Page 1

Taste

Wednesday Sept. 18,

2013

50 cents

Home & Garden

Healthy potato soup packs porky flavor.

Pumpkins, gourds make attractive fall displays.

Page 1B

Page 14A

Daily Corinthian

Thunderstorm Today

Tonight

87

67

20% chance of thunderstorms

Vol. 117, No. 223

• Corinth, Mississippi • 22 pages • 2 sections

‘Stand Your Ground Freedom Rally’ set BY STEVE BEAVERS sbeavers@dailycorinthian.com

The Alcorn County Patriots are going out with a bang. The group will be holding another “HB2 Victory Rally’” with its “Stand Your Ground Freedom Rally” at Crossroads Regional Park on Saturday.

Saturday’s event will mark the final rally of this sort, according to members of the local organization. “It took a while, but what we tried to do has been done,” said event organizer Bobby McDaniel of the passing of the state’s open carry gun law.

An array of speakers are part of Saturday’s 10 a.m. to 2:30 p.m. agenda. Local state representatives Nick Bain, Lester “Bubba” Carpenter and Tracy Arnold are scheduled to speak during the day. John Moran, president of the Mississippi Oath Keepers, will

More info released on local’s drowning Staff Report

CAPE SAN BLAS, Fla. — More details have been released on the drowning of a Corinth man Monday morning. According to authorities, Tom Timms, 45, of Corinth, was unresponsive when pulled from the water. Timms, a paramedic with Magnolia Regional Health Center Emergency Management Services and Air Evac Life Team, was vacationing with his wife, Rebecca, when he started yelling for help after going swimming in the gulf. Gulf County Sheriff’s Office deputies, who responded to a distress call in the area of Seahorse Land, described the surf conditions as very rough. Timms was just 100 feet out past the surf line when he began yelling for help. Witness Charles Seguy, a

dive master, told deputies he heard screams and saw the victim waving his arms in distress. Seguy went into the water and found Timms unresponsive after reaching him. The dive master attempted water rescue CPR on the Corinth man, but conditions were too rough for it to be performed. After pulling the 45-yearold to shore, Seguy began CPR before Timms was pronounced dead at the scene. Timms and his wife were staying in a beachside condo in Cape San Blas, a remote area of Florida about 50 miles south of Panama City. Arrangements for Timms, who is survived by his wife and a son, Eric, are incomplete with Memorial Funeral Home. The Star newspaper in Port St. Joe, Fla., contributed to this story.

Booneville man charged after high-speed chase BY BRANT SAPPINGTON bsappington@dailycorinthian.com

A Booneville man led law enforcement on a chase reaching speeds in excess of 100 mph Monday before being stopped and arrested in Itawamba County. Elvin Darren Farrar, 20, of 552 County Road 5011, Booneville has been charged with felony fleeing, along with numerous misdemeanor traffic offenses, and remains in the

Prentiss County Jail on a $5,000 bond. Farrar was driving a motorcycle when he fled from Prentiss County Farrar Deputy Please see CHASE | 3A

be on hand for the mass reaffirmation of the oath to the Constitution. The Oath Keepers is a nonpartisan association of current and formerly serving military, police, and first responders who pledge to fulfill the oath all military and police take to defend

the Constitution against all enemies, foreign and domestic. Oath Keepers reaches out to both current serving and veterans to remind them of their oaths, to teach them more about the Constitution they Please see RALLY | 3A

‘Biloxi Blues’

Staff photo by Steve Beavers

Eugene Morris Jerome, played by Cody Daniel, is constantly challenged during the many events of the play to engage in life rather than watching and writing about it in the Crossroads TheatreArts production of “Biloxi Blues.”

CT-A sharing Neil Simon’s play BY STEVE BEAVERS sbeavers@dailycorinthian.com

Six U.S. Army recruits make it through more than just basic training in Neil Simon’s “Biloxi Blues.” The Crossroads Theatre-Arts will be sharing Simon’s semiautobiographical play, starting Thursday at the Crossroads Playhouse. Show time is 8 p.m. with performances scheduled through Saturday. A Sunday matinée is slated for 2 p.m. “It’s a comedy which also serves to make a point,” said director Cynthia Potter. The play centers around

20-year-old Eugene Morris Jerome, played by Cody Daniel, who is drafted into the Army during World War II. The Brooklyn native is sent to Biloxi for basic training along with five other young men. “Biloxi Blues” is a tale of these young men as recruits in 1943,” said Potter. “The story covers the indignities they suffer and the growing up they do.” Eugene, based on Simon, learns to cope with fellow recruits from different walks of life. “He experiences his ‘coming of age’ as he survives boot camp

in the swamps of Biloxi,” said CT-A artistic director Cris Skinner. “Eugene learns from the conflict with another Jewish recruit and is constantly challenged during the many events of the play to engage in life rather than watching and writing about it.” Tickets are $12 for adults and $6 for students. Tickets can be reserved by calling the CT-A at 662-287-2995. Individuals can also purchase tickets at the theatre between 1-6 p.m. Tuesday-Friday or at the door prior Please see BLUES | 6A

Tourism tax continues to set Corinth collection records BY JEBB JOHNSTON jjohnston@dailycorinthian.com

Corinth sales tax collections ended fiscal 2013 with a couple of good months while the tourism tax continues on a recordsetting pace. The deposits made this week will be the last of the fiscal year for both taxes. After four consecutive months of negative growth, sales tax proceeds

rose for each of the last three months. The current deposit, $450,176.25, is up 4.5 percent, or almost $20,000, from the year-ago level, giving the tax a total for fiscal 2013 of $5,536,961.34, up 1 percent from the prior fiscal year. Sales tax has struggled to gain momentum in recent years. Fiscal 2012 ended with an increase of 2.6 percent; fiscal 2011 ended

with an increase of a quarter of 1 percent; and fiscal 2010 had negative growth of almost 3 percent. The city budget for fiscal 2014 anticipates the generally flat trend will continue. Collections across the state rose 6 percent during the latest month, and that trend was reflected in the region, with eight of 11 area municipalities post-

Index Stocks......8A Classified......5B Comics......9A State......5A

Weather....10A Obituaries......6A Opinion......4A Sports....12A

ing gains. The month’s results reflect sales activity that occurred in local businesses during the month of July. The 2 percent tourism tax on prepared food and lodging had a modest 1 percent gain for the month with a total of $94,003.72. It is the 11th consecutive monthly increase for the tax, which ends the fiscal year with another record high

of $1.109 million, up almost 5 percent from the prior year. The tourism tax has generated more than $1 million for each of the last three years. With the continued increase, the tourism office will see an increase in its monthly allotment of tourism funds from $42,000 to $45,000 in the new fiscal Please see TAXES | 3A

On this day in history 150 years ago The Battle of Chickamauga. For the first time, the Confederate Army of Tennessee outnumbers the Union 68,000 to 58,000. Southern attempts to position its army between the enemy and Chattanooga are not successful.

Now Renting 2013 Nissans!

Call for complete details and rates!

286.6006

BROSE

HWY 72 E • Corinth MS www.broseautoplex.com


2A • Wednesday, September 18, 2013 • Daily Corinthian

CASABELLA FURNITURE DON’T MISS IT!

THURSDAY!

CASABELLA FURNITURE’S

END OF SUMMER •

DOORS OPEN:

AM ’TIL

10 8 PM!

SUPER SALE

STORE CLOSING EARLY WEDNESDAY TO PREPARE!

SPECIAL CREDIT OFFER! Select $500 Worth, $ 1,000 Worth, Even $ 5,000 Worth With:

2013! 201 20 13!

(w.a.c. and monthly payment) BANK CARDS ARE WELCOME!

Lots of detailed show wood, just 87” in length. (also available w/accent chair)

Colorful, Red Leather Sofa and loveseat, lounger footrest and power recliners.

$577 $979

each piece

Plus Much, Much More!

“SUPER SALE” SAVINGS ON ALL...

DINING ROOM FURNITURE! 9 Piece Dinette Plain country look, 8 straight back chairs and 44”x100” table w/2 leafs.

5 Piece Pub Table Set

with 4 black vinyl bar stools and 1 brown brick marble lotus top that won’t show those circles when you leave your cups or glasses on it over night.

$1349 $469

Plus Much, Much More!

LA-Z-BOY RECLINERS DINETTE SETS IN ALL SIZES! with lever action footrest.

Medium Brown Leather Recliner medium in size, plush comfort level.

$399 $479

Plus Much, Much More!

“SUPER SAVINGS ON ALL... “SUPERSALE” SALE” SAVINGS ON ALL... LANE RECLINERS CHAIRS! ROCKERS! RECLINERS! Lane Leather Recliner NOW

$389 $649

marked 50% off (limited quantities).

BEDROOM FURNITURE! BIG! Bunk Beds 2 finishes, full size over full size, lots of room, sleeps 4 people comfortably (mattresses not incl.).

$199

NOTHING’S

MATTRESS SETS IN ALL SIZES! Queen Size Mattress

$748

With $399 purchase within 50 miles.

Plus Much, Much More!

TV Stands

King Size Cool Gel

IT’S AN INCREDIBLE SELECTION AT TOTAL “SUPER SALE” PRICES! HURRY AND SAVE!

with dark or light finish, wood products.

mattress set, soft comfort level, marked 50% off.

SPECIAL OFFER!

Large Sectional

NEW AND EXCITING!

9 Piece Formal Dining

with dark walnut cover with 2 power recliners and 1 sofa sleeper (1 left).

table, 2 captain’s chairs, 6 straight chairs and table with 1 leaf (matching china available).

$1999

$2299

$299

NOW ONLY

$1549

Lazboy Jamison Tempurpedic Flexsteel Lea

AND MANY MORE!!

Plus Much, Much More! SENSATIONAL!

Cloth, 3 Colors to choose from.

Lane Cloth Corner Sectional

STARING AT

$998

with accent pillows

WILL BE SPARED! SPECIAL CREDIT OFFER!

$399

BARGAIN!

The “Big Man’s Recliner”

“SUPER SALE” SAVINGS ON ON ALL... ALL... SALE” SAVINGS SECTIONALS OCCASIONAL TABLE SETS!

Plus Much, Much More!

• Coast to Coast • Plus Much, Much More! • Cheers • “SUPER SALE” SAVINGS ON ALL... BUY TODAY! • BOOKCASES! WALL UNITS! • Bassett GET TODAY! DESKS! LAMPS AND ACCESSORIES! • Ashley • FREE DELIVERY • Lane •

with the pocket coil core. Mattress & Box spring

IT’S THURSDAY!

ANYTHING...EVERYTHING EVERYTHING’S ON SALE, SELECT IN FURNITURE AND BUY WITH: INCLUDING ALL THEIR • UP TO 36 FAMOUS NAME BRANDS! MONTHS SAME

“SUPER SALE” SAVINGS ON... mattress by Jamison. The Marriot Collection. Marked 50% off.

NO ITEM

HELD BACK!

$999

Plus Much, Much More!

Queen Size All Foam

“SUPER SALE” SAVINGS ON... Small Cloth Recliner

“SUPER SALE” SAVINGS ON ALL... Full/Queen Size Cherry Sleigh Bed

BIG

IT’S THEIR END-OF-SUMMER SUPER SALE FOR 2013!

LIVING ROOM FURNITURE! Beautiful, Formal, Cloth Sofa

©COPYRIGHT 2013, COSEC® INTERNATIONAL, INC.

MAKE PLANS NOW TO JOIN THE CROWDS! Yes! It’s designed and intended to be HERE’S the most magnificent savings event in this store’s great 25-year history, with important sale clearly tagged on SAVINGS NEWS! pricesevery item in their Thursday, You’ll Discover More . . . A Lot More . . . In Terms Of Price, Selection And current inventory! Total Storewide Savings On Some Of America’s Hurry For Best Most Wanted Furniture, Bedding & Accessories! Selection And Save!

• UP TO 36 MONTHS SAME AS CASH! “SUPER SALE” SAVINGS ON ALL...

EVERY ITEM IN EVERY DEPARTMENT WILL BE CLEARLY TAGGED AT REMARKABLE SALE SAVINGS FOR YOUR QUICK-ANDEASY SELECTION!

Some items are one-of-a-kind or limited in quantity...Every item is clearly tagged for your quick and easy selection!

10 SPECIAL HOURS OF ASTONISHING SAVINGS ON EVERY ITEM IN THE STORE...10 SPECIAL HOURS OF NEW AND EXCITING HOME FURNISHINGS AT INCREDIBLE VALUES!

EXTRA Office Staff... EXTRA Delivery Personnel...EXTRA Salespeople...All will be on hand to assist you.

AS CASH!

(w.a.c. and monthly payment)

(EVEN AT “SUPER SALE”MARKDOWNS!) That entire houseful of new home furnishings you need can be yours! Buy 3,4,5 or more roomfuls of fine, new furniture and save hundreds of dollars if you can buy now! OUTSTANDING!

YOU’LL LOVE THIS!

All beds and nightstands for master bedroom are marked down. The LOWEST sale price this year!

Some Closeout mattresses still left in stock. Marked 50% off.

10:00 AM UNTIL 8:00 PM!

IT’S THURSDAY!...

IMPORTANT VALUE!

Sorry, No One Will Be Admitted Before The Official 10 AM Opening, Thursday!

Side Table

King North Shore Bed

$999 WITH THE PURCHASE OF OTHER PIECES

Narrow rectangle table for those tight areas. STARTING AT

$119 MAGNIFICENT!

Black Dresser/Mr. and twin or full size headboard, footboard & rails ONLY

$699

2401 S. HARPER RD • CORINTH, MS 38834

662-286-3127

www.casabellafurniture.net

IT’S A MAXIMUM STOREWIDE EFFORT OF SAVINGS, SELECTION & MUCH, MUCH MORE!


3A • Daily Corinthian

Local/Region

Wednesday, September 18, 2013

Today in history Today is Wednesday, Sept. 18, the 261st day of 2013. There are 104 days left in the year.

Today’s Highlight in History: On Sept. 18, 1862, President Abraham Lincoln signed a commission naming Rabbi Jacob Frankel of Rodeph Shalom Congregation in Philadelphia the first Jewish chaplain of the U.S. Army.

On this date: In 1759, the French formally surrendered Quebec to the British. In 1793, President George Washington laid the cornerstone of the U.S. Capitol. In 1810, Chile made its initial declaration of independence from Spain with the formation of a national junta. In 1850, Congress passed the Fugitive Slave Act, which created a force of federal commissioners charged with returning escaped slaves to their owners. In 1927, the Columbia Phonograph Broadcasting System (later CBS) made its on-air debut with a basic network of 16 radio stations. In 1931, an explosion in the Chinese city of Mukden damaged a section of Japanese-owned railway track; Japan, blaming Chinese nationalists, invaded Manchuria the next day. In 1947, the National Security Act, which created a National Military Establishment, went into effect. In 1961, United Nations Secretary-General Dag Hammarskjold was killed in a plane crash in northern Rhodesia. In 1970, rock star Jimi Hendrix died in London at age 27. In 1975, newspaper heiress Patricia Hearst was captured by the FBI in San Francisco, 19 months after being kidnapped by the Symbionese Liberation Army. In 1990, the city of Atlanta was named the site of the 1996 Summer Olympics. The organized crime drama “GoodFellas,” directed by Martin Scorsese, had its U.S. premiere in New York.

Ten years ago: Hurricane Isabel plowed into North Carolina’s Outer Banks with 100 mph winds and pushed its way up the Eastern Seaboard; the storm was later blamed for 30 deaths.

Five years ago: President George W. Bush told the country his administration was working feverishly to calm turmoil in the financial markets. The president met with Treasury Secretary Henry Paulson and Federal Reserve Chairman Ben Bernanke, who then asked Congress to give the government power to rescue banks by buying up their bad assets. Stocks on Wall Street shot up more than 400 points on word a plan was in the works.

Man loses appeal in child abuse case Associated Press

JACKSON — The state Court of Appeals has upheld the conviction of a Rankin County man on charges of abusing a 9-month-old girl who was taken to a hospital in 2009 with collapsed lungs, broken arms and burns to both hands. Charles Dennis Harris was sentenced to 30 years, with eight years suspended, in 2012.

TAXES CONTINUED FROM 1A

year beginning Oct. 1. Other sales tax results from the region for the current round of diversions from the Mississippi Department of Revenue (percentages rounded): • Booneville - $142,615.40 (+1%) • Burnsville - $11,147 (+1%) • Farmington - $4,008.62 (-4%) • Glen - $1,762.28 (+2%) • Iuka - $67,930.43 (-7%) • Kossuth - $3,395.40 (+2%) • Ripley - $96,549.60 (-4%) • Tupelo - $1,435,565.15 (+1%) • Walnut - $16,284.67 (+4%)

CHASE CONTINUED FROM 1A

Torie Jumper after she attempted to make a traffic stop on him on Mississippi Highway 371 near Marietta in southern Prentiss County, said Prentiss County Sheriff Randy Tolar. The suspect led Jumper on a chase down Highway 371 through Marietta, Kirkville, Houston, Ozark and Mantachie. He was stopped at Highway 371 and Fawn Grove Road in Mantachie where Itawamba County Sheriff

(Choice of Meat and Unlimited Sides)

602 South Cass Street • Corinth, MS 38834 (Beside Goody’s) 662-287-2323

RALLY CONTINUED FROM 1A

swore to defend, and to inspire them to defend it. See below for details on how we do that. McDaniel said the reason behind the rally is to thank those who supported Mississippi House Bill 2. In July, the Alcorn County Patriots sponsored the Second Amendment Firearm Freedom Day on the courthouse grounds with around 300 attending. The Mississippi Supreme Court unanimously upheld the state’s open carry gun law on Aug. 29. The law, now in effect, had been on hold after Hinds County Circuit Judge Winston Kidd issued an injunction blocking the gun law from taking effect for close to two months. “Immediately, after the Supreme Court upheld the gun law, people from all over the state were calling for us to have another celebration rally,” said McDaniel. Judge Henry Ross, a retired Navy Commander, is set to serve as mas-

(Singing starts at 6:30)

“Revive Us Again” Speaker: B.J. Clarke

FALL Savings

Song leader: Chris Whitaker

Corinth Coliseum

The Alcorn County Fair & the Crossroads Arena Cohost Kids and Family Day September 21, 2013 Tickets on sale Duck Dynasty tickets include Fair attendance on Saturday 9/21/13 only. For further information, call (662) 287-7779

ter of ceremony during the event. Corinth Mayor Tommy Irwin will the day’s first speaker at 11 a.m. Music gets the doing going at 10 a.m. There will be a party jumper for children along with several vendors and giveaways throughout the event. The Patriots group received a message from Speaker of the House Philip Gunn on Tuesday. “This was a great victory for Mississippi,” said Gunn. “I would like Mississippians to recognize once again the Mississippi House of Representatives has stood strong in protecting Second Amendment rights.” Gunn also thanked the group for organizing rallies to support the gun law. “Your support, participation and determination have kept this bill on the forefront of issues that are important to Mississippians,” he said. “We are protecting your rights to keep and bear arms.” Mississippi House Bill 2 was sponsored by Rep. Andy Gipson of Brandon.

September 22nd-24th at 7 PM

Comes to Corinth!

Cooked Like You Remember

Pinto Beans White Beans Turnip Greens Roasted Potatoes Cabbage Roasted Veggie Medley

Chris Dickinson blocked the intersection. Law enforcement radio traffic during the pursuit indicated the suspect was traveling as much as 120 mph as he fled from officers. Tolar said he appreciates the assistance of Dickinson and his department in capturing the suspect.

Wednesday’s Alcorn County Fair free admission lineup includes: ■ Crescent City Carnival, 5-10 p.m. ■ Canned goods display, 5-9 p.m. ■ Arts & Quilts display, 5-9 p.m. ■ Magnolia Car Show, 5-9 p.m. ■ Petting Zoo, 5-9 p.m. ■ Revolve, 6-8 p.m. ■ Vendor booths, 5-9 p.m.

DUCK DYNASTY

Classic Iron Skillet Cooking Fried Potatoes Skillet Corn Green Beans Purple Hull Peas Butter Beans Fried Okra Fried Squash

Authorities were called to Crossgates River Oaks Hospital on March 24, 2009, to investigate a possible abuse case after the girl’s mother sought help. The Appeal Court said in Tuesday’s ruling that medical experts testified that the injuries were consistent with abuse and the investigation determined that Harris was caring for the girl at the time.

Fair lineup

404 Taylor Street Corinth, MS 38834

All are invited to attend Sponsored by: AREA CHURCHES OF CHRIST

at

Charlie McDaniel’s Corinth Carpets, LLC 1805 Shiloh Rd. • Corinth, MS 662-286-5793 • 662-287-2378

Stop in for Low Prices on 1 Quality Floor Covering & Installation st

Ceramic Tile • Hardwood • Laminate • Carpet Vinyl • Wallpaper • Carpet & Upholstery Cleaning Fire & Water Restoration

1749 Virginia Lane • Corinth, MS 662.286.0133 www.corinthjewelers.com

P.O. Box 1800 Corinth, MS 38835

Home Delivery 1 year - - - - - - - $139.85 6 months - - - - - - $73.85 3 months - - - - - - $38.85

Mail Rates 1 year - - - - - - - -$198.90 6 months - - - - - - $101.60 3 months - - - - - - $53.45

To start your home delivered subscription: Call 287-6111 8 a.m. to 5 p.m. Monday-Friday. For your convenience try our office pay plans.

