edward B. Davis Henry and Mary Doll Nancy and Richard Dotson Mr. and Mrs. Terry C. Z. Egger Mr. David J. Golden Robert K. Gudbranson and Joon-Li Kim Kathleen E. Hancock Dr.* and Mrs. Shattuck W. Hartwell, Jr. Mrs. Sandra L. Haslinger In memory of Philip J. Hastings Pamela and Scott Isquick Mr. and Mrs. Donald M. Jack, Jr. Allan V. Johnson Joela Jones and Richard Weiss Mr. Lawrence B. and Christine H. Levey Judith and Morton Q. Levin Mr. and Mrs. Thomas B. McGowan Mr. Donald W. Morrison Mr. and Mrs. Stephen E. Myers Mr. and Mrs. William M. Osborne, Jr. Pannonius Foundation listings continue

Individual Donors

Severance Hall 2011-12


PHOTOGRAPH Š BY HEDRICH BLESSING

Imagine your picture-perfect event at Severance Hall.

Severance Hall, a Cleveland landmark and home of the world-renowned Cleveland Orchestra, is perfect for business meetings and conferences, pre-concert or post-concert dinners, and receptions, weddings, and social events. Exclusive catering by Sammyâ&#x20AC;&#x2122;s

Premium dates available! Call the Manager of Facility Sales at (216) 231-7421 or email hallrental@clevelandorchestra.com


THE CLEVELAN D ORCHESTRA

listings continued

Rosskamm Family Trust Mr. Larry J. Santon Patricia J. Sawvel Carol and Albert Schupp Naomi G. and Edwin Z. Singer Family Fund Mrs. Gretchen D. Smith Mr. and Mrs. Donald W. Strang, Jr. Bruce and Virginia Taylor Sandy and Ted Wiese Anonymous (2) INDIVIDUAL GIFTS OF $5,000 TO $7,499

Dr. Jacqueline Acho and Mr. John LeMay Mr. and Mrs. Monte Ahuja Susan S. Angell Agnes Armstrong Mr. and Mrs. Albert A. Augustus Ms. Jody Bacon Mr. and Mrs. Dean Barry Mr. Jon Batchelor (Miami) James and Reita Bayman Dr. and Mrs. Nathan A. Berger Dr. and Mrs. Eugene H. Blackstone In memory of Claude M. Blair Mrs. Flora Blumenthal Brennan Family Foundation Mr. Robert W. Briggs Mr. and Mrs. William C. Butler Mr. and Mrs. R. Bruce Campbell Ms. Maria Cashy Drs. Wuu-Shung and Amy Chuang Dr. William & Dottie Clark Mrs. Lester E. Coleman Corinne L. Dodero Trust for the Arts and Sciences Mr. and Mrs. Evan R. Corns Mr. Peter and Mrs. Julie Cummings (Miami) Mrs. Barbara Ann Davis Peter and Kathryn Eloff Dr. and Mrs. Robert Elston Mary and Oliver Emerson Mr. and Mrs. Charles R. Emrick, Jr. Mr. and Mrs. Henry J. Goodman Mr. and Mrs. Randall J. Gordon Harry and Joyce Graham Mr. Paul Greig Mr.* and Mrs. David E. Griffiths David and Robin Gunning Clark Harvey and Holly Selvaggi T. K. and Faye A. Heston Mr. Clifford Hill Amy and Stephen Hoffman Mr. and Mrs. Brinton L. Hyde Mr. and Mrs. Christopher Hyland Ms. Martha Ingram (Miami) Judith* and Clifford Isroff Rudolf D. and Joan T. Kamper Andrew and Katherine Kartalis Milton and Donna* Katz Dr. and Mrs. William S. Kiser Cynthia Knight (Miami) Julius and Doris Kramer Mrs. Justin Krent Mr. and Mrs. Peter A. Kuhn Mr. and Mrs. Arthur J. Lafave, Jr.

