Issuu on Google+

ETHS focuses on ACT scoring » PAGE 3 gap across races

SPORTS GAMEDAY Season ticket sales rise with average attendance » INSIDE

OPINION Jaro Undergrad business could thrive » PAGE 4

High 58 Low 42

The Daily Northwestern Friday, October 19, 2012

DAILYNORTHWESTERN.COM

DAILY DECISION

Local candidates debate

Find us online @thedailynu

NU expanding online courses By LAUREN CARUBA

the daily northwestern

Rafi Letzer/Daily Senior Staffer

CANDIDATE CONVERGENCE Glenn Farkas, the Republican challenger for the Illinois 9th district state senate seat, speaks at a debate-like forum hosted by the Central Street Neighbors Association on Thursday.

Illinois House, Senate candidates met for a forum in Evanston By AMANDA GILBERT

the daily northwestern

The Central Street Neighbors Association hosted a forum Thursday night for several Illinois House and Illinois Senate candidates in an Evanston middle school. Nearly 50 people met at Haven

Middle School for the forum featuring candidates vying to represent the districts that contain Evanston. Both the Democratic and Republican candidates for the 17th and 18th Illinois House districts attended the debate. The Republican candidate for the 9th Illinois Senate District also attended, and Evanston Mayor Elizabeth Tisdahl spoke on behalf of Democratic candidate Daniel Biss, who was unable to attend the event. CSNA president Mark Sloane said the association hosted the event to give candidates an opportunity to speak to Evanstonians directly and

get their opinions out in the open. “Tonight is about hearing diverse opinions,” Sloane said before the event. “Our mission is informing, educating and activating citizens in Evanston.” In the debate’s opening statements, some candidates focused on their personal lives and past accomplishments, while others discussed their hopes for the future. Regardless of their introduction, all the candidates said they had concerns about the economic state of Illinois. » See FORUM, page 10

New efforts by University administrators and the School of Continuing Studies will help add Northwestern to the growing list of universities looking to expand online course offerings. Last week a newly formed committee comprised of faculty from across the University’s graduate and undergraduate schools began reexamining policies regarding online courses. The committee, headed by Mary Finn, associate dean for undergraduate academic affairs of the Weinberg College of Arts and Sciences, is tasked with evaluating how online courses and educational tools can be better incorporated at NU. Although NU does offer several online masters programs, the University does not currently have online courses for undergraduate students. Additionally, Weinberg does not allow undergraduate students to count any online course credits toward their degrees. However, that could change in the near future based on the results of the committee’s discussions this school year. “This is a rapidly evolving area, and Northwestern very much wants to be part of the group of institutions that helps shape online education,” said Provost Daniel Linzer, who initiated the committee’s formation in late September. Linzer said the University’s examination of online education stemmed from conversations he had with NU deans and faculty members toward the end of last year. Because each school at NU is responsible for forming its own curriculum and policies, the committee includes faculty from across the schools to address

potential concerns about expanding the University’s selection of online courses and tools. A new educational technologies committee within Northwestern University Information Technology is also assessing what types of resources the University will need to support future online initiatives, Linzer said. “We want to be careful that whatever we do retains the quality of learning and the quality of experience of an in-classroom course,” he said. “However we do it, we want to be sure that students interact with other students.” University registrar Jaci Casazza said there is not an “organizing force” for NU’s online course offerings. Online programs at NU are confined to graduate programs and primarily offered through the School of Continuing Studies, she said. The School of Continuing Studies currently offers four fully online masters programs in medical informatics; information systems; predictive analytics; and public policy and administration, said Joel Shapiro, associate dean of academic programs for the School of Continuing Studies. Recently the school has been working to expand its selection of online programs at both the graduate and undergraduate levels. While Weinberg and the other undergraduate schools continue evaluating their online credit policies, the School of Continuing Studies is developing online accounting courses geared toward undergraduate students, Shapiro said. The courses could constitute a new undergraduate certificate if Weinberg decides to change its policy for online credits, he said. The school is focusing on a discipline like accounting first because online platforms lend themselves well to » See ONLINE, page 10

NU Law attorneys petition to reopen Burge case By ZACHARY ELVOVE

the daily northwestern

Attorneys from Northwestern’s MacArthur Justice Center filed a class-action petition Tuesday asking a judge to grant hearings to more than 15 incarcerated men. The men claim they were tortured into confessing to murder by former Chicago Police Cmdr. John Burge. The petition was announced at a press conference held at the NU School of Law in downtown Chicago. Family members, freed victims and attorneys spoke in support of the filing, which seeks to have the cases of Burge’s alleged victims reexamined. Burge allegedly tortured more

than 200 suspects from 1972 to 1991 to force their confessions. He was acquitted for torture due to an expired statute of limitations but was later convicted in 2010 on two counts of obstruction of justice and one count of perjury for lying in written testimony during hearings in a 2003 civil lawsuit about his involvement in the torture of criminal suspects. Burge was sentenced to four and a half years in prison. “What do you do about the prisoners who are still in prison?” said Locke Bowman, executive director of the MacArthur Justice Center. “Those who have always said that they were victims of torture and confessed to crimes as a result?” The victims’ repeated torture

I want justice. And my son wants justice too. We all want justice for torture victims.” Jeanette Plummer, Mother of named victim Johnny Plummer

accusations against Burge prompted a series of investigations dating back to the 1990s. The investigations ultimately led to Burge’s conviction. Many of the victims have been behind bars for decades. Bowman, an NU Law professor, is one of the attorneys involved in the class-action petition. The center is a privately funded public interest law

firm that became a part of NU School of Law’s Bluhm Legal Clinic in 2006. NU has been involved with the cases of Burge’s victims for over a decade. Former Medill prof. David Protess and students of the Medill Innocence Project discovered evidence in 1999 exonerating death row inmate Anthony Porter, who was convicted based on a witness testimony. The witness said he named Porter as the murderer after officers threatened and intimidated him. Fifteen men named in Tuesday’s petition are currently serving prison sentences. However, Bowman said there could be additional inmates who have evidence that Burge coerced their confessions. Jeanette Plummer, mother of

named victim Johnny Plummer, spoke at Tuesday’s press conference. “I want justice,” she said at the press conference. “And my son wants justice too. We all want justice for torture victims.” This is the latest in a series of revelations regarding Burge torture victims, but the petition is the first of its kind in Cook County. Bowman is asking the court to recognize that each of these men is entitled to a hearing. Criminal Court Judge Paul Biebel will read the petition and determine whether to reopen the cases. “Each (man) ought to have their case reexamined,” said Bowman. zacharyelvove2016@u.northwestern.edu


2 NEWS | the daily northwesternfriday, october 19, 2012

Around Town

“

You’re singling some people out for favorable treatment ‌ simply because the one group of people happens to own a restaurant and the other group of people doesn’t ‌

— Jacob Huebert, Beavers Coffee and Donuts attorney

Q&A: Anthony Sosa, EPD canine officer By ina yang

daily senior staffer

Officer Anthony Sosa, starting his eighth year at the Evanston Police Department, was selected as the department’s new canine officer. His partner is a 2-year-old dual purpose German shepherd, who has the ability to detect narcotics and to perform tracking as it relates to Sosa’s patrol duties. Sosa has been teamed up with Rony since August, when they were paired at a camp in Pennsylvania. The duo communicates in Czech because Rony is originally from Slovakia and has been previously trained in the language.

Ina Yang/Daily Senior Staffer

Paw police Newly-appointed canine officer Anthony Sosa demonstrates training routines with his partner, Rony.

The Daily Northwestern: How does the program work? Anthony Sosa: The department decided to reinstate the canine unit because our former canine Jack retired from an injury. They had a selection process, a letter of intent, interviews, home visits (to make sure that my home life was compatible with having a canine), and then the bosses decided who would be the canine officer. Once they decided, I was informed that I was going to Sharpsville, Penn., and I underwent a six-week course.

Police Blotter Evanston juvenile charged with theft and aggravated battery A 14-year-old theft victim told patrolling Evanston Police officers in the 1900 block of Dempster Street that the person who took his skateboard the previous day was nearby. When the police officers approached the described person and attempted to talk about the theft, he physically resisted efforts to place him in custody and struck two separate officers. One of the officers used a taser to allow the police to properly handcuff him without

�

further incident. The man was then taken to a local hospital for examination, released back to EPD custody for transport to the Cook County Juvenile Detention Center. He was charged with theft, two counts of aggravated battery to police and resisting arrest by the juvenile detectives. No further information can be released due to the offender’s age, according to the EPD news release. -Ina Yang

The Daily: How is it different working with Rony? Sosa: At the beginning of the day, I have to make sure he’s fed, watered and walked. His diet stays strictly to dog food, good caliber food. He’s not eating table scraps. Bonding with him during the day, talking to him in an appraised tone, so when we come to work he’s looking to play with me. He doesn’t know that he’s doing an exterior vehicle sniff, building sniff or an article search — all those missions that he has, it’s basically play time to him. The Daily: What are the advantages and disadvantages of working with Rony? Sosa: The advantages are that he has a keen sense of smell, the physical presence of the dog and how he can diffuse a situation before it escalates to something big. The disadvantages are that I’m really attached to Rony right now, so I worry a bit more because anything can happen to him. It’s not like he’s wearing combat boots like we are. He’s not issued a bullet-proof vest, but we’re working on that. After a long service period (usually 5 to 10 years), hopefully I can purchase him from the city and he can live with me permanently. yirenyang2015@u.northwestern.edu

Setting the Record Straight In a graphic Thursday depicting details of Aetna health insurance for international students, the time period covered was incorrect. The plan covers students through August 31, 2013. Additionally, in a story Thursday about a wedding boutique in Evanston, the owners’ last name was misspelled. Rachel and Ted Alvia co-own Avail & Company. The Daily regrets the errors.

Food truck sues Evanston over unfair law Page 7

The Daily Northwestern www.dailynorthwestern.com Editor in Chief Kaitlyn Jakola

eic@dailynorthwestern.com

General Manager Stacia Campbell

stacia@dailynorthwestern.com

Newsroom | 847.491.3222 Campus desk

campus@dailynorthwestern.com

City desk

city@dailynorthwestern.com

Sports desk

sports@dailynorthwestern.com

Ad Office | 847.491.7206

spc-compshop@northwestern.edu

Fax | 847.491.9905 The Daily Northwestern is published Monday through Friday during the academic year, except vacation periods and two weeks preceding them and once during August, by Students Publishing Co., Inc. of Northwestern University, 1999 Campus Drive, Evanston, IL 60208; 847-4917206. First copy of The Daily is free, additional copies are 50 cents. All material published herein, except advertising or where indicated otherwise, is Copyright 2012 The Daily Northwestern and protected under the “work made for hire� and “periodical publication� clauses of copyright law. POSTMASTER: Send address changes to The Daily Northwestern, 1999 Campus Drive, Evanston, IL 60208. Subscriptions are $175 for the academic year. The Daily Northwestern is not responsible for more than one incorrect ad insertion. All display ad corrections must be received by 3 p.m. one day prior to when the ad is run.

Check out dailynorthwestern.com for breaking news

50,000

F S O E AR UM YE ST H CO T NG R NI /U WIN D AR

AW

Are you ready to venture where others fear to go?

)"--08&&/

$0456.&4 50#6:033&/5 53:0/4&-&$5

8*(4 .",&61"/%"--"$$&4403*&4

T G F P (Thank God For Parents)

LO S T E R A S

Yes, boys and girls, Mom and Dads, strengthen the parent-child bond this Parent’s Weekend by buying footwear together. Just bring your parents in and receive 10% off Thursday-Sunday with the mention of this ad. Or, if your parents are not here, just confess that you have parents and receive your discount! Featuring: the coolest and best selection of women’s and men’s fashion, comfort, quality footwear from Chicago to Sheboygan.

Williams Shoes - The Walking Spirit Where all your dreams come shoe!

710 Church Street • Evanston 847 328-5868

0''8*5)5)*4"% '03/6456%&/54

Lost Eras

1511 W. Howard (773) 764-7400 "LOCKSEASTOF(OWARD%,sMINUTESSOUTHOFCAMPUS

%XTENDED(ALLOWEENHOURSAMnPM;-ONDAYn3ATURDAY=PMnPM;3UNDAY=

WWWLOSTERASCOM


friday, october 19, 2012

On Campus

“

the daily northwestern | NEWS 3

�

It’s a culture that’s very foreign to Americans. It’s a different culture that is important for Americans to understand.

NU creating Middle East and North African studies major Page 10

— McCormick freshman Athif Wulandana

Art history prof claims prestigious professorship By Tal Axelrod

the daily northwestern

Photo courtesy of Miami University Center for the Humanities

ACCOLADES Art history Prof. S. Hollis Clayson gives a lecture at University of Miami. Clayson recently won an award for her work.