Miss your paper? To report a problem or delivery change call the circulation department at 287-6111. Late, wet or missing newspaper complaints should be made before 10 a.m. to ensure redelivery to immediate Corinth area. All other areas will be delivered the next day.

USPS 142-560 The Daily Corinthian is published daily Tuesday through Sunday by PMG, LLC. at 1607 South Harper Road, Corinth, Miss. Periodicals postage paid at Corinth, MS 38834

Postmaster: Send address changes to: P.O. Box 1800, Corinth, MS 38835


www.dailycorinthian.com

Reece Terry, publisher

Opinion

Mark Boehler, 4A • Wednesday, September 18, 2013 editor Corinth, Miss.

Barbour could still shape state policies JACKSON — Once a governor, always a governor in Mississippi. The title never fades, even when the time in office expires. However, with his recent re-entry into public policy disEmily cussions about energy, Haley Wagster Barbour appears to be wearing Pettus “Gov.” as more than an honorary title. Capitol Dome Call him Shadow Gov. Barbour — a person who still pushes ideas that, for better or worse, might shape Mississippi’s economic future. When Actual Gov. Phil Bryant was in Brazil on an economic development trip this past week, fellow Republican Barbour earned headlines with a speech defending rate increases for a new power plant and advocating the possibilities of nuclear waste reprocessing — two projects that aren’t far from the wallets of Barbour and his current professional colleagues. Barbour said Mississippi should explore options for storing or reprocessing spent nuclear fuel, a topic promoted in recent weeks by Mississippi Energy Institute, a group that Barbour started in 2009. He said if a state has the right kind of geology, it could lure “gigantic investment” and high-tech jobs that offer residents big paychecks. “This is going to be an enormous economic Godsend for somebody,” Barbour told more than 250 people at a Madison County Business League luncheon. The chairman of Mississippi Energy Institute is Barry Cannada, an attorney at the Butler Snow law firm in Ridgeland where Barbour has worked in government relations and business development since finishing his second term as governor in January 2012. The MEI president is Patrick Sullivan, who worked on Barbour’s gubernatorial staff as an energy policy adviser. Jason Dean, a former Barbour education adviser who now works for a unit of Butler Snow, spoke to a state Senate committee in late August to advocate that Mississippi explore nuclear reprocessing. After the speech, The Associated Press asked Barbour whether he could benefit financially from energy projects he discussed. “I don’t get paid anything by Butler Snow,” Barbour replied. “And as far as I know but you’ll have to ask, I don’t think Butler Snow gets paid anything by Mississippi Energy Institute.” AP: Do you work for Butler Snow for free? “I’m of counsel to Butler Snow, so I don’t do their clients, really. I mean, they pay me but it’s not for doing legal work,” Barbour said. During the speech, Barbour said it’s normal for utility rates to increase anytime a new power generating plant opens. Mississippi Power Co. rates are anticipated to increase 22 percent because of a coal-fired plant being built in Kemper County; the state Public Service Commission has already approved most of the increase. Because of a law Barbour signed as governor, the company was able to start seeking rate increases while the project is under construction. Barbour acknowledged that Mississippi Power Co.’s corporate parent, Southern Co., has been a client since 1981 of BGR, the Washington lobbying firm he co-founded decades ago as Barbour Griffith & Rogers. He noted that he was not working for BGR while he was governor; his assets were in a blind trust. Barbour aimed most of his energy speech at a wide audience, but he fell back into the gubernatorial habit of dispensing advice to policymakers. “I will say to y’all involved with the schools: We’ve got to quit stigmatizing skills training,” Barbour said, noting that not everyone needs a college degree to earn a solid income. He also said the U.S. “desperately needs to begin investing again in transportation infrastructure in many modes,” including highways, bridges and ports: “And all of this, I will say to my friends in the Legislature, is going to require major expenditures by the federal government and by the state government and by the private sector.”

Prayer for today Father, Help me to rebuke the devil’s temptations with Scripture just as Jesus did during the wilderness temptations. I may be weak, but Your Word is powerful to fight off the temptation to sin and to reassure me that You are with me even when others may forsake me. Amen.

A verse to share “The LORD hath appeared of old unto me, saying, Yea, I have loved thee with an everlasting love: therefore with loving kindness have I drawn thee.” — Jeremiah 31:3

The Syria seduction in evading military action Expecting Syria to live up to an agreement between Secretary of State John Kerry and Russian Foreign Minister Sergei Lavrov for the cataloging, inspection, removal and eventual destruction or sequester of chemical weapons is a subtle seduction. Why would a dictator like Bashar al-Assad relinquish his most potent weapon in the midst of a civil war? President Obama and his sycophants claim it was the threat of military action against Syria that focused Assad’s mind. That hardly seems credible after Kerry’s promise that any U.S. missile strike would be “unbelievably small.” Tyrants have a poor record of living up to agreements. One hates to resurrect Adolf Hitler, but the Munich Agreement of 1938 serves as one of many examples. The agreement gave Nazi Germany the Sudetenland region of Czechoslovakia, as long as Hitler agreed not to attempt to annex any other land. Hitler broke the pact in 1939 when he invaded Poland. Also in 1939, Germany and the Soviet Union signed a nonaggression treaty known as

the Molotov-Ribbentrop Pact, ensuring that the Soviet Union would stay Cal out of the Thomas E u r o p e a n war. That Columnist lasted until 1941 when Hitler invaded Russia. At the Yalta Conference in February 1945, Soviet General Secretary Joseph Stalin promised free elections in Poland, but soon broke that promise, leading to the Cold War. People whose only scruples are keeping themselves in power are not about to honor agreements that could take that power away. Assad has been called a “war criminal.” He fits the definition, having reportedly slaughtered more than 100,000 Syrians, allegedly including more than 1,400 with chemical weapons. Millions more have fled the country. Assad has no future outside Syria, other than exile, a jail cell or the gallows. It is conceivable Assad might move some of his chemical weapons to hiding

places in other countries, or within Syria. Could the United States through satellite technology and other means discover such subterfuge, as it did when Soviet missiles were detected entering Cuba 50 years ago? Perhaps, but remember that Iraq’s Saddam Hussein used chemical weapons against his Kurdish population. After the first Gulf War in 1991, when Iraqi forces were evicted from Kuwait, Saddam put on a public display in which at least some of his chemical weapons arsenal was destroyed. In 2003, when President George W. Bush ordered an invasion of Iraq on the pretext that Saddam had weapons of mass destruction and was attempting to acquire more, none were found. Do we really believe Hussein destroyed them all? According to a report in the Lebanese daily Al-Mustaqbal, reprinted in Sunday’s Jerusalem Post, Syria moved “20 trucks worth of equipment and material used for the manufacturing of chemical weapons into neighboring Iraq.” If true, that would have been the day after the agree-

ment between the U.S. and Russia was announced. The Iraqi government denies it is assisting Syria in hiding chemical weapons. Who can be believed in the murky Middle East? “Trust, but verify” was the slogan used by the Reagan administration when it came to promises made by the Soviet Union. That mantra should be updated in any dealings with Assad, as well as Iran: “Don’t trust and verify.” The Obama administration is attempting to sell this deal with Russia as if it were on a par with the surrender documents ending World War II. As evil as those regimes were, the cruel dictators in the Middle East are at least their equals. That is why they can’t be trusted to live up to any promise not in their own interest. Unless, of course, they are forced to do so through more international pressure than they are currently receiving and with a credible military option that is something larger than “unbelievably small.” (Readers may e-mail Daily Corinthian columnist Cal Thomas at tcaeditors@ tribune.com.)

Here comes Miss Kansas — tattoos and all Colorado floods of socalled biblical proportions, fire on the Boardwalk, a Miss America contestant with visible tattoos? It really might be the End Times. While I’ve always been mystified about why anyone -- male or female -- would want tattoos, I’ll admit the idea of an Army sergeant Miss Kansas who boxes, bow hunts, speaks Chinese, sings opera and has the Serenity Prayer inked on her torso tickles me. Sounds like a Sandra Bullock movie. It’s hard to objectify an expert marksman wielding a bow and arrow. It will enrage all the right Miss America purists. Bold beauty Theresa Vail blogged about her tattoos last month, “because I do not want to shock the nation when I’m seen in a swimsuit, bearing my marks.” First we must get beyond the self-importance of that statement. This is, after all, a nation that has seen great wars, a Great Depression, the Dust Bowl, several

Reece Terry

Mark Boehler

publisher rterry@dailycorinthian.com

editor editor@dailycorinthian.com

Willie Walker

Roger Delgado

circulation manager circdirector@dailycorinthian.com

press foreman

killer epidemics and Madonna. It probably could have withstood the shock of seeRheta ing a blonde Johnson in a bikini Columnist with her tattoos showing. Most of us, after all, have been to the beach. But now I’m nitpicking. I know what she means. Miss America pageants in the past have been about covering up things -- dark roots, body flaws, lack of talent, Penthouse photographs. And then came this Joan of Arc, fearless in life and pageant, baring and bearing, strutting her stuff and enough ink to print the next issue of The Daily Beast. Take that, Anita Bryant. Someone clever wrote that feminists have gone into the closet vacated by gays. I think truer words were never penned. It’s as tough to find an admitted

feminist these days as it is an eight-track tape player. We are out here, all right, but embarrassed a bit by what a mess of a mutant time has made of the movement. While aspiring to the vote, equal pay and professional access and the end of the perpetual beauty myth, who could have imagined feminists in 2013 would have to be satisfied with a tattooed Miss Kansas? I am, however, a realist. The Bible says the poor will always be with us, and so, I suspect, will beauty pageants. So long as little girls dream of wearing that crown and speaking to a television audience about making the world a better place, Miss America will get more ink than she wears. And, I take my hat off to Theresa Vail for her military service and managing to come up with another first for the tired old, gimmickridden pageant. There was the first Jewish Miss America (Bess Myerson), the first African-American victor

World Wide Web: www.dailycorinthian.com To Sound Off: E-mail: email: news@dailycorinthian.com Circulation 287-6111 Classified Adv. 287-6147

(Vanessa Williams), the first deaf winner (Heather Whitestone), and the 2014 Miss America (Nina Davuluri), the first of Indian descent. We could have had as Miss America the first soldier, an outdoors girl with visible tattoos. The bar, once again, has been raised. I used to think beauty pageants were anachronistic in a world of Sally Ride, Madeleine Albright, Maya Angelou and Kathryn Bigelow. Now I see that’s not necessarily so. Accomplishment and beauty riding tandem is a killer combination, in this modern age as much as any. And, if a contestant can succinctly explain her philosophy during the swimsuit competition without opening her mouth, she deserves to win. (Daily Corinthian columnist Rheta Grimsley Johnson is a Tishomingo resident. To find out more about her and her books, visit www.rhetagrimsleyjohnsonbooks.com.)

How to reach us -- extensions:

Newsroom.....................317 Circulation....................301 news@dailycorinthian.com advertising@dailycorinthian. Advertising...................339 Classifieds....................302 com Classad@dailycorinthian.com Bookkeeping.................333

Editorials represent the voice of the Daily Corinthian. Editorial columns, letters to the editor and other articles that appear on this page represent the opinions of the writers and the Daily Corinthian may or may not agree.


5A • Daily Corinthian

State/Nation

Wednesday, September 18, 2013

Nation Briefs Associated Press

Gunman told police he heard voices WASHINGTON — A month before he went on the rampage that left 13 dead, Washington Navy Yard gunman Aaron Alexis complained to police in Rhode Island that people were talking to him through the walls and ceilings of his hotel rooms and sending microwave vibrations into his body to deprive him of sleep. The account, contained in an Aug. 7 report from Newport, R.I., police, adds to the picture that has emerged of an agitated and erratic figure whose behavior and mental state had repeatedly come to authorities’ attention but didn’t seem to affect his security clearance to do defense work. Alexis, a 34-year-old information technology employee at a defenserelated computer company, used a valid pass Monday to get into the Navy Yard and killed 12 people before he was slain by police in a shootout that lasted more than a half-hour. A day after the assault, the motive was still a mystery. U.S. law enforcement officials told The Associated Press that investigators had found no manifesto or other writings suggesting a political or religious motivation. Alexis, a former Navy reservist, had been undergoing mental health treatment from Veterans Affairs since August but was not stripped of his security clearance, according to the law enforcement officials, who spoke on condition of anonymity because the

criminal investigation was still going on.

Navy gunman likely slipped through WASHINGTON — The gunman in the mass shootings at the Washington Navy Yard, Aaron Alexis, had a history of violent outbursts, was at least twice accused of firing guns in anger and was in the early stages of treatment for serious mental problems, according to court records and U.S. law enforcement officials. But Alexis apparently managed to exploit seams in the nation’s patchwork of complicated gun laws designed to keep weapons out of the hands of dangerous people. He was able to buy a shotgun in Virginia with out-of-state identification, even though that would have prevented him from buying a handgun. It is illegal for gun dealers to sell handguns to such out-ofstate buyers, but the Firearms Owners’ Protection Act, passed by Congress in 1986, opened up interstate sales for shotguns and rifles. Virginia gun laws require only that an out-of-state buyer show valid identification, pass a background check and otherwise abide by state laws in order to buy a shotgun in the state. Alexis was never prosecuted for the two misdemeanors involving guns. Alexis bought the shotgun at Sharpshooters Small Arms Range in Lorton, Va. on Sunday, according to a statement from the attorney for the gun range.

State Briefs

Michael Slocum said in an email that Alexis rented a rifle, bought bullets and used the range before buying the shotgun and 24 shells. Slocum said Alexis passed a federal background check.

GOP opposition to health law flares WASHINGTON — Implacable Republican opposition to Obamacare has Congress once more veering closer to gridlock. In the House, more than 60 conservatives support tacking a oneyear delay in implementing the health care law onto a bill needed to prevent a partial government shutdown on Oct. 1. Senior leaders warn the GOP could suffer significant political reverses if the party goes along with the plan and President Barack Obama and Democrats resist, as they have made clear they will, but it is strongly backed by senators with tea party ties and their influential allies outside Congress. Its leading advocate, Rep. Tom Graves of Georgia, said the proposal unifies the rank and file “around two objectives we have, keeping the government open and protecting our constituents from the harmful effects of Obamacare.” Across the Capitol, where energy legislation is under debate, Senate Republican Leader Mitch McConnell is proposing to add a one-year delay in the requirements for individuals to purchase coverage and for businesses to provide it to their employees.

The only thing smaller than the hole in his heart is the number of surgeons who can repair it. Experience matters.

One of the biggest challenges a surgeon will ever face is operating on the tiny beating heart of an infant. The pediatric heart specialists at Le Bonheur Children’s Hospital in Memphis have met this challenge – time and time again. As one of the nation’s best children’s hospitals in pediatric heart care, we know that kind of experience matters in the life of a child. We’re completely dedicated to caring for kids. With specialty clinics at North Mississippi Medical Center, we’re also equipped to deal with the everyday illnesses and injuries that childhood brings.

Where Every Child Matters lebonheur.org

Associated Press

MSU student dies in 1-vehicle accident STARKVILLE — Starkville police say a Mississippi State University student died Tuesday from injuries suffered in a one-vehicle wreck near the campus. MSU officials identified the student as Kaleb D. Barker. Barker was a freshman kinesiology major who was from Lucedale. The Starkville Police Department investigated the accident.

Judge blocks school takeover JACKSON — A Hinds County judge has blocked the state takeover of the Leflore County school district, while the Claiborne County school district is asking another judge to reverse the state’s takeover. Hinds County Circuit Judge Winston Kidd signed a temporary order blocking the Leflore takeover Monday, the same day Gov. Phil Bryant declared emergencies there and in Claiborne County, allowing the Mississippi Department of Education to step in. Claiborne County has asked Hinds County Circuit Judge Tomie Green to block its takeover, but Green had not acted as of Tuesday afternoon. Both districts argue they are owed formal legal appeals where they could put on evidence and question witnesses before the state may act. The Mississippi Department of Education says no formal appeals are required to declare a

state of emergency.

Former postal worker pleads guilty to theft OXFORD — A former U.S. Postal Service employee in Tupelo has pleaded guilty to charges of stealing $20 from a package. WTVA-TV in Tupelo reports that 50-year-old Steven Joslyn entered the plea in U.S. District Court in Oxford on Monday. According to a federal indictment, Joslyn was working for the postal service when he stole the money from a piece of mail in September of 2012. He faces up to five years in prison and a $250,000 fine. Joslyn will be sentenced at a later date.

USM holds event for residence halls HATTIESBURG — The University of Southern Mississippi has officially

started construction on Century Park South, which will provide 954 beds for freshmen and other scholarship students. A groundbreaking for the $55.6 million project was held Tuesday on the Hattiesburg campus. The project will feature three buildings with five floors in each structure. Officials say Buildings B and C are expected to be completed in July of 2014 with 511 beds available for the fall semester. Building B will be designated as Luckyday Citizenship Hall pending approval by the state College Board. It will house Luckyday Scholarship students and Luckyday offices. The Luckyday Foundation made a $4 million gift commitment toward construction of the Century Park South complex in November of 2011. Building A is scheduled for completion in January of 2015.


6A • Wednesday, September 18, 2013 • Daily Corinthian

Deaths Mike Killough

Funeral services for James Michael “Mike” Killough are set for 4 p.m. today at Church of the Crossroads with Bro. Nelson Hight and Bro. Mike Green officiating. Burial will be in the Forrest Memorial Park. Mike died Sept. 16, 2013 at his residence. He was born Aug. 24, 1954 to the late William and Mary Anna Killough. Mike was a retired job superintendent for ANCO Construction for over 30 years and was a member of Church of the Crossroads. He enjoyed fishing, carpentry, working in his garden, cooking, playing rook and spending time with his family and his grandchildren. He was preceded in death by his parents; his brother, Jerry Don Killough; and his father- and mother-in-law, Carmen and Zola Mae Wrenn. He is survived by his wife of 38 years, Sandra Wrenn Killough, his son, Michael Shane Killough and his wife Bridgett, his daughter, Dana Joy Lewis and her husband Al, and his sister, Marilyn Weaver, all of Corinth;

Joe Page

CHEROKEE, Ala. — Joe Page died Tuesday, Sept. 17, 2013 at his residence. Arrangements are incomplete at this time and will be announced later by Cutshall Funeral Home in Iuka.

Tom Timms

Tom Timms died Sept. 16, 2013 in Florida. Arrangements are incomplete at this time with Memorial Funeral Home in charge.

Leroy Chandler

BEECH BLUFF, Tenn. — Funeral services for Leroy Chandler, formerly of Corinth, are set for 2 p.m. on Thursday, Sept. 19 at Memorial Funeral Home Chapel with Bro. Charlie Carothers officiating. Burial will be in the Memory Gardens of Hardin County, just south of Savannah, Tenn. Mr. Chandler died on Monday, Sept. 16 at the Jackson-Madison County General Hospital in Jackson, Tenn. He was born on Feb. 2, 1920 in Adamsville, Tenn. to the late George and Ethel Patterson Chandler. He was a life member of the VFW and the American Legion, and served in the U.S. Army during WWII. He was a member of Beech Bluff Baptist Church. Along with his parents, Mr. Chandler was preceded in death by his two sisters, Orie and Dovie Chandler. He is survived by his wife of 15 years, Betty Joyce Brown Chandler; two stepdaughters, Janie Brasfield of Savannah, and Bobbie Doran and husband Michael of Jackson; and two step-grandchildren. The family will receive friends from 5 p.m. until 8 p.m today and from noon until service time on Thursday.

Earl Dillard

IUKA — Funeral services for Earl Ray Dillard, 83, are set for 1 p.m. today at

State Briefs

his grandchildren, Anna Grace Killough, Chelsey Brooke Killough, Addison Kate Tidwell, Alana Rose Lewis, Michael Shane Killough II and William Everett Lewis; his stepgrandchildren, Alex Lewis, Emily Sides Killough and Tyler Graham; his step great-grandchild, Jace Lewis; and a host of nieces and nephews, family and friends. Pallbearers will be Junior Killough, Nathan Vanderford, Kenneth Essary, Bobby Mitchell, Joe Wells, Eddie Rickman, Aaron Null, Harold Peters, Kevin Harvell and Aaron Hight. Honorary pallbearers are the Tweenagers Sunday school class. Family will receive friends from 12 to 3:45 p.m. at the church. Condolences can be left at www.memorialcorinth.com. Memorial Funeral Home is in charge of arrangements.

Associated Press

SA

aged wiring that had been compromised by salt water and sand during the Oct. 29 storm, federal and county investigators said at a news conference. The wind-whipped blaze destroyed more than 50 businesses in the two towns. Seaside Heights Mayor William William Akers said there is no issue with potentially compromised wiring on the surviving sections of the boardwalk.

