Skip to main content

2023 New Member Guide

Page 1

GREEK ADVANCE 2023-24

Phase 1: New Member Education

FSL New Member

RESOURCE GUIDE

Name: Chapter:

This guide will provide you with an introduction to many of the policies, expectations, services, and resources you'll need to be successful throughout your Greek experience at Georgia Tech.

We are so glad you're a part of our 135 year old community. We didn’t invent fraternity and sorority life, but we are reengineering it for the future every day. Our shared goal is to create people of purpose, of character, and of poise — ready to not only get a good job when they graduate, but to lead their industries, be well-rounded citizens, and have the confidence and communication skills needed to build the future.

Our members spend some moments building collegiate memories and the next moments building scientific history. Our members celebrate life and celebrate each other’s academic accomplishments. You are a Georgia Tech student because you want more out of life, you envision more for the world, and you chose to demand more of yourself than is required.

Throughout your new member experience, you'll build connections and strive to live your organization's values by your every day actions. Representing our community comes with high expectations and the Fraternity & Sorority Life staff are here to support you.

Table of Contents

Welcome!
4 6
10 12 13 14 16 18
for Student Engagement
Overview Expectations of Membership
Laws & Policies
Alcohol Smart
and Other Drug Policy
Misconduct Policy Terms
Violence Resources
Health Resources
8 9
Center
Greek Advance Programs 2023-24 Community
Anti-Hazing
Be
Alcohol
Sexual
Sexual
Mental

NEED HELP?

ASK OUR EXPERTS!

Fraternity & Sorority Life Staff

The office is open year-round except for official Institute holidays; Monday through Friday 8:00 a.m. to 5:00 p.m.

We work in collaboration with other teams in the Center for Student Engagement and in the Division of Student Engagement and Well-Being to support the success of our members.Through partnership with our student leaders and regular communication with the headquarters staff and volunteers, we help define the fraternal experience for the next generation.

Contact Us

We'd love to hear from you! Here's how to learn more and connect with our team:

greek.gatech.edu

@gtfsl

404-894-3458

John Lewis Student Center Suite 3110

Interfraternity Council

Greek 100 Meal Plan

Hazing Prevention Coalition

Collegiate Panhellenic Council

Multicultural Panhellenic Council

Greek Housing

Greek Advance Programming

National Pan-Hellenic Council

G.U.I.D.E.

Dr. Jamison Keller
edu
Life
Fraternity & Sorority Life
jkeller38@gatech.edu Assistant Dean of Students and Director of Fraternity & Sorority Life Kerry McCarthy kerry mccarthy@gatech
Assistant Director of Fraternity & Sorority
Vacant Assistant Director of
5

CENTER FOR STUDENT ENGAGEMENT

PROFESSIONAL STAFF

The Fraternity & Sorority Life team are part of the Center for Student Engagement. Our staff of dedicated professionals is here to help you achieve your organization's mission and grow as a wellrounded student and leader. There are 4 teams in our Center: Student Organizations, Civic Engagement, Student Media, and Fraternity & Sorority Life.

Mac Pitts Student Media Shavonne Delgado Jumpstart Jayde Nelson Civic Engagement Starmeka Jones Center for Student Engagement Dr. Gerome Stephens Center for Student Engagement Mariah Liggins Alyssa Rodriguez Student Organizations
4
Student Organizations Leadership Kayla Watson

GREEK ADVANCE 2022-23

Fraternity and Sorority Life staff have developed a series of development opportunities intentionally situated at different membership points throughout a student's Greek experience at Georgia Tech. Collectively known as Greek Advance, each program is designed to provide tools and resources at every level of membership for students to advance as leaders within their community To meet students where they are at, there is a program tied to each stage of membership Some programs are mandatory for all members, and some are optional programs to take advantage of. Learn more about our all-member Greek Advance opportunities below.

New Member Education

CPC & IFC: Sessions available at the start of Fall and Spring Semester

MPC & NPHC: Sessions available at the end of Fall and Spring Semester

Education provided by FSL staff related to hazing prevention and community expectations.

Attendance: RSVP on Engage is required for all new members offered a bid for membership in the current semester for CPC & IFC chapters. Required for all 2022 initiates of MPC & NPHC chapters in late November Spring joiners for all councils will have a date TBD in the Spring semester

Greek Emerging Leaders

January 31 - April 4, 2024

An 8-week cohort based experience designed to give newly initiated members the tools to amplify their impact and leadership potential Topics include exploring your strengths, embracing diversity & community, crucial conversations, and living your values

Attendance: Optional for newly initiated members who have been in the chapter less than one year and having rising leadership qualities. Up to two members per chapter can participate.