A Northwestern art history professor has earned one of the highest awards in the art history field. Prof. S. Hollis Clayson has been appointed the 2013-2014 Samuel H. Kress Professor with The National Gallery of Art and the Center for Advanced Study in the Visual Arts. Of the 34 years Clayson has taught art history, 27 have been at NU. The award makes Clayson the senior member of the center and responsible for counseling the seven predoctoral fellows while continuing her own independent research. She is the first NU professor to be appointed to this position. “I think it’s both an enormous surprise and entirely thrilling,� Clayson said. “I think I’m a very strange choice for the position, but I’m very, very happy that they chose me.� Clayson is a historian of modern art, with expertise in 19th-century Europe and international trades between France and the United States. She is also

the author of the books “Painted Love: Prostitution in French Art of the Impressionist Era� and “Paris in Despair: Art and Everyday Life under Siege (1870-71).� She also co-edited “Understanding Paintings: Themes in Art Explored and Explained,� which has been translated into six languages. At the center, Clayson will finish her current book, “Electric Paris: The Visual Cultures of the City of Light in the Era of Thomas Edison.� Clayson said she might have earned the award for her track record as a professor and her advising of graduate students. In 1987 she won the Weinberg teaching award for the art history department, and she received the Charles Deering McCormick Professorship of Teaching Excellence in the mid-1990s, which is NU’s highest teaching honor. “I guess they were looking for someone who was a functioning scholar but also had a reputation as being a successful teacher,� she said, adding that the award was also an honor for NU. Weinberg freshman Kayley McPhee had Clayson as a guest lecturer for her Global Orients class. “I talked to a lot of people afterward, and it was the

best lecture we had so far,â€? she said. McPhee was impressed by Clayson’s interpretation of the artistic styles of the period. “She picked specific paintings that were both topical to the subject of study, which is the Orient, and engaging paintings as well,â€? she said. “She didn’t pick boring or conventional paintings. ‌ She picked paintings of a wide variety, as well as being topical at the same time.â€? McPhee has encountered Clayson previously through her job as a clerical assistant for the art history department. She said Clayson is extremely accessible and funny for a person of such high esteem. Clayson, a transfer student, has been involved in art history since her freshman year at Wellesley College in Wellesley, Mass. “Somebody told me to take an art history class when I was a freshman in college,â€? Clayson said. “He told me it was a cool thing to do. And then I was an art history major by October of my freshman year.â€? talaxel@gmail.com

New council refines potential diversity requirements By Junnie Kwon

the daily northwestern

The University Diversity Council is working on a proposal for Northwestern’s first university-wide diversity requirement. The impending proposal will include student learning outcomes and guidelines for how courses can meet the requirement. Student learning outcomes consist of a statement presenting what skill or body of knowledge the students would gain as a result of taking a course. The academics and education working group, which meets monthly, consists of students, faculty and staff from all schools.

“We’re in the early stages, but the work has continued throughout the summer,� said UDC chair Dona Cordero. So far, a UDC subcommittee has written a document defining the requirement’s learning outcomes. At the next meeting, the working group will review the document and assess how they apply to the current NU curriculum. “If there are existing courses, let’s take a look at those and see how we can work with those,� said Cordero, also the assistant provost for diversity and inclusion. “And if there aren’t existing courses, then there may be a need to develop a course or courses that meet the expectation of the learning outcomes.�

The working group faces two main concerns: the amount of work the requirement would add on to students’ already hefty workloads and the notion that the subject of diversity is not academic. “(Some people) think of it as something that’s just personal, that people can just reflect or talk about it,� said Frances Aparicio, director for the Latina and Latino studies program. “There is a whole scholarship on this, so it’s not something that is just about the person.� Some students feel that the larger NU community is apathetic to issues pertaining to diversity and minorities. “At Northwestern, the culture is to do well in school and then leave and get a job,� SESP junior

Oceanique

Tessa Chiu said. “But if you make them take that class or to learn more about it – I don’t know if they would actually do anything – it would be a step in the right direction.� The UDC recently replaced the Faculty Diversity Committee to expand the focus to include student and staff issues. Although the shift had been pending before racially insensitive incidents in the spring, the debate on diversity that ensued substantiated the committee reform. “Certainly the issues that happened over the past year just reinforced the need for more attention in this area,� Cordero said. junniekwon2015@u.northwestern.edu

C\kj^f:Xkj$Af`eLj ]fi:_`ZX^fcXe[Ă&#x2039;j=`e\jkJ\X]ff[ `eXe<c\^XekJ\kk`e^%

N\[e\j[XpCfYjk\i<eki\\

)*%''

=i\eZ_8d\i`ZXe :l`j`e\

Mfk\[ KfgJ\X]ff[I\jkXliXek`e :_`ZX^fYpQ8>8KJlim\p

Jlg\iY=`j_ Gi`d\9\\] M\^\kXi`Xe

KXb\X[mXekX^\f]fliN`c[ZXi[ Jkl[\ek;`jZflekMXc`[Dfe[Xp$=i`[Xp

,',DX`eJki\\k#<mXejkfe Â&#x203A;/+.%/-+%*+*, Â&#x203A;nnn%fZ\Xe`hl\%Zfd

TAKE

15% OFF

ORDER YOUR GLOSSY, PRINTED NU SYLLABUS YEARBOOK.

ANY ONE ITEM!*

To have it charged to your student account, just log on to CAESAR.

OR USE THE DISCOUNT CODE NWParent15 TO SAVE ONLINE AT

Go to FOR STUDENTS > ENROLLMENT > SYLLABUS YEARBOOK ORDER.

www.udans.com 5IJTPGGFSDBOOPUCFDPNCJOFE XJUIBOZPUIFSDPVQPO EJT DPVOUPSTBMF QSFWJPVTTBMFT  TQFDJBMPSEFST PSJUFNTOPUJO TUPDL4PNFCSBOETFYDMVEFE &YQJSFT

Do it now and SAVE $5! Don't forget.

For questions & all things yearbook, go to www.NUSyllabus.com with mention of this ad FREE mat & towel RENTAL UĂ&#x160;Ă&#x160;-Ă&#x152;Ă&#x2022;`iÂ&#x2DC;Ă&#x152;Ă&#x160;,>Ă&#x152;iĂ&#x192;\Ă&#x160;f£äĂ&#x160;ÂŤiĂ&#x20AC;Ă&#x160;VÂ?>Ă&#x192;Ă&#x192; Ă&#x160;Ă&#x160;Ă&#x160;Ă&#x160;­"Â&#x2DC;Â?Â&#x2C6;Â&#x2DC;iĂ&#x160;*Ă&#x2022;Ă&#x20AC;VÂ&#x2026;>Ă&#x192;iĂ&#x160;Ă&#x153;Ă&#x2030;-Ă&#x152;Ă&#x2022;`iÂ&#x2DC;Ă&#x152;Ă&#x160; ÂŽ UĂ&#x160;Ă&#x160;fĂ&#x201C;xäĂ&#x160;vÂ&#x153;Ă&#x20AC;Ă&#x160;Ă&#x17D;Ă&#x160;Â&#x153;Â&#x2DC;Ă&#x152;Â&#x2026;Ă&#x192;Ă&#x160;1Â&#x2DC;Â?Â&#x2C6;Â&#x201C;Â&#x2C6;Ă&#x152;i`Ă&#x160;9Â&#x153;}> UĂ&#x160;Ă&#x160;xĂ&#x160;Â&#x2C6;Â&#x2DC;Ă&#x2022;Ă&#x152;iĂ&#x160;Ă&#x153;>Â?Â&#x17D;Ă&#x160;vĂ&#x20AC;Â&#x153;Â&#x201C;Ă&#x160; >Â&#x201C;ÂŤĂ&#x2022;Ă&#x192; UĂ&#x160;Ă&#x160; Â&#x2C6;Â&#x17D;Ă&#x20AC;>Â&#x201C;Ă&#x160;¸Â&#x153;Ă&#x152;¸Ă&#x160;9Â&#x153;}> UĂ&#x160;Ă&#x160;Â&#x2DC;VĂ&#x20AC;i>Ă&#x192;iĂ&#x160;-Ă&#x152;Ă&#x20AC;iÂ&#x2DC;}Ă&#x152;Â&#x2026;Ă&#x160;EĂ&#x160;Â?iĂ?Â&#x2C6;LÂ&#x2C6;Â?Â&#x2C6;Ă&#x152;Ă&#x17E; UĂ&#x160;Ă&#x160;Â&#x153;Ă&#x20AC;iĂ&#x160;Â&#x153;VĂ&#x2022;Ă&#x192;Ă&#x160;EĂ&#x160; Â&#x2DC;iĂ&#x20AC;}Ă&#x17E;Ă&#x160;Ă&#x2030;Ă&#x160;Â&#x2C6;Ă&#x20AC;Â&#x201C;Ă&#x192;Ă&#x160;EĂ&#x160;/Â&#x153;Â&#x2DC;iĂ&#x192;

ÂŁn{äĂ&#x160;">Â&#x17D;Ă&#x160;Ă&#x203A;iĂ&#x160;UĂ&#x160;n{Ă&#x2021;Â&#x2021;xxĂ&#x2C6;Â&#x2021;Ă&#x201C;Ă&#x2C6;ää

Ă&#x153;Ă&#x153;Ă&#x153;°LÂ&#x2C6;Â&#x17D;Ă&#x20AC;>Â&#x201C;Ă&#x17E;Â&#x153;}>iĂ&#x203A;>Â&#x2DC;Ă&#x192;Ă&#x152;Â&#x153;Â&#x2DC;°VÂ&#x153;Â&#x201C; info@bikramyogaevanston.com


FORUM Friday, October 19, 2012 

Join the online conversation at www.dailynorthwestern.com OPINIONS from The Daily Northwestern’s Forum Desk

PAGE 4

Rediscovering family ties not always an easy task julianna nunez

Daily columnist

My mom’s birthday is today, and it also happens to be the beginning of Family Weekend. Lately, I feel like I have been rediscovering my family. Growing up, my family lived in a different area of Chicago, so we didn’t interact with my cousins or extended family members much. Unfortunately, tragedy struck this spring when my great uncle died. Since this event, though, I have noticed my parents, siblings and I interacting with our extended family members more and more. We began by visiting my mother’s old neighborhood in Humboldt Park, which was very different from what it used to be. My cousin told me the neighborhood hit rock bottom years ago but is now building itself back up. This is evident by the fact that there are frozen yogurt shops and an abundance of young men and women wearing clothes ironically. However, the gentrification was not enough to totally change the landscape of my

mother’s old block. She is able to point out places where she would play, the curb where she was once hit by a bike, the drugstore she and her cousins would buy treats from and so much more. My great aunt’s home was largely the same, a big apartment building that was shared with other family members. I’ll admit that I was nervous about re-meeting some of them. I’m naturally shy as it is, and my cousins are very affectionate. They are happy to give hugs and compliments and there are so many of them (my mother has 43 cousins) that I was afraid of being overwhelmed. But as it turned out, my fears were pointless. They were curious about me and my brother. They wanted to know: How were we doing in school? Did we have a boyfriend or a girlfriend? Did we have a job for the summer and so on? And as I began to learn more about my family, I began to learn more about myself. I learned that my family has an abundance of teenagers. They talk about silly teenagerish things that I barely understand. I’ll admit that I look at them with a certain amount of fascination and bewilderment. Is that the way teenagers dress now? Is that the music they like? Do they seriously spend hours

It’s fascinating to learn about the people who helped sculpt my mother to who she is today and vice versa.

upon hours on Facebook and Skype? I also feel a sense of responsibility to be a good role model for them. I’m sure to them I’m not that cool, but I want to be there more for their education. I want to help them with their college applications and other things. I was the baby in my family for a long time, so I’ve never really thought about being a role model before. Now, I feel like I should help them. I have also enjoyed learning more about my family, especially my mother’s childhood. She was a bit more of a rapscallion in her youth than her present-day reserved self and it’s nice to see my mother share these memories with her relatives. I also found a sense of camaraderie with my great aunt. She busies herself with various creative outlets. She makes her own jewelry (which she gives away for free), cooks and even knits clothing. I always felt like I was

introverted like my grandfather, but it was nice to see a family member busy herself with different creative hobbies. I myself enjoy writing and drawing as hobbies. I guess that was where the sense of camaraderie developed. I find her endearing, almost like a kindred spirit. She’s creative and calm but knows when to put her foot down. It showed me that one does not have to be stereotypically tough in order to command respect. She earned her love and respect through kindness, something we can all learn from. Rejoining family members is not always the easiest process. Here is a collection of people that just happened to be related to each other. Nothing is written down that says everyone is going to have a compatible personality, but we manage to work through it anyway. It’s fascinating to learn about the people who helped sculpt my mother to who she is today and vice versa. A neighborhood I once viewed with apprehension and fear now seems like a welcoming place in a big city. Julianna Nunez is a Medill junior. She can be reached at juliannanunez2014@u.northwestern.edu. If you would like to respond publicly to this column, email a Letter to the Editor to forum@dailynorthwestern.com.

NU could become leader in undergraduate business jan jaro

Daily columnist

Walking around the halls of elite American universities, one hears a familiar refrain: “Business education doesn’t belong at the undergraduate level.” Although attitudes differ among universities, the success of undergrad business programs at Penn, MIT and Cornell seems to debunk the belief that a traditional liberal arts education can’t coexist with pre-professional programs. That shouldn’t come as a surprise, as engineering is an especially popular major at Northwestern and across the country. However, NU has unique strengths, and I believe that if the money were available, the school would be wise to explore the possibility of adding what could be a world-class undergraduate business program. It is certainly true that business in its widest sense is about applying soft skills such as relationship management in addition to using hard skills with the end goal of maximizing profitability. Many MBA programs center on the idea that applicants should have significant work experience precisely because soft skills are so valuable to business education. Kellogg is particularly stingy about this belief and NU’s law school is

The Daily Northwestern Volume 134, Issue 19 Editor in Chief Kaitlyn Jakola

Forum Editor Joseph Diebold

Managing Editors Marshall Cohen Michele Corriston Patrick Svitek

Assistant Forum Editors Blair Dunbar Arabella Watters

LETTERS TO THE EDITOR may be sent to 1999 Campus Drive, Evanston, IL 60208, via fax at 847-491-9905, via e-mail to forum@dailynorthwestern.com or by dropping a letter in the box outside The Daily office. Letters have the following requirements: • Should be typed and double-spaced • Should include the author’s name, signature, school, class and phone number. • Should be fewer than 300 words They will be checked for authenticity and may be edited for length, clarity, style and grammar. Letters, columns and cartoons contain the opinion of the authors, not Students Publishing Co. Inc. Submissions signed by more than three people must include at least one and no more than three names designated to represent the group. Editorials reflect the majority opinion of The Daily’s student editorial board and not the opinions of either Northwestern University or Students Publishing Co. Inc.

