Page 1

The official magazine for LEEASA (Lifting Equipment Engineering of South Africa) and CMA (Crane Manufacturers Association of SA)

Sept/Oct 2015

Planning a Heavy Lift Earth, Wind & Catastrophy Are LMI’s Really Aware of the Risk they Run? Lifting Africa - Sept/Oct 2015

Lifting Africa SEPTOCT15.indd 1

1

07-Sep-15 12:52:17 PM


"Technology from STAHL CraneSystems is in use whenever ƐŽƉŚŝƐƟĐĂƚĞĚĞŶŐŝŶĞĞƌŝŶŐ͕ŚŝŐŚƋƵĂůŝƚLJĂŶĚĞdžƚƌĞŵĞƐĂĨĞƚLJ ƐƚĂŶĚĂƌĚƐĂƌĞƌĞƋƵŝƌĞĚΗ

2

Lifting Africa - Sept/Oct 2015

Lifting Africa SEPTOCT15.indd 2

07-Sep-15 12:52:22 PM


ĞƐŝŐŶ͕&ĂďƌŝĐĂƟŽŶ͕ŽŶƐƚƌƵĐƟŽŶŽĨWŽƌƚĂďůĞ tŽƌŬƐŚŽƉƐ͕/ŶƐƚĂůůĂƟŽŶĂŶĚĞƌƟĮĐĂƟŽŶŽĨ KǀĞƌŚĞĂĚƌĂŶĞƐ͕,ŽŝƐƚƐĂŶĚĞůŽǁ,ŽŽŬ>ŝŌŝŶŐ͕ ZŝŐŐŝŶŐĂŶĚZĂŝůǁĂLJƋƵŝƉŵĞŶƚ͘ Tel: +27 (11) 900-1085 ƐĂůĞƐΛƐƚĂŚůĐƌĂŶĞƐ͘ĐŽ͘njĂzǁǁǁ͘ƐƚĂŚůĐƌĂŶĞƐ͘ĐŽ͘njĂ

Lifting Africa - Sept/Oct 2015

Lifting Africa SEPTOCT15.indd 3

3

07-Sep-15 12:52:26 PM


4

Lifting Africa - Sept/Oct 2015

Lifting Africa SEPTOCT15.indd 4

07-Sep-15 12:52:29 PM


Contents Sept/Oct 15

COVER STORY

The Benchmark of Lifting Performance

PERSONALITY PROFILE Topmost of the Industry

ASSOCIATION NEWS From the Chairman’s Desk

CRANE MANUFACTURERS ASSOCIATION Are LMI’s Really Aware of The Risks They Run?

NEWS FROM AFRICA

Self-Rigging MLC165 Crawler Crane is First of its Kind in Africa

CRANES, CHAINS & HOISTS Sinclinorium Headgear Cranes

HOOKS & CHAINS Getting Hooked on Safety

WORLD NEWS

Thailand’s Tallest Skyscraper

FORKLIFTS • •

Working in a Confined Area Pushing the Envelope: Refining Africa’s Capabilities

FLEET RENTAL • •

‘Uplifting’ Industry Its all about service, reliability and customer satisfaction

REGULATIONS

Legal Compliance Review

CASE STUDY

Earth, Wind, and Catastrophe

GRADING Chain Grading

SAFETY • •

The Nuts and Bolts of Power Plant Safety Heavy-Duty Round Sling

CRANES

The CXT Hoist - Star Performer

LIFTING • •

Planning a Heavy Lift Who We Are

OVERHEAD CRANES The 500 Tonner “Beast�

CRANES, CHAINS & HOISTS Optimum Efficiency And Enhanced Safety

LOADER CRANES

50 Years of Fassi Cranes at Bauma

6 9 10 11 13 15

Lifting Africa

Surita Marx Tel: (011) 047-2400, Cell: 083 281 5761 Email: info@liftingafrica.co.za Email: accounts@liftingafrica.co.za Contributors: Ronel Kotze, Tony Stone Distribution: 4000 (Provisional ABC member)

17 20 22 30 23 54 27 32 34 35 35 37 39 48 41 46 52

Index to Advertisers 6$  $-0(QJLQHHULQJ  %HFNHU0LQLQJ  %RQÂżJOLROL  &0&2<DOH  &XOPHQ  (QJLQHHULQJ6XSSOLHV  *XQQHER  .RQHFUDQHV  /LQGH  /LQN%HOW(TVWUD  0)1/LIWLQJ  0SKDWODODWVDQH/HDUQLQJ  1HZFRUU  3KDNDPLVD  3UR&UDQH6HUYLFHV OBC 5HQWWHFK6$  5LJJLQJ$FDGHP\  5XVFK  6FDZ0HWDOV  6KXWWHUORFN  6SHFLDOLVHG,QGXVWULDO6XSSOLHV IBC 6WDKO&UDQHV +RLVW  7HUH['HPDJ  7RFR/LIWLQJ  7RUUH/LIWLQJ  Verlinde OFC :+/LIWLQJ 

Disclaimer 2SLQLRQVLQWKLV3XEOLFDWLRQDUHWKRVHRIWKHDXWKRUVDQGGRQRWQHFHVVDULO\UHĂ&#x20AC;HFWWKRVHRIWKLVSXEOLFDWLRQLWVHGLWRULDOERDUGLWVHGLWRURULWV3XEOLVKHUV/(($6$RU &0$7KHPHQWLRQRIVSHFLÂżFSURGXFWVLQDUWLFOHVDQGDGYHUWLVHPHQWVGRHVQRWLPSO\WKDWWKH\DUHHQGRUVHGRUUHFRPPHQGHGE\WKLV3XEOLFDWLRQRULWVSXEOLVKHUVLQ SUHIHUHQFHWRRWKHUVRIDVLPLODUQDWXUHZKLFKDUHQRWPHQWLRQHGRUDGYHUWLVHG5HOLDQFHRQDQ\LQIRUPDWLRQFRQWDLQHGLQWKLVMRXUQDOLVDW\RXURZQULVN:KLOHHYHU\ HIIRUWLVPDGHWRHQVXUHWKHDFFXUDF\RIHGLWRULDOERDUGPDNHVQRUHSUHVHQWDWLRQVRUZDUUDQWLHVH[SUHVVRULPSOLHGDVWRWKHFRUUHFWQHVVRUVXLWDELOLW\FRQWDLQHGDQG RUWKHSURGXFWVDGYHUWLVHGLQWKLVSXEOLFDWLRQ7KH3XEOLVKHUVKDOOQRWEHOLDEOHIRUDQ\GDPDJHVRUORVVKRZVRHYHUDULVLQJLQFXUUHGE\UHDGHUVRIWKLVSXEOLFDWLRQRU DQ\RWKHUSHUVRQV7KH3XEOLVKHUGLVFODLPVDOOUHVSRQVLELOLW\DQGOLDELOLW\IRUDQ\GDPDJHVLQFOXGHVSXUHHFRQRPLFORVVDQGDQ\FRQVHTXHQWLDOGDPDJHVUHVXOWLQJ IURPWKHXVHRIVHUYLFHVRUSURGXFWVDGYHUWLVHGLQWKLVSXEOLFDWLRQ5HDGHUVRIWKLVSXEOLFDWLRQLQGHPQLI\DQGKROGKDUPOHVVWKHSXEOLVKHULWVRIÂżFHUVHPSOR\HHV DQGVHUYDQWVIRUDQ\GHPDQGDFWLRQDSSOLFDWLRQRURWKHUSURFHHGLQJVPDGHE\DQ\WKLUGSDUW\DQGDULVLQJRXWRULQFRQQHFWLRQZLWKWKHXVHRIDQ\VHUYLFHVDQGRU SURGXFWVRUWKHUHOLDQFHRQDQ\LQIRUPDWLRQFRQWDLQHGLQWKLVSXEOLFDWLRQ

Lifting Africa - Sept/Oct 2015

Lifting Africa SEPTOCT15.indd 5

5

07-Sep-15 12:52:32 PM


COVER STORYĂ&#x161;

T

he Benchmark of Lifting Performance

As one of the oldest crane companies in the world, Verlinde cranes, hoists and winches have been refined by over 150 years of continuous innovation. After over 55 years of success in the southern African bulk handling and mining markets, Verlinde Cranes & Hoists continues to innovate lifting solutions that will enhance its customersâ&#x20AC;&#x2122; ability to achieve efficient, safe and reliable handling. Verlinde has earned its reputation of â&#x20AC;&#x2DC;adding a new level of productivityâ&#x20AC;&#x2122; in southern Africaâ&#x20AC;&#x2122;s industrial lifting applications by focusing on providing the correct equipment at the right price. This is most recently demonstrated by the introduction of the new â&#x20AC;&#x2DC;back to basicsâ&#x20AC;&#x2122; EUROBLOC VM Essential to its extensive range of lifting equipment.

Simplified lifting solutions Launched in June this year, the new EUROBLOC VM Essential range of electric wire hoists offers a solution for applications that require lift from 2 000 to 12 500 kilograms â&#x20AC;&#x201C; without all the bells and whistles required in mining and heavy-duty bulk handling operations. 6

â&#x20AC;&#x153;In these high-risk and heavily regulated applications, we equip our lifting solutions with sparkand explosion-proof modifications, force gauges and a host of electronic devices,â&#x20AC;? says Warren Shankland, Managing Director, Verlinde Cranes & Hoists, Southern Africa. â&#x20AC;&#x153;However, what weâ&#x20AC;&#x2122;ve found in other everyday lifting operations, ranging from warehouses to construction sites, is that our customers are looking for a simple and safe lifting system â&#x20AC;&#x201C; without all the gadgets â&#x20AC;&#x201C; and our new VM Essential range satisfies this.â&#x20AC;? The VM Essential range is, therefore, a cost-effective lifting solution consisting of a simple wire rope

Our electric chain hoist in an XQGHUJURXQG application!

2XUQHZFRVWHIIHFWLYH90 (XUREORF(VVHQWLDO

Brand new EUROBOC VM Essential Range: your everyday lifting solution â&#x20AC;˘ â&#x20AC;˘ â&#x20AC;˘ â&#x20AC;˘ â&#x20AC;˘ â&#x20AC;˘ â&#x20AC;˘ â&#x20AC;˘

/LIWLQJ&DSDFLWLHVWRNJ /LJKW+HLJKWXSWRP /RZFRQWUROYROWDJH9 $XGLEOHRYHUORDGLQGLFDWRU KRLVWLQJVSHHGVXSWRPPLQ /LIHWLPHOXEULFDWHGWUDYHOOLQJJHDUER[ /RDGOLPLWHUVZLWFKGHOLYHUHU ,3HOHFWULFFXELFOHSURWHFWLRQ

hoist and crane kit that can lift large loads while adhering to the highest levels of safety.

Solutions for specialised industries The VM Essential range joins Verlindeâ&#x20AC;&#x2122;s wide portfolio of 30 product groups which offers lift from 63 to 250 000 kilograms up to 129 meters high and deliver best-in-class productivity and safety to Africaâ&#x20AC;&#x2122;s bulk handing industries. In addition to solutions for construction, automotive, engineering, marine, material handling, food & beverage, petrochemical and oil & gas, Verlinde also adapts its equipment for specialised industries where standard lifting solutions are not feasible. Mining: Safety first! Verlinde offers spark- and explosion-proof equipment with remote controlled operation; specialised power feed systems and a suspended electric box. Waterworks: Verlinde offers completely rust-resistant chains and suspended electronics to counter the hazards of this wet environment.

Lifting Africa - Sept/Oct 2015

Lifting Africa SEPTOCT15.indd 6

07-Sep-15 12:52:33 PM


Foundry: It is quite common in foundry applications to have the chain or hoist positioned over a melting pot. Verlinde provides chemical- and heat-resistant coatings and a thicker girder reinforcement to accommodate these high temperatures and corrosive fumes. Harbour Logistics: Not only is saline water a problem in this application â&#x20AC;&#x201C; more often than not itâ&#x20AC;&#x2122;s the humidity that will impact the lifting performance first. Verlinde offers superior rust-resistant hoists, gear boxes and electrical equipment for coastal applications.

Proven success throughout Africa Verlinde has installed, supplied and commissioned 18 overhead cranes at Randgold Resourcesâ&#x20AC;&#x2122; Kibali mine in the Democratic Republic of Congo to assist in moving items around in the mill. The company has also supplied and installed 12 overhead cranes in the production plant, primary crusher mill and maintenance plant of Anglo Americanâ&#x20AC;&#x2122;s Unki mine in Zimbabwe. In South Africa, four five-ton overhead cranes were supplied to an Impala Platinum mine to be used in an underground mine shaft for routine maintenance. Tailored for African bulk handling Verlinde offers customised lifting equipment that addresses the unique challenges of the African bulk handling industry. Verlinde technicians assess each customersâ&#x20AC;&#x2122; on-site operating conditions, taking all critical parameters into account, including heat, wind, dust, humidity and rain. Verlinde then uses computer-aided design tools to cus-

Secured in 2015! Manganese Mine in Northern Cape, South Africa 7KLVZRUOGUHQRZQHG\HDUROGPLQHUHTXLUHGDWRQ OLIWLQJVROXWLRQWRLQVWDOODQGPDLQWDLQLWVEUDQGQHZFUXVK HUPHWUHVEHORZWKHVXUIDFH RYHUKHDGFUDQHV 2UGHU5HFHLYHG-DQXDU\ ,QVWDOODWLRQ$XJXVW <HDUO\ORDGWHVWLQJDFFRUGLQJWR6$16DQG6$16  â&#x20AC;˘ \HDUPDLQWHQDQFHFRQWUDFW â&#x20AC;˘ 6XSSRUWHGE\9HUOLQGHÂśVEUDQFKLQ1RUWKHUQ&DSH â&#x20AC;˘ â&#x20AC;˘ â&#x20AC;˘ â&#x20AC;˘

2XU'RXEOH*LUGHU(852%/2&97OLIWVWRQV

tom-design the system according to the assessment findings, client and site specifications, after which the equipment is manufactured and tested in France. While the majority of Verlindeâ&#x20AC;&#x2122;s cranes and lifting equipment are imported from France, the South African distributor manufacturers the girders it requires locally (at their factory in Johannesburg).

Complete after-sales service and maintenance offerings Verlinde offers holistic, critical after-sales maintenance services to its customers. These services include the supply and replacement of genuine spare parts; supply, installation and commissioning of all hoisting systems; express customer support; maintenance contracts; and commissioning and load testing. These services extend to all brands of lifting equipment.

Verlinde service at your fingertips With representation in Gauteng, Limpopo, North West, Northern Cape, Free State, Mpumalanga, and in Kenya, Mozambique, Namibia, Zambia and Zimbabwe â&#x20AC;&#x201C; Verlinde is at the doorstep of African bulk handling, offering expert service, advice and maintenance for its customers. 9HUOLQGH&UDQHV +RLVWV6RXWK$IULFD7HO9(5/,1'(   (PDLO9HUOLQGH#LDIULFDFRP ZZZYHUOLQGHHG[FR]D

Lifting Africa - Sept/Oct 2015

Lifting Africa SEPTOCT15.indd 7

7

07-Sep-15 12:52:33 PM


Link-Belt is the

BEST

in its class

Best accessibility with flat deck Best load capacities Best attachment lengths Best distributor and factory support P

80130

RTC

8090

RTC

8080

RTC

8060

RTC

8050

RTC

RTC

8030

7

0

1

4

80150

RTC

4 4

INDUSTRIAL EQUIPMENT TEL : +27 (0) 11 966 2545 EMAIL : tzulu@eiegroup.co.za WEB : www.eiegroup.co.za

8

Lifting Africa - Sept/Oct 2015

Lifting Africa SEPTOCT15.indd 8

07-Sep-15 12:52:35 PM


PERSONALITY ROFILEÚ

TI

opmost of the ndustry Takes a bow to •

Kusile and Nghula Power Stations

Making Elephant Lifting a respected lifting equipment supplier in Sub-Sahara Africa

Challenges faced in the Industry

3HWHU7XUFKHWWL

P

eter is an Industrial Engineer and has a Post Graduate Diploma in Strategic Management. He was first employed by Chrysler in Australia. His last employer was Elephant Lifting. Peter started his career at Chrysler with a mere R450/month salary.

Achievements Design, development and supplying of Bespoke Lifting Gear and Rigging for various projects.

Projects • • • • •

Anglo Platinum Gautrain Viaducts and Tunnel Liners Nacala Coal Terminal Tipler Installation Katse Dam Medupi

50

years

of service.

According to Peter, the regulatory environment is the biggest challenge facing the industry; as there is no sense of urgency, low skilled and ignorant supervision capacity, insufficient control and a lack of knowledge shown by inspectors to regulate the quality and standards of lifting equipment. Another challenge is communication problems between industry bodies such as LEEASA, and end users and the Regulatory Authorities. Auditors and inspectors also enforce their own ideas of what is right and what is wrong.

Advice to offer Peter encourage companies to only use world class lifting equipment, supplied and maintained by reputable suppliers who are registered with the DOL as LMEs and are members of LEEASA. Price must not be a deciding factor when purchasing Lifting Equipment as safety comes first.

Conclusion Always use and only purchase lifting equipment that CONFORMS to appropriate design Standards and COMPLIES with all regulatory requirements. It is recommended to use professional (and independent) training advisors / consultants such Pakhamisa to put you, and keep you on the right safe lifting path!