Greek Leaders Advancing

October 13-15, 2023

A weekend retreat designed for middle members interested in running for a position within their chapter or council. Participants will examine chapter culture and values and create an action plan with peer feedback to spark culture change.

Attendance: Optional for members who have been in the chapter for longer than one year, but less than three years Up to two members per chapter can participate

Greek Officer Summit

January 2024

An advanced leadership conference for chapter and council officers designed to inspire a vision for the future of the community. Training tracks by specific officer position will be provided.

Attendance: Required for all chapter presidents, house managers, risk managers, social chairs, new member educators, and council officers Optional but encouraged for all other officer positions

Graduating Member Series

Ongoing throughout the Fall & Spring semesters

A passive and active series designed for the last year of membership to prepare students for life as an alumni Partnerships with the Career Center and Alumni Relations are a signature component

Attendance: Optional for any member who will be graduating within the next year.

6

GREEK ADVANCE 2022-23

Phase 1: New Member Education

CPC & IFC New Member Education

Education provided by FSL staff related to hazing prevention and community expectations.

Attendance: RSVP on Engage is required for all new members offered a bid for membership in the current semester New Members can choose which session to attend from multiple options Each session can accommodate 300 students max.

Fall Semester Options:

3 sessions to select from at the beginning of the semester

Spring Semester Options:

2 Sessions to select from at the beginning of the semester

Screenshot of sample Engage event to RSVP to engage.gatech.edu

MPC & NPHC New Member Education

Education provided by FSL staff related to hazing prevention and community expectations. *RSVP not required

Attendance: Required for all initiated members during semester they cross

Fall and Spring Semester Options:

1 session at the end of the fall and spring semester, prior to the last full day of classes

7

COMMUNITY OVERVIEW

Georgia Tech's fraternity and sorority community closely follows the history of the Institute.

Georgia Tech established

First IFC Fraternity

Women admitted to Tech

First CPC Sorority

Black students admitted to Tech

First NPHC Fraternity

First NPHC Sorority

Greek Housing Boom

First MPC Fraternity

First MPC Sorority

Today!- NPHC Plaza Opening

Governing Councils

Women were not admitted to Tech until 67 years after its establishment, but sororities came soon after. Black students were not admitted until 9 years after the first women. The need for affinity space was great.

The 1996 Atlanta Olympics created a housing boom for athletes, later used for Greek houses. Chapters in all 3 councils at the time had houses around the Greek Sector.
19521954
1888 1961 1977 1979 1990s 2005 2007 2023
Our MPC council was established making our Greek community what it is today.
1885
1885 1888 1952 1954 1961 1977 1979 1990s 2005 2007 2023
National Pan-Hellenic Council (NPHC) Collegiate Panhellenic Council (CPC) Interfraternity Council (IFC)
8 NPC Sororities 1 Associate Sorority 31 Fraternities 3 Fraternities 2 Sororities 4 Fraternities 4 Sororities 53
@gtcpc @gt_ifc @gt.mpc @gt_nphc 8
Multicultural Panhellenic Council (MPC)
Chapters Total

Divine Nine Plaza

The National Pan-Hellenic (NPHC) also known as the Divine Nine at Georgia Tech is proud to share with you all the Divine Nine Plaza. The mission of the NPHC is to promote unity and expose members to the “service for life” philosophy and foster leadership development and scholarship. The NPHC organizations are dedicated and committed to civic engagement, academic achievement, leadership and providing a sense of inclusivity and equity. Georgia Tech has committed to an initiative to recognize these organizations through the implementation of the Divine Nine Plaza. The plaza will feature nine plots to represent all organizations in the NPHC, and an amphitheater for events and performances. This Divine Nine Plaza will offer an opportunity for NPHC organizations to gather and foster community engagement and programming.

History of Plots

Dating back to the 1920’s, one of the most prominent symbols of Black Greek Letter Organizations on college campuses are plots. Plots symbolize the organization using colors Greek symbols or letters, national and local history. Plots serve as a gathering places and symbolic honor for the past and future generations of Black Greek members.

Order of Omega

Order of Omega members are selected from the highest achieving fraternity or sorority members (must be a sophomore, junior, or senior to apply) at each institution. To date, over 575+ chapters have been chartered throughout North America with over 250,000 members initiated since 1959.