starting to adopt the same philosophy. Nevertheless, business can be made to be a worthwhile intellectual exercise for undergraduate students. Imagine students discussing entry strategies for a blue-chip consumer goods company in an emerging market or ways to build socially sustainable relationships with communities and governments over late-night coffee. Northwestern does have elements of an undergrad business program built into its economics and Business Institutions programs, Industrial Engineering and Management Sciences degree, and Kellogg and marketing certificates. However, the disjointed nature of these programs prevents students from fully taking advantage of the opportunities that Northwestern presents them. In addition to significant prerequisites for the IEMS major (enrollment in McCormick) and the Kellogg certificates (a laundry list of mathematics and economics classes), the potential for course conflicts is rife because these programs are administered over several schools. Northwestern has the opportunity to create a highly innovative undergraduate business program. In the same way that McCormick has created the Engineering Analysis and DTC (Design Thinking and Communication) courses, introductory economics, statistics and management could be integrated into a three-quarter sequence with a separate series emphasizing case studies and practical exercises in the greater Chicago community. Medill’s Enterprise

The Drawing Board

Reporting in Diverse Communities class and the Chicago Field Studies programs are both a good start to building opportunities for undergraduates to acquire real-world experiences. Moreover, Northwestern can and should emphasize the economic principles underpinning business decisions but from a different angle than one would normally find in economics classes. Instead of limiting economic analysis to the effects of government policy and firm decisions on overall efficiency, business economics at Northwestern could ask how such decisions reinforce or contradict each other and could even delve into the social and political consequences of those decisions. Northwestern has two compelling attributes that other elite undergraduate business programs don’t have. First, the school runs on a quarter system, allowing students to take more courses and explore a wider variety of interests. Second, Northwestern already has an array of strong pre-professional programs. In addition to a top-notch engineering school, Northwestern has Medill, Bienen, the School of Communication, and the School of Education and Social Policy. The possibilities are (almost) endless. You could have a student studying social policy in addition to concentrating in business strategy. He or she could go on to be a leading figure in nonprofit work. On the other hand, Northwestern could admit a student who has the intent to study materials engineering in addition to international finance. This alum could go on

to start a company that revolutionizes carbon nanoengineering, becoming a big donor in the process. I don’t think it’s delusional to claim that within a decade of starting an undergraduate business program, NU could be as competitive as traditional powerhouses such as Wharton and MIT. There are certainly difficulties to adding an undergraduate business program at Northwestern. Business school professors are expensive and notorious for disliking undergraduate-level teaching. Moreover, NU might have to take away resources from other programs that are blossoming into the top tier of academia, such as chemical engineering (I had to show some love to my major at some point). Nevertheless, I believe that the potential benefits outweigh the costs, especially since the endowment fund increased by nearly 20 percent from last year and the school’s financial position seems to be strengthening. I won’t fully benefit from an undergraduate business program at NU, but I’m confident future generations will if one is established. My mom already wants my 10-month-old brother to come to Northwestern, and I’d like him to at least have the choice to study business at the best school that rocks purple. Jan Jaro is a McCormick sophomore. He can be reached at janjaro2015@u.northwestern.edu. If you would like to respond publicly to this column, email a Letter to the Editor to forum@dailynorthwestern.com.

by Erik Linnell


THE DAILY NORTHWESTERN | NEWS 5

FRIDAY, OCTOBER 19, 2012

Industry Day continues growth, aids networking About 800 show up to research potential jobs, connect with businesses By CHELSEA SHERLOCK

the daily northwestern

Do it for Mom. SIGN UP FOR YOUR YEARBOOK PORTRAIT. Monday, October 29–Friday, November 16 @ NORRIS Or sign up at: www.OurYear.com NU Code: 87150

questions? email: syllabus@northwestern.edu web site: www.NUsyllabus.com

“The hyperactive lovechild of SCOTT PILGRIM VS. THE WORLD and KUNG FU HUSTLE.” – Huffington Post

“HILARIOUS, ABSURD, AND AWESOME.”

chelseasherlock2017@u.northwestern.edu

FINER FOODS WINES & SPIRITS 825 Noyes St. 847-475-4344 (Corner of Noyes & Noyes Court, just east of the “L” Station)

We now sell

LIQUOR! s'REEK3YRIAN)MPORTED0RODUCTS s3ELECT-EAT0RODUCE s'OURMET&OODS$ELICATESSEN s(OMEMADE"RATWURST)TALIAN3AUSAGE s&RESH#UT&LOWERS"OUQUETS s7EHAVEDAILYWEEKENDPAPERSANDMAGAZINES

WE DELIVER 6 Days a Week

Come and see our new liquor selection.

Why go to Downtown Evanston? D&D DOGS serves Hot Dogs, Hamburgers, Gyros, Chicken and more!

STARTS FRI 10/19

AMC LOEWS 600 NORTH MICHIGAN 9

(AVEUSCATERYOUR.5 &OOTBALLGAMESOREVENTS

(888) AMC-4FUN

FREE WIRELESS INTERNET! CENTURY 12 EVANSTON/ CINÉARTS 6 & XD

1715 Maple Ave. 800-326-3264 #942

HOURS

Mon - Sat 8am-8pm Sun. 9am-5pm

– Ain’t It Cool News

/ TA I C H I Z E R O

FREE PARKING IN OUR LOT!

Bank of America

ATM Open 24 hours Ridge Noyes

NU SENIORS:

Students in business attire filled the first and second floors of Norris University Center on Thursday for the Society of Women Engineers’ annual Industry Day. Drawing about 800 students, the event was expanded to two floors of Norris in order to reduce congestion. Participation increased to 81 companies this year, said Olivia Gann, SWE’s publicity chair. “I definitely think it has become an increasingly anticipated event, both from the students’ end because they hear about and know that this is the place to land your next job, and from the companies because this is where they can get all of their prospective employees in one place and also develop a good relationship with Northwestern,” McCormick sophomore and SWE executive member Abigail Gardner said in an email. Fidessa Corporation, a software company that recently opened a new office in Chicago, attended the event for the first time. The company was hoping to find students to fill new positions created by its expansion. NU has a “very large technology base of students,” Fidessa Corporation representative Rukiya Tuotley said. Industry Day’s purpose is to provide an opportunity for students to present their resumes and talk to recruiters, Gann said. The event is also a source of revenue for SWE because companies pay a fee to register. “It is successful because it is sort of a winwin for both sides,” Gann said. “It’s great for the companies and it’s also great for the students because there are all these companies in one place so you can talk to all these companies

in one place. It’s a really efficient, compact event.” Shmoop, an education startup from Mountain View, Calif., had a booth at the fair and was looking to fill 30 to 40 positions within the company. Shmoop’s chief technology officer is a Northwestern graduate, and the company primarily hires NU students and graduates. “It’s cool to have a little diversity,” Shmoop representative Josh Jacobson said. “It’s a company with a lot of Northwestern alums.” McCormick junior Hanan Abdisubhan used the fair to look for an internship. “The competition seems deep,” AbdisIt’s great for ubhan said. “A lot of the companies I’ve the companies looked at had lines and it’s also out the door.” Technology comgreat for the pany HP used Indusstudents try Day as a source because there for finding potential employees and are all these interns. HP has been companies in represented at past NU information sesone place. sions, but last night Olivia Gann, was its first time at SWE publicity Industry Day. HP chair representative Adam Rossio outlined what he is looking for in an applicant. “Number one, communicate properly,” Rossio said. “Number two, present yourself and company well. Number three, think on your feet. Number four, enthusiastic and passionate.” McCormick junior Alex Freedman attended Industry Day for the first time Thursday. He said that it was a worthwhile experience and that he learned relevant information about application processes. “I definitely need to do more research on the company to see what they do and apply online,” Freedman said.

(

Sheridan

#OLD+EG"EER!VAILABLEs"EERS7INESs3ANDWICHES-ADETO/RDER


6 NEWS | the daily northwestern

friday, october 19, 2012

ETHS targets testing gaps in college prep work looking at ETHS ACT scores across race blacks

36

EE

nv er sa tio

FR Co

Complimentary Scones Every Sunday with Breakfast or Lunch

Live Music Weekly â&#x20AC;&#x153;your home away from homeâ&#x20AC;?

626 Church St. | Evanston | 847-864-1679 www.celticknotpub.com

Whites

18

18.6 19.6 27.3

18.0 19.3 27.6

0

18.5 19.9 27.2

9 07-08

08-09

09-10

10-11

11-12

Achievement Gap Infographic by Tanner Maxwell/Daily Senior Staffer

PLAN, seniors were invited to attend three sessions, discussing gap year considerations, how to pay for college and the college admissions process. Though parents may want to reduce stress in their children, Levinson said Assessment Day gives students

opportunities to improve their test-taking skills. â&#x20AC;&#x153;Unfortunately, itâ&#x20AC;&#x2122;s a fact of life that they have to take tests,â&#x20AC;? she said.

Â&#x201E;

manuelrapada2015@u.northwestern.edu

Mom always loved She always you wanted best... you to have a Breakfast, Brunch good breakfast. or Lunch She always wanted you to Breakfast, Brunch have a good breakfast. or LunchBuy one entree at regular price and get your second Breakfast of equal or lesser at at Breakfast Le Peep. at Le Peep.Buy one entree entree Mom would be pleased. regular price and getvalue for just 99¢

"REAKFASTs,UNCHs$INNER

Try our Cupcake of the Month

latinos

27

n

Some Evanston Township High School seniors acted as mock admissions officers Thursday, just as juniors finished a mock ACT exam mere classrooms away. The admissions dilemma dealt to the 19 students was this: choose â&#x20AC;&#x153;Jacqueline,â&#x20AC;? an out-of-state student committed to a few extracurricular activities, or â&#x20AC;&#x153;Holden,â&#x20AC;? an outstanding athlete with a consistent track record. The standardized tests and post-graduation information sessions such as this one were part of ETHSâ&#x20AC;&#x2122; Assessment Day. The annual event comes after recently released figures reveal the school has only made small gains on the ACT exam between the 2002 and 2012 graduating classes. In that time period, the schoolâ&#x20AC;&#x2122;s average ACT composite score jumped from 21.9 to 23, out of a possible 36. Scores peaked in 2009 and 2010, when graduating seniors averaged 23.5, according to an ETHS report. Still, Judith Levinson, ETHS director of research, evaluation and assessment, pointed out Wednesday, on the eve of testing more than 1,400 students, that the average composite scores are some of the schoolâ&#x20AC;&#x2122;s highest in 40 years. The racial achievement gap between blacks, Latinos and their white classmates, however, remains significant.

19.2 19.0 27.2

the daily northwestern

The nearly 10-point average difference between blacks and whites in ACT composite scores is the highest in at least five years. Translating the disparity nationally, more than 87 percent of recent high school graduates nationwide scored at or worse than the average 2012 ETHS white graduate who took the ACT, according to the ACT website. In comparison, only 34 percent of recent graduates scored at or worse than the average black ETHS graduate in 2012. More than 41 percent scored at or below this past graduate classâ&#x20AC;&#x2122; average Latino student. All sub-groups from at least the last five graduating classes, disparities aside, scored higher than state averages. Levinson highlighted the consistently increasing participation of students in the schoolâ&#x20AC;&#x2122;s Advanced Placement program as â&#x20AC;&#x153;very good news.â&#x20AC;? Between 1973 and 2012, the proportion of students taking AP exams jumped nearly five-fold from 5 to 25.8 percent, according to ETHS data. The percentage of AP exams receiving at least a three out of five â&#x20AC;&#x201D; deemed â&#x20AC;&#x153;qualifiedâ&#x20AC;? for college credit or for placement in advanced courses â&#x20AC;&#x201D; has only decreased slightly in the last five years of exam administrations, from 78 percent in 2008 to 70 percent in 2012. â&#x20AC;&#x153;Itâ&#x20AC;&#x2122;s a program thatâ&#x20AC;&#x2122;s expanding,â&#x20AC;? Levinson said. â&#x20AC;&#x153;So our point is to increase the numbers of students taking those courses and doing well on those exams.â&#x20AC;? While freshmen attended an assembly on respect and sophomores took a pre-ACT exam called ACT

17.6 18.1 27.0

By Manuel Rapada

99¢

Breakfast, Brunch or Lunch Mom would be your second entreeOffer good Monday-Saturday only Offer good only at restaurants listed Evanston, 827 Church St. of equal or lesser Mon. - Fri. 6:30 a.m. to 2:30 p.m. Limit one offer per coupon. Offer expires 11/2/12. Mom always loved you best... pleased. value for just 99¢ Sat. - Sun. 7:00 a.m. to 2:30 p.m. (847)328-4880 Offer good Monday-Saturday only Offer good only at restaurants listed Limit one offer per coupon

Breakfast, Brunch or Lunch

NORTHWESTERN (YDQVWRQ

&KXUFK 6W

 

0RQ)ULDPWRSP 6DW6XQDPWRSP

SPORTSWEAR

3DUN5LGJH 6(XFOLG

6XPPLW6KRSSLQJ&HQWHU  

Mon. - Fri. 6:30 a.m. to 2:30 p.m. Sat. - Sun. 7:00 a.m. to 2:30 p.m. Offer 11/19/07 Offer expires 10/22/07

s/VER4HAISPECIALITIES s$ELICIOUS,UNCHTIME"UFFET DAYSPERWEEKAT3KOKIE WEEKDAYSIN%VANSTON s6EGANSnANYDISHMADEVEGETARIANUPONREQUEST

$ELIVERYAVAILABLEALLDAYLONG DAYSPERWEEK <jkXYc`j_\[(0.,

Officially Licensed Dealer

Welcome NU Family!

s.ORTHWESTERN7ILDCARDHOLDERSGETOFF s&ORKSFROM#HICAGO4RIBUNEAND#,46

15% OFF Your Total Bill (excludes buffet and drinks)

ACROSS FROM RYAN FIELD ÂŁ{ÂŁĂ&#x2C6;Â&#x2021;Ă&#x160; /,Ă&#x160;-/, /Ă&#x160;UĂ&#x160;­n{Ă&#x2021;ÂŽĂ&#x160;Ă&#x17D;Ă&#x201C;nÂ&#x2021;Ă&#x201C;Ă&#x17D;Ă&#x201C;x

BuyNorthwesternGear.com

Expires 11/19/12. Must have coupon. Limit one coupon per customer. Not valid with any other offer.

%MERSONIN%VANSTON  


The Daily Northwestern FRIDAY, OCTOBER 19, 2012

HOME

vs. NEBR A 10/20, 2: SKA 30 p.m.