84

Robert and Judie Lasser Judy and Donald Lefton (Miami) Shirley and William Lehman (Miami) Mr.* and Mrs. Leo Leiden Mr. Jeff Litwiller Mr. and Mrs. Robert P. Madison Ms. Jennifer R. Malkin Mr. and Mrs. Morton L. Mandel Alan Markowitz M.D. and Cathy Pollard Mrs. Kay Marshall Alexander and Marianna C. McAfee Claudia Metz and Thomas Woodworth Edith and Ted* Miller Mr. and Mrs. William A. Mitchell Robert Moss (Miami) Mr. and Mrs. Herbert Newman Richard and Kathleen Nord John and Margi Oâ&#x20AC;&#x2122;Brien Mr. Michael G. Oravecz Mr. Henry Ott-Hansen Mr. J. William and Dr. Suzanne Palmer Nancy and Robert Pfeifer Dr. and Mrs. John N. Posch Douglas and Noreen Powers Lois S.* and Stanley M. Proctor Drs. Raymond R. Rackley and Carmen M. Fonseca Mr. and Mrs. Roger F. Rankin Mrs. Nancy L. Reymann Mr. and Mrs. James E. Rohr Carol Rolf and Steven Adler Dr. Tom D. Rose Steven and Ellen Ross Mr. Christopher Roy Mr. Klaus G. Roy and Mrs. Gene J. Roy Mr. and Mrs. Robert C. Ruhl Drs. Michael and Judith Samuels (Miami) Larry and Sally Sears Dr. and Mrs. James L. Sechler Mr. Eric Sellen and Mr. Ron Seidman Dr. Gerard and Phyllis Seltzer Drs. Daniel and Ximena Sessler Mrs. Frances G. Shoolroy Mrs. William I. Shorrock Laura and Alvin A. Siegal David Kane Smith Jim and Myrna Spira George and Mary Stark Mrs. Marie S. Strawbridge Charles B. and Rosalyn Stuzin (Miami) Mr. and Mrs. Paul A. Teel, Jr. Mr. and Mrs. Bill Thornton Mr. Brian Thornton Mr. and Mrs. Lyman H. Treadway Mr.* and Mrs. Robert N. Trombly Robert A. Valente Don and Mary Louise Van Dyke Bill Appert and Chris Wallace (Miami) Tom and Shirley Waltermire Dr. Edward L. and Mrs. Susan Westbrook Tom and Betsy Wheeler Mr. Roy Woda Mrs. Janet A. Wright Mr. David Zauder Anonymous (5) listings continue

Individual Donors

The Cleveland Orchestra


The Center for Music & Medicine University Hospitals Center for Music and Medicine is proud to support The Cleveland Orchestra.

1-866-UH4-CARE | 1-866-844-2273 UHhospitals.org/musicandmedicine

© 2011 University Hospitals NEU 00262

Creativity, Passion, Accountability, and Integrity are our guiding principles principles.

Providing Controllership, CFO, Transaction Management, and Traditional Accounting Services to enterpreneurs and not-for-profit organizations. Contact Jonathan Green • 216.593.0900 ext. 109 • www.jmgreencpa.com

We believe in working for the greater good of all and we are proud to support any organization that shares this value. We thank The Cleveland Orchestra for its commitment to excellence! Ken Lanci, Chairman & CEO Consolidated Companies Severance Hall 2011-12

85


THE CLEVELAN D ORCHESTRA

listings continued INDIVIDUAL GIFTS OF $3,500 TO $4,999

Dr. and Mrs. D. P. Agamanolis Mr. and Mrs. Quentin Alexander Mr. and Mrs. Robert H. Baker Ms. Delphine Barrett Mr.* and Mrs. Russell Bearss Mr. and Mrs. Jules Belkin Dr. Ronald and Diane Bell Dr. Robert Benyo Suzanne and Jim Blaser Mr. and Mrs. Dennis A. Block Paul and Marilyn* Brentlinger Ms. Elizabeth E. Brumbaugh Frank and Leslie Buck Dr. and Mrs. William E. Cappaert Mrs. Millie L. Carlson Ms. Mary E. Chilcote Drs. Mark Cohen and Miriam Vishny Diane Lynn Collier Marjorie Dickard Comella Mr. and Mrs. David J. Cook Pete and Margaret Dobbins Mr.* and Mrs. Sidney Dworkin Mr. Brian L. Ewart and Mr. William McHenry Mr. J. Gilbert and Mrs. Eleanor Frey Mrs. Cora C. Gigax Robert N. and Nicki N. Gudbranson

