Page 1

Kilkenny Reporter

WEDNESDAY OCTOBER 9 2013

T: 056 7795051 E: sales@kilkennyreporter.ie


Kilkenny Reporter

WEDNESDAY OCTOBER 9 2013

T: 056 7795051 E: sales@kilkennyreporter.ie

RUSSIAN ROULETTE ON ROADS AS BOY RACERS PUT LIVES AT RISK » P22

Joe’s Crock of Gold

» Story Page 16

LOVE BALLOON: A balloon of love reminded of relatives and friends who lost their lives through addiction. Local girl Amelie Foley supported a drugs’ awareness ceremony. » Story and pics page 84&85

HORSE POWER: It was novel, exciting too, and it gets The Reporter vote. Local friends, Gillian Hennessy, left, on Stanley, and Fiona Dalton, on Bono, went to vote on Friday, on horse back! » Story and pic page 25

14,000 Reporter newspapers distributed every week


4 | NEWS

KILKENNY REPORTER 9 10 2013

INSIDE YOUR

Tom enjoys the Foyle Run in classic style

THIS WEEK

720 7(11<621 3LOWRZQ ZDV DPRQJ WKH FRQWHVWDQWV LQ WKH DQQXDO )R\OH 5XQ LQ 3LO WRZQ 7KH 9LQWDJH  9HWHUDQ FDU UXQLVLQPHPRU\RIWKHODWH-LP )R\OHJDUDJHRZQHULQ3LOWRZQ

NEWS Our solicitors are gone to pot!

DQG D FROOHFWRU RI YLQWDJH FDUV DQGWUXFNV  7RP LV GULYLQJ KLV  &KHYUROHW /DQGULXH ZKLFK ZDV PDGH DQG VROG ¿UVW LQ 6RXWK $IULFD 7RP ERXJKW WKH FDU LQ 1RUWKHUQ,UHODQG

SEE PAGE 17

SPORT Our GAA expert Pat Treacy predicts a Clara/Shamrocks senior county final SEE PAGES 114-117

Tom Tennyson in his Chevrolet

Reporter Briefs Hip hop for kids

+,3+23VWDUWVRQ2FWREHU IURPSPWRSP¼SHUFKLOG 7R UHJLVWHU ULQJ  RUFDOOWR%DJHQDOVWRZQ)DPLO\ 5HVRXUFH&HQWUH *XLWDU OHVVRQV IRU FKLOGUHQ VWDUW VRRQ VPDOO JURXSV  ¼ SHU FODVV &RQWDFW .DWH   ,QWHUPHGLDWHFRPSXWHUFODVVHV VWDUW RQ 7KXUVGD\V SP WR SP  &RVW ¼ IRU HLJKW ZHHN FRXUVH 3OHDVH FRQWDFW 

A photo finish

&$55,&.&DPHUD&OXEZLQQHUV LQWKHµ3KRWRJUDSKHURIWKH<HDU¶ FRPSHWLWLRQ RQ WKH WKHPH RI µ:KHHOV¶%HJLQQHUV/HQD3RZ HU,QWHUPHGLDWH7RQ\)LW]JHUDOG $GYDQFHG 7RP *UDFH 1H[W PHHWLQJ LV 2FWREHU  SP LQ WKH&DUUDLJ+RWHO*XHVWZLOOEH SKRWRJUDSKHU -RKQ &URZOH\ $ FOXE PHQWRULQJ RXWLQJ ZLOO EH KHOGRQ6DWXUGD\2FWREHU

Locals head to Dublin

75$,1,1*KDVEHHQXSSHGDV DORFDOER[LQJFOXESUHSDUHVWR YLVLW WKH 'XEOLQ FOXE RI 2O\P SLFJROGPHGDOOLVW0LFKDHO&DU UXWK IRU D ERXW WRXUQDPHQW RQ2FWREHU 0LFKDHO ZKR LV GHYHORSPHQW RI¿FHU IRU WKH ,ULVK $PDWHXU %R[LQJ$VVRFLDWLRQLQ'XEOLQLV GHHSO\LQYROYHGZLWKWKH'ULP QDJKFOXE+HKDVVHWXSDFDUG RIER\VDQGJLUOVWKURXJKRXWWKH FLW\ 7KH ¿UVW ERXW LV DW SP 0HDQZKLOH WUDLQLQJ FRQWLQXHV IRU 6W 3DWULFN¶V DW 7KH :DWHU VKHG 6FDQORQ 3DUN 0RQGD\ SP WR SP7KXUVGD\ SP WR SP 6DWXUGD\ DP WR SP (QTXLULHV

Cheers to set dancers 7+(  PRQWKO\ SXE IXQ TXL] DW WKH +RPH 5XOH &OXE -RKQ¶V 4XD\ RQ 7KXUVGD\ ZDV KLJKO\ HQMR\DEOHDQGZHOOVXSSRUWHG :LQQHUZDVDWHDPIURP0\UD .HQQHG\¶V 6HW 'DQFHUV ZKR EHDWRWKHUWHDPV4XL]PDV WHU ZDV WKH HYHU SRSXODU 5LFK DUG 2¶&RQQRU RI 6W &DQLFH¶V &UHGLW8QLRQ 7KH QH[W TXL] LV RQ WKH ODVW 7KXUVGD\ RI 2FWREHU DQG DOO DUHZHOFRPH7KLVTXL]LVQRYHO LQWKDWWKHUHLVQRHQWU\IHHQR UDIÀH DQG SUL]HV DUH FRPSOL PHQWDU\GULQNVIRUWKHZLQQHUV

Kilkenny CBS Lottery

180%(56     -DFNSRW QRW ZRQ ¼ %HFN\ 6PLWK  1HZSDUN &ORVH ¼ )UDQFHV 2¶&RQQRU  &RO OHJH &RXUW -RKQQ\ %DUU\ )U 0XUSK\¶V 6TXDUH ¼ %ULDQ 1XJHQW &XIIHVJUDQJH *LOOLDQ .HOO\5RVH+LOO&RXUW 3URPRWHUV¶ SUL]H 5REHUW 9D VRODFKLQ &%6 1H[W MDFNSRW ¼2FWREHU


ADVERTISEMENT | 5

9 10 2013 KILKENNY REPORTER

Â&#x2DC;'9*7$61#664#%6,1$5(146*'5176*'#56 Â&#x2DC;'8'.12/'069+...'#&/#,144')'0'4#6+101(+.g -'00;+6;'064'

.#05708'+.'&(140'9019.'&)' #0&75+0'557#46'4(14+.-'00; #,142.#05(146*'4')'0'4#6+101(+.-'00;g+0%.7&+0)6*'&'8'.12/'061(#019.'&)'#0&75+0'55 7#46'4106*'*+5614+%/+6*9+%-54'9'4;5+6'+06*'%'064'1(6*'%+6;g9'4'708'+.'&6*+59''-T '4' #4%*+6'%610;'&&;X1('&&;4%*+6'%674'x4$#0+5/9*1&4'9726*'/#56'42.#0(146*'5+6'#0&9*1 +52#55+10#6'#$1766*'&'8'.12/'061(6*'%+6;X176.+0'5*+58+5+10(14+65(7674'&'8'.12/'06T



*'#%37+5+6+101(6*'*+5614+% EGg#%4'/+6*9+%-54'9'4; 5+6'(41/+#)'1$;+.-'00; 1417)*#0&1706;170%+.5 +5*7)'.;5+)0+(+%#06(14+.-'00;T 6 24'5'065759+6*#70+37'1221467g 0+6;(146*'5'05+6+8'4')'0'4#6+101( 6*'%+6;%'064'X9*+.56#66*'5#/' 6+/'&4+8+0)'%101/+%&'8'.12/'06 61'0574'6*#6+.-'00;(.174+5*'5 +0616*'(7674'T *'708'+.+0)1(2.#056*+59''- (14#0'9019.'&)'#0&75+0'55 7#46'4106*'5+6'24'5'065+.-'00; 9+6*#70+37'12214670+6;#/10) 4+5*#0& 7412'#0%+6+'561%4'#6'# /1&'4052#%'#&,1+0+0)+65/'&+'8#. %14'X9*+.56'0*#0%+0)+65%7.674#. *'4+6#)'#0&+/2418+0)+655756#+0g #$+.+6;#0&#..19+0)+661%1/2'6'+0 6*'-019.'&)''%101/;1(6*'FE56 '0674;T +.-'00;*#5*#&#4'276#6+105+0%' /'&+'8#.6+/'5(146*'37#.+6;1(+65 74$#0+5/T 0&''&6*'(+4567-'1( 4/10&'g(41/':+.'#66*'%1746 1(17+5 +0#4+5h$417)*6 61 4'.#0&#0#224'%+#6+101(6*' +/2146#0%'1(#4%*+6'%674'#0& 27$.+%52#%'5616*''0*#0%'/'061( 174%+6+'5#0&61905T 69#5*'9*1 %10%'+8'&6*'#4#&'+0+.-'00;X 6*'1;#. 152+6#.+0+./#+0*#/#0& 7$.+05+((';7#;5T *'#%37+5+6+101(6*'/+6*9+%-5 5+6'019#((14&56*'%+6+<'051( +.-'00;6*'12214670+6;61#%*+'8' +06*'FE56'0674;9*#66*'7-' 1(4/10&'%17.&016#%*+'8'+0*+5 .+('6+/'g2.#00+0)6*'%+6;61#&&4'55 6*'+8'414'T '8'.12/'061(6*'5+6'9+..#..19

754'&4'556*'$#.#0%'+04'52'%61( .15612214670+6+'51(6*'2#5657%*#5 /+55+0)6*' 0&7564+#.'81.76+10Xj# $.'55+0)+0&+5)7+5'kX#0&016$'+0) 5'#661#0+8'45+6;Xj0169+6*56#0&+0) #/'5 5)4#061(#%*#46'4616*' 0+8'45+6;1(6#0+%'+0EJLMkT*' 5+6'01924'5'0656*'12214670+6;61 #%%1//1&#6'#70+8'45+6;146*+4& .'8'.+056+676'#0&#%.756'41(-019.g '&)''%101/;#0&51%+#./'&+# %1/2#0+'5T*'5'75'59+..24'5'06 +.-'00;9+6*6*'12214670+6;61$' #%1/2'6+6+8'%+6;+06*'-019.'&)' '%101/;)1+0)+0616*'(7674'T *'.1%#6+101(6*'/+6*9+%-55+6' +06*'/'&+'8#.*'#461(6*'%+6;9+.. #..19(146*'4')'0'4#6+101(6*'%+6; '%101/+%#..;#0&51%+#..;T 624'5'065 #012214670+6;614'2#+46*'(#$4+% 1(6*'%+6;#0&4'+056#6'64#&+6+10#. 564''65#0&5.+29#;5 1/#:+/+5'6*+512214670+6;6*' +.-'00;.1%#.#76*14+6+'5#)4''&61 6*'&4#9+0)721(#04$#0 4#/'g 914-.#05'66+0)6*'2#4#/'6'45(14 6*'74$#04')'0'4#6+101(6*'(14/'4 $4'9'4;5+6'T59'..#5&+4'%6.;&'g 6'4/+0+0)6*'4'&'8'.12/'061(6*' 5+6'+65'.(X6*'#56'42.#0+0(14/5 6*'21.+%+'5#0&1$,'%6+8'51(6*' 170%+.5+04'52'%6616*'10)1+0)

&'8'.12/'061(+.-'00;+6;#0&+65 '08+4105T *'4$#0 4#/'914-.#0+5 6*'%7./+0#6+101(#241%'559*'4' ':2'465+06*'(+'.&51('%101/+% &'8'.12/'06X61902.#00+0)X%10g 5'48#6+10#0&#4%*+6'%674''0)#)'& +0#5'4+'51(914-5*1256157))'56 564#6')+'5(146*'74$#04')'0'4#g 6+101(6*'5+6'T

1..19+0)6*+5241%'55#07/$'41( #4%*+6'%674#.24#%6+%'59'4'+08+6'& 6157$/+6(14/#.241215#.5(146*'+4 #2241#%*616*'24'2#4#6+101(#0 4$#0 4#/'914-.#0(146*'5+6'T 9#5&'.+)*6'&6*#6/;24#%6+%'X'&g &;4%*+6'%674'x4$#0+5/X9*+%* *#5#.10)'56#$.+5*'&+.-'00;1((+%'X 9#55'.'%6'&61914-9+6*6*'170g %+.'0)+0''4+0)#0&2.#00+0)6'#/5 106*+55+)0+(+%#06%1//+55+10T *'4$#0 4#/'914-.#0 &'(+0'56*'24+0%+2.'5(146*' 4')'0'4#6+101(6*'5+6'+04'52'%6 1(2.#00+0)21.+%+'5#0&1$,'%6+8'5 #5+&'06+(+'&+06*'#6+10#.2#6+#. 64#6');X6*'+.-'00;+6;n 08+4105 '8'.12/'06.#0#0&6*'+.-'00; +6;'064'1%#.4'#.#0X *'.#05'65176%105'48#6+10X 5756#+0#$+.+6;X27$.+%4'#./#0&74$#0 &'5+)0564#6')+'5(146*'5+6'T 69+..

&'.+8'4#/+:1(75'561'0574'6*#6 6*+50'937#46'49+..$'#8+$4#06 #0&57%%'55(7.#&&+6+10616*'%+6;X #0#664#%6+10+0+651904+)*6#0&#0 '0*#0%'/'06616*'/'&+'8#.%14'T *'4$#0 4#/'914-.#05'65 176)7+&'.+0'5(146*'&'5+)0#0& &'.+8'4;1(U Â&#x2DC;/#,142#4-f)#4&'0106*' $#0-51(6*'14'T Â&#x2DC;0'9.#0&5%#2'&9#.-#.10)6*' +6;#..5#0&4'#)#)*+8'4T Â&#x2DC;105'48#6+101(*+5614+%$7+.&+0)5 106*'5+6'T Â&#x2DC;'927$.+%X.#0&5%#2'&52#%'5 +0%.7&+0)#27$.+%537#4'#66 4#0g %+5$$';T Â&#x2DC;756#+0#$.'#0&'0'4);'((+%+'06 564#6')+'5(14+0&+8+&7#.$7+.&+0)5 #0&6*'18'4#..5+6'T Â&#x2DC;G4&.'8'.4'5'#4%*#0&'0g 6'424+5'%#/275%'064'&106*' 4')'0'4#6'&+0&7564+#.$7+.&+0)561 $'4'6#+0'&105+6'T Â&#x2DC;'5+&'06+#.#0&4'6#+.75'5T Â&#x2DC; 0&+)'0175#0&+06'40#6+10#. -019.'&)''%101/;75'510-'; 5+6'5T Â&#x2DC;7.674#.X4'6#+.#0&6174+564'.#6'& 75'510&'(+0'&5+6'5T *'.#05'65176/'%*#0+5/561 &'.+8'46*'&'8'.12/'0610#2*#5'& $#5+5X$;6*'27$.+%#0&24+8#6'5'%g 6145X18'46*'0':6EN61EI;'#45X 57$,'%6616*'8+6#.+6;1(6*'.1%#.#0& 0#6+10#.'%101/;T $'.+'8'6*+52.#0 (146*+5*7)'.;+/2146#065+6'+06*' *'#461(+.-'00;9+..'0574'6*#6 +.-'00;9+..5'%74'+65'%101/+% (7674'h#0&24'5'48'9*#6+5/#)+g %#.#0&24'%+175#$176+652#56#66*' 5#/'6+/'T

'9\+8'4 #4&'05[2#4-2.#00'&(14*'#461(+.-'00;



56700+0)2#4-#0&)#4&'05 #.10)6*'$#0-51(6*' /#)+%#.+8'414'+561$' &'8'.12'&+0+.-'00;#52#46 1(#/#,144')'0'4#6+101(6*'%+6; %'064'T '6#+.51(#/#,140'94+8'45+&' .+0'#42#4-#.10)6*'4'9'4;9+6*# 8+'91(+.-'00;#56.'X9'4'4'8'#.'& +06*'#56'42.#0(146*'&'8'.12g /'061(6*'/+6*9+%-54'9'4;5+6' 708'+.'&6*+59''-T *'2#4-#0&4+8'4)#4&'059+..$'# /#,144'%4'#6+10#.4'5174%'(146*' 2'12.'1(+.-'00;#0&#0#664#%6+10 (146*'6*175#0&51(6174+5659*1 8+5+6'#%*;'#4T 69+..+0%14214#6'#9#.-9#;#.10) 4+8'4.'8'.&+8+&'&+061&+56+0%62.165 +0%.7&+0)10'(145*19)#4&'05X 5+/+.#4619*#6+55''0#6.11/X 9*+%*%17.&$'&'8'.12'&)4#&7#..;

18'46*';'#45T *'241215#.+561'%*16*'.10) 0#44192.165%*#4#%6'4+56+%1('&+g '8#.619056*417)*1769'56'40 7g

412'9*'4'*175'59'4'$7+.6$'*+0& 5*1259+6*)#4&'05#0&14%*#4&5T T#.-+0)5176*#.10)6*'4+8'4$#0-X 6*')#4&'05X9#.-9#;#0&212.#4

64''59+...'#&6*'';'61/#,'56+% +.-'00;%#56.'+06*'&+56#0%'X$'g %1/+0) 8+'91(6*'%+6;T 6+5241215'&6*#66*'.+0'#42#4- 9+..':6'0&0146*9#4&5#.10)6*' 4'9'4;5+6'X2#566*'0'9$4+&)' #0& 4''054+&)'616*'':+56+0) 2#4-.#0&5$';10&T16*'5176*X+6 9+..5'#/.'55.;.+0-9+6*6*'':+56+0)X 910&'4(7.%#0#.9#.-#0&61#0'9 2'&'564+#0$4+&)'241215'&(14%10g 5647%6+1070&'45514;4+&)'X.+0-+0) 616*'':+56+0)4+8'45+&'9#.-#.10) 6*' '#.6*1#4&.#0&5T 1)'6*'4X6*+5%114&+0#6'&%106+07g 175'05'/$.'1(4+8'4$#0-)#4&'05X 2#4-5X9#.-9#;5X$4+&)'5#0&6*' %#56.'9+..&'8'.12+061#/#,142#4- #0&)#4&'09+6*#70+37'4+8'45+&' 2#4-X#/#,14#/'0+6;#0&#6174+56 #664#%6+10X+06*'%'064'1(6*'%+6;X #66*'/+6*9+%-55+6'T

.#059'4'708'+.'&61&#;j10&#;X%61$'4K6*k (146*'&'8'.12/'061(#019.'&)'#0&75+0'55 7#46'4+0+.-'00;%+6;X9+6*6*'216'06+#.61#664#%6 5+)0+(+%#06,1$5616*'4')+1018'46*'0':66'0;'#45T *'0'9$75+0'5537#46'49+..215+6+10+.-'00;#5#0 +/2146#060'9+08'56/'06.1%#6+101765+&'1(7$.+0X #0&#0#664#%6+8'126+10(14(14'+)0#0&&1/'56+%%1/g 2#0+'5.11-+0)61.1%#6'14':2#0&+0 4'.#0&T *'2.#0+56*'/156+/2146#06'%101/+%&'8'.12g /'06+0+6+#6+8'(14+.-'00;+0+65*+5614;X#0&#.51 +0%.7&'5#241215#.(14#6*+4&.'8'.%#/275#0&#0'9 4+8'45+&'%+6;%'064'2#4-T *'-019.'&)'#0&$75+0'5537#46'4+561$' &'8'.12'&106*'EGg#%4'/+6%*9+%-54'9'4;5+6'X #0#4'#1(564#6')+%#0&*+5614+%#.+/2146#0%'616*' 2'12.'1(+.-'00;T*'&'8'.12/'069+..&4+8'/#,14 %+6;%'064'4'0'9#.X#0&9+..$'5'48+%'&$;6*'0'9 '064#.%%'55%*'/'9*+%**#5$''0)4#06'&2.#0g 0+0)2'4/+55+10$;014&.'#0#.#T *'0'97#46'49+..2418+&'7261::::537#4'(116 1(1((+%'52#%'10#$'#76+(7.5+6'#.10)6*'$#0-51( 6*'+8'414'18'4.11-+0)+.-'00;#56.'X9+6*6*' %#2#%+6;(14/#0;,1$5X+.-'00;%170%+..1459'4'61.& #6#/''6+0)61&#;T *'37#46'49+..+0%.7&'U Â&#x2DC;((+%'#%%1//1&#6+10(14%14214#6'X%4'#6+8'#0& 6'%*01.1);%1/2#0+'5T Â&#x2DC;2#%'(144'5+&'06+#.#0&4'6#+.75'T Â&#x2DC;0'9G4&.'8'.4'5'#4%*#0&&'8'.12/'06%#/275 (146*'2.#00'&0'9 '%*01.1)+%#.0+8'45+6;1(6*'176* #56T Â&#x2DC; +8'0'9#4'#51(27$.+%4'#./T Â&#x2DC;/#,140'9%+6;%'064')#4&'0f2#4-1(+06'40#6+10#. 56#0&#4&T *'57%%'55(7. f4%#$(#%+.+6;Xj'.'%1/51(6g 9#4'#0&;56'/ 4172kX#,1+068'0674'$'69''06*' +.-'00;1%#.76*14+6+'5X#6'4(14&#0&#4.19 0g 56+676'1('%*01.1)+'5X9+..$'.1%#6'&616*'0'9G4& .'8'.4'5'#4%*#0&&'8'.12/'06%#/275T 6+5#*7$(14 0':6)'0'4#6+10+06'40'6&'8'.12/'06(14%1/2#0+'5 +06*'(+0#0%'X$#0-+0)X+0574#0%'#0&#)4+g$75+0'55 5'%6145#0&9#5'56#$.+5*'&#66+'4#051..')'.#56 ;'#4T 6#.4'#&;'/2.1;5/14'6*#0FN4'5'#4%*'45T *'EGg#%4'/+6*9+%-54'9'4;5+6'9#5274g %*#5'&$;6*'+.-'00;1%#.76*14+6+'5(41/+#)'1 (14}FTE/.#56;'#4T+#)'1+561/18'6*'/+6*9+%-5 $4'9+0)12'4#6+10(41/+.-'00;617$.+0#(6'4GNN ;'#45+06*'%+6;T*';#4'&'8'.12+0)#}G/+5+614 '064'106*'5+6'X&7'6112'0+0FNEHT

1..19+0)6*'274%*#5'X#0'9241%'55g#(+456+0 4'.#0&g9#5276+02.#%'9+6*6*'1;#. 056+676'1(6*' 4%*+6'%651( 4'.#0&6124'2#4'#4%*+6'%674#.#0&&'g 5+)024+0%+2.'59*+%*917.&)7+&'6*'/#56'4g2.#00+0) 1(6*'5+6'T 4%*+6'%610;'&&;24'2#4'&6*'/#56'42.#0 24'5'06'&61'.'%6'&/'/$'45#6#/''6+0)61&#;T

'5#+&6*'/+6*9+%-55+6'24'5'065+.-'00;9+6*# 70+37'12214670+6;#/10) 4+5*#0& 7412'#0%+6+'5 61%4'#6'#/1&'40+06'48'06+10#&,1+0+0)+65/'&+'8#. %14'9*+%*9+..'0*#0%'+65%7.674#.*'4+6#)'X+/2418' +655756#+0#$+.+6;#0&'0#$.'+661%1/2'6'+06*'-019.g '&)''%101/;1(6*'FE56%'0674;T %%14&+0)61+.-'00;+6;#;14X#46+04'666*' ':%+6+0)0'9+0+6+#6+8'*#56*'%#2#%+6;612418+&'6*17g 5#0&51(,1$518'46+/'#66*'*'#461(6*'%+6;%'064'T

'5#+&U\*'5+6'+51(564#6')+%+/2146#0%'616*' 2'12.'1(+.-'00;#0&#/'#05(14/#,14%+6;%'064' 4'0'9#.#0&4')'0'4#6+10T*'24+0%+2.'51(%105'48#g 6+10X5756#+0#$+.+6;X27$.+%4'#./+/2418'/'06#0&74g $#0&'5+)0$'5624#%6+%'9+..)18'406*'&'8'.12/'06T[ #;144'66#&&'&U\*'241215#.5(14#0'9G4& '06'424+5'%#/275X#/#,140'92#4-#0&)#4&'0#0& (14#0'9-019.'&)'#0&%4'#6+8'37#46'4#4'+&'#. 564#6')+'5(146*''%101/+%X51%+#.#0&%1//70+6; &'8'.12/'061(+.-'00;X616*'*+)*'56+06'40#6+10#. 56#0&#4&5[

'5#+&6*#66*'4'917.&$'':6'05+8'27$.+%%10g 57.6#6+10106*'241215#.5#5/'4+6'&#5+6'1(6*+5 5+)0+(+%#0%'T \*+5+56*'/156':%+6+0)#0&6*'/156+/2146#06 '%101/+%&'8'.12/'06+0+6+#6+8'+0/;.+('6+/'T+.-'00; +6;'064'X(#/175(14+65%#('5X*'4+6#)'X5*122+0) #0&#5#)4'#66174+56.1%#6+10X9+..0192418+&'6*' 2'4('%6.1%#6+10(146*'%14214#6'X-019.'&)'X#0& %4'#6+8'5'%6145T *#+4/#01(+.-'00;1706;170%+.X#6702*;X 5#+&U\+6*70'/2.1;/'06#6ELÂ&#x2020;+06*'176* #56 ')+10X+6+5+/2146#066*#6/#,140'9#664#%6+8'.1%#g 6+1051765+&'1(7$.+0X5*17.&$'2418+&'&(14(14'+)0 &+4'%6#0&0#6+10#.+08'56/'06[T '5#+&6*+5+0+6+#6+8' 9#5+0.+0'9+6*6*'#6+10#.2#6+#.64#6');T 1'41%-'66X1706;#0&+6;#0#)'4X5#+&6*#66*' %1/$+0#6+101(G4&.'8'.(#%+.+6+'59+6*#..6*'#664#%g 6+1051(+.-'00;%+6;%'064'#0&9+6*/16149#;%10g 0'%6+8+6;X9#5#0':%'26+10#..;#664#%6+8'241215+6+10(14 +0%1/+0)(14'+)0&+4'%6+08'56/'06[T \#0;1(6*'$'56.1%#6+105+07$.+0*#8'019$''0 76+.+5'&$;/#,14%1/2#0+'5.+-' 11).'#0&6*#6+.-'0g 0;%+6;%'064'0191(('4'&6*'2'4('%6X%15/121.+6#0X $'#76+(7.#0&#8#+.#$.'.1%#6+10#6#8'4;%1/2'6+6+8' 24+%'(146*'%14214#6'#0&%4'#6+8'5'%6145[T


6 | NEWS

KILKENNY REPORTER 9 10 2013

New airport CEO is a real high flier

New Pembroke staff

Intern trio to join hotel staff 7+5((<281*ZRPHQZKR HDFK FRPSOHWHG D QLQHPRQWK LQWHUQVKLSDWDORFDOKRWHOKDYH EHHQJLYHQIXOOWLPHMREV /RFDOV &RXUWQH\ 3RZHU DQG (GHO (DUGO\ DORQJ ZLWK 'LDQH 2Âś1HLOO IURP &DUORZ GLG H[ WHQVLYHWUDLQLQJDQGVXSHUYLVHG PHQWRULQJ 7KH3HPEURNH+RWHO3DWULFN 6WUHHWSODFHVSDUWLFXODUHPSKD VLVRQRIIHULQJRSSRUWXQLWLHVWR

VWDII WKURXJK WUDLQLQJ DQG UH VNLOOLQJ 7KH LQWHUQV WRRN SDUW LQ D .LONHQQ\7RXULVP$PEDVVDGRU 3URJUDPPH DQG *HQHUDO 0DQ DJHU3DXO%URGHULFNFRPSOHWHG D 6WUDWHJLF +RVSLWDOLW\ 0DQ DJHPHQW FRXUVH ZLWK &RUQHOO 8QLYHUVLW\ 3UDFWLFDOH[SHULHQFH Âł, FKRVH DQ LQWHUQVKLS EH FDXVH , ZDQWHG WR JDLQ SUDFWL

FDO H[SHULHQFH +DYLQJ MXVW ¿QLVKHGFROOHJH,KDGSODQQHG RQ JRLQJ RQ WR GR D PDVWHUV EXW , GHFLGHG WKH UROH DGYHU WLVHG DW WKH 3HPEURNH ZDV WKH MRE , ZDQWHG´ VDLG (GHO (DUGO\ ³7KH RSSRUWXQLW\ WR OHDUQ LQ D UHDO EXVLQHVV HQYLURQPHQW ZRXOG EH MXVW DV YDOXDEOH DV FRPSOHWLQJDQRWKHU\HDURIFRO OHJH´VKHDGGHG

:$7(5)25' $LUSRUW KDV DS SRLQWHG 'HVPRQG 2œ)O\QQ DV FKLHI H[HFXWLYH IROORZLQJ WKH GHSDUWXUH RI *UDKDP 'R\OH ZKR KDG KHOG WKH UROH IRU RYHU VL[\HDUV 0RVW UHFHQWO\ 'LUHFWRU RI $pURSRUW GH 'LMRQ%RXUJRJQH LQ )UDQFH 0U 2œ)O\QQ LV IURP 'XEOLQDQGKDVSUHYLRXVO\KHOG VHQLRUPDQDJHPHQWUROHVDW,UH ODQG :HVW $LUSRUW .QRFN DQG DW $pURSRUW GH 'HDXYLOOH1RU PDQGLH ³:HDUHGHOLJKWHGWREHEULQJ LQJ RQ ERDUG DQ H[SHULHQFHG SHUVRQ ZKR KDV ZRUNHG LQ WKLV FRXQWU\ DQG LQ (XURSH 'HV PRQGMRLQVDWDQLPSRUWDQWWLPH IRU RXU DLUSRUW DQG , NQRZ KH LV ORRNLQJ IRUZDUG WR ZRUNLQJ ZLWK WKH WHDP KHUH WR GHYHORS WKH EXVLQHVV IXUWKHU DQG WR VHL]H RSSRUWXQLWLHV WR JURZ WKH EXVLQHVV´ 'DQ %URZQH ERDUG FKDLUPDQWROG7KH5HSRUWHU ³, DP GHOLJKWHG WR KDYH EHHQ VHOHFWHG WR OHDG WKH QH[W SKDVH RI GHYHORSPHQW ,Q FRPPRQ ZLWK RWKHU UHJLRQDO DLUSRUWV :DWHUIRUG KDV EHHQ VHULRXVO\ FKDOOHQJHG E\ WKH HFRQRPLF HQYLURQPHQW RYHU WKH ODVW ¿YH \HDUV EXW JRRG OHDGHUVKLS KDV EURXJKW LW WKURXJK DQG WKH RS

Top man: Desmond Oâ&#x20AC;&#x2122;Flynn SRUWXQLW\LVQRZWKHUHWRPRYH IRUZDUG´VDLG'HVPRQG ([WHQGUXQZD\ Âł, ZDV HQFRXUDJHG E\ WKH FRPPLWPHQW RI 0LQLVWHU /HR 9DUDGNDULQSURYLGLQJIXQGVWR IXUWKHU LPSURYH VDIHW\ DQG DO ORZ WKH DLUSRUW H[SORUH RSWLRQV WRH[WHQGLWVUXQZD\´KHDGGHG ,GHQWLI\LQJ VRPH RI KLV RZQ SULRULWLHV LQ WKH UROH ZKLFK KH ZLOO WDNH XS LQ PLG1RYHPEHU WKH QHZ &(2 VDLG Âł&OHDUO\ ZH QHHG WR H[SDQG WKH UDQJH RI GHVWLQDWLRQV WKDW :DWHUIRUG

LV FRQQHFWHG WR %XVLQHVV DQG OHLVXUH SDVVHQJHUV PDNH JRRG XVHRIWKHH[LVWLQJ)O\EHURXWHV WR%LUPLQJKDPDQG0DQFKHVWHU EXW WKHUH UHPDLQV FRQVLGHUDEOH GHPDQGIRUDUHVXPSWLRQRIGL UHFWVHUYLFHVWRRQHRIWKHPDLQ /RQGRQDLUSRUWV ³$VZHOODVZRUNLQJZLWKDLU OLQHSDUWQHUV,VHHDQLPSRUWDQW SDUW RI P\ UHPLW DV EHLQJ WR GULYHSURJUHVVRQWKHLQIUDVWUXF WXUHLQYHVWPHQWDWWKHDLUSRUWVR WKDWWKHIDFLOLWLHVKHUHPDWFKRXU DPELWLRQ´KHDGGHG

Advertorial

Networking, mentoring and sound advice for females WOMEN running or managing small businesses are being invited by Kilkenny County Enterprise Board to National Womenâ&#x20AC;&#x2122;s Enterprise Days, October 16 and 17 Heritage Hotel, Portlaoise. The event offers advice, networking and mentoring. Key speakers include Ramona Nicholas, Founder of Cara Pharmacy Group and RTE Dragonsâ&#x20AC;&#x2122; Den. Successful female entrepreneurs who are featured â&#x20AC;&#x2DC;Case Studiesâ&#x20AC;&#x2122; are Rosaria Piseri, AlgAran, Donegal, Mags Kirwan, Goatsbridge Trout Farm in County Kilkenny; internationally acclaimed milliner Davina Lynch, Cavan and Pauline Naughton of P and G Cards, Roscommon. Formal networking events will be held on both days with Caitlin Oâ&#x20AC;&#x2122;Connor facilitating Accelerating Performance, Networking and â&#x20AC;&#x2DC;Referral Strategiesâ&#x20AC;&#x2122; while Catherine Moonan will give advice on how to achieve the â&#x20AC;&#x2DC;Perfect Pitchâ&#x20AC;&#x2122;. Team of mentors Fiona Deegan, CEO Kilkenny County Enterprise Board said: â&#x20AC;&#x153;The Board supports female entrepreneurship and

Entrepreneurs for Enterprise Days development of micro and small businesses at local level. Whether you are thinking of starting a new business or wish to expand your existing business, the Board, can provide advice, information and guidance.â&#x20AC;? Mentors include John Clarke, brand building consultant; Ron Connell, â&#x20AC;&#x2DC;Business Doctorâ&#x20AC;&#x2122;; Margaret Daly, Consultant and Mentor; Barra Flynn, BFL Training and Development; Sandra Hennessy, Digital Marketing; Suzanne Hoey, Web Development; Gillian Horan, Business Branding; Elaine

Hyland, Business Mentor; Evan Mangan, founder Marketing Crowd; Rob Marr, founder Catalyst; Theresa Mulvihill, Marketing and Business Consultant and Yvonne Scully. Consultant. Womenâ&#x20AC;&#x2122;s days are Cofunded by the European Social Fund with support from the Department of Justice and Equality. Fee of â&#x201A;Ź100 allows half day attendance on October 16, including supper, and full day, including lunch, October 17. Booking forms from www. nwed.ie or through County Enterprise Board.


9 10 2013 KILKENNY REPORTER

ADVERTISEMENT | 7


8 | NEWS

KILKENNY REPORTER 9 10 2013

Investigations continue in the cityâ&#x20AC;&#x2122;s Vicar Street .,/.(11< &,7< &RXQFLO VXUYH\V DQG LQYHVWLJDWLRQV E\ FRQVXOWDQW DUFKDHRORJLVWV 9DO HULH-.HHOH\/WGDQGDUFKLWHF WXUDO DQG KLVWRULFDO EXLOGLQJV VSHFLDOLVW 0U 5RE *RRGERG\ DUH FRQWLQXLQJ RQ WKH JDEOH RU HQGZDOORI1R9LFDU¶V6WUHHW XQGHU OLFHQFH DQG VXSHUYLVLRQ RIWKH'HSDUWPHQWRI$UWV+HUL WDJHDQGWKH*DHOWDFKW 7KLV ZDOO LV RQ WKH OLQH RI D SODQQHG IRRWSDWK IRU WKH SUR SRVHG &HQWUDO $FFHVV 6FKHPH DQGLVSDUDOOHOWRWKHOLQHRIWKH SURSRVHGQHZVWUHHW ,Q D PDMRU XQGHUWDNLQJ DOO UHQGHU KDV EHHQ UHPRYHG IURP WKHWKUHHKRXVHVDW9LFDU6WUHHW WRHQVXUHWKDWDIXOODQGGHWDLOHG VXUYH\ZLOOLQIRUPWKHGDWLQJRI WKHVWUXFWXUHV

$W WKLV WLPH WKHUH LV QRW VXI¿FLHQW HYLGHQFH WR GH¿QL WLYHO\ GDWH WKH JDEOH ZDOO DW 1R  9LFDU¶V 6WUHHW 6XEVWDQ WLDO SRUWLRQV RI WKH ZDOO DUH PRGHUQ DQG WKH DUFKLWHFWXUDO EXLOGLQJ VXUYH\ DQG DUFKDHR ORJLFDO LQYHVWLJDWLRQV FXUUHQWO\ XQGHUZD\ZLOOLQIRUPWKLVSUR FHVV 0RYHDZD\ 7RGDWHWKHUHLVQRVXEVWDQWLYH HYLGHQFH WR VXSSRUW WKH YLHZ WKDW WKHVH UHPDLQV UHSUHVHQW D µ0DQVH +RXVH¶ IRU WKH 3UHEHQ GDU\RI7DVFRI¿Q,QGHHGDWWKLV SRLQWUHVHDUFKLQGLFDWHVDPRYH DZD\IURPWKLVWKHRU\ ,W LV FOHDU IURP WKH H[WHQW RI WKH RQJRLQJ LQYHVWLJDWLRQV EH LQJ FRQGXFWHG DW WKH VLWH WKDW WKH XWPRVW FRQVLGHUDWLRQ KDV

EHHQDQGLVDIIRUGHGWKHVHVWUXF WXUHV 7KHVWXG\FXUUHQWO\EHLQJXQ GHUWDNHQIRUWKH&RXQFLODW9LF DU6WUHHWLVDGHVLJQDWHGSURFHVV RI  LQ GHSWK UHVHDUFK VXUYH\V DQGLQYHVWLJDWLRQV 7KLVZRUNLVXQGHUOLFHQFHIURP WKH'HSDUWPHQWRI$UWV+HULWDJH DQGWKH*DHOWDFKWXQGHU0LQLVWH ULDO'LUHFWLRQDQGLQOLQHZLWK$Q %RUG3OHDQDODUHTXLUHPHQWV .LONHQQ\ &RXQW\ &RXQFLO ZLVKWRFRQWLQXHWKLVSURFHVVWR LWV FRQFOXVLRQ ZLWKLQ WKH FRQ WH[W RI RXU DOUHDG\ HVWDEOLVKHG FRPPLWPHQW WR DQG UHVSHFW RI RXU KHULWDJH LQ .LONHQQ\ &LW\ DQG&RXQW\ 7KH VWDWHPHQW ZDV LVVXHG RQ EHKDOI RI .LONHQQ\ &RXQW\ &RXQFLO

From left, Leah Dowd, Flair Beauty, Karina Gibbons, Peter Marks, Karen Morrissey, Hype Model Management, Roisin McGarry, Health Express Pharmacy

A question of style at MacDonagh 6+28/' , FKDQJH P\ VKDP SRR":KDWIRXQGDWLRQVXLWVP\ VNLQ EHVW" :KDW FRORXUV ORRN EHWWHURQPH" $W VRPH SRLQW HYHU\ JLUO KDV DVNHG WKHPVHOYHV WKHVH TXHV WLRQV %XW LW LV QRW DOZD\V HDV\ WR ¿QGWKHULJKWSHUVRQWRDVN 7KHUHZDVDWLPHZKHQVSHHG GDWLQJZDVDOOWKHUDJHZLWKXS WR  VHHNLQJ D VRXO PDWH RU VLPSO\KDYLQJIXQ ,W¶V IURP WKLV FRQFHSW WKDW 0DF'RQDJK-XQFWLRQ6KRSSLQJ &HQWUH KDV FUHDWHG DQ HYHQW WR DVVLVW ZRPHQ WR ¿QG WKH DQ VZHUVWRVW\OHTXHVWLRQV $ SDQHO RI H[SHUWV ZLOO EH DYDLODEOHIRURQHWRRQHVSHHG\

FRQVXOWDWLRQV RQ 2FWREHU  SP WR SP LQ D 9,3 DUHD RS SRVLWH=XPR 3HUVRQDOVKRSSHU.DUHQ0RU ULVVH\ZLOORIIHUDGYLFHRQKRZ WR GUHVV IRU \RXU ERG\ VKDSH %HDXWLFLDQV IURP )ODLU %HDXW\ ZLOOJLYHWLSVZKLOH+HDOWK([ SUHVV 3KDUPDF\ ZLOO GLVSHQVH NQRZOHGJH RQ KHDOWK 3HWHU 0DUNVVW\OLVWVZLOOGLYXOJHKDLU VHFUHWV *UHDWZHHNHQG 7KHUH ZLOO EH D GUDZ IRU D PDNHRYHU LQ )ODLU %HDXW\ D QHZ ORRN IURP 3HWHU 0DUNV DQGDJLIWIURP+HDOWK([SUHVV 3KDUPDF\ :LWK WKH )DVKLRQ :HHN 'LV FRXQWV LQ VWRUH IURP 2FWREHU

DQGWKH¿QDORIµ:LQ<RXU :DUGUREH¶ D JUHDW ZHHNHQG LV LQSURVSHFW 7KH µ:LQ <RXU :DUGUREH¶ ¿QDO  LV WKH ELJJHVW IDVKLRQ JLYHDZD\ VLQFH WKH VKRSSLQJ FHQWUHRSHQHG,WLVRQ2FWREHU  SP /RFDO '- 3DXO .DYD QDJK ZLOO  SURYLGH HQWHUWDLQ PHQW DV ¿QDOLVWV FRPSHWH IRU ¼ ,Q WKH ¿QDO DUH 'RORUHV 6ODW WHU\ DQG 'DZQ 'R\OH$QRWKHU ZLQQHUZLOOEHFKRVHQDWSPRQ 2FWREHU %RRNLQJV DUH WKURXJK 0DF 'RQDJK-XQFWLRQFRP VR LI \RX KDYH DQ\ VW\OHUHODWHG TXHVWLRQV PDNH VXUH WR ERRN RQOLQH