Filling Ryan Field By ROHAN NADKARNI

daily senior staffer

It may be decades before the mayor of Chicago decides to dye the Chicago River purple, but right now Chicago’s Big Ten Team continues to attract new fans. Especially this season, with the help of a talented squad fighting for a chance in the conference championship, Northwestern’s fan base has grown significantly, creating a home-field edge at Ryan Field that has been absent for decades of the school’s existence.

Half full, not half empty During a memorable post-game news conference this season, when asked a question about that night’s game, coach Pat Fitzgerald held up his nearly finished Powerade bottle and told reporters, “This is 98 percent full, man.” Fitzgerald may as well have been talking about Ryan Field, the Wildcats’ home turf. For many years before and up through this season, NU has dealt with swathes of empty seats at home games. But this year, things have changed for the only private school in the Big Ten. Despite being saddled with a sub-10,000 undergraduate enrollment and the second-smallest alumni population in the Chicago area, season ticket sales rose 58 percent for the 2012 season, NU’s associate director of external affairs Mike Polisky told Crain’s Chicago Business. “It’s critically important,” Fitzgerald said of increased fan support. “Those are some of the steps we need to continue to make in our program to get us to where we want to be. We’re very thankful for the administration and the work Mike Polisky and our season ticket sales staff are doing.” The 2012 season represented the third-highest season ticket base in school history, said Doug Meffley, NU’s director of digital and social communications. According to Meffley, the season ticket base has grown 70 percent since 2009. “We’re just taking the steps,” Fitzgerald said. “We’re not where we want to be yet.”

Protect this house With the buzz of new Under Armour uniforms and the chase for an elusive bowl win heading into the season, NU saw very impressive showings at its first four home games of the season. The Cats averaged about 31,503 fans for the games against Vanderbilt, Boston College, South Dakota and Indiana. For the first three of those games, the entire student population had yet to reach campus, with move-in day for upperclassmen not arriving until Sept. 24. Last year, NU averaged 33,442 fans per game, but that included contests against Michigan and Penn State, two large

Daily file photos by Rafi Letzter

Big Ten schools whose fans travel well. Both of those games drew more than 40,000 fans, with the match-up with Penn State coinciding with Homecoming weekend for the Cats. Saturday’s game against Nebraska is sold out. NU also has more chances to draw big with a Homecoming match-up against Iowa and a rivalry battle with Illinois. The effect of the growing attendance, a 38 percent increase from 2009-2011, has been twofold. First, the heightened buzz around NU football has brought in more opportunities for the school’s athletic department. In addition to the school-wide Under Armour sponsorship, the Cats have struck lucrative deals with BMO Harris Bank and Northwestern Memorial Hospital, both of which have prominent advertising exposure at home games. The fan support also improves the product on the field, with NU slowly gaining a home-field edge that fellow Big Ten members like Ohio State and Michigan have enjoyed for nearly their entire existence. “We’re very thankful, first of all, for our student support,” Fitzgerald said. “We play for our students. It’s unbelievable to see that kind of support early in the year. I have a feeling they’re getting ready to ‘get it on’ on Saturday.” Fitzgerald, who frequently speaks on campus during the week, said, “It’s a lot of fun to have that kind of chemistry and that kind of buzz. Things are starting to feel special on campus.” Some of the first home contests of the year were special for the Cats. NU’s home opener against Vanderbilt fell on Sept. 8, more than a week before new freshmen arrived on campus. Regardless of the very few students at school, more than 31,000 people showed up to watch the game, including a full student section. Toward the end of the game, the skies opened up, resulting a solid downpour onto the field. But the student section remained full, with those who somehow found their way to Evanston literally soaking up every last second of the Cats’ win over Vanderbilt. “As an alum, definitely something I’ve noticed is the increased student support,” said Meffley, who graduated from NU in 2004. “The students arrive to games earlier than before. From where I sit up in the press box, I can see always how full the student section is.”

Rags to riches Even with one of the largest financial endowments in the country, NU’s athletic program have operated on a different scale. Last month, the Cats’ athletic department announced plans for new football and

athletic facilities to be built on campus, a project estimated to cost more than $200 million. The plan is the first major football facilities renovation since 1996, when Dyche Stadium became Ryan Field for the 1997 season. The increased fan support around the football team helped make catching up with other Big Ten schools a priority. Ben Slivka, a member of the NU board of trustees who voted on the new athletic facility project, remembers the days when the Cats struggled tremendously at football. “During my undergraduate years, we won exactly one game and tied one game,” Slivka said. “We lost all the rest.” Although Slivka admitted to losing touch with the team after graduating in 1982, before the 1995 Rose Bowl season brought him back into the fold. Now Slivka, a Seattle resident, is part of a group of alumni who organize watch parties to support the Cats in large groups. “Like fans everywhere, it is more fun to watch a winning program. So when NU football is doing better, more alumni tune in and follow the team,” Slivka said. “We had 48 people at our watch party in Seattle two weeks ago for the Penn State game when we were 5-0 and ranked in the Top 25. That may have been a new high for our watch parties in Seattle.”

All along the clock tower After every NU win, students can see the Rebecca Crown Center Clock Tower lit purple for at least the next week. Current students are used to walking down Clark Street and seeing the tower shine purple. In fact, it’s tough for them to imagine a time when the team struggled. “I think I would go to games if we still lost a lot,” Weinberg junior John Le said. “But we’ve improved a lot.” It will still take many years for NU to reach the heights of other Big Ten schools. The Ohio States and Michigans of the conference regularly draw more than 100,000 fans to a single home game in stadiums twice the size of NU’s Ryan Field. But at the same time, in the early 1980s, when Slivka saw the Cats win only one game in a fouryear period, no one thought a college football hallof-fame linebacker would lead the team to five straight bowl games and have a winning record for his coaching career. Now, fans expect to not only see wins, but also post-season success. And more often than not, they walk around campus with the clock tower glowing purple. Maybe they don’t need the Chicago River after all. rohannadkarni2015 @u.northwestern.edu

Bringing down the

HOUSE

NU has averaged 31,503 fans through four games. Here is how many people have cheered on the Cats each week.

Vanderbilt 31,644

Boston College 32,597

South Dakota 28,641

Indiana 33,129

Nebraska (Projected) 47,130

Infographic by Christine Nguyen/Daily Senior Staffer


2 GAMEDAY

The Daily Northwestern

Friday, October 19, 2012

Basics key to NU success against Nebraska By josh walfish

daily senior staffer

Northwestern went to Lincoln, Neb., last year and beat then-No. 9 Nebraska 28-25. It was a game that set the Wildcats back on track for a bowl bid and turned their season around. On Saturday, the Cornhuskers visit Evanston, and the Cats have moved on from last year’s game and are looking at this contest as its own entity. “Both teams are different,” coach Pat Fitzgerald said. “So last year is what it is.” The game will feature two of the more dynamic running attacks in the Big Ten. The Cornhuskers are the top-ranked rushing offense in the conference, and the Cats come in at number four. Both teams have explosive running backs in NU junior Venric Mark and Nebraska senior Rex Burkhead. This puts a lot of pressure on the defense to shut down these potent ground attacks. NU has a large advantage when it comes to stopping the run, giving up

nearly 80 yards fewer per game than Nebraska does on the ground. The Cats rank second in the Big Ten in rushing defense, and defensive coordinator Mike Hankwitz said his unit will need to continue to be strong in the basics to stop Nebraska. “We’ve got to be fundamentally sound,” Hankwitz said. “You’ve got to be in the right spot because they run enough option component things, that if you got a guy out of position they have a chance to make a big play.” The Nebraska rushing attack provides a couple of unique challenges for the NU

Daily file photo by Meghan White

sure Tackle Damien Proby wraps up Penn State running back Zach Zwinak last Saturday. The junior linebacker leads the Cats with 62 tackles this season.

Opponent Profile

defense. The Cornhuskers have a two-back system with Burkhead filling the role of punisher while Ameer Abdullah plays the speedster. In addition, quarterback Taylor Martinez is capable of escaping the pocket and gaining large chunks of yards by scrambling. This three-headed monster will be difficult to stop, and Hankwitz said they are more prolific now than last year. The key for the Cats will be stopping the quarterback draw, something they did not do very well early against Minnesota last week. In the first half of that game, quarterback MarQueis Gray ran for 76 yards on 7 carries including a 25-yard touchdown run. Senior defensive lineman Quentin Williams said the defensive line needs to focus on keeping Martinez in containment more and not allowing him to get outside of the pocket. “It’s always a constant thing in your mind to be aware of the draw,” Williams said. “It’s definitely going to be higher on our minds this week. (Martinez) wants to run the ball. He’s a fast kid, and if you let him out, he’s going to hurt you.” While its running attack has been prolific,

joshuawalfish2014@u.northwestern.edu

Burkhead sliding under the radar By rohan nadkarni

daily senior staffer

Matt Masin/The Daily Nebraskan

NU’s passing game has been anemic recently. The Cats threw for a combined 202 yards the last two weeks, about 100 yards less than sophomore Trevor Siemian threw against Indiana on Sept. 29. Quarterback Kain Colter said he sees the potential for the Cats to make some explosive plays, but the offense has not been consistent enough to capitalize on these opportunities. “The way we ran the ball last week might open the play-action game a little bit,” the junior said. “On offense we’ve been a little inconsistent, and there are some areas where we can make some big time plays. We’ve got athletes all around the field and those guys are going to go make plays when the ball’s in their hands.” The game will be broadcasted regionally on ABC, and the national media has started to descend upon the Cats. With all the distractions surrounding Saturday’s game, NU remains focused on just this week. Senior offensive lineman Brian Mulroe said the team must stay alert about the task at hand in order to keep all of the Cats’ goals in front of them. The distractions that surround a game like this can be difficult to deal with. Fitzgerald said the level of focus will be the difference in the contest Saturday. “The hallmark of any good player or competitor or team is how do you handle success,” Fitzgerald said. “With 17-to-23-year-old young men, that’s the challenge. We’ve got distractions all over the place. ... This is when leadership needs to step up. This is when I need to see that group of guys take that next step collectively.”

In the Big Ten, Michigan State running back Le’Veon Bell and Wisconsin running back Montee Ball garner the most hype as stars in the backfield. Even Northwestern running back Venric Mark has turned heads with his explosive play in the 2012 season. Often lost in the shuffle is Nebraska’s senior running back Rex Burkhead. The Plano, Texas, native has been a consistent performer during his two seasons in the Big Ten, as well as one of its best. Burkhead was ready from the get-go as a true freshman in 2009, when he played in nine games and carried the ball 81 times, gaining a respectable 360 yards on the ground for the season. The next year, Burkhead’s workload increased to 172 carries for 990 yards and 7 touchdowns. Last season, Burkhead had his coming out party when coach Bo Pelini handed him the starting job at running back. The then-junior exploded on to the scene, becoming one of the best playmakers in the conference. The Plano Senior High School graduate tore up opposing run defenses for 1,406 yards on the ground, running the ball 284 times and racking up 15 touchdowns. At Big Ten Media Days in July, Burkhead was asked about his success and credited his parents for guiding him through his football career. “My parents did a tremendous job,” he said. “They made sure I stayed humble and didn’t get too high on myself. My coaches and teammates do the same thing, and we all hold each other accountable.” Burkhead grew up watching a lot of Texas football, and with all the exposure to the Big 12 through

Texas, Texas Tech and Baylor, Nebraska would also catch the running back’s eye. In fact, Burkhead admitted to always wanting to play in the Big 12, something that changed when the Cornhuskers switched conferences. “I watched (Nebraska) a lot,” Burkhead said. “I was a big college football guy growing up. I had always been watching them, but as they showed more interest, I started watching them more.” But the switch to the Big Ten didn’t faze Burkhead. His aforementioned junior year coincided with Nebraska’s first season in its new conference, and Burkhead immediately made himself a top performer. In his first conference game against Wisconsin, Burkhead picked up 96 yards on 18 carries. He followed up that performance with a 119-yard effort against Ohio State, picking up 96 of his yards and his only touchdown in the fourth quarter of a Nebraska comeback. The Cornhuskers relied on Burkhead throughout conference play. He picked up 100 yards in each of the following two weeks after Ohio State. His best game of the year came late in the season against Iowa, when Burkhead was handed the ball a school-record 38 times, picking up 160 yards for his seventh 100-yard game of the season. But being considered as one of the best is not enough for Burkhead. “It’s a cool honor, but it’s not very important,” Burkhead said when asked how he felt about being regarded as one of the top backs in the conference. “I’m just worried about winning a Big Ten championship.” Burkhead has fought injuries throughout the year, even missing two games in the middle of the season. He returned for the Cornhuskers’ game against Idaho State and rushed 8 times for 119 yards. The senior, who hopes to play football for as long as possible and coach after he graduates, will get a chance for revenge against NU on Saturday. Last year, the Wildcats held Burkhead to only 69 yards on 22 carries. Given his body of work against the rest of the conference, NU should be prepared for a bounce back performance Saturday. rohannadkarni2015@u.northwestern.edu


GAMEDAY

The Daily Northwestern

Friday, October 19, 2012

Northwestern Wildcats (6-1, 2-1) vs. Nebraska Cornhuskers (4-2, 1-1) 5

23

14 70 72 2

66

5

79 75

3 34 55 53 46

88

71

42

44 91

61

51

46 67 33 97

72 3

45 13

27

Compiled by Josh Walfish Daily Senior Staffer

81

24

22

77 76 10

8 6

16

15

18

@Sir_6_A_Lot Tony Jones So basically I’m home alone cuz I was too scared to go see Sinister with my boys. I just don’t see the entertainment in getting scared.