John and Virginia Hansen Mr. Robert D. Hart Barbara Hawley and David Goodman Matthew D. Healy and Richard S. Agnes Ms. Mary Beth Hedlund Hazel Helgesen and Gary D. Helgesen Anita and William Heller Bob and Edith Hudson (Miami) Mr. James J. Hummer Dr. and Mrs. Scott R. Inkley Donna L. and Robert H. Jackson Mrs. Rita G. Kelly Mr. and Mrs. Robert M. Koch Ronald and Barbara Leirvik Mr. and Mrs. Irvin A. Leonard Mrs. Emma S. Lincoln Mr. and Mrs. Robert C. Loesch Anne R. and Kenneth E. Love Robert and LaVerne Lugibihl Elsie and Byron Lutman Joel and Mary Ann Makee Martin and Lois Marcus Dr. Susan M. Merzweiler Drs. Terry E. and Sara S. Miller Ann Jones Morgan

Dr. Joan R. Mortimer Mr. and Mrs. Peter R. Osenar Mrs. Ingrid Petrus Mr. and Mrs. John S. Piety In memory of Henry Pollak Dr. Laurine Purola Dr. Robert W. Reynolds Amy and Ken Rogat Bob and Ellie Scheuer Ms. Freda Seavert Ginger and Larry Shane Dr. Marvin and Mimi Sobel Mr. and Mrs. William E. Spatz Dr. Elizabeth Swenson Ms. Lorraine S. Szabo Mr. and Mrs. Leonard K. Tower Robert J. and Marti J. Vagi Mr. and Mrs. Fred A. Watkins Mr. and Mrs. Mark Allen Weigand Mr. Peter and Mrs. Laurie Weinberger Robert C. Weppler Nancy V. and Robert L. Wilcox Ms. Judith H. Wright Anonymous (3)

Mr. and Mrs. James B. Chaney Dr. and Mrs. Ronald Chapnick Dr. Christopher and Mrs. Maryann Chengelis Mr. and Mrs. Homer D. W. Chisholm Mr. and Mrs. Robert A. Clark Dr. Dale and Susan Cowan Mrs. Frederick F. Dannemiller Charles and Fanny Dascal (Miami) Jeffrey and Eileen Davis Mrs. Lois Joan Davis Ms. Nancy J. Davis (Miami) Scott and Laura Desmond Dr. and Mrs. Richard C. Distad Ms. Maureen A. Doerner and Mr. Geoffrey T. White Mr. George and Mrs. Beth Downes David Jack and Elaine Drage Mrs. Mary S. Eaton Esther L. and Alfred M. Eich, Jr. Erich Eichhorn and Ursel Dougherty Mrs. Margaret Estill David and Margaret Ewart Harry and Ann Farmer Scott Foerster, Forester and Bohnert Joan Alice Ford Mrs. Mary Elizabeth Ford Mr. Randall and Mrs. Patrice Fortin Mr. Monte Friedkin (Miami) Marvin Ross Friedman and Adrienne bon Haes (Miami) Peggy and David* Fullmer Richard L. Furry

Marilee L. Gallagher Barbara and Peter Galvin Joy E. Garapic Mrs. Georgia T. Garner Mr. Wilbert C. Geiss, Sr. Mrs. Joan Getz (Miami) Mr. Herman Gilbert Anne and Walter Ginn Joyce and Ab* Glickman Mr. and Mrs. David A. Goldfinger Dr. and Mrs. Ronald L. Gould Cynthia and David Greenberg Mr. and Mrs. Brent R. Grover The Thomas J. and Judith Fay Gruber Charitable Foundation Nancy and James Grunzweig Dr. Phillip M. and Mrs. Mary Hall Ronald M. and Sallie M. Hall (Miami) Mr. Holsey G. Handyside Mr. George P. Haskell Virginia and George Havens Oliver and Sally Henkel Mr. and Mrs. Jerry Herschman Mr. Robert T. Hexter Dr. and Mrs. John D. Hines Dr. and Mrs. Robert L. Hinnes Dr. Feite F. Hofman Mr. and Mrs. Edmond H. Hohertz Peter A. and Judith Holmes Thomas and Mary Holmes Dr. Keith A. and Mrs. Kathleen M. Hoover