GORGEOUS By ASH

1501 Hwy 72 - Corinth, MS

Open Monday-Saturday

N

By ASH

expires 1/01/14

Keesler street renamed for Vietnam War hero BILOXI — Keesler Air Force Base has renamed a street for Chief Master Sergeant Richard Etchberger. Etchberger, who was posthumously presented the Medal of Honor, trained at Keesler Air Force Base in 1952. He was killed in 1968 while saving others at a remote radar location called Lima Site 85 when it came under attack from North Vietnamese soldiers.

Styles, Cuts, Color, Perms, Waxes & More Ashley Raines Owner/Stylist

Staff photos by Steve Beavers

Rowena (Liz Inman) helps Eugene (Cody Daniel) learn a lesson in life in “Biloxi Blues.”

BLUES CONTINUED FROM 1A

to performances. The theatre is located at 303 Fulton Drive. The cast includes: Cody Daniel (Eugene Morris Jerome); Conner Humphreys (Roy Selridge); Paul Locke (Joseph Wykowski); Darrell King II (Don Carney); Jerry McCalpin (Arnold Epstein); Charlie Curtis (James Hennesey); Randy Duke (Sgt. Merwin J. Toomey); Liz Inman (Rowena); Leah Petty (Daisy Hannigan). “This has been one of the best rehearsal periods of my life,” said Potter. “The cast was perfect and met every deadline on time.” Technical director is Cheryl Sproles with the stage manager being Jennifer Strachan. Cindi Bullard is in charge of

“HB2 Victory” FREE

Call For Appointments, Walk-ins Welcome

LO

NATCHEZ — Waste Pro wants Adams County to pay extra money for

Saturday, Sept. 21st 10am-2:30pm Corinth City Park POST

(between O’Reilly Auto Parts & Dixie Coin)

SA

Waste Pro seeking extra trash fees in Adams County

Tea Party in the Park

N

with this coupon GORGEOUS

JACKSON— Mississippi’s prison system, mental health system and Medicaid program are seeking budget increases for the coming year. Agency leaders appeared Tuesday before the Joint Legislative Budget Committee. They’re requesting money for fiscal 2015, which begins next July 1. Medicaid director David Dzielak says executives are trying to control costs with managed care. He says 22 percent of Medicaid recipients are in managed care now, up from 8 percent this past December. Dzielak says Medicaid enrollment has been fairly steady the past couple of years. In late August, it was 644,504.

Sharrion Miller

BOONEVILLE — Funeral services for Sharrion Miller, 49, are set for 1 p.m. today at TV 53 with burial at Betts Cemetery. Mrs. Miller died Sept. 15, 2013 at Methodist hospital. She was born Oct. 27, 1963. She received her GED; and was employed as an independent Mary K beauty consultant. She was also owner/operator of TOTS Family Restaurant. She was a member of Faith Harvest Church. She is survived by her husband, Robert W. Miller; her children, Lamar Mitchell, Chiquita Miller and Jason Miller; her parents, Elvester Nunn and Betty Jo Nunn; and her siblings, Martha Hendrix, John Spencer, Slyvester Nunn, Caren Burress, Melissa Burress, Cicley Nunn and Eddie Nunn. She was preceded in death by her children, Jermaine Miller and Robert J. Miller; and her grandfather, Willie Nunn. The Rev. Lee Miller will officiate.

LO

Save $5 on any hair service

Prison, mental health, Medicaid seek money

repeated garbage pickups at two local trash bins. Waste Pro Division Manager Doug Atkins has told county officials residents are filling the containers so much that the company has to haul off on average six loads each week per location. Atkins says the company would like to $100 for the extra runs. Atkins says the company is planning to bring a compactor to each location that could help reduce the load to four weekly pulls per location.

Cutshall Funeral Home Chapel in Iuka with burial in Providence Cemetery. Mr. Dillard died Monday, Sept. 16, 2013 at North Mississippi Medical Center in Iuka. He is survived by his son, Ricky Dillard of Iuka; two daughters, Tamela Hill (Ellis) and Drusilla Boggs (Don), all of Iuka; two brothers Lawrence Dillard (Connie) of Iuka, and Neal “Buddy” Dillard (Hazel) of Ripley; one sister, Annie Ruth Clark of Nashville, Tenn.; three grandchildren, Alisha Clark, Andrea Davis, and Carey Dillard; and three great grandchildren. He is preceded in death by his parents, Henry and Anna Boren Dilliard; his son, Ray Gene “Buddy” Dillard; and two brothers, Joe and Hilton Dillard. Bro. William Burcham will officiate.

Boardwalk fire linked to electrical wiring TOMS RIVER, N.J.— The massive fire that destroyed part of a Jersey shore boardwalk and dozens of businesses began accidentally in wiring damaged in Superstorm Sandy, and should prompt coastal property owners to get their own equipment inspected for similar danger, officials said Tuesday. The boardwalk fire in Seaside Park and Seaside Heights started Thursday in

Associated Press

TH COLORSE 10:30A M

Music ★ Singing ★ Door Prizes Guest Speakers

Early Bird Drawing 11am • Free gun laser engraving Jumpers • Face painting • Games

Bring the family & lawn chairs

662-808-6034

CHRISTIAN CONSERVATIVE FUN DAY

Eugene (Cody Daniel) finds the love of his life in Daisy Hannigan (Leah Petty) while going through basic training in Biloxi. costumes and Potter is over sound design. As part of the “Biloxi Blues” performances, the CT-A Guild – a group of CT-A volunteers dedicated to fund-raising – is hosting “Dinner with the Director” at 5:30 p.m. Sept. 21, at Smith restaurant. Cost is $38 per person and includes choice of (selected) entrée, salad,

dessert, drink (cash bar available), tax and gratuity at Smith as well as admission to the show. Skinner will discuss Simon and “Biloxi Blues” during the first course and then Anthony Hopper will provide music on acoustic guitar. Deadline for reservations is today. Call 662287-2995 for details.

Walk HAVE YOURin, OWN Jaye Smith, RMT #67 Krisy Evans, RMT #136 RELAXATION flVACATION! oat out. A Hand to Health Therapeutic Massage Center & Spa

Phone: Phone: 662-284-9880 662-284-9880 1908 1908 Proper Proper Street Street Corinth, MS 38834 Corinth, MS 38834 Call For Appointment~ Gift Certificates Available

Mid-South Neurology 2425 Proper St. (formerly Shiloh Neurology) Corinth, MS 38834 • 662-396-9447

8th Year Anniversary Lunch Special

Currently Taking New Patients

September 3rd-October 31st Mon-Fri 11:00AM - 3:30PM All You Can Eat More Sushi Items • New Items Added

$5.29

2115 S. Harper Rd • 662-287-3666 • Across From Wal-Mart • Corinth, MS

QUICK - EASY - LOW COST

William E. Owens, M.D.

$5.29

Stop the Harassment & Keep your Property

• •

We Treat Alzheimer’s Disease, Parkinson’s Disease, Als, Tremors, Strokes, Seizures, Multiple Sclerosis, Sleep Disorders, Migraines, Back Pain And Neuropathy. Only Emg (Nerve Conduction Study) Full Service Lab EEG Testing Performed In Office Botox For Migraine Headaches, Cervical Dystonia & Blepharospasm

Affordable flexible payment plans ZERO down payment gets you a fresh start with

106 West College Street, Booneville, MS


Daily Corinthian • Wednesday, September 18, 2013 • 7A

Like St. Francis, St. Paul’s people love dogs There I was, on a Sunday morning, tearing around the house looking for my cookie recipes. Dog cookies, that is. In honor of St. Francis, who loved all creatures, great and small. I had volunteered to make the dough for our Sunday school kids to roll out and cut out into little bone-shaped cookies. Bake’em, bag’em and set up a booth the following Sunday, offering the treats in return for donations to the humane society, which is struggling to keep a roof over the heads of hundreds of cast-off critters. I think St. Francis would approve. I, however, am no saint. Which is why I found myself in such a rush. At the very last minute. Tossed a cup of oats into oil and boiling water, bouillon and powdered milk. Added an egg and cornmeal and shredded cheese, then three cups of whole wheat flour, pommeling the glutinous mixture with a sturdy potato masher. Yes!

“Cheesy Dog Biscuit” batter, all ready to roll. Now for “Peanut Butter Bones.” I whisked the dry ingrediRyland ents together and Bruhwiler then .... Oops. Columnist Realized I’d forgotten to ask my husband to pick up peanut butter when he went shopping yesterday. (Darn!) This is when you know who your Real Friends are. They’re the ones you call — at the very last minute — to bring peanut butter to church for you. April said she didn’t think she had much left in the jar, but she’d bring what she had. Susan didn’t answer and Amanda didn’t answer, but I left messages on their cell phones anyway. However much we ended up with would have to do. Staggered out to the car beneath an oversized cardboard

Engagement

Curry - Mitchell

Subscribe today To start your home delivery subscription of The Daily Corinthian: Call 287-6111 between 8 a.m. and 5 p.m. Monday-Friday.

bulatory Surgery Center. The prospective groom is the son of Alexis “Lex” and Debbie Mitchell of Corinth, and the grandson of Camille Borroum Mitchell and the late Kimmons Mitchell, and Audrey Seago and the late Roe Seago, of Corinth. Mr. Mitchell is a graduate of Northeast Community College with an associates degree in business, and a graduate of Corinth High School. He is currently employed by Mitchell Construction. After a honeymoon in St. Lucia, the couple will reside in Corinth.

Labs-N-Lace

two cups’ worth — which is exactly what the recipe called for. I don’t really think we had guardian angels providentially assisting in our Dog Biscuit Bake, but the thought did cross my mind. (Is there a patron saint for procrastinators?) I showed the kids how to spread a little flour on the table, how to squeeze the dough into a ball, and roll it out with a rolling pin. Then press the cookie cutters into it just right and scrape them up with the spatulas. (Or not .... Hallie-Kate and Nora set to work with a will. But Elam decided he didn’t like icky stuff between his fingers. And Lily disdained to use a spatula. She preferred pressing the cookie cutter into the dough, then pulling the leftover dough away from the imprint.) I must say, it sure was cute watching those small hands handle a rolling pin almost half as long as they are tall. Folks kept coming in and remarking how good our kitchen

smelled. Several could not restrain themselves and nibbled on bits of raw dough. They made no comment, but I bet that they were disappointed. Dog biscuits, even at their best, are basically bland. Still, when I got home, I carried a couple out to my Labradors and Doberman in their pen to say hello. Judging by their bulging eyes and the way they begged for seconds, I do believe these made the grade. My husband, on the other hand, did have one complaint. Sunday is his day to whip up pancakes for lunch, and he’d gone ahead and gotten going since I was home a little late. Guess who’d taken every single spatula? Oh well, sometimes you gotta suffer for a good cause. (Daily Corinthian columnist Ryland Bruhwiler lives on a farm in McNairy County, Tenn. She can be contacted by email at downyonder@wildblue.net.)

MSU hosts President Lincoln symposium

Branon Alyse Curry, Alexis “Lex” Borroum Mitchell II

Branon Alyse Curry and Alexis “Lex” Borroum Mitchell II will be married Saturday, September 21, 2013 6:00 in the evening at Madelyn’s in the Grove, Athens Alabama. The bride-elect is the daughter of David and Lisa Curry of Athens, Alabama, and the granddaughter of Tom and the late Janice Harris of Athens, Alabama, and Claire Mitchell of Taunton, Massachusetts. Miss Curry is a graduate of the University of North Alabama with a bachelors of science degree in Nursing. She was a member of the Phi Mu sorority. She is currently employed as a nurse at Magnolia Regional Health Center Am-

box containing big bowls of dog biscuit dough, all four cookie sheets, all our spatulas, rolling pin, whisk and potato masher. My grandmother’s aprons (in case somebody was all dressed up), cooking oil, and other paraphernalia tossed in just in case. Tried not to drive too fast on our winding country roads. It’d be an awful irony to kill a dog en route. Got to St. Paul’s and found not one, but two partially filled jars of peanut butter waiting on the kitchen counter. April and Amanda to the rescue. Hooray! (Ms. Amanda told me later that she’d listened to my cell phone message as she was driving to church and, bless her heart, made an immediate turnaround to run back home and grab her jar.) One of our teenagers — Emma — took the cookie sheets outside and gave them a thorough spray with Pam, then scraped every smidge of peanut butter out of those two jars — exactly

NOW CARRYING CHEROKEE

Come check out our great selection of medical supplies

•Stethoscope

20-30% •Uniforms OFF SELECT ITEMS •Blood Pressure Cuffs 1405 Hwy 72 E Corinth, MS 38834 Phone 662-286-6900 Hours: Monday-Friday 10am-5pm

STARKVILLE — President Abraham Lincoln will be at Mississippi State University later this month for a number of university-organized public programs. Of course, the actual 16th U.S. chief executive who was assassinated in 1865 will be unable to make it, but his transcendent spirit should be well represented at a two-day special event. “A Symposium on Lincoln: The Movie and Man” is being co-sponsored by the Office of President Mark E. Keenum and MSU Libraries, along with the campus-based U.S. Grant Presidential Library, Shackouls Honors College, and African American Studies. Free and open to all, the Sept. 23 and 24 programs — including a “presidential press conference” — are part of the institution’s observance of the 150th American Civil War anniversary. The symposium gets under way at 7 p.m. on the Sept. 23 with a screening of “Lincoln,” the epic 2012 historical drama starring Daniel Day-Lewis in the title role that won him Academy Award best-actor honors. To be shown in 124 McCool Hall, the Stephen Spielberg-produced and directed movie will run approximately 150 minutes. “We have been privileged to be host to many

significant events over the years, but this symposium truly is one we feel will be remembered and appreciated for a long time to come,” said Frances Coleman, MSU dean of libraries. Activities on the Sept. 24 will begin with George Buss, a nationally recognized character actor who has won widespread acclaim for his stage depictions of Lincoln. A sixth-generation Illinois native, he is, like the man he portrays, bearded, sixfeet-four-inches tall and weighing between 160180 pounds. For more, visit www.woodward. edu/data/files/gallery/ ContentGallery/Buss_ bio1.pdf. At Mitchell Memorial Library’s third-floor John Grisham Room, Buss will be part of a 9 a.m. panel discussion focusing on Lincoln’s lasting impact on the country he led during its most trying time. Other panelists — all speakers at separate programs later in the day — include historians John F. Marszalek and Stephen Middleton of MSU, and John David Smith of the University of North Carolina at Charlotte. Civil War historian and author Frank K. Williams will be panel moderator. A former Rhode Island Supreme Court chief justice, he leads the U.S. Grant Association that brought

the Grant Library to MSU. He also is founding chair of the Lincoln Forum, a national organization devoted to the study of its namesake and the Civil War era. Other activities on the 24th include: • 10:15 a.m., Mitchell’s first-floor Grant Library, an open house and reception with forum participants; • 12:30 p.m., Grisham Room, Buss/Lincoln’s delivery of the Gettysburg Address, followed by “presidential press conference” moderated by veteran Mississippi newspaper editor and columnist Sid Salter, MSU’s university relations director; • 1:30 p.m., Grisham Room, address by Smith titled “Lincoln and the Black Troops.” • 2:30 p.m., Grisham Room, examination by Marszalek of Lincoln and Grant’s military leadership; and • 3:30 p.m., Grisham Room, presentation by Middleton on Lincoln,

African Americans and the 13th Amendment. The symposium concludes at 7:30 p.m. in McCool Hall’s Rogers Auditorium (Room 100), with an in-depth discussion by Williams of the Spielberg movie. “The motion picture ‘Lincoln’ provides a vivid insight into the nation’s greatest president” said Marszalek, a retired MSU Giles Distinguished Professor Emeritus currently serving as executive director and managing editor of the U.S. Grant Association. “When students and local residents saw it, the immediate question that came to their minds was: ‘How accurate is it?’” the nationally recognized Civil War author and researcher added. “Judge Williams and the other speakers at the symposium will be providing answers to this question, and a lot more.” A complete symposium schedule is available at http://library.msstate. edu/abrahamlincoln.

McPeters Funeral Directors Yesterday • Today • Tomorrow 1313 3rd St., Corinth • 662-286-6000

Natural Gas Water Heaters

CITY OF CORINTH GAS & WATER DEPARTMENT is proud to announce that Natural Gas is available to you. If you are interested in having a Natural Gas line run to your home, contact our office at 662-286-2263 and a customer service representative will be glad to assist you.

A NATURAL GAS WATER HEATER PROGRAM IS BEING OFFERED! If you are building a new home, or find it is time to replace your water heater, let us help you save money with our natural gas water heater program!

Today’s natural gas water heaters represent an extra-ordinary value in performance, reliability and operating costs, making them the choice of energy-conscious homeowners. Natural gas water heaters are safe and energy efficient. t Spacious studio apartments t Luxurious suites

t Laundry, housekeeping and apartment maintenance t Daily activities

t 24 hour emergency call system Beginning rate $1850 in each apartment t Beauty salon & much, much more t Three home-style meals daily Beginning Rate $1950 1101Levee Road 1101 Levee Road Corinth, MS 38834 Corinth, MS 38834 662-286-7021 662-286-7021 dogwoodplantation@comcast.net dogwoodplantation@comcast.net

of Corinth

Corinth’s only home owned

Corinth’s only home owned andoperated operatedRetirement Retirement Facility and Facility

Don’t wait! Call our office for all the details on our “Natural Gas Water Heater Program”. CITY OF CORINTH GAS & WATER DEPARTMENT 305 W Waldron St. Corinth, MS 38834 www.corinthgasandwater.com


Business

8A • Daily Corinthian

YOUR STOCKS Name

P/E Last

A-B-C-D ADT Cp n AES Corp AK Steel AbtLab s AbbVie n AberFitc Accenture ActivsBliz AdobeSy AMD Aeropostl Aetna Agenus AlcatelLuc Alcoa AlldNevG Allstate AlphaNRs AlpAlerMLP AlteraCp lf Altria Amarin Amazon AMovilL AmAxle ACapAgy AEagleOut AmExp AmIntlGrp ARltCapPr AmTower Amgen Anadarko AnglogldA Annaly Apache ApolloInv Apple Inc ApldMatl ArcelorMit ArchCoal ArchDan ArenaPhm AriadP ArmourRsd ArubaNet Atmel AuRico g Autodesk AutoData AvagoTch AvanirPhm Avon B2gold g Baidu BakrHu BcoBrad pf BcoSantSA BcoSBrasil BkofAm BkNYMel Barclay BariPVix rs BarrickG Baxter Belo BerkH B BerryPls n BestBuy BioMarin BlackBerry Blackstone Boeing Boise Inc BostonSci BrMySq Broadcom BrcdeCm Buenavent CA Inc CBS B CMS Eng CNO Fincl CSX CVS Care CYS Invest CblvsnNY CabotOG s Cadence Calpine CapOne CapitlSrce Carlisle Celgene CellThera Celsion Cemex Cemig pf CenterPnt CntryLink CheniereEn ChesEng Chicos Chimera CienaCorp Cirrus Cisco Citigroup CleanEngy CliffsNRs ClovisOnc Coach CobaltIEn CocaCE ColeREI n ColgPalm s ConAgra ConocoPhil CooperTire Corning Coty n CSVelIVST CSVxSht rs CypSemi DCT Indl DDR Corp DR Horton Danaher DaVitaH s DeltaAir DenburyR Dndreon DenisnM g DevonE DirecTV DxGldBll rs DxFinBr rs DxSCBr rs DxFnBull s DirDGdBr s DxSCBull s Discover DishNetw h Disney DoleFood DomRescs DowChm DryShips DuPont DukeEngy

22 dd dd ... 15 14 16 14 43 dd dd 13 dd ... 31 10 11 dd q 25 17 ... dd 12 4 4 13 19 28 dd 46 19 28 ... 4 14 15 11 dd dd dd 19 dd dd 2 dd dd dd 41 26 19 dd dd ... 30 22 ... ... ... 26 19 ... q dd 18 14 16 28 dd dd dd 22 21 84 ... 55 39 19 5 13 21 17 19 14 18 dd cc 66 8 27 10 20 27 41 dd dd ... ... 53 19 dd dd 16 ... dd 10 13 13 dd dd dd 15 dd 27 ... 25 15 12 8 11 37 q q cc cc dd 16 20 21 10 16 dd dd dd 13 q q q q q q 11 84 20 dd 54 44 dd 12 20

41.33 13.32 4.09 34.97 47.60 38.43 76.61 17.16 48.14 3.85 10.17 67.75 3.02 3.40 8.26 4.67 51.19 6.34 17.04 38.18 35.36 6.44 304.17 20.61 20.21 23.18 15.12 76.92 50.46 12.51 73.92 115.73 93.67 13.13 11.95 88.25 8.46 455.32 15.91 14.09 4.77 37.16 5.85 21.08 4.09 17.51 7.81 3.83 39.31 74.16 40.12 4.31 21.31 2.59 143.80 50.26 13.37 7.72 6.38 14.55 31.45 19.06 14.18 18.33 71.58 13.99 115.39 21.87 38.95 75.96 10.56 23.70 117.11 12.60 11.90 45.40 27.45 7.78 11.46 30.60 56.39 26.11 14.55 26.21 61.01 8.08 17.45 38.21 14.00 19.60 69.12 11.58 69.71 147.04 1.37 1.21 11.51 8.32 23.49 32.43 32.29 27.16 16.89 2.95 25.98 22.29 24.37 51.20 13.09 22.44 72.44 55.28 25.72 40.80 11.77 59.80 31.85 69.70 30.74 14.65 15.64 27.95 14.51 11.60 7.16 16.04 19.95 70.03 59.10 23.32 17.69 3.13 1.10 58.86 62.40 57.52 28.03 23.34 73.35 33.76 61.23 52.59 47.25 66.98 13.50 61.75 39.71 3.09 59.62 66.19