@ChuckPorcelli Chuck Porcelli

@CarpeD_em Jared Carpenter

Nebraska Offense

Northwestern Offense 14 WR Christian JONES 17 WR Rashad LAWRENCE 70 LT Patrick WARD 72 LG Brian MULROE

66 C Brandon VITABILE 79 RG Neil DEITERS 75 RT Jack KONOPKA

3 QB Taylor MARTINEZ 22 RB Rex BURKHEAD 80 WR Kenny BELL 18 WR Quincy ENUNWA

10 WR Jamal TURNER 72 C Justin JACKSON 81 TE Ben COTTON 61 RG Spencer LONG 76 LT Brent QVALE 71 RT Jeremiah SIRLES 77 LG Seung HOON CHOI

34 DE Cameron MEREDITH 45 OLB Alonzo WHALEY 51 MLB Will COMPTON 42 OLB Sean FISHER

NU Profile

12 CB Stanley JEAN-BAPTISTE 13 S P.J. SMITH 3 S Daimion STAFFORD 5 CB Josh MITCHELL

88 DE Quentin WILLIAMS 91 DT Brian ARNFELT 67 DT Sean MCEVILY 97 DE Tyler SCOTT

The woman that did my pedicure was so cute..like not romantically, but in a humbling way. She told me about bout her son playing fball

@KainColter_2 Kain Colter

Northwestern Defense

Nebraska Defense 46 DE Eric MARTIN 53 DT DaQuan RANDLE 55 DT Baker STEINKUHLER

Some of the highlights of the Wildcats’ lives — in 140 characters or fewer

Just ordered a meal “reduced size” tonight. I don’t recognize the man staring back in the mirror. What kind of monster have I become?

Roster 2 QB Kain COLTER 5 RB Venric MARK 8 WR Demetrius FIELDS 6 WR Tony JONES

Central St.

TWEETS

80

NEBRASKA

NORTHWESTERN

17

3

44 OLB Chi Chi ARIGUZO 24 S Ibraheim CAMPBELL 46 MLB Damien PROBY 27 S Jared CARPENTER 33 OLB David NWABUISI 15 CB Daniel JONES 23 CB Nick VANHOOSE

My boy Venric Mark needs to be in the #Heisman talk. He puts on a show every game.

Injuries can’t slow DE Gibson By JOSH WALFIH

daily senior staffer

Deonte Gibson was back to 100 percent and ready to play his first college football game. After taking a redshirt season last year to rehabilitate from a torn anterior cruciate ligament he suffered during his senior year of high school, Gibson returned to the practice field in a regular uniform in the spring. Gibson impressed the coaching staff during spring practices with his performance and was poised to be a breakout star on the Northwestern defensive line as part of the rotation at defensive end. However, in the season opener against Syracuse on Sept. 1, Gibson left the game early with a dislocated elbow. “It’s devastating, but when you sign up for a game like football you understand that injuries are a dime a dozen,” he said. “You know something’s always going to happen to you, so you’ve got to be prepared and play every play like it’s your last.” Despite the added setback in his career, Gibson did not stop pushing to get back on the field and help the Wildcats. He came back from the elbow dislocation in about a week, suiting up for practice just nine days after the injury occurred. Dislocated elbows normally require multiple weeks to heal properly, but Gibson played in NU’s 22-13 win over Boston College with a brace on his elbow only two weeks removed from the dislocation. He still wears the brace, but Gibson said once he gets on the field he forgets about his injuries. His mentor on the team, senior defensive end Quentin Williams, said Gibson is one of the hardest workers and added that although he didn’t think Gibson would be back within a week, he wasn’t surprised by the redshirt freshman gutting it out. “Te’s one of the most motivated guys I know,” Williams said. “He’s tough as nails, and his toughness is a testament to the way he plays. We didn’t expect him to be playing out there, but he’s a tough kid, and that’s huge for him.” Gibson may not have a lot of playing experience, but his maturity and wisdom extends well beyond his years. Williams said it is difficult sometimes to remember Gibson is only a freshman and hasn’t been around the team for multiple years.

“Whenever people bring up Te’s a freshman and that he’s playing his first year as a college football player, it’s kind of weird to us,” Williams said. “We honestly consider him kind of a veteran, someone who’s been out there a lot. Sometimes he’ll have a few lapses and we’ll be like, ‘I’m surprised you didn’t know that. We ran this defense two years ago,’ but he’s only been here a year. He’s playing like a veteran.” The veteran leadership has been a crucial step in Gibson’s developmental process. The three upperclassmen on the defensive line have done an excellent job at teaching both Gibson and freshman Dean Lowry how to play defensive end in the Big Ten, Gibson said. Defensive coordinator Mike Hankwitz said the dialogue between the younger guys and the veterans have allowed the freshmen to make huge strides. The upperclassmen all had positive things to say about how Gibson has progressed so far this season, and Gibson returned the compliment by giving them the credit. “They’ve shown me how to play at this level,” Gibson said. “They’re great mentors and they know the game. They’ve been here for a while. They just take us by the hand and guide us to where we need to be.” Even though Gibson may not be having the kind of productivity he would like on the field, his coaches see him making an impact on the game in ways that don’t show up on the stat sheet. Last week against Minnesota, Gibson bull rushed past the offensive line and took down quarterback Max Shortell for what looked like his first sack of the season. However, Gibson got ahold of the face mask during the tackle and was flagged for a penalty that negated the sack. It may not have counted, but it was a play that showed Gibson has the talent to compete at the Big Ten level. Coach Pat Fitzgerald said he is happy with how Gibson has progressed this season and has seen him become more active in the play. “He’s gotten more and more comfortable playing,” Fitzgerald said. “I’m really proud of the way he’s playing right now, and the sky’s the limit as he moves forward in his career.” joshuawalfish2014@u.northwestern.edu Daily file photo by Meghan White


4 GAMEDAY

The Daily Northwestern

Friday, October 19, 2012

Wide receivers pave way for rushing success By ROHAN NADKARNI

daily senior staffer

Imagine an intense Pat Fitzgerald recruiting a young wide receiver to be part of an offensive attack renowned for passing the ball. Then imagine that receiver arriving on campus to work on their blocking. For Northwestern’s offensive attack this season, the entire wide receiver group placed an emphasis on blocking during practice, resulting in the Wildcats’ newfound rushing success. Last year, with then-sophomore Mike Trumpy and then-senior Jacob Schmidt handling most of the running back duties for the Cats, NU managed only 166.6 yards per game on the ground, gaining just 3.8 yards per carry. The Cats ran on 58.6 percent of their offensive snaps last season but never found consistent success. This season, with a heavier focus on option runs, NU has upped its yards per carry average to 5.1. The Cats now run for 228.4 yards per game and run slightly more often at 60.5 percent of their offensive snaps. The 19 rushing touchdowns scored in seven games this season are approaching the 25 scored all of last year. “Since I’ve been here, it’s been something that coach (Fitzgerald) has worked on,” wide receivers coach Dennis Springersaid of the option-run game. “As a crew, we take pride in (blocking). It’s a big part of our success.” Despite all of junior running back Venric Mark’s flair and personal accomplishments, including being on pace to be the first NU player to run for more than 1,000 yards since Tyrell Sutton in 2006, a decent running attack mainly rests on the shoulders of those making the blocks, however unsexy it may be. Fortunately for the Cats, the players who would much rather run around and catch the ball have bought into the team’s the run-first philosophy

and have opened holes for their cohorts in the backfield. “Our goal is to be the best blocking wide receiver group,” Springer said. “The improvement has been that they’ve embraced that role. Wide receivers want to run, catch balls, catch touchdowns and that kind of thing, but they’ve become an extremely physical group.” In the game against Our goal Minnesota, wide receivis to be the best ers were key on many of blocking wide the big runs. On a 47-yard run into receiver group. the red zone during the The improvefirst quarter, sophomore ment has been wide receiver Tony Jones that they’ve placed the key block. embraced that Jones started up the field, and then ran role. back toward the line of Dennis Springer, scrimmage to take out a wide receivers helpless defensive back, coach allowing Mark to turn the corner and run untouched. Jones made just enough contact while Mark was still near the line of scrimmage, but his work produced a huge play. On the very next play, senior wide out Demetrius Fieldsprovided the only block on a bubble screen that led to another first down. Working in the slot, Fields quickly engaged his defender off the snap, driving him backwards to create more traffic for the other Minnesota defensive backs. As a result, the wide receiver to Fields’ right could easily run toward the first-down marker. “It’s all about your feet, your hands and your eyes,” Springer said about the group’s techniques. “You have to get yourself to the point where you are close enough to block someone, you have to have your eyes in the right place and you have to be physical with your hands.” Even on a seemingly simple option play, as

Rafi Letzter/Daily Senior Staffer

UNSELFISH Though Venric Mark (No. 5) has gotten the headlines, he has benefitted greatly from the blocking of his wide receivers. The Cats are averaging 228.4 rushing yards per game.

many as three wide receivers will be called upon to deliver the critical blocks to spring the run, and everyone’s techniques must be sound. For example, on a play early in the second quarter against the Golden Gophers, Kain Colter lined up in the backfield with Mark behind him and Fields to his left. Sophomore wide receiver Christian Jones and junior wide receiver Rashad Lawrence lined up out wide to the left of the formation. As the play commenced, Colter began to run left with Mark trailing, as Fields ran patiently up the field to find a defender. As Colter pitched to Mark, Fields took out the Minnesota safety with a devastating block, while Jones ran back toward the formation to seal the edge. As Mark turned the corner, Lawrence engaged with another cornerback, allowing Mark to pick up 9 yards on the play. Fields needed to trust his eyes in order to find the right person to block, Jones made good use of

his feet to run laterally to seal the edge and Lawrence’s physicality pushed his defender backwards to create room. “When you see how much success we’re having, it’s hard to fight it,” Christian Jones said. “We know that the running game is going to be a big part of our offense every week.” Jones continued on about the work that goes behind the run game each week, explaining that NU will “study linebackers and safeties” and individual preferences of players on defense. And although blocks may not be as easily recognized as catches, yards and touchdowns, the receivers still manage to make it worthwhile. “We have a competition going,” Christian Jones said. “We’re counting who knocks people down the most. Anything can be fun if you make it that way.” rohannadkarni2015@u.northwestern.edu

Fearless Forecasters

WEEK 8

DAN

JOSH

RYAN

ANNIE

WALFISH

Northwestern 38 Nebraska 24

CHANG

ROHAN

NADKARNI

Kain is able, but Taylor throws too many TDs.

Northwestern 30 Nebraska 24

Nebraska 38 Northwestern 24

Wildcats cream some corn

I’m nervous.

Wisconsin 23 Minnesota 20

Wisconsin 34 Minnesota 17

Wisconsin 17 Minnesota 7

Wisconsin 28 Minnesota 14

Ohio State (7-0) vs. Purdue (3-3)

Ohio State 30 Purdue 13

Ohio State 56 Purdue 24

Ohio State 38 Purdue 20

Ohio State 45 Purdue 14

Navy (3-3) vs. Indiana (2-4)

Indiana 43 Navy 30

Navy 38 Indiana 27

Navy 27 Indiana 17

Indiana 21 Navy 14

Penn State 37 Iowa 27

Penn State 10 Iowa 6

Iowa 20 Penn State 10

Penn State 24 Iowa 14

Michigan 24 Michigan State 20

Michigan 24 Michigan State 20

Michigan 17 Michigan State 14

Michigan 28 Michigan State 17

13-3

13-3

10-6

12-4

Northwestern (6-1) vs. Nebraska (4-2)

Nebraska is only marginally better than Indiana, and Indiana isn’t good.

Wisconsin (5-2) vs. Minnesota (4-2)

Iowa (4-2) vs. Penn State (4-2) Michigan (4-2) vs. Michigan State(4-3) Forecasting record

B1G S T A N D I N G S LEGENDS Iowa Michigan Northwestern Nebraska Michigan State Minnesota

GAMEDAY Gameday Editor

LEADERS (4-2, 2-0) (4-2, 2-0) (6-1, 2-1) (4-2, 1-1) (4-3, 1-2) (4-2, 0-2)

Ohio State Penn State Wisconsin Purdue Indiana Illinois

Nebraska 38 Northwestern 35

Josh Walfish

(7-0, 3-0) (4-2, 2-0) (5-2, 2-1) (3-3, 0-2) (2-4, 0-3) (2-5, 0-3)

Assistant Editor Colin Becht

Sports Editor Dan Ryan

Writers

Design Editors Kaitlin Svabek Christine Nguyen

Rohan Nadkarni

Gameday is a publication of Students Publishing Co. A four-page issue is published on the Friday prior to Northwestern home games and a three-page issue is published on the Friday prior to Northwestern road games. All material is © 2011 Students Publishing Co. Questions or comments should be sent c/o Gameday Editors Colin Becht and Robbie Levin, 1999 Campus Dr., Evanston, IL 60208.


the daily northwestern | NEWS 7

friday, october 19, 2012

EN JOY E VA NSTON'S FAVORITE RESTAUR A NT

Greek and Italian

S a l on Food truck sues city over Rou l a right-to-sell requirements ­n{Ç®ÊÎÓn‡È££äÊUÊÈäÎÊ >ۈÃÊ-Ì°

specialties:

the daily northwestern

Grilled Seafood *>ÃÌ>ÃÊUÊ->>`ÃÊ Chargrilled Chops ÕÀ}iÀÃÊUÊ iÃÃiÀÌÃÊ Wine & Beer OPEN 7 DAYS A WEEK ONLY 2 1/ 2 BLOCKS FROM CAMPUS! JUST WALK WEST ON NOYES STREET. 828 Noyes Street Evanston 847-475-8683

www.noyescafe.com

By CIARA MCCARTHY

25% OFF Any first time service * 20% OFF Future Appointments with Wildcard * *with selected professionals. Not valid with any other specials or keratin services. Must present coupon.