INDIVIDUAL GIFTS OF $2,500 TO $3,499

Stanley I. and Hope S. Adelstein Norman and Rosalyn Adler Family Philanthropic Fund Mr. Gerald O. Allen Norman and Helen Allison Mr. and Mrs. Robert J. Amsdell Rev. Dr. and Mrs. Kenneth J. Anderson Mr. and Mrs. Jeffrey R. Appelbaum Mr. and Mrs. Stanley H. Arkin (Miami) Geraldine and Joseph Babin Mr. William Baldwin Reverend Thomas and Dr. Joan Baumgardner Mr. and Mrs. Mike Belkin Ms. Pamela D. Belknap Mr. Roger G. Berk Kerrin and Peter Bermont (Miami) Barbara and Sheldon Berns Julia & David Bianchi (Cleveland, Miami) John A. Biek and Christina J. Norton Carmen and Karl Bishopric (Miami) Bill and Zeda Blau Mr. Doug Bletcher Mrs. Mary Wick Bole John and Anne Bourassa Ms. Barbara E. Boyle Betty Madigan Brandt David M. and Carol M. Briggs Ms. Mary R. Bynum and Mr. J. Philip Calabrese Mr. and Mrs. Frank H. Carpenter Leigh and Mary Carter

86

listings continue

Individual Donors

The Cleveland Orchestra


investments | trust | banking

does your ďŹ nancial advisor know the score? A well-planned financial life has all the complexity â&#x20AC;&#x201C; and the fluidity â&#x20AC;&#x201C; of a symphony orchestra. Real life is complicated. People come to Key Private Bank for the simpliďŹ ed sophistication we bring to their ďŹ nancial lives. Our team can help you achieve what matters most to you, delivering strategic advice and objective wealth management solutions based on a ďŹ duciary standard of care that puts your interests before our own. Your ďŹ nances, your life â&#x20AC;&#x201C; in tune, on key â&#x20AC;&#x201C; for generations.

go to keyprivatebank.com call Louisa Guthrie, Key Private Bank Executive at 216-828-7877

Bank and trust products from KeyBank National Association, Member FDIC and Equal Housing Lender. Investment products are:   !  !   !  !      Key.com is a federally registered service mark of KeyCorp. ©2010 KeyCorp.    ADL1735.04


THE CLEVELAN D ORCHESTRA

listings continued INDIVIDUAL GIFTS OF $2,500 TO $3,499

Xavier-Nichols Foundation Robert and Karen Hostoffer Mr. and Mrs. Mark Houck Dr. Randal N. Huff and Ms. Paulette Beech Ms. Charlotte L. Hughes Ms. Luan K. Hutchinson Mr. and Ms. Charles S. Hyle Ruth F. Ihde Carol Lee and James Iott Helen and Erik Jensen Mr. Peter and Mrs. Mary Joyce Mr. Daniel Kamionkowski Mr. William and Mrs. Mary Jo Kannen Barbara and Michael J. Kaplan Rev. William C. Keene Elizabeth Kelley Ms. Angela Kelsey (Miami) The Kendis Family Trust: Hilary & Robert Kendis and Susan & James Kendis Bruce and Eleanor Kendrick Mr. James Kish Fred and Judith Klotzman Jacqueline and Irwin Kott (Miami) Dr. Ronald H. Krasney and Ms. Sherry Latimer* Dr. James and Mrs. Margaret Kreiner Mr. James and Mrs. Patricia Krohngold Mr. Donald N. Krosin David C. Lamb Mrs. Carolyn Lampl Kenneth M. Lapine Anthony T. and Patricia A. Lauria Mr. and Mrs. Leon Lazarev Jeffrey and Ellen Leavitt Dr. Hasoon Lee Dr. and Mrs. Jai H. Lee Michael and Lois A. Lemr Dr. Edith Lerner Dr. Stephen B. and Mrs. Lillian S. Levine Robert G. Levy Dr. Alan and Mrs. Joni Lichtin Isabelle and Sidney* Lobe Drs. Alex and Marilyn Lotas Martha Klein Lottman Sandi M. A. Macdonald and Henry J. Grzes (Miami) Herbert L. and Rhonda Marcus Dr. and Mrs. Sanford E. Marovitz Mr. and Mrs.* Duane J. Marsh Dr. Ernest and Mrs. Marian Marsolais Mr. Julien L. McCall Mrs. Alice Mecredy Dr.* and Mrs. Hermann Menges, Jr Stephen and Barbara Messner Donald D. Miller MindCrafted Systems Bert and Marjorie Moyar Mr. Raymond M. Murphy Richard B. and Jane E. Nash Marshall I. Nurenberg and Joanne Klein