We want to say

u thank yo to all our loyal customers.

www.eiegroup.co.za

Lifting Africa - Sept/Oct 2015

Lifting Africa SEPTOCT15.indd 9

9

07-Sep-15 12:52:36 PM


ASSOCIATION NEWSĂ&#x161;

F

rom the Chairmanâ&#x20AC;&#x2122;s Desk

The first edition of the Lifting Africa was awesome! .HQ*UHHQZRRG&KDLUPDQ

&XUUHQWDIIDLUVRIQRWHDQGRIFRQFHUQ

Bauma Conexpo Africa

DMR 2015

The show is from 15 to 18 September 2015. LEEASA will be in hall 6 at stand No. H6.N70, we hope to see you there so that we can discuss our restructuring of membership and introduction of new training programs. More details are in this edition of â&#x20AC;&#x153;Lifting Africaâ&#x20AC;?.

On the 27 August 2015 the Department of Labour held a workshop in Pretoria to present the new DMR 2015. The day after, LEEASA held a special general meeting to consider the way forward regarding DMR 2015. On the 28 of August 2015 LEEASA held a special general meeting as announced in our last newsletter/s and the website. A unanimous resolution was passed at this meeting by the quorum of in excess of 72 members as follows: â&#x20AC;˘

10

That LEEASA does not accept the â&#x20AC;&#x153;new DMR 2015â&#x20AC;? and LEEASA will therefore officially approach the Department of Labour and lodge an objection.

LEEASA NPO The implementation of our â&#x20AC;&#x153;No Profit Organisationâ&#x20AC;? (NPO) has been delayed due to a name change. A name change requires a 90 days waiting period for any objections to the new name. This expires at the beginning of November 2015. An announcement regarding our next meeting will be on our website in the near future. Until next time, Ken Greenwood. Chairman. ZZZOHHDVDPLUURU]FRP

Lifting Africa - Sept/Oct 2015

Lifting Africa SEPTOCT15.indd 10

07-Sep-15 12:52:37 PM


$ODQ 2Âś+DUD &UDQH 0DQXIDFWXUHUV $VVRFLDWLRQFKDLUSHUVRQ

How many of these engineering practitioners understand the risks of doing load tests on equipment which could have reached its safe working period?

Machinery Inspectors, under its influence, to familiarize themselves with the criteria which influence the safe working period .Many LMIâ&#x20AC;&#x2122;s are unaware of the risks they run when signing off on a load test on a lifting appliance which has reached its safe working period. If the load test certificate is issued with no reference to the need for a general overhaul then the LMI carries the responsibility in the event of a hoist failure. If the LMI At a recent meeting between the D. O.L and represenhas noted on the test certificate that the safe working tatives of the newly formed Crane Manufacturers Assoperiod has been reached, and a general overhaul is reciation extensive discussions took place relating to the quired; the end user does not take heed of the Original safe working period for hoists and lifting equipment Equipment Manufacturers recommendation that a general overhaul should take place Hoists are designed to have a maximum ca+RLVWVDUHGHVLJQHG then the responsibility passes pacity for a determined duty cycle. This results to the end user. The new DrivWRKDYHDPD[LPXP in a safe working period for a lifting appliance. en machinery regulation 18 for As the law stands at the moment each lifting capacity for a lifting machines together with appliance has to be load tested annually. Part GHWHUPLQHGGXW\F\FOH the soon to be adopted SANS of this procedure is to subject the lifting ma10375, The Inspection and testchine to 10% overload. This is intended to ing of overhead cranes takes indicate defects which are not apparent and care of the scenarios which can could lead to a failure arise due to the safe working period being reached.

Does this system really work? An overload test only proves that the lifting machine will lift the overload at that given point in time, itâ&#x20AC;&#x2122;s no guarantee that it will continue to function properly for the next year. . Moreover by overloading the hoist the safe working period is further eroded beyond the OEM design norm. This is particularly relevant when the lifting equipment being tested is 10 years old or more. Very often by the time a crane has reached an age of 10 years it has had a number of owners, and a number of different operational conditions. The aspect of safe working period is of vital importance to be able to guarantee the continued overall safety of the lifting appliance. The Department Of Labour made it quite clear that the responsibility for the education of the Lifting Machinery Inspectors lies with the Original Equipment Manufacturer. It is for this reason that the Crane Manufacturers Association of South Africa is actively encouraging the Lifting

The development of sophisticated computer based design programs has resulted in the more accurate prediction of an item of lifting equipmentâ&#x20AC;&#x2122;s safe working period. Many of the associationâ&#x20AC;&#x2122;s members have defined overhaul programs which can extend the safe working period, and in fact give the lifting appliance a new lease of life. They also have data logging devices which are able to track and record a lifting applianceâ&#x20AC;&#x2122;s duty cycle and load handling history thereby giving the end user total confidence in the future remaining safe working life of his crane or wire rope hoist. All of the end userâ&#x20AC;&#x2122;s responsible persons must question the lifting machinery inspector when a certificate is issued without any interrogation of the history of the lifting appliance being tested. It is the responsibility of the lifting machinery inspectors to determine the remaining safe working life of the equipment he tests and to recommend the need for a general overhaul .It is the responsibility of the end user to ensure that the overhaul is carried out.

Lifting Africa - Sept/Oct 2015

Lifting Africa SEPTOCT15.indd 11

CRANE MANUFACTURERS ASSOCIATIONĂ&#x161;

A R

re LMIâ&#x20AC;&#x2122;s Really Aware of The isks They Run?

11

07-Sep-15 12:52:37 PM


Reduced oscillation. Improved precision.

201508

30 17

500.000

The Demag V-type girder – less is more. The revolutionary architecture of the Demag V-type girder provides greater load handling efficiency. Thanks to tapered diaphragm joints, the oscillation characteristics are reduced by up to 30 %. That cuts cycle times, boosts load handling rates and ensures improved precision in handling operations – above all in the upper load capacity range. This means that heavy loads can also be positioned even faster and more precisely without the need for electronic control systems.

Terex MHPS (Pty) Ltd 60 Atlas Road, Boksburg North Tel. +27 (0)11 898 3500 enquiry.sa@terex.com

www. demagcranes.co.za 12

Lifting Africa - Sept/Oct 2015

Lifting Africa SEPTOCT15.indd 12

07-Sep-15 12:52:37 PM


NEWS FROM AFRICAĂ&#x161;

S

elf-Rigging Manitowoc MLC165 Crawler Crane is First of its Kind in Africa

Requiring a crane that could be easily dismantled and transported throughout Africa, Alistair Group, a handling equipment and logistical support services company based in Tanzania, has recently purchased a Manitowoc MLC165 crawler crane â&#x20AC;&#x201C; nicknamed â&#x20AC;&#x2DC;Big Redâ&#x20AC;&#x2122;.

m wide and can assemble and disassemble itself without the aid of an assist crane. The 165 t capacity Manitowoc crane is powered by a Cummins 300 HP engine. The open-loop hydraulic system, served by two variable displacement piston pumps, gives the MLC165 more lifting power than other cranes of its class. Big Red has a 60 m boom and a 90.7 ton hook block.

he Manitowoc MLC165 â&#x20AC;&#x201C; the first crane of its type in Africa â&#x20AC;&#x201C; was delivered to Alistair Group earlier this year and commissioned at the remote Mtwara Port in Tanzania. The craneâ&#x20AC;&#x2122;s initial contract will provide the port site with lift support for offshore oil and gas exploration. The Manitowoc MLC165 crawler crane can install and remove its own tracks and counterweights, and has an environmentally efficient engine.

The machine complements Alistair Groupâ&#x20AC;&#x2122;s fleet of rough-terrain Grove cranes ranging from 60 to 130 t capacity. From a maintenance and servicing perspective, it made sense that the company add the MLC165 to its growing fleet. Alistair Group has Manitowoc diagnostic software and qualified technicians on site, and were supported by a Manitowoc Crane Care service engineer during the handover.

T

â&#x20AC;&#x153;We specifically purchased the MLC165 due to its amazing versatility,â&#x20AC;? said Clementine James, business development director. â&#x20AC;&#x153;The machine can be disassembled and easily transported. It can be rigged up or down depending on capacity requirements and weight restrictions â&#x20AC;&#x201C; and best of all â&#x20AC;&#x201C; we are able to move it anywhere in the region on 11 truckloads without incurring any overweight penalties.â&#x20AC;? The MLC165 is exceptionally mobile, measuring only 3

The crane was assembled and rigged by a team of technicians that finalized the calibration, tests and training before it started work on the quayside in Mtwara.

â&#x20AC;&#x153;Here in Africa we donâ&#x20AC;&#x2122;t have the support infrastructure that companies have in other regions,â&#x20AC;? continued James. â&#x20AC;&#x153;We have found Manitowoc Crane Care to be a natural partner as they give us such responsive aftermarket product support, which is imperative to guaranteeing uptime on our remote worksites.â&#x20AC;? Alistair Groupâ&#x20AC;&#x2122;s cranes are used at a number of different sites across Africa, mainly to support the oil and gas exploration industry as well as construction sites, mining projects and general infrastructure developments, including power plants, wind farms and pipe lines. $OLVWDLU*URXSZZZPDQLWRZRFFUDQHVFRP

Lifting Africa - Sept/Oct 2015

Lifting Africa SEPTOCT15.indd 13

13

07-Sep-15 12:52:38 PM


14

Lifting Africa - Sept/Oct 2015

Lifting Africa SEPTOCT15.indd 14

07-Sep-15 12:52:40 PM


CRANES, CHAINS & HOISTSĂ&#x161;

Sinclinorium Headgear Cranes Condra has completed load tests on two 25ton headgear cranes manufactured at the companyâ&#x20AC;&#x2122;s Germiston works, for Mopani Copper Minesâ&#x20AC;&#x2122; Sinclinorium shaft. The two headgear cranes are part of a bigger order that includes two 70-ton maintenance cranes for the projectâ&#x20AC;&#x2122;s winderhouse. Condra will begin work on these in August 2015.. MCMâ&#x20AC;&#x2122;s headgear cranes were manufactured as identical machines with very high lifts of over 80 metres. They feature high tensile ropes and incorporate materials of the best possible quality on critical components. Gearboxes, for example, are made of 36B case hardened stainless steel. Live axle drives have been used throughout. Managing director, Marc Kleiner, said that this customer had named reliability and rapid service response among the reasons for awarding the order for Synclinoriumâ&#x20AC;&#x2122;s headgear and winderhouse cranes to Condra, which submitted a tender price higher than those of two rival bidders. Rapid response is supplied by the company agent EC Mining, which is based in the Copperbelt and able to react quickly to service calls using spare parts held in stock. Kleiner said, â&#x20AC;&#x153;Competitor man-

ufacturers in the Northern hemisphere generally found it difficult to respond promptly to service requirements in Zambiaâ&#x20AC;?. â&#x20AC;&#x153;Last year, we lost the order for Synclinoriumâ&#x20AC;&#x2122;s workshop cranes to a European company, but there have apparently been long waits for spare parts for these cranes when they were needed,â&#x20AC;? Kleiner said. â&#x20AC;&#x153;Copper mining companies need maximum production because of the currently depressed copper price, but this is dependent on the reliability of all machinery installed in the mines. There is no margin for excessive machine downtime. â&#x20AC;&#x153;It is a fact that the ability of some of our competitors to respond to needs and realities of African continent lags behind that of Condra. I am pleased that we have been able to add Synclinoriumâ&#x20AC;&#x2122;s headgear cranes to our long list of successful installations throughout this continent,â&#x20AC;? Kleiner said. An interesting aspect of manufacture of the MCM cranes was the flexing of factory production schedules in order to meet time-to-site requirements. According to Kleiner, this is something that Condra is accustomed to doing, whereas most rival companies tend not to be as accommodating. Africaâ&#x20AC;&#x2122;s market for very high-lift cranes such as those for MCM has for many years been dominated by Condra, which designs these machines around the companyâ&#x20AC;&#x2122;s durable and robust K-Series hoist range,

proven to be dependable under conditions of increased mechanical strain associated with high-lift applications. The modular design of the K-Series allows rapid modification to specific high-lift requirements, resulting in delivery times that are usually the shortest available. Competitive prices are the result of long production runs of standard parts. Condra uses silumin rotor cores to enhance K-Series motor-starting torque in the high-lift role, and has developed variable speed control levels on the drives to enable precise load positioning even on lifts of 100 metres and more. Hoist speeds of between zero and 18 metres per minute, and travel speeds of between zero and 200 metres per minute, are possible. Condra manufactures to ISO 9000 standards, and complies with the standards of ISO 14000 and ISO 18000. &RQGUD&UDQHV7HO   (PDLOVDOHV#FRQGUDFR]D ZZZFRQGUDFR]D

Lifting Africa - Sept/Oct 2015

Lifting Africa SEPTOCT15.indd 15

15

07-Sep-15 12:52:42 PM


16

Lifting Africa - Sept/Oct 2015

Lifting Africa SEPTOCT15.indd 16

07-Sep-15 12:52:42 PM


G

HOOKS & CHAINSÚ

etting Hooked on Safety

%\7RQ\6WRQH

Buying cheap usually gets you more than you bargained for! As one rigger operator found out the hard way, his shortcuts on safety turned out to be rather expensive, in more ways than one. Lifting hook and chain selection is critical.

I

n a recent accident with tragic consequences metallurgical analysis revealed that the hook’s composition, mechanical strength and hardness were quite inadequate. And, what should have been an obvious giveaway, the hook did not carry any mandatory markings.

Pieter Pelser, GM at Gunnebo Industries

The rule is simple - buy

smart, work smart, be safe, save time, save money!

SANS standards According to the SANS 1595:2003 standard, each hook should be legibly and indelibly marked in such a manner that does not impair the mechanical properties of the hook. These markings must include the following manufacturer information: | manufacturer's name, trade name or trade mark; | strength grade of the hook steel, e.g. M(4), P(5), S(6), T(8) or V(10); | working Load Limits (WLL) of the hook ; | batch or lot traceability details. When speaking to Pieter Pelser, General Manager at Gunnebo Industries, now celebrating 20 years in business, he said, “Given the applications, lifting hooks and chains have to be manufactured to the highest possible safety standards, and comply with all the regulatory

requirements. A death or injury is easy to talk about but a painful to experience.” Pelser’s advice is simple. If a lifting hook has been subjected to provable quality assurance testing, then your risk factor should far less. But, to be totally sure of what you are buying, ask the supplier whether the following tests form part of the quality assurance test set. If not, don’t buy that hook!

Types testing In order to prove the design, material, heat treatment and method of manufacture, each size of component and chain must be type tested in the finished condition in order to demonstrate that the component and chain possesses the required mechanical properties. The following testing procedures are particularly relevant: | Test for deformation: The manufacturing proof force (MPF) for the relevant size of the component is Lifting Africa - Sept/Oct 2015

Lifting Africa SEPTOCT15.indd 17

17

07-Sep-15 12:52:43 PM


/HWXVĂ RDW

your boat

Thank you Fassi for taking on all our heavy weights, from planes, trains and automobiles.

18

Lifting Africa - Sept/Oct 2015

Lifting Africa SEPTOCT15.indd 18

www.eiegroup.co.za

07-Sep-15 12:52:44 PM


HOOKS & CHAINSĂ&#x161;

times the WLL, and equal to 62.5% of the minimum breaking force (MBF). | Non-destructive test / visual inspection: A sample, approximately 3%, of every production batch of forged components should be subjected to magnetic particle or dye penetrating examination. This involves an experienced visual inspection of each chain link, and each forged component to detect defects. | Static tensile and ultimate elongation test: During manufacture, ad hoc samples should be tested. The minimum breaking force (MBF) value and the total ultimate elongation must be verified. | Bending deflection: During manufacturing, of chain and master links, samples should be taken and the minimum bend deflection is verified.

A working example

applied and removed. The dimensions, after proof loading, should not be different from the original dimensions, within prescribed tolerances in the specifications and in international standards. | Static tensile test: The breaking force (BF) for each component and size must be verified, in which case the verified value must at least be equal to the minimum breaking force (MBF) value. The MBF value /D\LQJGRZQDKHDY\GXW\ÂżEUHRSWLF FDEOHXVLQJD*UDE,4V\VWHP is equal to the working load limit (WLL) multiplied by an industry standard specified safety factor. | Fatigue test: By fatigue testing in pulsator testing machines, the toughest conditions of service must be simulated.

Manufacturing testing

.