NU SENIORS: Do it for Mom. SIGN UP FOR YOUR YEARBOOK PORTRAIT. Monday, October 29–Friday, November 16 @ NORRIS Or sign up at: www.OurYear.com NU Code: 87150 questions? email: syllabus@northwestern.edu web site: www.NUsyllabus.com

The legal conflict between a Chicago-based food truck and Evanston escalated recently when the city moved to dismiss a lawsuit filed by the vendor. Beavers Coffee and Doughnuts is protesting an Evanston ordinance that says mobile food vehicles must be owned and operated by the owner of a licensed food establishment within city limits. “We’re objecting to the provision that says, in essence, that you have to own a brick-and-mortar restaurant if you want to own a food truck,” said Jacob Huebert, the food vendors’ attorney with the Liberty Justice Center. The doughnut truck has been in operation since the beginning of 2012 and regularly sells on other Chicago-area campuses, including the University of Chicago and DePaul University. Beavers Coffee and Donuts has operated in Evanston at several Northwestern events, including Dillo Day. The company ran into barriers, however, when it inquired about selling regularly in Evanston, said Gabriel Wiesen, co-owner of the truck. Initially, the food truck attempted to partner with an Evanston bakery to sell both that bakery’s products and Beavers’ doughnuts from their truck. However, Wiesen said they were told by city representatives that they would need to be

Evanston utilities clarifies resident duties regarding insurance

Evanston’s utilities department warned property owners Wednesday that companies offering water and sewer service line insurance are not associated with the city. “As with any insurance or warranty program, individuals should do their own due diligence to check the company’s reputation and references and to confirm covered services and exclusions,”

majority owners of the bakery in order to operate the truck. The Liberty Justice Center approached Beavers as the owners were encountering these obstacles, and the company decided to file a lawsuit with the Cook County Circuit Court’s chancery division. According to Huebert, the Evanston law is unconstitutional on two grounds. The law violates the guarantee of equal protection under the law in the Illinois Constitution because it exists only to protect restaurant owners from competition, he said. “You’re singling some people out for favorable treatment and everyone else for unfavorable treatment simply because the one group of people happens to own a restaurant and the other group of people doesn’t own a restaurant,” Huebert said. Beavers Coffee and Donuts is also challenging the law under the due process clause of the Illinois Constitution, he said. A city representative declined to comment on ongoing litigation. Beavers Coffee and Donuts will file a response to the city’s motion that is due on Oct. 29, Huebert said, and the court will decide whether the complaint has merit. Wiesen said that this law hurts consumers and entrepreneurs in Evanston. “It’s stifling the choices for consumers and it’s stifling entrepreneurship growth,” he said. ciaramccarthy2015@u.northwestern.edu the release said. The department also reiterated that property owners are responsible for water and sewer service lines from the city-maintained equipment into their property. Though average work on water and sewer line permit applications totaled in the thousands of dollars, only a small proportion of applications were made in 2011. Applications for private water service line repairs, for instance, represented less than 0.1 percent of the city’s approximately 14,400 water services. — Manuel Rapada

Downtown Evanston Gift Cards

NOW AVAILABLE ONLINE!! s0ERFECTGIFTFORSTUDENTS TEACHERS FRIENDS ANDFAMILY s!CCEPTEDATOVER$OWNTOWN %VANSTONPARTICIPATINGBUSINESSES s!VAILABLEINDENOMINATIONSOFTO s#ANBEPURCHASEDWITH6ISA -ASTER#ARD and Discover Gift cards may also be purchased at: Downtown Evanston 820 Davis Street Suite 151 Monday through Friday 9AM–5PM

First Bank and Trust 820 Church Street Monday through Friday 8:30AM–6PM Saturday 8AM–2PM

www.downtownevanstongiftcard.com evanston_dailynw_gift_card_half_pg_ad_bw.indd 1

10/17/12 10:41 AM


THE DAILY NORTHWESTERN | NEWS 8

FRIDAY, OCTOBER 19, 2012

â&#x20AC;&#x2DC;Snapshot Evanstonâ&#x20AC;&#x2122; captures cityâ&#x20AC;&#x2122;s character in a day around for a day or people who just want to learn about Evanston. We go around and talk about the things that make this town what it is.â&#x20AC;? This year, 27 people registered for the event, which began at 8:30 a.m. The dayâ&#x20AC;&#x2122;s programming began with a bus tour sharing Evanstonâ&#x20AC;&#x2122;s history. Upon returning to the Lorraine H. Morton Civic Center, participants heard from city officials, including Ald. Melissa Wynne (3rd) and Steve Griffin, the cityâ&#x20AC;&#x2122;s director of community and economic development, among others. Later, Sara Schastok, president and CEO of the Evanston Community Foundation, discussed the cityâ&#x20AC;&#x2122;s strengths, particularly how residents come together to strengthen the community.

City officials, leaders and NU administrators join forces to teach about Evanston By NINA MUNOZ

the daily northwestern

The Evanston Community Foundation aimed to illuminate the cityâ&#x20AC;&#x2122;s history, economic development and educational successes in its annual â&#x20AC;&#x153;Snapshot Evanstonâ&#x20AC;? event Thursday. â&#x20AC;&#x153;Itâ&#x20AC;&#x2122;s Evanston in a day,â&#x20AC;? said Beth Osterlund, director of Leadership Evanston, the organization that planned the event. â&#x20AC;&#x153;Itâ&#x20AC;&#x2122;s great for people who just arrived here, people who are

â&#x20AC;&#x153;

We go around and talk about the things that make this town what it is. Beth Osterlund, director of Leadership Evanston

Attendee Tricia Bulaclac, activities director at the North Shore Retirement Hotel, was particularly impressed with the education talk from Hardy Murphy, Evanston-Skokie District 65 superintendent, and Eric Witherspoon, superintendent for Evanston Township High School District 202. For closing remarks, Burgwell Howard,

Northwesternâ&#x20AC;&#x2122;s assistant vice president for student engagement in student affairs, delivered a speech focusing on the relationship between NU and the greater Evanston area. Snapshot Evanston is only one of the many events designed to encourage collaboration among community members and a better understanding of Evanston, Osterlund said. Andrea Densham, executive director of the Childcare Network in Evanston, said it was â&#x20AC;&#x153;wonderfulâ&#x20AC;? meeting other members of the community at the event. â&#x20AC;&#x153;It continues to impress me how Evanston keeps developing,â&#x20AC;? Densham said. â&#x20AC;&#x153;Itâ&#x20AC;&#x2122;s inspiring to be part of a community thatâ&#x20AC;&#x2122;s so committed to making Evanston a better place.â&#x20AC;? NinaMunoz2015@u.northwestern.edu

Columbia prof discusses effects of microagression â&#x20AC;&#x153;perpetuate stereotype threat,â&#x20AC;? Sue said. Stereotype threat refers to the anxiety felt when people think they might confirm negative stereotypes about their social groups. Sue, who has contributed to more than 150 publications and productions about microaggression, said he has found microaggressions to be most common in situations where a person feels as if others will agree with them or support them by laughter or verbal encouragement. Throughout his speech, Sue provided instances of microaggressions from his research studies. In one example, Sue discussed when teachers compliment black students for making articulate and bright contributions to class discussion. Sue said this reveals a subconscious belief that most blacks are inarticulate and lack intelligence.

By ELISA Oâ&#x20AC;&#x2122;NEAL

the daily northwestern

Columbia Prof. Derald Wing Sue explained the concept of microaggressions in an on-campus address to about 50 students Thursday. Sue defined racial, gender and sexual orientation microaggressions as â&#x20AC;&#x153;brief and commonplace daily verbal, behavioral or environmental indignities, whether intentional or unintentional, that communicate hostile, derogatory or negative racial slights.â&#x20AC;? Racial and gender microaggressions, although seemingly trivial in nature, can have major consequences for minorities because they â&#x20AC;&#x153;create a hostile and invalidating campus climateâ&#x20AC;? and

Sueâ&#x20AC;&#x2122;s research also revealed that medical school students perceive female physicians wearing stethoscopes as nurses, exposing the subconscious bias that women should be in nurturing roles and are not as well suited to decision-making roles as men. He also gave examples of race and gender microaggressions from recently active politicians such as Sen. John McCain (R-Ariz.) and Vice President Joe Biden. In addition to verbal microaggression, Northwestern Daily Sue cited statistics from his research about environmental PDF Display Ad of 2.5â&#x20AC;? x 5â&#x20AC;? microaggression, a manifestation racism or sexism in oneâ&#x20AC;&#x2122;s surroundings. Sue himself said he has been the recipient of microaggression. â&#x20AC;&#x153;It is a communication that I am a perpetual alien in my own country â&#x20AC;&#x201D; that I am not a true American,â&#x20AC;? he said.

Sue encouraged moving forward by trying to understand the worldview and experience of minority groups, despite initial discomfort. â&#x20AC;&#x153;We have to have the honest dialogue about what racism is all about,â&#x20AC;? Sue added. Angela Edwards-Campbell, director of the Kellogg Schoolâ&#x20AC;&#x2122;s Office of Diversity and Inclusion, introduced Sue and echoed his perspective. â&#x20AC;&#x153;In essence, people are good, and we all do what we know until we learn differently,â&#x20AC;? she said. Edwards-Campbell said the highlight of the speech was the conclusions reached by the research Sue referenced throughout his talk. That research, she said, proved the â&#x20AC;&#x153;unconscious phenomenon that happens among well-meaning people.â&#x20AC;? elisaoneal2016@u.northwestern.edu

FEDERAL GOVERNMENT COMMITTING FEDERAL CRIMES (for 29 years) ? by Leland Yoshitsu ISBN 9780985262280

ORDER YOUR GLOSSY, PRINTED NU SYLLABUS YEARBOOK.

QRQÂżFWLRQGRFXPHQWDU\ H%RRN  SDSHUEDFN

$PD]RQÂ&#x2021;% 11RRNÂ&#x2021;6RQ\Â&#x2021;H%RRNSLH

/

To have it charged to your student account, just log on to CAESAR. Go to FOR STUDENTS > ENROLLMENT > SYLLABUS YEARBOOK ORDER. Do it now and SAVE $5! Don't forget.

For questions & all things yearbook, go to www.NUSyllabus.com

$2.99 online FEDERAL GOVERNMENT COMMITTING FEDERAL CRIMES

including President Obamaâ&#x20AC;&#x2122;s August 2009 White House letter to Leland (page 2): â&#x20AC;&#x153;Dear Leland â&#x20AC;Śwe hope that the issue you brought to the Presidentâ&#x20AC;&#x2122;s attention has been resolved. However, if you still need help with a Federal agency, we are pleased to assist you.â&#x20AC;?

(for 29 years)?

including President Obamaâ&#x20AC;&#x2122;s August 2009 White House letter to Leland: â&#x20AC;&#x153;Dear Leland . . .we hope that the issue you brought to the Presidentâ&#x20AC;&#x2122;s attention has been resolved. However, if you still need help with a Federal agency, we are pleased to assist you.â&#x20AC;?

By LELAND Š Leland Yoshitsu 2012 All Rights Reserved.

V-3648MB

&#+.;%.#55+(+'&5  Place a Classified Ad

For Sale

For Rent

Syllabus Yearbook

CLASSIFIED ADS in The Daily Northwestern are $5 per line/per day (or $4 per line/per day if ad runs unchanged for 5 OR MORE consecutive days). Add $1/day to also run online. For a Classified Ad Form, go to: dailynorthwestern.com/classifieds FAX completed form with payment information to: 847-4919905. MAIL or deliver to: Students Publishing Company 1999 Campus Dr., Norris-3rd Floor Evanston, IL 60208. Payments in advance are required. Deadline: 10am on the day before ad is to run. Office Hours: Mon-Thurs 9-5; Fri 9-4. Phone: 847-491-7206.

EVANSTON Condo for sale. 1500 Oak 2F $375000 Well maintained building, great location, pets, laundry, indorr/outdoor parking. 847-644-1267

It is the policy of The Daily Northwestern to accept housing advertising only from those whose housing is available without discrimination with respect to sexual orientation, race, creed or national origin. The presumption is therefore, that any housing listing appearing here is non-discriminatory.

Order your NU Yearbook! Log on to your CAESAR account and click â&#x20AC;&#x153;Syllabus Yearbook Order.â&#x20AC;? The $50 will be charged to your student account. Questions? Visit NUSyllabus.com

Daily Policies THE DAILY NORTHWESTERN is not responsible for more than one incorrect insertion of an ad. Corrections must be received by 10am on the day before ad runs again, call 847-4917206. All Classifeds must be paid in advance and are not accepted over the phone. To run online, ad must run in print on same day. The Daily does not knowingly accept misleading or false ads and does not guarantee any ad or claim, or endorse any advertised product or service. Please use caution when answering ads, especially when sending money.

Help Wanted HELP WANTED ADS are accepted only from advertisers who are equal opportunity employers. The presumption, therefore, is that all positions offered here are available to qualified persons without discrimination on the basis of race, color, religion, national origin, sex, sexual orientation, marital status, age, handicap, or veteran status. A real estate investment firm near Northwesternâ&#x20AC;&#x2122;s campus seeks reliable part-time administrative help. Casual environment. For more info, please call 847-440-8441 or submit your resume to: sengelsen@jenningsrealtyinc.com or stan60660@yahoo.com.

Rent your place here! Or sell it. Or ďŹ nd a roommate. Or sublet your place. Right here. Go to: dailynorthwestern.com/classiďŹ eds

Join the 2013 yearbook team! We create the printed volume that chronicles a year at Northwestern. No yearbook experience necessary. Interested? Write to: syllabus@northwestern.edu

FIND A JOB! OR AN APARTMENT!

WITH EXCITING POSITIONS AVAILABLE IN: ACCOUNTING, ADMINIS-

TRATION, CHILDCARE, DESIGN, EDUCATION, FINANCE, JOURNALISM, MARKETING, MEDICAL, RESEARCH AND MORE!

START YOUR SEARCH TODAY!

Go to: DailyNorthwestern.com/classifieds

&#+.;57&1-7  Complete the grid so each ROW, COLUMN and 3-by-3 BOX (in bold borders) contains every digit, 1 to 9. For strategies on how to solve Sudoku, visit www.sudoku.org.uk SOLUTION TO PREVIOUS PUZZLE

Crossword D A I LY PUZZLE SPOT

Sudoku Place your ad in the most read section of The Daily

10/19

Level:    

Š 2012 The Mepham Group. Distributed by Tribune Media Services. All rights reserved.

Call your ad rep today! 847-491-7206

      &#+.;%4155914&

(* '" % *$& *$%. )(**-()+//% 

 8858...G< 0.7;. #.<987<.=8* -;8>01=.7-270 $98==1*=6*7B *?82 '8;-<8/ *==;2+>=287  7<92;*=287/8; 3*6+*5*B*  *>7=B0;..=270 86987.7=<8/

,;8<< (*8524. >66B 86987.7=<8/

,;8<< 201=<*+.; @2.5-.;< .=;.*-B/8;* -;2?.