E-F-G-H

Today

E-Trade eBay EMC Cp EastChem Ecotality lf Elan EldorGld g ElectArts EmersonEl EmpDist EnCana g EnteroMed Ericsson ExOne n ExcoRes Exelis Exelon Expedia ExpScripts ExtrmNet ExxonMbl FAB Univ Facebook FedExCp FidlNFin FifthThird FstRepBk FstSolar Flextrn

dd 27 21 13 dd dd 27 69 24 15 13 dd ... ... 6 10 22 53 30 45 9 23 cc 22 11 10 19 10 28

17.48 54.63 26.81 77.37 .16 15.52 7.25 27.60 64.89 21.28 17.67 1.25 13.90 49.43 7.15 15.87 30.34 52.26 65.95 4.48 88.94 5.93 45.07 110.68 25.52 18.55 46.78 38.51 9.19

Chg ForestOil 20 6.48 FrankRes s 15 50.54 FrSea rsh ... .31 12 33.53 -.15 FMCG 4.34 -.03 FrontierCm 43 dd 13.97 +.12 Fusion-io 18 47.72 -.04 GATX 1.93 +1.78 GalenaBio dd +1.09 GameStop dd 52.62 16 42.09 +.27 Gap 16 44.42 -.09 Garmin GencoShip dd 4.06 +.03 GenDynam dd 89.14 GenGrPrp 52 19.61 +1.56 18 49.78 -.96 GenMills +.28 GenMotors 13 36.71 Genworth 11 12.18 +.07 ... 7.41 +.16 Gerdau dd 2.31 +.20 GeronCp +.68 GileadSci s 35 62.69 ... 51.13 +.24 GlaxoSKln ... 4.77 -.11 GolLinhas ... 4.70 +.33 GoldFLtd 7.24 +.23 GoldResrc 18 dd 26.31 -.14 Goldcrp g +8.11 GoldmanS 12 167.42 18 8.84 +.33 GrafTech dd 11.36 +.81 Groupon -.11 HSBUS pfG ... 19.86 4.75 +.26 HalconRes 34 18 49.67 +1.32 Hallibrtn 9.86 +.77 Halozyme dd ... 3.61 +.29 HarmonyG 41 32.30 -.35 HartfdFn 23 12.81 -1.45 HltMgmt cc 3.24 +.31 HeclaM 17 73.29 +.21 Herbalife dd 7.60 +.03 HercOffsh 36 27.38 +1.25 Hertz Hess 7 77.79 +.09 dd 21.67 +5.20 HewlettP 61 9.11 -.05 HimaxTch HollyFront 5 41.56 +.08 dd 20.56 +.15 Hologic 22 75.80 +.41 HomeDp -.09 HopFedBc 23 11.13 3.25 +.81 HorizPhm dd 87 18.30 +.06 HostHotls HovnanE dd 5.25 +.16 8.66 +.18 HuntBncsh 12 49 19.50 +.01 Huntsmn +.24 I-J-K-L +.06 9 5.37 +1.07 IAMGld g ... 11.91 -.07 ING iShGold q 12.72 +.20 q 47.32 +.08 iShBrazil q 37.34 +1.22 iShEMU iSh HK q 19.84 +.31 q 14.02 +.22 iShItaly iShJapan q 11.70 +.03 q 61.75 +.05 iSh SKor q 66.07 +.02 iShMexico q 14.15 +.05 iSTaiwn iShSilver q 20.96 -.34 -.15 iShChinaLC q 38.41 +.19 iSCorSP500 q 171.99 iShEMkts q 41.53 -.34 iSh20 yrT q 103.71 +.09 iS Eafe q 63.36 +.55 iShiBxHYB q 91.86 -3.12 iShR2K q 106.08 +.63 iShChina q 47.19 +2.56 iShUSPfd q 37.73 +.24 iShREst q 64.67 iShHmCnst q 22.32 +1.44 IdenixPh dd 5.64 +.04 IngrmM 12 22.93 -.02 InovioPhm dd 2.35 +.26 IBM 13 192.16 +.54 IntlGame 19 20.86 +.04 IntPap 20 48.11 +.10 Interpublic 23 16.92 +.09 IntPotash 15 16.11 +.45 InvenSense 29 17.89 -.01 ItauUnibH ... 13.96 -.06 JDS Uniph 63 15.20 JPMorgCh 9 53.09 +.06 JetBlue 21 6.60 -.02 JinkoSolar dd 17.67 -.20 JohnJn 20 89.06 +.61 JohnsnCtl 17 42.78 +.31 JoyGlbl 8 52.96 +.28 JnprNtwk 36 21.42 +1.47 KB Home dd 17.27 +.13 Kellogg 23 60.64 +.54 KeryxBio dd 10.00 -1.00 Keycorp 14 12.12 +.13 KindMorg 32 34.72 -.05 KindrM wt ... 4.64 +.11 Kinross g dd 5.26 +.03 KodiakO g 30 11.24 +.62 Kohls 12 51.88 +.16 KytheraBio dd 41.95 +.29 LSI Corp 56 7.90 +.64 LaredoPet 90 28.64 +.41 LVSands 28 64.25 -.01 LennarA 19 35.04 +.67 LeucNatl 9 28.05 +.80 LexiPhrm dd 2.29 -.01 LillyEli 12 53.83 +.20 LinnEngy dd 27.91 +.66 LloydBkg ... 4.78 +.41 LockhdM 14 129.64 +4.95 Lorillard s 14 44.97 +.30 LaPac 11 17.71 +.36 lululemn gs 38 70.22 +.39 LyonBas A 13 72.68 -.03 M-N-O-P -.22 -.24 MFA Fncl 9 7.52 +.36 MGIC dd 7.54 -1.52 MGM Rsts dd 19.55 +.16 Macys 13 45.05 -.61 MagHRes 53 5.29 +.29 Manitowoc 21 19.46 -.37 MannKd dd 5.87 +.18 MarathnO 16 35.93 MarathPet 7 66.21 +.04 MktVGold q 25.93 +.11 MV OilSvc q 47.73 -.08 MktVRus q 28.58 +2.49 MarshM 18 42.74 +.17 MartMM 47 98.37 +.28 MarvellT 26 12.67 +.15 Masco cc 21.50 -.05 Mastec 22 30.68 +.75 Mattel 19 42.12 +.48 McDrmInt dd 7.40 +2.99 McEwenM dd 2.59 -.46 MeadJohn 26 77.86 -.75 Medtrnic 14 53.94 +1.01 Merck 26 48.01 -2.01 MetLife 46 49.88 +1.79 MKors 33 75.02 +.71 MicronT dd 16.84 +.31 Microsoft 13 32.93 +.04 MillenMda ... 7.81 Molycorp dd 6.73 +.64 Mondelez 24 31.98 -.09 Monsanto 23 104.43 4.52 +.12 MonstrWw dd 35 29.01 -.08 MorgStan 10 45.00 +.16 Mosaic Mylan 24 38.50 NII Hldg dd 6.91 +.41 NQ Mobile cc 22.50 +.98 NRG Egy 20 27.92 -.07 Nabors 38 16.16 +1.07 NOilVarco 15 78.90 -.07 NetApp 31 43.82 +.04 Netflix cc 299.55 +.14 Neuralstem dd 2.72 +.64 NwGold g 31 6.21 +.36 NY CmtyB 14 15.35 -.02 Newcastle ... 5.72 -.04 NwLead hlf ... .11 +.03 NewmtM dd 28.52 +.01 NewsCpA n ... 17.00 -1.37 NextEraEn 20 79.00 +.14 NiSource 20 30.25 +.19 NikeB s 26 68.32 +.12 NobleCorp 17 38.72 -.16 NokiaCp ... 6.27 +.18 NorthropG 12 98.75 +.11 NStarRlt dd 9.13 +.27 NovaGld g dd 2.56 +.68 Novavax dd 3.29 +2.56 NuanceCm 12 19.23 +1.11 Nucor 38 49.47 +.72 Nvidia 18 15.86 +.06 OcciPet 17 90.98 +.78 Oclaro dd 1.63 +.03 OfficeDpt dd 4.31 -.09 Oi SA ... 1.87

+.22 +.35 +.04 +.28 +.03 +.19 -.16 -.01 +.50 +.28 +1.30 +.08 +1.07 -.10 +.05 +.49 -.11 +.02 +.06 -.33 -.17 -.08 +.03 -.90 +.34 +.39 +.44 +.12 +.31 +.03 -.15 +.76 +.10 +.42 +.03 +.10 +2.65 +.02 +.46 -.13 -.07 +.42 -.34 +.05 +.26 -.11 +.48 +.18 +.01 +.12 +.36 +.20 -.07 +.59 +.16 -.01 +.09 -.05 -.28 -.08 -.05 +.02 -.18 +.69 -.09 +.85 +.04 +.30 +1.04 -.23 +.05 -.05 +.05 +.33 +.29 -.09 -.99 -1.30 +.02 +.08 -.19 +.35 +.22 -.05 +.07 -1.05 +.03 +.05 -.82 +.36 +.10 -.34 +.71 +.07 +.07 +.18 +.38 +8.42 +.01 +1.61 +.60 +.27 -.25 +.06 +.19 -.39 -.16 +1.18 +.49 -.32 +.18 +1.29 +.06 +.17 +.25 +.08 -.08 -.57 -.03 +.47 -.74 +.54 +.21 -.03 +.03 -.43 -.08 +.20 +.07 +.19 -.01 +.04 +1.75 -.12 -.18 +.53 +.72 +.40 +.13 +.80 +.30 +.12 -1.27 -.04 +.28 -.55 -.45 -.16 +1.90 +.36 -.12 +.17 +.27 -2.61 +.02 +.18 +.24 +.01 +.39 +.04 -.17 +.10 +.13 -.43 +.03 +.96 +.01 -.02 +.08 +.08 +.38 +.05 +1.30 -.01 +.07 +.03

Omeros OnSmcnd Oracle Outerwall PG&E Cp PNC PPG PPL Corp PanASlv Pandora PeabdyE PetrbrsA Petrobras Pfizer PhilipMor Phillips66 PiperJaf PitnyBw PlugPowr h Polycom Potash PwshDB PwShs QQQ ProUltSP PrUVxST rs ProctGam ProgsvCp PrUShSP rs PrUShL20 rs PUSSP500 ProspctCap PSEG PulteGrp

dd 7.62 -.94 dd 7.51 +.04 15 33.26 +.29 11 49.49 -6.48 20 41.07 +.07 11 74.77 +.58 22 165.36 +.16 12 30.21 +.29 dd 11.08 +.07 dd 25.19 +1.20 dd 18.28 +.23 ... 16.50 +.12 ... 15.59 +.22 15 28.64 -.07 17 88.22 +.37 8 56.05 -.78 16 35.74 -.05 14 17.45 +.28 dd .60 -.03 dd 10.81 -.13 13 32.45 -.55 q 25.74 -.27 q 78.37 +.52 q 86.95 +.75 q 32.34 -.78 21 79.83 -.33 14 26.32 +.09 q 35.68 -.30 q 79.48 -1.30 q 19.97 -.26 ... 11.52 -.01 14 32.84 +.42 23 17.00 -.14

Q-R-S-T Qihoo360 Qualcom QuantaSvc Questar QksilvRes RF MicD RadianGrp ReneSola ReprosTh RiteAid RiverbedT RockwllM RoyDShllA RymanHP SAIC SpdrDJIA SpdrGold S&P500ETF SpdrHome SpdrLehHY SpdrS&P RB SpdrRetl SpdrOGEx SpdrMetM SABESP s Safeway Salesforc s SamsO&G SanDisk SandRdge Sanofi rt Schlmbrg Schwab SeagateT SealAir SiderurNac SilvWhtn g Sina SkywksSol SmithWes SmithfF Sohu.cm SonyCp SwstAirl SwstnEngy SpiritRC n Sprint n SP Matls SP HlthC SP CnSt SP Consum SP Engy SP Inds SP Tech SP Util StdPac Staples Starbucks StlDynam SterlF WA StratHotels Stryker Suncor gs SunEdison Suntech SunTrst Supvalu SwiftTrans Symantec Synovus Sysco T-MoblUS n TD Ameritr TJX TaiwSemi TakeTwo TalismE g Target Tellabs Terex TeslaMot Tesoro TevaPhrm TexInst ThermoFis 3D Sys s 3M Co TibcoSft TimeWarn TollBros Transocn TriangPet TrinaSolar TurqHillRs 21stCFoxA TwoHrbInv TycoIntl s Tyson

cc 18 17 18 dd dd dd dd dd dd cc dd 8 cc 13 q q q q q q q q q ... 14 dd ... 21 dd ... 18 34 9 dd ... 17 dd 20 9 30 28 ... 27 dd dd ... q q q q q q q q 5 dd 36 26 18 dd 21 13 dd dd 9 dd 19 24 dd 20 ... 25 21 ... 68 ... 16 dd 92 dd 10 75 25 27 cc 19 44 17 11 cc ... dd dd 11 5 dd 15

84.51 69.42 27.13 21.80 1.91 5.45 14.05 4.34 23.85 3.70 15.59 9.77 64.96 35.53 15.50 155.29 126.50 171.07 30.76 39.90 36.21 81.76 65.37 37.85 9.59 30.99 49.90 .56 60.45 5.84 1.96 87.74 22.64 41.26 29.81 4.21 24.61 81.46 25.68 11.40 34.15 67.76 21.66 14.22 37.71 9.12 6.39 42.51 51.70 41.23 60.83 84.31 47.01 32.37 37.53 7.96 14.96 76.04 17.24 28.96 8.66 71.35 35.94 7.28 1.21 33.96 7.70 19.48 25.30 3.30 33.17 25.09 28.05 55.94 17.68 17.00 11.00 64.38 2.34 32.94 166.23 45.58 37.62 40.73 93.29 53.51 119.93 24.39 62.90 32.89 46.77 9.50 11.62 5.23 32.59 9.78 35.27 30.27

U-V-W-X-Y-Z UBS AG US Airwy UltraPt g Umpqua UtdContl UPS B US NGas US OilFd USSteel UtdTech UtdhlthGp UrbanOut Vale SA Vale SA pf ValeroE VanS&P500 VangREIT VangEmg VangFTSE VerizonCm ViacomB Visa Vodafone Volcano Vonage VulcanM Walgrn WalterEn WarnerCh WeathfIntl WellPoint WernerEnt WstnUnion WhitingPet WholeFd s WmsCos Windstrm WisdomTr WTJpHedg XcelEngy Xilinx Yamana g Yelp YingliGrn YoukuTud YumBrnds Zoetis n Zynga

+1.58 +1.33 +.54 -.02 +.07 +.11 +.41 +.07 +2.59 +.10 +.16 -.23 -.29 +.28 -.07 +.35 +.05 +.76 +.30 +.12 +.49 +.87 +.83 +.63 +.24 +2.95 +.25 +.04 -.20 +.33 +.12 +.74 +.56 +.32 -.56 +.06 +.43 +1.46 +.37 +.35 -.20 -1.85 +.20 +.12 -.20 +.02 -.25 -.12 +.03 +.14 +.35 +.38 +.20 +.16 +.22 +.16 +.20 +.80 +.44 +.09 -.07 +.52 -.13 +.09 -.04 +.36 +.31 -.69 -.08 +.10 +.16 +.42 +.44 +.65 +.06 -.35 -.08 +.59 -.01 -.13 -.35 +.09 -.26 +.28 +1.52 +3.45 +.70 -.04 +.18 +.28 +.09 +.41 -.04 +.05 -.01 -.02 +.69 -.03

How will you pay for    

retirement? Let’s talk.             

   Financial Advisor Financial Advisor 605 Foote Street 1500 Harper Road Suite 1 Corinth, MS 38834 Corinth, MS 38834 662-287-4471 662-287-1409

       

   Financial Advisor Financial Advisor 605 Foote Street 1500 Harper Road Suite 1 Corinth, MS 38834 Corinth, MS 38834 662-287-4471 662-287-1409 

www.edwardjones.com

Member SIPC

Combating diabetes class had combined sales of $4.5 billion last year and are expected to grow as high as $8 billion by 2021. More than 350 million people worldwide are estimated to have diabetes, according to the World Health Organization. New treatments like the DPP-4 class of drugs have helped make diabetes treatments the fourth best-selling group of drugs, behind drugs for cancer, pain and high blood pressure. Since 2008, sales of diabetes medications have risen more than 56 percent to $42.4 billion. That’s more than twice as fast as the overall prescription drug market, which has grown 20 percent to $962 billion.

The world’s largest drugmakers recently received some good news. A new class of diabetes drugs was found not to increase the risk of heart attack and stroke – deadly side effects which have plagued some older diabetes treatments. The results of two large studies, published in the New England Journal of Medicine, eased investor concerns over the class known as DPP-4 inhibitors; which includes Onglyza from BristolMyers Squibb and AstraZeneca; Nesina from Sanofi; and Januvia and Janumet from Merck. All of the drugs work by blocking the DPP-4 enzyme, which promotes the release of insulin, a protein that controls blood sugar levels. Drugs in the

Diabetes drug sales

2012 pharmaceutical sales by treatment category

(in billions)

(in billions)

$40 30

$61.6

56.1

42.4

Cancer

Pain

Diabetes

19.2

13.8

20 10 0

’08

’09

’10

’11

Heart Vaccines disease

’12 Matthew Perrone; Jenni Sohn • AP

Sources: IMS Health; Decision Resources

INDEXES 52-Week High Low 15,658.43 12,471.49 6,686.86 4,838.10 537.86 435.57 9,741.64 7,841.76 2,509.57 2,186.97 3,756.25 2,810.80 1,709.67 1,343.35 18,157.57 14,036.94 1,065.25 763.55

Name Dow Industrials Dow Transportation Dow Utilities NYSE Composite NYSE MKT Nasdaq Composite S&P 500 Wilshire 5000 Russell 2000

Last 15,529.73 6,604.57 479.61 9,738.93 2,370.24 3,745.70 1,704.76 18,143.13 1,066.39

Dow Jones industrials

15,560

Close: 15,529.73 Change: 34.95 (0.2%)

15,160 14,760

16,000

Net YTD 52-wk Chg %Chg %Chg %Chg +34.95 +.23 +18.51 +14.49 +7.42 +.11 +24.46 +29.93 +2.29 +.48 +5.85 +2.55 +34.46 +.36 +15.34 +16.11 +10.59 +.45 +.62 -4.82 +27.85 +.75 +24.05 +17.87 +7.16 +.42 +19.53 +16.82 +91.92 +.51 +20.99 +18.88 +10.14 +.96 +25.55 +24.44

10 DAYS

15,600 15,200 14,800 14,400

M

A

M

J

J

A

S

STOCKS OF LOCAL INTEREST Name AFLAC AT&T Inc AirProd AlliantEgy AEP AmeriBrgn ATMOS BB&T Cp BP PLC BcpSouth Caterpillar Chevron CocaCola Comcast CrackerB Deere Dell Inc Dillards Dover EnPro FordM FredsInc FullerHB GenCorp GenElec Goodyear HonwllIntl Intel Jabil KimbClk Kroger Lowes

Div 1.40 1.80 2.84 1.88 1.96 .84 1.40 .92 2.16 .20f 2.40f 4.00 1.12 .78 3.00f 2.04 .32 .24f 1.50f ... .40 .24a .40 ... .76 ... 1.64 .90 .32 3.24 .60 .72

YTD PE Last Chg %Chg Name Div 3.08 9 62.22 +.35 +17.1 McDnlds 26 34.75 +.18 +3.1 MeadWvco 1.00 23 106.54 -1.45 +26.8 OldNBcp .40 15 49.02 -.02 +11.6 Penney ... 17 43.20 +.38 +1.2 PennyMac 2.28 21 61.59 +.64 +42.6 PepsiCo 2.27 15 40.92 +.46 +16.5 ... 14 35.06 +.58 +21.3 PilgrimsP ... 10 42.02 -.10 +.9 RadioShk .12 23 20.23 +.32 +39.1 RegionsFn 3.00 14 87.07 -.11 -2.8 SbdCp 9 124.34 +.26 +15.0 SearsHldgs ... 21 38.79 -.07 +7.0 Sherwin 2.00 18 44.45 +.03 +19.0 SiriusXM .05e 22 107.00 +2.31 +66.5 SouthnCo 2.03 10 83.71 +.17 -3.1 SPDR Fncl .31e 18 13.85 ... +36.6 ... 11 81.32 -.12 -2.9 TecumsehB ... 17 89.67 -.27 +36.5 TecumsehA .68 32 59.49 +.19 +45.5 Torchmark 3.23e 12 17.44 +.09 +34.7 Total SA 21 16.25 +.12 +22.1 USEC rs ... 19 39.50 +.02 +13.4 US Bancrp .92 ... 16.41 +.34 +79.3 WalMart 1.88 18 24.45 +.31 +16.5 WellsFargo 1.20 19 21.98 +.16 +59.2 Wendys Co .20f 21 85.45 +.35 +34.6 WestlkChm .90f 13 23.74 +.35 +15.1 .88f 15 23.62 -.10 +22.4 Weyerhsr .23 21 96.36 -.07 +14.1 Xerox ... 14 40.55 +.87 +55.8 YRC Wwde ... 24 46.85 +.01 +31.9 Yahoo