Order of Omega is a leadership honor society for members of Fraternity & Sorority organizations. Order of Omega recognizes upperclassmen who have exemplified high standards in the areas of scholarship, leadership, involvement within their respective organization and within the Fraternity/Sorority, campus, and local community. Members share the common goal of recognizing the many outstanding student leaders at their institution.

Order of Omega is a society based on leadership and academics and limits membership to 5% of the total number of enrolled fraternity/sorority undergraduates.

G.U.I.D.E.
Greeks United for Inclusivity, Diversity, and Equity is a student advocacy organization committed to creating a culture of diversity, equity, and inclusion and establishing Georgia Tech as a pioneer for a nation-wide shift in the Greek experience.

EXPECTATIONS OF MEMBERSHIP

I understand that as a fraternity or sorority member, my personal actions will reflect not only upon myself, but also upon my chapter, the entire Greek community, and the Institute; therefore, I will adhere to the highest standards of personal responsibility and integrity. I will become familiar with and comply with the policies of my organization, Georgia Tech, and the law.

I will learn and understand the ideals expressed in my fraternity or sorority ritual, strive to incorporate those values into my daily life, and hold members who do not adhere to these standards accountable.

I will respect the dignity of all persons and will not tolerate racist, sexist, homophobic or other abusive or discriminatory behavior. I will strive to uphold an inclusive environment in my chapter and community

I will not engage or participate in any hazing activities nor tolerate hazing by others

I will support healthy living. I will neither misuse nor support the misuse of alcohol. I will neither use nor support the use of illicit drugs or the misuse of prescription drugs.

I will protect the safety and welfare of my fellow members and others in the campus community I am willing to call for emergency assistance for those in need.

I will commit to serving the Institute and society through social responsibility and community service.

I will strive to develop my leadership skills by getting involved in fraternity, sorority, and campus programs and activities.

I will strive for academic achievement and intellectual development and practice academic integrity

I will fulfill my fraternity and sorority responsibilities, including prompt payment of financial obligations, attendance at meetings and other required activities, and participation in the management of the chapter.

I will respect the rights of Institute area neighbors (including other students and religious houses) and others in the campus community

I will promote unity and the general welfare of the fraternity and sorority community by respecting and supporting all chapters and members.

Signature Date 9 Initial Initial Initial Initial Initial Initial Initial Initial Initial Initial Initial Initial

ANTI-HAZING LAWS & POLICIES

The Max Gruver Act State of Georgia Law

Effective July 21, 2021

Definition of Hazing:

An individual commits hazing by subjecting an enrolled student or prospectively enrolled student to perform an activity, in connection with or as a condition or precondition of gaining acceptance, membership, office, or other status in a student organization, that “endangers” or is “likely to endanger” his or her physical health or“coerces” the student through the use of “social or physical” pressure to consume any food, liquid, alcohol, drug, or other substance which subjects the individual to a likely risk of vomiting, intoxication, or unconsciousness

Georgia Tech Student Code of Conduct

"Hazing is conduct, whether on or off Institute premises, which exceeds the normal expectations of the organizational purpose or mission and which:

Endangers the mental or physical health or safety of a student as a condition of affiliation with a Group or RSO; Is sufficiently severe or pervasive enough to interfere with academic responsibilities; or

Is any intentional, negligent or reckless action, or situationcausing another pain, embarrassment, ridicule or harassment, regardless of the willingness of the participant "

Read the full legislative text at: stophazing.org/policy/state-laws/georgia

Read the full Student Code of Conduct at: policylibrary.gatech.edu/student-life/student-code-conduct

HAZING CAN TAKE MANY FORMS:

Greeting others in a specific manner

Making prank calls or harassing others

Being taken to & left at an unknown location

Expecting items to always be in one's possession

Humiliation, roast nights, or wearing embarrassing clothing

Threats, implied threats, verbal abuse, & assigning demerits

Sleep deprivation and being woken up in the night

Water intoxication or forced ingestion of substances

WHERE CAN IT HAPPEN?