5.6<,1885 <=*95.

$86. .68=2,87<

*;+.;*-G)) =*52*7@27.

$><12=899.;

$B6+852,<>68/  *7-  ,;8<< .B/8;0.==270 8>=8/*3*6 >6+5.;.95B=8 9;*2<. &2<2= ))*+8< .A2,8 18@-.;1.* *<.8><";./

86987.7=<8/

,;8<<

$207*5=8=;B=8 <,8;.

%1.BG;.8/=.7 +;>2<. 5*<<2,6*7>*5 @2=1E%1.F*7@1*==1.<=*;;.*7<@.;<G ,86987.7=<*;. ?2<D?2<  ,;8<< ;.0G<58?.87 E8><.F *;-92.,.< 52,4< ">9@2=18>= 9*9.;< ';2=.;-. .*>?82; 2<<"B6G< ,;.*=8;

Edited by Rich Norris and Joyce Nichols Lewis -2=.-+B#2,1 8;;2<*7-8B,..@2<

. !! # '

 *4./58*=.; >;4*@.*;.;G< -.2=B

86.-2*7$18;. "G<+><B=26.

*2)) E*7,270@2=1=1. $=*;<F3>-0. *B.;9*274255.; 78,4.-8// %2+2*7.201+8;< E'1B7.?.;F E*<=2?.F<=*;  $><12=>7*  !7.8/*=887 <.9=.= >=5*<<6*4.; *7B*$= 7-;.@<085/.; *CC52,4 !=1.;<*+;8* $92;2= *=< 884<=1*= ;.:>2;.* ,8662=6.7=

%89<

=6201=6*4.B8> /8;0.=B8>;527.<

A*4.; <2518>.==.-27=1.  5808

.=.,=2?.G< 9;878>7

 

#+)*.0*+//% (%, 

  )$+'  $ ),$ *'

8*/=.;9>99B <=B5.

$.;28>< E52G<86270F <870@;2=.; $>998;=/8;* -8@7@*;-/*,270 -80 *69+.558/E'25%1270<F E<=12<@1*=)) /8;F

%*692,8=8=<

 

*70<=.;;*74

;2./5B

+>$26+.5G<5*7

E87.<=F

$=.*6B

$>7+58,48/*<8;= $,1@2=1* #2?.;1.*,*69>< ";./2A@2=16.=.; *;<15*7 >++8,4=8 *;.-8-2;


WHAT YOU SHOULD KNOW ABOUT DISCRIMINATION, HARASSMENT, AND SEXUAL HARASSMENT Policy and Guidelines for the Northwestern Community 2012–13 POLICY ON DISCRIMINATION AND HARASSMENT

WHERE TO GET ADVICE AND HELP

Northwestern University does not discriminate or permit discrimination by any member of its community against any individual on the basis of race, color, religion, national origin, sex, sexual orientation, gender identity, gender expression, parental status, marital status, age, disability, citizenship, veteran status, or genetic information in matters of admissions, employment, housing, or services or in the educational programs or activities it operates. Harassment, whether verbal, physical, or visual, that is based on any of these characteristics is a form of discrimination. This includes harassing conduct affecting tangible job benefits, interfering unreasonably with an individual’s academic or work performance, or creating what a reasonable person would perceive is an intimidating, hostile, or offensive environment. Prohibited sex discrimination includes sexual harassment and sexual violence. While Northwestern University is committed to the principles of free inquiry and free expression,

Office of Equal Opportunity and Access

discrimination and harassment identified in this policy are neither legally protected expression nor the proper exercise of academic freedom.

Discrimination and harassment may include ➤ Refusing to hire or promote someone because of the person’s protected status ➤ Demoting or terminating someone because of the person’s protected status ➤ Jokes or epithets about a person’s protected status ➤ Teasing or practical jokes directed at a person based on his or her protected status ➤ Displaying or circulating written materials or pictures that degrade a person or group ➤ Verbal abuse or insults about, directed at, or made in the presence of an individual or group of individuals in a protected group

POLICY ON SEXUAL HARASSMENT It is the policy of Northwestern University that no member of the Northwestern community—students, faculty, administrators, staff, vendors, contractors, or third parties—may sexually harass any other member of the community. Sexual advances, requests for sexual favors, and other verbal, physical, or visual conduct of a sexual nature constitute harassment when ➤

Submission to such conduct is made or threatened to be made, either explicitly or implicitly, a term or condition of an individual’s employment or education;

Sexual harassment may include ➤ Pressure for a dating, romantic, or intimate relationship ➤ Touching, kissing, hugging, or massaging ➤ Pressure for or forced sexual activity ➤ Unnecessary references to parts of the body ➤ Remarks about a person’s gender or sexual orientation

Submission to or rejection of such conduct by an individual is used or threatened to be used as the basis for academic or employment decisions affecting that individual; or

➤ Sexual innuendoes or humor

Such conduct has the purpose or effect of substantially interfering with an individual’s academic or professional performance or creating what a reasonable person would perceive is an intimidating, hostile, or offensive employment, educational, or living environment.

➤ Sexually explicit profanity

SEXUAL VIOLENCE STATEMENT Sexual violence is a prohibited form of sexual harassment. Sexual violence includes physical sexual acts perpetrated against a person’s will or where a person is incapable of giving consent due to use of drugs and/or alcohol or to an intellectual or other disability. Some examples of sexual violence may include rape, sexual assault, sexual battery, and sexual coercion.

TITLE IX STATEMENT It is the policy of Northwestern University to comply with Title IX of the Education Amendments of 1972, which prohibits discrimination (including sexual harassment and sexual violence) based on sex in the University’s educational programs and activities. Title IX also prohibits retaliation for asserting claims of sex discrimination. Northwestern has designated Title IX coordinators, listed at right under “Where to Get Advice and Help,” to coordinate Northwestern’s compliance with and response to inquiries concerning Title IX. A person may also file a complaint with

➤ Obscene gestures ➤ Sexual graffiti, pictures, or posters

➤ Stalking or cyberbullying

(discrimination and harassment complaints, including Title IX sex discrimination complaints) 720 University Place, Evanston Campus 847-491-7458; eeo@northwestern.edu www.northwestern.edu/hr/eeo

University Sexual Harassment Prevention Office (sexual harassment complaints) Joan Slavin, director and interim Title IX coordinator 633 Clark Street, Room 2-636, Evanston Campus 847-491-3745; sexual-harassment@northwestern.edu www.northwestern.edu/sexual-harassment

Division of Student Affairs (student-to-student discrimination, harassment, sexual harassment, and sexual violence complaints) Jim Neumeister, director of Office of Student Conduct and Conflict Resolution and deputy Title IX coordinator for sex discrimination, sexual harassment, and sexual violence complaints involving students 601 University Place, Suite 3, Evanston Campus 847-491-4582; neumeister@northwestern.edu www.northwestern.edu/student-conduct

CARE: Center for Awareness, Response, and Education (sexual violence) 633 Emerson Street, Evanston Campus 847-491-2054; care@u.northwestern.edu www.northwestern.edu/care

Department of Athletics and Recreation (Title IX athletics compliance issues) Janna Blais, associate athletic director and deputy Title IX coordinator for athletics compliance issues 1501 Central Street, Evanston Campus 847-491-7893; j-blais@northwestern.edu

➤ Email and Internet use that violates this policy ➤ Sexual assault

the Department of Education’s Office for Civil Rights regarding an alleged violation of Title IX by visiting www2.ed.gov/about/offices/list/ocr /complaintintro.html or calling 800-421-3481.

ADDITIONAL GUIDANCE Investigation and confidentiality All reports describing conduct that is inconsistent with these policies will be promptly and thoroughly investigated. Complaints about violations of these policies will be handled discreetly, with facts made available only to those who need to know to investigate and resolve the matter. Retaliation The University prohibits retaliation against anyone for registering a complaint pursuant to these policies, assisting another in making a complaint, or participating in an investigation under the policies. Anyone experiencing any conduct that he or she believes to be retaliatory should immediately report it to one of the individuals listed at right under “Where to Get Advice and Help.”

For more details and additional guidance on these policies, consult www.northwestern.edu/sexual-harassment or www.northwestern.edu/hr/eeo.

Discrimination and Harassment Prevention Advisors In addition to the people listed above, each school or unit of the University has advisors on the faculty or staff who have been trained to answer questions about the University’s discrimination and harassment policies and to receive complaints. To find an advisor, consult www.northwestern.edu/sexual-harassment/advisors.

Confidential Counselors If you wish to speak with someone who is legally privileged to keep communications confidential, you may contact a confidential counselor. Seeking advice from a confidential counselor does not constitute reporting an incident. To find a confidential counselor, consult www.northwestern.edu/sexual-harassment.

EthicsPoint EthicsPoint provides another means of reporting discrimination, harassment, and sexual harassment. Any complaints reported via EthicsPoint will be reviewed in acccordance with current University procedures. You may file a report by phone at 866-294-3545 or online at www.northwestern.edu/ethics.


10 NEWS | the daily northwestern

friday, october 19, 2012

Middle East, North African studies major coming to NU By Tal Axelrod

the daily northwestern

Northwestern will soon offer a new major in Middle East and North African studies to keep up with increasing interest in the region. The major will be offered to students starting Fall Quarter 2013 and will require a study abroad component in a Middle Eastern or North African country. The new major, along with majors in the Asian Studies Program, will replace the Middle East Languages and Civilizations major in the Asian and Middle East Studies Program, anthropology Prof. Jessica Winegar said. “There was a real concerted interest for its building Middle East and North African studies

Forum

From page 1 State Rep. Robyn Gabel (D-Evanston) said candidates must develop adequate solutions for the state’s economic problems. “This election is about leadership in times of crisis,” Gabel said. The candidates responded to questions on a range of topics, from local issues involving gun control to broader topics such as the U.S. Constitution. However, the main concerns that arose throughout the Thursday night debate concerned spending on pension plans, Medicaid and education. Republican candidates Kyle Frank and Glenn Farkas mentioned pension and Medicaid spending in nearly all of their arguments. “In the state, pension and Medicaid spending has taken priority, “ said Frank, who is running for the 17th district Illinois House seat against Democrat Laura Fine. “If we fix those, then we will improve education and reduce our problem taxes.” On the other hand, Democratic candidates focused on gun control, women’s rights and rights for the disabled. Democrats also brought up local concerns, such as how state funding cuts affected Evanston. Tisdahl used information provided by Biss

as a central area of academic inquiry these days,” Winegar said. “It was seen as an area of exciting scholarship.” These factors, combined with the region’s growing influence in international politics, led the University to create this interdisciplinary major, she said. Winegar said the University is implementing a 300-level seminar sequence specifically for juniors and seniors in the Middle East and North African studies program. She said enrollment in the seminar will be kept low in order to facilitate interaction among the students and with the professors. The University made an effort to acquire professors with expertise in this region of the world, according to Winegar. The major will have classes on medieval times, but the main

before the forum to talk about future plans for Evanston. She spoke about her support for Biss and why she believed he has been a strong leader. “He’s become an admired leader in terms of returning pensions,” Tisdahl said. “He’s a great representative in terms of getting to know people, knocking on their doors, listening to people and getting to know them.” The candidates talked less about the issues as the debate heated up toward the end. Republican candidates continued to ask if the Democratic incumbents would vote for Michael Madigan, speaker of the Illinois House of Representatives. Farkas, who is running against Biss for the 9th district state senate seat, said both Madigan and all Democratic incumbents need to be voted out. “They’re like a computer,” Farkas said. “When one thing doesn’t work, we need to push the reboot button and restart all over again.” Eric Lieberman, the Republican candidate for the 18th district House seat, responded by asking Gabel if Madigan had some kind of power that was preventing her to vote against the speaker. He later responded to Gabel’s statement regarding his lack of leadership positions in government. “ I haven’t held a position like you, but I wouldn’t perform it like you either,” Lieberman said. amandagilbert2015@u.northwestern.edu

There was a real concerted interest for its building Middle East and North African studies as a central area of academic inquiry these days. Jessica Winegar, anthropology professor

focus will be on Ottoman and post-Ottoman Middle East and North Africa. “We don’t have too many faculty that teach ancient history in the region, but we have faculty that focus on medieval to present times,” Winegar said. The new major will require 17 course units, including three in history, three in the social