9 10 2013 KILKENNY REPORTER

ADVERTISEMENT | 9


10 | NEWS

KILKENNY REPORTER 9 10 2013

Tiger Kazzaz, aged 3, Sarah, aged 13, and Darragh Cuddihy, aged 9, swop scarves

Charity call: Doff your caps to the scarf girls! :( 6+28/' GRII RXU FDSV WR WKH /HDGEHWWHU :RPHQ RI -HUSRLQW *ODVV ZKR KDYH FRPH XSZLWKDQRYHOZD\RIKHOSLQJ FKDULW\ 7KH JLUOV DUH WR KRVW D VSH FLDOHYHQWWRUDLVHIXQGVIRUWKH 6RXWK (DVW 6LPRQ &RPPXQLW\ WKURXJKWZR6FDUI6ZRS&RIIHH 0RUQLQJV 7KH VDOHV ZLOO EH RQ 2FWREHU DQGDW-HUSRLQW*ODVV6WX GLRV6WRQH\IRUGDPWRSP HDFKGD\7KHUHZLOOEHFRPSOL PHQWDU\WHDFRIIHHDQGWUHDWV :LWK WKH 6FDUI 6ZRS WKH /HDGEHWWHUV ZLOO SUHVHQW JODVV EORZLQJ GHPRQVWUDWLRQV DQG IDPLOLHV DUH LQYLWHG WR EULQJ FKLOGUHQ ZKR ZLOO HQMR\ IUHH EDQGDQDSDLQWLQJRQGD\WZR 6FDUIORYLQJPHQDQGZRPHQ DUHDVNHGWREULQJDQXQZDQWHG VFDUI WR GRQDWH IRU WKH VDOH LQ DLG RI 6LPRQ ZKLFK SURYLGHV

YLWDOVHUYLFHVWRWKRVHDWULVNRI KRPHOHVVQHVV 7KH 6FDUI 6ZRS ZLOO UDLVH IXQGV IRU D FKDULW\ WKDW RIIHUV GURSLQ IDFLOLWLHV UHVLGHQWLDO RSSRUWXQLWLHV DQG DGYLFH LQ WKH 6RXWK(DVW 6FDUIORYHU .DWKOHHQ/HDGEHWWHULVDVFDUI ORYHU DQG WKH 6FDUI 6ZRS LGHD ZDVERUQZKHQVKHEHJDQWKLQN LQJ DERXW KRZ -HUSRLQW *ODVV FRXOGKHOSWKHFKDULW\LQDSUDF WLFDODQGIXQZD\ ³(YHU\ERG\ KDV D VFDUI WKH\ GRQ¶W ZDQW 6FDUYHV DUH DQ XQGHUVWDWHG DQG YHUVDWLOH DFFHVVRU\ ZRUQ E\ PHQ DQG ZRPHQ:HKRSHWRKDYHDYD ULHW\ RI GRQDWHG VFDUYHV´ VDLG .DWKOHHQ (YHU\\HDU6RXWK(DVW6LPRQ PXVWUDLVH¼WRFRQWLQXH WRGHOLYHUVHUYLFHVLQWKH6RXWK (DVW,Q6LPRQVXSSRUWHG

RYHUDGXOWVDQGDOPRVW FKLOGUHQ ZLWK KRXVLQJ WHQDQF\ VXVWDLQPHQW VXSSRUWV UHVHWWOH PHQW VXSSRUWV DQG DIWHUFDUH SURMHFWV 6LPRQ DOVR RIIHU OLIH VNLOOV WUDLQLQJ DQG ZHOOEHLQJ SURJUDPPHVDLPHGDWSURYLGLQJ LQIRUPDWLRQ RQ SHUVRQDO GHYHO RSPHQW DQG WHDFKLQJ FOLHQWV WR EHFRPHPRUHLQGHSHQGHQW -RH6LPSVRQRI6RXWK(DVW6L PRQVDLGKHZDVGHOLJKWHGWKDW WKH /HDGEHWWHUV ZHUH KRVWLQJ WKHHYHQW  ³'HPDQG IRU RXU VHUYLF HV FRQWLQXHV WR ULVH :H DUH YHU\ JUDWHIXO WR -HUSRLQW *ODVV IRU RUJDQLVLQJ WKLV HYHQW´ VDLG -RH  6FDUYHV FDQ EH GRQDWHG DW 6XSHUYDOX LQ 7KRPDVWRZQ DQG /RXJKER\ .LONHQQ\ &LW\ 6W &DQLFH¶V &UHGLW 8QLRQ DQG LQ &HQWUD%HQQHWWVEULGJH

Oral Irish for adults and teens $1 $57 H[KLELWLRQ µ3URJUHV VLRQV¶ E\ 2UODLWK +DPHUVOH\ LV RQ GLVSOD\ LQ )HUU\EDQN /L EUDU\ XQWLO 2FWREHU  &DOO LQ WRPHHWWKHDUWLVWRQ2FWREHU DPWRQRRQ ,ULVK &RPKUi LV WKH OLEUDU\¶V LQIRUPDODGXOWJURXSIRUµF~SOD IRFDLO¶HYHU\VHFRQG7XHVGD\DW SP

$ µ&LRUFDO *DHLOJH¶ IRU WHHQ DJHUV LV QRZ EHLQJ VHW XS ,I \RXKDYHDJUiIRUWKHODQJXDJH RU MXVW LQWHUHVWHG LQ LPSURYLQJ \RXU ,ULVK IRU \RXU RUDO H[DPV SOHDVH FRQWDFW WKH OLEUDU\ IRU PRUHLQIRUPDWLRQ)iLOWHURLPK GpDJyLUÈ&#x201C;JROHRU µ:ULWHIRUUHOHDVH¶DZHHNO\ ZULWLQJ JURXS KDV UHVWDUWHG IRU

WKHZLQWHU*RDORQJDQ\7XHV GD\DQGPDNHDVWDUWRQIXO¿OO LQJ WKDW GUHDP RI ZULWLQJ WKDW EHVWVHOOHU 'RLQJ \RXU 'ULYLQJ 7KHRU\ 7HVW" 'LG \RX NQRZ WKDW \RX FDQJRLQWRWKHOLEUDU\DQGGRD SUDFWLFHUXQEHIRUHWKHELJGD\" )RUPRUHRQDQ\HYHQWFRQWDFW WKHOLEUDU\RQ

Minister Phil gives the nod for â&#x201A;¬146,100 0,1,67(5 3KLO +RJDQ KDV JLYHQ VDQFWLRQ WR &RXQW\ .LONHQQ\ /HDGHU 3DUWQHU VKLS WR DSSURYH ¼ WR %HQQHWWVEULGJH &RPPX QLW\ 'HYHORSPHQW  IRU WKH LQWHUQDO UHGHYHORSPHQW RI WKH 2OG 6FKRRO +RXVH

EXLOGLQJ LQ WKH FHQWUH RI WKH YLOODJH 7KH UHGHYHORSPHQW ZRUNV ZLOO LQFOXGH WKH UHGHFRUDWLRQ RI H[LVWLQJ IDFLOLWLHV LQFOXGLQJ PHHWLQJURRPNLWFKHQVWDJH VWRUDJHDQGWRLOHWIDFLOLWLHVDV ZHOODVEULQJLQJWKHHOHFWULFDO

DQGKHDWLQJV\VWHPVXSWRUH TXLUHGVWDQGDUGV 7KH IXQGLQJ LV EHLQJ SUR YLGHGXQGHUWKH&RQVHUYDWLRQ DQG 8SJUDGLQJ RI WKH 5XUDO +HULWDJH PHDVXUH RI WKH 5X UDO 'HYHORSPHQW 3URJUDPPH 


9 10 2013 KILKENNY REPORTER

ADVERTISEMENT | 11


12 | NEWS

KILKENNY REPORTER 9 10 2013

John Paul pictured with St Kieranâ&#x20AC;&#x2122;s College students Conor Quinlan, David Prendergast, Cathal Oâ&#x20AC;&#x2122;Neill, Sean Mulholland, Diarmaid Hickey Pic: Dylan Vaughan

Good idea over elections may not win kidsâ&#x20AC;&#x2122; votes! $ 68**(67,21 WR KROG IXWXUH HOHFWLRQV DQG UHIHUHQGD DW ZHHN HQGV PD\ QRW ZLQ WKH YRWHV RI WKH VWXGHQW SRSXODWLRQ ZKR ORYH DGD\RII %XW LW ZRXOG HQG WKH SUDFWLFH ZKHUH RYHU  VFKRROV DUH FORVHG HYHU\ WLPH RXU SHRSOH JR WRWKHSROOV 'HSXW\ -RKQ 3DXO 3KHODQ VD\V WKH FORVXUH RI VFKRROV IRU )ULGD\¶V UHIHUHQGD ZDV D UHPLQGHU RI WKH QHHG WR KROGSROOVRQ6DWXUGD\VDQG6XQ GD\V  ³7KH UHODWLYHO\ ORZ WXUQRXW LV DQRWKHU FDVXDOW\ RI ZHHN GD\ SROOLQJ´ VD\V WKH 6RXWK .LONHQ Q\EDVHG'iLO'HSXW\

+H VD\V WKDW DV D UHVXOW RI SXSLOV EHLQJ JLYHQ D GD\ RII ZRUNLQJ SDUHQWV KDYH WR PDNH DUUDQJHPHQWV IRU FKLOGFDUH D FRQVLGHUDEOH H[ SHQVH ³6RPH  SULPDU\ DQG  VHFRQGDU\ VFKRROV ZHUH XVHG DV SROOLQJVWDWLRQVLQWKHUHIHUHQGXP RQ WKH 6WDELOLW\ 7UHDW\ LQ  7KLV LQWHUUXSWHG WXLWLRQ IRU KXQ GUHGVRIWKRXVDQGVRISXSLOV 1RWVDWLVIDFWRU\ ³(DFK VFKRRO GD\ ORVW PXVW EH PDGH XS GXULQJ WKH VFKRRO \HDU 7KLVLVQRWVDWLVIDFWRU\DQGPLWL JDWHVDJDLQVWHIIHFWLYHSODQQLQJ´ KHFRQWLQXHV ³$VFHQDULRFRXOGDULVHZKHUHLI

WKHUHZHUHPXOWLSOHSROOVVFKRROV PLJKWQRWEHDEOHWRPDNHXSIRU GD\V ORVW DV KDSSHQHG GXULQJ D IRRWDQGPRXWKRXWEUHDN´ $QGKHVD\VZHHNGD\SROOVDOVR LPSDFWRQORFDOVHUYLFHVDVPDQ\ ZKR PDQ SROOLQJ VWDWLRQV DQG FRXQW FHQWUHV DUH ORFDO DXWKRULW\ VWDII ³,W LV UHJUHWIXO WKDW WKH KROGLQJ RISROOVGXULQJWKHZHHNLPSDFWV RQWKHZRUNRIWHDFKHUVDQGORFDO DXWKRULW\ VWDII DQG LW LV WKH WD[ SD\HUZKRIRRWVWKHELOO´KHDGGV -RKQ3DXOSODQVWRUDLVHWKHPDW WHULQWKH'iLO 7KHNLGVRI,UHODQGZKRDOZD\V ORYHDGD\RIIZLOOQRGRXEWNHHS DFORVHH\HRQWKDWRQH

HG WR EH D SURIHVVLRQDO F\FOLVW WKHQ D PXVLFLDQ EXW D ODFN RI WDOHQW LQ WKHVH DUHDV PHDQW WKDW KH EHFDPH D WHOHPDUNHWHU DVNLQJ WKHP WR UDWH WKLQJV RXW RI +HPRYHGWRFRPHG\DQGELQ JRKHKLWWKHMDFNSRW 'RQ¶WPLVVKLP

7ZRKLJ&KDUWHUHG7D[&RQVXO WDQW %UHQGDQ LV 7D[ 3DUWQHU ZLWK 0.%UD]LODQGDQDWLYHRI3LO WRZQ 7KH SUHVHQWDWLRQ ZLOO H[DPLQHWKHPDLQDVSHFWVIURP %XGJHW  DQG WKH LPSOLFD WLRQV IRU LQGLYLGXDOV DQG EXVL QHVVHV 7KHUHZLOODOVREHD4 $VHV VLRQ 'DWH LV :HGQHVGD\ 2F WREHU  SP WR SP 3LOWRZQ &RPPXQLW\&HQWUH 3ODFHV DUH OLPLWHG VR SOHDVH ERRNRQZHEVLWHRUSKRQH 

Reporter Briefs Bingo: Comedy is his forte +(,6DQDPD]LQJO\IXQQ\PDQ DQG KH LV RQ KLV ZD\ EDFN WR .LONHQQ\ 'DYLG 2¶'RKHUW\ WKH 5\ DQDLU -DPHV %RQG WKH .HYLQ 0F&ORXG RI WKH WLQ\ NH\ERDUG UHFLSLHQWRIWKH(GLQEXUJK &RPHG\ $ZDUG KDV ZULWWHQ D QHZFRPHG\VKRZ +H EULQJV LW WR7KH 6HW -RKQ 6WUHHWRQ2FWREHUDQGWLFNHWV DUHQRZRQVDOH +H LV D FRPHGLDQ ZKR ZDQW

Budget briefing in Piltown 3,/72:1 &RPPXQLW\ (Q WHUSULVH LV WR KROG D %XGJHW %ULH¿QJSUHVHQWHGE\%UHQGDQ


9 10 2013 KILKENNY REPORTER

ADVERTISEMENT | 13


14 | NEWS

KILKENNY REPORTER 9 10 2013

Recently deceased... Local man died in Waterford -$0(6 /(,*+ SLF WXUHG RI %DOO\OLQH &DOODQ &RXQW\ .LONHQQ\ DQG 7UDPRUH&RXQ W\ :DWHUIRUG KDV SDVVHG DZD\ DW :D WHUIRUG 5H JLRQDO +RVSL WDO +LV UHPDLQV ZHUH UHPRYHG IURP 0ROOR\¶V )XQHUDO +RPH &DOODQ WR WKH &KXUFK RI WKH $VVXPSWLRQ &DO ODQ DQG EXULDO ZDV DW .LOEULGH&HPHWHU\ +H LV VXUYLYHG E\ KLV ZLIH $QQH VRQ .HYLQ GDXJK WHU -DQHW VRQLQODZ )UDQN GDXJKWHULQODZ -RODQWD JUDQG FKLOGUHQ 'RPLQLF (PLOLD ,VDEHO )UDQN )LOLS EURWKHUV LQODZ VLVWHULQODZ QLHFHV QHSKHZVUHODWLYHVDQGH[WHQGHG IDPLO\

John Furlong 7KH GHDWK KDV RFFXUUHG RI -RKQ)XUORQJ6PLWKVWRZQ7XO ORJKHU&RXQW\.LONHQQ\

+LV UHPDLQV ZHUH UHPRYHG WR 6W 'DYLG¶V &KXUFK /LVWHU OLQ DQG EXULDO ZDV DW DGMRLQLQJ FHPHWHU\

EHIRUH UHPRYDO WR 6W 1LFKR ODV¶V&KXUFK:LQGJDS&RXQW\ .LONHQQ\%XULDOZDVDWDGMRLQ LQJFHPHWHU\

Bobby Bibby Jack Maher 7KH GHDWK KDV RF FXUUHG RI %REE\ %LEE\ 6W 0DU\¶V 3ODFH .LONHQQ\ &LW\ $IWHUUHSRVLQJDW -RKQVWRQ¶V )XQHU DO+RPHUHPDLQV ZHUH UHPRYHG WR (QQLVQDJ &KXUFK IRUIXQHUDOVHUYLFH ,QWHUPHQW ZDV DW DGMRLQLQJ FKXUFK \DUG

Raimie Foran 5DLPLH)RUDQ$UGHUD0RRQ FRLQ &RXQW\ .LONHQQ\ ZDV EXULHG DW 7KH 2OG &HPHWHU\ 0RRQFRLQ5HSRVLQJZDVDWKLV FRXVLQ:DWWLH)RUDQ¶VKRPH

Kathleen Oâ&#x20AC;&#x2122;Driscoll .DWKOHHQ 2¶'ULVFROO +DU ULVWRZQ 0XOOLQDYDW &RXQW\ .LONHQQ\ ZKR KDV GLHG ZDV D PHPEHURIWKH5\DQIDPLO\ 5HSRVLQJ ZDV DW 2¶'Z\HU¶V )XQHUDO +RPH &DUULFNRQ6XLU

7KH GHDWK KDV RFFXUUHG LQ *UDQDUG /RQJIRUG 7RZQ RI -DFN0DKHUIRUPHUO\RI.LOPR JDQQ\&RXQW\.LONHQQ\ +H LV VXUYLYHG E\ KLV ZLIH $QQH GDXJKWHUV .DWKOHHQ DQG 6DUDKVLVWHU$QQHEURWKHUVLQ ODZVLVWHULQODZQLHFHVQHSK HZVDQGRWKHUUHODWLYHV 5HPDLQV ZHUH UHPRYHG WR 6W 0DU\¶V&KXUFK1HZWRZQIRUEHV DQGEXULDOZDVDW%DOO\FRUPDFN &HPHWHU\

Eily Murphy (LO\0XUSK\%DOO\UHGG\7XO ORJKHU &RXQW\ .LONHQQ\ ZKR KDV GLHG ZDV D PHPEHU RI WKH )LW]JHUDOGIDPLO\ 6KH LV VXUYLYHG E\ KHU ZLIH 3KLOO\ FKLOGUHQ $OLFH 'RGLH -RKQ DQG 6KHPP\ EURWKHUV -DFN 3DW DQG 'LFN DOVR 7RP )LW]JHUDOG VRQVLQODZ -RKQ DQG &KDUOLH GDXJKWHUVLQODZ -RDQ DQG 1HOO JUDQGFKLOGUHQ VLVWHUVLQODZ DQG RWKHU UHOD WLYHV 5HPDLQV ZHUH UHPRYHG WR 6W 'DYLG¶V &KXUFK /LVWHUOLQ DQG EXULDO ZDV DW DGMRLQLQJ FHP HWHU\

Rosaleen Fitzgerald 5RVDOHHQ )LW]JHUDOG &DVKHO 3LOWRZQ&RXQW\.LONHQQ\ZDV DPHPEHURIWKH&RZDQIDPLO\ 5HPDLQV ZHUH UHPRYHG WR .LOQDVSLF &KXUFK DQG EXULDO ZDVDWDGMRLQLQJFHPHWHU\

Patrick Ryan 7KH GHDWK RFFXUUHG DW KLV KRPHRI3DWULFN5\DQ0DGGR[ WRZQ.LONHQQ\ 5HPDLQV ZHUH UHPRYHG WR 6W &ROPDQ¶V &KXUFK &ODUD DQG EXULDOZDVDWDGMRLQLQJFHPHWHU\

+XUOHUSOD\HG IRUWZRFRXQWLHV $ KXUOHU ZKR KDV SDVVHG DZD\ SOD\HG DW VHQLRU OHYHO IRU KLV QDWLYH .LONHQQ\ DQGIRUQHLJKERXULQJ:D WHUIRUG 0LFKDHO :DOVK SLF WXUHG RI 1HZSRUW 6TXDUH :DWHUIRUG DQG IRUPHUO\ RI 6OLHYHUXH LQ 6RXWK .LONHQQ\ SOD\HG ZLWK .LONHQQ\ LQWKH$OO,UHODQG¿QDOV RIDQGDQGKH ZHQWRQDVDVXEIRU:D WHUIRUGLQWKH¿QDORI +HZDVSRSXODUO\NQRZQDV 0LFKDHOµ%URZOH\¶:DOVK

+LV UHPDLQV ZHUH UHPRYHG IURP 7KRPSVRQ¶V )XQHUDO +RPH %DUUDFN 6WUHHW :DWHU IRUG WR %DOO\EULFNHQ &KXUFK DQG EXULDO ZDV DW 6W 0DU\¶V &HPHWHU\%DOO\JXQQHU

DW &RDG\¶V )XQHUDO +RPH &DVWOHFRPHU )ROORZLQJ 0DVV DW WKH &KXUFK RI WKH ,PPDFX ODWH &RQFHSWLRQ &DVWOHFRPHU EXULDO ZDV DW DGMRLQLQJ FHP HWHU\

Patricia McGuinness

Anne Gaule

7KH GHDWK KDV RFFXUUHG RI 3DWULFLD 0F*XLQQHVV 3UDJXH +RXVH )UHVKIRUG 2¶%ULHQ¶V *DUGHQV &DVWOHFRPHUDQG 0R YLOOH'RQHJDO 6KH ZDV SUHGHFHDVHG E\ KHU KXVEDQG 5RELQ DQG GDXJKWHU 0DHYH 6KH LV VXUYLYHG E\ KHU VRQ 3DXO GDXJKWHU 5RLVLQO VLVWHUV 5RLVLQ 2¶'RQQHOO .LONHQQ\ &DUPHO 0F'RQDJK :DWHUIRUG EURWKHU 5D\PRQG (VVH[ JUDQGFKLOGUHQ .HUUL 5\DQ -D]PLQ &RQ UDG DQG 6DP VRQ LQODZ3DXO GDXJKWHU L Q  O D Z & D U R O H  EURWKHUVLQ ODZ VLVWHUV LQODZQHSK HZV QLHFHV DQG RWKHU UHOD WLYHV 5HPDLQVUHSRVHG

7KHGHDWKKDVRFFXUUHGRI$QQ *DXOH %DOOLQHUOD .LOPDFRZ D PHPEHU RI WKH +HQQHEU\ IDP LO\5HPDLQVZHUHUHPRYHGWR6W 6HQDQ¶V &KXUFK DQG EXULDO ZDV DWDGMRLQLQJFHPHWHU\

PJ Brett 3- %UHWW %UDQGRQ &UHV FHQW *UDLJQDPDQDJK &RXQW\ .LONHQQ\ZDVEXULHGDW&DOYDU\ &HPHWHU\ *UDLJQDPDQDJK DI WHU 5HTXLHP 0DVV DW 'XLVNH $EEH\

Marie Oâ&#x20AC;&#x2122;Farrell 0DULH 2¶)DUUHOO $\OHVEXU\ .LONHQQ\ZDVDPHPEHURIWKH 0F'HUPRWIDPLO\ 6KHLVVXUYLYHGE\KHUKXVEDQG 0LFKDHOVRQ'HFODQGDXJKWHU LQODZ JUDQGFKLOGUHQ EURWKHUV VLVWHUV EURWKHUVLQODZ VLVWHUV LQODZ QLHFHV QHSKHZV DQG RWKHUUHODWLYHV %XULDO ZDV DW )RXONVWRZQ &HPHWHU\ IROORZLQJ 5HTXLHP 0DVV LQ WKH DGMRLQLQJ )RXON VWRZQ&KXUFK More obits Page 108


9 10 2013 KILKENNY REPORTER

ADVERTISEMENT | 15


16 | NEWS

KILKENNY REPORTER 9 10 2013

Our future

Gung ho: Our proud city shows bottle in the battle to create jobs JIMMY RHATIGAN JIMMYRHATIGAN@ GMAIL.COM

$1$0%,7,286 \HDU SODQ WR EULQJ MREV WR RXU FLW\ DQG FRXQW\ZDVODXQFKHGDW&RXQW\ +DOORQ0RQGD\ 7KH SURMHFW LV WR ERRVW HP SOR\PHQW KHUH ZLWK D .QRZO HGJH DQG %XVLQHVV 4XDUWHU LQ .LONHQQ\ &LW\ ZKLFK SURPRW HUV EHOLHYH ZLOO SRVLWLRQ RXU FLW\DVDSULPHLQYHVWPHQWORFD WLRQ 7KHEDWWOHWREULQJVMREVKHUH LVEHLQJVSHDUKHDGHGE\&RXQW\ 0DQDJHU-RH&URFNHWWZKRVDLG PDQ\ RI WKH EHVW ORFDWLRQV LQ 'XEOLQ KDYH QRZ EHHQ XWLOLVHG E\ PDMRU FRPSDQLHV VXFK DV *RRJOH 7ZLWWHU DQG )DFHERRN DQG .LONHQQ\ &LW\ FHQWUH QRZ RIIHUVDSHUIHFWDOWHUQDWLYH +H VDLG ZH KDYH D FRVPR SROLWDQ EHDXWLIXO DQG DYDLODEOH ORFDWLRQ DW D YHU\ FRPSHWLWLYH SULFHIRUWKHFRUSRUDWHDQGFUH DWLYHVHFWRUV +H DGGHG WKDW WKH FRPELQD WLRQ RI UG OHYHO IDFLOLWLHV ZLWK DOO WKH DWWUDFWLRQV RI .LONHQQ\ &LW\FHQWUHDQGZLWKPRWRUZD\

FRQQHFWLYLW\ ZDV DQ H[FHSWLRQ DOO\ DWWUDFWLYH SURSRVLWLRQ IRU LQFRPLQJ IRUHLJQ GLUHFW LQYHVW PHQW &DSDFLW\IRUMREV 7KH SODQ LQFOXGHV D SURSRVDO IRU D WKLUG OHYHO FDPSXV DQG D QHZULYHUVLGHFLW\FHQWUHSDUN 7KH NQRZOHGJH DQG EXVLQHVV TXDUWHU LV WR EH GHYHORSHG RQ WKHDFUH6PLWFKZLFN¶V%UHZ HU\VLWHDQDUHDRIVWUDWHJLFDQG KLVWRULFDOLPSRUWDQFH  7KH GHYHORSPHQW ZLOO GULYH PDMRU FLW\ FHQWUH UHQHZDO DQG ZLOOEHVHUYLFHGE\WKHSURSRVHG QHZ &HQWUDO $FFHVV 6FKHPH ZKLFK KDV EHHQ JUDQWHG SODQ QLQJ SHUPLVVLRQ E\ $Q %RUG 3OHDQDOD 7KH QHZ FHQWUH ZLOO SURYLGH VLJQL¿FDQWRI¿FHVSDFHRQDVLWH DORQJ WKH EDQNV RI WKH 5LYHU 1RUH RYHUORRNLQJ .LONHQQ\ &DVWOH ZLWK WKH FDSDFLW\ IRU PDQ\ MREV .LONHQQ\ %RURXJK DQG &RXQFLOORUV ZHUH WROG DW D PHHWLQJ 7KHTXDUWHUZLOOLQFOXGH  2I¿FH DFFRPPRGDWLRQ IRU FRUSRUDWHFUHDWLYHDQGWHFKQRO RJ\FRPSDQLHV  6SDFH IRU UHVLGHQWLDO DQG UHWDLOXVH  $ QHZ UG OHYHO UHVHDUFK DQG GHYHORSPHQW FDPSXV IRU WKH SODQQHG QHZ 7HFKQRORJLFDO

Driving force: City and County Manager Joe Crockett 8QLYHUVLW\RIWKH6RXWK(DVW PHQWFDPSXV  )LYH QHZ DUHDV RI SXEOLF ,WLVDKXEIRUQH[WJHQHUDWLRQ UHDOP LQWHUQHW GHYHORSPHQW IRU FRP  $ PDMRU QHZ FLW\ FHQWUH SDQLHV LQ WKH ¿QDQFH EDQNLQJ JDUGHQSDUN RI LQWHUQDWLRQDO LQVXUDQFHDQGDJULEXVLQHVVVHF VWDQGDUG WRUV DQG ZDV HVWDEOLVKHG DW 6W 7KHVXFFHVVIXO766*$UF/DE .LHUDQ¶V&ROOHJHODVW\HDU,WKDV IDFLOLW\ 7HOHFRPV 6RIWZDUH UHVHDUFKHUV DQG6\VWHP*URXS DMRLQWYHQ .LONHQQ\ ORFDO DXWKRULWLHV WXUH EHWZHHQ WKH .LONHQQ\ /R ERXJKWWKHDFUH6PLWKZLFN¶V FDO $XWKRULWLHV :DWHUIRUG DQG %UHZHU\ VLWH IURP 'LDJHR IRU &DUORZ ,QVWLWXWH  RI 7HFKQROR ¼PLOOLRQODVW\HDU JLHVZLOOEHORFDWHGWRWKHQHZ 'LDJHR PRYHV WKH 6PLWK UGOHYHOUHVHDUFKDQGGHYHORS ZLFN¶V EUHZLQJ RSHUDWLRQ IURP

.LONHQQ\WR'XEOLQDWWKHHQGRI WKLV\HDUDIWHU\HDUVLQWKH FLW\7KH\DUHGHYHORSLQJD¼P 9LVLWRU&HQWUHRQWKHVLWHGXHWR RSHQLQ 0DVWHUSODQ $ PDVWHU SODQ SUHSDUHG E\ DUFKLWHFW 7RQ\ 5HGG\ ZDV SUH VHQWHGWRSXEOLFUHSUHVHQWDWLYHV 7RQ\ VDLG WKH 6PLWKZLFNV VLWH SUHVHQWV .LONHQQ\ ZLWK D XQLTXHRSSRUWXQLW\DPRQJ,ULVK DQG (XURSHDQ FLWLHV WR FUHDWH D PRGHUQ LQWHUYHQWLRQ DGMRLQ

LQJ LWV PHGLHYDO FRUH ZKLFK ZLOO HQKDQFH LWV FXOWXUDO KHUL WDJH LPSURYH LWV VXVWDLQDELOLW\ DQGHQDEOHLWWRFRPSHWHLQWKH NQRZOHGJHHFRQRP\RIWKHVW FHQWXU\ 0D\RU 0DUWLQ %UHWW  VDLG WKH H[FLWLQJ QHZ LQLWLDWLYH KDV WKH FDSDFLW\ WR UHJHQHUDWH DQG UHQHZ WKH FHQWUH RI .LONHQQ\ DQG GHOLYHU PDMRU HFRQRPLF JURZWK ³7KLVLVWKHPRVWH[FLWLQJDQG WKH PRVW LPSRUWDQW HFRQRPLF GHYHORSPHQW LQLWLDWLYH LQ P\ OLIHWLPH .LONHQQ\ &LW\ &HQWUH IDPRXV IRU LWV FDIHV KHULWDJH VKRSSLQJ DQG DV D JUHDW WRXULVW ORFDWLRQ ZLOO QRZ SURYLGH WKH SHUIHFW ORFDWLRQ IRU WKH FRUSR UDWH NQRZOHGJH DQG FUHDWLYH VHFWRU´KHDGGHG &RXQW\ &RXQFLO 3DW 'XQSK\ VDLGZLWKXQHPSOR\PHQWDW LQWKH6RXWK(DVWLWLVLPSRUWDQW WKDW PDMRU QHZ DWWUDFWLYH ORFD WLRQV RXWVLGH RI 'XEOLQ VKRXOG EH SURYLGHG IRU IRUHLJQ GLUHFW DQGQDWLRQDOLQYHVWPHQW ,QYHVW.LONHQQ\KLJKOLJKWVWKH FLW\¶V FRQQHFWLYLW\ ZLWK H[FHO OHQW URDG DLU DQG UDLO WUDQVSRUW OLQNV,WDOVRKLJKOLJKWV.LONHQ Q\¶V ULFK FXOWXUH DQG KHULWDJH DQG TXDOLW\ RI OLIH D EHDXWLIXO SODFHWROLYHZLWKDKLJKO\HGX FDWHGZRUNIRUFH


NEWS | 17

9 10 2013 KILKENNY REPORTER

Gillian and Fiona: Girls of grit

Brave horse women get The Reporter vote! JIMMY RHATIGAN JIMMYRHATIGAN@GMAIL.COM

7:2 '$5,1* \RXQJ ZRPHQ ZKR FOLS FORSSHG WKHLU ZD\ WR )ULGD\ YRWLQJ RQ WKH EDFNV RI WZR HOHJDQW KRUVHV HQG LQ D SKRWR¿QLVKLQWRGD\¶V.LONHQQ\ 5HSRUWHU $QG DV WKH KRUVH ZRPHQ LQ IXOOUHJDOLDDQGWKHLUH[FHOOHQWO\ JURRPHG DQLPDOV VDXQWHUHG DFURVV FRXQWU\ WKHUH ZDV QR QHHGIRUDSDUW\ZKLS *LOOLDQ+HQQHVV\ZLWKDUDWK

HUDSWKRPHDGGUHVV7KH5DFH FRXUVH .HOOV 5RDG .LONHQQ\ ZDV UHVSOHQGHQW RQ D KRUVH FDOOHG6WDQOH\ $QG DV ZRXOG EH H[SHFWHG )LRQD 'DOWRQ RI )LRQD¶V %DU EHUV :DONLQ 6WUHHW .LONHQQ\ ZDV D FXW DERYH WKH UHVW RQ ERDUG%RQR 7KH JLUOV HVWLPDWHG WKDW WKHLU )ULGD\ PRUQLQJ URDG ULGH ZDV DERXWRQHDQGDKDOIPLOHVDQG WKH\ HQMR\HG HYHU\ PLQXWH RI WKHLUQRYHOMRXUQH\WRWKHORFDO SROOLQJERRWK

7KH\ KDFNHG XS IURP &XIIHV JUDQJH 6SRUW +RUVHV <DUG WR &XIHVJUDQJH 1DWLRQDO 6FKRRO ZKHUH*LOOLDQYRWHGLQWKH6HDQDG DQG&RXUWRI$SSHDOUHIHUHQGD *HWWLQJDNLFN 6KH HQMR\HG WKH VXSSRUW DQG FRPSDQ\ RI KHU IULHQG )LRQD ZKRZHQWDORQJµIRUWKHFUDLF¶ ³,WZDVDQHQMR\DEOHMRXUQH\RQ KRUVHEDFN´)LRQDVDLG ³,W ZDV D ORYHO\ IUHVK PRUQ LQJDQGDVZHOODVJHWWLQJDNLFN RXWRIWKHQRYHOW\YRWLQJWULSZH VDYHG RXUVHOYHV PRQH\ :LWK

WKH FRVW RI GLHVHO WRGD\ WUDYHO OLQJE\KRUVHPDNHVUHDOVHQVH %XW LW ZDV JUHDW IXQ WRR´ VKH DGGHG %RWK JLUOV DUH PHPEHUV RI 7DFN +DFN&OXELQWKHORFDO LW\DFOXEZKLFKZDVIRUPHGLQ E\DJURXSRISHRSOHZLWK D FRPPRQ ORYH RI DOO WKLQJV HTXLQH 0HPEHUV RI WKH FOXE HQMR\ KRUVHULGLQJDQGWKH\DOVRPDNH DJHQHURXVFRQWULEXWLRQWRWKHLU ORFDOFRPPXQLW\7KH\UXQWKUHH VSRQVRUHGULGHVD\HDUERRVWLQJ

WKH IXQGV RI ORFDO FKDULWLHV 7R GDWHWKH\KDYHFROOHFWHGDQGGR QDWHG¼ 1RLQWHUHVW ,Q FRPPRQ ZLWK PDQ\ RI RXU ORFDO SROLWLFLDQV %RQR DQG 6WDQOH\WRRNOLWWOHRUQRLQWHUHVW LQWKHYRWLQJ %XW WKH\ GLVSOD\HG DGPLUDEOH FKLYDOU\ DQG DSORPE DQG SXW WKHLU EHVW IRRW VRUU\ KRRI IRU ZDUGDVWKH\FDUULHGWZRKDSS\ JROXFN\ JLUOV WR H[HUFLVH WKH IUDQFKLVH :KHWKHU RU QRW *LOOLDQ ZDV

RQ D ZLQQHU ZH VLPSO\ GRQ¶W NQRZEHFDXVHLWLVQRQHRIRXU EXVLQHVVKRZVKHYRWHG %XW ZH GR NQRZ WKDW OR FDOV ZKR VSRWWHG WKH JLUOV RQ WKHLU YRWLQJ WULS JDYH WKHP WKH WKXPEV XS DV WKH SDLU JDOORSHG WR ZKDW PLJKW EH WHUPHG WKH ¿UVW HYHU 3ROOLQJ %RRWK *UDQG 1DWLRQDOLQWKHORFDOLW\ 1RGRXEWWKHKRUVH¶VWDOHZLOO JHWOHJVLQWKHWHOOLQJ7KHJLUOV PD\ KDYH XQZLWWLQJO\ WURWWHG WKHLUZD\LQWRWKHSDJHVRIOHJ HQGV

Our solicitors are gone to pot! JIMMY RHATIGAN JIMMYRHATIGAN@GMAIL.COM

)520 7+( FRXUWURRP WR WKH NLWFKHQZLOOEHWKHORWRIORFDO OHJDOHDJOHVDVWKH\WDNHRQWKH DXFWLRQHHULQJIUDWHUQLW\LQZKDW SURPLVHV WR EH D KHDWHG FRRN HU\EDWWOH 3RWVDQGSDQVZLOOEHSURPL QHQW LQ ZKDW SURPLVHV WR EH D KLJKOLJKWRIWKH6DYRXU.LONHQ Q\)RRG)HVWLYDO $QG WKH UHVXOW RI D Ã&#x20AC;DPLQJ EDWWOHFRXOGPHDQµDORW¶WRWKH ZLQQHUV $W ERLOLQJ SRLQW ZLOO EH VR OLFLWRUV (PHU )ROH\ DQG 7LP .LHO\ ZKLOH DXFWLRQHHUV $QG\ 2¶.HHIIH DQG (G 'RQRKRH

DUH KDSS\ WKDW WKH\ FDQ SXW WKHLURSSRQHQWVXQGHUWKHKDP PHU 7KH ¿JKWHUV VRUU\ FRRNV URRNLH FKHIV RU ZKDWHYHU WKH\ DUH ZLOO VKDUSHQ WKHLU NQLYHV DQG UXVWOH XS D PHDO IURP D EDVNHWRIXQNQRZQLQJUHGLHQWV $EUDYHPDQ 7KH\ZLOOEHMXGJHGE\$QQH 1HDU\ 5\HODQG +RXVH &RRN HU\6FKRRODQG%UHGD0F'RQ DOGFKDPSLRQEXWWHUPDNHUDQG IRUPHU ,&$ .LONHQQ\ )HGHUD WLRQ3UHVLGHQW 79¶VFHOHEULW\FKHI(GZDUG +D\GHQZLOOUHIHUHH $EUDYHPDQLQGHHG $XFWLRQHHUV¶ PHQWRU ZLOO EH 0DULD5DIWHU\KHDGFKHI=XQL

5HVWDXUDQW 0DVWHUFKHI ¿QDOLVW &ODUH$QQ2¶.HHIIHZLOOJXLGH WKHVROLFLWRUV 7KH QRYHO HYHQW LV DW WKH &KHI¶V 7DEOH 0DUTXHH RQ 2F WREHUSP 7KHVROLFLWRUVDQGDXFWLRQHHUV ZLOO EH WKH FORVLQJ DFW DW WKH SRSXODU &KHI¶V 7DEOH DV LW UH WXUQVWRWKHKHDUWRIWKH6DYRXU 0DUNHWRQWKH3DUDGH 7KH &KHI¶V7DEOH ZLOO KRVW D IHDVWRIWDOHQWIURP\RXUIDYRX ULWH 6DYRXU UHVWDXUDQWV DV ZHOO DVDPL[RIQDWLRQDODQGLQWHU QDWLRQDOFKHIV 0HDQZKLOH.LONHQQ\LVJHDU LQJ XS IRU WKH WDVWLHVW IRRG IHVWLYDO HYHU RYHU WKH 2FWREHU Friends in food?: From left, auctioneers Ed Donohoe and Andy Oâ&#x20AC;&#x2122;Keeffe, with solicitors Tim Kiely, Poe, Kiely, Hogan, Lanigan and Emer Foley, Reidy, Foley %DQN+ROLGD\ZHHNHQG


18 | NEWS

KILKENNY REPORTER 9 10 2013

Over 8,000 in prison: A â&#x20AC;&#x2DC;fineâ&#x20AC;&#x2122; state of affair In the Oireachtas

By Tim Ryan Oireachtas Correspondent 7+()$&7WKDWODVW\HDURYHU  SHRSOH UHFHLYHG VRPH IRUP RI SULVRQ VHQWHQFH LQ UH VSHFW RI WKH QRQSD\PHQW RI ¿QHV LV TXLWH VWDUWOLQJ 'HSXW\ -RKQ3DXO3KHODQWROGWKH'iLO 6SHDNLQJRQDQHZ)LQHV%LOO KHVDLGKHZDVVXUHDOOPHPEHUV DUHRIWKHYLHZWKDWSHRSOHZKR GR QRW SD\ ¿QHV ZKHWKHU E\ FKRLFH RU EHFDXVH WKH\ FDQQRW DIIRUG WR VKRXOG QRW HQG XS LQ SULVRQ DQG WKDW DWWDFKPHQW RI HDUQLQJVDQGFRPPXQLW\VHUYLFH RUGHUVRIIHUDPXFKPRUHHIIHF WLYHZD\RIHQVXULQJMXVWLFH ³, ZLVK WR IRFXV RQ FRPPX QLW\ VHUYLFH RUGHUV ZKLFK DUH LPSRVHG LQ D YHU\ KDSKD]DUG ZD\´ KH VDLG ³,Q VRPH DUHDV VLJQL¿FDQWO\ PRUH RI WKHVH RU GHUVDUHSXWLQSODFHWKDQLVWKH FDVHHOVHZKHUH´ 'HSXW\3KHODQVDLGKHDJUHHG

John Paul Phelan ZLWK 'HSXW\ 'DYLG 6WDQWRQ¶V FRPPHQWV RQ WKH SRVVLELOLW\ RI GHGXFWLRQV IURP VRFLDO ZHO IDUHSD\PHQWVLQSDUWLFXODUIRU VPDOOHU ¿QHV DOWKRXJK LW LV D FRQWURYHUVLDODUHD ³7KH 'HSDUWPHQW RI 6RFLDO 3URWHFWLRQ LV LQ D SRVLWLRQ WR ORRN IRU PRQH\ EDFN ZKHQ RYHUSD\PHQWV DUH PDGH´ KH

Phil Hogan VDLG³$VPDOOFRQWULEXWLRQRYHU DORQJSHULRGRIWLPHWRHQVXUH VRPHERG\ GRHV QRW HQG XS LQ SULVRQVKRXOGKDSSHQ ³)DLOLQJWKDWDPRUHHIIHFWLYH FRPPXQLW\VHUYLFHRUGHUUHJLPH VKRXOGHQVXUHVXFKSHRSOHQHYHU HQGXSLQSULVRQ´KHDGGHG +RJDQRQJUDI¿WL $1287/,1(RIWKHPHWKRGV

WR WDFNOH WKH JURZLQJ SUREOHP RI JUDI¿WL LQ XUEDQ DUHDV ZDV JLYHQ WR WKH 'iLO E\ 0LQLVWHU 3KLO+RJDQ 3KLO VDLG XQGHU WKH /LWWHU 3ROOXWLRQ $FWV  WR  WKH SULPDU\ UHVSRQVLELOLW\ IRU PDQDJHPHQW DQG HQIRUFHPHQW UHVSRQVHVWROLWWHUSROOXWLRQLQ FOXGLQJWKHGHIDFHPHQWRIVWUXF