During manufacture, continuous process tests should be carried out according to the specification requirements and in accordance with the latest international standards. The following testing procedures are particularly relevant: | Proof force: Each individual component and chain link must be tested to the manufacturing proof force (MPF) level before delivery. The MPF level is 2.5

A common thread is shared between working smartly and safety - keeping costs to a minimum. With all the heavy duty electrical and fibre optic cables, and contiguous HDPE pipes, being installed in South Africa, a flexible, yet safe, and cost efficient chain sling system is a must, in any contractorâ&#x20AC;&#x2122;s tool set. One such device is the GrabIQ system, which means, besides hooks to grab, it has a chain shortening function that allows the user to quickly adjust the chain sling. In addition, its four-point design gives it a safe and more efficient lift, which makes its use that much more effective. Not only this, but it also increases productivity, thereby bringing unit costs down. In looking at the its technical side, GrabIQ uses Grade 10 material that gives it that 25% added strength, while at the same time being lighter, yet able to maintain its high degree of safety. The foundational principles of safety must never be compromised in technology products. Unless a crane hook or chain is supplied by a reputable manufacturer, with patents to back up the technology, one should be very circumspect when considering a purchase. No crane hook or chain should leave its factory without being proof loaded and visually inspected, and with a guarantee of top quality. A properly integrated, multifunction product, especially in South Africa, needs to be easily assimilated. This means fewer components in each sling, but with the same and even better function than the old system. â&#x20AC;&#x153;A good example of this kind of innovation is the FlexiLeg system, where one Master Link combined with one 1-leg sling and two 2-leg sling units, completely replaces four master links and ten legs of chain sling. This innovation delivers flexibility in the field where the conditions for a lift can change quickly. Itâ&#x20AC;&#x2122;s this flexibility that saves time and money,â&#x20AC;? Pelser emphasised. *XQQHER,QGXVWULHV 7HO SLHWHU#JXQQHEROLIWLQJFR]D ZZZJXQQHERLQGXVWULHVFRP

Lifting Africa - Sept/Oct 2015

Lifting Africa SEPTOCT15.indd 19

19

07-Sep-15 12:52:44 PM


WORLD NEWSĂ&#x161;

Thailandâ&#x20AC;&#x2122;s Tallest Skyscraper $HULDOYLHZRIWKH0DKD1DNKRQWRZHU image: Payont Thanasatirakul

On top of the MahaNakhon tower, a 340-meter-high Linden Comansa 21LC290 18t tower crane dominates the skyline in Bangkok.

MahaNakhon Development by PACE Development Corporation Plc. is being built by Bouygues-Thai, and counts with the collaboration of two Linden Comansa tower cranes sold to Bouygues-Thai by Smart (1994) Co. Ltd, official distributor of Linden Comansa in Thailand.

Two tower cranes, from Spanish manufacturer Linden Comansa, work in the construction of the MahaNakhon tower in Bangkok. This skyscraper, 314 meters tall and with 77 floors, is already the tallest building in Thailand and from 2016 will house a hotel, a Shopping Malland the luxury apartments "The Ritz-Carlton Residences, Bangkok". When finished, the MahaNakhon tower will amaze everybody with its exceptional and spectacular "pixelated" facade.

A luffing-jib LCL310 24t model is located at the base of the tower since 2012. With maximum load of 24 tonnes and a freestanding height of 40.4 metres, its first duty was the construction of the MahaNakhon CUBE, a seven floor luxury retail centre in the same area of the MahaNakhon tower which opened in 2014. Since then, its work consists of unloading all construction materials arriving to the jobsite, arrange and distribute them on the ground as well as lift them up to the first floors of the tower. Thanks to its 60-meter-long luffing jib, its short counter jib, and its high load capacity, the LCL310

T

20

Lifting Africa - Sept/Oct 2015

Lifting Africa SEPTOCT15.indd 20

07-Sep-15 12:52:47 PM


24t works quickly and efficiently preparing on the site all the materials that have to be lifted to the top of the building. On top of the MahaNakhon tower stands a flat-top crane, model 21LC290 18t, with 40 meters jib and maximum load of 18 tonnes. Initially, the crane was erected on fixing angles with a freestanding height of 60.7 metres. As the tower was gaining height, the 21LC290 18t was also getting higher thanks to Linden Comansaâ&#x20AC;&#x2122;s internal climbing system, which is tied to the structure of the building. This internal climbing system climbs the crane quickly and safely while maintaining two ties to the structure, and saves economic costs as it only needs 11 mast sections, when an external crane would need more than 60 mast sections to reach the height of 340 meters. Smart trained the Bouygues-Thaiâ&#x20AC;&#x2122;s erectors team how to climb the 21LC290 18t, by doing the first set of manoeuvres together. It took a total of 18 climbs to reach the maximum height of 340 metres, climbing 4 floors each time.

7KH/&WRQWRSRIWKH0DK1DNKRQWRZHUDQGWKH/&/ WDWWKHEDVH

To work with the greatest possible efficiency, the 21LC290 18t is equipped with a 110 kW rated hoist motor, which reaches speeds of up to 228 metres per minute, allowing high productivity and efficiency as the loads are moved very quickly. In addition, this engine has a high capacity cable drum (1,280 metres of rope) manufactured by Lebus, so that the crane can permanently work with double trolley and full capacity of 18 tonnes. The 21LC290 18t crane started with the construction of the core structure of the MahaNakhon tower in September 2013 and completed it only 20 months later, in April 2015. This successful construction process was due to the good planning by Bouygues-Thai, the great collaboration between the service teams of Smart and Bouygues-Thai and certainly the great quality and performance of the Linden Comansa 21LC290 18t tower crane. The cranes LCL310 24t and 21LC290 18t, delivered with Bouygues-Thaiâ&#x20AC;&#x2122;s corporate orange colour, are still working tirelessly 16 hours a day, from 6 am to 10 pm under the Bangkok Metropolitan Administration guidelines, to meet the demanding schedule of the project. 0DULDQR(FKiYDUUL   (PDLOPDULDQRHFKDYDUUL#FRPDQVDFRP ZZZFRPDQVDFRP

&ORVHYLHZRIWKH/&/WOXIÂżQJMLEFUDQHDWWKH0DKD1DNKRQ SURMHFW image courtesy of PACE Development Corporation Plc

Lifting Africa - Sept/Oct 2015

Lifting Africa SEPTOCT15.indd 21

21

07-Sep-15 12:52:55 PM


FORKLIFTSĂ&#x161;

Â&#x2018;Â&#x201D;Â?Â&#x2039;Â?Â&#x2030;Â&#x2039;Â?Â&#x192;Â&#x2018;Â?ƤÂ?Â&#x2021;Â&#x2020;Â&#x201D;Â&#x2021;Â&#x192; On the 8th of May 2015 Langkloof Bricks took delivery of 3 x H 45 D and 2 x H 25 D, Linde Forklifts. The exceptional service levels, quality of machines and the competence of the staff experienced over this period made it a no brainer as to which machines to buy again. The Lindeâ&#x20AC;&#x2122;s are perfect for working in confined areas as well as in big sheds where sound is ampli- /WR5*DU\9HUPDDN6DOHV([HFXWLYH/LQGH3(1LFR%ODNH([HFXWLYH'LUHFWRU/DQJNORRI%ULFNV8QD%ODNH fied by the high roof structures. )RXQGHU/DQJNORRI%ULFNV'HDQ/DZVRQ5HJLRQDO%UDQFK0DQDJHU/LQGH3('HRQ&RHW]HH/DQJNORRI %ULFNV

Machines are allocated to different areas, 1x H45d and x 1x H25d to the production division, 1 x H45d to the drying division and 1x H45d and 1x H25d to the Vertical Shaft Brick Kiln firing division. Energy efficiency is one of our highest priorities at Langkloof Bricks and as such it was important to choose forklifts that fit into that profile.

As the VSBK divisions operates on a 24/7 principle, exceptionally high levels of machine availability is non-negotiable, a principle that Dean Lawson: Branch Manager and his team at Linde Port Elizabeth understands completely. /LQNL GH -RQJK%URZQ /LQGH 0DWHULDO +DQGOLQJ7HO    ZZZOLQGHPKFR]D

&5$1(5(3$,5

U/DERUDWRU\FRQWURORIRULJLQDOPDWHULDO U6DPHTXDOLW\PDWHULDOZLWKFHUWLILFDWHV U4XDOLILHGZHOGHUV U4XDOLILHGZHOGSURFHGXUHV U8SWR:HOGR[ U$FFHSWDQFHE\,QVXUDQFHDQG&HUWLI\LQJ $XWKRULWLHV U5HSDLUUHSRUWIRUIXWXUHUHIHUHQFH

www.rusch.to

&5$1(%2205(3$,5

586&+&5$1(5(3$,5 >Â&#x201C;LiiÂ?`Ă&#x160;{Ă&#x160;UĂ&#x160;ÂŁĂ&#x2C6;Ă&#x2021;ÂŁĂ&#x160; /Ă&#x160;i`iÂ&#x201C;LÂ?Â&#x2C6;Â&#x17D; /iÂ?°Ă&#x160;ÂłĂ&#x17D;ÂŁĂ&#x160;­äŽĂ&#x201C;Ă&#x201C;Ă&#x2021;Ă&#x160;x{ääĂ&#x201C;Ă&#x2021;Ă&#x160;UĂ&#x160;Ă&#x20AC;Ă&#x192;VJĂ&#x20AC;Ă&#x2022;Ă&#x192;VÂ&#x2026;°Ă&#x152;Â&#x153;Ă&#x160;

22

Lifting Africa - Sept/Oct 2015

Lifting Africa SEPTOCT15.indd 22

07-Sep-15 12:52:56 PM


FLEET RENTALĂ&#x161;

â&#x20AC;&#x2DC;Upliftingâ&#x20AC;&#x2122; Industry Renttech South Africaâ&#x20AC;&#x2122;s extensive rentĂ&#x201C;  Â&#x2020;    Ă&#x201C;      Ă&#x201C;   @

H RI

Lifting and rigging takes place in every conceivable industry sector. Renttech South Africaâ&#x20AC;&#x2122;s wide range of lifting and rigging equipment - and related products have consistently proven to be an invaluable solution to lifting requirements on a number of major engineering, construction or other infrastructure-related projects throughout South Africa. Alongside its array of well-known brands in welding, power generation and construction equipment, Renttech South Africaâ&#x20AC;&#x2122;s Unilift and Kyoto products include chain blocks, lever hoists, rope winches, chain slings and rope slings; as well as shackles, endless round slings, pneumatic winches and cargo securing systems. The companyâ&#x20AC;&#x2122;s own manufacturing division also produces high-quality webbing and endless round polyester slings. Besides the wide product range of lifting equipment for sale, Renttech also offers a rental option. For lifting solutions, Renttech is a recognisable name throughout industry â&#x20AC;&#x201C; from paper and pulp to shipping, power generation, mining, petrochemical and offshore oil and gas. The company ascribes its success in the industry - and strong presence in the power generation and refinery sectors - to its large rental fleet size and diverse product range. â&#x20AC;&#x153;Our Unilift brand has become synonymous with dependable lifting systems, all of which are manufactured to Renttechâ&#x20AC;&#x2122;s specifications. Our customers also appreciate the fact that the company is fully ISO-accredited â&#x20AC;&#x201C; this assures them of the highest quality products and processes, as in the lifting industry safety is of utmost importance,â&#x20AC;? says Gerrit van Zyl, Managing Director of Renttech SA. â&#x20AC;&#x153;Renttech also sources directly from the original equipment manufacturer (OEM) and supplies the end-user, resulting in premium brand products at very affordable pricing,â&#x20AC;? van Zyl adds. As an accredited company and member of the Lifting Equipment Engineering Association of South Africa (LEEASA), Renttechâ&#x20AC;&#x2122;s products are fully traceable and offer critical safety features, such as overload protection. â&#x20AC;&#x153;Adding to the peace of mind for our customers is our service, which includes full back-up support, spare parts and equipment servicing. All 23 of our branches around South Africa are consistent in offering high levels of ser-

8QLOLIW7RQ&KDLQ+RLVW

Lifting Africa - Sept/Oct 2015

Lifting Africa SEPTOCT15.indd 23

23

07-Sep-15 12:52:57 PM


24

Lifting Africa - Sept/Oct 2015

Lifting Africa SEPTOCT15.indd 24

07-Sep-15 12:52:58 PM


FLEET RENTALĂ&#x161;

for rental and, increasingly, customers are realising the benefits of rental over the outright purchase of equipment, according to van Zyl.

Rental Makes Sense â&#x20AC;&#x153;In many cases, rental makes sense as an alternative to capital expenditure, and our customers benefit from the full lifting solution for the duration of the project, be it long-term or short-term. This means fully-certified equipment which is also supported by service, maintenance and regular inspections. Renttech takes full ownership and responsibility for ensuring the up-to-date compliance of the equipment, which takes the worry out of managing the equipment for the customer,â&#x20AC;? van Zyl says. Serving a number of blue-chip companies throughout a variety of industry sectors, Renttech has built significant in-house capacity for both repairs and servicing, as well as for safety inspections. Registered as a Lifting Machinery Entity (LME), Renttech has a number of lifting machinery inspectors (LMIs) with the capacity to inspect and re-certify a customerâ&#x20AC;&#x2122;s lifting equipment to ensure compliance.

Visual Inspections 7RQ/HYHU+RLVW RLVW

vice and quality,â&#x20AC;? adds Renttechâ&#x20AC;&#x2122;s Operations Manager, Martiens Opperman. â&#x20AC;&#x153;All units are load-tested and certified, even if rented out for only a week.â&#x20AC;?

â&#x20AC;&#x153;Renttech is involved on an ongoing basis with quarterly visual inspections, as required by legislation, on projects in South Africa, and further afield in Africa,â&#x20AC;? says Opperman. â&#x20AC;&#x153;Most of our national sales staff have completed the South African Lifting Tackle Inspection (LTI) course. In addition, our workshop staff are all qualified to support the lifting and rigging industry, being fully trained in servicing, testing, and repairs on this equipment, such as chain blocks.â&#x20AC;?

Furthermore, Renttech plays a pivotal role in the petrochemical sector, having become the preferred supplier for many refinery maintenance and shutdown projects in South Africa.

Many of Renttechâ&#x20AC;&#x2122;s high-end customers request exact, tailored specifications when it comes to the length and type of chain or sling. In this way, the company works closely with the customer in tailor-making equipment according to their requirement.

â&#x20AC;&#x153;Our customers in the oil refinery industry have come to depend on our dedicated on-site team, which is on-hand for technical support, our fleet of more than 5,000 pieces of lifting and rigging equipment, quick turn-around times, and a choice of purchase or rental,â&#x20AC;? says Opperman.

â&#x20AC;&#x153;At Renttech we strive to provide a solution appropriate to the specific type and scale of a project. I believe our success rate rests on high levels of service and quality, ready availability of stock, and a quick delivery time, all of which are essential to the success of a project,â&#x20AC;? van Zyl concludes.

Renttech South Africa is the only company in South Africa with such an extended fleet of lifting equipment

7HO ZZZUHQWWHFKVDFR]D

Lifting Africa - Sept/Oct 2015

Lifting Africa SEPTOCT15.indd 25

25

07-Sep-15 12:52:58 PM


26

Lifting Africa - Sept/Oct 2015

Lifting Africa SEPTOCT15.indd 26

07-Sep-15 12:53:01 PM


REGULATIONSÚ

LR

egal Compliance eview

To assist users of lifting equipment to implement and maintain a safe lifting program in the work place and to be legally compliant, proper risk reviews or audits on lifting equipment should be conducted.

T

he scope of such a review will depend on the size, type and equipment used on a mine, factory, plant or installation.

The review must be conducted against either the requirements of the OHSA or MHSA Lifting Equipment Regulations, depending on which Act is applicable. For users of lifting equipment across the RSA border, cognizance has to be taken of their local legal requirements as well. According to Piet Otto from Phakamisa Safety Consultants, the issues to be covered, but not restricted to, on such a visit are the following: ™ Peruse and scrutinize all documentation.(See below);

™ Peruse purchasing procedures, vendor and product specifications; ™ Examine all written appointments and responsibilities; ™ View all storage facilities to determine legal compliance; ™ View all (or selected) lifting applications to ascertain legal compliance or identify any dangerous or illegal lifting practices; ™ View all lifting practices and equipment used in the various operations for legal compliance and product conformance; ™ Investigate the condition of all lifting equipment used on site for safe operation, quality, marking, certification etc.; ™ Investigate existing training requirements and short comings. All visits should start with an opening meeting with all concerned. At the end of the visit a closing meeting is held to summarize the visit as well as to express findings, recommendations and opinions.

Lifting Africa - Sept/Oct 2015

Lifting Africa SEPTOCT15.indd 27

27

07-Sep-15 12:53:02 PM


S14543

A trusted industry leader For more than 90 years, Scaw, a South African industry leader, has been a preferred supplier to the lifting and rigging industry. )URP ZLUH  VWUDQG SURGXFWV +DJJLHÂ&#x160; 6WHHO :LUH 5RSH FKDLQ SURGXFWV DV ZHOO DV ÂżWWLQJV DQG attachments, Scaw continues to design and deliver the highest quality products to customer VSHFLÂżFDWLRQV +LJKO\TXDOLÂżHGWHDPVZLWKH[WHQVLYHH[SHULHQFHLQDOODVSHFWVRIWKHDSSOLFDWLRQRIRXUSURGXFWVDUH on call to advise and support the selection, handling, installation and maintenance of products vital WRGULYLQJVDIHW\SURGXFWLYLW\DQGSURÂżWLQWKHOLIWLQJDQGULJJLQJLQGXVWU\

www.scaw.co.za 28

Lifting Africa - Sept/Oct 2015

Lifting Africa SEPTOCT15.indd 28

More than steel. 07-Sep-15 12:53:03 PM


The following documentation will be scrutinized, where applicable. If these documents are not available or up to date, Phakamisa will assist to compile and implement the necessary, to be legally compliant. Documentation to be scrutinized will include, but are not limited to: Â&#x2122; Inventories or asset registers of lifting tackle and hoists in use; Â&#x2122; Supplierâ&#x20AC;&#x2122;s test or conformance certificates for all products used; Â&#x2122; Up to date and proper Inspection registers and check lists; Â&#x2122; Existing Codes of Practice or written Operating Procedures; Â&#x2122; Stores control documents and registers; Â&#x2122; All written appointments for operators, inspectors and lifting equipment users, based on appropriate proof of training; Â&#x2122; Purchasing procedures, vendors and brands; Â&#x2122; Lifting plans/rigging studies where applicable; Â&#x2122; Functions of all appointed Responsible Persons Â&#x2122; LME/LMI verification for service providers who do load testing;

by different persons and target dates should be set to complete the project. As part of the project Phakamisa can supply proper inspection, and stores control registers, and assist clients to compile or update their existing written procedures and other documents Consulting fees will depend on the scope of work which will include a written report, with recommendations, at the end.