Online

From page 1 methods-based classes, Shapiro said. “When there are right and wrong ways of doing things and there are sets of good practices, it’s very easy to do it in a high-quality way online,” he said. The School of Continuing Studies is also working with some NU undergraduate professors to experiment with hybrid online classes. For the past two summers, philosophy Prof. Sandy Goldberg has split the time for his Introduction to Philosophy class, devoting half to online work and half to in-classroom interactions. The course, proposed by the School of Continuing Studies, fostered online discussions on the course management system Blackboard outside of class so that in-class time could be devoted to targeted activities, Goldberg said. “Online courses are going to be a part of our future, there’s no doubt about that,” he said. “If that’s the case, the best thing to do is to figure out how we can use the resources that are online to help us teach better than we already do and more effectively than we already do.” The Department of Philosophy is offering the course in the same half-online format this year, Goldberg said. The School of Continuing Studies is also continuing to expand its online graduate programs this

sciences and three in the humanities. There are also six units of a language required beyond freshman year. McCormick freshman Athif Wulandana said he had not heard of the new major, but found it interesting. He said that as a Muslim student, he thought the major could provide more insight about the region and allow students to form their own opinions. “I think it’s really valuable just because of all the questions (about the region) that people are searching for answers for,” he said. “It’s a culture that’s very foreign to Americans. It’s a different culture that is important for Americans to understand. ... It definitely sounds pretty enticing.” talaxel@gmail.com

year, partnering with the Medill School of Journalism, Media, Integrated Marketing Communications to launch the school’s first fully online Integrated Marketing and Communications master’s program this fall. Tom Collinger, executive director of the Medill IMC Spiegel Digital & Database Research Center, said the advantage of the new program is students’ ability to largely work through course material at their own pace. Opponents to online education worry that these courses will not be as engaging and active as a traditional classroom environment. The new IMC graduate program works against that perception through group discussion threads and live phone conversations. “Every class is built in a way where there is student engagement prompted and required all the time on every topic, every week,” Collinger said. As the University continues to evaluate approaches to online education this year, Linzer said he expects to receive a range of new proposals from faculty. “This is probably the most significant change to a centuries-old model of delivering information to students and helping them learn new material,” Linzer said. “You’re right in the middle of a time period when universities are going to question their modes of education in fundamental ways.” laurencaruba2015@u.northwestern.edu


the daily northwestern | SPORTS 11

friday, october 19, 2012

Volleyball

NU looks for consistency in serving game vs. Iowa By ryan miller

the daily northwestern

Northwestern is back in Evanston this weekend for another Big Ten matchup, this time against Iowa. The Wildcats (13-7, 2-7 Big Ten) will return to Welsh-Ryan Arena for the first time in two weeks to take on the Hawkeyes (10-12, 2-7) on Sunday afternoon. NU will face an Iowa team that experienced a big conference win over then-No. 12 Purdue two weeks ago. Although the Hawkeyes have not won since, the victory is no doubt still fresh in their minds, as are the close losses to No. 10 Minnesota and No. 4 Nebraska. The Cats will have to slow down the Hawkeyes as both teams look for their third conference win. “Iowa’s playing some really good volleyball,” said coach Keylor Chan. “They’ve gotten some new players added to their program and they had a big win against Purdue, so I think we’re going to have be very good on Sunday to give ourselves a chance to come out with a successful outcome.” The Cats will try to shake off Wednesday night’s loss to Illinois in order to find their first home win in a month. Shaky serving from NU was a major problem during the five sets against the Fighting Illini – the team ended up with 14 service errors to Illinois’ five. Dropping these points, especially at crucial moments in the match, played a major role in the Cats’ loss. Despite this, Chan does not think the issue will carry over into the game against Iowa. “I don’t think it has really been a problem in the past,” Chan said. “We look at it as a onematch thing.” Because of this, the coach does not plan to focus on serving issues in the practices leading up to Sunday. “Sometimes by not addressing things, you recognize it’s just an outlier,” Chan said. “We just keep on moving through practice as we typically would and focus on things that we feel

have been problematic in the past.” Yet again, consistency proved to be a problem for the Cats on Wednesday, and it will certainly be an issue that needs to be addressed. After coming out with a strong first set, NU dropped the second set and lost the third 25-14. The Cats came back in the fourth set with a dominating start, only to let the lead narrow, eventually winning 25-17, before losing the final set by a 6-point margin. This kind of uneven pacing has held the Cats back from winning close conference games, and the team Sometimes by knows that to get the win not addressing against Iowa, they need things, you to recreate the intensity recognize it’s from their successful sets against Illinois. just an outlier. “Continuing to play Keylor Chan, consistent volleyball and sustaining it through the volleyball coach whole match (will be important),” junior outside hitter Stephanie Holthus said. NU knows how to put plays together, so it may come down to controlling the momentum. “We’ve played really good volleyball at times,” Chan said. “But we know we need to continue to be consistent in our approach and we need to be consistent from set to set.” Returning to their home court should help the Cats keep their composure and dictate late set points. If they can couple this with a return to their usual serving habits and continued attacking success, NU will have everything in place to take down a determined Hawkeyes squad. Sophomore outside hitter Hannah Crippenis confident the team will be able to do just that and pull out the win on Sunday. “We have all the components,” Crippen said. “We just need to execute.”

ryanmiller2015@u.northwestern.edu

Send your student a gift… in a Snap! STUDENTS CAN USE SNAPIT, ANYTIME, ANYWHERE

For more info: 440-840-4943 info@snapitapp.com www.snapitapp.com

Simple & Fast: Send money quickly from our easy-to-use site

Ease of Mind: Choose where your student spends money

Snap some money to your student so they can get: • A nice dinner • A new haircut • Campus gear to • A coffee for late show school spirit night studying

www.Snapitapp.com

Snapit


SPORTS

ON DECK Football 20 NU vs. Nebraska, 2:30 p.m. Saturday OCT.

ON THE RECORD

Being down 1-0, you’re anxious. With all the progress we’ve made, we believed we could come back. — Georgia Waddle, sophomore midfielder

Friday, October 19, 2012

@Wildcat_Extra

NU stuns Illinois with last-second magic By NICK MEDLINE

the daily northwestern

Northwestern was following the script: down 1-0 with less than 10 minutes to go, the Wildcats looked well on their way to an eighth consecutive loss – until they broke through in dramatic fashion. Sophomore midfielder Georgia Waddle scored in the 82nd minute and junior forward Kate Allen knocked home a penalty shot with four seconds remaining, as NU stunned Illinois 2-1 in Champaign to earn its first conference win of the season. The Cats had scored only once in the past 652 minutes of play, yet somehow staged a late rally to give Michael Moynihan his first Big Ten victory as head coach of NU. “It was fantastic,” Moynihan said. “Especially to get it against an in-state rival on the road. It’s a special moment for (the players).” “It’s a great feeling,” Allen added. “There are no other words.” The Cats (5-10-2, 1-8-0 Big Ten) had lost three of their past five matches by a 1-0 margin. Despite hanging tight in games, they allowed late goals that contributed to a poor overall record. When Illinois (7-7-2, 4-4-1)s truck early on a penalty shot from Vanessa DiBernardo in the 17th minute, the feeling must have been all too familiar. Still, Waddle said the team was due for a comeback. “Being down 1-0, you’re anxious,” she said. “With all the progress we’ve made, we believed we could come back.” Waddle entered the game one minute and five seconds prior to her goal. On her first touch of the night, she drove a shot

Northwestern

2

Illinois

1

past Illinois goalkeeper Steph Panozzo. Panozzo was out of position after leaving the net in an attempt to play the ball. When Waddle evened the score, the game appeared destined for extra play. With time winding down, NU earned a throw-in with about 20 seconds left. Waddle tossed a high-arcing ball into the box, and as it bounced around, Illinois was whistled for a handball. Allen stepped to the line with a chance to ice the game. Although she entered tied for ninth in NU scoring history, Allen had not scored since Sept. 21 against Penn State. “My heart was pounding,” she said. “It was one of the most nerve-wracking penalty kicks I’ve ever taken.” Like a true scorer, Allen blasted a shot past Panozzo, and the celebration began. The Cats entered the game under difficult circumstances, knowing they will not qualify for the postseason this year. Moynihan said they were battling for something more profound. “We came into this knowing we weren’t making the conference tournament,” he said. “We decided we were going to play for pride and to show some character.” After spending 19 seasons at Wisconsin-Milwaukee, Moynihan arrived in Evanston hoping to rebuild a program that won just two games in 2011. The progress has not been reflected on the scoreboard in conference play, until now. “It was one of those feelings where we

Women’s Soccer Daily file photo by Melody Song

LATE HEROICS Sophomore midfielder Georgia Waddle scores in the 82nd minute to draw NU even with Illinois. Waddle entered the game just one minute and five seconds before knocking home the critical goal.

had a monkey on our backs,” Moynihan said. “We didn’t have our first conference win. To finally get it is a huge relief.” The late outburst was especially impressive considering Illinois held a one-goal advantage. The Fighting Illini launched 31 shotsand tightened their back line. Until Waddle tied the game, the Cats had very few scoring chances. Despite several close losses, NU has stuck to its game plan of stout defense.

Men’s Soccer

Sophomore goalkeeper Anna Cassell made six saves for , which helped the team stay in contention. Moynihan said the entire team stayed focused and motivated while facing the deficit. “I thought, ‘Gosh, what do we need to do to catch a break?’” he said. “To the girls’ credit, they kept battling.” The significance of this win will extend past Wednesday. To Allen and Waddle, this marked a sign of a program finally

headed in the right direction. Moynihan said he hopes this win lays the foundation for more success. “(The players) feel like we’re moving forward,” he said. “They’ve been working really hard. My message to them was: We need to own that ... When the time is right, you’ll get the win. Now, I hope they get addicted to it.” nicholasmedline2015@u.northwestern.edu

Field Hockey

Wildcats turn to Penn State Carpenter, Wildcats

prepare for Spartans

By AVA WALLACE

daily senior staffer

It’s an exciting weekend to be a Northwestern sports fan. After the football team battles Nebraska on Saturday, No. 24 Northwestern will take the spotlight on Lakeside Field on Sunday to face off against Big Ten rival Penn State. The weekend match is also the Wildcats’ last home conference match for seniors. “It’s always a bit of an emotional day ... it seems like yesterday this group was just coming in,” coach Tim Lenahan said. “They’ve been a great group in terms of their success on the field, but they’ve also been a great group of guys – just great leaders and great teammates for four years. You have to keep your emotions in check after those introductions, you know, wipe your eyes a little bit and gather yourself. Because then you’ve got a big game to play.” Penn State (8-4-2, 2-1-1 Big Ten) currently stands third in the conference, just behind co-leaders No. 11 Indiana and NU (10-2-2, 3-0-0). In Big Ten play so far this season, Penn State has triumphed against Wisconsin and Michigan State. Penn State suffered a tough 1-0 loss to Indiana in double overtime and tied Michigan 1-1, also after two extra play periods. Three of Penn State’s four losses this season have come against teams currently ranked No. 11 or higher. Penn State and NU have similarities in strategy that should keep the Cats on their toes throughout Sunday’s match. “They use a lot of players in their attack, it’s not just one guy we have to shut down,” Lenahan said. “They like to keep fresh energy up there and switch things around a lot, and we just have to be cognizant of those subs.”

By ALEX PUTTERMAN

the daily northwestern

Daily file photo by Meghan White

LION’S SHARE Forward Joey Calistri has made an impact his first year on campus, leading NU’s nine goal scorers with six tallies on the season.

Both the Cats and the Nittany Lions have nine different goal scorers so far this season. Freshman forward Joey Calistri leads NU with 6 goals for the season, narrowly edging Penn State’s top goal scorer Julian Cardona, who has 5. Also similar to NU, Penn State has more luck finding the back of the net after halftime. The Nittany Lions have scored 7 of their 18 goals for the season before halftime,whereas the Cats have tallied 8 of their 22 total goals before the half. Penn State also brings a veteran team to Lakeside. About eight of the players in the Nittany Lions’ usual starting lineup are either juniors or seniors. Lenahan said his team will need to match the strong mentality of Penn State’s more experienced players “They have a lot of seniors who have been through the battles so certainly, we need to make sure we match the

intensity,” Lenahan said. “Hopefully the better team wins and on that day, hopefully we’re the better team.” NU is coming off of a dominant showing in a 1-0 victory against Loyola Chicago during which sophomore goalkeeper Tyler Miller was never forced to make a save. Miller and his defensive back line have been the Cats’ most consistent asset this season. The Penn State game falls on a jampacked weekend for the Cats. Sunday is the final day of NU’s Family Weekend and the match follows the team’s alumni game Friday. “We’ll have our parents here for parents weekend and Nebraska’s in town for a sold out Ryan Stadium – it’s an amazing weekend for Northwestern athletics,” Lenahan said. “We’re going to try to do our part.” avawallace2015@u.northwestern.edu

No team has ever won a field hockey game without scoring a goal, so the Wildcats have simply decided not to allow any. No. 9 Northwestern (14-2, 3-1 Big Ten) has now gone three straight games without giving up a goal, its first such streak since 1994, and it will be put on the line Friday against No. 20 Michigan St. (9-7, 2-2 Big Ten)at Lakeside Field. After a week during which goalie Maddy Carpenter and the Cats’ defense shut out both Indiana and Central Michigan, limiting their opponents to one and four shots on goal, in 4-0 and 8-0 victories, respectively, the sophomore was rewarded with Big Ten Defensive Player of the Week honors. Carpenter, who tops the Big Ten with a 1.01 goals-against average and ranks third with a .759 save percentage, attributed much of the personal success to the comfort, poise and confidence that come with experience. In other words, “I love not being a freshman anymore,” she said. Asked what’s been right with her team’s defense, coach Tracey Fuchs agreed with Carpenter’s self-assessment and expanded on what has fueled the team’s recent goalstopping successes. “Maddy being a year older,” Fuchs said. “She’s become one of the best goalkeepers in the Big Ten. … I think the defense is really coming into their own. We’ve had a couple of young players in there, and now they’re really developing.” Carpenter agreed that the defenders have stepped up. “If the ball doesn’t get to me, it can’t go in,” she said. “(Last weekend) I had loads and loads of help from my defense. They’ve

been making my job pretty easy.” NU will look to maintain momentum on both sides of the ball against the Spartans, who have won three of four amidst a six-game stretch of road match-ups. During the Cats’ current six-game winning streak, they have have outscored opponents 29-6, including 22-1 over their last three contests. Key to that success has been senior midfielder Chelsea Armstrong, the Big Ten leader in points and goals scored and a player for whom Fuchs said Michigan State “will have a plan.” Armstrong’s two first-half goals against Central Michigan brought her season total to 24 for a conference-leading average of 1.5 per game. According to the veteran, NU’s on-field chemistry has yielded results. “Obviously we’ve been clicking really well as a team,” Armstrong said. “We’re actually looking out between the lines really well, so between the backs and the midfield and then outletting the ball to the forwards, it’s been working much better than it has previous years.” As for Wednesday’s showdown with Michigan State, “it’s gonna be a battle,” Fuchs said. “It’s a really important game and a really important time in our season.” Only two games, one in conference, remain for NU after Friday. The Cats will host Missouri State on Sunday, their fifth consecutive home date, before closing the regular season Oct.28 in Iowa City against the Hawkeyes and beginning the Big Ten Tournament three days later. “They’re looking to just spoil our day,” Armstrong said of the upcoming Michigan State game. “We’re used to a chance to win the Big Ten championship, so I think they’re just out to try and ruin that for us.” alexputterman2016@u.northwestern.edu


The Daily Northwestern - Oct. 19, 2012