WXUHVE\ZULWLQJRURWKHUPDUNV OLHVZLWKORFDODXWKRULWLHV ³7KDW LQFOXGHV JUDI¿WL´ KH VDLG ³7KH UROH RI P\ 'HSDUW PHQW LV WR SURYLGH WKH OHJLVOD WLYH IUDPHZRUN ZLWKLQ ZKLFK ORFDO DXWKRULWLHV FDQ SHUIRUP WKLV WDVN ,W LV D PDWWHU IRU HDFK ORFDO DXWKRULW\ WR GHFLGH RQ WKH PRVW DSSURSULDWH

SXEOLF DZDUHQHVV DQG FOHDQXS DFWLRQV ³(DFKORFDODXWKRULW\PXVWGH WHUPLQHWKHOHYHORIH[SHQGLWXUH RQLQGLYLGXDOORFDOVHUYLFHVEXW , ZRXOG KRSH LQ WKH FRQWH[W RI WKH DQQXDO HVWLPDWHV SURFHVV WKDW WKH\ ZRXOG SULRULWLVH WKH HOLPLQDWLRQRIJUDI¿WL´ 5HPHGLDODFWLRQ +H VDLG 6HFWLRQ  LV D FRP SOHPHQWDU\ SURYLVLRQ WKDW HQ DEOHV D ORFDO DXWKRULW\ LQ WKH LQWHUHVWVRIDPHQLW\RUWKHHQYL URQPHQWWRWDNHUHPHGLDODFWLRQ LQUHODWLRQWRJUDI¿WLUHJDUGOHVV RI ZKHWKHU LW KDV EHHQ SXW XS ZLWKWKHFRQVHQWRIWKHRZQHURU RFFXSLHU ³7KH ORFDO DXWKRULW\ PD\ VHUYH D QRWLFH RQ WKH RFFXSLHU UHTXLULQJ VWHSV WR EH WDNHQ WR UHPRYH RU RWKHUZLVH UHPHG\ GHIDFHPHQW ZLWKLQ D VSHFL¿HG SHULRG RI QRW OHVV WKDQ VHYHQ GD\V´KHVDLG³)DLOXUHWRFRP SO\ ZLWK D QRWLFH LV DQ RIIHQFH DQG LQ VXFK LQVWDQFH WKH ORFDO DXWKRULW\PD\JLYHHIIHFWWRWKH QRWLFHDQGUHFRYHUFRVWV´ 7KH SHQDOWLHV DWWDFKLQJ WR OLW WHULQJ DQG JUDI¿WL RIIHQFHV DUH VXEVWDQWLDO DQG LQFOXGH DQ RQ WKHVSRW¿QHRI¼KHDGGHG 7KH 3URWHFWLRQ RI WKH (QYLURQ PHQW$FWLQWURGXFHGFRQ YLFWLRQ RQ LQGLFWPHQW IRU OLWWHU DQG JUDI¿WL RIIHQFHV ZLWK D PD[LPXP¿QHRI¼DQG VHW WKH PD[LPXP ¿QH RQ VXP PDU\FRQYLFWLRQDW¼


9 10 2013 KILKENNY REPORTER

ADVERTISEMENT | 19

DUBLIN Tel: 01 639 2966 www.conservatoryconversionsireland.com


&

Opinion Comment Mary Lou struck blow for women in politics

7

+( 6($1$' GHEDWH RQ 79 RQ WKH :HGQHVGD\ EHIRUH 5HIHUHQGD )ULGD\ ZDV DQ H\H RSHQHU %UDYLQJ DQ LQHYLWDEOH ZDU RI ZRUGV LQ D GHEDWH FKDLUHG E\ MRXUQDOLVW9LQFHQW%URZQHZDV DWULRRIPHQDQGRQHZRPDQ 6WDQGXSJLUOVDQGFKHHUWKHPHPEHURIWKHIDLU VH[ZRQDQ\KRQRXUVE\WKHSURYHUELDOPLOH 0DU\/RX0F'RQDOGVWUXFNDEORZIRUZRPHQ LQSROLWLFV$ORQJZLWKDUDWKHUQHUYRXVDQGVRPH WLPHVXQFRPIRUWDEOH5LFKDUG%UXWRQRI)LQH*DHO VKHDUJXHGIRUWKHFORVXUHRIWKH6HDQDG ,QWKHRSSRVLWHFRUQHUZHUH)LDQQD)DLO/HDGHU 0LFKHiO 0DUWLQ DQG IRUPHU 0LQLVWHU IRU -XVWLFH 0LFKDHO0F'RZHOO7KHGHEDWHODVWHGIRURYHUDQ KRXU,WZDVLQWHUHVWLQJJRWDELWKHDWHGZKLFKLV WREHH[SHFWHGEXWQHYHUUHDOO\JRWERULQJ

â&#x20AC;&#x153;

ON A SCORE OF 7-5 OUT OF A POSSIBLE 10 POINTS, THE DEBATERS FOR KEEPING THE SEANAD MAY HAVE SHADED IT, BUT MARY LOU WAS WELL AHEAD IN ANY INDIVIDUAL CONTEST AS SHE LEFT THE THREE WISE MEN TRAILING BY AS MUCH AS THREE OR EVEN FOUR POINTS

7KHVZHHWWDONLQJ0 0V0LFKHiODQG0LFKDHO HQVXUHGWKDW7KH\ZHUHWKDWELWPRUHFRQYLQFLQJ WKDQ WKHLU RSSRQHQWV PDLQO\ EHFDXVH 5LFKDUG %UXWRQZDVZHDNZKHQWU\LQJWRGHIHQGZK\(QGD GLGQRWPDNHKLPVHOIDYDLODEOHIRUGHEDWH 2QDVFRUHRIRXWRIDSRVVLEOHSRLQWVWKH GHEDWHUVIRUNHHSLQJWKH6HDQDGPD\KDYHVKDGHG LWEXW0DU\/RXZDVZHOODKHDGLQDQ\LQGLYLGXDO FRQWHVWDVVKHOHIWWKHWKUHHZLVHPHQWUDLOLQJE\DV PXFKDVWKUHHRUHYHQIRXUSRLQWV %XWZHVKRXOGUHVSHFWDOOIRXURIWKHSDUWLFLSDQWV

,

JIMMY RHATIGAN DVWKH\KDGWKHERWWOHWRJREHIRUHWKHFDPHUDV 8QIRUWXQDWHO\ZHFDQQRWVD\WKHVDPHIRU7DR LVHDFK(QGD:KHUHSHRSOHVWDQGRQKLVVWDQFHQRW WRGHEDWHZLOOGHSHQGRQZKDWVLGHRIWKHSROLWLFDO GLYLGHWKH\¿QGWKHPVHOYHV%XWLWVKRXOGEHVDLG WKDWKDYLQJOHGWKHFKDUJHWRJHWULGRIWKH6HDQDG (QGDVKRXOGKDYHGRQHRXUSHRSOHWKHFRXUWHV\RI WHOOLQJWKHPZK\KHZDVVRDGDPDQW %XWEDFNWR0DU\/RX3HUKDSVWKHIDFWWKDWVKH ZDV DW WKH KHDW RI D PDOHGRPLQDWHG EDWWOH PD\ KDYHZRQKHUVRPHIULHQGV%XWWKHUHZDVPXFK PRUHWRKHUSHUIRUPDQFHWKDQWKDW 6KH GHEDWHG ZLWK JRRG PDQQHUV WKURXJKRXW QHYHU JRW RYHU H[FLWHG WRRN VZLSHV RQ WKH FKLQ DQGERXQFHGEDFNQHYHUVKRXWLQJRUKDUDQJXLQJ $VDUHVXOWVKHJRWKHUSRLQWDFURVVPXFKEHWWHU WKDQWKHPDOHSDUWLFLSDQWVZKRZHUHSURQHWRUHDFW ZLWK DQJU\ YHUEDOV SDUWLFXODUO\ ZKHQ &LYLO :DU SROLWLFVUDLVHGLWVXJO\KHDG 2QHVXVSHFWVWKDW0DU\/RXZRQWKHWLWOHRIWKH GDUOLQJ RI WKH GHEDWH DQ DFFRODGH ZKLFK ZRXOG SUREDEO\QRWVLWFRPIRUWDEO\RQWKHKHDGVRIWKH RWKHUV :H DUH FRQVWDQWO\ UHPLQGHG WKDW HYHU\WKLQJ LV EHLQJ GRQH WR DWWUDFW PRUH ZRPHQ LQWR SROLWLFV :KDW LV EHLQJ GRQH RU LQGHHG QRW EHLQJ GRQH ZH VLPSO\ GRQ¶W NQRZ EXW ZH GR NQRZ WKDW0DU\¶VKRXURUVRRQWKHWHOO\ZLWK9LQFHQW %PD\QRWRQO\ZRUNZRQGHUVIRU6LQQ)pLQEXW FRXOGDOVRVSDUNDFDOOWRDUPVE\WKHZRPHQRI ,UHODQG :H PD\ EH H[DJJHUDWLQJ RYHU UHDFWLQJ HYHQ EXWRXUEHOLHILVWKDW0/ZLOOHYHQWXDOO\VLWFRP IRUWDEO\LQ*HUU\$GDPVVHDWLQ6)DQGVKHPD\ LQGHHG¿QGKHUVHOIFOLPELQJWKHODGGHURISRZHU VKRXOG6)HYHU¿QGLWVHOILQJRYHUQPHQW +HUSHUIRUPDQFHZDVWKDWJRRGFRQYLQFLQJDQG ZDUP 0HDQZKLOH DV ZH SRLQWHG RXW WKH SUHYLRXV ZHHNRXURZQSUL]HSRQLHVZHUHFRQVSLFXRXVE\ WKHLUDEVHQFHLQWKHUXQXSWRWKH6HDQDGDQG6SH FLDO&RXUWRI$SSHDO5HIHUHQGXPV 7KH\GLGWKHPVHOYHVQRIDYRXUV$PDMRULW\RI RXUSXEOLFUHSUHVHQWDWLYHVSHUKDSVHYHQWKHPDOO EHKDYHGDVLI2FWREHU5HIHUHQGXP'D\GLGQ¶W HYHQH[LVW :KDW D SLW\ WKH\ KDG WKH RSSRUWXQLW\ WR VKRZ WKDW WKH\ FDUH DERXW ZKDW RXU SHRSOH VKRXOG EH FDULQJDERXWEXWLQVWHDGWKH\FKRVHWRUHPLQGXV WKDWLIWKHUHLVQRWVRPHWKLQJLQLWIRUWKHPWKHQLW GRHVQ¶W¿JXUHLQWKHLUGLDULHV 7KH\FRXOGKDYHPDGHHYHQWRNHQDSSHDUDQFHV WRDVNRXUSHRSOHWRYRWHRQHZD\RUDQRWKHU7KH\ GLGQ¶W7KH\JDYHXVWKHWZR¿QJHUVKLJKOLJKW LQJWKHUHVSHFWRUUDWKHUODFNRILWLQZKLFKWKH\ KROGWKHSHRSOHZKRYRWHWKHPLQWRSRZHU 1RWDGRRUEHOOZDVUXQJRUDNQRFNHUNQRFNHG DUHOLHIQRGRXEWWRPDQ\DQJU\FRQVWLWXHQWV%XW RQHZRQGHUVKRZORFDOUHSUHVHQWDWLYHVFDQH[SHFW WR JHW UHVSHFW ZKHQ WKH\ GRQ¶W VKRZ UHVSHFW IRU RWKHUV :H KDYH FRQVWDQWO\ UHPLQGHG WKDW UHVSHFW LV D WZRZD\ VWUHHW ,Q WKH VWUHHWV RI .LONHQQ\ LQ WKH UXQXSWRWKHUHIHUHQGDWKHUHZHUHQRVLJKWLQJVRI ORFDOSXEOLFUHSUHVHQWDWLYHV 7KDWLVDVKDPHDQGDQLQVXOW

Russian Roulette is a dangerous game to play

â&#x20AC;&#x153;

LATE NIGHT LUNACY ON WHEELS, EXCESSIVE SPEEDING AND WILD STUNTS ON LOCAL ROADS, THE SCREECHING OF BRAKES AND THE REVELLING ROARS OF YOUNG PARTICIPANTS, LEADS TO SLEEPLESS NIGHTS

7,6DFUD]\JDPHLQZKLFKWKHUHFDQ EH QR ZLQQHUV 7KH SUREOHP RI ER\ UDFHUV LQ RXU FRXQW\ WRZQ RI &DOODQ LV ZRUU\LQJ $V KLJKOLJKWHG RQ 3DJH  WRGD\ ORFDOV DUH IULJKWHQHG WKDW VRPHRQH ZLOO EH EDGO\ LQMXUHG RU ZRUVHLQDPDGURDGIRUPRI5XVVLDQ 5RXOHWWH 7KH\ IUHW WRR EHFDXVH WKH\ IHDU IRU WKH \RXQJ PHQWRZKRPWKH\KDYHQRSUREOHPGHOLYHULQJD WRQJXHODVKLQJEXWWKH\GRQRWZDQWWRVHHWKHP KXUWLQJWKHPVHOYHVEHFDXVHRIPDGQHVVRQZKHHOV $QDFFLGHQWKLJKOLJKWHGE\D&DOODQUHVLGHQW LQZKLFKDWOHDVWRQHUDFHUZDVOXFN\WRHVFDSH VHULRXV LQMXU\ LV D PHUH WDVWH RI ZKDW D FRQ FHUQHG ORFDO UHVLGHQW FDOOV µDQ DFFLGHQW ZDLWLQJ WRKDSSHQ¶ 7RGD\ZHDSSHDOWRWKHPHQZKRDUHSXWWLQJ WKHPVHOYHVDQGRWKHUVDWULVNLQWKHLUSXUVXLWRI µNLFNV¶WRGHVLVWLQWKHQDPHRIFRPPRQVHQVH LQGHHGFRPPRQGHFHQF\ :HNQRZORFDOSHRSOHIHDUWKHZRUVW /DWHQLJKWOXQDF\RQZKHHOVH[FHVVLYHVSHHG LQJDQGZLOGVWXQWVRQORFDOURDGVWKHVFUHHFK LQJ RI EUDNHV DQG WKH UHYHOOLQJ URDUV RI \RXQJ SDUWLFLSDQWVOHDGVWRVOHHSOHVVQLJKWV 7KH DQWLFV FDQ DOVR OHDG WR DQ $FFLGHQW  (PHUJHQF\ 'HSDUWPHQW )DPLO\ GHVSDLU LQ D PRUWXDU\WRUPHQWVWKHPLQGVRIPDQ\DVGDQJHU OXUNV SHULORXVO\ FORVH IURP WXUQLQJ D QRUPDOO\ SHDFHIXOWRZQLQWRDYDOHRIWHDUV <RXQJPHQFDQWKULYHRQDGYHQWXUHEXWZKHQ GDQJHURXVDQWLFVSXWOLYHVDWULVNWKHQWKHUHLVQR RWKHURSWLRQEXWWRFU\KDOW 2XUZLVKLVWKDWWKHVH\RXQJPHQZLOOVHHUHD VRQVWRSEHIRUHWKH\UXLQWKHLURZQOLYHVRUWKH OLYHVRIRWKHUV 7KHUH DUH ORWV RI RWKHU KHDOWK\ DQG VHQVLEOH ZD\V RI JHWWLQJ NLFNV RXW RI OLIH 3XFNLQJ RU NLFNLQJDEDOOFDQEHH[FHOOHQWRSWLRQVDQGDKHOO RIDORWVDIHUWRR±IRUHYHU\RQH

Endaâ&#x20AC;&#x2122;s own goal! ','(QGD.HQQ\VFRUHDQRZQJRDOZKHQKHGLG DVRORUXQRIVRUWVE\DVNLQJRXUSHRSOHWRFORVH WKH6HDQDG" 7KDWZLOOEHRQHRIVHYHUDOSHUWLQHQWSRVHUVDWD SRVWPRUWHPLQWRWKHVKRFNUHVXOWLQWKH6HDQDG 5HIHUHQGXP <HVLWGLG¿QLVKDVDµ1R¶EXWQRWHYHQWKHXVX DOO\VKUHZGERRNPDNHUVFRXOGVHHWKDWRQHFRP LQJ:KHUHGRHVWKDWOHDYHWKHRSLQLRQSROOV" $VZHNQRZWKHEHVWPDGHSODQVRIPLFHDQG PHQ FDQ HQG LQ D GLVDVWURXV SLOH :KHQ WKRVH SODQV DUH VRPHZKDW DLU\ IDLU\ WKHQ WKH ORVHUV¶ GUHVVLQJURRPEHFNRQV 2XUKXQFKLVWKDW(QGDPD\UHJUHWQRWDFFHSW LQJDQLQYLWDWLRQWRGHEDWHWKH6HDQDG5HIHUHQ GXP$IWHUDOOKHZDVKRVWLQJWKHSDUW\DQGLWLV KDUGO\SROLWHZKHQWKHKRVWGRHVQ¶WWXUQXS 7KHUHZLOOEHVRXOVHDUFKLQJLQ)LQH*DHO6LQQ )pLQZLOODVNWKHPVHOYHVZK\WKH\GLGQ¶WIROORZ WKH RULJLQDO URXWH VXJJHVWHG E\ *HUU\ $GDPV 7KH/DERXU3DUW\ZDVVRPHZKDWORZNH\ )LDQQD)iLOZLOOFODLPDYLFWRU\%XWWKH\KDYH DORWPRUHPDWFKHVWRZLQEHIRUHWKH\DUHFKDP SLRQVDJDLQ )DLUSOD\WRWKHVHQDWRUVZKRIRXJKWWKHLUFRU QHU ZLWK WKH IHURFLW\ RI ZRXQGHG DQLPDOV %XW WKHUHDONXGRVJRWRRXUSHRSOHZKRVHQWRXWD FOHDUPHVVDJH0HVVZLWKXVDW\RXUSHULO :HDZDLWWKHQH[WPRYHIURPRXUSROLWLFLDQV 7KDWZLOOEHLQWHUHVWLQJ


9 10 2013 KILKENNY REPORTER

ADVERTISEMENT | 21


22 | NEWS

KILKENNY REPORTER 9 10 2013

A crash scene: Boy racers court injury, or worse

A brush with death as boy racers urged to stop JIMMY RHATIGAN JIMMYRHATIGAN@GMAIL.COM

$ &$5 GULYLQJ DW KLJK VSHHG ORVWFRQWURORQWKHEULGJHVWUXFN DQ (6% VXSSO\ XQLW DQG RYHU WXUQHG 7KH VSHDNHU ZDV D &DOODQ &RXQW\.LONHQQ\UHVLGHQWZKR WROG 7KH 5HSRUWHU RI WKH LQFL GHQWWKHORFDOVDLGµWRKLJKOLJKW DSUREOHPRIµER\UDFHUV¶LQWKH WRZQ ³7KDQN *RG QRERG\ ZDV NLOOHG´WKHUHVLGHQWDGGHG

³7UDJHG\ ZDV RQO\ QDUURZO\ DYHUWHGRQWKHQLJKWRI6HSWHP EHU8QIRUWXQDWHO\LWLVRIWHQ WKHFDVHWKDWRQO\ZKHQWUDJHG\ VWULNHV GR SHRSOH UHDOO\ VLW XS DQGWDNHQRWLFH´WKHFRQFHUQHG ORFDODGGHG 7KH LQFLGHQW ZDV ZDLWLQJ WR KDSSHQ7KH 5HSRUWHU KDV EHHQ WROG ³)RU WKH SDVW \HDU DQG D KDOI JDQJV RI \RXWKV KDYH EHHQ XV LQJWKHVWUHHWVRI&DOODQDQGWKH E\SDVV DURXQG WKH WRZQ DV DQ LPSURYLVHGUDFHWUDFN

6FUHHFKLQJRIFDUV ³7KH ZHHNHQGV LQ SDUWLFXODU FDQ EH DQ DEVROXWH QLJKWPDUH HVSHFLDOO\ DW QLJKW ZKHQ \RX KHDUWKHVFUHHFKLQJRIFDUVRXW VLGH RQ WKH VWUHHW DQG WKH IUHQ ]LHG KRZOLQJ RI WKH GULYHUV´ VDLG WKH ORFDO LQ D OHWWHU WR 7KH 5HSRUWHU 7KH OHWWHU LV VLJQHG DQG FDU ULHV DQ DGGUHVV EXW WKH ZULWHU UHPDLQVDQRQ\PRXVIRUREYLRXV UHDVRQV ³8SWRDGR]HQFDUVDWDWLPH FRPSHWHLQWKHVHFUD]\UXQVXS

DQG GRZQ WKH VWUHHWV <RX FDQ KHDUWKHGULYHUVVFUHDPLQJFKDO OHQJHV DQG REVFHQLWLHV DW HDFK RWKHU HDFK GDULQJ WKH RWKHU WR RXWUDFH WKHP´ WKH OHWWHU FRQ WLQXHV ³, ZDV KRUUL¿HG WR VHH RQH RI WKHVH PLVJXLGHG \RXQJ VWHUV VZLJJLQJ IURP ZKDW ORRNHGOLNHDQDJJLQRIZKLVNH\ DV KH GURYH +H ZDV KRZOLQJ VRPH JLEEHULVK WKDW , FRXOGQ¶W PDNHRXW 0DMRUWUDJHG\ ³7KH VSHHGV DW ZKLFK WKHVH

WUDYHODUHSKHQRPHQDO,WZRXOG DOOUHPLQG\RXRIWKHELJUDOOLHV VKRZQRQWHOHYLVLRQH[FHSWWKDW WKLVµUDFLQJ¶LVRXWVLGHRXUIURQW GRRUV ³/DWH QLJKW ZDONHUV RU SHRSOH UHWXUQLQJ IURP SDUWLHV RUHPHUJLQJIURPSXEVKDYHWR WKLQNDQGPRYHIDVWWRDYRLGEH LQJUXQRYHU,IWKLVVLWXDWLRQLV DOORZHG WR FRQWLQXH ZH FRXOG VRRQ KDYH D PDMRU WUDJHG\ RQ RXUKDQGV´ 7KH ZULWHU GHVFULEHV WKH DF FLGHQW DW %ULGJH 6WUHHW DV D

ZDNH XS FDOO $ FDOO KDV JRQH RXWWRSURYLGHVSHHGUDPSVLP PHGLDWHO\ RQ *UHHQ 6WUHHW DQG %ULGJH 6WUHHW µWR DYRLG WKH XQ WKLQNDEOH¶ ³'R ZH KDYH WR ZDLW XQWLO VRPHRQH KDV GLHG RU EHHQ KRU ULEO\ LQMXUHG EHIRUH ZH VHH WKH UDPSVLQVWDOOHG" ³7KLVKDVEHFRPHDPDWWHURI OLIH DQG GHDWK´ VD\V WKH UHVL GHQW ³:K\ VKRXOG WKHVH LUUH VSRQVLEOHGULYHUVEHDOORZHGWR KROGRXUWRZQWRUDQVRP"´WKH PLVVLYHFRQFOXGHV

Victims of their own excess â&#x20AC;&#x201C; Review of Mr Loverman by Bernardine Evaristo By Rhiannon Jones 05 /29(50$1 DND %DU ULQJWRQµ%DUU\¶-HELGLDK:DONHU LVD\HDUROG$QWLJXDQ :KHQZHPHHWKLPKHLVOLYLQJ LQ+DFNQH\DKXVEDQGDIDWKHU D JUDQGIDWKHU DQG D VXFFHVVIXO EXVLQHVVPDQ ZKR KDV EHHQ LQ D VHFUHW UHODWLRQVKLS ZLWK KLV FKLOGKRRG IULHQG 0RUULV VLQFH WKH\ZHUH ,W TXLFNO\ EHFRPHV DSSDUHQW WKDW QRQH RI WKH FKDUDFWHUV DUH KDSS\ $V WKH VWRU\ XQIROGV LW

EHFRPHV FOHDU WKDW ZKDW PRVW RIWKHPKDYHLQFRPPRQLVWKH IHHOLQJ WKDW WKH\ DUH YLFWLPV RI WKHLU FLUFXPVWDQFHV EURXJKW DERXW E\ WKHLU QHHG WR GR ZKDW WKH\EHOLHYHLVULJKWUDWKHUWKDQ ZKDWZRXOGDFWXDOO\PDNHWKHP KDSS\ 7KH VWRU\ LV QDUUDWHG LQ WKH SUHVHQWGD\E\%DUU\DQGLQWHU VSHUVHG ZLWK FKDSWHUV IURP WKH SDVWEHLQJZRUGHGE\&DUPHO¶V SRHWLFLQQHUGLDORJXH 7KLV ZRUNHG YHU\ ZHOO WR HV WDEOLVK WKH SHUVRQDOLW\ RI WKH WZR FKDUDFWHUV DQG SURYLGH D EDFNJURXQGDVWRKRZWKH\KDG DUULYHGLQWKHLUFXUUHQWVLWXDWLRQ %HUQDUGLQH (YDULVWR EHJDQ

KHU FDUHHU DV D SRHW ZLWK VRPH SUHYLRXVQRYHOVEHLQJZULWWHQLQ YHUVHDQGWKLVFRPHVWKURXJKLQ &DUPHO¶VFKDSWHUV 7KH FULWLFDO %DUU\ ZKR LV LQ GHQLDO DERXW KLV RZQ IDLO LQJV DORQJ ZLWK KLV VH[XDO LW\ KH FDOOV KLPVHOI D µ%DUU\ VH[XDO¶  DQG WKH *RGIHDULQJ IUXPS\&DUPHODUHMRLQHGLQWKH VWRU\ E\ WKHLU WZR XQKDSS\ GDXJKWHUV 6LQJOHPXP 'RQQDLVDVLQJOHPXPZLWKD ORQJ OLVW RI XQUHDOLVWLF TXDOLWLHV WKDWVKHWKDWLVORRNLQJIRULQD IXWXUHSDUWQHU7KHVSRLOHGIDVK LRQLVWD 0D[LQH LV GHVSHUDWHO\ WU\LQJWRVWD\WKLQDQGXQZLOOLQJ

WRJURZXSDQGDGPLWWKDWVKH¶V LQKHUV 7KH RQO\ FKDUDFWHU LQ WKH ERRN ZKR GRHV QRW IHHO YLFWL PLVHG EXW SUREDEO\ VKRXOG  LV WKH OLNHDEOH 0RUULV RU 8QFOH 0RUULVDVKH¶VNQRZQWR%DUU\¶V IDPLO\ +H FRPHV DFURVV DV WKH PRVW VWDEOH RI WKH FKDUDFWHUV DQG DO WKRXJK KH¶V SUHVHQW WKURXJK PRVW RI WKH ERRN KH LV YHU\ PXFK D VHFRQGDU\ FKDUDFWHU ,W ZRXOGKDYHEHHQLQWHUHVWLQJIRU KLPWRKDYHEHHQUHSUHVHQWHGLQ WKHERRNDVPXFKDV&DUPHODQG WRKDYHNQRZQPRUHDERXWZKDW KHZDVWKLQNLQJ 2YHUDOOWKLVZDVDQHQMR\DEOH

G ERRN ZLWK VRPH XQH[SHFWHG SDUWV±ZDWFKRXWIRUWKHFKDSWHU HU DERXW&DUPHO¶VWLPHDW+DFNQH\ \ &RXQFLO 0\ RQH FULWLFLVP ZRXOG EH OH WKDWWKHHQGLQJLVQRWEHOLHYDEOH H LQWKDWLWLVWRRQHDWDQGGH¿QLWH O\ QRW GHVHUYHG E\ WKH PRVW RI WKHFKDUDFWHUV %RUG *iLV (QHUJ\ %RRN &OXE E OO LV FDOOLQJ RQ ERRN ORYHUV DOO U RYHU ,UHODQG WR YRWH IRU WKHLU Z IDYRXULWH ERRNVKRS DW ZZZ O %*(ERRNVKRSRIWKH\HDULH XQWLO 2FWREHU   9RWHUV FDQ ZLQ JUHDW SUL]HV LQFOXGLQJ ERRN KDPSHUV L3DGV DQG D WULS WR WKH %RUG *iLV (QHUJ\ ,ULVK %RRN$ZDUGVRQ1RYHPEHU

Letters to the Editor Wheelchairs are not comfortable! 6LU :KLOHYLVLWLQJDUHODWLYHDW

6W/XNH¶V*HQHUDO+RVSLWDO .LONHQQ\LWZDVKHDUWZDUP LQJWRVHHWKHIDQWDVWLFFDUH EHLQJJLYHQDQGZRUN EHLQJGRQHE\QXUVHVDQG RWKHUVWDII

%XW,DOVRQRWLFHGWKDWWKHUH ZDVDVKRUWDJHRIZKHHO FKDLUVDQGWKDWVRPHRIWKH ZKHHOFKDLUVLQXVHDUHLQEDG FRQGLWLRQ 6XUHO\ZKHHOFKDLUVVKRXOG

EHDSULRULW\IDFLOLW\LQD KRVSLWDO &DQ,SRVHWKHTXHVWLRQ &RXOGZHIXQGUDLVHWRSUR YLGHVRPHZKHHOFKDLUVIRU6W /XNH¶VWKHUHE\KHOSLQJWKH

SDWLHQWVDQGPDNLQJ OLIHDOLWWOHELWPRUH EHDUDEOHIRUWKHKDUG ZRUNLQJVWDIIZKRLW VHHPVDUHH[SHFWHGWR ZRUNZLWKFKDLUVWKDWDUH

RXWGDWHGDQGKDUGO\¿WIRU SXUSRVH" <RXUVHWF $QQH5\DQ .LONHQQ\&LW\


9 10 2013 KILKENNY REPORTER

ADVERTISEMENT | 23


24 | NEWS

KILKENNY REPORTER 9 10 2013

Our Miriam edits hospice masterpiece /2&$/  MRXUQDOLVW DQG PHGLD FRQVXOWDQW0LULDP'RQRKRHKDV HGLWHGDQHZ,ULVK+RVSLFH)RXQ GDWLRQERRNµ7KH*DWKHULQJ±5H ÀHFWLRQVRQ,UHODQG¶ ,WIHDWXUHVVWRULHVIURP*DWKHU LQJ HYHQWV DQG DQ LQVSLULQJ FRO OHFWLRQ RI UHÀHFWLRQV RQ ,UHODQG IURPLQÀXHQWLDOLQGLYLGXDOV &RQWULEXWRUV LQFOXGH WKH ODWH 6HDPXV +HDQH\ %RQR 0R\D 'RKHUW\ %ULDQ 2¶'ULVFROO DQG 1LDOO2¶'RZG 7KH SDJH IXOO FRORXU KDUGEDFN ERRN WKDW FHOHEUDWHV D\HDULQWKHOLIHRIDQDWLRQDQG KHU SHRSOH  DW KRPH DQG DEURDG ZDVODXQFKHGE\7DRLVHDFK(QGD .HQQ\ 7KH ERRN H[DPLQHV ZKDW LW PHDQVWREH,ULVKWKURXJKDVHULHV RI WKRXJKWIXO DQG WKRXJKWSUR YRNLQJUHÀHFWLRQV %HDXWLIXOO\ GHVLJQHG E\ 6WHYH $YHULOO RI $03 9LVXDO LQWHU QDWLRQDOO\ DFFODLPHG IRU KLV DZDUGZLQQLQJ ZRUN ZLWK 8 WKH ERRN FRQWDLQV  UHÀHFWLRQV DQG*DWKHULQJHYHQWVFDSWXUHG WKURXJKQDUUDWLYHRUSKRWRJUDSKV +DUSHUIDPLO\ $PRQJWKH.LONHQQ\*DWKHULQJ HYHQWVLVWKH+DUSHUIDPLO\*DWK HULQJZKLFKVDZGHVFHQGDQWV DW .LONHQQ\ &ROOHJH GXULQJ WKH VXPPHU 7KH ,ULVK +RVSLFH )RXQGDWLRQ KRSHVWRUDLVHRYHU¼IURP WKH VDOH RI WKH ERRN ZKLFK ZLOO

At the book launch were contributors Moya Doherty, Riverdance, former GAA commentator Michael Ó Muircheartaigh and editor Miriam Donohoe

From left, Irish Hospice Foundation CEO, Sharon Foley, Chair of the Irish Hospice Foundation Board Jean McKiernan, Taoiseach Enda Kenny, Miriam Donohoe and book project director Miriam with her family, Catherine Murray, John Murray and Stephen Murray Anne Marie Taylor. VOH\DQG'U3DW:DOODFH EHXVHGWRVXSSRUWLWVZRUNSDU :RQGHUIXOPHPHQWR WLFXODUO\LWVDFWLYLWLHVLQKRVSLWDOV 0LULDP'RQRKRH*RUHVEULGJH ZKHUH QHDUO\ RQH LQ WZR SHRSOH RZQHURI0'0HGLDVDLGLWZDV GLHLQ,UHODQGHDFK\HDU ZRQGHUIXO WR EH LQYROYHG ZLWK /($',1*,ULVK '¶DUWHDQG6HPSUH PH]]RE\9HUGL  )XQGV ZLOO EH LQYHVWHG LQ WKH µ7KH *DWKHULQJ ± 5HÀHFWLRQV VRSUDQR5HJLQD1D OLEHUDE\9HUGLDQG 6W&DQLFH¶V6HQLRU SLRQHHULQJ µ'HVLJQ  'LJQLW\¶ RQ ,UHODQG¶ DQG WR H[SHULHQFH WKDQUHWXUQVWR6DLQW 4XDQGRP¶HQYRE\ 2UFKHVWUDFRQGXFWHG SURMHFW ZKLFK DLPV WR LPSURYH SHRSOH¶V JHQHURVLW\ RI VSLULW LQ &DQLFH¶V&DWKHGUDO 3XFFLQLDVZHOODV E\5XWK2¶/HDU\ WKHSK\VLFDOLQIUDVWUXFWXUHRIKRV VKDULQJWKHLUVWRULHVWKHLUSKRWR .LONHQQ\WRSHUIRUP IDYRXWLWHK\PQV RSHQ6DWXUGD\¶V SLWDOV JUDSKV DQG WKHLU SHUVSHFWLYHV RQ VDFUHGFODVVLFVDQG 0DNH0HD&KDQQHO 2FWREHUSP &XUUHQWO\WKHSURMHFWLVIXQGLQJ ,UHODQG RSHUDWLFDULDVDV RI<RXU3HDFH3DQLV FRQFHUWZLWKDVHOHF DEHUHDYHPHQWURRPLQIDQWYLHZ ³7KHUH LV PXFK WR PDNH \RX SDUWRI3DWURQDO'D\ $QJHOLFXVDQG$YH WLRQIURPWKHLUOLYHO\ LQJURRPDWWKHPDWHUQLW\ZDUGDW WKLQNVPLOHDQGVRPHWLPHVODXJK FHOHEUDWLRQV 0DULD DQGDZDUGZLQQLQJ RXU6W/XNH¶V*HQHUDO+RVSLWDO RXW ORXG :H EHOLHYH WKDW LW ZLOO 6XSSRUWHGE\ 7KH0LFKDHO-RKQ UHSHUWRLUH 2WKHUFRQWULEXWRUVDUH7RP$U EH D ZRQGHUIXO PHPHQWR RI WKLV WKH0LFKDHO-RKQ &KDPEHU2UFKHVWUD 7LFNHWV¼ QROG 3DXOLQH %HZLFN 'U 3DGG\ QDWLRQDO \HDUORQJ FHOHEUDWLRQ RI &KDPEHU2UFKHV ZLOODOVRSHUIRUP 6SHFLDOJURXSGLV %RODQG-RKQ*HRJKHJDQ/RUHWWD ,UHODQGDQGZLOOEHWUHDVXUHG´ WUDDQG6W&DQLFH¶V VRPHIDYRXULWHFODV FRXQWRI¼SHUWLFN %UHQQDQ *OXFNVPDQ )HUJDO .H  7KH ERRN DYDLODEOH LQ DOO OR 6HQLRU2UFKHVWUD VLFRUFKHVWUDOSLHFHV HWIRUJURXSVRI¿YHRU DQH 'HFODQ .LEHUG 3HDUVH DQG FDOERRNVKRSVLVUHWDLOLQJDW¼ 5HJLQDZLOOSHUIRUP LQFOXGLQJ7KH$UULYDO PRUH%RRNLQJZZZ 'HLUGUH /\RQV %ULGJHW 0HJDU 6SRQVRUV DUH &,( 7RXUV *OHQ DVHOHFWLRQRIRSHUDWLF RIWKH4XHHQRI6KHED UHJLQDQDWKDQFRPRU U\ 7LP 2¶&RQQRU 0LFKHiO Ï 'LPSOH[ ,QYHVWHF ,ULVK )HUULHV 0XLUFKHDUWDLJK 6LPRQH 5RFKD .30* DQG 3RZHUV ,ULVK :KLV DULDVVXFKDV9LVVL E\+DQGHODQG,QWHU  3DW6KRUWW.DWLH7D\ORU2UOD7LQ NH\

Sacred classics at St Canice’s Cathedral Regina Nathan


NEWS | 25

9 10 2013 KILKENNY REPORTER

Tasty, rewarding: Cup cakes and apple tarts )520 FDUHIXOO\ GHFRUDWHG FXS FDNHV WR WUDGLWLRQDO DSSOH WDUWV WKH IUHVK WKLQNLQJ \RXQJ SUR GXFHUV RI WRPRUURZ DUH LQYLWHG WRVKRZFDVHDQGVHOOWKHLUKRPH PDGHSURGXFHLQDEX]]LQJPDU NHW HQYLURQPHQW DW :RUNKRXVH 6TXDUH0DF'RQDJK-XQFWLRQ 7KLVHYHQWRQ2FWREHUKDV EHHQ D KLJKOLJKW RI WKH 6DYRXU .LONHQQ\ )RRG )HVWLYDO IRU VRPH \HDUV 7KLV ZDV WKH ¿UVW

\RXQJSURGXFHUV¶PDUNHWLQ,UH ODQG DQG LWV VXFFHVV KDV EHHQ UHPDUNDEOH $IWHU DWWHQGLQJ D IRRG K\ JLHQH SUHVHQWDWLRQ HQWHUSULVLQJ \RXQJDGXOWVZLOOXVHWKHLUFUH DWLYLW\DQGÃ&#x20AC;DLUWREDNHGLVSOD\ DQGVHOOWKHLUNHHQO\SULFHGSUR GXFH ,W LV RSHQ WR DOO VFKRRO FKLO GUHQ WDEOHV DQG VWDQGV ZLOO EH SURYLGHG WKH\ RQO\ QHHG WR

EULQJ WKHLU SURGXFWV IRU VDOH SODWHVDQGWDEOHFORWKV 7KHSDUWLFLSDWLRQIHHLV¼SHU SHUVRQ $OO LQFRPH IURP VDOHV LV SRFNHWHG E\ WKH HQWHUSULVLQJ SDUWLFLSDQWV (QWU\ IRUPV DUH DYDLODEOH IURP WKH LQIRUPDWLRQ GHVN LQ 0DF'RQDJK -XQFWLRQ RU FDQ EH GRZQORDGHG IURP ZZZVD YRXUNLONHQQ\FRP &ORVLQJ GDWH IRUHQWULHVLV2FWREHU

Green competition will have our primary schools going for a song! .,/.(11< /RFDO $XWKRUL WLHVKDVODXQFKHGDVRQJFRP SHWLWLRQ IRU SULPDU\ VFKRROV FDOOHG(FR)DFWRU ,W¶V DQ RSSRUWXQLW\ IRU SUL PDU\VFKRROVWRFUHDWHDVRQJ WRUHPLQGRIKRZWROLYHLQDQ HQYLURQPHQWDOO\IULHQGO\ZD\ 6SRQVRUVDUH%URGHULFN¶V0X VLF 6KRS .LONHQQ\ &LW\ DQG .&/5)0 &OOU $QGUHZ 0F*XLQQHVV DQG&OOU0DOFROP1RRQDQDUH FRPSHWLWLRQ DPEDVVDGRUV DQG MXGJHVZLWK0RQLFD+D\HV

7KH FRQFHSW ZDV ERUQ ZKHQ %HUQDGHWWH 0RORQH\ (QYLURQ PHQWDO $ZDUHQHVV 2I¿FHU RI .LONHQQ\/RFDO$XWKRULWLHVYLV LWHGVFKRROVHDUOLHULQWKH\HDU ³0DQ\ VFKRROV GHYLVH HQ YLURQPHQWDO VRQJV DV SDUW RI WKH*UHHQ6FKRROV3URJUDPPH DQGWKHVHFRXOGEHWZHDNHGWR WUDQVIRUP WKHLU VFKRRO VRQJ LQWR D *UHHQ(FR OLYLQJ VRQJ IRU &RXQW\ .LONHQQ\´ VDLG %HUQDGHWWH 6RQJVRQDLU (FR)DFWRU LV RSHQ WR DOO

SULPDU\ VFKRROV LQ .LONHQQ\ 6RQJV FDQ EH WR D EDFNLQJ WUDFN RI D SRSXODU WXQH D JXLWDURUDZKROHVFKRROEDQG &ORVLQJ GDWH IRU HQWULHV LV 1RYHPEHU  )LYH VRQJV ZLOO EH VKRUWOLVWHG E\ MXGJHV DQG VQLSSHWVRIHDFKZLOOEHSOD\HG GDLO\RQDLU 7KH VFKRRO RI WKH ZLQQLQJ VRQJZLOOUHFHLYH¼DQGLQ YLWHGWRUHFRUGWKHLUVRQJSUR IHVVLRQDOO\ZLWKWKHDVVLVWDQFH RI5RU\%URGHULFNRI%URGHU LFN¶V0XVLF6KRS Cup cake kids: Savour Kilkenny girls, Lauren Hennessy, aged 13, left, and Katy Mullins, aged 16

PLANNING NOTICES


26 | NEWS

KILKENNY REPORTER 9 10 2013

In Castlecomer with Chubby Brennan

A blast from the past....

Photo courtesy of Charlie McCarthy, Clogh

A Castlecomer McCalmont Cup soccer team of yesteryear

Anthony Owens hits €9,400 GAA Lotto jackpot WELL DONE to local man Anthony Owens who has won the €9,400 jackpot in the Erin’s Own GAA Club lotto. The new jackpot will be €2,000. There is still €20,000 up for grabs in the Castlecome Golf Club Lotto. Jackpot in the Conahy Shamrocks GAA Club Lotto is €8,700. All local lotto tickets are available at The Lime Tree Bistro.