REGULATIONSĂ&#x161;

It is essential to prepare for such a visit.

All work is conducted by the writer, who is a lifting equipment expert, consultant and trainer with over 47 years of experience in this industry. 3LHW2WWR&HOO(PDLOSRWWR#LFRQFR]D ZZZSKDNDPLVDVDIHW\FR]D

MEET THE FAMILY

Â&#x2122; Contractor files for crane and lifting operations; Â&#x2122; Instructions for the safe use of lifting equipment; Â&#x2122; Training records, contents of training programs etc. All relevant operational areas need to be visited where lifting equipment is used as well as stores and planning departments.

A written report At the end of the visit, a comprehensive written report is submitted, with comments and recommendations. This report should then be used by the client to compile an Action Plan allocating various actions to be taken,

Our combination of multi-faceted handling equipment means that Linde machines are perfectly equipped for big jobs, small jobs and everything in between. With our comprehensive logistical know how, Linde has fast become the industry symbol for superior quality, seamless functionality and innovation. Available to lease, rent or on hire purchase, investing LQ/LQGHPDFKLQHVHQVXUHVWKHUHPDUNDEOHHIÄžFLHQF\RIHDFKPHPEHU of our family.

Linde Material Handling

For more information on Linde dealerships, products and services contact us on Tel : +27 11 723 7000 or visit www.linde-mh.co.za

Lifting Africa - Sept/Oct 2015

Lifting Africa SEPTOCT15.indd 29

29

07-Sep-15 12:53:03 PM


FORKLIFTSĂ&#x161;

Â&#x2014;Â&#x2022;Â&#x160;Â&#x2039;Â?Â&#x2030;Â&#x2013;Â&#x160;Â&#x2021;Â&#x2021;Â?Â&#x2DC;Â&#x2021;Â&#x17D;Â&#x2018;Â&#x2019;Â&#x2021;ÇŁÂ&#x2021;ƤÂ?Â&#x2039;Â?Â&#x2030;Â&#x2C6;Â&#x201D;Â&#x2039;Â&#x2026;Â&#x192;ÇŻÂ&#x2022; Material Handling Capabilities From a tradition of innovation that includes the construction of the worldâ&#x20AC;&#x2122;s first all-terrain forklift in 1958, Manitou continues to define the forefront of materials handling equipment, with a complete range of robust and reliable machinery and attachments that includes the worldâ&#x20AC;&#x2122;s largest telescopic handler, the 35-ton lift MHT-X 14350.

In spite of its overall size and 68-ton weight, a turning radius of 7.34 metres coupled to a steering configuration enabling 2-wheel, 4-wheel and crab steering functionality delivers a high level of manoeuvrability.

Manitou Scaler As required by South African mining law, the Manitou Scaler enables operators to scale detonated hard and soft rock from secure areas on a seven metre, 180° rotational turret, either from within its fully-enclosed cabin, or from up to 20 metres away via remote control for maximum safety.

R

Manitou Roof Bolter

Manitou engineers machines that perform in rough and hazardous environments to their full performance capacity with maximum levels of safety, including the implementation of mine-spec and flameproof technologies for hard and soft rock mining.

ManiTrax Tow Tractor

enowned for its ability to modify and customise its French-engineered machinery for southern Africaâ&#x20AC;&#x2122;s unique environments, Manitou Southern Africaâ&#x20AC;&#x2122;s equipment has established a reputation for high performance levels, improved safety standards and lower operational costs.

New additions to the mining and construction industry With a maximum lift of 35 tons on its 14-metre boom, the MHT-X 14350 combines all-terrain operability and ergonomic designs with exceptional handling capabilities for the lifting of massive material loads.

0DQLWRX6FDOHUHQDEOHV operators to scale hard DQGVRIWURFNIURPVHFXUH DUHDVRQLWVVHYHQPHWUH Â&#x192;URWDWLRQDOWXUUHWIRU PD[LPXPVDIHW\

30

The Manitou Roof Bolter is an automated drill and bolt rig that operates in confined soft and hard rock hanging walls as low as 1.8 metres. The Roof Bolter comprises a single rotating carousel head carrying six roof bolts, and enables drilling, automatic epoxy insertion and bolting functions in a single procedure.

The ManiTrax Tow Tractor is a utility vehicle for hauling, towing and transporting equipment, tools, skids and tanks. It is designed for maximum manoeuvrability, with full four-wheel and crab steering functionality allied to sleeker, more compact exterior designs, with hauling capacity of 35 tons. Manitouâ&#x20AC;&#x2122;s material handling equipment range includes: | Telehandlers: Characterised by their rough-terrain power, ability, manoeuvrability and versatility, with lift from 2.5 to 35 tons on a range of fixed and rotational booms.

7KHZRUOGÂśVODUJHVW WHOHKDQGOHUWRQOLIW FDSDFLW\ZLWKDPD[LPXP KHLJKWUHDFKRI PHWUHVIRUDOOWHUUDLQ SHUIRUPDQFH

Lifting Africa - Sept/Oct 2015

Lifting Africa SEPTOCT15.indd 30

07-Sep-15 12:53:04 PM


| Truck mounted forklifts: Truck-mounted handling solution for loading and offloading of heavy materials from the truck, with a lift capacity up to 2.5 tons, and maximum height of 3.3 metres. | Rough terrain and conventional forklifts: Rough terrain and conventional forklifts in electric and diesel/ LPG variations, with capacity up to 10 tons and lift height of up to 4 metres. Compact designs enable the machine to operate in confined spaces | Compact skid and track loaders: Gehl skid steer and track loaders from Manitou combine power and exceptional manoeuvrability in a compact, rigid frame, with lift up to over 5 tons. The machines can be equipped with over 100 application-specific attachments. | Access platforms: Manitouâ&#x20AC;&#x2122;s articulated and vertical access platforms and scissor lifts enable crews to access elevated, inaccessible locations.

Attachments By equipping a single vehicle to fulfil the function of many, Manitou reduces the need for operators to invest in standalone, single-purpose material handling solutions. As a leader in designing attachments that solve real-field material handling challenges, the companyâ&#x20AC;&#x2122;s engineers and designers are able to customise attachments for the specific application and safety requirements of the customerâ&#x20AC;&#x2122;s operation. Specialised Manitou attachments that reflect this [tra-

dition] include conveyor belt handlers, tyre handlers, strut and cylinder handlers, wheel motor handlers and stone dusters to name a few. Standard attachments include forks, jibs, s, winches, wi cranes, platforms, cages, and buckets in a range of specifications and designs. Manitouâ&#x20AC;&#x2122;s automatic attachment recognition system (E-Reco) enables vehicles to intelligently calibrate weight limits and envelope tolerances, enhancing site and application safety.

Performance anchored in safety Manitou is a leader in mining equipment safety, with advanced failsafe and auxiliary brakes and load-sensing technology facilitating safer material handling. Manitouâ&#x20AC;&#x2122;s minespec technologies for hard rock mining include catalytic fume filters and diluters that improve machine emissions to enhance underground air quality for greater compliance with health, safety, environmental and productivity regulations. Flameproof technology for soft rock mines includes an additional array of combustion traps that limit the possibility of mechanical sparks igniting finely-dispersed coal dust in hazardous underground environments. These include flameproof radiators, header tanks, cowls, cooling fans, intake manifolds, fuel pumps, air blast coolers, electrical systems, hydraulic starters and alarms. /LQGVD\6KDQNODQG0DQLWRX6RXWKHUQ$IULFD7HO   (PDLOOVKDQNODQG#PDQLWRXJURXSFRP, ZZZPDQLWRXFR]D

Lifting Your Expectations

Po box 752037 Gardenview 2047. 139 Hertz Street, Meadowdale Ext.3 Germiston Gauteng South Africa Tel: +27 11 453 0728/29 Fax: +27 11 453 0757/66

0861 Pro Star(776782)

www.ajmengineering.co.za

info@ajmengineering.co.za

www.ajmengineering.co.za Lifting Africa - Sept/Oct 2015

Lifting Africa SEPTOCT15.indd 31

31

07-Sep-15 12:53:05 PM


CASE STUDYÚ

Earth, Wind, and Catastrophe %\7RQ\6WRQH

Case Study /ŶEŽǀĞŵďĞƌůĂƐƚLJĞĂƌĂϭϵϴŵŚŝŐŚůĂƫĐĞŵĞĚĐƌĂǁůĞƌ ĐƌĂŶĞŽǀĞƌƚƵƌŶĞĚŬŝůůŝŶŐƚǁŽƉĞŽƉůĞĂŶĚŝŶũƵƌŝŶŐĨŽƵƌ͘tŚLJ͍ ĞĐĂƵƐĞƚŚĞ͞ƵŶĨŽƌĞƐĞĞŶ͟ŚĂƉƉĞŶĞĚ͘ƵƚǁĂƐŝƚƌĞĂůůLJƚŚĞƵŶĨŽƌĞƐĞĞŶ͍tĞĞdžĂŵŝŶĞƚŚĞŝŶĐŝĚĞŶƚ͘ ďĞŶŐŽĂ͛Ɛ͊<ŚŝĐŽŶĐĞŶƚƌĂƚĞĚƐŽůĂƌƉŽǁĞƌ;^WͿƉƌŽũĞĐƚŶĞĂƌ hƉŝŶŐƚŽŶŝŶƚŚĞEŽƌƚŚĞƌŶĂƉĞƐƵīĞƌĞĚĂĨĂƚĂůďůŽǁŽŶDŽŶĚĂLJ͕ ϯ EŽǀĞŵďĞƌ ϮϬϭϰ͕ Ăƚ ϭϯ͗ϯϬ ŝŶ ƚŚĞ ĂŌĞƌŶŽŽŶ͘  ϭϵϴ ŵ ŚŝŐŚůĂƫĐĞŵĞĚĐƌĂǁůĞƌĐƌĂŶĞŽǀĞƌƚƵƌŶĞĚŬŝůůŝŶŐƚǁŽƉĞŽƉůĞĂŶĚŝŶũƵƌŝŶŐĨŽƵƌ͘dŚĞŝŶǀĞƐƟŐĂƟŽŶĂŌĞƌǁĂƌĚďůĂŵĞĚĂ ƐƚŽƌŵ͕ǁŝƚŚŝƚƐǁŝŶĚĂŶĚŚĞĂǀLJƌĂŝŶƐ͕ĨŽƌƚŚĞĂĐĐŝĚĞŶƚ͘ The CSP uses mirrors or lenses to it concentrate a large area of sunlight, or solar thermal energy, onto a small area, a heat exchanger (receiver) on top of a tower. The concentrated sunlight heats a fluid in the receiver, such as molten salt, to temperatures as much as 1,050°F. The hot fluid is used to make steam for electricity generation. Interestingly, molten salt retains heat efficiently so it can be stored for later use. This means electricity can be produced during periods of peak need on cloudy days or even several hours after sunset. /ŶƚŚŝƐŝŶƐƚĂŶĐĞ͕ƚŚĞĐƌĂŶĞǁĂƐďĞŝŶŐƵƐĞĚŝŶƚŚĞĐŽŶƐƚƌƵĐƟŽŶ ŽĨƚŚĞƚŽǁĞƌĂŶĚƚŚĞĮƫŶŐŽĨƚŚĞƌĞĐĞŝǀĞƌ͘ŶĚ͕ĂƐŝƚƚƵƌŶĞĚ ŽƵƚ͕ ƚŚĞ ĚĂƚĞ ĂŶĚ ƚŚĞ ƟŵĞ ŽĨ LJĞĂƌ ǁŚĞŶ ƚŚĞ ĂĐĐŝĚĞŶƚ ŚĂƉƉĞŶĞĚ ǁĞƌĞ ŝŵƉŽƌƚĂŶƚ ĨĂĐƚŽƌƐ ŝŶ ĚĞƚĞƌŵŝŶŝŶŐ ƚŚĞ ĐĂƵƐĞ͕ ĂƐ ǁĂƐƚŚĞŐĞŽůŽŐLJŽĨƚŚĞĂƌĞĂ͘

Understanding the technology dŚĞƐĞůĞĐƟŽŶŽĨĂĐƌĂǁůĞƌĐƌĂŶĞĨŽƌƚŚŝƐƉƌŽũĞĐƚǁĂƐĂŐŽŽĚ ĚĞĐŝƐŝŽŶ͘ƌĂǁůĞƌĐĂƌƌŝĞƌƐĂƌĞŝĚĞĂůůLJƐƵŝƚĞĚĨŽƌƌƵŐŐĞĚũŽďƐŝƚĞ ƐŝƚƵĂƟŽŶƐ͘dŚĞůĂƌŐĞĨŽŽƚƉƌŝŶƚƉƌŽǀŝĚĞƐĂůĂƌŐĞŐƌŽƵŶĚͲďĞĂƌŝŶŐďĂƐĞĂƌĞĂƚŚĂƚŝƐŝĚĞĂůĨŽƌǁŽƌŬŝŶŐŽŶƵŶĮŶŝƐŚĞĚƐŝƚĞƌŽĂĚƐ Žƌ ƉĂƚŚƐ͕ ĞƐƉĞĐŝĂůůLJ ǁŝƚŚ ƐĂŶĚLJ ƐŽŝů ĐŽŶĚŝƟŽŶƐ͘  dŚĞƐĞ ŚƵŐĞ ĐƌĂŶĞƐ͕ǁŚŝĐŚĐĂŶůŝŌĂƐŵƵĐŚĂƐϭ͕ϬϬϬƚŽŶŶĞƐĂŶĚŵŽƌĞ͕ĂƌĞ ŵŽƵŶƚĞĚŽŶĐƌĂǁůĞƌƐ͕ǁŝƚŚůĂƫĐĞŵƐĨŽƌǁĞŝŐŚƚĚŝƐƚƌŝďƵƟŽŶ ĂŶĚ ĐĞŶƚƌĞ ŽĨ ŐƌĂǀŝƚLJ ĐŽŶƚƌŽů͕ ďĞĐĂƵƐĞ ŶŽ ŽƚŚĞƌ ĐĂƌƌŝĞƌ ƚLJƉĞǁŽƵůĚƉƌŽǀŝĚĞƐƵĸĐŝĞŶƚŽƌĞĐŽŶŽŵŝĐĂůĚĞĂĚůŽĂĚǁĞŝŐŚƚ ĚŝƐƚƌŝďƵƟŽŶŽŶƚŚĞŐƌŽƵŶĚƚŽƐĞƌǀĞĂƐƚŚĞ͞ĂŶĐŚŽƌ͟ƉŽŝŶƚ͘ ,ĞƌĞŝŶŝƐƚŚĞĐƌƵdžŽĨƚŚĞƉƌŽďůĞŵ͕ĂŶĚǁŚLJƚŚĞĐƌĂŶĞƚŽƉƉůĞĚ ŽǀĞƌ͘dŚĞĐƌĂŶĞΖƐŵŽďŝůŝƚLJĂŶĚƐĂĨĞƚLJĚƵƌŝŶŐůŝŌŝŶŐŽƉĞƌĂƟŽŶƐ ŝƐĚĞƚĞƌŵŝŶĞĚďLJĨŽƵƌĨƵŶĚĂŵĞŶƚĂůůŝŌŝŶŐƉƌŝŶĐŝƉůĞƐ;ĂƐĂƉƉůŝĐĂďůĞƚŽĂŚŝŐŚůĂƫĐĞŵĞĚĐƌĂǁůĞƌĐƌĂŶĞͿ͗

Centre of Gravity In simple terms, the centre of gravity is the average lo32

3URMHFWRI¿FHEXLOGLQJVDEDNNLHDQGDVPDOOHUFUDQHLWVHOIEHFRPLQJD WDUJHWZHUHVHULRXVO\GDPDJHGLQWKHDFFLGHQW

cation of the weight of an object, in relationship to its height, and the lower the centre of gravity the better its stability, especially where motion is involved. The location of the center of gravity of a mobile crane depends primarily on the weight and location of its heaviest components (the base (carrier), main boom, load, and counterweight (the lattice boom)).