88

Richard and Jolene O’Callaghan Nedra and Mark Oren (Miami) James P. Ostryniec (Miami) Mr. and Mrs. Christopher I. Page Deborah and Zachary Paris Dr. Lewis and Janice B. Patterson Mr. Thomas F. Peterson, Jr. Dr. Roland S. Philip and Dr. Linda M. Sandhaus Dale and Susan Phillip Mr. and Mrs. Richard W. Pogue Dr. Marc and Mrs. Carol Pohl William and Gwen Preucil Mr. Richard and Mrs. Jenny Proeschel Mr. Lute and Mrs. Lynn Quintrell Mr. and Mrs. Thomas A. Quintrell Ms. C. A. Reagan David and Gloria Richards Mrs. Florence Brewster Rutter Fred Rzepka and Anne Rzepka Family Foundation Dr. Harry S. and Rita K. Rzepka Nathan N. and Esther Rzepka Family Philanthropic Fund of the Jewish Federation of Cleveland Dr. and Mrs. Martin I. Saltzman Ms. Patricia E. Say Mr. Paul H. Scarbrough Mr. James Schutte Dr. John Sedor and Ms. Geralyn Presti Lee G. and Jane Seidman Charles Seitz (Miami) Harry and Ilene Shapiro Norine W. Sharp Dr. and Mrs. William C. Sheldon Mr. Richard Shirey Dr. Howard and Mrs. Judith Siegel Donald Singer and Helene Love Mr. and Mrs.* Jeffrey H. Smythe Pete and Linda Smythe Mrs. Virginia Snapp Jay and Ellen Solowksy (Miami) Mr. John C. Soper and Dr. Judith S. Brenneke Mr. John D. Specht Howard Stark M.D. and Rene Rodriguez (Miami) Mr. and Mrs.* Lawrence E. Stewart Mrs. Barbara Stiefel (Miami) Mr. and Mrs. G. W. Stuelpe Mr. and Mrs. Daniel C. Sussen Mr. Nelson S. Talbott Mr. Karl and Mrs. Carol Theil Colin Blades Thomas Dr. and Mrs. Thomas A. Timko Mr. and Mrs. Robert J. Tomsich Mr. Erik Trimble Drs. Anna* and Gilbert True Miss Kathleen Turner Mrs. H. Lansing Vail, Jr. Mr. and Mrs. Joaquin Vinas (Miami) Mr. and Mrs. Les C. Vinney Mr. and Mrs. Joseph F. Wasserbauer

Individual Donors

Ms. Laure A. Wasserbauer Philip and Peggy Wasserstrom Mr. and Mrs. Jerome A. Weinberger Richard Wiedemer, Jr. Helen Sue* and Meredith Williams Mr. Peter and Mrs. Ann Williams Richard and Mary Lynn Wills Charles Winans Michael H. Wolf and Antonia Rivas-Wolf Drs. Nancy Wolf and Aric Greenfield Mr. Robert Wolff and Dr. Paula Silverman Kay and Rod Woolsey Rad and Patty Yates Fred and Marcia Zakrajsek Mr. Kal Zucker and Mrs. Mary Frances Haerr Anonymous (11)

member of the Leadership Council (see page 80)

* deceased

The Cleveland Orchestra is sustained through the annual support of thousands of generous patrons, including members of the Crescrendo Patron Program listed on these pages. Listings of all donors of $300 and more each year are published in the Orchestra’s Annual Report, which can be viewed online at CLEVELANDORCHESTRA.COM For information about how you can play a supporting role for The Cleveland Orchestra’s artistic excellence and community partnerships, please contact our Philanthropy & Advancement Office by calling (216) 231-7545.

The Cleveland Orchestra


,&"/ #&& )/((.',)* ,*"# )/)#-+ )+# *

" !0*% /#!+ )+#1+ *

Since its founding in 1920, CIM has offered a world-class education to students of all ages and skill levels and presented concerts and operas to the community. To get your FREE CIM 2011-12 Concert Guide or for more details about CIM concerts or classes, call 216.791.5000 or visit cim.edu.