Theatre lovers Local theatre lovers are reminded that ‘Phantom and the Musicals’, a West End production, will be at the Watergate Theatre, Kilkenny, on Sunday, October 13. Tickets: 056-7761674.

Looking for work? Anyone looking for extra income should contact Castlecomer Area Oriflame which is recruiting. Rebecca is on 0834466668.

Ceili time There will be what is being called a Set Dancing Ceili in Castlecomer Community Hall on November 22. Music is by James Kelliher Ceili Band. Contact Moira on 085-8161889.

‘Comer Rebels Castlecomer

Rebels

have

congratulated the local Banner on a great win in the All-Ireland final, a win which the Corkborn say was well deserved over the two games.

for information and bookings.

Set dancing classes

Kilkenny Campus of NUI Maynooth at St. Kieran’s College, College Road, Kilkenny is still accepting applications for the following courses: Teastas Eorpach na Ghaeilge (Teg), Irish language course (Level A2); NUI Certificate in Addiction Studies; NUI Certificate in Psychology; NUI Certificate in Return to Learning; Short course in Literature: French Short Fiction; Postgraduate Certificate in Arts in Healthcare Settings. Contact: Campus on 056 7775910 or E-mail www.nuim. ie/kilkenny.

Classes have resumed at the community hall every Monday, 8pm to 10pm. All are welcome.

Defib group ‘Comer Community Defibrillator Group thanks all who supported their churchgate collection. Two CPR/AED training courses are planned for October 6 and 17, 087-2936209

College courses


9 10 2013 KILKENNY REPORTER

ADVERTISEMENT | 27


Michael Wolsey +RZ,VHHLW

Who needs a doctor when there’s snake oil on tap?

$

OO GRFWRUV LV VZDEV VDLG %LOO\ %RQHV WKH EXFFDQHHU ZKR GRPLQDWHV WKH RSHQLQJ FKDSWHUV RI 7UHDVXUH ,VODQG 7KH UHGRXEWDEOH0U%RQHVKDG D KHDUW FRQGLWLRQ EURXJKW RQE\\HDUVVSHQWGULQNLQJ GDUN UXP DQG VHUYLQJ DV )LUVW 0DWH WR WKH HYLO &DSWDLQ)OLQW +H KDG D VHOIPHGLFDWLRQ SODQ ZKLFK FRQVLVWHG SULQFLSDOO\RIFRQVXPLQJDVPXFKRIWKHVDPHUXP DVKLVVL]HDEOHIUDPHFRXOGKROG6LQFHKHGLHGRI KHDUW IDLOXUH VKRUWO\ DIWHU LVVXLQJ WKLV VODQGHU RQ WKHPHGLFDOSURIHVVLRQLWPD\EHDVVXPHGWKDWWKH SODQZDVQRWDJUHDWVXFFHVV %XW WKHQ WKH PHGLFDOO\DSSURYHG DOWHUQDWLYHV ZHUHQRWHQFRXUDJLQJ/HHFKHVDQGEORRGOHWWLQJ DUHQRWJUHDWRSWLRQV 0HGLFDO VFLHQFH KDV DGYDQFHG D ELW VLQFH WKHQ EXW PDQ\ SHRSOH VWLOO VHHP WR VKDUH 0U %RQHV¶V YLHZ RI WKH FDSDELOLW\ RI GRFWRUV , QHYHU FHDVH WR EH DPD]HG E\ WKH QXPEHU RI RWKHUZLVH VROLG FLWL]HQV ZLOOLQJ WR SXW WKHLU IDLWK LQ WKH GXELRXV DQG RIWHQ H[SHQVLYH UHPHGLHV RI VRPH VQDNH RLOVDOHVPDQUDWKHUWKDQWDNHWKHIUHHDGYLFHRID IXOO\TXDOL¿HGSK\VLFLDQ 7KLV ZHHN , RYHUKHDUG D FRQYHUVDWLRQ EHWZHHQ WZR ZRPHQ ZKR KDG GHFLGHG WR UHMHFW WKH DQWL ÀXLQMHFWLRQVWKHLUHPSOR\HUKDGDUUDQJHGWRKDYH GLVSHQVHG DW WKHLU ZRUNSODFH ³6XUH \RX NQRZ¶¶ VDLGRQHµ¶LW¶VWKRVHMDEVWKDWJLYH\RXWKHÀX¶¶ , WKRXJKW WKLV SOXPEHG WKH GHSWKV RI PHGLFDO VWXSLGLW\EXWWKHYHU\QH[WGD\,PHWDPDQZKR KDG GHFLGHG DJDLQVW VHHNLQJ D GRFWRU¶V DGYLFH DERXW KLV FKHVW SDLQV ³EHFDXVH KH¶OO RQO\ EH JLYLQJPHWKHVDPHROGOHFWXUHDERXWVPRNLQJDQG GULQNLQJOLNHDEURNHQUHFRUG¶¶ +H KDG GHFLGHG LQVWHDG WR FRQVXOW ³D ZUHFNLQJ VSHFLDOLVW¶¶ , WKLQN KH PD\ KDYH PHDQW D 5HLNL VSHFLDOLVW +H KDG QR LGHD ZKDW WKLV WUHDWPHQW ZDVRUKRZLWZDVGLVSHQVHGEXWDSSDUHQWO\LWKDG ZRUNHGZRQGHUVIRUDQHLJKERXUZKRPD\RUPD\ QRWKDYHKDGFRORQFDQFHU +HZDVPRVWRIIHQGHGZKHQ,VXJJHVWHGWKDWD YLVLWWRDKHDGVSHFLDOLVWPLJKWEHDEHWWHULGHD 7KHUH LV DQ RQOLQH GLUHFWRU\ IRU µQDWXUDO WKHUDSLHV¶ ,W UHYHDOV DQ LQFUHGLEOH UDQJH RI WUHDWPHQWV LQ ZKLFK SHRSOH DUH SUHSDUHG WR SXW WKHLU WUXVW 6RPH OLNH DFXSXQFWXUH DQG WKH DIRUHVDLG 5HLNL DUH FUHGLEOH HQRXJK SURYLGLQJ \RX DUH WURXEOHG E\ VRPHWKLQJ OHVV SRWHQWLDOO\ FDWDVWURSKLFWKDQFKHVWSDLQV 2WKHUVDUHRQDVFDOHRIRGGLW\ZKLFKVWDUWVZLWK VWUDQJH DQG UDQJHV WKURXJK EL]DUUH WR PDG DV D KDWWHU 6WUDQJH LV 7DR ZKLFK DFFRUGLQJ WR LWV µELEOH¶ WKH7DR7H&KLQJ³LVQRWDQDPHIRUDWKLQJEXW WKHXQGHUO\LQJQDWXUDORUGHURIWKHXQLYHUVHZKRVH XOWLPDWHHVVHQFHLVGLI¿FXOWWRFLUFXPVFULEH¶¶ ,W SURPRWHV KHDOLQJ WKURXJK WKH LQWULQVLFDOO\ UHODWHG FRQFHSWV RI \LQJ DQG \DQJ ZKHUH HYHU\ DFWLRQFUHDWHVDFRXQWHUDFWLRQ 5LJKW 6R WKDW¶V FOHDU WKHQ:KR¶G ZDQW DQ DXO

GRFWRUZLWKKLVSLOOVDQGDQWLELRWLFVZKHQ\RXFDQ KDYHWKHZRQGHUVRI\LQJDQG\DQJ" %L]DUUH LV &U\VWDO +HDOLQJ ZKLFK :LNLSHGLD GHVFULEHV DV ³D SVHXGRVFLHQWL¿F DOWHUQDWLYH PHGLFLQH WHFKQLTXH WKDW HPSOR\V VWRQHV DQG FU\VWDOVDVKHDOLQJWRROV¶¶ $FFRUGLQJ WR LWV SUDFWLWLRQHUV FU\VWDOV ³KDYH WKH DELOLW\ WR KROG DQG HPLW HQHUJ\ YLEUDWLRQV¶¶ 6RZKHQ\RXWDNHDSLOHRIVWRQHVDQGSODFHWKHP URXQGDSDWLHQWWKH\ZLOOLQGXFHGHHSUHOD[DWLRQ UHGXFH VWUHVV DQG SDLQ DQG SURPRWH HQHUJ\ EDODQFH <RX PD\ WKLQN &U\VWDO 7KHUDS\ LV WKH PDG DV KDWWHUHQGRIWKHVFDOHEXWWKDW¶VRQO\EHFDXVH\RX

KDYHQRW\HWUHDFKHGWKHSURJUDPPHIRUOHDUQLQJ µ¶PRUHDERXWDQJHOVDQGKRZWKH\FDQDVVLVW\RX LQ\RXUGD\WRGD\OLIH¶¶ $QJHOVLWVHHPVDUHJXHVWVZKRDUHLQYLWHGLQWR RXUKHDUWV%HIRUH\RXFDOORQRQH³LWLVLPSRUWDQW WRPHGLWDWHDQGSLFWXUH\RXURZQKHDUWDVDVRIW WHQGHUDQGKHDYHQO\SODFHDQGOLJKWDFDQGOHWKDW LVDWWUDFWLYHWRWKDWSDUWLFXODUKHDYHQO\EHLQJ¶¶ 7KHQ WKHUH LV 'LDPRQG $OLJQPHQW ZKLFK DFFRUGLQJ WR LWV ZHEVLWH µ¶SURPRWHV PHQWDO DQG SK\VLFDOZHOOEHLQJ DQG HQKDQFHV\RXUSHUVRQDO HQHUJ\¶¶ +RZ"6LPSOHUHDOO\,W³DFWLYDWHV\RXUKLJKHVW 'LDPRQGSRWHQWLDOWKURXJKDWUDQVFHQGHQWRQOLQH

THIS WEEK I OVERHEARD A CONVERSATION BETWEEN TWO WOMEN WHO HAD DECIDED TO REJECT THE ANTI-FLU INJECTIONS THEIR EMPLOYER HAD ARRANGED TO HAVE DISPENSED AT THEIR WORKPLACE. “SURE YOU KNOW,’’ SAID ONE, ‘’IT’S THOSE JABS THAT GIVE YOU THE FLU.’’

HQHUJ\ H[SHULHQFH WKDW FOHDUV DQG IRFXVHV \RXU PLQG IUHHV \RXU ERG\ IURP VWUHVV DQG DFWLYDWHV GHHSLQQHUMR\DQGSHDFH¶¶ ,V WKDW FOHDU" &OHDU HQRXJK LW VHHPV WR KDYH SHUVXDGHG KXQGUHGV RI SHRSOH LQ ,UHODQG WR IROORZWKHWHDFKLQJVRI-DFTXHOLQH-R\$PHULFDQ IRXQGHU RI WKH ³VDFUHG WHFKQRORJ\¶¶ ZKR FDOOV RQ µ¶OLJKWZRUNHUV DQG FRQVFLRXV EHLQJV IURP DURXQG WKH ZRUOG WR DQFKRU 'LDPRQG /LJKW DQG $OLJQPHQW¶¶ ,DPDPD]HGQRWRQO\DWWKHPHGLFDOWUXVWSHRSOH SXW LQ WKHVH WKHUDSLHV EXW E\ KRZ PDQ\  WXUQ WR WKHPIRUUHOLJLRXVFRPIRUW $OOUHOLJLRQVUHTXLUHVRPHVXVSHQVLRQRIUHDVRQ DQG ORJLF EXW ZK\ ZRXOG DQ\RQH GHVHUW WKH UHODWLYH FHUWDLQWLHV RI VD\ 5RPDQ &DWKROLFLVP IRU(FNDQNDUDEULGJHEHWZHHQKXPDQVRXOVDQG *RG ZKLFK KHLJKWHQV DZDUHQHVV RI WKH (FN RU GLYLQHVSLULW" $QG ZK\ ZRXOG \RX IRUVDNH WKH FRQYHQWLRQDO ZLVGRPRIVD\3UHVE\WHULDQLVPIRUWKH1DWLYH $PHULFDQ&KXUFKDIXVLRQRI1DWLYH$PHULFDQ EHOLHIV DQG &KULVWLDQLW\ ZLWK FHUHPRQLHV WKDW KLQJHRQSH\RWHDGUXJREWDLQHGIURPWKHFDFWXV SODQW" 7KH JURZWK RI RGG VHFWV DQG SUDFWLFHV VXUHO\ VXJJHVWV VRPH IDLOLQJ E\ WKRVH ZKR SUHDFK WKH JUHDWIDLWKV $OOGRFWRUVLVVZDEVVDLG%LOO\%RQHV:HVHHP WREHH[WHQGLQJKLVSKLORVRSK\WRDOOFOHUJ\


9 10 2013 KILKENNY REPORTER

ADVERTISEMENT | 29


30 | NEWS

KILKENNY REPORTER 9 10 2013

People in pictures

Pics: Noel Hoyne

Naho Koizumi and Miskal Naka at The Parade on Friday

On skates: Lisa Prendergast, Gowran and Morgan Kelly, Dungarvan

Rockinâ&#x20AC;&#x2122; outside Essaness Music, David James Glendon

Happy man: Christy Murray on John Street

Retired army man Paddy Horohan


NEWS | 31

9 10 2013 KILKENNY REPORTER

People in pictures

Tony Lacey and Billy Dunphy walking their dogs, Boycie and Buddy Texas man Fred Cauble, a welcome visitor

The Oregon Trio, Mallory Malot, Miriam and Elizabeth Crowhurst

Every Little helps: Pat Little collecting for the Migraine Association of Ireland

Butts friends Paddy Shelly and Ger Barry have a chat

Pics: Noel Hoyne


32 | ADVERTISEMENT

KILKENNY REPORTER 9 10 2013


9 10 2013 KILKENNY REPORTER

ADVERTISEMENT | 33


34 | ARTS & ENTS

KILKENNY REPORTER 9 10 2013


9 10 2013 KILKENNY REPORTER

ARTS & ENTS | 35


36 | ARTS & ENTS

KILKENNY REPORTER X9 10 2013


9 10 2013 KILKENNY REPORTER

ADVERTISEMENT | 37


38 | ADVERTISEMENT

KILKENNY REPORTER 9 10 2013


9 10 2013 KILKENNY REPORTER

ADVERTISEMENT | 39


40 | NEWS

KILKENNY REPORTER 9 10 2013

)5$1¶6*$5'(1

To bee or not to bee? That is a serious question 2+72EHDTXHHQEHHWROLHDURXQG DOOGD\GLFWDWLQJFRQWUROOLQJWKHKLYH OD\LQJWKHRGGHJJRUEHLQJ VHUYLFHGE\DSSUR[GURQHVRYHUD GD\SHULRGDQGQRFRPSHWLWLRQ QRKRXVHZRUNZKDWZLWKP\ WKRXVDQGVRIZRUNHUEHHV 7KHUHPLJKWEHODPHQWDEOH GUDZEDFNVWKDW,EHFRPHKXJHO\ REHVHP\OLIHVSDQZLOOEHPD[LPXP RQO\WKUHHWRIRXU\HDUVDQGQR79 RUERRNV %XWKH\QRVWUHVVRUPRQH\ ZRUULHV,¶GZDQWWRPDNHVXUHDQG KDYHDGHFHQWEHGRIFRXUVH«ZKDW ZLWKDOOWKHGHOLYHULQJRIEDELHVDQG UHJXODUFDQRRGOLQJ,¶GKDYHWRPDNH VXUHRIDQRVWHRSDWKLFPDWWUHVV 2QDPRUHVHULRXVQRWHLQWKH ODVW\HDUVWKHEHHSRSXODWLRQ KDVGHFOLQHGE\:KHQ\RX WKLQNKRZLPSRUWDQWEHHVDUH IRUSROOLQDWLRQ,FDQQRWEHOLHYH WKDWFRXQWULHVDUHQRWWDNLQJWKLV SUREOHPRQERDUGDQGDFWXDOO\GRLQJ VRPHWKLQJDERXWLW 7KHPDLQUHDVRQIRUWKHKXJH GHFOLQHLQEHHSRSXODWLRQVDUH LQVHFWLFLGHVDQGSHVWLFLGHV :HYRWHGDJDLQVW <HWODVW\HDUWKH(8SURSRVHG DEDQRQQHRQLFRWLQRLGSHVWLFLGHV QHRQLFV ZKLFKUHVXOWVLQWKH&RORQ\ &ROODSVH'LVRUGHU 'HVSDLULQJO\HYHQ,UHODQGYRWHG DJDLQVWWKHEDQ6WDWLFLDQVDUHVD\LQJ

Frances Theloke WKDWLIWKHEHHSRSXODWLRQGLVDSSHDUV HQWLUHO\WKHHQWLUHKXPDQSRSXODWLRQ ZLOOIROORZVXLWZLWKLQVL[\HDUV %HHVQRWRQO\SROOLQDWHÃ&#x20AC;RZHUV WKH\SROOLQDWHIUXLWDQGYHJHWDEOHV FHUHDOVEDVLFDOO\DOORIWKHIRRGVZH QHHGWRSURYLGHWRVXUYLYH %HHVDUHHVVHQWLDOWRRXUIRRG V\VWHPDQGWKH\DUHG\LQJDWDODUPLQJ UDWHV1HRQLFSHVWLFLGHVDUHDNH\SDUW RIWKHSUREOHPZHVKRXOGVWDUWWR¿[ ULJKWQRZLQRXURZQJDUGHQV 2QHRIWKHHDVLHUWKLQJVWRGRLV SODQWEHHDQGEXWWHUÃ&#x20AC;\DWWUDFWLQJ SODQWVLQWR\RXUJDUGHQSODQWVOLNH 9HUEHQD%RQDULHQVLVDQGVHGXP SLFWXUHG (FKLQDFLDUXGEHFNLD KHOHQLXPOXSLQVPRQDUGD±WKHOLVW LVHQGOHVV 7KHSLFWXUH\RXVHHIHDWXUHGLVRI DKRQH\FRPEIRXQGLQ5LEHDXYLOOH )UDQFH%HHVUHWXUQHGWRWKHKLYH FRYHUHGLQEOXHJUHHQDQGUHGV\UXS

±DUHVXOWRIIRUDJLQJDWDIDFWRU\WKDW SURFHVVHGZDVWHIURPDQ0 0V IDFWRU\ %OXHKRQH\ 7KHUHVXOWLQJKRQH\REYLRXVO\ FRXOGQ¶WEHVROGGXHWRLWVFRORXU, PHDQZRXOG\RXEX\EOXHKRQH\"2U UHGRUJUHHQIRUWKDWPDWWHU" $QG\HVLWLVDFWXDOO\WUXHWKDWD EHHGLHVDIWHULWVWLQJV\RX,WKDVD VWLQJHUZLWKDEDUEWKDWDQFKRUVWKH VWLQJHULQWKHYLFWLP¶VERG\DQGWKH EHHGLHVVKRUWO\DIWHUZDUGVGXHWR DEGRPLQDOUXSWXUH 'LG\RXNQRZWKDWEHHVDUHYHU\ QDWW\GDQFHUV"$QGWKHLUGDQFHWHOOV WKHRWKHUEHHVWKHH[DFWORFDWLRQDQG GLVWDQFHRIZKHUHWKHVWDVKRIKRQH\ LVZDLWLQJWREHFROOHFWHG" 1RVXFKWKLQJDVµWDNHWKH5 IRUHLJKWPLOHVWKHQWDNHDOHIWRQ WKH/FDUU\RQIRURQHDQG KDOIPLOHVDQGWKHUH¶VDZRQGHUIXO JDUGHQRQWKHOHIWFDOOHG&ODVKDFURZ *DUGHQVZLWKORDGVRIKRQH\MXVW ZDLWLQJWREHFROOHFWHG"´ 1RVLUHH%REWKH\GRDZRQGHUIXO )UHG$VWDLUHLPSHUVRQDWLRQDQG ZLWKLQVHFRQGVTXLFNHUWKDQ5\DQDLU WKH\DUHRQWKHLUZD\WRWKHWDUJHWHG GHVWLQDWLRQ QRWPLOHVDZD\HLWKHU DQGQRWFKDUJHGIRUWKHRYHUORDGHG SROOHQVDFV  3UHWW\QLIW\FUHDWXUHVDUHEHHV )UDQFDQEHFRQWDFWHGDWWKHORNHI# JPDLOFRP

Nifty, dancer Fred Astaire


/LIH

6W\OH October 9, 2013

Apple stuffed

Chicken

FASHION • GIRL ABOUT TOWN • TRAVEL • MOVIES • PLUS LOTS LOTS MORE

Simple steps to a

Healthy Lifestyle See P42&43

P50


/LIH67</(

9 10 2013 KILKENNY REPORTER

SIMPLE WAYS THAT LEAD TO A

HEALTHY LIFESTYLE

Y

ou hear a lot about living a healthy lifestyle, enough that the phrase ‘healthy lifestyle’ may be one we’d like to permanently retire. The problem is, that phrase describes the life we need to live if we want to feel good and look good. So, what does it actually mean? Well, there are the obvious things that describe a healthy person: He or she doesn’t smoke, is at a healthy weight, eats healthy foods and exercises on a regular basis. It sounds so simple, it’s funny just how hard it is to do all of those things in our current world. The good news is, you don’t

have to change everything at the same time. In fact, the trick to healthy living is making small changes. Take more steps each day, adding fruit to your cereal, having an extra glass of water or saying no to that second helping of buttery mashed potatoes. So, what else can you be doing to live healthy? Your first order of business is to start exercising. Exercise One of the biggest reasons we’re have a weight problem these days is because we sit around too much. We know we need to exercise, but we have so many excuses not to do it. We’re too busy, don’t

know where to start, we’re not motivated or we’re afraid we’ll injure ourselves or we’re afraid that exercise has to be vigorous for what our bodies can handle. The truth is, everything counts and the more you move, the healthier you’ll be. It’s great if you can spend time exercising - Meaning you’re sweating, working in your target heart rate zone and/or doing something to strengthen your body. But it doesn’t always have to be that way. Moderate activities like chores, gardening and walking can make a difference. Just adding a little movement to your life can: Reduce the risk of heart disease,

stroke and diabetes Improve joint stability Increase and improve range of movement Help maintain flexibility as you age Maintain bone mass Prevent osteoporosis and fractures Improve mood and reduce symptoms of anxiety and depression Enhance self esteem Improve memory in elderly people Reduce stress So, even if you opt for small changes and a more modest weight loss, you can see the benefits are still pretty good. One study has found that just a 10% weight reduction helped obese

patients reduce blood pressure, cholesterol and increase longevity. In fact, you don’t even have to have a goal to lose weight, especially if you have trouble stick to a program. Why not focus on being healthy to start and worry about the weight loss once you’ve got some healthy habits under your belt? Simple Ways to Move Your Body You can start the process of being healthy and weight loss now by adding a little more activity to your life. If you’re not ready for a structured program, start small. Every little bit counts and it all adds up to burning more calories.

Turn off the TV. Once a week, turn off the TV and do something a little more physical with your family. Play games, take a walk...almost anything will be more active than sitting on the couch. Walk more. Look for small ways to walk more. When you get the mail, take a walk around the block, take the dog for an extra outing each day or walk on your treadmill for 5 minutes before getting ready for work. Do some chores. Shoveling snow, working in the garden, raking leaves, sweeping the floor...these kinds of activities may not be ‘vigorous’ exercise,


/LIH67</(

9 10 2013 KILKENNY REPORTER

but they can keep you moving while getting your house in order. Pace while you talk. When you’re on the phone, pace around or even do some cleaning while gabbing. This is a great way to stay moving while doing something you enjoy. Be aware. Make a list of all the physical activities you do on a typical day. If you find that the bulk of your time is spent sitting, make another list of all the ways you could move more--getting up each hour to stretch or walk, walk the stairs at work, etc.

Eating Well Eating a healthy diet is another part of the healthy lifestyle. Not only can a clean diet help with weight management, it can also improve your health and quality of life as you get older. You can use the new MyPlate to determine how many calories you need and what food groups you should focus on or, if you’re looking for smaller changes, you can use these tips for simple ways to change how you eat: Eat more fruit. Add it to your cereal, your salads or even

your dinners Sneak in more veggies. Add them wherever you can--a tomato on your sandwich, peppers on your pizza, or extra veggies in your pasta sauce. Keep precut or canned/frozen veggies ready for quick snacks. Switch your salad dressing. If you eat full-fat dressing, switch to something lighter and you’ll automatically eat less calories. Eat low-fat or fat-free dairy. Switching to skim milk or fat free yogurt is another simple way to eat less calories without having to change too much in your diet.

Make some substitutes. Look through your cabinets or fridge and pick 3 foods you eat every day. Write down the nutritional content and, the next time you’re at the store, find lowercalorie substitutes for just those 3 items. Creating a healthy lifestyle doesn’t have to mean drastic changes. In fact, drastic changes almost always lead to failure. Making small changes in how you live each day can lead to big rewards, so figure out what you can to be healthy today.


/LIH67</(

9 10 2013 KILKENNY REPORTER

Xxx XXX newfilms

GRAVITY M

ovie theaters will talk themselves blue these days trying to convince people to still bother to come out and see films in dark theaters with other people. But all they really need is Gravity, one of the most captivating and essential big-screen experiences in recent years, and maybe ever. The gripping thriller about two astronauts lost in space could work on a small screen in theory, sure. But in a dark theater, with expert sound effects and the stunning visuals surrounding you, Gravity is like being launched into orbit yourself; it’s transporting and terrifying and, eventually, transcendent. With its mind-boggling visuals and commitment to the authentic experience of outer space (no sound, no gravity, no oxygen), Gravity is genuinely unlike any film you’ve ever seen before. But its story, from a script written by director Alfonso Cuaron with his son Jonas, is deliberately, sometimes clangingly familiar. You’ve got one astronaut Matt Kowalski (George Clooney), a wisecracking veteran on his final spacewalk. And you’ve got the rookie Dr. Ryan Stone (Sandra Bullock), a brilliant and strong-willed scientist who’s understandably nauseous on her first trip into orbit. This odd couple pair has met disaster in

countless types of movies for the last century, but this time it happens to be in space, when a Russian satellite is hit by a missile and the debris comes flying at them at thousands of miles an hour. In space, nobody can help you dodge shrapnel. The lauded 10-minute unbroken shot that opens the film is mesmerizing and thrilling, and leads into the first action sequence, as Stone and Kowalski survive the debris field and manage to regroup themselves while overcoming problems that just don’t exist on earth, like the fact that once you start spinning in space, there’s no way to stop yourself. As Cuaron’s camera slips magically inside Stone’s helmet and back out into the distance of space, the visceral experience of the film becomes almost unbearable; the action sequences of Gravity are designed like a thrill ride, wringing maximum physical response from the audience, and it’s an insanely well-calibrated ride at that. When Stone and Kowalski finally have a chance to catch their breath, you may only then realize you’ve been holding yours as well. When the film takes the time to develop the characters, allowing Stone to talk about her young daughter’s death and Kowalski (Clooney essentially just playing himself in a space-

suit) to talk her through the ordeal, the lighter moments tend to work better than the heavier stuff near the end. Sandra Bullock’s resolutely physical, ferocious performance often says more concisely everything the script stumbles in saying out loud, and many of the film’s best emotional moments-- like her one-sided communication with amateur radio operator back on Earth-- are nearly wordless. The gambit of having the astronauts communicate with “Houston in the blind” allows the characters to narrate essential technical parts of the action, but at several key moments the script doesn’t know to step back-- that Bullock’s face and grim determination to survive say it all. With its deliberately archetypal characters and occasionally chewy dialogue Gravity feels like a film James Cameron would be lucky to make--an enormous compliment for this technically brilliant, unerringly entertaining thriller. Your mileage may vary on the film’s more spiritual elements, but Gravity will make you believe in the higher power of movies, of the transformation that happens in a dark room with a giant screen and a story set in a place you couldn’t possibly imagine. See it in IMAX and in 3D and any other way that allows you to block out the rest of the world. Gravity is movie


/LIH67</(

9 10 2013 KILKENNY REPORTER

(,+'*&*

Xxx XXX newďŹ lms BAGGAGE CLAIM

Baggage Claim racks up a lot of frequent flier miles criss-crossing the country in the name of finding love. It makes pit stops in Houston, Washington DC, New York City, Baltimore and Los Angeles, but despite all that traveling, it never really arrives anywhere new. It borrows from previous romantic comedies like Whatâ&#x20AC;&#x2122;s Your Number?, 27 Dresses and The Wedding Date, and in doing so, is never able to find enough original space to be its own movie. Itâ&#x20AC;&#x2122;s just a retread of conversations and plot points viewers have seen before. Fortunately, many of those retreads are likable enough to get by. Montana Moore (Patton). Sheâ&#x20AC;&#x2122;s a hopeless romantic and in serious need of a rehearsal dinner date; so, she takes a page out of the Anna Faris playbook and decides to loop back around and check out the men sheâ&#x20AC;&#x2122;s already been with. With the help of her good friends/ fellow flight attendants Sam (Adam Brody) and Gail (Jill Scott) and several of her co-workers who handle a variety of airport-related jobs, she begins stalking the former flames and engineering her schedule to bump into as many of the dudes as possible, either by working or taking the same flights. Sheâ&#x20AC;&#x2122;s been with more than a handful of men in her day, but there are plenty of highlights including a rising star politician (Taye Diggs), a powerful hotel owner (Djimon Hounsou), an up and coming record producer (Trey Songz) and, of course, her longtime best friend who she doesnâ&#x20AC;&#x2122;t think of in that way (Derek Luke). Many of these encounters are amusing, enlightening or worthy of a oh-no-he-didnâ&#x20AC;&#x2122;t, and in them, the film has its single greatest strength. It might be formulaic, but thereâ&#x20AC;&#x2122;s a reason why romantic comedies love incorporating former lovers. Itâ&#x20AC;&#x2122;s an easy way to generate laughs and shoehorn in character development backstory. Baggage Claim isnâ&#x20AC;&#x2122;t really good by any definition. Its characters arenâ&#x20AC;&#x2122;t particularly well-developed, and its basic plot isnâ&#x20AC;&#x2122;t anything anyone would ever consider doing. The film contains one scene thatâ&#x20AC;&#x2122;s so bizarrely shot and weirdly sexual that Iâ&#x20AC;&#x2122;m still convinced it was originally meant to be a dream sequence, and it makes no sense that all of Mooreâ&#x20AC;&#x2122;s ex-boyfriends started crushing life immediately after they separated. At no angle would any objective person look at Baggage Claim and pile on large amounts of unqualified praise. But Baggage Claim is still remarkably average, which, in the world of romantic comedies, means itâ&#x20AC;&#x2122;s absolutely good enough to watch, given the right mood. Adam Brody and Jill Scott are absurdly wonderful as Montanaâ&#x20AC;&#x2122;s constantly fighting co-workers, and there are more than a handful of big smiles to be had here. If youâ&#x20AC;&#x2122;ve always been annoyed by the overwhelming percentage of marginal romantic comedies that feature Kate Hudson or another generic white girl trying to get her happy ending and have always yearned to see more women of color embroiled in stupid schemes to land men, go ahead and line up for this one.

Looking after your pet Get Regular Vaccinations For optimal health, pets need regular vaccinations against common ills, such as rabies, distemper, feline leukemia, and canine hepatitis. How often your dog or cat needs to be immunized depends on their age, lifestyle, health, and risks, says McGeorge, so talk to your vet about the vaccinations that make sense for your pet. Provide an Enriched Environment An enriched environment is another key to the long-term health and welfare of your canine and feline friends, says C.A. Tony Buffington, DVM, PhD, a veterinary nutritionist and professor at Ohio State University Veterinary Medical Center in Columbus. Pets need mental stimulation, say the pros, which may mean daily walks for your pooch, and scratching posts, window perches, and toys for your cat. It means play time with you, which not only keeps your petâ&#x20AC;&#x2122;s muscles toned and boredom at bay, it also strengthens your bond with your four-footed companions. ID Microchip Your Pet Lack of identification means as few as 14% of pets ever find their way home after getting lost. Fortunately, â&#x20AC;&#x153;microchipping allows for the pet to be reunited with its family,â&#x20AC;? no matter how far away it is when found, Burns says. About the size of a rice grain, a microchip is inserted under the skin in less than a second. It needs no battery and can be scanned by a vet or an animal control officer in seconds. Be sure to register the chip ID with the chipâ&#x20AC;&#x2122;s maker. A

current registration is the vital last step in making certain your pet can always find his way home. Pets Need Dental Care, Too Just like you, your pet can suffer from gum disease, tooth loss, and tooth pain. And just like you, regular brushing and oral cleanings help keep your petâ&#x20AC;&#x2122;s teeth strong and healthy. â&#x20AC;&#x153;Dental disease is one of the most common preventable illnesses in pets,â&#x20AC;? Ohio veterinarian Vanessa Douglas tells WebMD, â&#x20AC;&#x153;yet many people never even look in their petâ&#x20AC;&#x2122;s mouths.â&#x20AC;? Itâ&#x20AC;&#x2122;s estimated 80% of dogs and 70% cats show signs of dental disease by age three, leading to abscesses, loose teeth, and chronic pain. In addition to regular dental cleanings by your vet, â&#x20AC;&#x153;periodontal disease can be avoided by proper dental care by owners,â&#x20AC;? Douglas says. Owner care includes brushing, oral rinses, and dental treats. Your vet is a good source of information about brushing techniques, oral rinses, and dental treats. Never Give Pets People Medication Medicines made for humans can kill your pet, says Georgia veterinarian Jean Sonnenfield, DVM. As a matter of fact, in 2010 the ASPCA listed human drugs in the top 10 pet toxins. NSAIDs like ibuprofen and naproxen are the most common pet poisoning culprits, but antidepressants, decongestants, muscle relaxants, and acetaminophen are just a few of the human drugs that pose health risks to pets. Human drugs can cause kidney damage, seizures, and cardiac arrest in a dog or cat.


46 | ADVERTISING

KILKENNY REPORTER 9 10 2013


9 10 2013 KILKENNY REPORTER

ADVERTISEMENT | 47


Eimear Ni Bhraonain 6WUDLJKW7DON

Canine Comfort: A manâ&#x20AC;&#x2122;s best friend...and a womanâ&#x20AC;&#x2122;s pal too

,

+($5' D VWRU\ DW WKH ZHHNHQG WKDW ZRXOGEULQJDWHDUWR\RXUH\H ,WZDVDERXWDIDLWKIXOGRJZKRVWD\HG E\KLVRZQHU¶VVLGHDIWHUVKHGLHG 7KH IDPLO\ RI $O]KHLPHU¶V VXIIHUHU 3HJJ\0DQJDQJRWJUHDWFRPIRUWLQWKH IDFW WKDW VKH GLG QRW GLH DORQH +HU EH ORYHG.LQJ&KDUOHVVSDQLHO&DVSHUGX WLIXOO\VWRRGRYHUKHUXQWLOVKHZDVIRXQG 3HJJ\   KDG EURXJKW KHU SHW IRU D ZDON RQ 6HSWHPEHUEXWVKHHQGHGXSNPIURPKHUKRPH LQ7HUHQXUH+HUERG\ZDVIRXQGE\YROXQWHHUVLQ D¿HOGQHDU'XEOLQ¶V,NHDVWRUHIRXUGD\VDIWHUKHU GLVDSSHDUDQFH 3HJJ\ KDG SDVVHG DZD\ IURP QDWXUDO FDXVHV &DVSHUGLHGWZRKRXUVDIWHUKLVRZQHU¶VERG\ZDV GLVFRYHUHG 7KH \HDUROG GRJ GLHG RI VWDUYD WLRQDQGGHK\GUDWLRQLQWKHFDUHRIDYHW ³*RRGROG&DVSHUGHYRWHGWR3HJJ\WRWKHYHU\ HQG´DIDPLO\PHPEHUUHPDUNHGDIWHU0UV0DQ JDQZDVODLGWRUHVW 1HLJKERXUV DQG IULHQGV RI 0UV 0DQJDQ OLQHG RXW DORQJ WKH DYHQXH WR 0RXQW$UJXV &KXUFK LQ 'XEOLQZLWKWKHLURZQSHWVWRELGIDUHZHOOWRWKH

JUDQGPRWKHU DW KHU IXQHUDO 3HJJ\ ZDV EXULHG ZLWKWKHDVKHVRIKHU³EHVWIULHQG´E\KHUVLGH %HVWIULHQGV &DVSHU¶V OR\DOW\ LV SURRI LI ZH HYHU QHHGHG LW WKDWRXUFDQLQHEHVWIULHQGVORRNRXWIRUXVZKHQ ZH¶UHLQGLVWUHVV $Q\RQHZLWKDIDPLO\SHWNQRZVKRZLQWHOOLJHQW GRJV DUH ZKHQ LW FRPHV WR RXU HPRWLRQV 6RPH GRJVDUHVRWXQHGWRWKHLURZQHUVWKDWWKH\FDQWHOO ZKHQZH¶UHVLFNRULQEDGIRUP7KH\KDYHDZD\ RINQRZLQJZKHQZH¶UHRXWRIVRUWV7KH\VKRZXV WKH\FDUHE\VWUHWFKLQJWKHLUSDZVRQWRRXUODSVRU VLWWLQJDWRXUIHHW 5HVHDUFKSXEOLVKHGLQWKHMRXUQDO$QLPDO&RJ QLWLRQODVWPRQWKJLYHVXVDQLQVLJKWLQWRKRZRXU GRJVFDQUHVSRQGWRRXUHPRWLRQVPRUHWKDQDQ\ RWKHUVSHFLHV²LQFOXGLQJRWKHUKXPDQEHLQJV 7KHVWXG\IURP*ROGVPLWKV8QLYHUVLW\RI/RQ GRQ VXJJHVWV GRPHVWLF GRJV VKRZ HPSDWKLF EH KDYLRXU ZKHQ WKH\ FRPH DFURVV KXPDQV LQ GLV WUHVV $VSDUWRIWKHUHVHDUFKSHWGRJVVSDQQLQJD UDQJH RI DJHV DQG EUHHGV ZHUH H[SRVHG WR IRXU VHSDUDWH VHFRQG H[SHULPHQWDO FRQGLWLRQV LQ

ZKLFK HLWKHU WKH GRJ¶V RZQHU RU D VWUDQJHU SUH WHQGHGWRFU\KXPPHGLQDQRGGPDQQHURUFDU ULHGRXWDFDVXDOFRQYHUVDWLRQ &RPIRUWRIIHULQJ 6LJQL¿FDQWO\PRUHGRJVDSSURDFKHGDQGWRXFKHG WKH KXPDQV DV WKH\ ZHUH FU\LQJ DV RSSRVHG WR WKH KXPPLQJ RU WDONLQJ 7KH PDMRULW\ RI GRJV UHVSRQGHG WR WKH FU\LQJ SHUVRQ ³LQ D VXEPLVVLYH PDQQHU´FRQVLVWHQWZLWK³FRPIRUWRIIHULQJ´ ³7KHKXPPLQJZDVGHVLJQHGWREHDUHODWLYHO\ QRYHO EHKDYLRXU ZKLFK PLJKW EH OLNHO\ WR SLTXH WKHGRJV¶FXULRVLW\7KHIDFWWKDWWKHGRJVGLIIHU HQWLDWHG EHWZHHQ FU\LQJ DQG KXPPLQJ LQGLFDWHV WKDWWKHLUUHVSRQVHWRFU\LQJZDVQRWSXUHO\GULYHQ E\FXULRVLW\´H[SODLQHGWKHVWXG\¶VFRDXWKRU'U 'HERUDK&XVWDQFH ³5DWKHU WKH FU\LQJ FDUULHG JUHDWHU HPRWLRQDO PHDQLQJ IRU WKH GRJV DQG SURYRNHG D VWURQJHU RYHUDOOUHVSRQVHWKDQHLWKHUKXPPLQJRUWDONLQJ´ 7KHVWXG\DOVRIRXQGWKDWWKHGRJVUHVSRQGHGWR WKHSHUVRQZKRZDVFU\LQJUHJDUGOHVVRIZKHWKHU LWZDVWKHLURZQHURUWKHXQIDPLOLDUSHUVRQ ³,IWKHGRJV¶DSSURDFKHVGXULQJWKHFU\LQJFRQ GLWLRQ ZHUH PRWLYDWHG E\ VHOIRULHQWHG FRPIRUW

VHHNLQJ WKH\ ZRXOG EH PRUH OLNHO\ WR DSSURDFK WKHLUXVXDOVRXUFHRIFRPIRUWWKHLURZQHUUDWKHU WKDQWKHVWUDQJHU´VDLG-HQQLIHU0D\HURIWKH8QL YHUVLW\¶V'HSDUWPHQWRI3V\FKRORJ\ /R\DOFRPSDQLRQV ³1R VXFK SUHIHUHQFH ZDV IRXQG 7KH GRJV DS SURDFKHGZKRHYHUZDVFU\LQJUHJDUGOHVVRIWKHLU LGHQWLW\7KXVWKH\ZHUHUHVSRQGLQJWRWKHSHUVRQ¶V HPRWLRQQRWWKHLURZQQHHGVZKLFKLVVXJJHVWLYH RIHPSDWKLFOLNHFRPIRUWRIIHULQJEHKDYLRXU´ 7KHDFWLRQVRISHWVMXVWOLNH&DVSHUVKRZKRZ GRJVDUHPRUHVHQVLWLYHWRRXUHPRWLRQVWKDQDQ\ RWKHUVSHFLHV ³:HKDYHGRPHVWLFDWHGGRJVRYHUDORQJSHULRG RIWLPH:HKDYHVHOHFWLYHO\EUHGWKHPWRDFWDV RXUFRPSDQLRQV´VDLG'U&XVWDQFH 7KHUH¶V QR GRXEW WKDW RXU FDQLQH IULHQGV KDYH FHUWDLQO\ HDUQHG WKH WLWOH RI ³PDQ¶V EHVW IULHQG´ 6LQFHWKHGRPHVWLFDWLRQRIWKHGRJWKHUH¶VEHHQD FRQQHFWLRQEHWZHHQKXPDQVDQGFDQLQHV 7RGD\ WKH\ DUH OR\DO FRPSDQLRQV DQG ZRUNHUV ZKRKHOSWKHSROLFHDQGWKHGLVDEOHG ,QUHWXUQ ZHFDUHIRUWKHPIHHGWKHPDQGJLYHWKHPDJRRG TXDOLW\RIOLIH


 The Shining (1981) The Shining is an incoherent, illogical, chaotic mess; it is also one of the best ďŹ lms ever made. The ďŹ lm is based on the famous and fantastic novel by American author Stephen King; the novel is a story about a loving family who head to a haunted hotel in Colorado for ďŹ ve months because the father obtained a job as its caretaker. As the novel progresses, the father becomes more and more inďŹ&#x201A;uenced by the hotel whose powers have been ampliďŹ ed because of the supernatural ability of the familyâ&#x20AC;&#x2122;s young son Danny. This culminates in the third act where the father tries to kill his wife and daughter with a croquet mal-

let. The ďŹ lm on the other hand downplays the supernatural aspect of the book and has the father lose himself much more willingly than he did in the book. It also removes several important chunks of the story, making it almost impossible to completely understand what is happening. Thankfully though, the ďŹ lm isnâ&#x20AC;&#x2122;t about the story, itâ&#x20AC;&#x2122;s about the experience; and it is an extremely tense and mind bending one at that. The movie succeeds in creating and holding suspense better than any ďŹ lm I can think of. The ďŹ lm is just plain creepy, like in the scenes where Danny is cycling around the hotel and happens upon room 237, or when Jack ďŹ nds the naked woman in the bathtub, it will ďŹ ll you completely with dread. The ďŹ lm constantly blurs the line between what is real

and what isnâ&#x20AC;&#x2122;t, at some points it feels like everyone is just insane. As the ďŹ lm continues characters begin to see more and more ghosts and supernatural activities, near the end of the ďŹ lm in one section it devolves into pure surreality with elevators full of blood and a man in a bear suit. Though he may have failed slightly playing the straight man at the start, once everything starts going wrong Nicholson becomes bona ďŹ de possessed and creates one of the most famous performances of all times; though I still believe the ďŹ lm is at its best in the second act as the tension is building. I hadnâ&#x20AC;&#x2122;t seen the ďŹ lm in about ďŹ ve years before recently, and I was amazed to ďŹ nd I remembered every scene; they are all highlights. It is truly a horror classic.