Stability dŚŝƐŝƐƚŚĞƌĞůĂƟŽŶƐŚŝƉďĞƚǁĞĞŶƚŚĞǁĞŝŐŚƚĂŶĚƐƉƌĞĂĚŽĨƚŚĞ ďĂƐĞ͕ǁŝƚŚŝƚƐĐŽƵŶƚĞƌǁĞŝŐŚƚƐ͕ƚŚĞůŝŌůŽĂĚǁĞŝŐŚƚ͕ƚŚĞĂŶŐůĞ ŽĨƚŚĞůŝŌ͕ŵĞĂŶŝŶŐƚŚĞĂŶŐůĞďĞƚǁĞĞŶƚŚĞǀĞƌƟĐĂůĐĂďůĞĂŶĚ ƚŚĞŵĂŝŶŵ͕ĂůƚĞƌŶĂƟǀĞůLJŝƚƐƌĂĚŝƵƐ͕ƚŚĞĚŝƐƚĂŶĐĞĨƌŽŵƚŚĞ ĐƌĂŶĞ͛ƐĐĞŶƚƌĞŽĨƌŽƚĂƟŽŶƚŽƚŚĞĐĞŶƚƌĞŽĨƚŚĞůŝŌůŽĂĚ͕ƚŚĞůŝŌ ŚĞŝŐŚƚĂŶĚƚŚĞĞdžƚĞŶƚƚŽǁŚŝĐŚƚŚĞůĂƫĐĞŵŝƐ͞ĂŶŐůĞĚ͕͟ ĂƐĂĐŽŵƉůŝŵĞŶƟŶŐĐŽƵŶƚĞƌǁĞŝŐŚƚĂŶĚĨŽƌĐŽŶƚƌŽů͕ŝŶƚŚĞŽƉƉŽƐŝƚĞĚŝƌĞĐƟŽŶƚŽƚŚĞůŽĂĚ͘dŚŝƐƌĞůĂƟŽŶƐŚŝƉŝƐƉŝǀŽƚĂů͘/ĨƚŚŝƐ ƌĞůĂƟŽŶƐŚŝƉŝƐŵŝƐĐĂůĐƵůĂƚĞĚ͕ƚŚĞĐƌĂŶĞ͛ƐƟƉƉŝŶŐƉŽŝŶƚǁŝůůďĞ ĞdžĐĞĞĚĞĚĂŶĚŝƚǁŝůůƚŽƉƉůĞŽǀĞƌ͘ĨĂĐƚŽƌŽŌĞŶŽǀĞƌůŽŽŬĞĚŽƌ ŵŝƐĐĂůĐƵůĂƚĞĚŝƐƚŚĞƌĞůĂƟŽŶƐŚŝƉďĞƚǁĞĞŶƚŚĞďĂƐĞ;ĐĂƌƌŝĞƌ͛ƐͿ ƐƉƌĞĂĚ͕ůĞŶŐƚŚĂŶĚǁŝĚƚŚ,ĂŶĚƚŚĞĐƌĂŶĞ͛ƐƌŽƚĂƟŽŶ͕ŵŽǀŝŶŐĂ ůŽĂĚĨƌŽŵŝƚƐůŝŌƉŽŝŶƚƚŽŝƚƐĚƌŽƉƉŽŝŶƚ͘dŚŝƐƉĂƌƟĐƵůĂƌƌĞůĂ-

Lifting Africa - Sept/Oct 2015

Lifting Africa SEPTOCT15.indd 32

07-Sep-15 12:53:05 PM


)URPWKHSRROVRIZDWHUDORWRIUDLQKDGIDOOHQVRIWHQLQJWKHVRLO

Ć&#x;ŽŜĆ?Ĺ&#x161;Ĺ?Ć&#x2030;Ä?ŽƾůÄ&#x161;Ä?Ä&#x201A;ĆľĆ?Ä&#x17E;Ć&#x161;Ĺ&#x161;Ä&#x17E;Ä?Ć&#x152;Ä&#x201A;ĹśÄ&#x17E;Î&#x2013;Ć?Ä?Ä&#x17E;ĹśĆ&#x161;Ć&#x152;Ä&#x17E;ŽĨĹ?Ć&#x152;Ä&#x201A;Ç&#x20AC;Ĺ?Ć&#x161;Ç&#x2021;Ć&#x161;Ĺ˝Ä?Ĺ&#x161;Ä&#x201A;ĹśĹ?Ä&#x17E; Ć?ĹŻĹ?Ĺ?Ĺ&#x161;Ć&#x161;ĹŻÇ&#x2021;Í&#x2022;Ć&#x161;Ĺ&#x161;Ä&#x17E;Ć&#x152;Ä&#x17E;Ä?Ç&#x2021;Ä?Ĺ&#x161;Ä&#x201A;ĹśĹ?Ĺ?ĹśĹ?Ĺ?Ć&#x161;Ć?Ć&#x;Ć&#x2030;Ć&#x2030;Ĺ?ĹśĹ?Ä&#x201A;Ç&#x2020;Ĺ?Ć?Í&#x2DC; Stability can also be affected by fluctuating leverage the crane exerts, as determined by its load, as it turns. The crane's rated capacity is therefore altered in the load chart to compensate for those changes in leverage. Provided the ground is capable of supporting the load, a crane can be made more stable by moving the tipping axis further away from its centre of gravity. The extra stability gained by moving the tipping axis can then be used to carry larger/heavier loads. This translates into a simple rule: Increased stability = more load. A crane's load rating is generally developed for operations under ideal conditions, i.e., a level firm surface. Uneven surfaces or soft ground therefore must be avoided. In areas where soft ground poses a support problem for stability, mats and or blocking should be used to distribute a crane's load and maintain a level, stable base.

stability failure (toppling over). If the crane is overloaded on a regular basis it wonâ&#x20AC;&#x2122;t be a matter of â&#x20AC;&#x153;ifâ&#x20AC;? but â&#x20AC;&#x153;whenâ&#x20AC;? a structural failure will occur, and when it does it will be catastrophic. If safe operating practices are followed and lift planning is done properly, using crane operators and personnel who are knowledgeable and have experience, problems are least likely to occur. 5HIHUHQFHV %HFKWHO 5LJJLQJ +DQGERRN QG (GLWLRQ %HFKWHO (TXLS PHQW2SHUDWLRQV,QF'UDIW(QYLURQPHQWDO,PSDFW$VVHVVPHQW 5HSRUWIRU3XEOLF5HYLHZ6DYDQQDK(QYLURQPHQWDO 3W\ /WG$XJXVW 

THE CXT HOIST THAT HAS BIG BIG FEATURES

These star performers are highly adaptable, super efficient, reliable, safe and quick, enabling improved productivity.

Ć&#x152;Ä&#x201A;ĹśÄ&#x17E;Ć?ĆľĆ?Ä&#x17E;Ć&#x161;Ĺ&#x161;Ä&#x17E;Ć&#x2030;Ć&#x152;Ĺ?ĹśÄ?Ĺ?Ć&#x2030;ĹŻÄ&#x17E;ŽĨĹŻÄ&#x17E;Ç&#x20AC;Ä&#x17E;Ć&#x152;Ä&#x201A;Ĺ?Ä&#x17E;Ć&#x161;ŽůĹ?Ĺ&#x152; ĹŻĹ˝Ä&#x201A;Ä&#x161;Ć?Í&#x2DC; Ç&#x2021; Ä&#x201A;Ä&#x161;ĹŠĆľĆ?Ć&#x;ĹśĹ? Ć&#x161;Ĺ&#x161;Ä&#x17E; Ć&#x152;Ä&#x17E;ĹŻÄ&#x201A;Ć&#x;ŽŜĆ?Ĺ&#x161;Ĺ?Ć&#x2030; Ä?Ä&#x17E;Ć&#x161;Ç Ä&#x17E;Ä&#x17E;ĹśĆ&#x161;Ĺ&#x161;Ä&#x17E;Ä?Ä&#x201A;Ć?Ä&#x17E;ÍžĆ&#x161;Ĺ&#x161;Ä&#x17E;Ä?Ä&#x201A;Ć&#x152;Ć&#x152;Ĺ?Ä&#x17E;Ć&#x152;ÍżÍ&#x2022;ĹľÄ&#x201A;Ĺ?ĹśÄ?ŽŽžÍ&#x2022; ĹŻĹ?Ĺ&#x152; ĹŻĹ˝Ä&#x201A;Ä&#x161;Í&#x2022; Ć&#x161;Ĺ&#x161;Ä&#x17E; Ĺ&#x161;Ä&#x17E;Ĺ?Ĺ?Ĺ&#x161;Ć&#x161; ŽĨ Ć&#x161;Ĺ&#x161;Ä&#x17E; ĹŻĹ?Ĺ&#x152; ĹŻĹ˝Ä&#x201A;Ä&#x161; Ä&#x201A;ĹśÄ&#x161; Ä?ŽƾŜĆ&#x161;Ä&#x17E;Ć&#x152;Ç Ä&#x17E;Ĺ?Ĺ?Ĺ&#x161;Ć&#x161; ÍžĆ&#x161;Ĺ&#x161;Ä&#x17E; ĹŻÄ&#x201A;ĆŤÄ?Ä&#x17E; Ä?ŽŽžͿ, the Ä?Ć&#x152;Ä&#x201A;ĹśÄ&#x17E;Î&#x2013;Ć?Ä?Ä&#x17E;ĹśĆ&#x161;Ć&#x152;Ä&#x17E;ŽĨĹ?Ć&#x152;Ä&#x201A;Ç&#x20AC;Ĺ?Ć&#x161;Ç&#x2021;Í&#x2022;Ä&#x201A;ĹŻĆ&#x161;Ä&#x17E;Ć&#x152;ĹśÄ&#x201A;Ć&#x;Ç&#x20AC;Ä&#x17E;ĹŻÇ&#x2021;Ć&#x152;Ä&#x17E;ĨÄ&#x17E;Ć&#x152;Ć&#x152;Ä&#x17E;Ä&#x161;Ć&#x161;Ĺ˝Ä&#x201A;Ć?Ĺ?Ć&#x161;Ć?ĹŻÄ&#x17E;Ç&#x20AC;Ä&#x17E;Ć&#x152;Ä&#x201A;Ĺ?Ä&#x17E;Ć&#x2030;Ĺ˝Ĺ?ĹśĆ&#x161;Ĺ˝Ć&#x152;ĨƾůÄ?Ć&#x152;ƾžÍ&#x2022; Ĺ?Ć?Ä?Ĺ&#x161;Ä&#x201A;ĹśĹ?Ä&#x17E;Ä&#x161;Í&#x2022;Ç Ĺ&#x161;Ĺ?Ä?Ĺ&#x161;Ĺ?ĹśÄ?Ć&#x152;Ä&#x17E;Ä&#x201A;Ć?Ä&#x17E;Ć?Ĺ˝Ć&#x152;Ä&#x161;Ä&#x17E;Ä?Ć&#x152;Ä&#x17E;Ä&#x201A;Ć?Ä&#x17E;Ć? Ĺ?Ć&#x161;Ć? ĹŻÄ&#x17E;Ç&#x20AC;Ä&#x17E;Ć&#x152;Ä&#x201A;Ĺ?Ä&#x17E;Í&#x2022; Ä&#x201A;Ć? Ĺ?Ć&#x161;Ć? ĹŻĹ˝Ä&#x201A;Ä&#x161; Ä&#x161;Ä&#x17E;ĹľÄ&#x201A;ĹśÄ&#x161;Ć?Í&#x2DC;  KÄ?Ç&#x20AC;Ĺ?ŽƾĆ?ĹŻÇ&#x2021;ĨÄ&#x201A;Ä?Ć&#x161;Ĺ˝Ć&#x152;Ć?Ć?ĆľÄ?Ĺ&#x161;Ä&#x201A;Ć?Ä?Ä&#x201A;Ä?ĹŻÄ&#x17E;Ć?Ć&#x161;Ć&#x152;Ä&#x17E;ĹśĹ?Ć&#x161;Ĺ&#x161;Í&#x2022;Ä?Ä&#x201A;Ä?ĹŻÄ&#x17E; Ä&#x161;Ć&#x152;ƾž Ä&#x161;Ĺ?Ä&#x201A;ĹľÄ&#x17E;Ć&#x161;Ä&#x17E;Ć&#x152; Ä&#x201A;ĹśÄ&#x161; Ä?Ä&#x201A;Ä?ĹŻÄ&#x17E; Ä&#x161;Ć&#x152;ƾž žŽĆ&#x161;Ĺ˝Ć&#x152; Ć?Ć&#x161;Ć&#x152;Ä&#x17E;ĹśĹ?Ć&#x161;Ĺ&#x161;Ć&#x2030;ĹŻÄ&#x201A;Ç&#x2021;Ä&#x201A;ĹśĹ?ĹľĆ&#x2030;Ĺ˝Ć&#x152;Ć&#x161;Ä&#x201A;ĹśĆ&#x161;Ć&#x2030;Ä&#x201A;Ć&#x152;Ć&#x161;Ĺ?ĹśÄ&#x161;Ä&#x17E;Ć&#x161;Ä&#x17E;Ć&#x152;ĹľĹ?ĹśĹ?ĹśĹ?ĹŻÄ&#x17E;Ç&#x20AC;Ä&#x17E;Ć&#x152;Ä&#x201A;Ĺ?Ä&#x17E;Í&#x2DC;

Structural Integrity

5 Jurie Street, Alrode, Johannesburg, SA 011.864 2800 * 076.403 3184 john.macdonald@konecranes.com

www.konecranes.co.za

HBPR/K92

Leverage

Branches in Johannesburg, Durban, Cape Town, Port Elisabeth, Witbank, Klerksdorp, Ngodwana, Richards Bay, Rustenburg & Maputo

If a load is added beyond a craneâ&#x20AC;&#x2122;s rated capacity, the crane may fail structurally before there is any sign of Lifting Africa - Sept/Oct 2015

Lifting Africa SEPTOCT15.indd 33

33

07-Sep-15 12:53:06 PM


GRADINGÚ

Chain Grading e are

moving

hƐŝŶŐ ƚŚĞ ĐŽƌƌĞĐƚůLJ ŐƌĂĚĞĚ ĐŚĂŝŶ ŝŶ ŽǀĞƌŚĞĂĚ ŚŽŝƐƟŶŐ ĂƉƉůŝĐĂƟŽŶƐŝƐĂĐƌŝƟĐĂůƐĂĨĞƚLJĐŽŶƐŝĚĞƌĂƟŽŶ͘ dŚĞĨŽůůŽǁŝŶŐĐŚĂŝŶŐƌĂĚĞƐĂƉƉůLJ͗

Gr 30 Proof Coil

$JHQHUDOSXUSRVHFKDLQRIVWDQGDUGFRPPHUFLDO TXDOLW\0DGHIURPORZFDUERQVWHHOWKLVFKDLQLV IUHTXHQWO\XVHGIRUIDEULFDWLQJWRZFKDLQVORJJLQJ FKDLQVDQGZKHQDSSURSULDWHWLHGRZQRUELQGLQJ FKDLQV+DOOPDUNHGHYHU\IHHWRUOHVVRQVL]HV RYHUZLWKPDQXIDFWXUHU VV\PERODQGJUDGH PDUNLQJRU1RWIRURYHUKHDGOLIWLQJ

BBB Anchor Chain

$ FRPSDFW VKRUW  OLQN FKDLQ RI VWDQGDUG FRP PHUFLDO TXDOLW\  0DGH IURP ORZ FDUERQ VWHHO WKLV FKDLQ LV XVHG SULPDULO\ IRU ERDW ZLQGODVVHV ZKHQKRWJDOYDQL]HG+DOOPDUNHGHYHU\OLQNZLWK %1RWIRURYHUKHDGOLIWLQJ

Gr 40 High Test

6WUHQJWK OHYHOV DUH WKH VDPH DV *U  EXW WKH GLPHQVLRQV RI WKH FKDLQ OLQNV DUH VPDOOHU XVLQJ ,62VWDQGDUGV3ULPDULO\XVHGIRUERDWZLQGODVV HVWKLVJUDGHKDVEHFRPHDVWDQGDUGIRUWKDWLQ GXVWU\7KH*UDGHGHVLJQDWLRQZDVH[FOXVLYH O\ XVHG E\$&&2 &KDLQ XQWLO  WR GHVLJQDWH WKHLU+LJK7HVWJUDGHFKDLQ7KH\QRZXVHLQ NHHSLQJZLWKWKHUHVWRIWKHLQGXVWU\7KHFKDLQLV KDOOPDUNHG*RQHYHU\OLQN1RWIRURYHUKHDG OLIWLQJ

Gr 43 High Test

7KLVLVDKLJKHUVWUHQJWKFKDLQXVHGIRU\HDUVLQ WKHWUXFNLQJLQGXVWU\IRUWLHGRZQVWKDWPHHW'27 VSHFL¿FDWLRQV0DGHIURPDKLJKHUFDUERQVWHHO LWVVWUHQJWKVXUSDVVHVSURRIFRLOZRUNLQJORDGOLP LWVVL]HIRUVL]HE\DIDFWRURIWR+DOOPDUNHG HYHU\WRIHHWZLWKPDQXIDFWXUHU VV\PERODQG JUDGHPDUNLQJRU1RWIRURYHUKHDG OLIWLQJ

Gr 70 Transport

$VLWVQDPHLPSOLHV7UDQVSRUW&KDLQLVXVHGSUL PDULO\WRWLHGRZQORDGVRQRYHUWKHURDGHTXLS PHQW7KH\HOORZFKURPDWH JROG SODWLQJPDNHV LWHDVLO\UHFRJQL]DEOHHYHQIURPDGLVWDQFH0DGH IURPKHDWWUHDWHGFDUERQVWHHOLWKDVDERXW PRUHVWUHQJWKWKDQKLJKWHVWFKDLQV+DOOPDUNHG HYHU\WRIHHWZLWKPDQXIDFWXUHU VV\PERODQG JUDGH PDUNLQJ   RU   1RW IRU RYHUKHDG OLIWLQJ

Gr 80 Alloy

7KH¿UVWFKDLQVSHFL¿FDOO\GHVLJQHGIRUVDIHW\DQG DSSURYHGE\26+$DQGRWKHUDJHQFLHVIRURYHU KHDGOLIWLQJ,WVDOOR\KHDWWUHDWHGVWHHOPDNHVLW LGHDOIRUPDNLQJOLIWLQJVOLQJVDQGKHDY\GXW\WRZ FKDLQV  +DOOPDUNHG QR PRUH WKDQ  IHHW DSDUW ZLWK PDQXIDFWXUHU V V\PERO DQG JUDGH PDUNLQJ RU6XLWDEOHIRURYHUKHDGOLIWLQJ