Hazing happens at colleges and universities AND middle and high schools. Some common places are:

Varsity Athletic Team

Social Fraternity or Sorority

Club Sports

Performing Arts Organization

Academic Club

Honor Society

10

The Spectrum of Hazing Behaviors

(Allan, 2015; Allan & Kerschner, 2020; Adapted from Bringing in the Bystander)

To report hazing at Georgia Tech: https://secure.ethicspoint.com/domain/en/report_company.asp https://cm.maxient.com/reportingform.php?GeorgiaTech=&layout_id=14 Anonymously: Publicly: Hazing conduct history at Georgia Tech: osi.gatech.edu/hazing-conduct-history More information & resources: https://hazingprevention.org/students 11

BE ALCOHOL SMART

ALCOHOL & OTHER DRUG POLICY + Good Samaritan/Medical Amnesty Provision

Read the full policy text at: policylibrary.gatech.edu/student-life/studentstudent-organization-alcohol-and-other-drug-policy

Alcohol:

Individual possession and/or consumption of alcohol is acceptable, provided individuals DO NOT:

Possess or consume alcohol if under 21 years of age

Furnish, or cause to be furnished, any alcohol to persons under 21 years of age.

Conspicuously display open containers of alcohol in any public location, including, but not limited to, grounds, sidewalks, and streets within campus boundaries (but not the public sidewalks and streets, or privately owned or leased property)

Sell alcoholic beverages

Misrepresent one's age or identity in any manner for the purpose of obtaining or possessing alcohol.

Serve or make available alcohol to intoxicated persons

Alcoholic beverages may be served and/or consumed by individuals 21 and older at advertised events and activities that are promoted, sponsored, or supervised by a chartered Georgia Tech organization, providing the organization shall:

Ensure that alcoholic beverages are not consumed by any individual under the legal drinking age of 21

Provide non-alcoholic beverages and food in reasonable quantity, in the same general area, and for the same time period, as the alcoholic beverages are accessible

Control access to the alcoholic beverages through a central point of distribution by a designated server within a designated area at the event (e g beer garden) and through the use of sober monitors Only students who have shown proper proof of age may enter the designated area where alcohol is being served All alcohol must be distributed and consumed within the designated area Control is for the purpose of restricting use by those under 21 and/or who are obviously intoxicated.

Not use organizational funds to purchase alcohol Any funds used to pay for alcohol must be taken from personal/private sources and paid to a properly licensed third party vendor Alcohol may not be paid for by the student organization via a sale at the activity or by charging an admission fee either in advance or at the door (as stated in the Georgia Code of Law, 1981 Section 3-3-21).

Not use kegs, champagne/punch fountains, or other common usage containers (such as punch bowls or frozen drink machines) for alcoholic beverages

Attempts to circumvent the provisions in this policy in any way are an infraction of this policy.

Possession and/or Use of Illegal Drugs:

Georgia Tech does not permit or condone the illegal possession and/or use of controlled substances

In accordance with Georgia law, any student convicted of a felony that involves the manufacture, distribution, sale, possession, or use of controlled substances or other illegal drug, or chartered student organizations and student groups involved in these activities may be subject to specific penalties required by state law

Drug and Alcohol Counseling, Treatment, and Rehabilitation Programs:

Students with alcohol- or drug-related concerns may be referred to, or seek assistance from the Division of Student Engagement & Well-Being Georgia Tech provides trained professional and paraprofessional counselors in the Counseling Center for drug and alcohol abuse prevention, education, and counseling

Good Samaritan/Medical Amnesty Provision

The Good Samaritan/Medical Amnesty Provision ensures that students do not delay seeking medical assistance for fear of disciplinary action by the Institute. Students are expected to inform Institute offices, Georgia Tech Police, or local/law enforcement/first responders when someone’s health or safety is at risk. No formal Institute disciplinary actions or sanctions will be imposed for violations of Institute rules regarding alcohol or drug use by the reporting student(s) However, individuals may be provided with resources on drug and alcohol counseling and/or education, as appropriate This Good Samaritan/Medical Amnesty Provision applies to: Any student or student organization who, in good faith, seeks medical assistance from appropriate Institute personnel, local law enforcement, or first responders for another individual whose health or safety is at risk; and Any student whose health or safety is at risk, and who in good faith, seeks medical assistance for themselves.

13

Equity and Compliance Programs

Equity and Compliance Programs

RBI Paper Tricentennial Building

500 10th Street, NW, 4th Floor Atlanta, GA 30318

(404) 894-5698

diversity gatech edu/equity-compliance

Through education, response, and collaboration, we illuminate and remove institutional barriers to equity & inclusion, while fostering a culture beyond compliance.