 Brian KeenanAn Evil Cradling (1991) Between 11 April 1986 and 24th August 1990 the Islamic Jihad Organization held Irish professor Brian Keenan hostage in Beirut; he spent the majority of this time blindfolded and chained by both hands and feet to radiators with fellow hostage John McCarthy. This book, published a year following his release, tells the story of his time in captivity. The book captures in its three hundred and ďŹ fty the complete psychology of Keenanâ&#x20AC;&#x2122;s treatment. Most autobiographical authors fail to allow the reader to truly live inside them, to look through the same eyes, feel and smell the same things. Keenan lets himself by wholly known to his readers, exposing his

greatest weaknesses and most degrading moments. In the early parts of the book, before he is moved in with John McCarthy, we see him struggle desperately with madness and desperation, culminating in one scene where his room appears to ďŹ ll with birds. From this point in order to ďŹ ght off the madness he: â&#x20AC;&#x2DC;decided to become my own self observerâ&#x20AC;Ś Letting madness take me where it would as long as I stood outside it and watched itâ&#x20AC;&#x2122;. This method that is used throughout the entirety of the work is fascinating to see in action and really does give us insight into our main characterâ&#x20AC;&#x2122;s mind. He also discusses the mentality of the guards, the friends he meets, and the regime as a whole; these elements all elevate the book into something much more than it otherwise could have been. If this book had been just a standard and to-the-point bit

Charles Mingus- The Black Saint and the Sinner Lady (1963)

of non-ďŹ ction then it will still be a harrowing and fascinating journey; but Keenan studied English and incorporates rich and descriptive prose into his work. His style is distinctly Irish and it gives the book a magniďŹ cent and engaging ďŹ&#x201A;ow. Overall, An Evil Cradling is a harrowing, dark journey that should be experienced by all.

Charles Mingus, though one of the most celebrated jazz artists of all time now, was quite an anomaly in his day. He publicly scorned both the decadent habits of his jazz contemporaries and the jazz audience of the time. Mingus made music that both harkened back to the origins of jazz in New Orleans while also looking forward with the third stream Jazz movement of the late 50â&#x20AC;&#x2122;s and early 60â&#x20AC;&#x2122;s. Unlike many of his contemporaries he composed music with big bands, the band on this album is eleven big and consists of session men all hand picked by Mingus based on personality as well as skill. With such a big band, Mingus needed to ďŹ nd people who wouldnâ&#x20AC;&#x2122;t let loose all over each other when improvising which means that compiling this band would have been an absolute nightmare. This is the main reason why there is truly nothing else like The Black Saint and the Sinner Lady, most jazz musicians have a hard

enough time getting bands of four or ďŹ ve to stay on beat with music that twists and turns as much as the music on this album does, and do to it with eleven is absolutely unprecedented. The album was Avant Garde back in the 60â&#x20AC;&#x2122;s and the label mostly comes from the instrumentation. Though, with the exception of a Spanish guitar that comes sounding like the zither from The Third Man, the instruments used are conventional for jazz, itâ&#x20AC;&#x2122;s just their playing that is not. Mingus would put groups of instruments in juxtaposition with each other and create constantly evolving tones and textures. The album is at its heart an attempt at controlled chaos and no other album creates that feeling with a sound this big. The album also melds beauty, ugliness and chaos in a way that is reminiscent of Loveless. The album is split into four tracks and six modes, Mingus built a concept around the idea that the music would be used in a ballet but the idea never came into fruition so the concept and story is largely indecipherable. It is truly one of jazzâ&#x20AC;&#x2122;s greatest achievements and one of the most important albums ever made.


/LIH67</(

9 10 2013 KILKENNY REPORTER

*DUHWK%\UQH Campagne chef dishes up your weekly recipe

$SSOH6WXIIHG &KLFNHQ%UHDVW ,QJUHGLHQWV

WDEOHVSRRQZDWHU WHDVSRRQVFRUQÃ&#x20AC;RXU WDEOHVSRRQFKRSSHGIUHVKSDUVOH\ WRJDUQLVK

6HUYHV  J VNLQOHVVERQHOHVVFKLFNHQ EUHDVW¿OOHWV VPDOODSSOHVWKLQO\VOLFHGRU FRDUVHO\VKUHGGHG WDEOHVSRRQVJUDWHGPLOG&KHGGDU FKHHVH WDEOHVSRRQEUHDGFUXPEV WDEOHVSRRQEXWWHU PO Ã&#x20AC;R] GU\ZKLWHZLQH PO Ã&#x20AC;R] ZDWHU

ANSWERS & SOLUTIONS Simplex Crossword T R E A S U R E

O W A N R D U R O A B E

A A S I M U S E N S E T S U S

D E E R S R E B E A P T C C L G E R E T E N D E T B I I S E W H I T E N A P L E T O N T U A H R I N E E G P E N S E

A D H E A T E R N H O L D E N D O E A L I A T E R R O U R D N A N U D G E F A J T R A I L A U C A R R E S T E A N E L A T E D

Quick Crossword B Y P A S O E E D E C L A R E S P E D C E I L I N T S U L I M I T S I P A B S E N T E S B A L E A P L E A L

S E L E D E R G E E X A M X P L D E

D

N A A

E R

C T U R G I O I S I C T Y S L L U M A

C N E M N E T L E R L Y L E D A N

Brain Teasers 1. 65.45 minutes (to 2 decimal places) 2. 15!, or 15 x 14 x 13 x 12...

Sud-o-ku 2 9 3 1 5 7 8 6 4

4 8 6 3 2 9 7 5 1

1 5 7 6 4 8 3 9 2

3 1 8 2 9 6 5 4 7

Sud-o-ku 7 1 4 9 3 6 8 2 5

9 3 8 7 5 2 6 4 1

2 5 6 1 4 8 9 3 7

3 6 1 8 2 7 4 5 9

5 8 9 4 6 7 1 3 2

6 1 7 3 8 2 5 9 4

9 5 3 8 4 6 2 7 1

8 3 1 9 6 2 4 7 5

9 7 5 4 1 3 2 8 6

6 4 2 8 7 5 1 3 9

Improvers

5 4 9 6 1 3 7 8 2

Sud-o-ku 2 3 4 5 9 1 7 6 8

5 6 4 7 3 1 9 2 8

8 2 7 4 9 5 1 6 3

4 7 5 3 8 1 2 9 6

1 8 2 5 6 9 3 7 4

6 9 3 2 7 4 5 1 8

Graduates

8 2 6 1 7 9 3 4 5

7 4 1 2 5 3 6 8 9

4 6 5 7 2 8 9 1 3

3 7 2 9 1 4 8 5 6

1 9 8 6 3 5 4 2 7

3UHSPLQ¾&RRNPLQ¾ 5HDG\LQPLQ &RPELQHDSSOHFKHHVHDQG EUHDGFUXPEV6HWDVLGH )ODWWHQFKLFNHQEUHDVWVEHWZHHQ VKHHWVRIJUHDVHSURRISDSHUWRFP WKLFNQHVV'LYLGHDSSOHPL[WXUH

Kieran Oâ&#x20AC;&#x2122;Gorman

Beginners

7 2 9 5 8 4 6 1 3

0HWKRG

EHWZHHQFKLFNHQEUHDVWVDQG UROOXSHDFKEUHDVW6HFXUHZLWK WRRWKSLFNV 0HOWEXWWHULQODUJHIU\LQJSDQRYHU PHGLXPKHDWDQGEURZQWKHVWXIIHG FKLFNHQEUHDVWV $GGZLQHDQGZDWHU&RYHU 6LPPHUIRUWRPLQXWHVRU XQWLOFKLFNHQLVQRORQJHUSLQN 7UDQVIHUFKLFNHQWRDVHUYLQJ SODWWHU&RPELQHWDEOHVSRRQ ZDWHUDQGFRUQÃ&#x20AC;RXUVWLULQWR MXLFHVLQSDQ&RRNDQGVWLUXQWLO WKLFNHQHG 3RXUVDXFHRYHUFKLFNHQDQG JDUQLVKZLWKSDUVOH\6HUYH

We will be a cut above at gala

,

7¶6KDUGWREHOLHYHLW¶VEHHQ WZHOYHPRQWKVVLQFHWKHODVW .LONHQQ\)DVKLRQ:HHNDQG ZKDWDQDPD]LQJHYHQWLWZDV 7KLV\HDUSURPLVHVWREHHYHQ ELJJHUDQGEHWWHU :HDW.LHUDQ2¶*RUPDQ +DLUDQG%HDXW\DUHYHU\ SURXGWREHLQYROYHGZLWK7KH *DOD)DVKLRQVKRZLQ/\UDWK (VWDWH+RWHOWRQLJKW:HGQHV GD\WK2FWREHU:HZLOO RYHUVHHWKHKDLUIRUWKHWRS PRGHOVLQYROYHGLQWKHHYHQW 6W\OLVWV&DWKHULQH&RQGHOODQG 6LQHDG.HHQDQZLOOFRRUGLQDWH DKRVWRIORRNVIURPWKHSOXV ORFDOIDVKLRQUHWDLOHUVVKRZFDV LQJ$:FROOHFWLRQV&DQ¶W :DLW 5HJDUGLQJWKLVVHDVRQ¶VKDLU WUHQGV7KH3RQ\WDLOLVELJ QHZV7KHSRQ\WDLOKDVWDNHQ PDQ\IRUPVRQWKHFDWZDON IURPZHWORRNSRQ\WDLOVWRYHU\ WH[WXUHGRQHVSRVLWLRQHGKLJK RQWKHFURZQRIWKHKHDGRUORZ WRWKHQDSH)RUDQHDV\ORRN WRFUHDWHDWKRPHDQGIRUH[WUD GUDPDDGGD3RQ\WDLOH[WHQVLRQ DQGDSSO\ORWVRIVKLQHVSUD\WR JHWWKDWVOHHNZHWORRN 1RWIRUJHWWLQJWKHJX\V

WKHORRNIROORZVWKURXJKZLWK VOHHNZHWORRNJHOOHGKDLUZLWK DWZLVWRIFXUORUQDWXUDOZDYH DOORZHGWRFRPHWKURXJK $V$XWXPQLVKHUHLW¶VWLPH WRJRWRGHHSHUKXHVZLWKFR ORXU,W¶VWKHWLPHRIULFKEXUQW RUDQJHVUXVWVDQGULFKUHGKXHV

*RQHDUHWKHGD\VRIWKH\HOORZ EULJKWQHVVRIWKHVXPPHUVXQ VRZHPXVWUHÃ&#x20AC;HFWWKLVLQRXU KDLUFRORXU +HUH¶VWRDJUHDW.LONHQQ\ )DVKLRQ:HHN,KRSHWRVHH \RXDWVRPHRILWVIDQWDVWLF HYHQWV


/LIH67</(

9 10 2013 KILKENNY REPORTER

T i m e O ut

CROSSWORDS 1

2

3

4

9

Simplex

5

6

8

10 11

12

13

14

15

16

17 18

20 22

19

by Michelle

2

3 8 5 6

B e g i n n e r s

6 2

8 6

5

5

8

28

1 4

29

30

Down 1. Wealth stored up (8). 2. Closet for film set (8). 3. Risen help might stock abundantly (9). 5. Build straight up (5). 6. Show lascivious pleasure over (5). 7. Cause to be loved (6). 8. Easy to cut or chew (6). 11. Balance in one’s favour (6). 16. One who holds lease (6). 17. A lunar nut could be indecently abnormal (9). 18. Lying near or next to (8). 19. Cause to feel suddenly despirited (8). 22. The entire property of (6). 23. Excites mirth in (6). 25. Great in size (5). 26. Puts in smooth working order (5).

Quick 3

4

8 9

9 3 5

G r a d u a t e s

5 1

6 9 2

6 4 7

9

3

2 6

4 6

7 5

4

1 4

3 4

7 1

9

6

6

BRAIN TEASERS

7

1

Ceann Comhairle, John Young, rang the bell and drew the Dail to a recess, and glanced up at the clock on the wall. He said, “I propose at this time to break for lunch. You will obser ve that the time is exactly twelve noon and the hands of the clock are such that the minute hand is exactly on top of the hour hand. We will re-assemble here at the time when the minute hand is next on top of the hour hand.

8 9 10 11

12 13

14

Question: Can you work out precisely in how many minutes that will be?

15

18 20

21 22

Across 1. Detoured (8). 7. Melody (4). 8. Announced (8). 9. Motor (6). 11. Roof (7). 12. Passageway (5). 14. Boundary (5). 15. Precisely (7). 17. Missing (6). 20. Evicted (8). 21. Jump (4). 22. Councillor (8).

This is a time for reflection, planning and proving that you have ever ything it takes to reach the dizzy heights. Don’t hold back when it comes to selling the goods; and if it is necessar y to be selfish and mean, don’t be shy about doing it. GEMINI May 21 - June 20

With business associates, colleagues and relatives at their least cooperative, you need to make your points succinctly, backed up by hard facts. If you let them get away with it this time, there will be no stopping them in the future. Something that happens over the next few days will make you realise that you have taken a wrong turning. It is not the end of the world, and may even work in your favour if you use it as an opportunity to review your goals and re-examine your motives. With a business or financial matter nearing its conclusion, you can star t thinking about more enjoyable things. Indications are you can focus on creative projects and romantic affairs at the end of the week. You really can start to relax and have fun. VIRGO August 24 - September 22

Someone you encounter over the next few days will open your eyes – and your mind – to a new interest or idea. But don’t just leave it at that: with all the signs just right, there is a strong chance that it could turn into a moneyspinner. LIBRA September 23 - October 22

If you are feeling overworked or undervalued, think again. What occurs over the next few days will remind you that life is for living, and that anyone who tries to undermine your happiness or self-esteem does not deser ve your talents or your time. SCORPIO October 23 - November 22

16 17

TAURUS April 21 - May 20

LEO July 23 - August 23

8

2

This week, heed the warnings of the planets and take whatever measures are necessar y to put your finances in order, and don’t leave things to chance. You can no longer rely on that friendly bank manager to sympathise – he’s, most likely, in a worse position.

CANCER June 21 - July 22

8

3

2

No. 021

5

1 7

8

I m p r o v e r s

3

4 4

31. Made exultant (6).

Across 1. Rises to reach great height (6). 4. Arrive at finish together (4,4). 9. In ecstasy (6). 10. Under obligation or indebted (8). 12. Sudden increase in power (5). 13. A late rite might pay like with like (9). 14. Jewish doctor of law (5). 15. Circuitous way (6). 20. Colour through fear from the win (6). 21. Give gentle encouragement to (5). 24. One weak or foolish (9). 27. Beaten path in wilds (5). 28. Enclose in hallowed place (8). 29. Legally seize and detain (6). 30. Period of indecision (8).

7 5

7

31

2

9

5 8 6

It is too easy to cross the line between enthusiasm and obsession, and you seem to be in danger of doing so when it comes to a creative venture of business affair. Slow down, stand back and view the complete picture. It may surprise you what you find. ARIES March 21 - April 20

27

9 2

1

2 7 8

1

4 26

1

3

No matter how stressed-out you feel, you must spend time listening to the problems of a relative or loved one this week. Even it their worries seem insignificant compared to your own, to them they are ver y real and ver y important. PISCES Februar y 19 - March 20

7 2

23 25

7 1

1

21

24

AQUARIUS Januar y 20 - Februar y 18

SUD-O-KU

No. 021

7

HOROSCOPES

Down 1. Insects (4). 2. Upright (4). 3. Snake (7). 4. Senior (5). 5. Interest (9). 6. Graveyard (8). 10. Sacking (9). 11. Guilty (8). 13. Specimen (7). 16. Pilfer (5). 18. Dump (4). 19. Slender (4).

19

I was at the local GAA club the other evening and found Sean, the team captain, in the changing room with a blank sheet and a pencil. “Figuring out the team for next Sunday?” I asked. “There isn’t much to figure out,” said Sean. “We only have fifteen players fit, so there’s only one team I can write down!” “Not so,” said I. “You have a vast number of possible teams.” Sean looked at me in bewilderment and so I explained. The players don’t always have to play in the same positions. So considering the full-back first, there are fifteen names you could write on the sheet in that position. For ever y on of the names there, you could now write any one of the fourteen remaining names in the next position on the sheet, and so on until all positions are filled with possibilities.

2

Question: Can you say how many differnt team sheets Sean could write out using only his fifteen players?

$16:(56RQ3DJH Answers and Solutions on Page ??

A change of roles and responsibilities is in the pipeline but you need to understand the ground rules before agreeing to anything. Talk to those you’ll be working with, but take what they say in context and in the light of your own experience. SAGITTARIUS November 23 - December 21

There is more to life than work and worry – as you’ll find out over the next few days. So stop wasting your time on things that cannot be changed, or may never happen, and start thinking of ways to improve the overall quality of your life. CAPRICORN December 22 - January 19

Romance, fun and fulfilling times lie ahead. They will be even more rewarding if you know what you want to do, and spend time planning and preparing. You have worked hard to earn your pleasures, so now is the time to reap the rewards and enjoy them.


52 | LIFESTYLE/FASHION

BY MAX CASEY

TOP TEN

1 2 3 4 5

KILKENNY REPORTER 9 10 2013

Pub of the week The Ennisnag Lounge The Ennisnag Lounge is a pub, located near Stoneyford and Danesfort. When entering this fine establishment, one would be forgiven for thinking they’ve just gone through a time machine. Every facet of this pub with the exception of its widescreen television screams golden nostalgia for the bygone 60’s lounge bars. Many pubs around

the country struggle with an austere sense of grime, especially during the day, that makes cans at home look more appealing but the Ennisnag Lounge is different. The pub always feels warm and friendly, it has a set patronage but is always welcoming to those outside. It’s the kind of place tourists think of when they imagine the ideal Irish pub.

Business of the week Amanda Burke Photography Amanda Burke Photography is a photography company based in Kilkenny who has recently opened a course in beginner’s photography. Starting on the 29th October, the classes will be held between 7:30 and 9:30pm at St

Patrick’s Parish Centre in Loughboy. The classes are designed for all sorts of different camera enthusiasts from those completely alien to the idea of photography to those who already know what they’re doing. There is

always more to know and Amanda Burke will guide you through your learning process. The course will run for 8 weeks and includes field trips and sessions on portraits. For more information visit www. amandaburkephotography.com.

Book of the week Gillian Flynn- Gone Girl Gone Girl is the newest book by American author Gillian Flynn, published in January of this year. The book tells the story of Nick Dunne, happily married to his wife Amy Dunne until their fifth anniversary in which his

wife goes missing. The police suspect Nick, Amy’s friends reveal secrets that she had been keeping from her husband, and when the police analyze his computer, they find strange searches that he swears are not his.

The book is a thriller and quite a long one, coming in at about 500 pages but it does manage to stay interesting until the end which already puts it above most thrillers. Overall a good read and worth a look.

Game of the week Dota 2 Dota 2 is a free multiplayer PC game, developed by Valve and available on Steam. Though hundreds of thousands of players could play the game in beta the game has only been officially released recently. The genre (moba) currently houses the most popular multiplayer games in the world with 555,245 people currently playing Dota

2 with peak times that often excess ten times that. The basic idea is that there are two teams of five who set up on opposite sides of a symmetrical map and fight to destroy the core at the op-

posing teams main base. Each player plays as a champion (of which you can choose from a list of hundreds) who levels up and learns new abilities in games that last about fourty-five minutes. The basic formula soon becomes intoxicating and extremely addictive, with many players exceeding a thousand hours in the game already. The game is also low intensity on graphics so should play on almost anything.

DVD of the week Dead Man Down Dead Man Down is a new neo noir crime thriller directed by Danish director Niels Arden Oplev and starring Colin Farrell. The film is at heart about a man and a woman; Vic (Farrell) is a thug working for a ruthless mobster who he intends to torture and kill and Beatrice (Noomi Rapace) is a traumatized woman who has been in a car accident. On their first date, Beatrice reveals that she owns Vic kills people

and wants him to kill the man who hit her with his car, disfiguring her face in the process. I’ll be honest this film isn’t great. When I saw it I thought it was a 6/10 at best but unfortunately there doesn’t seem to be anything much coming out in the realm of DVD’s at the moment so here we are. Give it a few more weeks and we’ll be getting a few of the Summer films but until then.. Dead Man Down is decent.


LIFESTYLE/FASHION | 53

9 10 2013 KILKENNY REPORTER

Charity Shops Not only are charity clothes shop the cheapest possible option for those in search of clothes, it is also the most fashionable! Ok maybe three years they were the most fashionable before ‘hipster’ re entered everyone’s vocabulary but I’ll be damned if they don’t provide a plethora of great clothing options for next

to nothing. In the US the Salvation Army has shops the size of lidl but here in Ireland instead we have dozens of little shops that all represent different charities. So instead of picking just one I thought it best to collectively give this meagre award to all the charity shops that sprout like weeds around the city centre.

App of the week Duolingo Duolingo is a free educational app that will help you learn languages in a clean and effective manner. Until recently one would have to use the duolingo website to make use of its fantastic services but no more. The app divides languages into small sections that all form together into a tree like structure where you often get to pick what you want to study next. The app

is designed so you can use it for five minutes or five hours and obtain results every time, it’s the sort of app you’re supposed to use every day in order to learn. The course is easy, fun and completely free with no ads or in app purchases. Languages now available include: Spanish, French, German, Portuguese, Italian and English. It’s an app that I have used personally for months and found it extremely helpful.

Film of the week Blue Jasmine Blue Jasmine is the new film by the great (if divisive) Woody Allen and stars Cate Blanchett, Alec Baldwin and Peter Sarsgaard. The films tells the story of a New York socialite brought low who moves in with her poorer sister in San Francisco to rebuild her life. The premise has brought comparisons with A

Streetcar Named Desire and certainly these sentiments are not uncalled for, most notably in its basic plot structure and its main characters. The film has been receiving absolutely rave review and has been called by contemporary critics Allen’s best film since Manhattan. It is unquestionably worth seeing.

Gig of the week David O’Doherty David O’Doherty is a very famous Irish comedian, author, musician, actor and playwright who has won many, many awards in his time such as The Perrier Award. He will be playing at the set theatre next Saturday, the 12th October, and will be starting at 8PM. This new comedy show

Album of the Week The Haxan Cloak- Excavation Excavation, released in April of this year, is the newest album by London based music producer Bobby Krlic aka The Haxan Cloak. The album is a dark ambient work that’s main objective is to horrify you. The album resembles the soundtrack to a horror film and is obsessed with low frequency, physical, cacophonic sounds. But

Krlic also knows that one needs lighter moments over an hour of music, so these dark terrifying moments are punctuated with sounds of absolute beauty. The album is at its core, an experience; and one shouldn’t listen to it unless they’re ready to spend the next hour completely submerged in its sounds.

that he is touring with includes both talking and songs and no scrubs. He is a comedian whose most potent tools are his legendary dry sarcasm and sporadic topics of song such as angry mathematicians, finding love and how to dislodge badger’s from one’s leg. The gig will cost €18 and is well worth the cost.

Top ten

6 7 8 9 10

Clothes Shop of the week


54 | NEWS

KILKENNY REPORTER 9 10 2013

'$<6&+('8/( )5,'$<6  086,&$$$ &UDLJ2·6KHDDQG&LDQ'RRODQ

 6RFLDO,QFOXVLRQ -DPLH'RKHQ\-RKQ0DKHUDQG$VKOH\7UHDF\

,Q7KH0RRG %HU6FRWW

 /HLVXUHO\/XQFK 0LNH2%ULHQ

 $IWHUQRRQ'HOLJKW )UDQN&R\QH

 &ODVVLFDO&ROOHFWLRQ /LDP/DQJUHOOH

 7KH)RRG)LOHV FRRNHU\VKRZ  )LRQD'LOORQDQG3DGG\'DO\

 6SRUWV3UHYLHZ 3DW7UHDF\DQG6SRUWV3DQHO

 &RPPXQLW\1RWLFH%RDUG /L].HWWDQG0DXUD&ODQF\

 )ULGD\)ODVKEDFN %HVWRISUHYLRXVZHHNVSURJUDPPHVV

 /RYH=RQH /DUU\'RZG

 6RXOCG6HVVLRQV &OHYHODQG0LNH

6$785'$<6  *RRG0RUQLQJ.. 'DYH*DOODJKHUDQG-DQLQH'RROH\

&RQYHUVDWLRQV6DWXUGD\)RUXP ..7RGD\ <HVWHUGD\ 0DUWKD%ROJHUDQG6HDQ'5DIWHU

 &LW\6SRUW 3DW7UHDF\1LFNH\%UHQQDQ%DUULH+HQULTXHV%HU6FRWWDQG6HDPXV %URSK\

 6DWXUGD\0XVLF 'RQ'HYOLQ7-0LOOVDQG-DPLH0DORQH

 3ROLVK6KRZ *RVLD$JDWD6LPRQDQG$QLD

 $URXQG(XURSH '-<)LUH

 7KH7UDG6KRZ 1LFKRODV'XQSK\

 $URXQG7KH)LUH $QQ0DULH+RJDQ

 &ODVVLF+LWV6DWXUGD\ 0DUWLQ0RUULV

 0HOORZ0RRGV 'HV0XUSK\

681'$<6  *RRG0RUQLQJ.. 0DUN&ROOLQVDQG$LVOLQJ.HRKDQH

$OO5HTXHVW6XQGD\ -RH0DORQH

<RXU&RPP<RXU*URXS 0DFUD6KRZ

 6SLULW$OLYH )U:LOOLH3XUFHOODQG+HLGL*RRG

 6XQGD\%UXQFK %LOO:DOVK

 7KH3RG '\ODQ0HJDQ%HFN\DQG&LDUD

 0XVLF)RU$OO 7RPP\'RZG

 5K\WKP 5RRWV .%

 7DON6SRUW 3DW7UHDF\DQG6SRUWV7HDP

 6WUDLJKW7DON 3DW0F.HHDQG6DP0DWKHZV

 &RXQWU\ ,ULVK 5D\1RODQ

5RFN6KRZ 'U0DFDQG'DUUDJK0F&DQQ

5RFN5DGLR -RKQ.DYDQDJKDQG/HZLV5HGPRQG

Community Radio Kilkenny City telephone 056-77-62777; Text 086-3537782


NEWS | 55

9 10 2013 KILKENNY REPORTER

FZaeWiWdWfZWVSke Great sport as we ramble in memory lane JIMMY RHATIGAN JIMMYRHATIGAN@GMAIL.COM

7+$1.672NLQGUHDGHUVZH WDNH D OLWWOH WULS GRZQ PHPRU\ ODQHWRGD\DVZHIRFXVRQKXUO LQJ DQG KDQGEDOO VWDUV RI WKH SDVW DQG DOVR UHFDOO WKH KDOI D FHQWXU\ ZKLFK ORFDO KHUR 3DW 6KRUWLVD)UHHPDQRI.LONHQQ\ VSHQWDW6PLWKZLFN¶V%UHZHU\ 2XU KXUOLQJ SLFWXUH ZH DUH WROG IHDWXUHV PHPEHUV RI WKH RQFH PLJKW\ 6W 5LRFK¶V *$$ &OXE DW WKH KHDUW RI .LONHQQ\ &LW\2XUWHDPLWVHHPVSOD\HG LQDVHYHQDVLGHEOLW]DWWKH)DLU *UHHQDQGPD\HYHQKDYHZRQ WKHFRPSHWLWLRQ :H GR NQRZ VRPH RI WKRVH LQYROYHG EXW ZRXOG DSSUHFLDWH LI DQ\ UHDGHU FDQ JLYH XV WKH QDPHVRIDOOWKRVHLQWKHSKRWR JUDSKSOD\HUVDQGPHQWRUV 2XU KDQGEDOO SKRWR DOVR IHD WXUHV VRPH IDPLOLDU IDFHV EXW DJDLQZHDUHORVWDVWRWKHQDPHV RIPDQ\RIWKRVHZKRPD\KDYH EHHQPHPEHUVRIWKHIDPHG7DO ERW¶V,QFK+DQGEDOO&OXE$JDLQ ZHZRXOGDSSUHFLDWHDQ\DVVLV WDQFH 7KH JHQWOHPDQ SLFWXUHG E\ 'RQDO )ROH\ RXWVLGH ZKDW LV QRZ NQRZQ DV 6W  )UDQFLV$E EH\%UHZHU\LVQRQHRWKHUWKDQ VSULJKWO\ QRQDJHQDULDQ 3DW 6KRUWLV ZKR VSHQW DOPRVW  \HDUVRQWKHEUHZHU\VWDII +H ZDV D VXSHUYLVRU LQ WKH EUHZKRXVH DW WKH EUHZHU\ WKH ROGDQGWKHQPRUHPRGHUQEUH ZKRXVHIRU\HDUV 7KH LQVHW SLFWXUH LV RQH RI D PXFK \RXQJHU 3DW GXULQJ KLV EUHZHU\GD\VZKHQKHZDVWDN

Talbot’s Inch handballers

Pat Shortis outside St Francis Abbey Brewery LQJDVDPSOHLQWKHEUHZKRXVH FRXQW\ RQH RI RXU PRUH DFWLYH 3DWLVLQJUHDWIRUPVWLOOSOD\ VHQLRUFLWL]HQVDWWKHDJHRI LQJ PXVLF VLQJLQJ DQG WHOO 7KHKXUOLQJDQGKDQGEDOOSLF LQJ MRNHV DQG KHOSLQJ RXW DW WXUHVZHUHORDQHGWRXVE\PHP FKDULWDEOHHYHQWVLQWKHFLW\DQG EHUVRIORFDOIDPLOLHV

St Rioch’s hurlers

Michael and Alice Blanchfield have thanked their customers and staff who took part in the Centra Action Breast Cancer walk in Mooncoin on Sunday. A great day was had by all and a large sum of money was raised.


56 | ADVERTISEMENT

KILKENNY REPORTER 9 10 2013

Clearys OCTOBER 2 DAY

SPECIALOFFERS! Waterford Stanley Bilberry Non Boiler Stove - 5kW l l l l

Full cast iron construction Heat resistant glass door Under grate air supply Burns everyday household solid fuels

STARTS Friday 11 & 12 OCTOBER

Blacksmith Stoves Anvil 6kW Non Boiler Stove - Matt Black

Blacksmith Stoves Artisan 5kW Non Boiler Stove - Black Enamel

ROCK BOTTOM PRICE Was €349.00

OUR PRICE

a

Was €669.00 OUR PRICE a

€299.

00

Sirocco 9 Fin Oil Filled Radiator 2kW

Was €44.99 OUR PRICE a

€39.

99

SPECIAL OFFER

Topline Clearys Carrick on Suir, Co.Tipperary Tel: 051 640034

€619.

00

´ na Bord na Mo Peat Briquettes

OUR PRICE a

€3.

99

4 FOR

€15.00

GREAT VALUE

Was €839.00 OUR PRICE a

€769.

00

GREAT VALUE

Beko Chest Freezer - F393APW

Triton T90Z Pumped Electric Shower 8.5kW - White

OUR PRICE a

OUR PRICE a

€169.

99

GREAT PRICE

€209.

99

WOW OFFER

STORE OPENING HOURS: MON-FRI SAT SUN

8.30am-5.30pm 9.00am-5.00pm Closed

Disclaimer: E & OE. All items subject to availability. All goods on sale are for cash only, VAT inclusive. Prices shown are correct at the time of print. Pictures are for illustration purposes only. Every effort has been made to ensure the details of this promotion are correct but errors and omissions cannot be discounted. Assembly and delivery not included. All rights reserved. While stocks last.


Peter Mark salon ready to show its true colours /

DVW)ULGD\VDZWKH .LONHQQ\3HWHU0DUN KDLUGUHVVLQJVDORQ FDSWXUHLWVHQWU\IRUWKH FRPSHWLWLRQIRUFRORXU H[FHOOHQFHKRVWHGE\/¶2UHDO 7KHPRGHOORFDOJLUO(GHQ 6PLWKDSSHDUHGLQIURQW RIWKHFRXUWKRXVHLQKLJK KHHOVDORQJEODFNGUHVV DQGDVKLPPHULQJNLPRQR OHQGLQJKHUDFHUWDLQRULHQWDO ORRN+HUKDLUH[HPSOL¿HG

DSOHWKRUDRIUHGVDQGZDV GUHVVHGLQDPRGHUQVW\OHWKH SLFWXUHWHOOVPRUHWKDQZRUGV FRXOGHYHUH[SUHVV 7KHFRPSHWLWLRQLVEHLQJ KHOGEHWZHHQDOO3HWHU 0DUNVDORQVORFDWHGRQRXU LVODQG 7KH0DUNHW&URVV6DORQ¶V SUHPLHUKDLUVW\OLVWLV/RXLVH 0F$UGOHDFRORXUGHJUHH VSHFLDOLVWZLWKRYHUVL[\HDUV¶ H[SHULHQFHLQWKLV3HWHU0DUN

+DLUVDORQ:LWKDVVLVWDQW FRORXULVW&KULVWLQH 2¶'Z\HUDQGPDNHXS DUWLVW(PPD0DJXLUH(GHQ 6PLWK¶VKDLUZDVVFXOSWHG LQWRVRPHWKLQJRIH[WUHPH VSOHQGRUDQGEHDXW\ZKRVH UDGLDQFHZDVFRQWUDVWHGWR ERXQGOHVVHIIHFWZLWKWKH OHDGHQVWRQHFKDUDFWHURIWKH FRXUWKRXVH7KHFRPSHWLWLRQ¶V QH[WURXQGZLOOEHKHOGLQ 1RYHPEHU


H 0  U H S P D 3

Ž

&+226(21(75($70(17)520($&+%2;)25 +RW6WRQH%DFN1HFN DQG6FDOS0DVVDJH 6KHOODF3DLQWRQ +DQGVRU)HHW /X[XU\)DFH %RG\6FUXE

(\HODVK7LQW

)DFH 6FDOS0DVVDJH

(\HEURZ7LQW

6RRWKLQJ)RRW0DVVDJH

/LS &KLQ:D[

%RG\3ROLVK

(\HEURZ6KDSH

/X[XU\%DFN0DVVDJH 0LQL)DFLDO

,QGXOJHQW%DFN7UHDWPHQW

3 TREATMENTS FOR JUST â&#x201A;¬65 - 1 HR 25MINS TREATMENT TIME

7R%RRN&RQWDFW.26SD7HO


2 10 2013 KILKENNY REPORTER

ADVERTISEMENT | 67


68 | NEWS

KILKENNY REPORTER 9 10 2013

Afternoon tea was a piece of cake! JIMMY RHATIGAN JIMMYRHATIGAN@GMAIL.COM

$ %5,//,$17 DIWHUQRRQ WHD IXQFWLRQ IRU RYHU  VHQLRU FLWL]HQVWXUQHGRXWWREHDSLHFH RIFDNH±OLWHUDOO\ 7KH .LONHQQ\ 2OGHU 3HRSOH¶V )RUXP FHOHEUDWHG $JH $FWLRQ :HHN ZLWK D WHD GDQFH LQ WKH FLW\¶V2UPRQGH+RWHO 7KHRFFDVLRQUHSUHVHQWHGWUXH FRPPXQLW\ VSLULW LQ DFWLRQ DV WKH RUJDQLVHUV LQYLWHG SHRSOH IURP FLW\ DQG FRXQW\ WR D FHO HEUDWLRQ RI VHQLRU \HDUV 7KH KRWHO JDYH WKHLU EDOOURRP IUHH RIFKDUJHDQGVXSSOLHGOLJKWUH IUHVKPHQWV ³,WZDVEULOOLDQWWKHKRWHOZDV H[FHOOHQW ZDUP DQG ZHOFRP LQJ WKH RUJDQLVHUV GLG D JUHDW MREDQGPHQDQGZRPHQPRVW O\ ZRPHQ WXUQHG XS LQ JRRG QXPEHUV IRU ZKDW WXUQHG RXW WR EH DQ HQMR\DEOH IHZ KRXUV RIGDQFLQJDQGFKDWWLQJ´FRP PLWWHHPHPEHU%XWWVPDQ&KD +DLGHWROG7KH5HSRUWHU

&XSSDDQGELVFXLW &KDGLVFRYHUHGWKDWWKHHYHQW SURYHGWREHDSLHFHRIFDNHLQ PRUHZD\VWKDQRQH ,W ZDV D  SLHFH RI FDNH FRO ORTXLDOO\ µHDV\ WR UXQ¶ RU µZHOO UXQ¶EHFDXVHHYHU\WKLQJUDQVR VPRRWKO\ %XWLWZDVDOVRDSLHFHRIFDNH EHFDXVH ZKHQ YROXQWHHU GRRU PDQ &KD WRRN D EUHDN IRU D FXSSDDQGDELVFXLWWKHELVFXLWV KDGUXQRXW ³7UXHWRLWVFRPPLWPHQWDVDQ $JH)ULHQGO\+RWHO $)+ WKH 2UPRQGH DQ$)+ DZDUG ZLQ QHU LPPHGLDWHO\ VXSSOLHG PH ZLWK D EHDXWLIXO VOLFH RI FDNH ZKLFK , WKRURXJKO\ HQMR\HG´ &KDWROG7KH5HSRUWHU $VDOXWH ,W ZDV WKDW NLQG RI DIWHUQRRQ DV SHRSOH IURP DOO DUHDV RI WKH FLW\ DORQJ ZLWK IHOORZ VHQLRUV IURP+XJJLQVWRZQ'XQQDPDJ JLQ7KRPDVWRZQ DQG RWKHU OR FDO WRZQV HQMR\HG ZKDW PLJKW EH WHUPHG WKHLU *DWKHULQJ DV D VDOXWHWR$JH$FWLRQ:HHN

0DVWHU RI FHUHPRQLHV ZDV FRPPLWWHH PHPEHU 0DU\ +DQ UDKDQ'XNHVPHDGRZVZKRGLG D EULOOLDQWMRE 'DQFLQJ FRQWLQ XHGIURPSPWRSPDQG WKHUHZDVDVLPSOHTXHVWLRQRQ WKH PLQGV RI PDQ\ DV WKH HYH QLQJ GUHZ WR D FORVH µ:KHQ LV WKH QH[W $IWHUQRRQ 7HD"¶ ³.LONHQQ\LVDSURJUHVVLYH$JH )ULHQGO\&LW\´&KDHQWKXVHG &UHGLWWRFLW\ ³$WWKH2OGHU3HRSOH¶V)RUXP ZH DUH SDUW RI WKH .LONHQQ\ $OOLDQFH ZKLFK SURPRWHV DJH IULHQGOLQHVV D FRQFHSW ZKLFK , EHOLHYH ZDV KDQGHG GRZQ E\ WKH:RUOG+HDOWK2UJDQLVDWLRQ ³/HW¶VJLYHFUHGLWZKHUHFUHGLW LVGXH3HRSOHKHUHDUHYHU\UH VSHFWIXODQGVXSSRUWLYH:HDUH FRQVXOWHG E\ RXU ORFDO DXWKRUL WLHV ZKHQ FKDQJHV DUH EHLQJ PDGH WR RXU FLW\ DQG HQYLURQV :H KDYH PDQ\ DJHIULHQGO\ UHVWDXUDQWV ZKR ORRN DIWHU WKH QHHGV RI VHQLRUV DQG ZH KDYH KRWHOV OLNH WKH 2UPRQGH ZKLFK DUHDFUHGLWWRRXUFLW\´

Letâ&#x20AC;&#x2122;s dance: Annette Cummins and Noelle Walsh

Dedicated organisers: Ann McLoughlin, Breege Murphy, Cha Haide, Mairead Phelan, Mary Oâ&#x20AC;&#x2122;Hanrahan, Nora Webster, Mick Ryan and Bob McMunn

David Creane and Bob McMunn

Mary Cuddihy and Nuala Moore

Country and western radio presenter Johnny Barry and Michael Brennan

All pics: Noel Hoyne


NEWS | 69

9 10 2013 KILKENNY REPORTER

Kate Tennyson, Margaret Hoyne, Mary Doyle, Nellie Walsh, Violet Carr, Nellie Duggan, Mary Cuddihy, May O’Shea, Alex Murphy, Kate Leahy

Mary Hanrahan and Con Shanley

Musicians Seamus Holden and Dickie Phelan

Nellie and Matty O’Shea

Una Kelly and Dessie Collins


70 | ADVERTISEMENT

KILKENNY REPORTER 2 10 2013


74 | NEWS

KILKENNY REPORTER 9 10 2013

Positive thoughts: Laughter was free and going for a song!