Gr 100 Alloy

7KLVQHZLQQRYDWLRQLQDOOR\FKDLQPHWDOOXUJ\SUR YLGHVDERXWKLJKHUZRUNLQJORDGOLPLWVRYHU *UFKDLQZLWKVRPHOLPLWDWLRQVUHSRUWHGLQORZ HU DPELHQW WHPSHUDWXUHV  +DOOPDUNHG QR PRUH WKDQIHHWDSDUWZLWKPDQXIDFWXUHU VV\PERODQG JUDGHPDUNLQJRU6XLWDEOHIRURYHUKHDG OLIWLQJ

We are upgrading

to bigger and better premises.

www.eiegroup.co.za

34

$W\SLFDOKRLVWDQG FKDLQFRPELQDWLRQ

Lifting Africa - Sept/Oct 2015

Lifting Africa SEPTOCT15.indd 34

07-Sep-15 12:53:07 PM


Component reliability and overall structural safety has been ensured at a large power station in Mpumalanga, following the successful completion of a bolt inspection (torque verification) project on plant equipment by rope access specialist Skyriders. Torque verification is a process where the tightness of a fastener or bolt assembly on any type of plant is inspected and verified according to a specified standard or value determined by appointed engineers, in order to ensure that structural integrity and safety are in no way compromised. Insufficiently torqued fasteners and bolt assemblies can come loose as a result of excessive vibration, causing the torque to strip threaded fasteners. As a result, all industrial sites with conveyors and other moving or vibrating plants must undertake torque verification regularly. â&#x20AC;&#x153;Failure can lead to catastrophic or latent failures and, in projects where height-related access and confined space are a challenge, the use of rope access is the most efficient means, as rope access technicians can swiftly traverse the most challenging obstacles,â&#x20AC;? says Skyriders Marketing Manager Mike Zinn. According to Zinn, traditional means of access were deemed too costly by the client and would have taken too long to set up. â&#x20AC;&#x153;This was a classic example of when the cost of access is disproportionate to the scope of work, and Skyriders offers the greatest value through its rope access solutions.â&#x20AC;? A five-man Skyriders rope access team successfully completed the project within a week at the end of June 2015. Zinn added that the most challenging part of the job was access-related, as the team had to work on the underside of a large steel structure. â&#x20AC;&#x153;Although the scope of work was simple â&#x20AC;&#x201C; to inspect and tighten bolts â&#x20AC;&#x201C; access by any other means would have cost considerably more, and would have been far more time-consuming. Due to the speed and efficiency of rope access, Skyriders expects to be contracted to a number of torque verification projects at power plants across South Africa,â&#x20AC;? he concluded. 0LNH=LQQ6N\ULGHUV7HO   (PDLOPLNH#URSHDFFHVVFR]DZZZURSHDFFHVVFR]D

HR

eavy-Duty ound Sling

Safety which immediately catches the eye SpanSet GmbH & Co. KG, Ă&#x153;bach-Palenberg, is renowned for its innovative products, which meet the highest quality and safety requirements. At the same time the developers are focused on the cost effectiveness and handling of the products.

A current example for the companyâ&#x20AC;&#x2122;s successful philosophy is the latest variation of the heavy-duty round sling Magnum-X. The Magnum-X smart essentially consists of two parts: One is the very robust outer sleeve, made of hard-wearing high-performance fibres, which if damaged can easily be exchanged. Beneath this is the actual lifting round sling with a hose sleeve which comes in a highviz yellow colour. Even if the outer sleeve suffers only minimal damage or wear, the inner hose sleeve of the round sling is easily visible due to its striking colour â&#x20AC;&#x201C; an unmistakable sign that the outer sleeve needs to be exchanged. The Magnum-X smart is available in high carrying capacities of 20, 30 and 40 tonnes and offers the same advantages as all Magnum-X round slings. That is, on the one hand, an extremely compact design due to the utilised high-performance polyester core and the innovative hose construction, which compared to conventional round slings provides a clear cross section and width reduction, at the same time ensuring comparable carrying capacities. Furthermore, the low weight clearly facilitates the handling of the round sling. The Magnum-X smart is manufactured according to DIN EN 1492-2 and fulfils the required safety levels when hoisting heavy loads. The hose sleeve carries a raised label which ensures that the information regarding carrying capacity can clearly be read even when heavily soiled. The working temperature range of the Magnum-X smart lies between â&#x20AC;&#x201C;40°C and +100°C. The extension at WLL (Working Load Limit: carrying capacity in kg in the "single direct" slinging configuration) is less than 1%. ZZZPDJQXP[GH

Lifting Africa - Sept/Oct 2015

Lifting Africa SEPTOCT15.indd 35

SAFETYĂ&#x161;

TP

he Nuts and Bolts of ower Plant Safety

35

07-Sep-15 12:53:08 PM


t,>ŝŌŝŶŐĂŶĚ,ĂŶĚůŝŶŐĐĐ ĂƐLJĂŶĚĚĂŵĂŐĞĨƌĞĞůŝŌŝŶŐǁŝƚŚ DĂŐŶĞƟĐĂŶĚsĂĐƵƵŵƚĞĐŚŶŽůŽŐLJ

ƉƉůŝĐĂƟŽŶŽĨ/ŶĚƵƐƚƌŝĞƐ͗ нƵƚŽŵŽƟǀĞ  н&ƵƌŶŝƚƵƌĞ  нtŽŽĚ 

нĂŐƐ  н'ůĂƐƐ н&ŽŽĚ

нƵŝůĚŝŶŐ  н'ŽůĚͬ^ŝůǀĞƌ  н&ŽƌŬ>ŝŌĞƌ 

нŚĞŵŝĐĂů  н>ŝŐŚƚDĞƚĂů  нWĂĐŬĂŐŝŶŐ 

нŽŵƉƵƚĞƌ н,ĞĂǀLJDĞƚĂů н'ƌĂŶŝƚĞ

>ŝŌŝŶŐĨƌŽŵϭϮϱŬŐƵƉƚŽϯϱƚŽŶƐ ĂŶĚͬŽƌĂƐƉĞƌĐƵƐƚŽŵĞƌƐƐƉĞĐŝĮĐĂƟŽŶƐ

^ĞŶĚŶƋƵŝƌŝĞƐƚŽŝŶĨŽΛǁŚůŝŌŝŶŐ͘ĐŽ͘njĂ KƌƉŚŽŶĞ͗dĞů͗нϮϳϭϭϯϭϱϬϮϮϳŽƌ&Ădž͗нϮϳϭϭϯϭϱϮϵϯϳ 36

Lifting Africa - Sept/Oct 2015

Lifting Africa SEPTOCT15.indd 36

07-Sep-15 12:53:09 PM


CRANESÚ

TS

he CXT Hoist tar Performer

Compact and strong, the intelligent Konecranes CXT hoist concept combines space efficiency with high reliability and promises a long service life. The CXT crane features an especially compact and robust design — equipped with extremely low headroom and small-end approaches — that is suitable for almost every application and Africa’s often challenging environments.

F

urthermore, thanks to its advanced technology and innovative features, the CXT crane can be tailored to suit the different needs of customers.

Standard CXT cranes can be implemented with single-girder or double-girder construction, a fixed

single-girder system (monorail), or with under-running construction. CXT trolley models are available for single girder cranes with low headroom (up to 12.5 tons) or normal headroom (up to 40 tons), as well as for double girder trolleys (up to 80 tons). With different trolley configura-

tions, the most common one is with two or even three trolleys on the same crane, CXT wire rope hoist cranes maximize the lifting height and easily fit into different building types. Konecranes CXT cranes are indispensable in an assembly workshop or industrial plant. With the latest technology for improved load accuracy, versatility, and ease of use, the CXT crane is the industry leader in medium-heavy indoor cranes.

Short work cycle and long life cycle with Smart Features Production facilities have many critical operations that need to be under constant control to be successful: materials coming in, parts being moved around, and finished products going out. One of those operations is, for example, material handling with cranes. Cranes and employees make up a combination that must operate as smoothly, as safely, and as fast as possible. Based on extensive experience, and backed by a thorough understanding of a customer’s processes, Konecranes developed Smart Fea-

Lifting Africa - Sept/Oct 2015

Lifting Africa SEPTOCT15.indd 37

37

07-Sep-15 12:53:09 PM


CRANESĂ&#x161;

tures: software-based intelligence that saves time and increases the productivity and safety of the crane in the specified application.

Smart Features Depending on the customer needs, CXT cranes can be equipped with standard features and with Smart Features. With the Smart Features developed by Konecranes, the work cycle is substantially shorter. An experienced operator can operate any crane fast, and almost anybody can operate an intelligent crane fast and precisely. The intelligent assisting features help to make almost anyone a good crane operator. It speeds up load handling and offers unprecedented safety characteristics. The advanced functionalities, like sway control, positioning, and protected area functions, enable fast and safe load transfer, even when the operator is not a seasoned professional.

veloped by Konecranes are the frequency converters ASR (Adaptive Speed Range/Adaptive hoisting speed) and ESR (Extended Speed Range/Extended hoisting speed); the hoisting speed is adjusted automatically according to the current load of the wire rope hoist â&#x20AC;&#x201D; the hoisting speed is faster with lighter loads than with heavier loads. In practice, this means faster operation with light loads and safe and gentle operation with heavy loads. Since lighter industrial cranes still mostly use conventional control, with only two-speed hoisting in the ratio of 4:1 or 6:1, the engineers at Konecranes have gone a step further when developing these frequency converters.

A wide range of Smart Features are available: Sway Control, Positioning, Protected Areas, Shock Load Prevention, Inching, Microspeed, Working Limits, Synchro, etc.

The convenient ASR technology provides stepless control of the hoisting speed in the ratio of 10:1. Whereas, the ESR technology offers extremely fast hoisting speeds using more powerful engines and providing an extended speed range of up to 37:1. ASR and ESR allow the hoist to run at a higher than nominal rated hoisting speed with light loads. This significantly reduces load cycle and waiting times.

Right speed in the right place

Ergonomic and onehand usability

Additional innovative features de-

After several studies, and backed

by a thorough understanding of the specific customer needs, Konecranes developed a new remote control for the CXT cranes, which is more ergonomic and offers onehand usability. The main requirement was the ergonomics: creating a radio transmitter that is usable with one hand led to the use of a joystick element, which controls the craneâ&#x20AC;&#x2122;s travelling movements. The new MiniJoystick for CXT cranes offers ergonomic benefits. It is also intuitive to operate, allowing users to control the load with just a single grip, to safely move and precisely place heavy loads.

CXT crane features â&#x20AC;˘

Five frame sizes up to 80t

â&#x20AC;˘

Low headroom trolleys up to 12.5t

â&#x20AC;˘

Normal headroom trolleys up to 40t

â&#x20AC;˘

Fixed hoists up to 80t

â&#x20AC;˘

Double-girder trolleys up to 80t

â&#x20AC;˘

Standardized span solutions up to 30 meters. Main girders with a profile, or box-beam structure.

7HO      *UDKDP  RU .HYLQ  ZZZNRQHFUDQHVFR]D

MPHATLALATSANE LEARNING RESOURCES CC. (Prosperity you have always being dreaming of) Reg: 2008/242073/23 9$74370252035 SETA Reg. No. TETA09-194 CPHA Membership no: MPH001 Department of Lab our NSF no: 4497 ,QDVVRFLDWLRQZLWKWKHUHJLVWHUHG/0(

We offer the following training courses on your site so as to prevent interruption to production!!! x

Overhead crane operator training

x

Forklift operator training

x

Basic rigging& related courses

x

Mobile crane operator training

x

Truck mounted crane operator training

x

RIGGING QUALICATION NQF Level 2 & 3

We strive to change your operators behaviour Mobile: 083 522 9627 071 952 0919 Office: 016 931 9437 E-mail: percy@mphatlalatsane.co.za

38

Lifting Africa - Sept/Oct 2015

Lifting Africa SEPTOCT15.indd 38

07-Sep-15 12:53:10 PM


LIFTINGĂ&#x161;

2Q$XJXVWLQWKH ZHVWHUQ 'XWFK WRZQ RI $OSKHQ DDQ GHQ 5LMQ D KHDY\OLIWJRQHZURQJ

Planning a Heavy Lift %\7RQ\6WRQH

In a heavy lift situation, accidents happen because of human error. Either the equipment failed, because of poor maintenance, or, as is often the case, the lift was not thought through and carefully planned â&#x20AC;&#x201C; with every contingency in mind. Why plan? Whether you are superstitious or not, Murphy usually has a finger in the pie and anything that can go wrong will go wrong. In heavy lifting this is not a fatalistic approach but a realistic one. To prove the point, on the 4 August 2015, in the western Dutch town of Alphen aan den Rijn, about 20 people were injured after two cranes working on a bridge upgrade toppled onto houses. Watching the accident on You Tube, it becomes quite apparent why the accident happened.

They placed the two cranes more to one side of the barge instead of in the middle. So, when the cranes lifted the prefabricated bridge component, turning it and moving it between the two cranes, the barge dipped to one side and with the shifting load and the inevitable happened. The proverbial curve ball â&#x20AC;&#x201C; they didnâ&#x20AC;&#x2122;t think enough! Given the qualified engineers involved, hindsight leaves you gobsmacked! It should have been foresight!

Project planning Every heavy lift is a project on its own. As Harold Kerzner, father of project management, said, â&#x20AC;&#x153;Project management is not just a career path. It is a strategic competency.â&#x20AC;? Project planning, one of the most important project management techniques, is preparing a sequence of action steps to achieve a specific goal. And, if you plan effectively, you are more likely to complete the project on or within time and budget, and with minimal or preferably zero error. Like delivering a baby, heavy lifting has to be spot on 100% of the time.

Planning a crane lift Many written briefs on heavy lift planning are incomplete â&#x20AC;&#x201C; far too simple. Reading about and watching videos of crane accidents, Lifting Africa adds a couple of steps to and refines the process. In essence, a load is at Point A. It needs to be moved to Point B, and placed. A number of handling systems may be involved in its transition from take-off to placement. These may include cranes, jacks, rollers, hydraulic gantries, a slide system, heavy-haul transporters, strand jacks or other equipment. At the end of the day, the need is to overcome gravityâ&#x20AC;&#x2122;s pull and create movement in a controlled, efficient and safe manner.  Verify the lift-weight and dimensions of the load.  Determine the loadâ&#x20AC;&#x2122;s centre of gravity, as established in point 1.  Check the location and quantity of approved lifting lugs/ points relative to point 2.

Lifting Africa - Sept/Oct 2015

Lifting Africa SEPTOCT15.indd 39

39

07-Sep-15 12:53:11 PM


LIFTINGĂ&#x161;

with quality and safety standards and regulations â&#x20AC;&#x201C; especially for the specifics of the lift being planned.  Relative to point 5, check the stability of the base, especially with the crane and loadâ&#x20AC;&#x2122;s movement and shifting weight. Assess the risks, thinking laterally, taking into account any and all possibilities, especially extraneous factors such as weather e.g. wind, rain etc. Think problems and preventative solutions. Write your project plan and present it to your client, and any involved authority, going over every detail. Your project plan should include the overall process, $FRPSOH[OLIWXVLQJWKUHHFUDQHV3ODQQLQJDQGH[HFX crane(s) siting and lifting tion has to be precise study, step-by-step procedures, engineering data,  Measure the lift-height requirecosting, public and site impact, ments, checking for height repreparation requirements, continstrictions, any rotational movegencies and safety. ment hindrances. Overlooking any one of these criti Select the appropriate rigging cal elements will result in setbacks, gear to suit the lift-weight, liftand possible catastrophe. Discuss ing points, centre of gravity, the project plan, in detail, with lift-height, angle of lift and royour crew. This is essential. tational movement needs. During the lift you need eyes every Check the quality and condiwhere. Communication is critical. tion of the equipment to be Everyone needs to have a proactive used, especially its compliance mind-set.

40

Competent Person(s) No lift should be taken on without the appointment of a competent person(s), someone who has been given the responsibility for planning and executing the lift and who has the appropriate practical and theoretical training, knowledge and experience in heavy lifting. If such a person has not been appointed, serious legal and financial consequences could follow in the event of an accident.

Use a checklist It may only be one element, even a small but key element in the execution of a lift, but one that makes the difference between success and failure. Once all the preparation work has been completed for the lift, it is recommended, and wise, to use a final checklist to ensure that all and everything is in place, and in proper working condition. As a last comment, leave nothing to chance and remember, everyone on the team should think proactively, and safety. 5HIHUHQFHV ZZZ\RXWXEHFRP  3URMHFW 0DQDJHPHQW 'U +DUROG .HU]QHU (PHULWXV3URIHVVRURI6\VWHPV0DQDJHPHQW DW%DOGZLQ:DOODFH8QLYHUVLW\ *XLGHOLQHVIRU&UHDWLQJ/LIWLQJ3ODQIRU/LIW LQJ 2SHUDWLRQV ,Q :RUNSODFHV :RUN>SODFH 6DIHW\DQG+HDOWK&RXQFLO %\7RQ\6WRQH

Lifting Africa - Sept/Oct 2015

Lifting Africa SEPTOCT15.indd 40

07-Sep-15 12:53:12 PM


%\5RQHO.RW]H

It is official! Pro Crane is building the biggest single hook overhead crane in Africa. This” Beast” will be able to lift a maximum load of no less than 500 tons.