PE Last 18 97.92 46 38.27 15 13.97 ... 13.74 6 21.94 19 81.66 14 16.88 ... 4.07 12 9.64 14 2823.66 ... 62.03 25 175.68 55 3.86 17 41.15 ... 20.52 ... 9.15 ... 9.53 13 72.80 ... 56.67 ... 9.55 13 37.52 15 75.15 12 42.85 ... 8.54 16 104.61 26 28.58 11 10.40 ... 18.21 9 30.00

Chg +.21 -.28 +.17 +.10 +.15 +.64 +.43 -.01 +.05 -.32 +.68 -1.82 +.03 +.21 +.10 +.30 +.25 -.10 -.34 -.31 +.01 +.37 -.04 +.07 -.16 -.19 ... -.45 +.38

YTD %Chg +11.0 +20.1 +17.7 -30.3 -13.2 +19.3 +133.1 +92.0 +35.2 +11.6 +50.0 +14.2 +33.6 -3.9 +25.2 +98.9 +106.3 +41.3 +9.0 -27.9 +17.5 +10.1 +25.4 +81.7 +31.9 +2.7 +52.5 +169.8 +50.8

... 21.18 +.17 6 18.72 +.65 dd 21.38 +.46 18 16.55 +.10 dd 32.95 +.29 62 89.89 +.30 q 19.57 -.02 q 37.74 -.37 dd 20.51 +.52 16 110.39 +.69 14 74.31 -.81 21 38.12 -.27 ... 16.16 +.18 ... 14.55 +.10 8 34.60 +.04 q 78.36 +.32 q 67.01 -.04 q 41.30 -.03 q 39.48 +.02 99 48.57 +.27 20 83.14 +.39 24 191.60 +2.22 ... 33.80 -.09 cc 23.99 +.99 15 3.05 -.04 dd 51.92 -.43 24 54.92 +.14 dd 13.84 +.28 MOST ACTIVE ($1 OR MORE) AINERS ($2 OR MORE) OSERS ($2 OR MORE) 14 21.91 +.13 Vol (00) Last Chg Name Last Chg %Chg Name Last Chg %Chg dd 15.15 +.21 Name 10 88.27 -.83 Facebook 901288 45.07 +2.56 KytheraBio 41.95 +8.42 +25.1 Galectin un 24.70 -6.70 -21.3 18 23.39 -1.02 Microsoft 707378 32.93 +.13 Repros wtA 26.10 +4.35 +20.0 Galectin wt 5.00 -.89 -15.1 12 18.83 +.09 BkofAm 706328 14.55 +.02 Air Inds 7.20 +1.17 +19.4 MethesE n 2.90 -.45 -13.4 16 54.78 +1.96 S&P500ETF 703140 171.07 +.76 Aeropostl 10.17 +1.56 +18.1 BerryPls n 21.87 -3.12 -12.5 40 58.14 +.43 iShJapan 463149 11.70 -.05 HorizPhm 3.25 +.48 +17.3 DigitalAlly 14.27 -1.95 -12.0 39 35.20 -.34 -.29 -11.8 iShEMkts 452961 41.53 -.09 iP LXR1K 186.79 +26.90 +16.8 RecovE h 2.16 32 8.54 +.04 Intel 359815 23.74 +.35 IntrntGold 8.67 +1.19 +15.9 Outerwall 49.49 -6.48 -11.6 54 11.88 +.08 3.72 +.51 +15.9 SutorTch h 2.02 -.26 -11.4 346729 24.45 +.31 TanzRy g q 47.64 +.09 GenElec 2.89 +.38 +15.1 Cvent n 40.01 -5.06 -11.2 335323 25.93 +.54 SinoGlob 14 27.10 -.02 MktVGold -.90 -11.1 26 47.99 +.49 SPDR Fncl 329768 20.52 +.10 B Comm 17.16 +2.23 +14.9 GoldResrc 7.24 15 10.67 +.32 dd 65.92 +3.16 YSE IARY ASDA IARY dd 5.54 -.21 2,064 Total issues 3,171 Advanced 1,704 Total issues 2,614 dd 27.03 +.61 Advanced 1,008 New Highs 157 Declined 794 New Highs 134 23 72.74 +.09 Declined 99 New Lows 33 Unchanged 116 New Lows 16 ... 32.38 +.53 Unchanged Volume 2,701,688,868 Volume 1,449,421,961 dd 3.27 +.18

MARKET SUMMARY G

N

L

D

Fed in the spotlight

Improved profit?

Investors will be listening today for any updates from the Federal Reserve on its bond-buying program. The central bank’s $85 billion in monthly bond purchases have helped keep long-term interest rates low and encouraged more borrowing and spending. The Fed is expected to announce plans for winding down the purchases after a two-day meeting of its Federal Open Market Committee, a 12member group that decides on central bank policy.

FedEx has been hurt by the sluggish global economy and cost-cutting by customers. Even so, Wall Street expects the package delivery company's latest quarterly results to show a slightly improved profit. FedEx's high-end express-delivery air service has suffered as consumers cut back by switching to cheaper but slower shipping options. The company reports fiscal first-quarter earnings today.

N

FDX 120

D

$110.68

$90.15

100

80

Operating EPS

’13

$1.45

est. $1.50

1Q ’12

1Q ’13

Price-earnings ratio:

23

based on trailing 12 months’ results

Dividend: $0.60 Div yield: 0.5% Source: FactSet

Wednesday, September 18, 2013

YOUR FUNDS YTD Name NAV Chg %Rtn AllianzGI NFJAllCpValIns15.03 +0.05 +20.0 NFJSmCVIs 36.60 +0.21 +22.2 American Beacon LgCpVlInv 25.60 +0.10 +24.6 LgCpVlIs 27.04 +0.11 +25.0 American Century EqIncInv 8.79 +0.03 +14.2 GrowthInv 31.93 +0.22 +18.8 UltraInv 32.15 +0.16 +23.5 ValueInv 7.69 +0.02 +22.0 American Funds AMCAPA m 26.59 +0.10 +25.2 BalA m 22.92 +0.08 +13.8 BondA m 12.37 +0.02 -3.0 CapIncBuA m 56.93 +0.13 +9.8 CapWldBdA m20.06 +0.03 -4.4 CpWldGrIA m 42.66 +0.05 +16.4 EurPacGrA m 45.75 -0.06 +11.0 FnInvA m 48.54 +0.24 +20.0 GrthAmA m 42.01 +0.18 +22.3 HiIncA m 11.23 ... +3.4 IncAmerA m 19.68 +0.06 +11.8 IntBdAmA m 13.40 ... -1.7 IntlGrInA m 34.38 -0.02 +11.0 InvCoAmA m 36.10 +0.09 +21.1 MutualA m 33.29 +0.12 +19.2 NewEconA m 36.34 +0.07 +27.8 NewPerspA m 36.49 +0.12 +16.7 NwWrldA m 57.54 +0.01 +5.6 SmCpWldA m 48.50 +0.19 +21.5 TaxEBdAmA m12.31 +0.01 -4.2 WAMutInvA m 37.56 +0.16 +21.6 Aquila ChTxFKYA m 10.46 ... -3.4 Artisan Intl d 28.25 -0.06 +14.9 IntlVal d 36.79 -0.17 +21.1 MdCpVal 26.40 +0.16 +27.0 MidCap 48.31 +0.29 +28.7 BBH TaxEffEq d 20.57 +0.07 +18.6 Baron Growth b 68.36 +0.58 +27.5 Bernstein DiversMui 14.25 ... -2.1 IntDur 13.32 +0.01 -3.6 TxMIntl 15.89 +0.01 +13.7 BlackRock Engy&ResA m 32.28 +0.32 +11.5 EqDivA m 22.66 +0.08 +14.9 EqDivI 22.72 +0.08 +15.1 GlobAlcA m 21.39 +0.05 +9.1 GlobAlcC m 19.87 +0.04 +8.5 GlobAlcI 21.49 +0.04 +9.2 HiYldBdIs 8.15 +0.01 +5.3 HiYldInvA m 8.15 +0.01 +5.0 Cohen & Steers Realty 66.23 -0.07 +3.8 Columbia AcornIntZ 45.95 +0.10 +13.7 AcornZ 36.66 +0.26 +21.9 DivIncZ 17.41 +0.05 +19.3 DivOppA m 10.14 +0.03 +17.7 DFA 1YrFixInI 10.32 ... +0.2 2YrGlbFII 10.05 ... +0.3 5YrGlbFII 10.98 -0.01 -1.1 EmMkCrEqI 19.44 +0.11 -3.4 EmMktValI 28.35 +0.17 -3.6 IntSmCapI 19.22 +0.01 +21.9 RelEstScI 26.81 -0.04 +3.1 USCorEq1I 15.25 +0.09 +24.8 USCorEq2I 15.14 +0.09 +25.5 USLgCo 13.44 +0.06 +21.4 USLgValI 28.87 +0.13 +27.5 USMicroI 18.69 +0.18 +28.4 USSmValI 33.33 +0.27 +27.5 USSmallI 28.85 +0.26 +27.9 USTgtValI 21.66 +0.16 +27.9 DWS-Scudder GrIncS 22.49 +0.11 +23.8 Davis NYVentA m 39.75 +0.14 +23.5 NYVentY 40.22 +0.13 +23.7 Dimensional Investme IntCorEqI 12.08 +0.02 +15.6 IntlSCoI 18.55 +0.02 +18.1 IntlValuI 18.79 +0.01 +16.0 Dodge & Cox Bal 91.86 +0.33 +18.9 Income 13.49 +0.02 -1.2 IntlStk 40.59 +0.02 +17.2 Stock 153.03 +0.69 +26.6 DoubleLine TotRetBdN b 10.86 ... -1.2 Dreyfus AppreciaInv 49.09 +0.18 +12.8 Driehaus ActiveInc 10.75 ... +1.8 FMI LgCap 20.76 +0.06 +21.4 FPA Cres d 32.31 +0.08 +15.3 NewInc d 10.42 ... +0.2 Fairholme Funds Fairhome d 40.95 +0.34 +30.2 Federated StrValI 5.63 +0.02 +15.6 ToRetIs 10.89 +0.01 -2.5 Fidelity AstMgr20 13.38 +0.03 +2.8 AstMgr50 17.78 +0.05 +8.8 Bal 22.57 +0.08 +12.7 BlChGrow 58.63 +0.38 +26.5 CapApr 36.25 +0.16 +23.4 CapInc d 9.54 ... +4.1 Contra 93.23 +0.47 +21.3 DivGrow 33.39 +0.16 +20.8 DivrIntl d 34.27 -0.05 +14.5 EqInc 56.06 +0.14 +20.3 EqInc II 23.07 +0.07 +19.6 FF2015 12.54 +0.02 +7.0 FF2035 13.09 +0.04 +13.3 FF2040 9.21 +0.02 +13.6 Fidelity 40.21 +0.13 +18.3 FltRtHiIn d 9.96 +0.01 +2.6 Free2010 15.04 +0.03 +6.8 Free2020 15.35 +0.03 +8.0 Free2025 13.02 +0.03 +10.4 Free2030 15.78 +0.04 +11.2 GNMA 11.16 ... -3.2 GrowCo 118.93 +0.84 +27.6 GrowInc 26.05 +0.10 +23.6 HiInc d 9.24 -0.01 +2.9 IntMuniInc d 10.16 ... -2.6 IntlDisc d 37.94 -0.04 +14.7 InvGrdBd 7.64 +0.01 -3.0 LatinAm d 39.57 +0.23 -14.6 LevCoSt d 40.25 +0.25 +25.4 LowPriStk d 46.83 +0.22 +24.5 Magellan 89.82 +0.41 +23.2 MidCap d 37.25 +0.26 +27.9 MuniInc d 12.62 ... -4.6 NewMktIn d 15.87 +0.03 -7.3 OTC 75.56 +0.64 +36.1 Puritan 21.70 +0.07 +12.7 RealInv d 32.86 -0.04 +3.5 ShTmBond 8.56 +0.01 +0.1 SmCapDisc d 29.67 +0.26 +27.7 StratInc 10.87 ... -1.8 Tel&Util 20.66 +0.15 +12.1 TotalBd 10.47 +0.01 -2.5 USBdIdx 11.34 +0.01 -3.1 USBdIdxInv 11.34 +0.01 -3.2 Value 95.91 +0.46 +25.6 Fidelity Advisor NewInsA m 27.84 +0.18 +22.4 NewInsI 28.23 +0.19 +22.6 StratIncA m 12.14 +0.01 -2.0 Fidelity Select Biotech d 172.96 +0.65 +57.3 HealtCar d 182.71 +0.65 +39.4 Fidelity Spartan 500IdxAdvtg 60.68 +0.26 +21.3 500IdxInstl 60.68 +0.25 +21.3 500IdxInv 60.67 +0.26 +21.3 ExtMktIdAg d 50.28 +0.42 +26.9 IntlIdxAdg d 39.14 -0.04 +14.2 TotMktIdAg d 50.30 +0.25 +22.3 First Eagle GlbA m 53.56 +0.03 +10.2 OverseasA m 23.69 -0.03 +7.6 Forum AbStratI 11.11 -0.02 +0.3 FrankTemp-Frank Fed TF A m 11.68 +0.01 -5.9 FrankTemp-Franklin CA TF A m 6.89 ... -5.7 GrowthA m 59.89 +0.23 +18.3 HY TF A m 9.77 +0.01 -8.0 HighIncA m 2.06 ... +3.4 Income C m 2.36 +0.01 +8.5

IncomeA m 2.34 +0.01 IncomeAdv 2.32 +0.01 NY TF A m 11.12 +0.01 RisDvA m 46.02 +0.10 StrIncA m 10.45 +0.01 USGovA m 6.47 ... FrankTemp-Mutual Discov Z 33.77 +0.02 DiscovA m 33.25 +0.01 QuestZ 19.01 +0.01 Shares Z 26.95 +0.05 SharesA m 26.69 +0.05 FrankTemp-Templeton Fgn A m 8.18 -0.02 GlBond C m 13.04 +0.03 GlBondA m 13.01 +0.02 GlBondAdv 12.97 +0.03 GrowthA m 23.44 -0.03 WorldA m 19.01 -0.01 Franklin Templeton FndAllA m 12.78 +0.02 GE S&SUSEq 55.53 +0.22 GMO EmgMktsVI d 11.17 +0.05 IntItVlIV 24.03 -0.02 QuIII 25.60 +0.04 QuVI 25.62 +0.04 Goldman Sachs HiYieldIs d 7.24 +0.01 MidCpVaIs 49.00 +0.30 ShDuTFIs 10.49 +0.01 Harbor Bond 11.99 +0.01 CapApInst 52.22 +0.32 IntlInstl 68.96 +0.11 IntlInv b 68.14 +0.11 Hartford CapAprA m 44.52 +0.19 CpApHLSIA 55.32 +0.24 DvGrHLSIA 25.62 +0.07 INVESCO CharterA m 21.62 +0.08 ComstockA m 22.05 +0.07 EqIncomeA m 10.78 +0.03 GrowIncA m 26.02 +0.10 HiYldMuA m 9.03 ... Ivy AssetStrA m 29.40 ... AssetStrC m 28.52 -0.01 JPMorgan CoreBdUlt 11.56 +0.02 CoreBondA m 11.55 +0.01 CoreBondSelect11.54 +0.01 HighYldSel 8.09 ... LgCapGrA m 28.64 +0.17 LgCapGrSelect28.63 +0.17 MidCpValI 34.24 +0.17 ShDurBndSel 10.89 ... USEquit 13.77 +0.06 USLCpCrPS 27.39 +0.11 Janus BalT 29.26 +0.08 GlbLfScT 42.38 +0.28 PerkinsMCVT 25.28 +0.10 John Hancock LifAg1 b 15.18 +0.07 LifBa1 b 14.87 +0.04 LifGr1 b 15.49 +0.06 Lazard EmgMkEqtI d 19.26 +0.12 Legg Mason/Western AggGrowA m 168.27 +0.78 CrPlBdIns 11.12 +0.01 Longleaf Partners LongPart 32.06 +0.17 SmCap 35.36 +0.11 Loomis Sayles BdInstl 15.05 +0.05 BdR b 14.99 +0.05 Lord Abbett AffiliatA m 14.56 +0.07 BondDebA m 8.14 +0.01 ShDurIncA m 4.55 ... ShDurIncC m 4.58 ... MFS IsIntlEq 21.49 -0.01 TotRetA m 16.87 +0.05 ValueA m 31.34 +0.12 ValueI 31.50 +0.12 MainStay HiYldCorA m 6.01 ... Manning & Napier WrldOppA 8.80 +0.02 Matthews Asian China d 24.11 +0.11 India d 14.52 -0.08 Merger Merger b 16.15 +0.01 Metropolitan West TotRetBdI 10.51 +0.01 TotRtBd b 10.51 +0.01 Morgan Stanley IntlEqI d 16.14 -0.04 MdCpGrI 44.14 +0.30 Munder Funds MdCpCrGrY 40.58 +0.25 Natixis LSInvBdY 12.11 +0.03 LSStratIncA m 15.92 +0.05 LSStratIncC m16.01 +0.05 Neuberger Berman GenesisInstl 60.70 +0.48 Northern HYFixInc d 7.49 ... StkIdx 21.16 ... Oakmark EqIncI 33.21 +0.12 Intl I 25.86 -0.02 Oakmark I 60.50 +0.28 Select I 38.31 +0.24 Oberweis ChinaOpp m 15.23 +0.09 Old Westbury GlbSmMdCp 16.79 +0.05 LgCpStr 11.62 +0.01 Oppenheimer DevMktA m 36.89 +0.17 DevMktY 36.54 +0.17 GlobA m 76.17 +0.19 IntlBondA m 6.05 ... IntlBondY 6.05 ... IntlGrY 36.19 +0.03 MainStrA m 44.33 +0.30 RocMuniA m 14.66 -0.01 SrFltRatA m 8.38 ... StrIncA m 4.11 ... Osterweis OsterStrInc d 11.78 ... PIMCO AAstAAutP 10.25 +0.01 AllAssetI 12.22 +0.02 AllAuthA m 10.24 +0.01 AllAuthC m 10.22 +0.01 AllAuthIn 10.24 ... ComRlRStI 5.68 -0.02 DivIncInst 11.46 +0.01 EMktCurI 10.14 +0.02 EmMktsIns 11.19 +0.03 ForBdInstl 10.50 +0.01 HiYldIs 9.46 ... InvGrdIns 10.44 +0.02 LowDrIs 10.24 ... RERRStgC m 3.64 +0.01 RealRet 11.09 +0.05 ShtTermIs 9.82 ... TotRetA m 10.68 +0.01 TotRetAdm b 10.68 +0.01 TotRetC m 10.68 +0.01 TotRetIs 10.68 +0.01 TotRetrnD b 10.68 +0.01 TotlRetnP 10.68 +0.01 PRIMECAP Odyssey AggGr 28.13 +0.21 Parnassus EqIncInv 35.40 +0.17 Permanent Portfolio 47.24 +0.01 Pioneer PioneerA m 39.54 +0.16 Principal DivIntI 11.27 ... L/T2020I 13.81 ... L/T2030I 13.97 ... LCGrIInst 12.15 ... Prudential Investmen JenMidCapGrZ 38.79 +0.25 Putnam GrowIncA m 18.45 +0.08 NewOpp 72.17 +0.46 Royce PAMutInv d 14.08 +0.11 PremierInv d 22.62 +0.16 Russell StratBdS 10.83 +0.01

Eye on home construction The pace of home construction has accelerated this year as sales of new homes have increased. Over the 12 months ended in July, builders broke ground on 15 percent more single-family homes than a year earlier. For August, economists anticipate the pace of so-called housing starts accelerated, even as mortgage rates rose. The Commerce Department reports today its tally of homes that builders broke ground on last month.