$ )5(( ODXJKWHU \RJD VHV VLRQ ZDV JLYHQ E\ )HUU\EDQN /LIHVW\OH/LQNVLQWKHOLEUDU\DV SDUWRI3RVLWLYH$JHLQJ:HHN 7KHUH ZHUH VRPH JUHDW SHR SOH DW WKH ZRUNVKRS ZKR DOO

OHIW VPLOLQJ DQG UHOD[HG +XJH WKDQNV ZHQW WR %HUQDGHWWH DQG 6WDQ3KLOLSVZKRWRRNWLPHRXW RI WKHLU EXV\ VFKHGXOH WR ¿QLVK ZLWK PHGLWDWLRQ ZKLFK ZDV HQ MR\HGE\DOO

)U :LOOLH 3XUFHOO RI .LONHQQ\ *RVSHO &KRLU HQWHUWDLQHG GXU LQJ D µ6LQJLQJ IRU :HOOEHLQJ¶ VHVVLRQ 7KH ORFDO µ0XVLF LQ 0RWLRQ&KRLU¶VDQJWKUHHVRQJV IURP WKHLU UHSHUWRLUH DV SDUW RI

WKLVHYHQWDQGKHOSHGWRPDNHLW DGD\WRUHPHPEHU 6LPSO\6LQJLQJ $V D GLUHFW UHVXOW RI WKLV ZRUNVKRS D FRPPXQLW\ LQLWLD WLYH 6LPSO\ 6LQJLQJ EHJLQV LQ

)HUUU\EDQN /LEUDU\ RQ 2FWREHU  SP 6LQJDORQJV DUH D KHDOWK\DQGIXQZD\WRSDVVDQ KRXU ZLWK IULHQGV DQG QHLJK ERXUV ZKLOH HQMR\LQJ \RXU ID YRXULWHVRQJV

<RXGRQ¶WKDYHWREHDPHP EHURIDFKRLURUKDYHDQ\PXVL FDOH[SHULHQFHWRMRLQ7KHVHV VLRQVIRUDGXOWVZLOOUXQIRURQH KRXUDWSPHDFK:HGQHVGD\ XSWR'HFHPEHU


9 10 2013 KILKENNY REPORTER

ADVERTISEMENT | 75


76 | NEWS

KILKENNY REPORTER 9 10 2013

â&#x20AC;&#x2DC;Now for our democratic revolution!â&#x20AC;&#x2122; 7+(  µ1R¶ YRWH GHOLYHUHG E\ YRWHUV LQ &DUORZ.LONHQQ\ DQG DFURVV,UHODQGEULQJVLQWRIRFXV WKH QHHG IRU UHDO DQG PHDQLQJ IXO UHIRUP RI WKH 6HDQDG DQG 'iLO VD\V SROLWLFDO DFWLYLVW 3DWULFN0F.HH +H VDLG (QGD .HQQ\ FDPH LQWR RI¿FH SURPLVLQJ D GHPR FUDWLF UHYROXWLRQ ³7KH SHRSOH KDYH UHPLQGHG KLP WR IROORZ WKURXJK RQ WKLV FRPPLWPHQW 7KH UHYROXWLRQ LV QHHGHG 1RZ OHW¶VJHWRQZLWKLW´3DWULFNWROG 7KH5HSRUWHU ³7KH SURSRVDO WR DEROLVK WKH 6HDQDG ZDV EDG WLPLQJ EDG VWUDWHJ\ DQG EDG DGYLFH JLYHQ WRWKH7DRLVHDFK,WZDVDOZD\V P\YLHZWKDWLQDWLPHRIFULVLV WKH ODVW WKLQJ ZH QHHGHG ZDV FDUYLQJXSRXUGHPRFUDWLFLQVWL WXWLRQVDQGULSSLQJXSYDVWVHF WLRQVRIRXU&RQVWLWXWLRQ´

+H VDLG WKH *RYHUQPHQW¶V SURSRVDOZDVQRWKLQJPRUHWKDQ D F\QLFDO SRZHU JUDE DLPHG DW FRQFHQWUDWLQJ PRUH SRZHU LQ WKHKDQGVRI0LQLVWHUV ³:H DOO NQRZ RQO\ WRR ZHOO ZKDW KDSSHQV ZKHQ ZH FRQ FHQWUDWHSRZHULQWKHKDQGVRID VPDOOQXPEHURISHRSOH 7KH\GLGQ¶WZLQ ³:HQHHGWRRSHQXSRUGHPR FUDWLF LQVWLWXWLRQV QRW FORVH WKHPGRZQ ³,Q WHUPV RI WKH FDPSDLJQ DOO WKH DGYDQWDJHV OD\ ZLWK WKH *RYHUQPHQW¶V µ<HV¶ FDPSDLJQ 7KH\KDGWKHIXQGVWKHSHUVRQ QHO DQG WKH VSLQ GRFWRUV EXW WKH\GLGQ¶WZLQ ³7KH,ULVKYRWHUVWRRNWLPHWR XQGHUVWDQG WKH LVVXHV LQYROYHG QRWZLWKVWDQGLQJ WKH RQVODXJKW RI SRSXOLVW UKHWRULF DQG FKHDS KHDGOLQHV ,W LV D YLFWRU\ IRU

FLYLF,UHODQG´ 3DWULFN VDLG WKH PRVW LPSRU WDQW FRQVHTXHQFH RI WKH SHR SOH¶V GHFLVLRQ LV WKDW WKH\ KDYH QRZ JLYHQ WKH 7DRLVHDFK DQG WKH UHVW RI WKH *RYHUQPHQW D PDQGDWHIRUUHDOUHIRUP ³,DPFRQYLQFHGWKDWLQWRWKH IXWXUHZHZLOOORRNEDFNDQGEH WKDQNIXO WKDW ZH FKRVH UHIRUP RYHUDEROLVKPHQW ³2QH RI WKH WDVNV , ZRXOG OLNH WR VHH D UHIRUPHG 6HDQDG XQGHUWDNH LV D FRQFHUWHG HIIRUW LQ VWUHQJWKHQLQJ RXU OLQN ZLWK 1RUWKHUQ,UHODQG ³7KH 3HDFH 3URFHVV LV RQ JRLQJ DQG LV QHHG RI FRQVWDQW DWWHQWLRQ $OORZLQJ UHSUHVHQWD WLYHVWDNHXSVHDWVLQDUHIRUPHG 6HDQDG ZRXOG EH D YHU\ ZHO FRPHPRYH´KHDGGHG

Patrick McKee


        

              

  

i

0DWW%ODFN)LQLVK

i

 %ODFNRU&UHDP(QDPHO)LQLVK  .:%RLOHU0RGHO$YDLODEOH

i

    

723/,1(52:(6  &+$76:257+675((7&$67/(&20(5&2.,/.(11<7(/)$; ,d^tKZd,^dZd͕^d>KDZ͕K͘</><EEzd>͗Ϭϱϲϰϰϰϭϯϯϴ&y͗Ϭϱϲϰϰϰϭϭϰϳ

(0$,/LQIR#URZHVKDUGZDUHLH:(%ZZZURZHVKDUGZDUHLH D/>͗ƌŽǁĞƐŚĂƌĚǁĂƌĞΛĞŝƌĐŽŵ͘ŶĞƚt͗ǁǁǁ͘ƌŽǁĞƐŚĂƌĚǁĂƌĞ͘ŝĞ


84 | NEWS

KILKENNY REPORTER 9 10 2013

All Pics: Noel Hoyne

A lone balloon in fond memory

JIMMY RHATIGAN JIMMYRHATIGAN@GMAIL.COM

,7 :$6 D SRLJQDQW FHUHPRQ\ EXWDYHU\DSWRQH 7KH UHOHDVH RI D VLQJOH UHG EDOORRQZDVLQIRQGPHPRU\RI RXU SHRSOH ZKR ORVW WKHLU OLYHV WKURXJKDGGLFWLRQLQWKHODVW PRQWKV ,W ZDV D UHPLQGHU WRR RI WKH WULDOVDQGWULEXODWLRQVRIDOFRKRO

DQGGUXJDEXVHWKHKXUWWRIDPL OLHVWKHVWUXJJOHIRUUHFRYHU\ 7KH EDOORRQ ZDV UHOHDVHG DW &LW\ +DOO E\ 0DJV /HDK\ D OHDGLQJ FDPSDLJQHU IRU GUXJV DZDUHQHVV DQG 0D\RU 0DUWLQ %UHWW 7KH FHUHPRQ\ IROORZHG D &RPPHPRUDWLRQRI+RSH:DON IURP -RKQ¶V 4XD\ WR +LJK 6WUHHWDQHYHQWZKLFKDWWUDFWHG XSWRSHRSOHDZDONZKLFK

VLJQDOOHG WKH HQG RI 'UXJV $ZDUHQHVV :HHN D SURMHFW RI WKH .LONHQQ\ &LW\ DQG &RXQW\ 'UXJV7DVN)RUFH 6SHDNHUV LQFOXGHG )U 3HWHU 0F9HUU\WKHYRLFHRIRXUKRPH OHVV DQG SRRU $QJHOD 3DUNHU RI )DPLO\ 6XSSRUW DQG &ROLQ .HDWLQJ RI WKH +HDOWK 6HUYLFHV ([HFXWLYH 7KHUH ZHUH UHDGLQJV E\ 'XEOLQ¶V %LVKRS (DPRQ :DOVK

DQG ORFDO &KXUFK RI ,UHODQG %LVKRS0LFKDHO%XUURZV :DONRIKRSH 0DJV/HDK\UHDGDSRHPDQG WKHUHZDVVXSSRUWLQPXVLFDQG VRQJ IURP .LONHQQ\ *RVSHO &KRLU FRQGXFWHG E\ )U :LOOLH 3XUFHOO 0DVWHU RI FHUHPRQLHV ZDV &RXQFLOORU -RH 0DORQH ZKR DORQJ ZLWK 0DJV /HDK\ ZDV GHHSO\LQYROYHGLQWKHFRRUGL

QDWLRQRIDZHHNZKLFKLQFOXGHG HYHQWVDWVFKRRODQGSDULVKOHYHO WKURXJKRXWRXUFLW\DQGFRXQW\ 3DUWLFLSDQWV LQ WKH VKRUW ZDON RI KRSH FDUULHG OLJKWHG FDQGOHV DQG LQIRUPDWLRQ OHDÃ&#x20AC;HWV ZHUH GLVWULEXWHGRXWOLQLQJWKHVHUYLF HVDYDLODEOHWRWKRVHH[SHULHQF LQJ WKH SDLQV RI DGGLFWLRQ DQG WKHLUIDPLOLHV -RH0DORQHWROG7KH5HSRUWHU WKDW ZKLOH WKH ZHHN ZDV D ELJ

Angela Parker of Family Support and Mags Leahy

MC Joe Malone welcomes families and friends

In support: Amelie Foley

Marianne Kelly, Fr Peter McVerry and Mary Purcell

VXFFHVV LW ZDV LPSRUWDQW WR UHPHPEHU WKDW HYHU\ ZHHN LV GUXJV¶DZDUHQHVVZHHNDQGWKDW WKH.LONHQQ\7DVN)RUFHFRQWLQ XRXVO\ZRUNVZLWK*RYHUQPHQW DJHQFLHV DQG YROXQWDU\ JURXSV WRKLJKOLJKWDGGLFWLRQSUREOHPV DQGWRJLYHDPHVVDJHRIKRSHWR IDPLOLHVLQGLVWUHVV ³7KHZHHNZDVH[FHOOHQW´VDLG -RH³EXWLWLVYLWDOWRUHPHPEHU WKDWWKHZRUNLVRQJRLQJ´


NEWS | 85

9 10 2013 KILKENNY REPORTER

of relatives and friends we lost

Eve Tuohy supported drug awareness

Members of Kilkenny Gospel Choir

Our youth took part

Eimear Roche and Yvonne Finnegan

Cynthia and Giselle Edozcue

Mayor Martin Brett with Evan Antrop and Larry Carroll


1$7,21$/7<5( 6$)(7<:((. &29(5


2 10 2013 KILKENNY REPORTER

MOTORS | 87


88 | MOTORS

KILKENNY REPORTER 2 10 2013


2 10 2013 KILKENNY REPORTER

MOTORS | 89


90 | MOTORS

KILKENNY REPORTER 2 10 2013


KILKENNY REPORTER, 9TH OCYOBER 2013

MOTORING

AUDIâ&#x20AC;&#x2122;S A GAME

)

DVKLRQDEOH VPDOO FDUV DUH D ERRP LQGXVWU\ DW WKH PRPHQW ZLWK QXPHURXV PDQXIDF WXUHUV GHFLGLQJ WKDW 0,1, KDV KDG WKLQJV LWV RZQ ZD\IRUWRRORQJ$XGL¶VDWWHPSW WR PXVFOH LQ LV WKH $ DQG LWV 9RONVZDJHQ 3ROR PHFKDQLFDOV FRXSOHGZLWKFODVV\$XGLGHVLJQ JLYHLWD¿JKWLQJFKDQFH %DFNJURXQG 5LVLQJPRWRULQJFRVWVHQYLURQ PHQWDO DZDUHQHVV DQG WUDI¿F OHYHOV VWDUWHG PDNLQJ VPDOOHU FDUV PRUH DWWUDFWLYH WR PRUH SHRSOH %0:¶V 0,1, VKRZHG WKDW ORWV RI EX\HUV ZRXOG LQ GHHG SD\ H[WUD IRU D VW\OLVK VX SHUPLQLZLWKWKHULJKWEUDQGLQJ DQG PDUNHWLQJ PL[ 6XGGHQO\ SUHPLXPVPDOOFDUVPDNHVHQVH LQDZD\WKDWVHHPHGDORQJZD\ GLVWDQWEDFNLQZKHQ$XGL ODXQFKHGLWVXQRUWKRGR[$IRO ORZLQJ D OXNHZDUP UHVSRQVH WR WKHRULJLQDO0HUFHGHV$&ODVV 7KH$LVWKHFDU$XGLKDVEXLOW WR FDSLWDOLVH RQ WKH EXUJHRQLQJ PDUNHW IRU DVSLUDWLRQDO VPDOO FDUV ,W JRHV KHDG WR KHDG ZLWK WKH 0,1,$OID 5RPHR¶V 0L7R &LWURHQ¶V '6 DQG SOXVKHU YHU VLRQVRIVXSHUPLQLVWDOZDUWVOLNH WKH )RUG )LHVWD DQG 9DX[KDOO &RUVD 2I FRXUVH $XGL KDG D PDMRU KHDG VWDUW LW VLPSO\ ERU URZHGWKHSODWIRUPDQGHQJLQHV IURP LWV 9: *URXS SDUWQHUV 7KLQNRIWKH$DVD9RONVZDJHQ 3RORZLWKH[WUD$XGLÃ&#x20AC;DYRXU 'ULYLQJ([SHULHQFH 7KHUH DUH QR VXUSULVHV LQ WKH $XGL $ HQJLQH ED\ EXW QR VKRUWDJH RI DGYDQFHG WHFKQRO RJ\ HLWKHU :H¶YH VHHQ DOO RI WKH HQJLQHV EHIRUH HOVHZKHUH LQWKH$XGLDQG9:JURXSOLQH XSV7KH76,SHWUROHQJLQHVXVH WXUERFKDUJLQJ WR FRPSHQVDWH

:+$7·6:+$7 Category: Supermini Performance Handling Comfort Space Styling Build Value Equipment Economy Depreciation Insurance

80% 90% 80% 70% 80% 100% 60% 70% 80% 90% 80%

IRU WKHLU PRGHVW FDSDFLWLHV WKH  76, DFKLHYLQJ 36 ZLWK 1P RU WRUTXH DQG WKH  76,FKLSSLQJLQZLWK36DQG 1P 7KHUH¶V DOVR D 36 YHUVLRQRIWKLVWKDWXVHVERWK VXSHUFKDUJHU DQG WXUERFKDUJHU DOOLHG ZLWK D FOHYHU VSHHG '6* VHPLDXWRPDWLF JHDUER[ 7KH GLHVHO RSWLRQ LV D OLWUH FRPPRQUDLO LQMHFWLRQ7', XQLW ZLWK36DQG1P,WZLOO JHW WKH $ WKURXJK PSK LQ  VHFRQGV ZKLOH WKH 36 OLWUHSHWUROHQJLQHWDNHVV WRGRWKHVDPH 6SRUWLQHVVKDVEHHQWRSRIWKH DJHQGDLQVHWWLQJXSWKH$7KH FDULVIURQWZKHHOGULYHEXWRQO\ DURXQG  RI LWV WRWDO ZHLJKW UHVWV RYHU WKH IURQW D[OH 7KLV PDNHVIRUDQXQXVXDOO\ZHOOEDO DQFHG ZHLJKW GLVWULEXWLRQ IRU D FDULQWKHVXSHUPLQLFODVV/LNH WKH 3ROR WKHUH¶V 0DF3KHUVRQ VWUXWIURQWVXVSHQVLRQDQGDWRUV HQEHDPDWWKHUHDUZKLOHVKRUW RYHUKDQJVIURQWDQGUHDUVKRXOG DLGPDQRHXYUDELOLW\(63VWDELO LW\ FRQWURO LV VWDQGDUG EXW VR LV DQHOHFWURQLFGLIIHUHQWLDOV\VWHP WRKHOSGHSOR\WKHSRZHUWRWKH EHVW HIIHFW 0DQXDO JHDUER[HV

DUH¿WWHGDVVWDQGDUG VL[VSHHGV IRUWKHDQG¿YHIRUWKHRWK HUV EXWWKH67URQLFWZLQFOXWFK DXWRPDWLF JHDUER[ ZKLFK KDV JDLQHG FULWLFDO DFFODLP HOVH ZKHUHLQWKH$XGLUDQJHLVDYDLO DEOHDVDQRSWLRQZLWKWKHOL WUHHQJLQH 'HVLJQDQG%XLOG $FRQYHQWLRQDOVXSHUPLQLVKDSH LVDGRSWHGE\WKH$ZKLFKLVQ¶W D JUHDW VXUSULVH JLYHQ LWV PH FKDQLFDOVLPLODULW\WRWKHODUJHO\ FRQYHQWLRQDO 9: 3ROR ,W DOVR PHDQVWKDWWKH$JDLQVDQHGJH RYHUULYDOVIURPWKHWUHQGLHUHQG RI WKH VXSHUPLQL VHFWRU ZLWK D OLWUH ERRW WKDW H[SDQGV WR  OLWUHV ZLWK WKH UHDU VHDW EDFNVIROGHG 7KH H[WHULRU RI WKH FDU LV FUDZOLQJZLWKUHFRJQLVDEOH$XGL GHVLJQ FXHV DQG DOWKRXJK \RX FRXOGQ¶WFDOOWKHORRNVDGYHQWXU RXV WKH$ KDV JRW WKH FRPEL QDWLRQ RI QHDW SURSRUWLRQV DQG HQJDJLQJ GHWDLOLQJ WKDW $XGL GRHV VR ZHOO 7KH RQH IHDWXUH WKDW REYLRXVO\ EUHDNV IURP WKH $XGL PDVWHU SODQ LV WKH URRI DUFKZKLFKFDQEHVSHFL¿HGLQD GLIIHUHQWFRORXUWRWKHUHVWRIWKH ERG\ZRUN$OVRQRWHZRUWK\DUH WKH EHDXWLIXOO\ VFXOSWHG KHDG OLJKWFOXVWHUVZLWK/('UXQQLQJ OLJKWV VKDSHG LQWR VWUHDNV RI ZKLOH OLJKW WKDW FXUO DURXQG WKH PDLQ EXOEV $XGL¶V WUDSH]RLGDO JULOO GRPLQDWHV WKH QRVH DQG WKHUH¶VPRUH/('OLJKWLQJDWWKH UHDU 7KH VWDWHG DPELWLRQ ZLWK WKH $ LV WR VHW D QHZ VWDQGDUG IRU LQWHULRUTXDOLW\LQWKHVXSHUPLQL FODVVDQGLIDQ\RQHFDQGRWKDW $XGL FDQ ,Q FRQWUDVW ZLWK WKH OLYHO\EXWVRPHWLPHVSRRUO\H[ HFXWHG UHWUR GHVLJQ RI LWV 0,1, ULYDO WKH$ WDNHV D VSRUW\ EXW VREHUDSSURDFKZLWKEDJVRIDW WHQWLRQWRGHWDLO'DUNVRIWWRXFK

SODVWLFV ZLWK EULJKW FKURPH GH WDLOLQJIRUPWKHVWDQGDUGWKHPH WKH KLJKOLJKW EHLQJ WKH ODUJH FLUFXODUDLUYHQWVGHVLJQHGWRUH VHPEOHMHWHQJLQHV7KRVHZDQW LQJDPRUHYLEUDQWORRNFDQJHW RQHIURPWKHRSWLRQVOLVW 0DUNHWDQG0RGHO 7KH VXFFHVV WKH 0,1, KDV KDG ZLWKLWVYDVWRSWLRQVOLVWGLGQRW JR XQQRWLFHG DW $XGL 7KH $ DOVRRIIHUVDYDULHW\RIWHPSWLQJ H[WUDVWKURXJKZKLFKEX\HUVFDQ µFXVWRPLVH¶WKHLUFDUVWRDOHYHO ZD\ EH\RQG WKHLU OLVW SULFHV 7KHUHDUHVWDQGDUG6SRUWDQG6 /LQHWULPOHYHOVDQGIURPWKHUH LW¶VSRVVLEOHWRUHDOO\JRWRWRZQ ZLWK OHDWKHU WULP /(' LQWHULRU OLJKWLQJ KHDWHG VHDWV DQG QX PHURXVYLYLGWULPFRPELQDWLRQV

7KH$LVDYDLODEOHDVDWKUHH GRRUDQG¿YHGRRUFDUDQGFDE ULROHW PRGHO LV LQ WKH SLSHOLQH DV LV DQ 6 KRW KDWFK YHUVLRQ 3ULFLQJLVQ¶WDWWKHH\HZDWHULQJ OHYHOWKDW\RXPLJKWH[SHFWZLWK FXVWRPHUVDEOHWRSLFNXSDQ$ IRU DURXQG Â&#x2026; DVVXPLQJ WKH\ FDQ UHVLVW WKH OXUH RI WKDW RSWLRQVOLVW &RVWRI2ZQHUVKLS 'HVSLWHLWVKLJKOHYHORIVRSKLV WLFDWLRQWKH$LVDOLJKWZHLJKW SURSRVLWLRQWKDWWLSVWKHVFDOHVDW MXVWNJ7KLVZLOOKHOSIURP DQ HI¿FLHQF\ SRLQW RI YLHZ DQG VR ZLOO $XGL¶V ZRUN LQ PDNLQJ WKHFDUDVDHURG\QDPLFDVSRVVL EOH%RWKRIWKHHQWU\OHYHOSHW URO HQJLQHV UHWXUQ YHU\ VLPLODU HFRQRP\ DQG HPLVVLRQV ¿JXUHV

RI DERXW PSJ DQG JNP 7KHGLHVHOLVVXEVWDQWLDOO\EHWWHU ZLWKDQH[FHOOHQWPSJDQGD &2RXWSXWRIJNP 6XPPDU\ $XGL¶VVHFRQGVWDEDWIRVWHULQJD VXSHUPLQL G\QDVW\ LV FDOOHG WKH $ DQG WKH UHFLSH LV D IDU VLP SOHURQHWKDQWKDWZKLFKUHVXOWHG LQWKH$VRPHWHQ\HDUVSUHYL RXVO\ 7KH KRSH ZLWKLQ$XGL LV WKDW WKH$ FDQ VWDQG RXW IURP WKHSDFNZLWKLWVSUHVWLJHEDGJH DQG SUHPLXP FDELQ TXDOLW\ ZKLOHKROGLQJLWVRZQZLWKVROLG PHFKDQLFDOVERUURZHGIURPWKH 9RONVZDJHQ3ROR,WVRXQGVOLNH DSODQWKDWZLOOKDYHWKHUHVWRI WKH FRQWHQGHUV DW WKH IDVKLRQ DEOHHQGRIWKHVXSHUPLQLVHFWRU ZRUULHG


92 | MOTORS

KILKENNY REPORTER 9 10 2013


9 10 2013 KILKENNY REPORTER

MOTORS | 93


94 | MOTORS

KILKENNY REPORTER 9 10 2013


9 10 2013 KILKENNY REPORTER

MOTORS | 95


96 | MOTORS

KILKENNY REPORTER 9 10 2013

Year

Make

Model

Engine

Fuel

Price

2013 2013 2013 2013 2013 2013 2011 2010 2010 2010 2010 2009 2009 2008 2008 2008 2008 2007 2007 2007 2007 2006 2006 2006 2005 2005 2005 2003 2003 2002 2002 2001

Seat Seat Seat Seat Seat Seat Peugeot Nissan Seat Hyundai Peugeot Suzuki Toyota Toyota Seat Seat Seat Seat Skoda Seat Nissan Mini Vw Hyundai Vw Seat Seat Renault Opel Opel Hyundai Peugeot

Toledo Leon Ref 105 Bhp Ibiza ST S.E Ibiza S.E Ibiza S.E Mii Chic 308 Diesel Qashqai (Low Mileage) Altea XL Diesel i30 Diesel 207 Alto Corolla Diesel Corolla Diesel Leon Auto DSG FR 200 BHP Ibiza (choice) Leon Altea XL Superb (Full Leather) Ibiza Almera One ‘7’ Model Golf Matrix Polo Diesel Cordoba Diesel Ibiza Megane Diesel Corsa Astra Accent 206

1.6 Tdi 1.6 Tdi 1.2 Tdi 1.2 Tdi 1.2 1 lt 1.6 Hdi 1.5 Dci 1.6 Tdi 1.6 Crdi 1.4 1lt 1.4 D4D 1.4 D4D 2.0 Tfsi 1.2 1.4 1.9 Tdi 1.9 Tdi 1.2 1.5 1.6 1.4 1.5 Crdi 1.4 Tdi 1.4 Tdi 1.2 1.5 Dci 1.0 lt 1.7 1.3 1.1

Diesel Diesel Diesel Diesel Petrol Petrol Diesel Diesel Diesel Diesel Petrol Petrol Diesel Diesel Petrol Petrol Petrol Diesel Diesel Petrol Petrol Petrol Petrol Diesel Diesel Diesel Petrol Diesel Petrol Diesel Petrol Petrol

€22,250 €21,950 €17,500 €16,950 €15,950 €12,950 €13,950 €17,450 €13,950 €12,450 €8,950 €5,950 €12,450 €11,450 POA €7,250 €6,950 €7,450 €7,450 €6,250 €4,750 €6,950 €6,500 €5,500 €5,950 €5,250 €4,250 €3,250 €3,250 €2,250 €2,250 €1,800

Eg: Deposit 20% €3,708 €3,658 €2,917 €2,825 €2,658 €2,158 €2,325 €2,908 €2,325 €2,075 €1,491 €991 €2,075 €1,908

Per Week €75 €74 €59 €57 €54 €44 €56 €69 €49 €49 €36 €36 €59 €55

€1,208 €1,158 €1,241 €1,208 €1,042

€40 €43 €46 €46 €39


9 10 2013 KILKENNY REPORTER

MOTORS | 97


98 | MOTORS

KILKENNY REPORTER 9 10 2013


CLASSIFIED | 99

9 10 2013 KILKENNY REPORTER

ACCOMMODATION

EDUCATION

Looking for Accomodation Property to rent for 1 person. Must accept rent allowance. Available Immediately for 1 year minimum. Contact 0899773084

Maths Teacher required for private lessons. International Baccalaureate level. Equivalent to Maths Leaving Cert Higher Level. Classes required immediately. Please phone 085 8509221 or Email susansccasey@gmail,com Highly qualified home tutor available for children on Autistic Spectrum. Contact 0861503225 Irish grinds available up to Leaving Cert Higher Level. Urlingford, Johnstown area. Contact 086-1078443

APPLIANCE SERVICES Washing Machine Repairs Cookers, Dryers, Dishwashers & Refrigeration Gas Cookers, Heaters & Boilers Serviced Phone 087 2817115 CHIMNEY SWEEP A Kilkenny Based Chimney Sweep. Safe chimney and clean service guaranteed. Stove/cookers and open fires. Crow guards and cowls fitted. Call Pat: 087-2793659

FUELS Good Quality Firewood for sale. Soft wood & hard wood. Contact 086 2523531.

CLOTHESLINE S

HEALTH & BEAUTY

Clotheslines, Galvanised, double and single lines, pole to wall lines, also wall-mounted foldaway clotheslines, ideal for small areas. All lines supplied & fitted. Call Dennis Scully 087-9488243 (anytime)

Reflexology and Reiki Practitioner Sarah Daly Health Care. Approved SRN. Phone: 0868054133 Cranio - Sacral Therapy, Reflexology (M.N.R.R.I) - Catriona Mulhall. See Website For Details www.catrionamulhall.com. 087 6416322 or 087 2687806

COMPUTER SERVICES Need A Helping Hand With; Internet/Online Bookings & Banking/Social Networking/ Microsoft Applications. Oneto-One Lessons. Contact Marilyn on 056 7708078 or 087 1717759 Computer Repair Service, Virus Removal, Wireless Networking, Computer Tuition, Contact Brian 087-1521698. Computer Services, gaming consoles, mobile phones. Full range of repairs. No Fix No Fee. Contact Marcin on 0871640552 DENTAL Kieran Campion Clinical Dental Technician - new private dentures now fitted direct at clinic, 5 Watergate, Kilkenny. Mon-Fri 9am-6pm, Sat 9.30am-1pm 056-7770343. After hours Emergency 0872270474 Langtons Denture Clinic MEDICAL CARDS ACCEPTED Custom-made dentures, repairs and relines. Contact 0567712741, Greenshill, Kilkenny

HOUSEHOLD SERVICES

James Fitzpatrick Approved Technician Oil Cooker Service Ex factory engineer 22 years experience (087) 7987477

All your unwanted bric- abrac, books, furniture, general house/shed contents cleared out completely free of charge. Free up valuable living & storage space. We provide a fast reliable & highly recommended service Contact 086 8932369 MUSIC Kilkenny Rock Music School lessons for guitar, keys, drums & playing in a rock band. Call 087 909 2700 or visit www.kilkennyrock.com (private lessons also available). PERSONAL Single, looking for a soulmate. Contact SWAN on 087 6132735 PERSONAL SERVICES

DIVORCE Get the fastest and cheapest divorce or legal separation in Kilkenny. Totally Legal Contact Jim on

087-1330320

Lady Available for Cleaning, Ironing and any general household duties inside or out Flexible Hours - Kilkenny City Call Simona on 089 9773084 Ballroom and Social Dance Lessons, starting Wed 11th September 8pm-10pm Newpark Hotel. Qualified teacher, tuition in Waltz, Quickstep, Foxtrot, Jive and Cha Cha Cha etc. Contact Mary 086-8153033 Qualified Childcare provider available to mind children in own home. Fetac level 5. In Thomastown, Bennettsbridge, Graignamanagh area. Contact 087-0646223

BOOK YOUR CLASSIFIEDS AD FOR NEXT WEEK TEL: 056 7795051

Childminder required in the home. Please contact 0831081340 PETS Kilkenny Dog Training - dog agility, obedience classes, puppy socialization, private consultations and advice on pet care. Contact Billy on 086 3207287 or Mary on 087 6702906 Responsible dog owner looking for field to rent to exercise dogs in Clashwilliam area. Phone 087-3446928 RECRUITMENT Increase Family Income, flexible hours with no door to door catalogue drops. Work from home, call Geraldine or Luke on 086-7249942 TO LET First and second floor units available to let on High St. Central location, would suit all types of businesses. Contact 085-7247582 or 086-2431454 VEHICLES WANTED

CARS WANTED

SANDBLASTING

All Cars vehicles wanted cars , van's , 4 x4 and trucks Old cars + Nct Failures Top Cash price paid everything considered Ger Mulhall Kilkenny 056 7762508 or 087 2593006 FUN SUMMER CAMPS FOR YOUR KIDS


100 | CLASSIFIED

KILKENNY REPORTER 9 10 2013


9 10 2013 KILKENNY REPORTER

CLASSIFIED | 101


102 | CLASSIFIED

KILKENNY REPORTER 9 10 2013


104 | SPORT

KILKENNY REPORTER 9 10 2013

Murty Brennan celebrates after Newpark won the McCalmont Cup last season

Pics: Noel Hoyne

Eoin Kavanagh, Bridge United, bursts through the â&#x20AC;&#x2DC;Booters defence

Carrier pigeon brings a match update to Murtyâ&#x20AC;&#x2122;s hospital bed SOCCER with

JIMMY RHATIGAN JRHATIGAN@KILKENNYREPORTER.IE

3$66,21$7( 1HZSDUN FOXE PDQ 0XUW\ %UHQQDQ ZDV D SDWLHQW LQ 6W /XNH¶V *HQHUDO +RVSLWDORQ6XQGD\DVKLVWHDP SOD\HG(YHUJUHHQLQWKH3UHPLHU /HDJXH 0XUW\ZKRLVRQWKH1HZSDUN µ$¶ PDQDJHPHQW WHDP DORQJ ZLWK 0DUN 5\DQ ZDV DGPLW WHGWRKRVSLWDORQ)ULGD\EXWDV KH UHFRYHUHG LQ 6W /XNH¶V RQ

6XQGD\KHZDVEHLQJNHSWXSWR GDWHZLWKWKH.HOOV5RDGJDPH &DUULHU SLJHRQV WH[WV SKRQH FDOOVDQG*RGRQO\NQRZVZKDW RWKHU PHDQV RI FRPPXQLFDWLRQ ZHUHXVHGWRXSGDWHKLP $ +HQU\ 2¶1HLOO JRDO IRU 1HZSDUN KHOSHG KLV UHFRY HU\ DQG D ODWH HTXDOLVHU IRU (YHUJUHHQ E\ \RXQJVWHU &LDQ 0RUWRQ GLGQ¶W GDPSHQ KLV VSLULWV $WRQLF ,WZDVDWRQLFIRU0XUW\ZKRLV ZHOORQWKHURDGWRUHFRYHU\DQG ZDV GLVFKDUJHG IURP KRVSLWDO \HVWHUGD\7XHVGD\ :KLOH D GUDZ ZLWK 1HZSDUN PD\ QRW KDYH EHHQ FRQVLGHUHG

â&#x20AC;&#x2DC;Booters Dessie Hayes controls beautifully before crossing

E\ (YHUJUHHQ WKH\ FHUWDLQO\ GLG D ORW EHWWHU WKDQ KLJK Ã&#x20AC;LHUV %ULGJH 8QLWHG D WHDP RI UHDO VSLULW ZKR KDYH EHHQ EDQJLQJ LQWKHJRDOVRQDQXQEHDWHQUXQ $ IXOO VWRS WR WKHLU SURXG JDOORS FDPH IURP )DLU *UHHQ FOXE )UHHERRWHUV ,W ZDV  DW KDOIWLPHLQWKH*UHHQEXWWKHQ WKUHHFUDFNLQJJRDOVLQWKHVDPH QXPEHURIPLQXWHVNQRFNHGWKH VWXI¿QJRXWRIWKHYLVLWRUV 'HV +D\HV   *HU +D\HV $DURQ 0ROOR\ DQG -DPLH 2¶+DUD FRQWULEXWHG WR WKH JRDO IHDVWDVWKH%OXHVZRQ $FHLQWKHSDFN 2QWKHRWKHUVLGHRIWKHFRLQ -LPP\ &DVKLQ¶V EDWWOLQJ )RUW

5DQJHUV FDPH XS WUXPSV DW ODVW 7KH 5DQJHUV KHOG WKH DFH LQ WKH SDFN LQ WKH WDOHQWHG (PPHWW 1XJHQW D EULOOLDQW \RXQJ SOD\HU ZKR VPDVKHG D JUHDWKDWWULFN 7KHRWKHU)RUWJRDOZDVVFRUHG E\ /LDP )RUULVWDO PDNLQJ LW  IRU WKH 'DQHVIRUW FOXE LQ D GHVHUYHG ZLQ RYHU QHLJKERXUV (DVW(QGRI%HQQHWWVEULGJH 7KRPDVWRZQ 8QLWHG FRQWLQ XHG WKHLU JRRG UXQ *RDOV E\ .HOYLQ6NHKDQ$QG\.DYDQDJK DQG'HVVLH:DOVKVDZWKHPJHW IXOO SRLQWV IURP (YHUJUHHQ µ%¶ ZKRKDGDFRQVRODWLRQIURP*HU *DOYLQ DV WKH FRXQW\ FOXE ZRQ 

Jason Hennessy and James Bolger go head-to-head


9 10 2013 KILKENNY REPORTER

ADVERTISEMENT | 105


106 | NEWS

KILKENNY REPORTER 2 10 2013

Europe jumps to hat-trick glory at fantastic Gowran Park $ )$17$67,& UDFH FDUG D EXPSHUFURZGDQGDVXSHUKDW WULFN E\ D ORFDO KRUVH KHOSHG WR PDNH WKH ZHHNHQG UDFLQJ DW *RZUDQ 3DUN D FUDFNLQJ H[SHULHQFH 7KH IDQFLHG 6L]LQJ (XURSH SURGXFHG D VROLG MXPSLQJ SHUIRUPDQFH DQG VWD\HG RQ FRPIRUWDEO\ WR ODQG WKH 3:& &KDPSLRQ &KDVH IRU WKH WKLUG FRQVHFXWLYH VHDVRQ D EULOOLDQW IHDWDPDJQL¿FHQWSHUIRUPDQFH

DMR\WRZDWFK 7KH +HQU\ GH %URPKHDG WUDLQHG \HDUROG ZKR KDV QRW EHHQ VHHQ VLQFH EHDWHQ E\ 6SULQWHU6DFUHLQWKH&KDPSLRQ &KDVHDW3XQFKHVWRZQLQ$SULO KHOGRIIODVWVHDVRQ¶V$UNOHUXQ QHUXS %DLO\ *UHHQ LQ VHFRQG DQG5XEL/LJKWLQWKLUGWRVFRUH DVWKHIDYRXULWH 7KH VWDU DWWUDFWLRQ DW *RZUDQ 3DUN  ZDV XQGRXEWHGO\  6L]LQJ (XURSH ZKLFK KDG D ELJ IRO

ORZLQJ7KHKRUVHZDVVWURQJO\ VXSSRUWHG DQG GLGQ¶W GLVDS SRLQW ZLWK D VXSHUE  GLVSOD\ RI MXPSLQJ )LYHZLQQHUV ,I 6L]LQJ (XURSH ZDV WKH HTXLQHVWDURIWKHZHHNHQGWKHQ 0V-HVVLFD+DUULQJWRQGH¿QLWH O\VWROHWKHVKRZIURPDWUDLQLQJ SHUVSHFWLYHZLWKDIDQWDVWLF¿YH ZLQQHUVRYHUWKHWZRGD\V -HVVLFD  VDGGOHG WKH EXPSHU ZLQQHU RQ )ULGD\ DQ XQEHOLHY

DEOH GRXEOH IRU PRWKHU DQG GDXJKWHUDVWKHKRUVHZDVULG GHQE\KHUYHU\WDOHQWHGGDXJK WHU.DWH *RZUDQ3DUN¶VEXPSHUFURZG ZDV WUHDWHG WR VRPH WUXO\ EULO OLDQW UDFLQJ RYHU WKH WZR GD\V DQGWKHUHZDVDKRVWRIH[FHOOHQW IULQJHHYHQWVWRR &RPHGLDQ 7RPP\ 7LHUQDQ ZDVLQJUHDWIRUPRQRQ)ULGD\ QLJKW ZKLOH 3HWH )DJDQ GLG WKH EXVLQHVV RQ 6DWXUGD\ 7KH

ZHDWKHU IRU ERWK GD\V ZDV VPDVKLQJSDUWLFXODUO\6DWXUGD\ ZKHUHWKHKDSS\JROXFN\UDF LQJ FURZG EDVNHG LQ EHDXWLIXO VXQVKLQH 2QHVWRZDWFK 2QHVWRZDWFKDVZHORRNIRU ZDUG WR WKH QH[W ELJ RFFDVLRQ DW *RZUDQ 3DUN LQFOXGH *XLWDU 3HWH6KDQDKDQ¶V7XUQDQG%DLO\ *UHHQ$OOKRUVHVUDQH[FHOOHQW O\ZLOOVXUHO\KDYHERRVWHGWKHLU FKDQFHVRIIXWXUHVXFFHVV

7KH QH[W PHHWLQJ DW *RZUDQ 3DUNLVRQ6DWXUGD\1RYHPEHU  ZLWK VRPH PRUH H[FHOOHQW MXPSV UDFLQJ RQ RIIHU 7KLV LV WKH ¿QDO PHHWLQJ RI  DQG DQRWKHUKXJHFURZGLVH[SHFWHG &RUSRUDWH KRVSLWDOLW\ RQ WKLV GDWH LV DOUHDG\ VROG RXW EXW WKHUH ZLOO VWLOO EH RWKHU SDFN DJHV RQ WKH GD\ WR VXLW HYHU\ EXGJHW )RU PRUH LQIR SOHDVH YLVLWZZZJRZUDQSDUNLHRUFDOO 


2 10 2013 KILKENNY REPORTER

NEWS | 107


108 | NEWS

KILKENNY REPORTER 9 10 2013

Carbon Monoxide: Prevention is the only option to threat of poison gas

By Willie Wilson &$5%210212;,'(RU&2 LV D FRORXUOHVV RGRXUOHVV SRL VRQRXVJDVWKDWFDQRFFXUZKHQ DQ\ IRVVLO IXHO LV EXUQHG %XW KRZ FDQ ZH LGHQWLI\ &DUERQ 0RQR[LGHLQWKHKRPHDQGZKDW VKRXOGZHGRDERXWLW" <RX FDQ¶W VHH KHDU RU VPHOO &2EXWWKHUHDUHDQXPEHURI SK\VLFDO ZDUQLQJ VLJQV .HHS DQH\HRXWIRUVWDLQLQJVRRWLQJ RU GLVFRORXUDWLRQ DURXQG IXHO EXUQLQJDSSOLDQFHV7KHUHPD\ DOVR EH FRQGHQVDWLRQ RU GDPS QHVV RQ ZDOOV DQG ZLQGRZV LQ WKH URRP RQFH WKH DSSOLDQFH LV OLW 2WKHU WHOOWDOH VLJQV LQFOXGH D \HOORZ RU RUDQJH ÀDPH ZKHUH QRUPDOO\ D EOXH ÀDPH ZRXOG EH YLVLEOH RQ D JDV DSSOLDQFH ,I DSSOLDQFHV WKDW DUH PHDQW WREXUQZLWKDYLYLGEOXHÀDPH EXUQ VORZO\ ZLWK ZHDN RUDQJH ÀDPHV RU RFFDVLRQDOO\ JR RXW RU LI WKHUH LV D VWUDQJH VPHOO ZKHQ WKH DSSOLDQFH LV RQ WKLV FRXOG DOVR VLJQDO DQ LVVXH ZLWK &2 7KHUHLVQRVPHOOIURP&2EXW VRPHWLPHVWKHUHLVDVPHOOIURP RWKHUSURGXFWVRIFRPEXVWLRQ

/RYHGRQHV &KHFN LI WKHUH LV UXVWLQJ RU ZDWHU VWUHDNLQJ RQ DSSOLDQFH FDELQHWV RQ YHQWV RU RQ FKLP QH\VRULIWKHUHDUHORRVHYHQWRU FKLPQH\FRQQHFWLRQVRUJXDUGV 7KH PDLQ ZD\ WR SURWHFW \RXU ORYHG RQHV LV KDYH \RXU IXHOEXUQLQJDSSOLDQFHVHUYLFHG DQQXDOO\ E\ D UHJLVWHUHG JDV LQVWDOOHURLOWHFKQLFLDQRUUHJLV WHUHGVHUYLFHDJHQW <RX VKRXOG DOVR PDNH VXUH  WKDW FKLPQH\V ÀXHV DQG YHQWV DUH NHSW FOHDU DQG WKDW URRPV FRQWDLQLQJ KHDWLQJ RU FRRN LQJ DSSOLDQFHV DUH SURSHUO\ YHQWLODWHG 7KH IXHOEXUQLQJ DSSOLDQFHV WKDWUHTXLUHDQQXDOVHUYLFLQJLQ FOXGHRLODQGJDVFHQWUDOKHDWLQJ ERLOHUVZRRGSHOOHWERLOHUVJDV ¿UHV PRELOH JDV KHDWHUV JDV FRRNHUVSHWURORUGLHVHOJHQHUD WRUVDQGVROLGIXHOVWRYHV

,QWKHFDVHRIPRELOHJDVKHDW HUV LI WKH SODTXHV RU EULFNV DW WKH IURQW DUH GDPDJHG RU WKH UHWDLQLQJFHPHQWLVPLVVLQJWKLV FDQ UHVXOW LQ WKH SURGXFWLRQ RI &R$GDPDJHGKHDWHUVKRXOG QRWEHXVHGDQGLWVKRXOGEHLQ VSHFWHGLPPHGLDWHO\ &DUERQ0RQR[LGHFDQDOVREH SURGXFHGE\WKHQDWXUDOGHFRP SRVLWLRQRIZRRGSHOOHWVVXFKDV WKRVHXVHGLQZRRGSHOOHWKHDW LQJV\VWHPVHYHQZLWKRXWEXUQ LQJWKHP 3HOOHWERLOHUV 7KH HQFORVHG QDWXUH RI VWRU DJH KRSSHUV RU WDQNV IRU:RRG 3HOOHW ERLOHUV FDQ FDXVH WR[LF DWPRVSKHUHVWREXLOGXSVRLWLV LPSRUWDQWWRPDNHVXUHWKH\DUH SURSHUO\YHQWLODWHG  ,I \RX H[SHULHQFH SUREOHPV ZLWK WKH SHUIRUPDQFH RI \RXU :RRG 3HOOHW ERLOHU \RX VKRXOG WXUQLWRIILPPHGLDWHO\

Reporter Briefs Kats look forward to Cuckoos!