I

t is not just one crane either, the order was received for no less than three of these cranes!

According to Ken Watridge, Managing Director of Pro Crane;” We expect the first of the three cranes to be completed by the 24th of August 2015. We have already started building and planning the second and third crane. This project is by far one of the high-lights of our 19 year old company. Due to Pro Cranes rapid growth a decision was made to move to larger premises in 2013 and to make huge investments in it’s own lifting capability’s in order to handle large projects such as this.

The hoist alone weighs in at a whopping 34 tons! All the key engineered components were imported from Europe, and were then assembled at their new premises onto the locally produced and fabricated steel work. Even though this is such a big project Pro Crane enforced all their normal Quality & safety standards into the design procurement and ultimate manufacture of the cranes. Ken Explains, “Even though this is such a big crane, the same Quality & Safety principles were incorporated as would be with any other project we work on. Safety & Quality is as a “way of life at our business”. Delivering this ‘beast’ to their Secunda-based client took careful planning and will require seven trucks two of which were 30 meters long trucks to transport just one crane to the plant. The crane will be disassembled in Johan-

nesburg and transported with the special duty trucks. It should be no less than a two day journey. Once the crane arrives at the plant, Pro Crane will assemble all the components. This process will take approximately a week. “Our client is a loyal client”, who has already bought no less than 22 cranes from us in the past. One such project was when we designed and assemble three 160 ton cranes for our client four years ago. This assisted us to secure the initial order for all three cranes. The three cranes will on completion have the capacity to lift a staggering weight of 1 500 tons utilising all three cranes at once. This is the main reason why their client decided on these three 500 ton cranes. The cranes will actually be used by Pro Crane’s client to lift a 1 350 ton heavy fabricated structure in one lift with all three cranes synchronised to one another for all motions to ensure that the load is lifted and positioned with an extremely high level of accuracy.

Lifting Africa - Sept/Oct 2015

Lifting Africa SEPTOCT15.indd 41

OVERHEAD CRANESÚ

T

he 500 Tonner “Beast”

41

07-Sep-15 12:53:12 PM


42

Lifting Africa - Sept/Oct 2015

Lifting Africa SEPTOCT15.indd 42

07-Sep-15 12:53:15 PM


Pro Crane is partnered with SA Cranes and Hoist in this project, as they are strategically placed to assist Pro Crane’s client with this project on a day to day basis, once all the cranes are on site, assembled and operational.

Ken shared with Lifting Africa that,” 2014 was a fantastic year for us with at least five major projects. We were very fortunate that the major strikes in South Africa didn’t really affect our company. We are very fortunate that we have a good order book going forward. This is exciting times for our company”. Ken Watridge Tel: (011) 394 5550 Email: ken@procrane.co.za www.procrane.co.za

OVERHEAD CRANES

Research shows that this is the biggest such project in Africa involving single hook cranes.

Pro Crane is no stranger when it comes to big and challenging projects. This company regularly undertakes special projects involving customised engineered cranes, which must be designed by a team of highly skilled Engineering & Management staff, with extensive experience and knowledge in all types of lifting equipment. Pro Crane Services (Pty) Ltd is the "Sole" Distributor and Licensee in Sub Saharan Africa for the German Crane manufacturer "SWF Krantechnik". Originally established in 1926, SWF Krantechnik is one of the world's largest crane and hoist providers. All SWF Krantechnik products are manufactured to international ISO 9001 requirements. “Pro Crane has been the Number One SWF distributor worldwide for the past three years”, Ken proudly said.

Contact Surita Marx on Tel: (011) 047-2400, Cell: 083 281 5761 Email: info@liftingafrica.co.za to book advertising space

Lifting Africa - Sept/Oct 2015 Lifting Africa SEPTOCT15.indd 43

43 08-Sep-15 11:36:42 AM


&203(7(173(5621 - RIGGER Rigging has a history that stretches back 5000 years where competent rigging skills were a part of the construction of the â&#x20AC;&#x2DC;Pyramids of Geyserâ&#x20AC;&#x2122; and still plays an integral part of our modern Lifting Equipment industry regarding lifting and moving of loads. The Lifting Equipment Industry today uses products that range from; the simplest lifting slings to highly sophisticated automated overhead travelling cranes that play an essential role in a diverse array of construction, production, mainWHQDQFHDQGGLVWULEXWLRQSURFHVVHVLQPDWHULDOKDQGOLQJLQLQGXVWU\UHĂ HFWLQJ the risks inherent in lifting operations - where employers have considerable UHVSRQVLELOLWLHVUHJDUGLQJFRPSHWHQFH$5LJJHULVDTXDOLĂ&#x20AC;HGWUDGHVPHQDQG WKDW5LJJLQJLVDOLVWHGTXDOLĂ&#x20AC;FDWLRQOLVWHGZLWK6RXWK$IULFDQ4XDOLĂ&#x20AC;FDWLRQ$XWKRULW\²6$4$LQWKHĂ&#x20AC;HOGRIPDWHULDOVKDQGOLQJWRWDNHFDUHWKHULVNVLQOLIWLQJ and moving loads. 7KHHPSOR\HU¡VUHVSRQVLELOLWLHVLVVSHOWRXWLQWKH2+6$FW2FFXSDWLRQDO+HDOWK 6DIHW\$FWVSHFLĂ&#x20AC;FDOO\LQWKHVHFWLRQ DQGRIWKH$FWDVZHOODVWKH 6NLOOV'HYHORSPHQW$PHQGPHQW$FW7KLVODZVSHOOVRXWWKDWDVHPSOR\HUVZH must do everything reasonably practical in the work place regarding health and safety. Reasonably practicable means practicable having regard to the severity and scope of the hazard or risk concerned; the state of knowledge reasonably avail-

$UQL6RPPHUV

able concerning that hazards or risks and of any means of removing or mitigating that hazards or risks; the availability and suitability of means to remove or mitigate that hazards or risks; and the cost of removing or mitigating that KD]DUGVRUULVNVLQUHODWLRQWRWKHEHQHĂ&#x20AC;WVGHULYLQJWKHUHIURP The law says we must not expose anyone to any danger of any kind while at ZRUN'DQJHUPHDQVDQ\WKLQJZKLFKPD\FDXVHLQMXU\RUGDPDJHWRSHUVRQV or property.

Section 8 of the OHS Act General duties of employers to their employees: â&#x20AC;&#x153;Every employer shall provide and maintain, as far as is reasonably practicable, a working environment that is safe and without risk to the health of their employees. He shall provide the necessary means to apply such precautionary measures by providing training and supervision as may be necessary to ensure, as far as is reasonably practicable, the health and safety at work.Take all necessary measures to ensure that the requirements of this Act are complied with by every person in his employment is under the general supervision of a person trained to understand the hazards associated with itâ&#x20AC;?.

37. Acts or omissions â&#x20AC;&#x153;Whenever an employee does or omits to do any act which it would be an offence, the employee or a user then unless it is proved that it was not under any condition or in any circumstance within the scope of the authority of the employee to do or omit to do an act, whether lawful or unlawful, and all reasonable steps were taken by the employer or any such user to prevent any act or omission of the kind in question, the employer or any such user himself shall be presumed to have done or omitted to do that act, and shall be liable to be convicted and sentenced in respect thereof; and the fact that he issued instructions forbidding any act or omission of the kind in question shall not, LQLWVHOIEHDFFHSWHGDVVXIĂ&#x20AC;FLHQWSURRIWKDWKHWRRNDOOUHDVRQDEOHVWHSVWR prevent the act or omissionâ&#x20AC;?. If we understand this, then the only way to prevent been found liable and avoid EHHQFRQYLFWHGDQGVHQWHQFHGDVWKHÂś&(2LVWRPDNHVXUHRQHVHPSOR\HHV DUHVNLOOHGLQHYHU\ZD\SRVVLEOHWRDYRLGWKHPSODFLQJ\RXEHIRUHWKHMXGJHIRU MXGJPHQWWREHFRQYLFWHGDQGVHQWHQFHG:HQHHGWRXQGHUVWDQGZKDWWKHODZ LVVD\LQJWRXVDVZHPD\MXVWEHGHDOLQJZLWKDWLPHERPEDERXWWRH[SORGHDV lifting and moving of loads is a dangerous business that requires the right skills to prevent a fatal incident. Who is supervising the lifting operations on your site and what level of competence do they have? 44

Lifting Africa - Sept/Oct 2015

Lifting Africa SEPTOCT15.indd 44

07-Sep-15 12:53:19 PM


What is a Competent Person? ,Q WKH ODZ D FRPSHWHQW SHUVRQ LV GHĂ&#x20AC;QHG DVÂśFRPSHWHQW SHUVRQ¡ means a person who has the knowledge, training, experience and TXDOLĂ&#x20AC;FDWLRQVVSHFLĂ&#x20AC;FWRWKHZRUNSHUIRUPHG3URYLGHGWKDWZKHUH DSSURSULDWHTXDOLĂ&#x20AC;FDWLRQVDQGWUDLQLQJDUHUHJLVWHUHGLQWHUPVRI WKHSURYLVLRQVRIWKH1DWLRQDO4XDOLĂ&#x20AC;FDWLRQ)UDPHZRUN$FWWKRVH TXDOLĂ&#x20AC;FDWLRQVDQGWKDWWUDLQLQJVKDOOEHGHHPHGWREHWKHUHTXLUHG TXDOLĂ&#x20AC;FDWLRQVDQGWUDLQLQJ ´7KH1DWLRQDO4XDOLĂ&#x20AC;FDWLRQV)UDPHZRUNprovides a guideline, setting out the boundaries of a VWDQGDUGLVHGTXDOLĂ&#x20AC;FDWLRQV\VWHP. In order to recognise skills and categorise these accordingly. OpHUDWLQJZLWKLQWKLVIUDPHZRUNLVWKH6NLOOV'HYHORSPHQW$PHQGPHQW $FW VWDWHV WKDW WKH 'LUHFWRU  *HQHUDO PXVW PDLQWDLQ D UHJLVWHU RISHUVRQVZKRKDYHREWDLQHGDQDUWLVDQTXDOLĂ&#x20AC;FDWLRQ1RSHUVRQ whether employed or self - employed, may hold themselves out WREHTXDOLĂ&#x20AC;HGDVDQDUWLVDQLQDOLVWHGWUDGHXQOHVVWKDWSHUVRQ LVUHJLVWHUHGDVDQDUWLVDQRQWKH1DWLRQDO5HJLVWHURI$UWLVDQV )XUWKHUPRUHQRSHUVRQPD\REWDLQDQDUWLVDQTXDOLĂ&#x20AC;FDWLRQXQOHVV they have successfully undergone a trade test. Any person may apply to undergo a trade test if that person has completed a learnHUVKLSRUWKDWSHUVRQKDVVDWLVĂ&#x20AC;HGWKHUHOHYDQWUHTXLUHPHQWVRI DQDSSUHQWLFHVKLSRUDQDFFUHGLWHGWUDGHWHVWFHQWUHKDVFHUWLĂ&#x20AC;HG WKDW WKH SHUVRQ KDV DFTXLUHG VXIĂ&#x20AC;FLHQW SULRU OHDUQLQJ DQG WKDW person has completed any other learning programme resulting in DQRFFXSDWLRQDORUYRFDWLRQDOTXDOLĂ&#x20AC;FDWLRQLQFOXVLYHRISUHVFULEHG work experience that entitles such person to undergo the relevant trade testâ&#x20AC;?.

Addressing Competence )URPWKHDERYHOHJLVODWLRQWKDWKDVEHHQVSHOWRXWLVLWQRWFOHDU that all persons that is helping with any rigging operation in the ZRUNSODFHPXVWDWOHDVWKDYHD%DVLF5LJJLQJ&HUWLĂ&#x20AC;FDWHDQGFRPpetent person that is the responsible person to supervise a lift that has the risk of causing a fatal incident or damage to property must VXUHO\ZLWKRXWDGRXEWEHDWUDGHWHVWHGÂś5HG6HDO5LJJHU¡"

The Rigging Academy The Rigging Academy is an accredited trade test centre registered WRWUDGHWHVWWKH5LJJLQJ4XDOLĂ&#x20AC;FDWLRQ7KH5LJJLQJ$FDGHP\LVIXUWKHUPRUHRIIHULQJ5LJJHU/HYHODQGDVFRUUHVSRQGHQFHGLVWDQWOHDUQLQJ PRGXODUFRXUVHV2QFH14)OHYHOKDVEHHQ successfully completed, and the learner has one year work experience as a Rigger Assistant, thereafter the Rigging Academy can UHJLVWHUWKHOHDUQHUZLWKWKH'HSDUWPHQWRI +LJKHU(GXFDWLRQDQG7UDLQLQJDQGWKH4XDOLW\&RXQFLO7UDGHVDQG2FFXSDWLRQ3UHSDUH this individual for Trade Test. If successful at Trade a Test this individual will enter a high earning career that opens doors to those

T: (011) 824 5172 / 072 331 4162

ZKR ZRXOG OLNH WR DFKLHYH D UHFRJQLVHG TXDOLĂ&#x20AC;FDWLRQ LQ D KLJKO\ SDLG VNLOOV shortage trade, as a Rigger. 7KH5LJJLQJ$FDGHP\LVDOVRRIIHUVVKRUWFRXUVHVWDNHQIURPWKH5LJJHUTXDOLĂ&#x20AC;FDWLRQOLNH)LUVW$LGDQG%DVLFĂ&#x20AC;UH2YHU+HDG&UDQH)RUN/LIWDQG0RELOH&UDQH 2SHUDWRU7UDLQLQJ:RUNDW+HLJKW²)DOO$UUHVWDQG5HVFXH%DVLF5LJJLQJ$GYDQFHG5LJJLQJ6FDIIROG(UHFWRUV6FDIIROG,QVSHFWRUV2+6$FW7UDLQLQJDQG 6DIHW\5HSUHVHQWDWLYHWUDLQLQJ/7, /LIWLQJ7DFNOH,QVSHFWLRQ7UDLQLQJ /0, /LIWLQJ0DFKLQHU\,QVSHFWRUV &3' &RQWLQXLQJ3URIHVVLRQDO'HYHORSPHQW LQ6DIH 6OLQJLQJ/LIWLQJ7DFNOH,QVSHFWLRQ/LIW3ODQDQGWKH/DZ/RDG&DOFXODWLRQVDQG :RUNDW+HLJKW²%DVLF)DOO$UUHVWDQG$GYDQFHG5RSH5HFXH

F: (011) 824 6172 E: arni.rasa@mme.co.za Lifting Africa - Sept/Oct 2015

Lifting Africa SEPTOCT15.indd 45

45

07-Sep-15 12:53:22 PM


CRANES, CHAINS & HOISTSÚ

Optimum ƥ…‹‡…› And Enhanced Safety Becker Mining South Africa’s range of Kito lifting equipment includes: Manual and Electric Chain hoists and Lever Blocks. Kito Corporation has SABS accreditation for the manual units in its range. Explosion-proof type Kito Electric Chain Hoists are designed for optimum efficiency and enhanced safety in materials handling applications in explosive atmospheres, where there are various ignitable gases and vapours present. “These explosion-proof hoists are recommended to be used as authorised with the type approval by JIS C0903 for ‘electrical apparatus for explosive atmospheres in general industry’ and C0905-d2G4 which conform to supplementary requirements for the construction of electrical apparatus for explosive atmospheres in general industry’,” says Rick Jacobs, Becker Mining South Africa. “Electric components of these hoists have sufficient strength to withstand the internal pressure indicated in JIS C0903. Other detailed specifications like gap, depth of gap and locking construction also meet required standards.” A chart in the Kito brochure makes it easy to determine the ignitability and explosion grade in each application. This is identified by establishing the dimension of the gap with the depth of 25 mm through which the internal flame is able to escape, the type of gases and vapours present and the temperature range in which the equipment has to operate. Other features of the Kito ER series include a compact, single die-cast aluminium body, which is structurally strong and an asbestos-free pull-rotor motor brake. This provides accurate and reliable stopping, even in the 46

event of a power loss. A unique friction clutch immersed in an oil bath protects the hoist from over-winding and over-loading and for quiet operation and extended service life, the precision durable alloy steel helical gears are also submersed in oil. A fan cooled heavy duty aluminium framed motor, with E Class insulation, enables frequent operation and high strength abrasion resistant load chain is electroplated with zinc for corrosion resistance. A durable pendant type push button cord floor operation system ensures easy control, and a rubber insulated flexible cables enhances safety. A two push button system is used for the hook suspension type and the manual operated type trolley and a four push button system is designed for the motorised trolley type. The forged carbon steel hook has been designed to open gradually and will not fracture under excessive load. Top and bottom hooks are equipped with a hook latch and the bottom hook swivels 360 degrees to prevent kinking and twisting of the load chain. Other options include a mechanical brake that combined with a friction clutch if dual braking is can be done. An upper limit switch prevents over winding without increasing headroom and an emergency stop

Lifting Africa - Sept/Oct 2015

Lifting Africa SEPTOCT15.indd 46

07-Sep-15 12:53:23 PM


Kito utilises a double safety mechanism consisting of a friction clutch and an upper-lower limit switch to ensure optimum safety, and to prevent hoist or load chain damage. The friction clutch is an emergency overload protection device that idles the motor when subjected to loads that exceed the rated capacity. Another important safety feature of this series is the electromagnetic brake that ensures strong braking power, while holding the load securely. This current-driven electromagnetic brake, which is connected in series to a motor circuit, does not release unless the motor is energised. This concurrent drive has increased safety of the circuit compared with separate circuits for the motor and the brake. Reduced rated current draw compared to previous models ensure energy savings and the utilisation of the inverter, 4-pole motor and an electromagnetic brake reduces noise levels during operation and braking. As an environmental measure, certain hazardous substances are not used during the manufacture of these hoists. facility enables the operator to shut down power immediately in the event of an emergency. A quick view hour counter/meter for checking start frequency and running time facilitates easy maintenance scheduling. Thermal protection is also available to prevent motors from over-heating. The company’s environmentally-friendly Kito ER2 series - with lifting capacities between 125 kg and 20 T, is designed for use in non-explosive Environments. These electric chain hoists boast reliable operation, enhanced safety, easy maintenance and extended service life in any application including high frequency and long lift operations. These energy efficient Kito Electric Chain Hoists have been designed with an inverter as standard in a dual speed hoist and trolley for improved efficiency and easy operation. To ensure these hoists are in pristine condition and operate effectively, it is critical they are tested regularly at Becker’s workshops, or at any certified repair centre. The dual speed inverter of the ER2 series reduces load swing and ensures smoother movement than the conventional pole change motor. The high to low speed ratio can be set to a large value which means smooth starts, improved low speed stops and improved positioning accuracy.