+9.0 +8.7 -5.9 +21.7 +0.6 -2.6 +18.5 +18.2 +17.6 +20.4 +20.1 +19.1 -0.4 -0.1 +0.1 +20.6 +20.8 +16.2 +25.0 -4.9 +15.7 +16.5 +16.6 +3.7 +24.7 -0.5 -2.9 +22.8 +11.0 +10.7 +29.4 +27.5 +22.0 +20.4 +24.7 +18.4 +25.0 -7.2 +13.6 +13.0 -2.5 -2.8 -2.7 +3.5 +19.4 +19.5 +22.3 -0.3 +23.4 +23.8 +12.4 +41.6 +18.5 +17.8 +10.4 +15.0 -1.4 +33.1 -2.7 +21.5 +22.4 +2.7 +2.5 +22.0 +4.1 +0.4 +11.6 +12.4 +24.7 +24.9 +3.0 +13.6 +2.7 -17.1 +2.0 -1.2 -1.5 +12.5 +27.1 +23.9 -1.2 +5.9 +5.3 +24.6 +3.7 +20.8 +16.5 +23.6 +24.7 +23.7 +37.0 +16.1 +16.0 +4.5 +4.8 +18.1 -5.6 -5.4 +17.8 +19.6 -10.1 +4.4 -2.1 +4.5 -6.1 -1.3 -6.3 -6.8 -6.1 -13.5 -3.2 -2.7 -7.3 -1.1 +2.4 -3.5 -1.2 -11.2 -8.9 +0.1 -3.5 -3.4 -4.0 -3.2 -3.4 -3.3 +44.4 +21.9 -2.9 +22.5 +10.2 +9.4 +11.8 +23.1 +19.6 +25.3 +23.3 +22.4 +18.1 -2.9

Schwab 1000Inv d 46.80 +0.21 S&P500Sel d 26.91 +0.11 Scout Interntl 35.79 ... Selected American D 48.25 +0.18 Sequoia Sequoia 207.15 +0.84 T Rowe Price Balanced 22.87 +0.05 BlChpGr 57.12 +0.35 CapApprec 25.77 +0.06 EmMktBd d 12.62 +0.02 EmMktStk d 32.46 +0.05 EqIndex d 46.11 +0.19 EqtyInc 31.67 +0.12 GrowStk 46.67 +0.26 HealthSci 57.44 +0.28 HiYield d 7.01 +0.01 InsLgCpGr 24.19 +0.14 IntlBnd d 9.46 +0.01 IntlGrInc d 14.85 -0.03 IntlStk d 15.67 ... LatinAm d 33.34 +0.31 MidCapE 39.26 +0.27 MidCapVa 29.26 +0.14 MidCpGr 72.06 +0.49 NewAsia d 16.33 -0.02 NewEra 46.13 +0.10 NewHoriz 45.41 +0.39 NewIncome 9.33 +0.01 OrseaStk d 9.66 -0.02 R2015 14.10 +0.03 R2025 14.87 +0.05 R2035 15.54 +0.05 Rtmt2010 17.66 +0.04 Rtmt2020 19.93 +0.05 Rtmt2030 21.74 +0.06 Rtmt2040 22.31 +0.07 ShTmBond 4.78 ... SmCpStk 43.11 +0.41 SmCpVal d 46.94 +0.47 SpecInc 12.77 +0.02 Value 33.27 +0.14 TCW EmgIncI 8.34 ... TotRetBdI 9.89 ... TIAA-CREF EqIx 13.22 +0.07 IntlE d 18.55 +0.01 Templeton InFEqSeS 21.95 -0.06 Thornburg IncBldA m 20.06 +0.05 IncBldC m 20.06 +0.06 IntlValA m 29.97 -0.02 IntlValI 30.63 -0.03 Tweedy, Browne GlobVal d 26.56 -0.04 VALIC Co I StockIdx 31.60 +0.13 Vanguard 500Adml 157.86 +0.67 500Inv 157.82 +0.67 BalIdxAdm 26.30 +0.10 BalIdxIns 26.30 +0.10 CAITAdml 11.19 +0.01 CapOpAdml 103.56 +0.41 DevMktsIdxIP 115.44 +0.11 DivGr 20.07 +0.04 EmMktIAdm 34.46 +0.23 EnergyAdm 124.65 +0.36 EnergyInv 66.38 +0.19 EqInc 28.82 +0.10 EqIncAdml 60.41 +0.21 ExplAdml 97.63 +0.80 Explr 104.86 +0.86 ExtdIdAdm 58.20 +0.48 ExtdIdIst 58.20 +0.48 ExtdMktIdxIP 143.64 +1.18 FAWeUSIns 95.79 +0.22 GNMA 10.39 ... GNMAAdml 10.39 ... GlbEq 22.04 +0.08 GrthIdAdm 43.78 +0.24 GrthIstId 43.78 +0.24 GrthIstSg 40.54 +0.23 HYCor 5.92 ... HYCorAdml 5.92 ... HltCrAdml 77.02 -0.02 HlthCare 182.52 -0.04 ITBondAdm 11.14 +0.01 ITGradeAd 9.69 +0.02 ITrsyAdml 11.19 +0.01 InfPrtAdm 26.01 +0.11 InfPrtI 10.59 +0.04 InflaPro 13.24 +0.05 InstIdxI 156.82 +0.66 InstPlus 156.83 +0.66 InstTStPl 39.20 +0.20 IntlGr 21.94 ... IntlGrAdm 69.83 +0.01 IntlStkIdxAdm 26.99 +0.06 IntlStkIdxI 107.93 +0.24 IntlStkIdxIPls 107.95 +0.23 IntlStkIdxISgn 32.37 +0.07 IntlVal 35.54 +0.06 LTGradeAd 9.52 +0.05 LTInvGr 9.52 +0.05 LifeCon 17.69 +0.05 LifeGro 26.26 +0.10 LifeMod 22.29 +0.07 MidCapIdxIP 139.36 +0.77 MidCp 28.16 +0.15 MidCpAdml 127.90 +0.71 MidCpIst 28.25 +0.15 MidCpSgl 40.36 +0.22 Morg 24.43 +0.13 MorgAdml 75.78 +0.40 MuHYAdml 10.45 +0.01 MuInt 13.64 +0.01 MuIntAdml 13.64 +0.01 MuLTAdml 10.94 +0.01 MuLtdAdml 10.98 ... MuShtAdml 15.83 ... PrecMtls 11.06 -0.01 Prmcp 88.29 +0.31 PrmcpAdml 91.63 +0.32 PrmcpCorI 18.83 +0.06 REITIdxAd 94.98 -0.11 REITIdxInst 14.70 -0.02 STBondAdm 10.49 +0.01 STBondSgl 10.49 +0.01 STCor 10.67 +0.01 STFedAdml 10.68 +0.01 STGradeAd 10.67 +0.01 STIGradeI 10.67 +0.01 STsryAdml 10.68 +0.01 SelValu 27.35 +0.16 SmCapIdx 48.89 +0.38 SmCpIdAdm 48.96 +0.38 SmCpIdIst 48.96 +0.38 SmCpIndxSgnl 44.11 +0.34 Star 22.95 +0.07 StratgcEq 27.26 +0.18 TgtRe2010 25.42 +0.06 TgtRe2015 14.47 +0.04 TgtRe2020 26.25 +0.09 TgtRe2030 26.52 +0.10 TgtRe2035 16.21 +0.06 TgtRe2040 26.91 +0.11 TgtRe2045 16.89 +0.06 TgtRe2050 26.80 +0.11 TgtRetInc 12.45 +0.03 Tgtet2025 15.19 +0.05 TotBdAdml 10.55 +0.01 TotBdInst 10.55 +0.01 TotBdMkInv 10.55 +0.01 TotBdMkSig 10.55 +0.01 TotIntl 16.13 +0.03 TotStIAdm 43.26 +0.23 TotStIIns 43.26 +0.22 TotStISig 41.75 +0.22 TotStIdx 43.23 +0.22 TxMCapAdm 86.93 +0.44 ValIdxAdm 27.92 +0.11 ValIdxIns 27.92 +0.11 WellsI 24.93 +0.05 WellsIAdm 60.41 +0.12 Welltn 37.82 +0.09 WelltnAdm 65.33 +0.16 WndsIIAdm 62.62 +0.26 Wndsr 18.93 +0.05 WndsrAdml 63.88 +0.16 WndsrII 35.29 +0.15 Virtus EmgMktsIs 9.70 ... Waddell & Reed Adv AccumA m 9.93 +0.06 SciTechA m 15.20 +0.14 Yacktman Focused d 24.81 +0.04 Yacktman d 23.21 +0.04

Housing starts seasonally adjusted annual rate, in millions 1

1.01

est. .91

.91 .89

.9

.85

.84

.8 M

A

M

J

J

A

Source: FactSet

+21.7 +21.3 +8.4 +23.1 +23.1 +11.9 +25.2 +15.8 -7.8 -4.7 +21.1 +20.8 +23.5 +39.3 +4.9 +28.1 -4.8 +14.6 +8.8 -12.4 +28.3 +21.7 +27.6 -2.9 +10.1 +36.9 -3.5 +13.6 +9.5 +13.3 +16.1 +7.2 +11.5 +14.9 +16.9 -0.3 +26.7 +19.8 +0.6 +26.1 -7.0 -0.9 +22.4 +14.3 +12.1 +10.4 +9.9 +9.9 +10.2 +14.3 +21.1 +21.3 +21.2 +11.7 +11.7 -2.4 +33.4 +14.6 +21.8 -4.9 +12.4 +12.4 +21.0 +21.0 +32.1 +31.9 +26.9 +27.0 +27.0 +9.0 -3.2 -3.1 +18.1 +20.2 +20.2 +20.2 +0.9 +1.0 +30.6 +30.6 -4.6 -3.1 -3.3 -8.4 -8.4 -8.5 +21.4 +21.4 +22.6 +13.9 +14.0 +9.5 +9.5 +9.5 +9.4 +14.0 -8.9 -8.9 +5.2 +13.8 +9.5 +25.5 +25.3 +25.5 +25.5 +25.4 +22.8 +22.9 -4.8 -3.1 -3.0 -4.7 -0.3 +0.2 -30.6 +27.1 +27.1 +26.1 +3.6 +3.6 -0.4 -0.4 -0.1 -0.6 -0.2 +30.4 +26.2 +26.3 +26.3 +26.3 +11.1 +27.1 +5.3 +8.1 +10.2 +13.4 +15.0 +16.1 +16.1 +16.1 +2.9 +11.8 -3.1 -3.1 -3.2 -3.1 +9.3 +22.5 +22.4 +22.5 +22.4 +22.2 +23.2 +23.2 +5.0 +5.0 +13.2 +13.2 +21.4 +25.9 +26.0 +21.4 -5.6 +21.2 +36.4 +20.9 +21.4


Daily Corinthian • Wednesday, September 18, 2013 • 9A

Mom charged with killing Newtown activists 2 children asks for death again lobby on guns Associated Press

SANTA ANA, Calif. — A woman charged with killing her 13-year-old autistic son and 9-year-old daughter in the midst of a custody dispute asked a judge for the death penalty Tuesday during her first court appearance since her arrest. Appearing disheveled, her head down and hands behind her back, 42-year-old Marilyn Edge appeared by video link for an arraignment on two counts of murder with special circumstances. When Orange County Superior Court Judge Craig Robison asked Edge if she wanted her arraignment postponed to Oct. 25, she twice said, “Only if you promise me the death penalty.” The judge postponed the arraignment. A phone call by The Associated Press for comment from Edge’s attorney, Deputy Public Defender Arlene Speiser, was not immediately returned. Authorities haven’t released many details of the case, but one of the special circumstances filed by prosecutors alleges the children, daughter Faith and son Jaelen, were poisoned. Edge, of Scottsdale,

Ariz., lost custody of them on Wednesday in a Georgia case, then texted her ex-husband, Mark Edge, two days later that she would bring the children back on Sunday, his attorney Marian Weeks said. The children were found Saturday in a Santa Ana hotel room. Mark Edge was informed about the death of the children early Sunday by Atlanta police and was taken to a hospital for duress. “He’s emotionally, extremely distressed,” Weeks said. “He is getting better. His whole focus right now is on the children.” Marilyn Edge could be eligible for the death penalty if convicted. She was driving a car that crashed Saturday into an electrical box outside a shopping complex in Costa Mesa. She refused to get out of the car and tried to choke herself with an electrical cord as rescuers attempted to free her, Santa Ana police Cpl. Anthony Bertagna said. Police found propane in the car but wouldn’t say whether there was a suicide note. Authorities said Edge told investigators they could find her children’s bodies at the hotel.

The Edges were married for less than 10 years and divorced in December 2007, Weeks said. Marilyn Edge claimed her former husband, who routinely traveled to Afghanistan where he worked as a contractor, failed to make child support payments, according to court records. Marilyn Edge was given full custody of her children in October 2009, a ruling that was later set aside after Mark Edge contended he wasn’t aware of a court hearing because he was overseas and documents were sent to a wrong address. However, the Georgia Supreme Court later found there wasn’t enough evidence to set aside the ruling.

Associated Press

NEWTOWN, Conn — Activists from the Connecticut town where 26 people were gunned down in a mass shooting at an elementary school in December headed to Washington on Tuesday to lobby again for gun control, a trip that took on new urgency in the wake of the massacre in the capital that killed 13, including the gunman. The trip by about 50 members of the Newtown Action Alliance was planned to mark roughly nine months since the Dec. 14 rampage, in which 20 children and six educators were shot to death, and it now also quickly follows Monday’s killings

at the Washington Navy Yard. The group will ask Congress to require background checks for gun buyers. Members of the group focused their criticism on Congress, where an effort to enact new background checks fell short in the Senate in April. “This is really what this is all about — our broken political system,” founder David Ackert told the Hearst Connecticut Media Group. Carlos Soto, the brother of a teacher who was one of six educators killed in Newtown, criticized lawmakers for failing to impose tougher gun regulations since the shootings. “It’s been nine months

and there’s still no action on the federal level,” he told WFSB-TV. “We’re not gonna go away.” Several parents of children killed at the Sandy Hook Elementary School lobbied Congress earlier this year. The activists now hope lawmakers may be motivated to act now because the killings at the Navy Yard were close to Capitol Hill. “It definitely brings back terrible feelings, and we know what the families are going through,” Ackert said. “It exacerbates the reason we’re going, and we’re determined to get the politicians to stop looking the other way, now that it’s come to their doorstep.”

CARING FOR YOU ...and Your Family! Professional Dependable • Friendly Affordable Let the reliable, professional staff at Whitfield Nursing Home show you how we use experience and resources to make your stay as enjoyable and comfortable as possible.

WHITFIELD NURSING HOME, INC

“WE ARE FAMILY TREATING YOU LIKE FAMILY..”

662-286-3331 • 2101 E. Proper St.

SEPTEMBER 17-21 CROSSROADS ARENA ‚ CORINTH f revol f O r ve m Chee inis r y

Magnolia Car Show

Bluegrass Show

Rodeo

th u o S Mid t Show Talen Beauty Pageant Sho Cattle wm a Clin nship ic

PETTING ZOO

Protect what’s most important What would happen to your family if something happens to you? Help ensure their financial security with life insurance from your Modern Woodmen representative. Modern Woodmen of America offers financial products and fraternal benefits. Call today to learn more.

g n i k l i tion M t a Go onstra Dem ower M n w a L

Pull

Livestock Show

Antiqu e Tracto rs

Duck Dynasty Saturday ‚ 5pm til 7pm

CARNIVAL • ARTS & QUILTS • Baked & Canned Goods

For More Information gotowww.alcornfair.com Jonathan Marsh, FIC*,FIC* CFFM Jonathan Marsh, Managing 710 CruisePartner St, 710 SuiteCruise 102 St, Suite 102 Corinth MS 38834 Corinth, MS 38834 662-287-4756 662-665-7904 Jonathan.Marsh@mwarep.org Jonathan.Marsh@mwarep.org

Agent name* address city, state phone Modern Woodmen email

Steven Eaton,

Agent name* address city, state phone Modern Woodmen email

Financial Representative 710 Cruise St, Suite 102 Corinth MS 38834 662-415-9427 steven.eaton@mwarep.org

or call662-284-5569 or 662-808-6329

modern-woodmen.org FAM0408

*Registered representative. Securities offered through MWA Financial Services Inc., a wholly owned subsidiary of Modern Woodmen of America, 1701 1st Avenue, Rock Island, IL 61201, 309-558-3100. Member: FINRA, SIPC.

HISTORY IS ONLY HALF OUR STORY


10A • Wednesday, September 18, 2013 • Daily Corinthian

WEDNESDAY EVENING C A WATN ^ ^ WREG # # QVC $ . WCBI

$

WMC

% %

WLMT & > WBBJ _ _ WTVA ) ) WKNO * WGN-A + ( WMAE , , WHBQ ` ` WPXX / WPIX

:

MAX

0 3

SHOW 2 HBO

4 1

MTV

5 2

ESPN

7 ?

SPIKE 8 5 USA

: 8

NICK

; C

DISC

< D

A&E

>

FSSO

? 4

BET

@ F

H&G

C H

E! HIST

D E B

ESPN2 F @ TLC G FOOD H INSP I LIFE

J =

TBN

M

AMC

N 0

FAM

O <

TCM

P

TNT

Q A

TBS

R *

GAME TOON TVLD SPEED

S T U K Z

FX

Æ ;

OUT NBCS OWN FOXN APL

Ø ∞ ± ≤ ≥

HALL

∂ G

DISN

“ L

SYFY

E

7 PM

7:30

SEPTEMBER 18, 2013 8 PM

8:30

9 PM

9:30

10 PM

10:30

11 PM

11:30

The Middle The Middle Modern Modern Nashville Local 24 (:35) Jimmy Kimmel (:37) NightFamily Family News Live (N) line Survivor Loved ones compete against Big Brother (N) News Ch. 3 Late Show With David Ferguson each other. (N) Letterman In the Kitchen With David Now That’s Cool With Jane Vicenza Style Survivor Loved ones compete against Big Brother (N) News Late Show With David Ferguson each other. (N) Letterman The Million Second Quiz America’s Got Talent The winner is announced. News The Tonight Show With Jimmy “Day 9” (N) (N) (L) Jay Leno (N) Fallon Arrow Laurel makes a Supernatural “Sacrifice” CW30 News at 9 (N) The Arsenio Hall Show House of Meet the decision. Payne Browns The Middle The Middle Modern Modern Nashville News (:35) Jimmy Kimmel (:37) NightFamily Family Live (N) line The Million Second Quiz America’s Got Talent The winner is announced. News (N) The Tonight Show With Jimmy “Day 9” (N) (N) (L) Jay Leno (N) Fallon Earthflight, A Nature NOVA “Why Ships Sink” Brains on Trial With Waiting for You’ve Tavis Newsline Special Alan Alda (N) God Gone Smiley EngageEngageEngageEngageWGN News at Nine (N) How I Met EngageEngageParks/Recment ment ment ment ment ment reat Earthflight, A Nature NOVA “Why Ships Sink” Brains on Trial With Inside Miss Charlie Rose (N) World Special Alan Alda (N) News The X Factor “Auditions No. 3” Auditions continue. Fox 13 News--9PM (N) Fox 13 TMZ Dish Nation Access (N) News (N) Hollyw’d WWE Main Event Flashpoint Flashpoint Flashpoint Flashpoint Arrow Laurel makes a Supernatural “Sacrifice” PIX News at Ten (N) The Arsenio Hall Show Seinfeld Love-Raydecision. mond Strike Back Girl’s (:45) Erotic Karma (12, Adult) India } ›› Battleship (12) Earth comes under attack Guide Summer, Kiara Diane. from a superior alien force. Ray Donovan “Bucky Inside the NFL (N) Dexter “Monkey in a Box” Inside the NFL History of the Eagles F... Dent” The Newsroom Boardwalk Empire “Res- Real Time With Bill (6:00) } ›› In Time } ›› Safe House (12, ignation” Maher (11) Action) Ridic. Ridic. The Challenge The Challenge The Challenge Catfish: The TV (6:00) MLB Baseball: Teams TBA. (N) (Live) MLB Baseball: Los Angeles Dodgers at Arizona Diamondbacks. From Chase Field in Phoenix. (N) (Live) } ››› The Rundown (03) The Rock. A bounty hunter must find (:35) } ›› Walking Tall A sheriff and a deputy try } The his boss’ son in the Amazon. to rid their town of thugs. Rundown NCIS “Ships in the Night” NCIS A murder at a col- NCIS “A Man Walks Into Suits “Stay” An old nem- Preview Law & lege fair. a Bar ...” esis returns. Show Order Full H’se Full H’se Full H’se Full H’se Full H’se Full H’se Full H’se Full H’se Friends Friends The Mystery of Flight Argo: Inside Story America’s Hidden Se- Argo: Inside Story America’s Hidden 800 (N) crets (N) Secrets Duck Dy- Duck Dy- Duck Dy- Duck Dy- Duck Dy- (:31) Bad (:01) Bad (:31) Bad Duck Dy- Duck Dynasty nasty nasty nasty nasty (N) Ink (N) Ink Ink nasty nasty (6:00) College Football: Iowa at Iowa State. SEC Gridiron LIVE (N) FOX Sports Live (N) UFC Countdown From (Live) (Live) Toronto. (N) Game Game Scandal Scandal The Sheards Wendy Williams Buying and Selling Property Brothers “Mark House Hunters Property Brothers Property Brothers “Mark & Priscilla” Hunters Int’l & Priscilla” E! Special Kardashian Soup Soup Chelsea E! News Chelsea American Pickers American Pickers “White Mountain Men “JudgGreat San- Great San- (:01) American Pickers “Knuckleheads” Knuckles” ment Day” tinis tinis Hispanic Spec Hey Rookie RGIII: Will to Win SportsCenter (N) Olbermann (N) Toddlers & Tiaras (N) Cheer Perfection (N) Here Comes Honey Toddlers & Tiaras Cheer Perfection Boo Boo Restaurant: Impossible Restaurant Stakeout (N) Mystery Thieves, Restaurant: Impossible Restaurant Stakeout “Valley Inn” Diners Inc. (N) Little House/Prairie The Waltons Matlock Matlock Medicine Woman } ››› Julie & Julia (09) Meryl Streep, Amy Adams. A woman vows to make (:01) Devious Maids (:02) } ››› Julie & every recipe in Julia Child’s cookbook. Julia (09) Behind Turning Prince End Praise the Lord Good Duplantis } ››› Erin Brockovich (00) Julia Roberts. A woman probes a power com- (:01) } ›› National Treasure (04, Adventure) pany cover-up over poisoned water. Nicolas Cage, Hunter Gomez. Fresh Fresh } Failure } ›› Burlesque (10, Drama) Cher. A small-town gal finds her The 700 Club Prince Prince niche at a neoburlesque club. } ›› The Seven Hills of Rome (58, Musical) } ›› For the First Time (59, Musical) Mario } ››› The Great CaMario Lanza, Renato Rascel. Lanza, Zsa Zsa Gabor. ruso (51) Castle “Setup” Castle “Countdown” Castle A writer on a soap The Mentalist “Red The Mentalist “Redempopera is killed. John’s Footsteps” tion” Family Guy Family Guy Big Bang Big Bang Big Bang Big Bang Conan (N) The Office Conan Theory Theory Theory Theory FamFeud FamFeud FamFeud FamFeud FamFeud FamFeud FamFeud FamFeud Baggage Baggage Annoying Total King/Hill Cleve American American Fam Guy Fam Guy Chicken Heart Boston Legal Raymond Raymond Cleve The Exes Friends Friends King of Queens Car Warriors Wrecked Wrecked Pinks Pinks Car Warriors Wrecked Wrecked The Bridge (N) The Bridge The Bridge “Old Friends” (6:00) } ››› Moneyball A baseball manager challenges old-school traditions. Stories Shooting USA Shots Rifleman Streams Stories ATK Shooting USA Star-Spangled Star-Spangled NFL Turning Point NFL Turning Point Playbook NFL Worse Worse Worse Worse Worse Worse Worse Worse Worse Worse The O’Reilly Factor Hannity (N) Greta Van Susteren The O’Reilly Factor Hannity Monsters Inside Me Monsters Inside Me Monsters Inside Me Monsters Inside Me Monsters Inside Me Garage Sale Mystery (13, Mystery) Lori Loughlin, Frasier Frasier Frasier Frasier Golden Golden Andrew Dunbar. Girls Girls Jessie Jessie gets a big Liv & Mad- GoodShake It Austin & Dog With a Jessie } ›› Gotta Kick It Up surprise. die Charlie Up! Ally Blog Susan Egan. Paranormal Witness Paranormal Witness (N) Ghost Mine “Phantom Paranormal Witness Ghost Mine “Phantom Intruder” (N) Intruder”