.$76 7KHDWUH *URXS ODXQFK WKHLU ODWHVW SURGXFWLRQ µ2QH )OHZ 2YHU 7KH &XFNRRV 1HVW¶ DW 7KH :DWHUJDWH 7KHDWUH RQ )ULGD\SP 7KH VKRZ LV DQ LFRQLF SLHFH DQG.$76XQGHUGLUHFWRU'DYLG

PRUH IUHTXHQWO\ LI \RX XVH WKH ¿UHUHJXODUO\ 6XLWDEOHIXHOV ,W LV LPSRUWDQW WR EXUQ RQO\ VXLWDEOH IXHOV  EXUQLQJ µJUHHQ¶ XQVHDVRQHGZRRGRUUXEELVKFDQ UHVXOW LQ D EXLOG XS RI UHVLGXHV ZKLFKFDQQRWRQO\OHDGWRDSRV VLEOH EORFNDJH EXW FDQ DOVR LQ FUHDVHWKHULVNRIDFKLPQH\¿UH 7KH SULFH RI VHUYLFLQJ \RXU ERLOHU DQG DSSOLDQFHV FDQ YDU\ 7KH FRVW RI VHUYLFLQJ KDV GH FUHDVHGRYHUWKHODVWIHZ\HDUV ,WLVYLWDOWKDWDOODSSOLDQFHPDLQ WHQDQFHZRUNLVFDUULHGRXWE\D UHJLVWHUHGJDVLQVWDOOHURLOWHFK QLFLDQRUTXDOL¿HGVHUYLFHDJHQW 7\SLFDOO\ D VHUYLFH IRU \RXU JDV ERLOHU ZLOO EH EHWZHHQ ¼¼  $ VHUYLFH IRU DQ RLO FHQWUDOKHDWLQJERLOHUFDQUDQJH IURP ¼¼ GHSHQGLQJ RQ WKHDJHRIWKHERLOHUDQGZKHUH \RXOLYH

$ OLTXLG SHWUROHXP JDV DSSOL DQFH VHUYLFH ZLOO FRVW EHWZHHQ ¼¼  6HUYLFLQJ RI FRDO EXUQHUV SDUDI¿Q KHDWHUV RU ZRRGEXUQLQJVWRYHVFDQYDU\ 6HUYLQJ DSSOLDQFHV KRZHYHU ZLOO PDNH WKHP UXQ PRUH HI¿ FLHQWO\UHVXOWLQJLQDVDYLQJRQ IXHOELOOV ,W LV LPSRUWDQW WR UHPHP EHU WKDW &2 LV D YHU\ GDQJHU RXV WR[LF JDV WKDW RQ DYHUDJH FODLPVWKHOLYHVRIVL[SHRSOHLQ ,UHODQGHDFK\HDUEXWLWLVSRV VLEOHWRFRXQWHUDFWWKHGDQJHULW SRVHVWKURXJKDZDUHQHVVRIWKH FDXVHVUHJXODUPDLQWHQDQFHDQG LQVWDOOLQJDXGLEOH&2DODUPV :LOOLH:LOVRQLVDQ,QVSHFWLRQV 0DQDJHU ZLWK WKH 5HJLVWHU RI *DV,QVWDOOHUVRI,UHODQG )RU PRUH LQIRUPDWLRQ RQ &DUERQ 0RQR[LGH $ZDUHQHVV :HHNYLVLWZZZFDUERQPRQR[ LGHLH

Recently deceased... +HIIHUQDQDUHSODQQLQJWRVKRZ WKHDXGLHQFHVH[DFWO\ZK\ 7KH.DWVDUHORRNLQJIRUZDUG WR PHHWLQJ WKHLU IULHQGV DW WKH ODXQFK

Emeralds turn to cookery! (0(5$/'6 *$$ &OXE SUHV

HQWµ$7DVWHRI&KULVWPDV¶ZLWK FKHI(GZDUG+D\GHQ 7KH FRRNHU\ GHPRQVWUDWLRQ LV LQ 8UOLQJIRUG &RPPXQLW\ +DOO WRPRUURZ 7KXUVGD\  SP 7LFNHWV ¼ DYDLODEOH IURP 'DQLHOOH  %DUEDUD  +HOHQ  RU 0DUJDUHW 

Soccer fixtures 6DWXUGD\2FWREHU )$,-XQLRU&XS :LOORZ3DUNY%URRNYLOOH SP 6XQGD\2FWREHU )$,-XQLRU&XS DPXQOHVV VWDWHG

(QQLVFRUWK\8QLWHGY 7KRPDVWRZQ8QLWHG)RUW 5DQJHUVY&ODUD7RZQ/LRQV )&Y&UHWW\DUG8QLWHG )UHVKIRUG7RZQY7RPEUDFN 8QLWHG'HHQ&HOWLFY1RUWK

)OXHOHVVJDVZDWHUKHDWHUVFDQ SRVH D &2 WKUHDW DV WKH\ FRQ VXPH WKH DLU LQVLGH WKH URRP ,IXVHGIRUH[WHQGHGSHULRGVRI WLPHWKHOHYHOVRI&2FDQEXLOG XS WR GDQJHURXV OHYHOV LI WKHUH LVDODFNRIVXLWDEOHYHQWLODWLRQ 2SHQÀXHW\SHZDWHUKHDWHUVOR FDWHGLQEDWKURRPVFDQDOVREH XQVDIH 2LOEDVHG ERLOHUV WKDW KDYH EHHQ FRQYHUWHG WR UXQ RQ JDV VKRXOGEHFKHFNHGDQQXDOO\ &KLPQH\V FDQ EHFRPH EORFNHG RYHU WLPH GXH WR QHVW LQJ ELUGV DQG WKH EXLOG XS RI VRRWDQGRWKHUFRPEXVWLRQSURG XFWV $ EORFNHG FKLPQH\ ZLOO SUHYHQW JDVHV SURGXFHG GXULQJ WKH FRPEXVWLRQ SURFHVV IURP HVFDSLQJWKHURRP &URZ JXDUGV VKRXOG EH ¿WWHG WRSUHYHQWEORFNDJHVIURPQHVW LQJ ELUGV DQG \RX VKRXOG KDYH \RXUFKLPQH\VZHSWDQQXDOO\RU

(QG8QLWHG6W3HWHU¶V )&Y6WRQH\IRUG8QLWHG 0RQNVODQG8QLWHGY(YHUJUHHQ  6W&DQLFH¶V&UHGLW8QLRQ 3UHPLHU'LYLVLRQ )UHHERRWHUVµ$¶Y1HZSDUN µ$¶DP 'LYLVLRQ XQOHVVVWDWHG

6SD8QLWHGY&DOODQ8QLWHG DP7XOODURDQY)UHHERRWHUV µ%¶1HZSDUNµ%¶Y&ORYHU 8QLWHGµ$¶

'XLVNH*ODVV'LYLVLRQ  XQOHVVVWDWHG

7KRPDVWRZQµ&¶Y &DVWOHZDUUHQ&HOWLF DP%DOODFROODY/LRQV µ%¶(DVW(QGµEY1HZSDUN µ&¶ 5LFR¶VRI*RZUDQ:RPHQ¶V 'LYLVLRQ DP

(DVW(QGY%DOODFROOD&ORYHU 8QLWHGY(YHUJUHHQ)UHVKIRUG 7RZQY3LOWRZQ

Anne Holden 7+(GHDWKKDVRFFXUUHG RI $QQH +ROGHQ SLF WXUHG 0DLQ 6WUHHW 0XOOLQDYDWDPHP EHU RI WKH /DZ IDPLO\ 5HPDLQV ZHUH UHPRYHG IURP 3RZHU¶V )XQHUDO +RPH )HUU\EDQN WR 6W %HDFRQ¶V &KXUFK0XOOLQDYDW DQGEXULDOZDVDWDG MRLQLQJFHPHWHU\

Lil Flynn 7KHGHDWKKDVRFFXUUHGRI/LO )O\QQ 2OG 5RDG 0RQHHQURH D PHPEHU RI WKH %UHQQDQ 'DQ IDPLO\ ,Q KHU UG \HDU VKH SDVVHG DZD\ DW &DVWOHFRPHU 'LVWULFW+RVSLWDO 5HPDLQV ZHUH UHPRYHG IURP &RDG\¶V )XQHUDO +RPH WR WKH &KXUFK RI WKH 6DFUHG +HDUW 0RQHHQURHDQGEXULDOIROORZHG DW DGMRLQLQJ FHPHWHU\ 6KH LV VXUYLYHGE\KHUIDPLO\

Kathleen Murtagh . D W K O H H Q 0XUWDJK *XUWHHQ & D V W O H F R P H U  &RXQW\ .LONHQQ\ DQG IRUPHUO\ RI 5XWODQG 7HUUDFH % H Q Q H N H U U \  &DUORZ ZDV D PHPEHU RI WKH +XWWRQIDPLO\ 6KH LV VXUYLYHG E\ KHU KXVEDQG :LOOLH GDXJKWHU 1RHOHHQ JUDQGFKLOGUHQ 'DQLHOOH /HRQDQG=DQHVLVWHUV3DWULFLD $QQH (YHO\Q DQG 0DULRQ EURWKHUV -RKQQ\ (GGLH DQG 'LFN EURWKHUVLQODZ VLVWHUV LQODZ QLHFHV QHSKHZV DQG RWKHUUHODWLYHV 5HPDLQVZHUHUHPRYHGWRWKH &KXUFK RI WKH 6DFUHG +HDUW 0RQHHQURH IURP 0RUDQ¶V )XQHUDO +RPH &DVWOHFRPHU %XULDO ZDV DW DGMRLQLQJ FHPHWHU\

Bridget Dollard

7KH GHDWK KDV RFFXUUHG RI %ULGJHW 'ROODUG 8OOLG .LOPDFRZ D PHPEHU RI WKH +XWFKLQVRQIDPLO\ 5HPDLQV ZHUH UHPRYHG WR 6W 6HQDQ¶V &KXUFK .LOPDFRZ DQG EXULDO ZDV DW DGMRLQLQJ FHPHWHU\

John Lynch -RKQ µ-DFN¶ /\QFK .QRFNUHDJK &DOODQ &RXQW\ .LONHQQ\ LV VXUYLYHG E\ KLV ZLIH 0DU\ VRQV 0LFKDHO -LP -RKQ DQG 'DYLG GDXJKWHUV $QQDQG.DWKOHHQVRQVLQODZ GDXJKWHUVLQODZ JUDQGFKLO GUHQQLHFHVQHSKHZVDQGRWKHU UHODWLYHV 5HPDLQV ZHUH UHPRYHG WR WKH &KXUFK RI WKH$VVXPSWLRQ &DOODQ DQG LQWHUPHQW ZDV DW .LOEULGH&HPHWHU\


9 10 2013 KILKENNY REPORTER

ADVERTISEMENT | 109


110 | CADVERTISEMENT

KILKENNY REPORTER 9 10 2013


NEWS | 111

9 10 2013 KILKENNY REPORTER

Brilliant brewery site plan

Put your skates on, says young peopleâ&#x20AC;&#x2122;s champ JIMMY RHATIGAN JIMMYRHATIGAN@GMAIL.COM

,7¶67,0(WRSXWRQWKHVNDWHV DFKDPSLRQRIVNDWHERDUGLQJLQ .LONHQQ\ WROG FRXQFLOORU FRO OHDJXHVRQ0RQGD\ +HZDVUHVSRQGLQJWRWKHEULO OLDQWQHZVIRU\RXQJHQWKXVLDVWV WKDWWKHUHGHYHORSPHQWRIWKH6W )UDQFLV $EEH\ %UHZHU\ VLWH LV VHWWRGHOLYHUDVNDWHSDUN :KLOH WKH RYHUDOO SURMHFW LV VWLOO RQO\ DW FRQFHSW VWDJH DUW LVWV LPSUHVVLRQV RI ZKDW ZLOO UHSODFH WKH EUHZHU\ LQFOXGH D

Berkeley Square

VNDWHSDUN RQ WKH EDQNV RI WKH 1RUH FORVH WR WKH QHZ &HQWUDO $FFHVV6FKHPHEULGJHFURVVLQJ &RXQFLOORU$QGUHZZHOFRPHG WKH LQFOXVLRQ RI WKH IDFLOLW\ IRU \RXQJ SHRSOH LQ WKH SODQV DQG IRUPDOO\SURSRVHGWKDWDVNDWH SDUNZRXOGEHGHYHORSHG ³:H KDYH EHHQ VHWWLQJ DVLGH IXQGLQJ IRU \HDUV DQG ZLWK ¼LQD.LONHQQ\%RURXJK &RXQFLO NLWW\ IRU D VNDWHSDUN LW VKRXOG EH DOO V\VWHPV JR´ $QGUHZVDLG &U\LQJRXW ³:HKDYHDOVREHHQLQRQJRLQJ

GLVFXVVLRQV ZLWK D VNDWHERDUG LQJ H[SHUW DQG %0;LQJ ZKR DUHZLOOLQJWRGHYHORSDFRPPX QLW\EDVHGIDFLOLW\GHVLJQHGE\ ZRUOGUHQRZQHGVNDWHUV ³7KHSDUNZRXOGEHRIVXFKD KLJK VWDQGDUG WKDW LW ZRXOG EH DQ DWWUDFWLRQ IRU VNDWHERDUGHUV DOO RYHU WKH FRXQWU\´ $QGUHZ DGGHG ³,DPGHOLJKWHGDFWLRQLVQRZ EHLQJ WDNHQ 2XU \RXQJ SHRSOH KDYHEHHQFU\LQJRXWIRUWKLVIRU IDUWRRORQJ ³7KH WLPHVSDQ EHIRUH GHYHO RSPHQW RQ WKH EUHZHU\ VLWH

VKRXOG QRW EH D GHWHUUHQW *HQHUDWLRQV RI VNDWHERDUG HUV KDYH EHHQ GLVDSSRLQWHG DQG , GRQ¶W ZDQW WR VHH DQ\ PRUH \RXQJ SHRSOH EHLQJ OHW GRZQ ³:H KDYH WKH FDSDELOLW\ DQG WKHULJKWSHRSOHLQWHUHVWHGWRVHW XS D WHPSRUDU\ LQGRRU VNDWH SDUNXQWLOWKHEUHZHU\IDFLOLW\LV UHDG\´KHFRQWLQXHG ³:RUNPXVWEHJLQLPPHGLDWH O\7KHIDFWWKDWDOOPHPEHUVRI .LONHQQ\%RURXJK&RXQFLOVXS SRUWDVNDWHSDUNVKRXOGPHDQQR GHOD\V´

Skateboarders: Ready to rumble

Champion: Councillor Andrew


112 | NEWS

KILKENNY REPORTER 9 10 2013

Good health with The Reporter

Do you fancy a natural face lift? By Trish Hayden /$670217+DGHUPDWRORJLVW RQ79WROGXVWKDWPRLVWXULVLQJ FUHDPV GRQ¶W SHQHWUDWH WKH VNLQ DQGSHWUROHXPMHOO\ZDVDVJRRG LI QRW EHWWHU WKDQ PDQ\ H[SHQ VLYHFUHDPV µ7KH ,ULVK 7LPHV¶ DOVR UHSRUW HG WKDW D UHFHQW VWXG\ RYHU ¿YH \HDUVVKRZHGWKDWPRGHUDWHH[ HUFLVHVWUHVVPDQDJHPHQWDQGD GLHW ULFK LQ XQSURFHVVHG IRRGV DFWXDOO\ UHYHUVHG GDPDJH LQ FKURPRVRPHVOLQNHGWRDJHLQJ <RJD ZDV RQH RI WKH VWUHVV UHGXFLQJ DFWLYLWLHV IRXQG WR UH YHUVHDJHLQJDWWKHFHOOXODUOHYHO :H¶UHYHU\NHHQWREX\\RXQJHU IDFHVDQGERGLHVEXWLQUHDOLW\D OLWWOHELWRIHIIRUWVSHQWRQDIDLU O\KHDOWK\GLHWDQGUHJXODUH[HU FLVHZLOOPDNHWKHGLIIHUHQFH  :KLOH \RX¶UH ZDLWLQJ IRU \RXU LQQHU EHDXW\ WR VKRZ RQ

\RXUIDFHKHUH¶VDQRWKHUQDWXUDO ZHDSRQ LQ \RXU DUVHQDO :KHQ ZHH[HUFLVHZHDOZD\VWKLQNRI ZRUNLQJIURPWKHQHFNGRZQ :KDWDERXWWKHIDFLDOPXVFOHV" 7KH\DUHSDUWRIWKHIUDPHZRUN RQZKLFK\RXUVNLQKDQJV7KH IROORZLQJDUHVRPHH[HUFLVHV ,Q WKH ¿UVW H[HUFLVH ZH SXII RXU FKHHNV RXW ZLWK DLU DQG WKHQPRYHWKHDLUIURPFKHHNWR FKHHNXQWLO\RXDUHRXWRIEUHDWK 5HSHDWWKUHHWRIRXUWLPHV7KLV H[HUFLVHV WKH PXVFOHV WKDW OLIW \RXUFKHHNVXS 6OLJKWVPLOH ,Q WKH VHFRQG H[HUFLVH WU\ WR SUHVV WKH LQVLGH RI \RXU FKHHNV ¿UPO\ DJDLQVW \RXU VLGH WHHWK DQG WKHQ GUDZ WKH OLSV EDFN LQ DVOLJKWVPLOHDQGSXUVHWKHOLSV 7KLVH[HUFLVHZLOOKHOS¿UPDQG WRQHFKHHNVDQGOLSV ,I WKLV HYHQ VHHPV OLNH WRR PXFK KDUG ZRUN D VLPSOH IRU ZDUG EHQG FDQ EULQJ UDGLDQFH ¿OO IDFLDO KROORZV FDOP WKH KHDUW DQG DOORZ WKH IDFH DQG EUDLQ WR UHFHLYH PRUH R[\JHQ

Exercise 1 7HFKQLFDOO\ DQ LQYHUVLRQ LV DQ\ SRVH ZKHUH WKH KHDUW LV EHORZ WKHKLSV 7KH KHDUW ZRUNV GRJJHGO\ WR HQVXUH WKDW IUHVKO\ R[\JHQDWHG EORRG PDNHV LWV ZD\ XS WR WKH

Exercise 2 EUDLQ,QDVLPSOHIRUZDUGIROG WKH SUHVVXUH DFURVV WKH ERG\ LV UHYHUVHGZLWKWKHKHOSRIJUDYLW\ :LWKDVOLJKWEHQGLQWKHNQHHV \RX FDQ VLPSO\ KLQJH IRUZDUG DQG DOORZ \RXU HOERZV WR UHVW

RQ D NLWFKHQ FKDLU  WU\ QRW WR URXQG \RXU EDFN DQG DYRLG LI \RX¶YH KLJK EORRG SUHVVXUH RU GLVFLVVXHV 7ULVK +D\GHQ <RJD7R*R LV D .LONHQQ\ \RJD WHDFKHU

DQG ZULWHU 6KH WHDFKHV D <RJD IRU 0DWXUH /LYLQJ FODVV RQ :HGQHVGD\ PRUQLQJV LQ .LONHQQ\ 3KRQH  )DFHERRN <RJDWRJR ZLWK 7ULVK +D\GHQ

There are so many reasons for loneliness By Angela Morrissey ,163,7(RIWKHYDULRXVPHWKRGV RI FRPPXQLFDWLRQ DYDLODEOH WR SHRSOH LW DSSHDUV WKDW WKHUH DUH TXLWHDORWRIORQHO\SHRSOHZKR IRUVRPHUHDVRQRURWKHUIHHOFXW RII IURP WKH ZDUPWK RI KXPDQ UHODWLRQVKLS 3HRSOH FDQ EH ORQHO\ IRU YDUL RXVUHDVRQV$QHZO\UHWLUHGSHU

VRQPD\QRWPLVVWKHDFWXDOZRUN LWVHOI EXW PLVVHV WKH FRPUDGH VKLSRIZRUNFROOHDJXHV 7KH GHDWK RI D ORYHG RQH ZKR QHHGHG FRQVWDQW FDUH PD\ OHDYH WKH FDUHU VXGGHQO\ DORQH DQG ORQHO\ QRW VLPSO\ IURP WKH ORVV RIWKHORYHGRQHEXWDOVRGXHWR WKH IDFW WKDW WKH\ KDG WR QHJOHFW IULHQGVKLSVGXULQJWKHLU\HDUVRI FDUH $ SHUVRQ ZKR KDV PRYHG WR D QHZDUHDDZD\IURPIDPLO\DQG IULHQGV PD\ IHHO ORQHO\ HVSH FLDOO\ LI KH RU VKH LV WLHG WR WKH KRXVHZLWKVPDOOFKLOGUHQ (OGHUO\SHRSOHPD\IHHOFXWRII LQ WKH FRXQWU\VLGH EHFDXVH WKH

SXEDQGSRVWRI¿FHDUHQRORQJHU WKHVRFLDOKXEVWRWKHVDPHH[WHQW WKH\RQFHZHUH 0LVVWKHEDQWHU 7KH XQHPSOR\HG PD\ ¿QG LW ORQHO\EHFDXVHWKH\PLVVWKHFD PDUDGHULH DQG EDQWHU IRUPHUO\ HQMR\HG ZLWK ZRUN FROOHDJXHV DQG SHUKDSV GXH WR WKH IDFW WKDW WKH\GRQRWKDYHWKHVSDUHPRQH\ DYDLODEOHIRUIRUPHUKREELHVDQG KDYH D VHQVH WKDW WKHLU VRFLDO OLYHVKDYHEHHQGLPLQLVKHG $ VXGGHQO\ GLVDEOHG SHUVRQ PD\ ¿QG KLP RU KHUVHOI FXW RII IURP VRFLDO LQWHUDFWLRQ EHFDXVH WKH\ DUH QR ORQJHU DV PRELOH DV WKH\ZHUHIRUPHUO\

$V KXPDQ EHLQJV ZH QHHG FRQQHFWLRQ WR WKH FRPPXQLW\ LQ ZKLFK ZH OLYH  7KLV FDQ EH E\ VLPSO\ SDVVLQJ SOHDVDQWULHV WR SHRSOH LQ WKH VWUHHW RU DWWHQGLQJ FODVVHVRUJRLQJWR&KXUFK:H DOVRQHHGWRJLYHDQGUHFHLYHDW WHQWLRQDQGWRKDYHVRPHPHDQ LQJLQRXUOLYHV (OGHUO\ SHRSOH ZKR FDQ QR ORQJHU DWWHQG FKXUFK RIWHQ ¿QG D YRLG LQ WKHLU OLYHV EHFDXVH QRWDORQHGRWKH\IHHOWKH\FDQ QRW ZRUVKLS FRPPXQDOO\ ZKLFK JDYH WKHP PHDQLQJ  7KH\ PD\ DOVRPLVVWKHDWWHQWLRQDQGVHQVH RI SODFH SURYLGHG E\ LQWLPDWH FRQWDFWZLWKRWKHUVDQGKDYHGH

YHORSHGDVHQVHRIEHLQJFXWRII IURPWKHLUFRPPXQLW\ +XPDQYRLFH <RXQJ SHRSOH RQ WKH RWKHU KDQGRIWHQEHOLHYHWKDWWKH\FDQ IXO¿O WKHLU  QHHGV IRU IULHQGVKLS E\ MRLQLQJ )DFHERRN  7KLV LV D RQH GLPHQVLRQDO SURFHVV DQG GRHV QRW UHSOLFDWH UHDO DQG VXV WDLQDEOH IULHQGVKLSV DQG FDQ RIWHQOHDYHWKHLUH[SHFWDWLRQVRI WKHUHODWLRQVKLSXQIXO¿OOHG 7KHUH LV QRWKLQJ OLNH IHHOLQJ WKH ZDUPWK WRQH DQG WKH QX DQFHV FRQWDLQHG LQ WKH VRXQG RI DKXPDQYRLFHRUDQROGIULHQG¶V FRPIRUWLQJ DUP DURXQG \RX ZKHQ\RXDUHORQHO\

7KH SUREOHP LV WKDW ZKHQ DQ RXWJRLQJ RU H[WURYHUWHG SHUVRQ IHHOVFXWRIIRYHUDSHULRGRIWLPH KHVKH FDQ GHYHORS D WHQGHQF\ WR EHFRPH GHSUHVVHG DQG ORVH WKH LQFOLQDWLRQ WR GR DQ\WKLQJ DERXW WKHLU LQFUHDVLQJ VHQVH RI LVRODWLRQ ,I\RXIHHOLVRODWHGDQGQHHGWR WDONWRVRPHRQH\RXFDQFRQWDFW $QJHOD ZKHUH \RX ZLOO EH OLV WHQHGWRLQFRPSOHWHFRQ¿GHQFH $QJHOD + 'LS3V\FK +*3 0*+, UXQV KHU RZQ SULYDWH SUDFWLFH DW WKH .LONHQQ\ +XPDQ *LYHQV&HQWUH6KHFDQEHFRQ WDFWHGDWRUHPDLO DQJHODODZFXV#HLUFRPQHW

By Ellen Roche (BSc Nutr Sci, PG Dip Dietetics), Consultant Dietitian & Clinical Nutritionist Member Irish Nutrition  & Dietetic Institute , Nutri Vive Nutrition Clinic, 49 John Street, Kilkenny. Mobile: +353 (87) 680 2248. Email: info@nutrivive.ie

:$7(5 ,6 HVVHQWLDO IRU OLIH DQG RSWLPDO KHDOWK DV  RI WKH KXPDQ ERG\ LV PDGH XS RI ZDWHU ,W LV FRXQWHG DV RQH RI WKH EDVLF VL[ QXWULHQWV DQG LW¶V RI WHQ RYHUORRNHG DV D FRPSR QHQWRIDKHDOWK\EDODQFHGGLHW 0DLQWDLQLQJ RSWLPDO K\GUDWLRQ OHYHOVLVLPSHUDWLYHWRNHHSRXU ERGLHV IXQFWLRQLQJ ZHOO LQ DG GLWLRQ WR ORRNLQJ DQG IHHOLQJ JRRG

Dehydration (too little water) 'HK\GUDWLRQ FRPPRQO\ RF FXUV GXH WR LQDGHTXDWH ÀXLG LQWDNH 2XU ERGLHV ORVH ZDWHU WKURXJK VZHDWLQJ EUHDWKLQJ DQG XULQDWLRQ VR LW LV YLWDO WKDW

Water is vital for our life and our health VXFK ÀXLG ORVHV DUH UHSODFHG 0LOGGHK\GUDWLRQ UHGXF WLRQRIXVXDOERG\ZHLJKW FDQ UHVXOW LQ ORVV RI FRQFHQWUDWLRQ UHGXFHG SK\VLFDO SHUIRUPDQFH KHDGDFKHV DQG V\PSWRPV RI IDWLJXH

Over-hydration (too much water) ([WUHPH RYHUFRQVXPSWLRQ RI ÀXLGV DSSUR[ / RU PRUH LI QRW SK\VLFDOO\ DFWLYH  FDQ SXW H[WUD SUHVVXUH RQ WKH NLGQH\V DQG RQ UDUH RFFDVLRQV FDQ OHDG WRK\SRQDWUDHPLD ORZOHYHOVRI VRGLXPLQWKHEORRG ZKLFKFDQ FDXVH OXQJ FRQJHVWLRQ KHDG DFKHVWLUHGQHVVDQGHYHQEUDLQ VZHOOLQJ ,W LV LPSRUWDQW WR EH PLQG

IXO WKDW FRQVXPLQJ H[FHVVLYH DPRXQWVRIÀXLGDVZHOODVWRR OLWWOH DUH ERWK DVVRFLDWHG ZLWK DGYHUVHKHDOWKULVNV

Beverages :H REWDLQ ZDWHU IURP DOO RI WKH ÀXLGV ZH FRQVXPH LQFOXG LQJWHDFRIIHHIUXLWMXLFHIUXLW GULQNVVRIWGULQNVLQDGGLWLRQWR GULQNLQJZDWHU  :KLOH ZH FDQ REWDLQ ZD WHU IURP PDQ\ OLTXLG VRXUFHV ZH PXVW EH DZDUH RI WKH SR WHQWLDOO\ SRVLWLYH DQG QHJDWLYH HIIHFWV RI WKHVH VRXUFHV RQ RXU KHDOWK 7KXV FRQVXPLQJ D JRRG EDO DQFH RI KHDOWK\ GULQNV LV YLWDO IRU ERWK RSWLPDOK\GUDWLRQ OHY HOVDQGIRUWKHZLGHUHIIHFWVRQ

RXU KHDOWK LH PRUH ZDWHU DQG OHVV¿]]\GULQNV $OO EHYHUDJHV VXSSO\ ZDWHU DQG HYHQ VRPH QXWULHQWV ZKLFK DUHEHQH¿FLDOIRURXUKHDOWKHJ DQWLR[LGDQWV IURP EODFN DQG JUHHQ WHD +RZHYHU WKH FDORULH DQG VXJDU FRQWHQW VKRXOG DOVR EH FRQVLGHUHG SDUWLFXODUO\ IRU SHRSOH ZKR DUH WU\LQJ WR FRQ WUROWKHLU,QWDNHLQRUGHUWRORVH ZHLJKW *LYHQ WKH ULVLQJ REHVLW\ HSLGHPLF LQ RXU FRXQWU\ LW LV LPSRUWDQW WR UDLVH FRQVXPHU DZDUHQHVVRIWKHFDORULHFRQWHQW RIGULQNVHVSHFLDOO\VRIWGULQNV DQGDOVRWKHLUDGYHUVHHIIHFWVRQ GHQWDOKHDOWK ,I VXJDU LV DGGHG WR WHDFRI IHHWKLVZLOOLQFUHDVHWKHFDORULH

FRQWHQW DV ZLOO ODUJH DPRXQWV RIPLONLQJRXUPHWFRIIHHVHJ ODWWHV %RWK WHD DQG FRIIHH FRQWDLQ FDIIHLQH ZKLFK KDV D PLOG GL XUHWLF HIIHFW LQFUHDVLQJ IUH TXHQF\ RI XULQDWLRQ  +RZHYHU PRGHUDWHFDIIHLQH FRQVXPSWLRQ XSWRFXSVRILQVWDQWFRIIHH RUFXSVRIWHD GRHVQRWDS SHDUWRFDXVHGHK\GUDWLRQ 6R KRZ PXFK ÀXLG GR ZH QHHG" 7KHDPRXQWRIZDWHUZHQHHG WR DFKLHYH RSWLPDO K\GUDWLRQ OHYHOVZLOOYDU\IURPSHUVRQWR SHUVRQ DQG GHSHQG RQ QXPHU RXV IDFWRUV LQFOXGLQJ FOLPDWH FORWKLQJ DQG SK\VLFDO RI DFWLY LW\ +RZHYHU WKH 'HSDUWPHQW RI+HDOWKKHDOWK\HDWLQJJXLGH

OLQHV UHFRPPHQGV DGXOWV WR KDYHEHWZHHQDQGFXSVRI ÀXLG / HYHU\GD\ &KLOGUHQ DUH UHFRPPHQGHG WRFRQVXPHDWOHDVWVL[FXSVRI ÀXLG SHU GD\  ,I \RX DUH YHU\ IRQG RI \RXU WHD RU FRIIHH DQG FRQVXPH LW LQ ODUJHU TXDQWLWLHV WKDQ PHQWLRQHG DERYH WKHQ FRQVLGHU VZDSSLQJ RYHU WR WKH µGHFDII¶YHUVLRQVWRKHOSSUHYHQW GHK\GUDWLRQ 1RWH LQGLYLGXDOV ZLWK FHUWDLQ KHDOWK FRQGLWLRQV HJ NLGQH\ GLVHDVH PD\ EH DGYLVHG E\ D GRFWRU RU RWKHU KHDOWK SURIHVVLRQDO WR IROORZ VSHFL¿F ÀXLG UHVWULFWLRQV DQG LQ WKHVH LQVWDQFHV ÀXLG OLPLWV PXVW EH DGKHUHG WR LQ RUGHU WR VWD\ ZHOO


9 10 2013 KILKENNY REPORTER

CLASSIFIED | 113


114 | SPORT

KILKENNY REPORTER 9 10 2013

A â&#x20AC;&#x2DC;Shock in store for the Shamrocks? PAT TREACY $1$775$&7,9(GRXEOHKHDG HU LQ 1RZODQ 3DUN RQ 6XQGD\ EULQJV WZR ORFDO GHUELHV PDV TXHUDGLQJDVFRXQW\VHPL¿QDOV 7KH RSHQLQJ JDPH KDV $OO ,UHODQG LQWHUPHGLDWH FKDPSL RQV &ODUD DJDLQVW QHLJKERXUV 6W 0DUWLQ¶V EDWWOLQJ IRU D SODFH LQ WKHVHQLRUFRXQW\¿QDO &ODUD DUH WKH IRUP WHDP DQG WKH\ DUH XQEHDWHQ LQ FKDPSLRQ VKLSKXUOLQJIRUDOPRVWWZRVHD VRQV.LONHQQ\VWDU/HVWHU5\DQ LV WKH NH\ PDQ LQ PLG¿HOG ZLWK WKH 3KHODQ EURWKHUV -RKQ DQG &RQRU DORQJ ZLWK WKH 6KDQH DQG 1HLO 3UHQGHUJDVW DGGLQJ EDFNERQH $XVWLQ 0XUSK\ FDSWDLQV WKH WHDP+HKDVPDGHDVLJQL¿FDQW FRQWULEXWLRQ VLQFH KLV UHWXUQ WR DFWLRQODVW\HDUIROORZLQJDORQJ WHUPLQMXU\ 6W 0DUWLQ¶V KDYH EHHQ VRXQG QHVVSHUVRQL¿HGVLQFHWKHUHWXUQ RI WKH FOXE FKDPSLRQVKLS LQ $XJXVW 0DQDJHU &KDUOLH &DUWHU KDV UHVKDSHGWKHLUGHIHQFHWRWHOOLQJ HIIHFWZLWK1LDOO0RUDQDQG2OOLH :DOVK DQG 3DWULFN 1RODQ FRP IRUWDEOHLQWKHLUQHZSRVLWLRQV 7KH WDOHQW RI &DQLFH 0DKHU -RKQ0XOKDOO7KRPDV%UHHQDQG -RKQ0DKHULVREYLRXVDQGFRQ VLVWHQF\KDVEHHQDGGHG -RH 0DKHU DQG 5RQDQ 0DKHU DUH XQDYDLODEOH ZLWK LQMXULHV

Battlers: Carrickshock %ULDQ0XOKDOOPLVVHGWKH TXDUWHU¿QDO ZLWK D IUDFWXUHG MDZEXWPD\EHDYDLODEOH 7KLV LV D FODVVLF  JDPH &ODUD KDYH DQ DPD]LQJO\ VXF FHVVIXO\HDUEHKLQGWKHP 7KH FRQ¿GHQFH DQG WHDPZRUN JDLQHG IURP WKDW MRXUQH\ FRXOG EHYLWDO &KDPSV %DOO\KDOH 6KDPURFNV ZLOO SUREDEO\ OLQH RXW ZLWK D PRUHIDPLOLDUORRNIRUWKHVHPL ¿QDO ZLWK $LGDQ &XPPLQV DW IXOO EDFN DQG -RVHSK +ROGHQ DW FHQWUHEDFN 7- 5HLG ZLOO EH GHSOR\HG IXUWKHU XS WKH ¿HOG 0LFKDHO )HQQHOO\ KDV DQ DQNOH LQMXU\

+HQU\ 6KHIÃ&#x20AC;LQ ZLOO SXOO WKH VWULQJV LQ DWWDFN ZKLOH &ROLQ )HQQHOO\ ZLOO DGG SDFH DQG HQHUJ\ &DUULFNVKRFNUHFHLYHGDERRVW GXULQJ WKH ZHHN DV PLG¿HOGHU -RKQ &DKLOO KDG D UHG FDUG UH VFLQGHG +H UHFHLYHG WKH FDUG LQ WKH TXDUWHU¿QDO ZLQ RYHU 'LFNVERUR -RKQ 7HQQ\VRQ LV LQ D UDFH DJDLQVW WLPH WR SOD\ DV KH VXI IHUHG D GLVORFDWHG VKRXOGHU LQ WKHTXDUWHU¿QDO 0LFKDHO 5LFH LV UHFRYHULQJ IURP D KDPVWULQJ LQMXU\ 7KH IRUP RI WKH 3RZHU EURWKHUV -DPLH 5LFKLH DQG -RKQ RQ WKH

Pics: Noel Hoyne KDOIIRUZDUGOLQHZLOOEHNH\ 6KDPURFNV DSSHDU D OLWWOH XQ FHUWDLQ DQG D ELW YXOQHUDEOH LW¶V D PDVVLYH FKDQFH IRU WKHLU QHLJKERXUV WR LQÃ&#x20AC;LFW GHIHDW RQ WKHFKDPSLRQV &DUULFNVKRFNZHUHQ¶WFRQYLQF LQJLQWKHTXDUWHU¿QDOEXWWKLVLV WKHGH¿QLQJJDPHIRUWKLVWHDP +RZDERXWD&ODUD6KDPURFNV FRXQW\¿QDO" 6W&DQLFH¶V&86HQLRU +XUOLQJ6HPL)LQDOV 1RZODQ 3DUN &ODUD Y 6W 0DUWLQ¶V6XQGD\#SP 1RZODQ 3DUN %DOO\KDOH 6KDPURFNV Y &DUULFNVKRFN 6XQGD\#SP

John Cahillâ&#x20AC;&#x2122;s red card which was rescinded


SPORT | 115

9 10 2013 KILKENNY REPORTER

The Rower Inistioge and The Emeralds, Urlingford upset the odds as they beat the fancied St Patrick’s, Ballyragget, and Dunnamaggin in the Michael Lyng Motors Intermediate Hurling semi-finals in Nowlan Park on Sunday. Both teams were full value for their wins.