  216.707.4045TBL45.COM 

     

216.791.5000 | cim.edu 11021 east boulevard | cleveland

HARNESSES THE POWER OF THE ARTS ) $!*+/,&"/ #&& )/ '$+#%* ** )+*/((.',)*/)#-+ )+# * '%#.*/ % )+#'&*/#!+ )+#1+ *

  216.707.4054C2RESTAURANT.COM

::::::::::::::::::::::::::::::::::::::::::::::

PNC supports those who make the world a more beautiful place. Thatâ&#x20AC;&#x2122;s why weâ&#x20AC;&#x2122;re proud to sponsor the Orchestra. Cleveland Orchestra. Tthe Cleveland Because we know that achievement is an art form all its own.

       

Š2011 The PNC Financial Services Group, Inc. All rights reserved. PNC Bank, National Association. Member FDIC. ACHIEVEMENT is a registered mark of The PNC Financial Services Group, Inc.

COMMSERV AD JUN 2010 001

Severance Hall 2011-12

89


THE CLEVELAN D ORCHESTRA R E C O R D I N G S great gift ideas

New!

The Cleveland Orchestra’s catalog of recordings continues to grow. The newest DVD features Bruckner’s Eighth Symphony recorded live at Severance Hall under the direction of Music Director Franz Welser-Möst in 2010 and released in May 2011. And, just released, Dvořák’s opera Rusalka on CD, recorded live at the Salzburg Festival. Writing of the Rusalka performances, the reviewer for London’s Sunday Times praised the performance as “the most spellbinding account of Dvořák’s miraculous score I have ever heard, either in the theatre or on record. . . . I doubt this music can be better played than by the Clevelanders, the most ‘European’ of the American orchestras, with wind and brass soloists to die for and a string sound of superlative warmth and sensitivity.” Other recordings released in the past year include two under the baton of Pierre Boulez and a second album of Mozart piano concertos with Mitsuko Uchida, whose first Cleveland Orchestra Mozart album won a Grammy Award this past year. Visit the Cleveland Orchestra Store for the latest and best Cleveland Orchestra recordings and DVDs. New!


11001 Euclid Avenue Cleveland, Ohio 44106

P H OTO BY S T E V E H A L L © H E D R I C H B L E S S I N G

CLEVELANDORCHESTRA.COM

the world’s most beautiful concert halls, Severance Hall has been home to The Cleveland Orchestra since its opening on February 5, 1931. After that first concert, a Cleveland newspaper editorial stated: “We believe that Mr. Severance intended to build a temple to music, and not a temple to wealth; and we believe it is his intention that all music lovers should be welcome there.” John Long Severance (president of the Musical Arts Association, 1921-1936) and his wife, Elisabeth, donated most of the funds necessary to erect this magnificent building. Designed by Walker & Weeks, its elegant HAILED AS ONE OF

Severance Hall 2011-12

Severance Hall

Georgian exterior was constructed to harmonize with the classical architecture of other prominent buildings in the University Circle area. The interior of the building reflects a combination of design styles, including Art Deco, Egyptian Revival, Classicism, and Modernism. An extensive renovation, restoration, and expansion of the facility was completed in January 2000. In addition to serving as the home of The Cleveland Orchestra for concerts and rehearsals, the building is rented by a wide variety of local organizations and private citizens for performances, meetings, and gala events each year.

91


of Music Director Franz Welser-Möst, The Cleveland Orchestra has become one of the most sought-after performing ensembles in the world. In concerts at its winter home at Severance Hall and at each summer’s Blossom Festival, in residencies from Miami to Vienna, and on tour around the world, The Cleveland Orchestra sets standards of artistic excellence, creative programming, and community engagement. The partnership with Franz Welser-Möst, now in its tenth season, and with a commitment to the Orchestra’s centennial in 2018, has moved the ensemble forward with a series of new and ongoing initiatives, including: UNDER THE LEADERSHIP

the establishment of residencies around the world, fostering creative artistic growth and an expanded financial base, including an ongoing residency at the Vienna Musikverein (the first of its kind by an American orchestra); an annual Miami Residency involving three weeks of concerts, community activities, and educational presentations and collaborations; concert tours from coast to coast in the United States, including regular appearances at Carnegie Hall; regular concert tours to Europe (including biennial residencies at the Lucerne Festival) and Asia (including a residency at Tokyo’s Suntory Hall in the autumn 2010); ongoing recording activities, including new releases under the direction of Franz Welser-Möst and Pierre Boulez as well as a series of DVD concert presentations of four of Bruckner’s symphonies; additional new residencies at Indiana University and at New York’s Lincoln Center Festival; an expanded offering of education and community programs with a comprehensive approach designed to make music an integral and regular part of everyday life in Northeast Ohio; continuing and expanded educational partnerships with schools, colleges, and universities from across Northeast Ohio and in the Miami-Dade community; creative new artistic collaborations, including staged works and chamber music performances, with arts institutions in Northeast Ohio and across the Miami-Dade community; the return of staged opera to Severance Hall with the presentation of acclaimed Zurich Opera productions of the three Mozart/Da Ponte operas;