An important feature of this lightweight series is the compact aluminium die-cast body that is structurally strong. The IP 55 rated enclosure offers protection against dust and water, which is critical in many applications. For reliable and safe operation a standard thermal protector prevents the motor from burning out due to excessive usage. An emergency stop button is standard to allow the motor power to be disconnected in an emergency, without cutting of the main power supply. The design of Kito’s push button controls ensures comfortable operation, preventing operator fatigue after long periods of operation. By increasing the number of load sheave pockets, vibrations produced by the revolving polygonal sheave on the hoist’s body and load chain are reduced. A fan cooled motor, with motor frame fins and a fan cover, ensures quiet operation and enhanced fan cooling capabilities. Kito’s super strength, nickel plated load chain offers increased resistance to fatigue, wear and corrosion. ER2 chains are not compatible with the previous ER series due to a difference in the chain profile. The connecting shaft that was previously attached inside the body is now mounted on the outside of the ER series. This allows a top hook or suspender to be easily Lifting Africa - Sept/Oct 2015

Lifting Africa SEPTOCT15.indd 47

47

07-Sep-15 12:53:23 PM


CRANES, CHAINS & HOISTSĂ&#x161;

attached or removed. Another feature for easy maintenance is that electric parts and equipment are now contained inside the controller cover. As a standard feature, the hoistâ&#x20AC;&#x2122;s total on-time and the number of lowering starts are shown on the LCD of the quick view hour counter/meter. This enables the user to carry out maintenance based on the frequency of use. By maintaining a history of the CH meter data, the inspection periods and replacement periods for gear oil, contactors, brakes and load chains ban be efficiently controlled. Other options in the ER2 series include; a mechanical brake combined with a friction clutch if dual braking is required for capacities up to 10 T. For additional safety, an overload limiter is recommended as an option which is preset by 115% of rated capacity. The Kito load bell automatically alerts the operator if

Electric components of these hoists have sufficient strength to withstand the internal pressure indicated in JIS C0903. the hoist is overloaded. Drop stops provide additional security of the motorised trolley for the operator and equipment and rubber bumpers protect the motorised trolley from collisions. The forged carbon steel hook has been designed to open gradually and will not fracture under excessive load. Top and bottom hooks are equipped with a hook latch and the bottom hook swivels 360 degrees to prevent kinking and twisting of the load chain.

Who We Are

MFN Lifting Systems is a Design and Manufacturing Company, established in 2009. With more than 40 years of accumulated knowledge and experience in the Lifting Industry, it was only a matter of time before the Design and manufacture of custom and standard lifting equipment became a reality.

Our Mission To exceed our customersâ&#x20AC;&#x2122; expectations in quality, delivery, and cost through continuous improvement and customer interaction. We endeavour to provide the highest level of customer service and satisfaction by delivering products and services of world-class standards, specifications and quality. We strive to achieve this by using stateof-the-art equipment. We pride ourselves with our highly motivated and experienced team in the lifting industry. Our customers testify to our reputation of being the most trust worthy, honest and reliable team in the world.

Our Vision To become the leading manufacturer and supplier of custom and standard lifting equipment in the industry. Our future relies on expanding our horizons beyond the borders of Southern Africa and ultimately into the international arena, where our expertise and vision will undoubtedly be recognised. 7HO  VDOHV#PIQOLIWLQJFR]DZZZPIQOLIWLQJFR]D

Kito trolleys are available as motorised, plain and geared, to provide smooth, precise and easy traversing and positioning. The Kito range is available nationally from Becker Mining South Africa, which offers a technical advisory, repair, test and back up service. *HRUJH0F0DVWHU%HFNHU0LQLQJ6RXWK$IULFD 7HO   (PDLOLQIR#]DEHFNHUPLQLQJFRPZZZ]DEHFNHUPLQLQJFRP

safrench

48

Lifting Africa - Sept/Oct 2015

Lifting Africa SEPTOCT15.indd 48

07-Sep-15 12:53:25 PM


Lifting Africa - Sept/Oct 2015

Lifting Africa SEPTOCT15.indd 49

49

07-Sep-15 12:53:25 PM


Light Work of Heavy Loads We are a multi-national company with business partners based in Germany (RUD) and Switzerland (SpanSet, Germany, United Kingdom). Our company is currently 33.3% South African owned. We have been producing and importing our products/equipment from our Randburg-based factory for 32 years. Currently we source raw material and product from 18 countries around the world. And export to 32 countries around the world. We’re ISO accredited and Supply Certification either by batch or individually attached to each sling assembly. The company can support our certification either via SABS or CSIR certificates. Please note/remember that product test or compliance certificates are not worth the paper they are printed on unless they are covered with the supporting documents such as destructive positive test reports. All of which we have available. We offer the following items: •

Textile slings up to 900 tons work load limits;

Sling and edge protectors for chain, steel wire rope and textile;

ENDLESS ROUNDSLINGS z:RUNORDGOLPLWVIURPNJWRNJz

Lashing equipment up to 20000kg minimum break strengths;

MANUFACTURED AND TESTED IN ACCORDANCE TO : z6$166$%6z&(z,62

Safety belts for personnel transport; (mining machines, busses, ambulances, etc)

Height safety and fall arrest equipment (includes temporary and permanent systems)

Vehicle and truck recovery systems up to 9900tons minimum break strengths.

FLAT WEBBING SLINGS z:LGWKVIURPPPWRPPz z:RUNORDGOLPLWVIURPNJWRNJz

Our brands are listed below: Tel : (+27) 011 792-5226 michael@liftlash.co.za / www.liftlash.co.za www.rud.com / www.spanset.com 50

SECURELOAD; (lifting equipment)

SECURETECH; (4x4 recovery and outdoor equipment)

Lifting Africa - Sept/Oct 2015

Lifting Africa SEPTOCT15.indd 50

07-Sep-15 12:53:28 PM


â&#x20AC;˘

SECURETEX; (anti cutting anti abrasion sleeves) â&#x20AC;˘ SECURESTRAP; (tie downs) â&#x20AC;˘ SECUREit; (auto safety belts) â&#x20AC;˘ SECURELIFT; (lifting equipment) â&#x20AC;˘ RUD; (lifting chains, lifting/ lashing points and snow chains) â&#x20AC;˘ SPANSET; (textile lifting and lashing equipment, fall arrest) â&#x20AC;˘ SECUTEX; (anti cutting anti abrasion sleeves) â&#x20AC;˘ SAFELINEâ&#x20AC;&#x2122; (permanent fall arrest systems) â&#x20AC;˘ AXZION (lifting spreader beams and turning attachments). Our production facility is currently approximately 1600 square metres, and we employ 52 people. Within this facility, we have 54 sewing machines and one endless roundsling winder. All our sling testing is done at the CSIR in Johannesburg. Currently we convert around 5 00 000 plus metres of various types of webbing including; polyester, polyamide, polypropylene, cotton, kevlar, glass, etc. Our leads times vary between a week and 6 weeks depending on the order size and complexity. 7HO   PLFKDHO#OLIWODVKFR]D ZZZOLIWODVKFR]D ZZZUXGFRP ZZZVSDQVHWFRP

Lifting Africa - Sept/Oct 2015

Lifting Africa SEPTOCT15.indd 51

51

07-Sep-15 12:53:32 PM


LOADER CRANESÚ

50

Years of Fassi Cranes at Bauma

With a business relationship with Fassi dating back as far as the 1970s, Eqstra 600SA will mark 50 years of Fassi Cranes worldwide at Bauma CONEXPO Africa, which takes place at the Johannesburg Expo Centre from 15–18 September 2015. A division of Eqstra Industrial Equipment (EIE), Eqstra 600SA is one of Fassi’s most successful distributors worldwide, marketing a comprehensive range of Fassi Loader Cranes, global leaders in the lifting industry, throughout Southern Africa.

52

FrancoFassi

Lifting Africa - Sept/Oct 2015

Lifting Africa SEPTOCT15.indd 52

07-Sep-15 12:53:33 PM


â&#x20AC;&#x153;

The longevity of our relationship with Fassi is an expression of EIEâ&#x20AC;&#x2122;s commitment to forming partnerships for life, both with our principals and our clients â&#x20AC;&#x201C; partnerships that go beyond just a business association to one based on a sound friendship,â&#x20AC;? says Brendan Londt â&#x20AC;&#x201C; MD: Eqstra 600SA. â&#x20AC;&#x153;A best-inclass brand, Fassi and its values are a perfect fit with those of Eqstraâ&#x20AC;&#x2122;s, including our shared commitment to ongoing innovation.â&#x20AC;? Eqstra 600SA will shortly be moving into ultra modern premises, state-of-the art facilities that are in line with the high quality and technologically advanced products it markets.

Today, Fassi manufactures over 5,000 articulating hydraulic truck-mounted cranes per year and exports over 80% all over the world. Fassi offers a complete range of cranes for every need that can be mounted on many types of commercial trucks and carriers. Eqstra 600SA distributes Fassiâ&#x20AC;&#x2122;s light-duty 1 - 12 tonnes, medium-duty 13 - 38 tonnes and heavy-duty (over 41 tonnes) truck-mounted, knuckle-boom cranes, which are characterised by advanced technological features that not only facilitate optimal productivity, but also ensure high levels of safety. Features include the innovative Fassi double linkage system, which assures perfectly constant lifting at all times, while the original ProLink System allows the working angle to be increased above the horizontal line by up to 20 degrees.

Developing its first truck-mounted crane in 1965, Fassi, which is headquartered in Bergamo, Italy, has continued its ongoing search for improvement and a high level of innovation that has always distinguished its brand on the world market. â&#x20AC;&#x153;We are honoured to be celebrating Fassiâ&#x20AC;&#x2122;s 50th anniversary as one of their distributors around the globe and to have contributed to their success with our extensive track record supplying Fassi cranes locally,â&#x20AC;? says Londt. â&#x20AC;&#x153;It speaks volumes about the quality and durability of these machines that over 70 % of the cranes produced by Fassi since 1965 are still in full-time operation.â&#x20AC;? The history of Fassi Cranes has been not so much one of building a company, but rather one of living out a passion. As Franco Fassi, the visionary founder of Fassi cranes says: â&#x20AC;&#x153;Fassiâ&#x20AC;&#x2122;s 50th anniversary doesnâ&#x20AC;&#x2122;t actually celebrate the birth of the company, but the birth of our love for cranes.â&#x20AC;? With the solid foundations laid in the 1960s, the company saw remarkable growth and development, as well as the second generation, Giovanni Fassi, taking the lead. Taking stock of his fatherâ&#x20AC;&#x2122;s valuable insight and philosophy, and applying them to a newly evolving global economy, Giovanni Fassi explains: â&#x20AC;&#x153;The principles that my father followed, in order to give life to his entrepreneurial adventure in the world of cranes in 1965, remain the same ones on which the global enterprise rests today. â&#x20AC;&#x153;As a company, we operate in the new millennium with the same values that we had at the outset: quality, innovation, consistency, safety and internationalism. We have never settled for second best and we have always forged ahead with the courage of pioneers and the eyes of explorers.â&#x20AC;?

The man-machine interface is also a design priority with advanced communication systems and user friendly control consoles. Fassi was also one of the first crane companies to develop remote control systems to allow the operator to work from positions of greater safety and with better visibility of the load. The digital radio remote control, exclusively compatible with the Fassi product, continuously monitors and ensures the ideal crane working conditions versus the vehicle/ crane stability. Eqstra 600SA fully supports its Fassi crane users over the complete product lifecyle, including maintenance contracts, operator and maintenance staff training and spares and aftermarket support. %UHQGDQ/RQGW(TVWUD6$7HO   (PDLOEUHQGDQO#HLHJURXSFR]D

Lifting Africa - Sept/Oct 2015

Lifting Africa SEPTOCT15.indd 53

53

07-Sep-15 12:53:34 PM


FLEET RENTALĂ&#x161;

Its all about service, reliability and customer satisfaction Reliable, well-maintained equipment and service excellence have earned Goscor Rental Company the position of rental equipment supplier of choice for exhibition freight forwarding and on-site contracting specialist, Larouxnelle Logistics and Consulting.

of site handling at Bauma CONEXPO Africa 2015 and will be using various rental equipment from Goscor Rental Company for this project. The company also hires cherry pickers and recently purchased their first machine from Goscor, a one off 2.5 ton Doosan forklift.

Based in South Africa, Larouxnelle Logistics, takes care of special projects such as hazardous cargo, military vehicles, equipment chartered flights, etc. and handles all aspects of exhibition logistics, from customs clearance to health and safety issues.

Innovative Solutions and Professional Support

â&#x20AC;&#x153;We operate in a niche field that demands a higher level of accountability compared to traditional commercial freight forwarding,â&#x20AC;? explains CEO, Leon Roux. â&#x20AC;&#x153;This requires specialised services and an extremely meticulous skillset. We are always working against the clock, unpacking containers and moving products at exhibitions. It is absolutely imperative that everything runs like clockwork because exhibitors can charge penalties if their products are not punctually moved in or out of venues. This means that there is no room for error or equipment breakdown.â&#x20AC;?

Exhibitions Most of the forklifts Larouxnelle hires from Goscor Rental Company are used to unpack containers and move products in and out of exhibition areas at leading South African exhibition venues such as Gallagher Convention Centre, Nasrec Expo Centre, Sandton Convention Centre, etc. Larouxnelle has been appointed to take care 54

Goscor Rental Company, a division of Goscor Lift Truck, part of the Goscor Group of companies and Imperial, has over 31 yearsâ&#x20AC;&#x2122; experience in the delivery of one of the most flexible and competitive machine rental solutions on the market. Barbara Abdalah, Head of Division for Goscor Rental Company, says that building and maintaining good customer relationships by supplying the most reliable equipment and service solutions are key to a successful and sustainable business. â&#x20AC;&#x153;We are committed to consistently deliver worldclass products with innovative solutions and professional support to maximise uptime and productivity for our valued customers like Larouxnelle.â&#x20AC;? In closing, Roux says that whenever they need a specific forklift for a specific job, whether a 2.5 ton or a 16 ton forklift, Goscor always comes through with the right equipment. He adds that this dedication to quality and service presents a good image for both Goscor and Larouxnelle since these forklifts are used at exhibitions where many forklift brands operate. â&#x20AC;&#x153;We have enjoyed a very good relationship with Goscor since 2012 and we are comfortable to stake our reputation on Goscor Rental Companyâ&#x20AC;&#x2122;s equipment and service.â&#x20AC;? %DUEDUD$EGDODK*RVFRU5HQWDO&RPSDQ\ 7HO  %DEGDODK#JRVFRUFR]D ZZZJRVFRUUHQWDOFR]D

Lifting Africa - Sept/Oct 2015

Lifting Africa SEPTOCT15.indd 54

07-Sep-15 12:53:35 PM


Lifting Africa - Sept/Oct 2015

Lifting Africa SEPTOCT15.indd 55

55

07-Sep-15 12:53:35 PM


4*;&*4&7&3:5)*/( Africaâ&#x20AC;&#x2122;s first single hoist 500t Double Girder crane

Go big or go home is our motto, it takes a special

40t auxiliary hoist Span: 23 metres Height of Lift: 19 metres Working in a bay 508 metres long All inverter controlled with extended speed range which means double the hoisting speed with half the load Crane 1 of 3 which will be used in tandem to lift 1500t via single remote

crane company to handle the challenges of our African environment.

At PCS we offer an exceptional combination of products and service for the manufacturing and maintenance of overhead cranes, hoists and mechanical lifting equipment.

Tel: +27 (0) 11 394 5550 Web: www.procrane.co.za Email: sales@procrane.co.za 56

Lifting Africa - Sept/Oct 2015

Lifting Africa SEPTOCT15.indd 56

07-Sep-15 12:53:35 PM

Profile for Lifting Africa

Lifting Africa Sep / Oct 2015  

Lifting Africa Sep / Oct 2015  

Advertisement

Recommendations could not be loaded

Recommendations could not be loaded

Recommendations could not be loaded

Recommendations could not be loaded