The Rower re-Joyce in victory The Rower Inistioge 2-14, St Patrick’s 2-9 7+(5RZHU,QLVWLRJHSURGXFHG DVROLGSHUIRUPDQFHZLWK.LHUDQ -R\FHLQRXWVWDQGLQJIRUPDWWKH KHDUWRIWKHLUGHIHQFH 7KLV ZLQ ZDV EDVHG RQ D VROLG GHIHQFH ZLWK 6pDQ &XPPLQV WKH 'R\OH EURWKHUV (RLQDQG-DPHV5XDLUt*DODYDQ DQG 6pDQ /\VWHU VQXI¿QJ RXW D KLJKO\ UDWHG %DOO\UDJJHW DWWDFN 7KH RSHQLQJ H[FKDQJHV ZHUH HYHQEXWLWZDV6W3DWULFN¶VZKR PDGHWKH¿UVWVLJQL¿FDQWEUHDN WKURXJKZLWKD0LFKDHO%UHQQDQ JRDOLQWKHWKPLQXWH 7KH ZLQQHUV UHSOLHG ZLWK D &DWKDO %ROJHU JRDO WKUHH PLQ XWHVODWHUDQGWKH\OHGWR DWWKHEUHDN 6FRULQJVSUHH $ VHYHQPLQXWH VFRULQJ VSUHH DIWHUKDOIWLPHZKLFK\LHOGHG JDYH7KH5RZHU,QLVWLRJH WKH PRPHQWXP IRU YLFWRU\ ZLWK 0LFKDHO *UDFH KLWWLQJ WKUHHSRLQWV'DYLG/\QJVFRULQJ DJRDODQG&DWKDO%ROJHUJRWDQ RWKHUSRLQWWR .HYLQ.HOO\UDOOLHGWKHWURRSV ZLWK WKUHH SRLQWV DQG 0LFKDHO %UHQQDQ FKLSSHG LQ ZLWK DQ RWKHU /LDP 7LHUQH\ GHQLHG WKH 6DLQWVDFHUWDLQJRDOEHIRUHKLV WZLQ EURWKHU 3iGUDLJ SRLQWHG WR

Pics: Noel Hoyne

A determined Sean Cummins eludes Eoghan Bergin 7KH ORVHUV HIIRUW IDGHG DQG WKHVRXWKWHDPTXDOL¿HGIRUWKH

FRXQW\ ¿QDO ZLWK ¿YH SRLQWV WR VSDUH

Eoin Doyle plucks the ball from Michael Brennan

$ FRPSHWHQW SHUIRUPDQFH IURPWKHZLQQHUVRQFHWKH\JRW

RYHUDQHUYRXVVWDUWDQGLIWKH\ FDQ VKRZ IXUWKHU LPSURYHPHQW

LQWKH¿QDOWKH\FRXOGEHSOD\ LQJVHQLRUKXUOLQJQH[W\HDU

Sean Lyster clears his lines

Lyng and Fogarty shine for Emeralds The Emeralds 1-18, Dunnamaggin 2-10 '(5(./<1*SOD\HGWKURXJK WKH SDLQ EDUULHU WR DVVLVW KLV FOXE 7KH (PHUDOGV WR WKHLU ¿UVW LQWHUPHGLDWH FRXQW\ ¿QDO DSSHDUDQFH 7KHQHZ.LONHQQ\VHQLRUKXUO

LQJVHOHFWRUSOD\HGZLWKDKHDY LO\EDQGDJHGNQHHDQG JDYHDQ RXWVWDQGLQJSHUIRUPDQFH ,I /\QJ ZDV RXWVWDQGLQJ WKHQKLVFRXQW\FOXEPDQ$LGDQ )RJDUW\ZDVGHYDVWDWLQJLQZLQ QLQJ SRVVHVVLRQ DQG WXUQLQJ LW LQWR VFRUHV +H VFRUHG  DQG ZRUNHGWLUHOHVVO\

7KH 8UOLQJIRUG FOXE WRRN WKH JDPH WR 'XQQDPDJJLQ DQGOHGWRDWKDOIWLPH 'XQQDPDJJLQEURXJKW6HDJKDLQ 2¶1HLOO DQG -- 'XQSK\ LQ IRU WKH VHFRQG KDOI DQG 2¶1HLOO PDGHDQLQVWDQWLPSDFW )LUVWWRXFK +HVFRUHGDJRDOZLWKKLV¿UVW

WRXFKRIWKHEDOODQGWKHQZRQD IUHH SRLQWHG E\ :LOOLH 3KHODQ 6XGGHQO\WKHJDPHZDVOHYHO 7KH WHDPV H[FKDQJHG SRLQWV EHIRUH D ORQJ UDQJH HIIRUW IURP %ULDQ7UR\ DQG D JRDO E\ )RJDUW\ SXW GD\OLJKW EHWZHHQ WKHWHDPVDJDLQWR 7KH (PHUDOGV VWUHWFKHG WKH

OHDG WR VL[ SRLQWV E\ WKH WK PLQXWH EHIRUH 'XQQDPDJJLQ UDOOLHG .HQQ\ 0RRUH JRDOHG IURP D  PHWUH IUHH1RHO +LFNH\KLWDQLQVSLUDWLRQDOORQJ UDQJHSRLQWIROORZHGE\VLPLODU VFRUHVE\'DUUHQ)LW]SDWULFNDQG .HQQ\0RRUH72 7ZR SRLQWV LQ DV PDQ\ PLQ

XWHVIURPFRUQHUIRUZDUG&RQRU 0DUWLQ EURNH 'XQQDPDJJLQ¶V KHDUWVDQGVXE-RH.DYDQDJKDQG $LGDQ)RJDUW\IROORZHGXSZLWK WZRPRUHWRVHDODIDPRXVZLQ )RXUZHHNVDJR7KH(PHUDOGV ZHUHLQDUHOHJDWLRQVHPL¿QDO 1RZ WKH\ DUH SUHSDULQJ IRU D FRXQW\¿QDO


116 | SPORT

KILKENNY REPORTER 9 10 2013

Strong support for the Rower Inistioge

JJ Kavanagh & Sons Junior Hurling Semi Finals

Showdown: The ‘Bridge meet Lisdowney 7+( %2<6 RI %HQQHWWVEULGJH FRQ¿UPHG WKHLU IDYRXULWHV WDJ IRU WKH -XQLRU +XUOLQJ &KDPSLRQVKLS ZLWK D SRZHU IXO VHFRQG KDOI GLVSOD\ WR EHDW %DUURZ5DQJHUVE\WKUHHSRLQWV LQWKHVHPL¿QDO /LVGRZQH\ ZLOO EH WKHLU RS SRQHQWVDVWKH\OHGIURPVWDUWWR ¿QLVKWRGHIHDW-DPHV6WHSKHQV  WR    LQ WKH RWKHU VHPL ¿QDO

‘The Bridge’ remain favourites for junior title Bennettsbridge 1-18, Barrow Rangers 2-12 $1 HQWHUWDLQLQJ JDPH IXOO RI JRRG KXUOLQJ DQG HQGHDYRXU VDZWKHµ%ULGJHSXWLQDVWRUP LQJVHFRQGKDOIWRWXUQD IRXUSRLQW GH¿FLW DW KDOI WLPH LQWRDWKUHHSRLQWZLQ ,W ZDV PRUH LPSUHVVLYH WKDQ WKDW DV 5DQJHUV VHFRQG JRDO FDPH LQ LQMXU\ WLPH IURP D 5LFKLH'R\OHPHWUHIUHH 5DQJHUV GLFWDWHG WKH ¿UVW KDOI ZLWK 0DUWLQ %DPEULFN DQG &DWKDO (QJOLVK OHDGLQJ WKH LQ DWWDFN DV 5LFKLH 'R\OH DQG 3DWULFN 3XUFHOO DQFKRUHG D QR QRQVHQVH GHIHQFH ZKLFK UH

GXFHG WKH KLJKO\ UDWHG µ%ULGJH DWWDFNWRVSRUDGLFVFRUHV ,PSRUWDQWVFRUH $ &DWKDO (QJOLVK JRDO LQ WKH WK PLQXWH VHW XS E\ 0DUWLQ %DPEULFN KDG WKH ORVHUV IRXU SRLQWV XS DW WKH EUHDN DV WKH µ%ULGJHRYHUSOD\HGWKHEDOO 7KDWDOOFKDQJHGLQWKHVHFRQG KDOIDVODVW\HDU¶VEHDWHQFRXQW\ ¿QDOLVWV ODQGHG SRLQWV IURP 1LFN\ &OHHUH %ULDQ /DQQRQ DQG6pDQ0RUULVVH\ 7KHQ /LDP %ODQFK¿HOG ZRQ D SHQDOW\ DQG 1LFN\ &OHHUH FUDVKHG KRPH WKH ZLQQHUV PRVW LPSRUWDQW VFRUH  WR  7KDW JRDO JDYH WKLV \RXQJ WDOHQWHG %HQQHWWVEULGJH WHDP WKH FRQ¿GHQFH WR NLFN RQ ZLWK RXWVWDQGLQJ ORQJ UDQJH SRLQWV IURP $LGDQ &OHHUH DQG 6pDQ 0RUULVVH\

Lisdowney stroll into final Lisdowney1-18, James Stephens 1-9 /,6'2:1(< GLG HQRXJK WR ZLQWKLVVHPL¿QDOFRPIRUWDEO\ ZLWKRXWHYHUUHDOO\LPSUHVVLQJ 7KH\ OHG  WR  DIWHU  PLQXWHV /LYHO\ FRUQHU IRUZDUG (GZDUG .HQQ\ VHW XS $DURQ

)RJDUW\ IRU D JRDO LQ WKH WK PLQXWH7KHZLQQHUVOHGWR DWKDOIWLPHZLWKPLG¿HOGHU &RQRU 0F4XLOODQ IS  DQG ZLQJ EDFN +DUU\ :DOODFH DF FRXQWLQJIRUWKHFLW\FOXEWRWDO 6WHSKHQV HQMR\HG WKHLU EHVW VFRULQJVSHOOHDUO\LQWKHVHFRQG KDOI ZLWK &RQRU 0F4XLOODQ QHW WLQJIURPDSHQDOW\DIWHU0DWWKHZ 0F:H\ ZDV IRXOHG DQG WKH\ FORVHGWKHJDSWRIRXUSRLQWV /LVGRZQH\¶VUHSO\ZDVLQVWDQW ZLWKSRLQWVIURP/DU&DUUROODQG 5RU\+LFNH\WRVHWWOHWKHLUWHDP LQWRDZLQQLQJJURRYH+LFNH\¶V VZLWFKWRFHQWUHIRUZDUGIRUWKH ¿QDO TXDUWHU SURYHG D PDVWHU VWURNHDVKHVFRUHG¿YHSRLQWV 0DQDJHU 0DUWLQ 3RZHU ZLOO ORRN IRU D ELJ LPSURYHPHQW IURPKLVWHDPIRUWKH¿QDO

St Canice’s CU Senior Hurling Relegation Final

Injury time heartbreak for Ballycallan Fenians 0-18, Graigue Ballycallan 1-14

7+( )(1,$16 -RKQVWRZQ UH WDLQHG WKHLU VHQLRU VWDWXV LQ D KLJKO\ FRPSHWLWLYH DQG WHQVH UHOHJDWLRQ¿QDOLQ3DOPHUVWRZQ 7KH ¿UVW KDOI ZDV OLYHO\ ZLWK *UDLJXH %DOO\FDOODQ JHWWLQJ D WRQLF VWDUW ZLWK DQ (GGLH %UHQQDQJRDOE\(GGLH%UHQQDQ IURPD¶ %XW \RXQJ JXQV IURP -RKQVWRZQ DLGHG E\ D VOLJKW EUHH]HGRPLQDWHGWKH¿UVWKDOI DQGOHGWRDWWKHEUHDN .HYLQ µ5HEHO¶ 3RZHU ZDV LQ VFRULQJ IRUP IURP IUHHV DQG SOD\ %DOO\FDOODQ DSSHDUHG UHMX YHQDWHG LQ WKH VHFRQG KDOI DV WKH\ SRLQWHG WKHLU ZD\ LQWR WKH OHDG ZLWK 1LDOO 0LOOHD DQG (GGLH%UHQQDQWRWKHIRUH7KH\ ORRNHG OLNH ZLQQHUV ZLWK  PLQXWHVUHPDLQLQJ )RFDOSRLQW 7KH LQWURGXFWLRQ RI 3- 'HODQH\WRWKH)HQLDQVDWWDFNLQ WKH ¿QDO TXDUWHU JDYH WKH ZLQ QHUV D IRFDO SRLQW +H VFRUHG D SRLQWLQWKHWKPLQXWHEHIRUH WKHQHUYHMDQJOLQJFORVLQJPLQ XWHVXQIROGHG $SRLQWLQWKHIRXUWKPLQXWHRI LQMXU\ WLPH E\ .LHUDQ *UHKDQ KLVRQO\VFRUHRIWKHJDPHVHQW *UDLJXH%DOO\FDOODQGRZQWRWKH LQWHUPHGLDWHJUDGHIRU ,WZDVURXJKMXVWLFHRQWKH6N\

%OXHVZKRSUREDEO\GHVHUYHGD GUDZDQGDQRWKHUGD\RXW *UDLJXH %DOO\FDOODQ¶V VRMRXUQ LQWR WKH VHQLRU JUDGH ZKLFK EHJDQ LQ  KDV HQGHG 7KH )HQLDQV KDYH EHHQ SOD\LQJ DW WKHWRSOHYHOVLQFHDQLQ FUHGLEOHUHFRUGIRUDVPDOOUXUDO FOXE

Coaching hats *5$,*8( %DOO\FDOODQ¶V (GGLH %UHQQDQ KHDGHG WR 1RZODQ3DUNWRWKHMXQLRUVHPL ¿QDOWRKHOSWKH/LVGRZQH\JHW WR D FRXQW\ ¿QDO DV KH LV WKH FRDFK ZLWK WKH PDQDJHPHQW WHDP IRU WKH 1RUWK .LONHQQ\ FOXE )HQLDQV JRDONHHSHU 3- 5\DQ DOVR MRXUQH\HG WR 1RZODQ 3DUN IRUWKHVHFRQGMXQLRUVHPL¿QDO DVKHLVWKHPDQDJHURI%DUURZ 5DQJHUV (LJKWWLPHV$OO,UHODQGPHGDO ZLQQHU (GGLH %UHQQDQ WDVWHG GHIHDWLQ3DOPHUVWRZQDQGVXF FHVV LQ 1RZODQ 3DUN ZKLOH LW ZDV WKH RSSRVLWH IRU VL[ WLPHV $OO,UHODQGPHGDOZLQQHU3-

Michael Lyng Motors intermediate Hurling Relegation

Mooncoin caught on the line Mooncoin 0-14, Young Irelands 3-5 0221&2,1 KHOG D VL[SRLQW OHDGKHDGLQJLQWRWKHG\LQJPLQ XWHVEXWWKH\IDLOHGWRFORVHWKH GHDODV<RXQJ,UHODQGVJUDEEHG WZRODWHJRDOVWREULQJWKHWLHWR DUHSOD\QH[W6DWXUGD\ <RXQJ ,UHODQGV JRW D WRQLF VWDUW ZLWK DQ HDUO\ JRDO IURP 'LFN &DUUROO EXW LW ZDV WKH VRXWK WHDP WKDW PDGH PRVW RI WKH UXQQLQJ ZLWK SRLQWV IURP 0LFKDHO *UDFH (RLQ +HQHEU\ DQG 'LDUPXLG 0DFNH\ WR JLYH WKHPFRQWURO 0DQ\UHJUHWV 1HUYRXVQHVV WRRN RYHU WKH 0RRQFRLQDSSURDFKLQWKHFORV LQJVWDJHVDVWKH\VRXJKWWRGH IHQGWKHLUOHDG 3DXO+ROGHQVKRWWRWKHQHWIURP DFORVHLQIUHHLQWKHWKPLQXWH DQGWKHQODWFKHGRQWRDEUHDNLQJ EDOOWROHYHOLQLQMXU\WLPH 0RRQFRLQ OHIW WKH %DOO\KDOH YHQXH ZLWK PDQ\ UHJUHWV DIWHU WDNLQJ D ¿UP JULS EXW OHIW WKH GRRUDMDUIRUWKHLURSSRQHQWV 5HSOD\ LV LQ %DOO\KDOH RQ 6DWXUGD\


SPORT | 117

9 10 2013 KILKENNY REPORTER

Pain into wrist and thumb

By Reporter physio Tomás Ryan ,1 72'$<¶6 DUWLFOH , ZLOO GLVFXVVDSDLQIXOFRQGLWLRQWKDW DIIHFWV WKH EDVH RI WKH WKXPE 7KH FRQGLWLRQ LV FDOOHG 'H 4XHUYDLQ¶VWHQRV\QRYLWLVZKLFK FDXVHVSDLQDQGWHQGHUQHVVLQWR WKHSDOPRIWKHKDQGDWWKHEDVH WKHWKXPE ,W DIIHFWV WKH WZR WHQGRQV RI WKH WKXPE WKDW WUDYHO GRZQ WKURXJKIRUHDUPDQGGRZQLQWR

WKH WKXPE VLGH RI \RXU ZULVW 7KHVH WHQGRQV DUH XVHG ZKHQ \RXJUDVSDWRZHORUIHWFKVRPH WKLQJ IURP D VKHOI ZLWK \RXU KDQG  :LWK FRQVWDQW UHSHWLWLYH PRYHPHQWV RI WKH ZULVW DQG WKXPE LQÀDPPDWLRQ GHYHORSV LQ WKH VOLSSHU\ VXUIDFH FDOOHG WKH V\QRYLDO VKHDWK WKDW FRY HUV WKHVH WZR WHQGRQV FDOOHG ([WHQVRU 3ROOLFLV /RQJXV DQG $EGXFWRU 3ROOLFLV %UHYLV  DV WKH\SDVVWKURXJKWKHZULVW 7KHV\QRYLDOVKHDWK¶VIXQFWLRQ LV WR SURWHFW WKH WHQGRQV IURP IULFWLRQIURPVXUURXQGLQJERQHV LQWKHZULVWZKHQWKHVKHDWKEH FRPHV LQÀDPHG WKH IROORZLQJ V\PSWRPVFDQEHIHOW 3DLQ DQG VZHOOLQJ ZLOO EH QRWHGLQWKHSDOPRIWKHKDQGDW WKHEDVHRIWKHWKXPE7KHSDLQ PD\VSUHDGLQWRWKHIRUHDUPRU IXUWKHULQWRWKHWKXPE

$FWLYLWLHV LQYROYLQJ PRYH PHQWRIWKHWKXPEDQGWZLVWLQJ RIWKHZULVWFDXVHVSDLQ 0XVFOHZHDNQHVVLQWKHWKXPE LVRIWHQQRWHGRYHUWLPH $IHHOLQJRIUHVWULFWLRQPD\EH IHOW LQ WKXPE 1XPEQHVV PD\ DOVR EH IHOW LQ WKH EDFN RI WKH WKXPEDQGLQGH[¿QJHU 0XVLFLDQVDQGKRXVHZLYHV 7KH FRQGLWLRQ FRPPRQO\ DI IHFWV PXVLFLDQV KRXVHZLYHV FDUSHQWHUV EXLOGHUV DQG RI¿FH ZRUNHUVZKLOVWLWFDQFRPPRQ O\ DIIHFW VSRUWV SHRSOH VXFK DV JROIHUVDQGWHQQLVSOD\HUV 2WKHUFDXVHVRI'H4XHUYDLQ¶V WHQRV\QRYLWLV LQFOXGH WUDXPD WRWKHZULVWWHQGRQVUHVXOWLQJLQ VFDUWLVVXHIRUPDWLRQOHDGLQJWR UHVWULFWLRQ ,Q DGGLWLRQ LQÀDPPDWLRQ DUWKULWLF FRQGLWLRQV VXFK DV 5KHXPDWRLG $UWKULWLV FDQ OHDG

WR VZHOOLQJ RI WKH V\QRYLXP VKHDWK WKXV EULQJLQJ DERXW 'H 4XHUYDLQ¶VWHQRV\QRYLWLV 0DQDJHPHQWRI'H4XHUYDLQ¶V 3DWLHQW¶V DWWHQGLQJ P\ FOLQLF ZLWK 'H 4XHUYDLQ¶V 7HQRV\QRYLWLV DUH DGYLVHG WR UHVWWKHKDQGIURPUHSHWLWLYHDF WLRQVWKDWDJJUDYDWHWKHSDLQ 7KLV LV DFKLHYHG E\ ZHDULQJ D VSOLQW WR UHVW WKH WKXPE DW QLJKWWLPH DQG SRVVLEO\ GXULQJ GD\WLPH7KLVVHUYHVWRSUHYHQW FRQWLQXRXVLQÀDPPDWLRQRIWKH LQÀDPHGV\QRYLXPVKHDWK ,Q DGGLWLRQ , RIWHQ FDUU\ RXW JHQWOH IULFWLRQ PDVVDJH WR WKH UHVWULFWHGWHQGRQVLQRUGHUWRLQ FUHDVHPRELOLW\RIWKHZULVWDQG WKXPE ,Q PRUH VHYHUH FDVHV VWHURLG LQMHFWLRQRUHYHQVXUJHU\PD\EH UHTXLUHGWRKHDOWKHFRQGLWLRQ 1H[WZHHN,ZLOOGLVFXVVDIXU

WKHU FRQGLWLRQ WKDW UHIHUV SDLQ LQWRWKHDUPKDQGDQG¿QJHUV 7RPiV 5\DQ LV D 5HJLVWHUHG 3K\VLFDO 7KHUDSLVW ZLWK 7KH ,ULVK $VVRFLDWLRQ RI 3K\VLFDO

7KHUDS\DQGLVEDVHGLQ&ORQPHO DQG7KXUOHV &RQWDFW   (PDLO \RXU TXHULHV WR WRPDVSU\DQ# JPDLOFRP

'XQQDPDJJLQ'XQQDPDJJLQY 6OLHYHUXH SP

5HI-RKQ0F&RUPDFN>([WUD 7LPH@ 'XJJDQ6WHHO8+/5RLQQ µ%¶6KLHOG6HPL)LQDO %DOO\UDJJHW6W/DFKWDLQ¶VY /LVGRZQH\ DP

5HI(DPRQ/DUNLQ 'XJJDQ6WHHO8+&5RLQQ µ&¶)LQDO 'DQHVIRUW7XOORJKHU 5RVEHUFRQY&RQDK\6KDPURFNV DP

5HI6HDQ%UHQQDQ 'XJJDQ6WHHO8+&5RLQQ µ&¶6KLHOG4)LQDOV 6W-RKQ¶V3DUN2¶/RXJKOLQ *DHOVY<RXQJ,UHODQGV DP

5HI&RQRU(YHUDUG>([WUD 7LPH@ &RRQ6W0DUWLQ¶VY%DUURZ

5DQJHUV SP

5HI*D\5DIWHU>([WUD7LPH@ 'XJJDQ6WHHO8+&5RLQQ µ'¶6KLHOG6)LQDOV :LQGJDS:LQGJDSY &DUULFNVKRFN DP

5HI3DW+D\HV>([WUD7LPH@ 7XOODURDQ7XOODURDQY 2¶/RXJKOLQ*DHOV SP

5HI-DPHV%DUU\>([WUD7LPH@ 8*R*DPHV)HVWLYDO )LQDOVLQ1RZODQ3DUN &DUULFNVKRFNY*OHQPRUH DP

&DUULFNVKRFNY*OHQPRUH DP

.LOPDFRZY3LOWRZQ DP

.LOPDFRZY3LOWRZQ DP

7KRPDVWRZQY'XQQDPDJJLQ DP

7KRPDVWRZQY'XQQDPDJJLQ DP

6XQGD\ 6W&DQLFH¶V&UHGLW8QLRQ6+& 6HPL)LQDOV 1RZODQ3DUN6W0DUWLQ¶VY &ODUD SP

5HI*DYLQ4XLOW\ 1RZODQ3DUN%DOO\KDOH 6KDPURFNVY&DUULFNVKRFN SP

5HI3DGG\1HDU\ 8DQG'HYHORSPHQW VTXDGV)RRWEDOO -DPHV¶V3DUN DP $OOLQWHU HVWHGSOD\HUVWRDWWHQG 8'HYHORSPHQW+XUOLQJ 3DOPHUVWRZQ'XQQDPDJJLQY 0HDWK DP

3DOPHUVWRZQ'LFNVERURY 0HDWK DP

-DPHV3DUN(ULQ¶V2ZQY 0HDWK DP

0HDWKWHDPVJXHVWVRI

.LONHQQ\&R%RDUGDW&RXQW\ 6HQLRU6HPL)LQDOV 0RQGD\ $OOLDQ]&XPDQQQDP%XQVFRO &RUQQD7XDLWKH&RXQWU\&XS )RRWEDOO SP

0RRQFRLQ%16Y7XOORJKHU 5RVEHUFRQ16 %DOO\UDJJHW16Y*RZUDQ16 *OHQPRUH16Y&DUULFNVKRFN 16 7KRPDVWRZQ16Y &DVWOHFRPHU%16 0XOOLQDYDW16Y'DQHVIRUW16 &RRQ0XFNDOHH16Y&ODUD16 /LVGRZQH\16Y*UDLJXH 6NHRXJK &RQDK\.LOPDQDJKY6FRLO 3KiGUDLJ%DOO\KDOH :HGQHVGD\ $OOLDQ]&XPDQQQDP%XQVFRO 5RLQQµ$¶7R\PDVWHU)/ SP

.LOPDQDJK16.LOPDQDJK16 Y.LONHQQ\&%616 'DQHVIRUW16'DQHVIRUW16Y 6W3DWULFNV'/6 &DVWOHFRPHU%16&DVWOHFRPHU %16Y*RUHVEULGJH3DXOVWRZQ 6FRLO0F&DXOH\5LFH166FRLO 0F&DXOH\5LFH16Y&ODUD16 *DHOVFRLO2VUDt*DHOVFRLO 2VUDtY7XOORJKHU5RVEHUFRQ16 6W&DQLFHCV166W&DQLFHCV 16Y7KRPDVWRZQ16 $OOLDQ]&XPDQQQDP%XQVFRO 7RS2LO5RLQQµ%¶)/ SP

*UDLJXH6NHRXJK*UDLJXH 6NHRXJKY6W&DQLFHCV16 *RZUDQ16*RZUDQ16Y %HQQHWWVEULGJH16 .LONHQQ\6FKRRO3URMHFW .LONHQQ\6FKRRO3URMHFWY *DHOVFRLO2VUDt SP

&RRQ0XFNDOHH16&RRQ 0XFNDOHH16Y/LVGRZQH\16 &ORJK0RRQHHQURH16&ORJK 0RRQHHQURH16Y%DOO\UDJJHW 16 )UHVKIRUG16)UHVKIRUG16Y 8UOLQJIRUG16 *OHQPRUH16*OHQPRUH16Y 6OLHYHUXH16 &DUULFNVKRFN16&DUULFNVKRFN 16Y.LOPDFRZ%16 7KH5RZHU167KH5RZHU16 Y0RRQFRLQ%16 3LOWRZQ163LOWRZQ16Y 0XOOLQDYDW16

De Quarains Tenosynovitis

GAA Fixtures :HGQHVGD\ $OOLDQ]&XPDQQQDP%XQVFRO 5RLQQ$7R\PDVWHU)/ SP

6W-RKQCV166W-RKQCV16Y &DVWOHFRPHU%16 *RUHVEULGJH3DXOVWRZQ *RUHVEULGJH3DXOVWRZQY 'DQHVIRUW16 6W3DWULFN¶V'/66W3DWULFN¶V '/6Y.LOPDQDJK16 7KRPDVWRZQ%167KRPDVWRZQ 16Y*DHOVFRLO2VUDt &ODUD16&ODUD16Y6W &DQLFHCV16 %DOO\KDOH166FRLO3KiGUDLJ %DOO\KDOHY6FRLO0F&DXOH\ 5LFH16 $OOLDQ]&XPDQQQDP%XQVFRO 7RS2LO5RLQQµ%¶)/ SP

'XQQDPDJJLQ16'XQQDPDJJLQ 16Y.LONHQQ\6FKRRO3URMHFW SP

*DHOVFRLO2VUDt*DHOVFRLO 2VUDtY*RZUDQ16 %HQQHWWVEULGJH16 %HQQHWWVEULGJH16Y*UDLJXH 6NHRXJK %DOO\UDJJHW16%DOO\UDJJHW 16Y)UHVKIRUG16 /LVGRZQH\16/LVGRZQH\16 Y&ORJK0RRQHHQURH16 &RQDK\16&RQDK\16Y &RRQ0XFNDOHH16 0XOOLQDYDW160XOOLQDYDW16 Y&DUULFNVKRFN16 0RRQFRLQ%160RRQFRLQ %16Y*OHQPRUH16 6OLHYHUXH166OLHYHUXH16Y 3LOWRZQ16 .LOPDFRZ%16.LOPDFRZ %16Y7KH5RZHU16 6DWXUGD\ 0LFKDHO/\QJ0RWRUV,+& 5HOHJDWLRQ)LQDO5HSOD\ %DOO\KDOH<RXQJ,UHODQGVY 0RRQFRLQ SP

5HI3HWHU%XUNH>([WUD7LPH@ --.DYDQDJKDQG6RQV1RUWK -+&)LQDO &ORQHHQ*DOPR\Y%DUURZ 5DQJHUV SP

5HI*HU2¶*UDG\>([WUD7LPH@ .LONHQQ\+RQGD&HQWUH0LQRU +&5RLQQµ$¶6HPL)LQDOV 7KRPDVWRZQ2¶/RXJKOLQ *DHOVY-DPHV6WHSKHQV SP

5HI0LFKDHO2¶6XOOLYDQ>([WUD 7LPH@ 7KRPDVWRZQ5RZHU,QLVWLRJH Y'LFNVERUR SP

5HI5D\PRQG%\UQH>([WUD 7LPH@ .LONHQQ\+RQGD&HQWUH0LQRU

+&5RLQQµ%¶6HPL)LQDOV )UHVKIRUG&RQDK\6KDPURFNV Y/LVGRZQH\ SP

5HI(XJHQH5\DQ>([WUD7LPH@ )UHVKIRUG&ODUDY'DQHVIRUW SP

5HI-RKQ*XLQDQ>([WUD7LPH@ .LONHQQ\+RQGD&HQWUH0LQRU +&5RLQQµ&¶6HPL)LQDOV %HQQHWWVEULGJH6W3DWULFN¶VY &DUULFNVKRFN SP

5HI-RKQ.HQQHG\>([WUD 7LPH@ 0XOOLQDYDW6OLHYHUXHY 'XQQDPDJJLQ SP

5HI-XOLDQ2¶'Z\HU>([WUD 7LPH@ 'XJJDQ6WHHO8QGHU+& 5RLQQµ%¶6KLHOG4)LQDOV 8UOLQJIRUG(PHUDOGVY&ODUD SP

5HI3RGJH%XWOHU>([WUD7LPH@

Pic: Noel Hoyne

Love is... A good game of hurling

Danesfort GAA & Parish Lotto 7+(*UDQJH,QQMDFNSRW¼ 1XPEHUV1RZLQQHU &RQVRODWLRQ ¼ $LQH DQG

-DQH 0DKRQ\ /XF\ %XFNH\ %UHGD 'RROH\ -RKQQ\ *UDFH $YD1RODQ

3URPRWHUV¼)LQEDUU.HOO\ 0DXULFH:RRGFRFN 1H[W GUDZ 2FWREHU  LQ

'HODQH\¶V.HOOVMDFNSRW¼ 7KHQ 6KHULGDQ¶V (QQLVQDJ 2FWREHU


118| SPORT

KILKENNY REPORTER 9 10 2013

Golf Notes – Callan Mount Carmel Classic Next Friday and Saturday Callan golf Club hosts the annual Mount Carmel Classic. The response this year has been phenomonal and most appreciated by all involved. This Classic is a vital fundraiser for this wonderful organisation who nurse the elderly in the most caring and respectful of manners. Ignasius Rice has fund raised brilliantly for years in aid of Mount Carmel and this year golf club members Robert Woodcock and Bea O Donovan and aided by Mount Carmels Anne Walpoole are the chief organisers. The classic costs 60e per team with some beautiful prizes on offer including a first prize of a weekend break in Kilcoran Lodge in Cahir for the winnning combination. Any sponsorship would be greatfully recieved (donations, tee boxes or prizes) with tee time enquires to Robert (087 6592977)/ Bea from Callan Golf Club (056 7725136) or Anne (056 7725301). There is very limited tee time availablity but the organising committee will endevour to accomodate any teams that are interested in supporting the efforts.

Membership 2014 Membership for 2014 is now open with some fantastic deals for new or lapsed members from 499e (449 for seniors). Membership for existing members has also

been reduced to 549 with an option of inviting in a new/ lapsed member for 449 for both the new/lapsed member and the existing member. Of one joins now they will be fully paid up members until January 2015. That represents amazing value and full details/finance options are available from Margaret on 056-7725136.

Ladies end of Season Prizes Mary Lanigan claimed top billing when the Ladies End of Season Prizes were played out last saturday on sunsoaked

fairways. The unseaonsally warm weather obviously suited Mary who had 40 points to win by 3 points from Eiliah Ahern with Berna Walsh in third. Breda Ryan capped off a fine season by taking the gross award. Mary Manning took fourth place with 36 points while Eileen Cuddihy was in fifth. Well done to all the prize winners and indeed all the participants in helping to make this finale such a successful and memorable day.

Bar and Catering The Club would like to

welcome Keith O Dwyer to the club as the new bar and catering lease holder. Keith has had a long relationship with the club and is wished the best of luck in his efforts. There is a full bar and catering service available to members and visitors with function catering also welcomed. Contact Keith at 056-7725136 to discuss availability. Best of luck to Michael Wlash in his new venture and all the best for the future also.

3 M Somers Cat B 1 L Tyrell 2 N Phelan 3 J Kehoe

Results

Fixtures

RGA Monday 30th Sept Cat A 1 D Bolger 2 J Kinsella

Ladies End of Season Prizes Saturday 5th October 1M Lanigan 40 2 E Ahern 37 Gross B Ryan 3 B Walsh 4 M Manning

Ladies Open 2 Person Team Event 1 October 1 M Kennedy/B McGrath 2 M Lanigan/A Lanigan Wed. 9th Oct. 2013 O Dwyer Golf Store Open

Singles Thu. 10th Oct. 2013 9.30 - 10.50 SENIOR LADIES 11.00-12.50 LADIES 12 HOLE COMP Fri. 11th Oct. 2013 MOUNT CARMEL CLASSIC Sat. 12th Oct. 2013 MOUNT CARMEL CLASSIC + 4 PERSON TEAM EVENT Sun. 13th Oct. 2013 4 PERSON TEAM EVENT Mon. 14th Oct. 2013 RGA Tue. 15th Oct. 2013 LADIE’S DAY

Golf Notes – Gowran Park Members Monthly Medal

winning team accompanied by Lady Captain Margaret were Hilary Dick, Mary Purcell and Fionnuala Hennebry with 84.6. In 2nd place with 84.8 Ann Mullins, Brigid Mullins and Eithne Byrne followed by Kate Hennessy, Ina Sweeney and Ann Marie McSorley in 3rd place with 87.1.

A record entry of over 80 members played in the final monthly medal of the season. 11 handicapper John Hoyne took the leading spot with a score of 65 with Pat Kirwan (9) secured 2nd place with a nett 66. Pat Nolan returned a nett 67 to take 3rd place. Fixtures for next weekend will include an Open Fourball on Sunday 13th October with a timesheet in place – book online or ring the office on 056 7726699.

Ladies Singles Matchplay After a very close final match, Judy Dick secured the win on the 19th hole against her younger sister Rachel. Well done Judy – a great achievement.

Injured Jockeys Classic – Thursday 26th September A very successful Classic was run by Gowran Park on 26th September last – over 35 teams went out over 2 shotgun starts in support of this very worthy cause. Courtown members, Michael and John Shiel along with Danny Whitty returned the best score on the day with 98 points with Sean

The Glenns Trophy Keane, Jerry McIntyre and Ger Lynch taking runners up spot with 96 points. Brigid Mullins, Michael Morrissey and David Bambrick took 3rd place with 95 points – just edging Paraic O’Rourke, Tom Mullins and Andy Hughes into 4th place

with 94 points. The singles competition on the day for jockeys resulted in Fergal Lynch (18) taking the honours with 47 points while Alan Donoghue and Ken Whelan took 2nd and 3rd place respectively with 43

points with the countback on the back 9 dividing. In excess of €3,000 was raised for the fund on the day.

2nd October 2013 - 18 Hole Stableford 1st - Hilary Dick (18) 40pts

Lady Captain Margaret’s Day Out The ladies enjoyed a great day out at Waterford Castle on Friday 4th Oct. The format 3 person 18 hole scramble with 2 scores to count on par 3. The

Following a qualifying round pairings Eileen Tobin & Ann Farrell, Helen Dunne & Gay Latchford headed off to Birr Golf Club last Wed 2nd October. There were no winning scores for Gowran but an enjoyable day was had by all.


SPORT | 119

9 10 2013 KILKENNY REPORTER

Golf Notes – Kilkenny RESULTS Mens October Monthly Medal Sat Oct 5th & Sun Oct 6th C.S S. Sat & Sun 70 1. Pat Butler (6) 62 net 2. Emmet Boland (7) 63 net 3. Aidan Brennan (11) 65 net (B9) Best Gross; Eddie Power (Scr) 70 5. Shane Henderson (17) 65 net 6. Seamus O’Neill (18) 66 net Junior Prize, Simon Cullen (18) 69 net Date for Presentation of Prizes Friday October 11th at 7pm. Two’s Club Mens October Monthly Medal Sat Oct 5th & Sun Oct 6th David Walsh at 15th & 17th. John Burke, Eugene Coyne, Pat Butler Snr, Morgan Doyle, Geoff Meagher, Willie Murphy (Conv) at 6th, Eddie Power at 10th, Roger Curran, Emmet Boland at 15th, Richard Walsh, Brian Meredith, Tom Hickey, Brian Crowdle, Colin Corbett at 17th. Each Two is worth €18.00 and is credited in the Pro Shop. Ladies & Gents & Gents Open Singles Wed Oct 2nd Gents Section 1. Tom Sloyan Jnr (7) 40 pts 2. Sean Murphy (22) 39 Pts (B9) 3. Liam McCormack (14) 39 pts (B9) Best Gross; Graham Nugent (2) 36 pts 5. Norman Williams (12) 39 pts 6. Conor Boland (6) 38 pts Ladies Section Rebecca Mulholland (9) 40 pts Two’s Club Lades & Gents Open Singles Wed Oct 2nd. Richard Guilfoyle at 6th, Simon Cullen, Seamus Rochford at 15th, Barry Walsh,

open for the Ladies and Gents sections of the club. Applicants who wish to join at the moment can enjoy the benefit of 3 months free membership as their fees will cover them until their subscription becomes due for renewal in 2015. Please contact Sean or Aoife in the office at 056 7765400 who will give you full details of all the packages that are available. Membership for the Boys and Girls Primary/ Juvenile/Junior categories will not be considered until February 2014.

FIXTURES

P J O’Reilly, Tony McCarthy, Mary Hickey at 17th. Each two is worth €23.42 and is credited in the Pro shop.

LADIES RESULTS & NEWS LADIES 18 HOLE V PAR SUN 29TH & TUES OCT 2ND C.S.S Sunday 73 & Tuesday 72 1. Breda Roche (15) 2 up 2. Sheila Brennan (24) 1 Down (B9) Best Gross; Mary Leahy Browne (3) 5 Down 3. Frances Graham (30) 1 Down (B9)

Ladies Fixtures Tuesday 8th October Ladies 18 Hole Stableford, 8.30 –

10.20 and 12.20 -2.20. No evening slots. Tuesday 15th October, Ladies 13 Hole Stableford 8.30 – 10.20 and 12.20 -2.20. No evening slots. Times also available on Sunday October 13th, bookable online 10.30 – 11.00 and draw at 3.20. Lady Captain Sheila Brennan has chosen Woodenbridge for the Ladies away outing this year. The date is Friday October 18th with golf in Woodenbridge on that day and staying overnight in the Woodenbridge Hotel. Details of the cost are on the Ladies notice board. The list of names is being closed off this week so

if any Lady wishes to go on the trip they will need to get their name down by Friday October 11th and the deposit of €50 must also be paid by this date.

SENIOR MEN No competition Thursday October 3rd due to weather. Next Competition Thursday 10th October 11.00am, Senior mixed rescheduled to Wednesday October 16th, timesheet for October 3rd stands. If you were on the sheet for Thursday October 3rd and unable to play on Wednesday October 16th please contact Martin Murphy or Lila Byrne.

SENIOR LADIES No competition on Thursday October 3rd due to weather. Next Competition Thursday 10th October at 10.00am. Senior mixed rescheduled to Wednesday October 16th, timesheet for October 3rd stands. If you were on the sheet for Thursday October 3rd and unable to play on Wednesday October 16th please contact Martin Murphy or Lila Byrne.

MEMBERSHIP As we approach the end of our financial year on October 31st we are again open for membership enquiries. There are a number of vacancies

Monday 7th October; 8.30 – 1.00 Ladies South East Alliance, 1.00 – 2.00 Members Time Tuesday 8th October, 8.30 – 10.20 and 12.20 – 2.20 Ladies 18 Hole Stableford, No evening slots. Wednesday 9th October, 1.00 – 2.00 Members Time Thursday 10th, October; 10.00 - 11.00 Senior Ladies, 11.00 – 1.00 Senior Men, 1.00 – 2.00 Members Time Friday 11th, October; 12.00 – 1.00 Visitors, 1.00 - 2.00 Members, 2.00 – 2.15 Schools Match. Saturday 12th October; 8.00 – 9.00 Members, 9.30 – 10.30 Mens October Hamper 4/Ball, 10.30 – 11.30 Visitors, Mens Crosscard Draw at 1.30pm. Sunday 13th October; 8.00 - 10.30 and 11.00 – 3.10 Mens October Hamper 4 Ball, Ladies Competition 10.30 - 11.00 Bookable online and draw at 3.10 – 3.50. Monday 14th. 1.00 -2.00 Members Time Tuesday 15th, 8.45 – 10.20 and 12.20 – 2.20 Ladies Competition. Wednesday 16th October, 10.00 – 11.00 Senior Ladies, 11.00 -1.00 Senior Men. 1.00 – 2.00 Members

Golf Notes – Mountain View Winter League

Results

41 players took part in the opening round of the Winter League last weekend. The competition was a single stroke and was played in near perfect conditions. In category 1 Colm Hayes (14) recorded a fantastic score with a net 66. The league points were allocated as follows. Category 1 C. Hayes 12Pts, E. Walsh 9Pts, S. Byrne 6Pts, M. Waugh 3Pts, T. Walton 1Pt. Category 2 N. Byrne 12Pts, T. Coyne 9Pts, B. McGuire 6Pts, St John Donovan 3Pts, N. Mullally 1Pt. Category 3 J Earle 12Pts, P. Parsons 9Pts, N. Doran 6Pts, M. Hoyne 3Pts, J J Holohan 1Pt.

Seniors competition on Tuesday Oct 1st and Ladies competition on Wednesday Oct 2nd were both cancelled due to heavy rain. Sun Oct 6th Single Stroke(Winter League 1st Round) 1. J Earle (21) Nett 65. 2. P Parsons (19) 65. 3. C Hayes (14) 66. 4. N Byrne (16) 66. 6 T Coyne (18) 66.

Diary Sunday Oct 13th Fourball Better Ball Wednesday Oct 16th MV Ladies 18 Hole Competition Sunday Oct 20th Winter League 2nd Round (Single Stableford )


120 | ADVERTISEMENT

KILKENNY REPORTER 9 10 2013

Kilkennyreporter09102013  
Read more
Read more
Similar to
Popular now
Just for you