Coming Up In The Daily Corinthian Like to eat out? The Daily Corinthian’s full color, quarterly Dining Guide magazine will be in the Friday, Sept. 27 edition. Watch for it.

Girl can conquer shyness if she reaches out to others DEAR ABBY: I’m a 14-year-old girl who just started high school. I started to notice boys when I was in middle school, and I’d like to start dating soon. The problem is I’ve never had a close friend who was a boy, and the idea isn’t natural to me. How can I ask a boy out if I don’t even grasp the concept of being friends with one? I’m frustrated over this, especially because I really like one particular guy. The only advice I have been given is, “Get over your fear and just talk to him.” This isn’t very helpful to me. I want to know how to get over my fear! Abby, your thoughts would be appreciated. -- CAN’T FIND THE NERVE IN OHIO DEAR CAN’T FIND THE NERVE: I’ll gladly share some thoughts. The first is I hope you realize how many girls and guys your age feel EXACTLY the same way you do. Social skills don’t come naturally to everyone -- but they can be learned. And like any learned skill, they take practice. The surest cure for shyness -- which is the “fear” you are experiencing -- is to forget about yourself and concentrate on the other person. Smile and introduce yourself if the guy doesn’t know you. If you share a class

with him or know an activity he’s involved in, ask a question about it. He’s not good at sports? Not Abigail musical? Ask about a Van Buren him class assignment. Dear Abby You don’t have to be brilliant or witty. Try leading off with a friendly remark or a compliment. (”Nice shirt, cellphone,” etc.) I know very few people who don’t appreciate a compliment. Overcoming shyness takes practice, so don’t go after the boy you “really like” at first. Make a point of smiling and saying hello to everyone. It’s friendly, it’s welcoming. Keep in mind that the majority of people have the same insecurities you do. Many of them will respond positively because they appreciate being noticed. That’s how you make friends of both genders. I have a booklet that offers even more suggestions. The title is “How to Be Popular,” and it contains hints for polishing social skills for people of all ages.

It can be ordered by sending your name and address, plus check or money order for $7 (U.S. funds) to Dear Abby Popularity Booklet, P.O. Box 447, Mount Morris, IL 61054-0447. Shipping and handling are included in the price. Remember, you don’t have to be the prettiest or smartest girl in school. But you CAN be one of the nicest. Show an interest in others. Be honest but always tactful. Cultivate your own interests so you will have something to talk about with others. If there are clubs at your school, join the ones that interest you. It’s another way of making friends of both sexes. Most young people go out in groups these days. So, if you and some friends plan to do something (and after you have been friendly and let the young man you like notice you), smile and ask if he’d like to come along. If he’s shy, it’s a way of making him feel less self-conscious, too. Good luck! (Dear Abby is written by Abigail Van Buren, also known as Jeanne Phillips, and was founded by her mother, Pauline Phillips. Write Dear Abby at www.DearAbby.com or P.O. Box 69440, Los Angeles, CA 90069.)

Horoscopes ARIES (March 21-April 19). Of course you can be mad at someone and still love that person, but young and emotionally immature people don’t understand this as well as others do. Declare your love often regardless of your momentary feelings. TAURUS (April 20-May 20). Take those things that you are obligated to do off of your list. Obligation just isn’t a strong enough motivator to get you to take action now. You’ll be too busy addressing that which is urgent or fascinating. GEMINI (May 21-June 21). If your focus seems fuzzy or your attitude is at half-mast, don’t go forward. Go for total engagement or none at all. A determined effort is needed if you are to avoid wasting your time. CANCER (June 22-July 22). Someone is purposely keeping you in the dark because he or she is afraid of your possible reaction. When there’s little else to go on, let your keen instinct take over.

LEO (July 23-Aug. 22). You don’t have to do anything you don’t want to do, as long as you are strong enough to believe it -and you certainly are! You’ll get the chance to show your backbone. VIRGO (Aug. 23-Sept. 22). If you realize that someone is rating you on your looks, success or status rather than on their experience of you as a person, you are being objectified. Steer people to the real you, not the you on paper. LIBRA (Sept. 23-Oct. 23). Your physical travels mirror your mental travels. Your thoughts will take you all over the map. Every time you land someplace new today, recognize those thoughts that are responsible for the journey. SCORPIO (Oct. 24-Nov. 21). Love is the magic ingredient of success. If you apply skill, money and talent to a project but do not apply love, you won’t find as much success as you would if you applied nothing more than

love. SAGITTARIUS (Nov. 22-Dec. 21). You can only come at a relationship from your own point of view, but at least you recognize that others think differently. That you care enough to ask about their experience of things will matter. CAPRICORN (Dec. 22-Jan. 19). Don’t cheat yourself! Being generous is one thing, but giving like you don’t even exist will ultimately be a detriment to all. Claim what you need, and hold on to it. AQUARIUS (Jan. 20-Feb. 18). Nothing will be written in stone today. You may choose and then change your mind, speak and then retract, claim and then trade your claim for another. Stay versatile. PISCES (Feb. 19-March 20). Utterly narcissistic people don’t see themselves as lacking empathy. Your pointing it out will make no difference. Navigate the interaction by accepting the limitations of this type.


NATIONWIDE SERIES

CAMPING WORLD TRUCKS

Race: Kentucky 300 Where: Kentucky Speedway When: Saturday, 7:30 p.m. (ET) TV: ESPNews 2012 Winner: Austin Dillon

Race: Smith’s 350 Where: Las Vegas Speedway When: Sept. 28, 8:30 p.m. (ET) TV: Fox Sports 1 2012 Winner: Nelson Piquet Jr.

Chase for the 2013 Sprint Cup begins; rain-delayed GEICO 400 diverts attention from recent NASCAR headlines

John Harrelson/Getty Images for NASCAR

The historic penalties assessed Michael Waltrip Racing after Richmond, including a $300,000 fine and removal of driver Martin Truex Jr. from the Chase, may not be the only setback for Waltrip’s team. Truex’s sponsor, NAPA Auto Parts, issued a statement on its Facebook page that indicates considerable unhappiness about the incident and hints that the company could pull its sponsorship of the No. 56 Toyota. Here is what NAPA had to say: “The actions taken by Michael Waltrip’s Racing team this past weekend, leading to the penalties assessed by NASCAR, are very concerning. We are disappointed that a partner associated with our organization would make such a significant error in judgment. In addition, we have launched our own review to determine the future of our partnership with Michael Waltrip’s Racing team. The NAPA Auto Parts organization is proud of its long-standing NASCAR relationship. We share a passion with our customers for high-quality racing and seek to determine the best course of action for our customers, NASCAR fans, and the NAPA organization.”

Kyle Busch sweeps Camping World and Nationwide Series races at Chicagoland Speedway

Todd Warshaw/Getty Images for NASCAR

Matt Kenseth’s victory in Sunday’s rainplagued Chase opener at Chicagoland Speedway, a race that was supposed to start at 2 p.m. Eastern time and ended around midnight, allowed the NASCAR world to enter Week Two of the Chase talking about something other than the shenanigans at Richmond International Raceway the week before. But the manipulation of the finishing order of the Sept. 7 regular-season finale at Richmond by Michael Waltrip Racing and an apparent attempt to do so by Penske Racing and Front Row Motorsports won’t been soon forgotten. The events at Richmond led to stiff penalties from NASCAR, a change in the makeup of the field for the Chase for the Sprint Cup and new rules for competition. NASCAR officials responded to the sport’s biggest scandal in years by adding Ryan Newman to the Chase field and dropping Martin Truex Jr., adding Jeff Gordon as a last-minute 13th entry, and creating new rules forbidding drivers and teams from laying over to affect the outcome Matt Kenseth hoists the GEICO 400 trophy after winning the first race of the 2013 of a race. Chase. NASCAR chairman Brian France said the unprecedented steps were taken to try to help the sport overcome the damage done to its integrity by teams trying to get drivers into the Chase. “I think we wanted it to be very clear, and we wanted to reinforce, frankly, the cornerstone of NASCAR, which is giving your all,” he said. “And that’s the cornerstone of any sport.” According to the new rules introduced prior to the Chase opener at Chicagoland Speedway, NASCAR will require competitors to race at 100 percent of their ability with the goal of achieving their best possible finishing position in an event. The rules state that competitors who try to artificially alter the finishing positions of the event or encourage others to do so will face penalties, including “disqualification and/or loss of finishing points and/or fines and/or loss of points and/or suspension and/or probation to any and all members of the teams, including any beneficiaries of the prohibited actions.” The rules do not apply to normal racing tactics, and do not apply to start-and-park teams, as NASCAR president Mike Helton said that those underfunded Kenseth gives the fans a victory burnout at Chicagoland Speedway. teams are giving 100 percent of their ability. take a wild-card Chase berth from Truex. Then Bowyer Additionally, there are new rules in place for and a third teammate, Brian Vickers, fell back in the field the spotter stand, where much of the manipulation at and finished behind 22nd-place Joey Logano, putting him Richmond took place. past Jeff Gordon into the top 10 in points and opening the Going forward, there will be only one spotter allowed per team on the spotter stand. That spotter will only be able to wild-card spot for Truex that was later taken away. “There is more concern to me that we get to Homestead have two analog radios. No digital radios will be allowed on the spotter stand any longer. And the activities on the spot- and have this come up again, so it needs to be addressed,” Gordon said. “Usually what happens in a situation that ter stand will be monitored by NASCAR using cameras. gets to this magnitude, there is going to be an overreaction, Penske Racing and Front Row Motorsports appeared and you understand that and accept that. It might need to to have worked a deal on the spotter stand at Richmond be modified over time, but I think right now an overreacto have David Gilliland give Joey Logano a spot on the tion is probably the acceptable reaction.” track in the closing laps in exchange for compensation in But Gordon also pointed out that the driver who started it the future, but NASCAR did not remove Logano from the all with an intentional spin — Bowyer — escaped with no Chase. Officials did put both teams on probation for the real penalty, as his 50-point docking came before the points remainder of the year. were reset and had no effect on his Chase seeding. Paul Wolfe, crew chief of Brad Keselowski’s No. 2 Ford at “A 50-point fine pre-Chase was no penalty,” Gordon said. Penske Racing, said after a meeting with NASCAR officials “I felt like [Bowyer’s spin] started all this, and that didn’t and Sprint Cup teams and drivers that the location of the really get addressed.” proverbial line that can’t be crossed without incurring big Series officials also instituted a new policy on restarts, penalties is clear to him. which have been a controversial subject all season. Going “I think everyone should have a pretty clear understandforward, the second-place driver can take the lead before ing of what that is now,” Wolfe said. “If you go out there and run 100 percent to your ability and run a normal race, the start/finish line as long as officials determine that the leader stepped on the gas first. then everything will be fine.” At Dover in June, Jimmie Johnson was penalized for Jeff Gordon, who lost a Chase spot because of Michael jumping a restart and lost what appeared to be a sure vicWaltrip Racing’s manipulation but was later added as a 13th entry, said it was time for NASCAR to react, and react tory. Then, at Richmond, Carl Edwards reached the starting line ahead of race leader Paul Menard, but was allowed strongly, so the issue won’t come up again. to keep the lead and went on to win. Actions by Waltrip’s team in the closing laps of the reguBut at Chicagoland, there was no controversy about lar-season finale at Richmond included a questionable spin restarts, even though the second-place driver wound up by Clint Bowyer to bring out the caution flag just as Ryan with the lead several times. Newman took the lead and was poised to win the race and

NOTEBOOK NAPA Auto Parts to review future sponsorship of MWR

Geoff Burke/Getty Images for NASCAR

SPRINT CUP

Race: Sylvania 300 Where: New Hampshire Motor Speedway When: Sunday, 2 p.m. (ET) TV: ESPN 2012 Winner: Denny Hamlin (right)

Kyle Busch races Brad Keselowski to the finish line in the EnjoyIllinois.com 225. Kyle Busch has a 50-50 year going in the Nationwide and Camping World Truck Series, thanks to a sweep of those two races at Chicagoland Speedway. On Friday, Busch won a hard-fought battle with fellow Sprint Busch’s second victory of the Cup driver Brad Keselowski to take weekend was in the Nationwide Series the EnjoyIllinois. com 225 for his Dollar General 300. fourth win in eight starts this season and the 34th triumph of his Truck career. Series points leader Matt Crafton finished fourth and now has a 41-point lead over second-place James Buescher. On Saturday, Busch dominated the Dollar General 300, leading all but five of 200 laps and taking the lead for good on Lap 31. Joey Logano finished second, with series points leader Sam Hornish Jr. third. It was Busch’s 10th Nationwide win in 20 starts this season and the record-extending 61st of his career. Hornish has a 17-point lead over second-place Austin Dillon and is 36 points ahead of third-place Regan Smith.

Todd Warshaw/Getty Images for NASCAR

NEXT UP...

Daily Corinthian • Wednesday, September 18, 2013 • 11A

Thirteen-driver Chase field is finalized with the addition of Jeff Gordon NUMERICALLY Points standings and race results from Sunday’s GEICO 400 at Chicagoland Speedway. 1. Matt Kenseth (finished first) 2,063 points In his first season with Joe Gibbs Racing, the top-seeded driver in the Chase ran his season win total to a personal record six by bolting past teammate Kyle Busch on a restart with 23 laps to go. His 89 laps led gave him the maximum 48 points for the race. 2. Kyle busch (finished second) 2,055 points; behind -8 After leading three times for 67 laps and having the lead late in the race, he fell to second place after Kevin Harvick pushed Kenseth past him on the deciding restart. Still, he seemed pleased with the results. “It was a great night for Joe Gibbs Racing,” he said. 3. jiMMie johnson (finished fifth) 2,052 points; behind -11 The five-time champion overcame confusion on an early pit stop when an official was briefly mistaken about whether a lug nut was tight and a broken jack on a later stop to score a top-five finish and remain in reach of the points lead. 4. Kevin harvicK (finished third) 2,048 points; behind -15 A strong run was aided by some chassis adjustments after the fivehour, 10-minute rain delay, but a few more tweaks were needed to fix a loose condition and contend for the win. “Had a lot of fun and came up a couple short,” he said.

5. carl edwards (finished 11th) 2,040 points; behind -23 After winning the regular-season finale at Richmond, he never seemed to get his No. 99 Ford up to speed at Chicagoland. “We needed things to fall a little better, and I needed to make better decisions,” he said. 6. Kurt busch (finished fourth) 2,040 points; behind -23 For the ninth time this season, Busch and his single-car No. 78 team scored a top-five finish. This time it came in spite of a speeding penalty on pit road that had him a lap down more than a third of the way through the race. 7. jeff Gordon (finished sixth) 2,039 points; behind -24 A stirring run from the back after a flat tire with less than 100 laps remaining showed that the lastminute addition to the Chase field is capable of contending for his fifth Sprint Cup title. 8. ryan newMan (finished 10th) 2,035 points; behind -28 Added to the Chase field after a review of the manipulations at Richmond, he moved up four spots in the standings with a top-10 finish despite not having track position for much of the race. 9. clint bowyer (finished ninth) 2,035 points; behind -28 The driver at the center of the controversy at Richmond had a compara-

tively uneventful run at Chicagoland and little to say afterward. “It was a good night” was his only comment. 10. Kasey Kahne (finished 12th) 2,032 points; behind -31 Damage to his No. 5 Chevrolet on an early trip to pit road hindered his efforts. “There were like three or four guys clueless on pit road; they are all stopping and can’t find their stalls — like we’ve never done this before,” he said. 11. GreG biffle (finished 16th) 2,032 points; behind -31 He ran in the top five for much of the race, but issues on pit road and a fading engine in the latter stages of the race left him with a mediocre finish. “That isn’t the way we wanted to start, but we had a pretty fast car at times,” he said. 12. joey loGano (finished 37th) 2,011 points; behind -52 In his first Chase appearance, the 23-year-old won the pole and led the first 32 laps. But the engine in his No. 22 Ford began to go sour mid-race and finally blew after completing 175 of 267 laps. 13. dale earnhardt jr. (finished 35th) 2,010 points; behind -53 NASCAR’s most popular driver enters the second Chase race deep in the points hole after a blown engine sidelined his No. 88 Chevrolet with 43 laps remaining. “It’s going to be really hard to win a championship this far behind,” he said.

SPEAKING

17

Bonus points earned by Sam Hornish Jr. for leading laps, tops among Nationwide Series drivers.

3

Rookies in the top 10 in Camping World Truck Series points: Jeb Burton in fourth place, Ryan Blaney in fifth and Darrell Wallace Jr. in ninth.

20

Top-20 finishes for Danica Patrick this season with her 20thplace finish at Chicagoland Speedway.

7

Drivers suffering blown engines in the GEICO 400 at Chicagoland Speedway: Denny Hamlin, Joey Logano, Cole Whitt, David Reutimann, Brian Vickers, Dale Earnhardt Jr. and Timmy Hill.