Our Equity and Compliance Programs office provides education, oversight, and guidance with adherence to applicable state and federal laws, regulations, professional standards, and Institute policies as it applies to ADA/504 and Title IX

We encourage you to connect with our office for information, resources, investigation, and support about the ADA and/or Title IX

Training and Education

Equity and Compliance Programs collaborates with various offices across Georgia Tech to provide comprehensive training for faculty, staff, and students. Through training and education initiatives that span from 15-minute office introductions to 2-hour sessions, we are working to make sure everyone is aware of the current policies, resources, and support services available at the Institute.

What is Title IX?

Title IX is a federal law that prohibits discrimination on the basis of sex in educational institutions that receive federal financial assistance Title IX’s broad prohibition against sex discrimination also includes sexual harassment/misconduct which is covered under Georgia Tech’s Sexual Misconduct Policy. The Sexual Misconduct Policy protects students, faculty, staff, contractors, vendors, visitors, and guests against:

Sex/Gender (Sexual Orientation, Gender Identity)

Discrimination

Sexual Harassment

Dating Violence and Domestic Violence

How Do I Make a Report?

To submit a report to the Equity & Compliance Programs, scan QR code.

Nonconsensual Sexual Contact

Nonconsensual Sexual Penetration

Sexual Exploitation

Stalking

What Happens After a Report is Submitted to Equity and Compliance Programs?

After a report is received, the Title IX Coordinator offers resources and support services to the individual who has experienced or has been involved in incidents of sexual misconduct Some of the resources can include:

Referrals to the Center for Mental HealthAssistance with supportive measures

Care & ResourcesHousing/work reassignment

Modifications to class schedules No Contact Directives (NCD

Requests for academic support

The Title IX Coordinator will also discuss the process and options for filing a formal complaint and/or initiating the Title IX/sexual misconduct grievance process.

Additional Resources & Support

For on and off campus resources please visit: https://diversity.gatech.edu/equity-compliance/ reporting-options/i-want-talk-someone

SEXUAL VIOLENCE RESOURCES

VOICE is Georgia Tech's sexual and relationship violence prevention and survivor support initiative based in the Wellness Empowerment Center.

Launched in 2002 after Georgia Tech received a federal grant from the Department of Justice to address violence against women, VOICE provides support to victimsurvivors of sexual violence of all genders and those supporting survivors as well as educates the campus community about healthy relationships and sexual violence

Sexual violence is an umbrella term that includes sexual harassment, stalking, dating and domestic violence, as well as sexual assault and rape.

HowToHelpaFriend

ListenandSupport

BelieveYourFriend

Reassure

Thesurvivorneedstohear thatitisnormaltofeelafraid, anxious,guilty,angry,sad, confusedandevennumbA survivor’sfeelingscanfeellike arollercoasterandthereisno rightorwrongwaytoreact

BePatient

Encourage

RespectPrivacy

ThingsYouCanSay

It’swasn'tyourfault

Have you experienced sexual violence or have questions related to victim-survivor support, referrals, accommodations, and reporting options and need to speak to a VOICE Advocate? For confidential support contact the following:

8am to 5pm Monday - Friday: (404) 385-4464 or (404) 385-4451

24-Hour Confidential Support: 404-894-9000

Schedule a meeting with a VOICE Advocate via their website voice.gatech.edu

I’msosorrythishappened

HowcanIsupportyou?

Iamhereforyounomatter

whatyoudecidetodo

You'renotalone

Ibelieveyou

Whatdoyouwanttodo?

GetSupportForYourself

16

Formal Grievance Process

Supportive measures are available to all parties throughout the duration of this process.

Hearing scheduled Complaint reviewed Formal complaint filed Initial meeting with ECP Staff Final report sent to all parties Support services requested are reviewed and implemented
evidence
report sent to decision makers
summary
relevant information
with named
closed Case closed Individual declines to meet/does not respond No formal complaint filed, resources/services provided
to
received Adjudication
Decision
Investigator assigned to question parties, witnesses, gather
Final
Draft
of
is shared
parties Investigator finalizes report after consideration of feedback/responses from parties. Respondent notified of allegations/investigation and offered resources Outreach to impacted individual with offer of support services/information on additional reporting/grievance options Case
Opportunity
appeal Report
Period Investigation Period Assessment
Opportunity for informal resolution
If no appeal, decision is final and case closed
complaint doesn't meet policy requirements, it may be dismissed or referred for review under other Institute policy
If
First Level of Appeal Second Level of Appeal