92

The Orchestra Today

The Cleveland Orchestra


an array of new concert offerings (including Fridays@7 and Celebrity Series at Severance Hall as well as movie, themed, and family presentations at Blossom) to make a wider variety of concerts more available and affordable; the return of ballet to Blossom, with performances by The Joffrey Ballet. The Cleveland Orchestra was founded in 1918 by a group of local citizens intent on creating an ensemble worthy of joining America’s ranks of major symphony orchestras. Over the ensuing decades, the Orchestra quickly grew from a fine regional organization to being one of the most admired symphony orchestras in the world. The opening of Severance Hall as the Orchestra’s home in 1931 brought a special pride to the ensemble and its hometown, as well as providing an enviable and intimate acoustic environment in which to develop and refine the Orchestra’s artistry. Year-round performances became a reality in 1968 with the opening of Blossom Music Center, one of the most beautiful and acoustically admired outdoor concert facilities in the United States.

CLEVELAND ORCHESTRA ARCHIVES

IN FOCUS

— Just two weeks after the Stock Market Crash, and still wearing a black armband in mourning for the death of his wife, Elisabeth, earlier in the year, John L. Severance breaks ground for the construction of Severance Hall.

NOVEMBER 1929

Severance Hall 2011-12

The Cleveland Orchestra

93


THE CLEVELAND ORCHESTRA U P C O M I N G

C O N C E R T S

At Severance Hall . . .

ALSOP CONDUCTS .. SAINT-SAENS ORGAN SYMPHONY

Cleveland Orchestra

CHRISTMAS

Sunday December 11 at 3 p.m. Friday December 16 at 8 p.m. Saturday December 17 at 3 & 8 p.m. Sunday December 18 at 3 & 7 p.m. Thursday December 22 at 8 p.m. Friday December 23 at 3 & 8 p.m.

Thursday December 8 at 8:00 p.m. Friday December 9 at 7:00 p.m. Saturday December 10 at 8:00 p.m. THE CLEVELAND ORCHESTRA Marin Alsop, conductor Peter Otto, violin Joela Jones, organ

Marin Alsop, music director of the Baltimore Symphony, makes her Cleveland Orchestra debut with a program of American daring and French sizzle. The concert thunders to a finish with the gargantuan sounds of Saint-Saëns’s spirited “Organ” Symphony. Featuring regular evening concerts and a KeyBank Fridays@7 presentation (with world music by Magda Giannikou and Banda Magda).

THE CLEVELAND ORCHESTRA Robert Porco, conductor Cleveland Orchestra Chorus and guest choruses

Celebrate the holiday season with a favorite Cleveland tradition — with The Cleveland Orchestra and Chorus in these annual offerings of music for the Christmas Season. Including sing-alongs and guest choruses, all in the festive yuletide splendor of Severance Hall.

Concert Sponsor: Medical Mutual of Ohio Fridays@7 Sponsor: KeyBank

See also the concert calendar listing on pages 48-49, or visit The Cleveland Orchestra online for a complete schedule of future events and performances, or to purchase tickets online 24 / 7 for Severance Hall concerts.

TICKETS

94

216-231-1111

clevelandorchestra.com

Upcoming Concerts

The Cleveland Orchestra


Bringing you classical music 24 hours a day.

Mobile | Online | HD Radio | FM

wksu.org/channels


A world of talent...

is inspiring Cleveland youth

The Cleveland Foundation’s Creative Fusion program is bringing international artists to Cleveland for long-term residencies at our cultural and educational institutions, giving our community a rich appreciation of diverse cultures and art forms. If the arts are important to you, why not join us? When you give to your favorite causes through the Cleveland Foundation, you can tap into our experts in investing and grantmaking so that your gift lasts – and keeps on giving – forever.

216.861.3810 877.554.5054 www.ClevelandFoundation.org

If you want to be remembered, do something memorable.SM


The Cleveland Orchestra program Nov. 25-27