MENTAL HEALTH RESOURCES

Center for As Referral, and (CARE)

The CARE intake p be simple and eas with the right reso campus This app you are having, w

If you believe that you need to see someone in the Counseling Center or in Stamps Psychiatry Clinic, then you will first need a CARE assessment to access these services. Some students maybe unsure of what they need, so CARE will help point you in the right direction

GT Counseling Center

The Georgia Tech Counseling Center offers several types of counseling, including:

Individual Counseling

Group Counseling

Couples Counseling

Referral Services, including Counseling

Services and Psychiatric Services

Consultation

Outreach

Life Skills Workshops

KORU Mindfulness Program

Testing and Assessment

Mandated Alcohol and Other Drug Counseling

Career Counseling

Students seeking counseling services must first visit the Center for Assessment and Referral (CARE) for an initial assessment and referral

Office hours are Monday, Wednesday, Thursday and Friday from 8:00AM - 4:00PM (office closes at 5:00PM), and Tuesdays from 9:00AM - 4:00PM (office closes at 5:00PM). Please be aware we will be closed for lunch between 12:00PM-1:00PM.

The Center is located on the first floor of the Smithgall Student Services building, off the main atrium.

StampsPsychiatryServices

StampsPsychiatryprovidespsychiatricevaluations andmedicationmanagementfordepression, anxiety,bipolardisorder,substanceabuse,and othermentalhealthissuestoGTstudents.These servicesareprovidedbyboard-certified psychiatristsandcarecoordinatorswho collaboratewiththeGeorgiaTechCounseling Centertoensurethatstudentsreceive comprehensivecare

Studentsseekingpsychiatryservicesmustfirstvisit theCenterforAssessmentandReferral(CARE) foraninitialassessmentandreferral.

Call CARE at 404-894-3498 to set up an appointment.
18

Students in Mental Health Crisis:

If you are experiencing a crisis that requires immediate attention you may speak with a counselor at any time 24 hours a day, 7 days a week During regular business hours (Monday-Friday 8-5), established Counseling Center clients may call 404894-2575. Students who are not actively in counseling may call CARE at 404-894-3498.

After business hours, please call either 404-8942575 or 404-894-3498 and select the option to speak to the after-hours counselor. You may also call the Georgia Tech police at 404-894-2500.

Life Threatening Emergency

Peer Coaching Program

The Peer Coaching Program (PCP) was developed by the Counseling Center to offer an innovative way for Tech students to access a unique type of support to facilitate academic and personal success. Services provided by the PCP are considered consultation services, as opposed to counseling or therapy.

Common Concerns Peer Coaching Can Help Address:

Adjustment to college/Tech culture

Academic Struggles (e g study skills, time management, motivation)

Stress

Relationship concerns (e.g. roommates, friendships, dating/partner relationships, family)

Uncertainty about Major/Career Path

Grief and Loss

Other Crisis Resources

Students who are experiencing an immediate lifethreatening emergency on campus, call the Georgia Tech Campus Police at 404-894-2500. If off campus, please immediately call 911. Click Get Help Now on Counseling Center Website:

The Georgia Crisis & Access Line is staffed with professional social workers and counselors 24 hours a day, 7 days a week.

The 988 Suicide and Crisis Lifeline provides free and confidential emotional support to people in suicidal crisis or emotional distress 24 hours a day, 7 days a week 988lifeline.org/talk-to-someone-now

The Crisis Text Line is an additional mental health resource: text HOME to 741741.

NutritionCounselingthrough theWellnessEmpowerment Center

Allstudentscanmeetwithourdietitianstoreceive individualcounselingEachinitialvisitincludesa one-hourappointment,ananalysisofyourcurrent eatingplan,andanactionplanaddressingyour individualgoals

Ourdietitiansseestudentswhowanttoaddress disorderedeatinghabits,changetheireating habits,manageamedicaldiagnosisorconcern,or learnhowtostaynourishedwhilefollowingspecific foodrestrictionsorallergiesOurdietitiansarealso membersofGeorgiaTech'smultidisciplinaryEating DisorderTreatmentTeam

Tomakeanappointment,email nutrition@gatech.edu

counseling.gatech.edu
the Counseling Center's website and click the Resources tab for more!
Visit
19

Turn static files into dynamic content formats.

Create a flipbook
2023 New Member Guide by gatechfsl - Issuu