12A • Daily Corinthian

Softball Late Monday Corinth 15, Belmont 0 Belmont 000 0 -- 0 5 3 Corinth 256 2 -- 15 16 1   WP: Allie Jacobs. LP: B. Clingon. Multiple Hits: (B) N. Moody 2, Cligen 2. (C) Anna Kayte Webb 3, Katie Vandiver 3, Jamia Kirk 3, Tatiana Selmon 3, Colby Cox 2. 2B: (C) Kirk. HR: (C) Vandiver. Record: Corinth 9-5

Local Schedule Thursday Football Northeast @ Northwest, 6:30 Hamilton @ Falkner, 7 Volleyball Corinth @ Amory, 6:30

Sports

Wednesday, September 18, 2013

Bulldogs out to stop long slide BY DAVID BRANDT AP Sports Writer

STARKVILLE — The losing continues for Mississippi State, which now finds itself in an extended slide. The Bulldogs have lost seven of nine games dating back to last season, including Saturday’s 24-20 loss to Auburn. It’s been a humbling and frustrating stretch for a program that has been to three straight bowl games under fifth-year coach Dan Mullen. Now Mullen is trying to address a myriad of issues on both sides of the ball. The offense has been inconsistent all season and quarterback Tyler Russell has missed

the past two games because of a concussion sustained against Oklahoma State. Injuries in the secondary have forced the Bulldogs to use several young players, and that inexperience has led to occasional breakdowns. One of those came when Auburn’s Nick Marshall threw an 11-yard game-winning touchdown pass with 10 seconds left on Saturday. But Mullen says there is still plenty of hope. Mississippi State (1-2) hosts Troy (2-1) on Saturday in a non-conference game. “It’s never as good and it’s never as bad as it seems,” Mullen said. “If we made one

play in that (Auburn) game, it looks like we have all the answers. We’re jumping up and down, patting ourselves on the back.” But the Bulldogs didn’t make that play, which has been a recurring theme during the losing skid. Mississippi State is almost always competitive, but isn’t winning the crucial plays at crucial moments. Mullen knows only one way to get that fixed. “We’ve got to get back to work,” Mullen said. “Hopefully we come out with a chip on our shoulder. To be successful, you have to respond to that type of loss with that

desperate desire to get back on the field and work harder.” One major issue: Mississippi State’s offense has scored just 23 combined points in two games against FBS opponents. It’s easy to point to Russell’s absence as the cause, but backup Dak Prescott has often played well in relief. If Russell returns, Mullen will have to make some interesting decisions. Russell set a school record with 2,897 passing yards and 24 touchdowns last season, but Prescott gives the Bulldogs a better running option. Mullen didn’t commit to eiPlease see BULLDOGS | 13A

Friday Football New Albany @ Corinth, 7 (WXRZ) Nettleton @ Kossuth, 7 Mantachie @ Central, 7 Biggersville @ Smithville, 7 Tish County @ Booneville, 7 Thrasher @ Coffeeville, 7 Walnut @ South Pontotoc, 7 McNairy @ Fayette-Ware, 7

Saturday Softball Meridian Tour. Corinth Cross Country Saltillo Invitational AC, Corinth, Kossuth

Shorts CHS Boosters Corinth Basketball Booster Club will hold a meeting on Monday, Sept. 23 at 5:30 in the Corinth high school library. Families of girls and boys playing basketball this year are encouraged to attend.

Hit-A-Thon The Kossuth Lady Aggie softball team will hold a hit-a-thon and OldTimer’s Game on Monday, Sept. 23. The hit-a-thon will begin at 6 with the Old-Timer’s Game -- for any former Lady Aggies and others that are out of high school. Cost for the game is $10 and can be paid before the game. For more information, contact Judy Mullins (223-6817) or Steve Lyles by calling the school/

5K Run/Walk The Soul Trot 5K Run/Walk, raising money and awareness for Soles4Souls, will be held Saturday, Oct. 5, at Selmer City Park beginning at 9 a.m. Pre-registration is $20 plus a pair of new or gently worn shoes, and includes T-shirt. Must be received prior to Sept. 21. Mail to “Soul Trot 5k”, 31 Fairway Place, Selmer, TN 38375 or register “on-site” for $25 -- no t-shirt -- beginning at 8 a.m. 5K race begins. Winner in each age/gender division receives a medal. Overall male/female winners receives a trophy. The person who donates the most pairs of shoes will received a trophy. All proceeds and shoes go to Soles4Souls. For more info call 731-645-9432.

AC Baseball Seeks Alumni The Alcorn Central High School Baseball program is seeking contact information from all Alcorn Central Baseball Alumni. Please be sure to include your phone number and mailing address, as well as the position you played, the years you were a player and any honors you may have received as a player. All former players can send requested information to acbaseballalumni@gmail.com or by calling 662-322-7389. We look forward to hearing from you.

Submitted Photo

Aggies take first again The Kossuth Aggies captured their second straight cross-country championship on Saturday, winning the 3A division at the Pontotoc Invitational. The club also took home honors the previous Saturday at the event hosted by Hickory Flat.

Cross Country: Pontotoc Invitational Results BY H. LEE SMITH II lsmith@dailycorinthian.com

Kossuth 1A-3A Division at Pontotoc Inv. 15 schools, around 130 runners BOYS (1st) -- 4. Riley McCalla, 17:39; 5 Jordan Mills, 17:43; 8 Rick Hokum, 18:10; 111 Nathan Ginn, 18:26; 13 Kevin Ginn, 18:36; 17 Zach Shawl, 18:46; Levi Burcham, 19:24; Avery Parks 19:51; Hunter Murphy, 21:41.   GIRLS -- Morgan Hodum, 19:27; Trinity Heavener, 19:33; Taylor Heavener,

21:23. Last Week GIRLS (3rd) -- 5. Grace Stanford, 17:52; 14 Sara Talley, 19:09; Kaylee Bonds, 19:11; Trinity Heavener, 21:03; Morgan Hodum, 21:07; Cheyenne Bennett, 24:11; Taylor Heavener, 24:11.  

18:56; 31. Austin McAllister, 19:16; 34. Blake Burnett, 19:18; Austin Settlemires, 19:58; Brandon Turner, 20:54 GIRLS -- 16. Ashlee Manahan, 17:33; 37. Taylor Derrick, 18:40; Lauren Walker, 20:15; McKenzie Eden, 20:20

Alcorn Central

Corinth

1A-3A Division at Pontotoc Inv. 15 schools, around 130 runners BOYS (2nd) -- 2. Samuel Holley, 17:20; 16. Luke Holley, 18:40; 19. Jacob Carter, 18:45; 21. Trevor Godwin,

4A-64 Division at Pontotoc 38 teams, around 1,200 runners BOYS (6th) -- 20. Dennis Dilworth, 17:57; 35. Reed Pearce, 18:35; 38. Will Crigger, 18:40; 45. Rosley

Smith, 18:49; 46. Morgan Toomer, 18:50; Rhett Robinson, 18:51; Sam Holt, 19:07; Tyler Martin 20:33; Manuel Franco, 20:35; Brendan Carter, 21:06; Davis Burns, 21:14; Bailey Martin 21:19; John Witt Mercier 21:27 GIRLS (4th) -- 4. Emma Knight, 15:23; 13. Holley Marshall, 16:11; 19. Yvette Evans, 16:22; 25. Brianna Scobey, 17:11; 39. Anna Ruth Price, 17:24; Macy Moore, 18:10; Laura Avant, 18:13; Kelsey Fulgrum, 18:15; Hollie Wood, 18:37; Jacie Hudson, 18:42; Amber McDonald, 19:08; Oaklea Ragan, 19:57

Pelini unsure if he’ll be disciplined for rant The Associated Press

LINCOLN, Neb. — Nebraska coach Bo Pelini said Tuesday he doesn’t know if he’ll be disciplined for his profane rant about Cornhuskers fans two years ago, adding that he expects most will continue to support him. An audio of Pelini’s tirade leaked to the website Deadspin has Big Red fans buzzing. Pelini issued an apology in a statement Monday night and reiterated it during the Big Ten coaches’ teleconference on Tuesday.

Chancellor Harvey Perlman has expressed disappointment in Pelini but declined to comment when asked if the coach would be disciplined. Athletic director Shawn Eichorst said he was “disheartened.” Pelini said he has met with Eichorst and spoken on the phone with Perlman about the audio. He did not elaborate. The Huskers play FCS South Dakota State on Saturday in Lincoln. “I fully anticipate coaching this weekend,” Pelini said

after practice. “I’m the head football coach until someone says different.” Pelini said on the teleconference he was shocked by the release of the audio, though he indicated he knew a potentially damaging audio existed. Pelini said he might lose some fan support, but that he was confident many would understand that his comments were made during what he thought was a private conversation before his radio show after the Huskers’ 34-27 win over Ohio State in October 2011.

“I think I’ve built up enough points with our fans over the last five years in how I’ve conducted myself, how I’ve run this program and what we’ve done with this program to earn some forgiveness for something that was made in a private setting,” Pelini said. “People will understand this isn’t how I feel about the fans. I’ve said it over and over.” The Deadspin audio caught Pelini speaking off air with Husker Sports Network playby-play man Greg Sharpe Please see PELINI | 13A

Night Tennis Come and play a little community tennis every Tuesday at 6:00 p.m. at the Corinth City Park Wear your tennis shoes, bring your racquet, tennis balls, and expect a great time.

50/50 Tickets The Kossuth Athletic Booster Club will be having a 50/50 fundraiser. Tickets for the fundraiser are $100 each and only three hundred tickets will be sold. Every 50th ticket drawn will receive $1,000 and the final Please see SHORTS | 13A

Oklahoma sports governing board faces criticism The Associated Press

OKLAHOMA CITY — Parents, coaches and school administrators voiced numerous complaints on Tuesday about a lack of oversight of the organization that oversees tens of thousands of Oklahoma high school athletes, cheerleaders and other extracurricular activities. People from across Oklahoma were invited by legisla-

tors to testify before the House Administrative Rules Committee about their experience with the private, nonprofit Oklahoma Secondary Schools Activities Association. Tuesday’s day-long hearing is one of three such meetings scheduled before the committee over the next month to determine whether more transparency and oversight is needed for the association.

“Because the OSSAA makes decisions that affect so many lives and derives money that is public in nature, there must be accountability and transparency,” said Rep. Bobby Cleveland, R-Slaughterville, who requested the study. “It is our intent to answer serious, significant questions that have arisen.” Among the complaints voiced Tuesday were from parents who were upset about

OSSAA’s decisions on transfer requests and from football coaches concerned about the way revenue is shared from high school football playoff games. Lawmakers also heard from the athletic director at Bishop McGuinness High School, a private Catholic school in Oklahoma City, who complained about the rules Please see OKLAHOMA | 13A


Scoreboard

Daily Corinthian • 13A

Wednesday, September 18, 2013

BULLDOGS

Auto racing

Chicago

Sprint: Geico 400 lineup CONTINUED FROM 12A

ther quarterback during Monday’s weekly press conference. Offensive coordinator Les Koenning said Prescott’s poise against Auburn was impressive. “I thought he made some excellent decisions,” Koenning said. “The kid rushed for 133 yards and threw for 213. He might have had one of two things that went wrong with him, but as a whole, in an environment like that, he was under control and knew what was coming up. I was pleased with his performance. It just comes down to a couple of plays.” Mullen said Mississippi State’s offense might be relying a bit too much on Prescott. Senior LaDarius Perkins, who rushed for 1,024 yards last season, has just 86 rushing yards so far this season in two games. “We want to make sure our playmakers are touching the ball,” Mullen said. On defense, Mississippi State will have several good plays overshadowed by one or two disasters. That happened against Auburn when Mississippi State cornerback Justin Cox went the wrong way in pass coverage and then fell down while trying to recover, allowing Auburn’s Quan Bray to score an easy 76-yard touchdown. Cox is in his first season at the FBS level after transferring for junior college. He’s one of many first-year players who are playing a significant role so far this season. The growing pains are difficult. But players say they see improvement. “I think everyone is going to be really good once we get it all figured out,” freshman linebacker Richie Brown said.

OKLAHOMA CONTINUED FROM 12A

governing private schools. The OSSAA oversees extracurricular activities for nearly every public school in Oklahoma for grades seven through 12, including the makeup of athletic districts, playoffs and student transfers and eligibility, among other things. It is governed by a 14-member board of mostly school principals and superintendents and had an annual operating budget last year of $5.4 million. Much of the association’s revenue comes from gate receipts for high school playoff games, which generated more than $4.5 million last year, according to the agency’s financial statements.

SHORTS CONTINUED FROM 12A

ticket will win $10,000 if all tickets are sold. Tickets may be purchased from any booster club member or at home football games. The drawing will be held at the last regular season home game on October 25 and you do not have to be present to win. All proceeds go to benefit all sports programs at Kossuth High School. Please contact Jeff Bobo at 665-2858 or Christy Dickson 665-2179 to purchase tickets.

After Friday qualifying; race Sunday at Chicagoland Speedway, Joliet, Ill.

Baseball NL standings, schedule East Division W L Pct GB Atlanta 89 62 .589 — Washington 81 70 .536 8 Philadelphia 71 80 .470 18 New York 67 82 .450 21 Miami 55 96 .364 34 Central Division W L Pct GB St. Louis 87 63 .580 — Pittsburgh 87 64 .576 ½ Cincinnati 86 66 .566 2 Milwaukee 67 83 .447 20 Chicago 63 88 .417 24½ West Division W L Pct GB Los Angeles 86 64 .573 — Arizona 76 73 .510 9½ San Diego 70 80 .467 16 San Francisco 69 81 .460 17 Colorado 69 82 .457 17½ ___ Monday’s Games Philadelphia 12, Miami 2 San Diego 2, Pittsburgh 0 Atlanta at Washington, ppd., local shooting tragedy Milwaukee 6, Chicago Cubs 1 Cincinnati 6, Houston 1 Colorado 6, St. Louis 2 Arizona 2, L.A. Dodgers 1 Tuesday’s Games Washington 6, Atlanta 5, 1st game Washington 4, Atlanta 0, 2nd game Philadelphia 6, Miami 4 San Diego 5, Pittsburgh 2 San Francisco at N.Y. Mets, (n) Milwaukee 4, Chicago Cubs 3 Cincinnati 10, Houston 0 St. Louis at Colorado, (n) L.A. Dodgers at Arizona, (n) Today’s Games Atlanta (A.Wood 3-3) at Washington (Ohlendorf 4-0), 6:05 p.m. Miami (Eovaldi 3-6) at Philadelphia (Miner 0-1), 6:05 p.m. San Diego (T.Ross 3-8) at Pittsburgh (Morton 7-4), 6:05 p.m. San Francisco (M.Cain 8-9) at N.Y. Mets (Harang 0-1), 6:10 p.m. Chicago Cubs (Rusin 2-4) at Milwaukee (Thornburg 2-1), 7:10 p.m. Cincinnati (G.Reynolds 1-2) at Houston (Peacock 5-5), 7:10 p.m. St. Louis (Wainwright 16-9) at Colorado (Chatwood 7-4), 7:40 p.m. L.A. Dodgers (Fife 4-3) at Arizona (McCarthy 4-9), 9:10 p.m. Thursday’s Games San Diego at Pittsburgh, 11:35 a.m. San Francisco at N.Y. Mets, 12:10 p.m. Chicago Cubs at Milwaukee, 1:10 p.m. St. Louis at Colorado, 2:10 p.m. L.A. Dodgers at Arizona, 2:40 p.m. Miami at Washington, 6:05 p.m.

AL standings, schedule Boston Tampa Bay Baltimore New York Toronto Detroit Cleveland Kansas City Minnesota

East Division W L 92 60 82 68 80 70 79 72 69 81 Central Division W L 88 63 81 69 79 71 64 85

Today No. 3 Clemson at NC State, 6:30 p.m. Saturday, Sept. 21 No. 1 Alabama vs. Colorado State, 6 p.m. No. 4 Ohio State vs. Florida A&M, 11 a.m. No. 5 Stanford vs. No. 23 Arizona State, 6 p.m. No. 6 LSU vs. Auburn, 6:45 p.m. No. 7 Louisville vs. Florida International, 11 a.m. No. 8 Florida State vs. BethuneCookman, 5 p.m. No. 9 Georgia vs. North Texas, 11:21 a.m. No. 10 Texas A&M vs. SMU, 6 p.m. No. 13 UCLA vs. New Mexico State, 9:30 p.m. No. 15 Michigan at UConn, 7 p.m. No. 16 Miami vs. Savannah State, 6 p.m. No. 17 Washington vs. Idaho State, 2 p.m. No. 18 Northwestern vs. Maine, 2:30 p.m. No. 19 Florida vs. Tennessee, 2:30 p.m. No. 20 Baylor vs. Louisiana-Monroe, 3 p.m. No. 22 Notre Dame vs. Michigan State, 2:30 p.m. No. 24 Wisconsin vs. Purdue, 2:30 p.m. No. 25 Texas State vs. Texas Tech, 6 p.m.

NFL standings, schedule AMERICAN CONFERENCE East W L T Pct PF PA New England 2 0 0 1.000 36 31 Miami 2 0 0 1.000 47 30 N.Y. Jets 1 1 0 .500 28 30 Buffalo 1 1 0 .500 45 46 South W L T Pct PF PA Houston 2 0 0 1.000 61 52 Indianapolis 1 1 0 .500 41 41 Tennessee 1 1 0 .500 40 39 Jacksonville 0 2 0 .000 11 47 North W L T Pct PF PA Cincinnati 1 1 0 .500 41 34 Baltimore 1 1 0 .500 41 55 Cleveland 0 2 0 .000 16 37 Pittsburgh 0 2 0 .000 19 36 West W L T Pct PF PA Kansas City 2 0 0 1.000 45 18 Denver 2 0 0 1.000 90 50 Oakland 1 1 0 .500 36 30 San Diego 1 1 0 .500 61 61 NATIONAL CONFERENCE East W L T Pct PF PA Dallas 1 1 0 .500 52 48 Philadelphia 1 1 0 .500 63 60 N.Y. Giants 0 2 0 .000 54 77 Washington 0 2 0 .000 47 71 South W L T Pct PF PA New Orleans 2 0 0 1.000 39 31 Atlanta 1 1 0 .500 48 47 Carolina 0 2 0 .000 30 36 Tampa Bay 0 2 0 .000 31 34 North W L T Pct PF PA Chicago 2 0 0 1.000 55 51 Detroit 1 1 0 .500 55 49 Green Bay 1 1 0 .500 66 54 Minnesota 0 2 0 .000 54 65 West W L T Pct PF PA Seattle 2 0 0 1.000 41 10 St. Louis 1 1 0 .500 51 55 San Francisco 1 1 0 .500 37 57 Arizona 1 1 0 .500 49 48 ___ Thursday, Sep. 19 Kansas City at Philadelphia, 7:25 p.m. Sunday, Sep. 22 San Diego at Tennessee, Noon Arizona at New Orleans, Noon St. Louis at Dallas, Noon Cleveland at Minnesota, Noon Houston at Baltimore, Noon N.Y. Giants at Carolina, Noon Detroit at Washington, Noon Tampa Bay at New England, Noon Green Bay at Cincinnati, Noon Atlanta at Miami, 3:05 p.m. Indianapolis at San Francisco, 3:25 p.m. Jacksonville at Seattle, 3:25 p.m. Buffalo at N.Y. Jets, 3:25 p.m. Chicago at Pittsburgh, 7:30 p.m. Monday, Sep. 23 Oakland at Denver, 7:40 p.m.

Transactions Tuesday’s deals Tuesday’s Sports Transactions The Associated Press BASEBALL COMMISSIONER’S OFFICE_Suspended Seattle minor league RHP Forrest Snow (Tacoma-PCL) 50 games after a second positive test for a drug of abuse in violation of the Minor League Drug Prevention and Treatment Program. NATIONAL BASEBALL HALL OF FAME_Promoted Brad Horn to vice president of communications and education, Ken Meifert to vice presi-

weather” fans and how the day is coming that he’ll be gone and that he wonders how the team will fare without him. “I’ve said it over and over since I’ve been here that we have great fans, but I’m human like anybody else,” Pelini said. “You say things in an emotional moment under certain circumstances and like anybody else, you’re human, you make mistakes, you apologize for your mistakes and you move on. That’s all you can do in this situation.” Pelini is 51-21 in six seasons at Nebraska, but he hasn’t won a conference title and the Huskers have had a run of lopsided losses on the national stage. His contract runs through the 2015 season. He’s being paid $2.975 million this

and associate athletic director for community relations Chris Anderson. Pelini criticized fans who left the stadium in the third quarter, when the Huskers trailed 27-6. Nebraska’s comeback was the biggest in program history. Pelini also used profanity while criticizing two Omaha World-Herald sports writers. Pelini had dressed down one of the writers in his postgame news conference that night for writing what he thought was an overly critical column about quarterback Taylor Martinez. In the days before the Ohio State game, Pelini faced withering criticism for the Huskers’ performance the week before in a 31-point loss at Wisconsin. Pelini repeatedly used expletives while talking on the audio Domino’s about “fair-

Choose any Two or More

Pizza

Get Quick Cash at Quick Way Booneville

GB — 6½ 8½ 23

Top 25 schedule

CONTINUED FROM 12A

of Iuka, Inc. of Booneville, Inc. of Corinth, Inc. 1204 W. Quitman St. 813 E. Church St. 501 Hwy 72 W. Iuka, 423-6600 MS 38852 Booneville, MS 38829 (662) MS 38874 (662) 286-2274 (662) 728-3070 Corinth, (662) 423-6600 (662) 728-3070 (662) 286-2274

Iuka

Pct .583 .540 .527 .430

College Football

Pro football

dent of sponsorship and development and Erik Strohl to vice president of exhibitions and collections. American League BALTIMORE ORIOLES_Reinstated OF Steve Pearce from the 15-day DL. BOSTON RED SOX_Recalled INF Brock Holt, RHP Brayan Villarreal and RHP Steven Wright from Pawtucket (IL). HOUSTON ASTROS_Placed C Jason Castro on the 15-day DL. LOS ANGELES ANGELS_Reinstated INF Chris Nelson from the 15-Day DL. National League CHICAGO CUBS_Released 3B Cody Ransom. American Association EL PASO DIABLOS_Exercised the 2014 option on INF Jonathan Cisneros. WINNIPEG GOLDEYES_Traded LHP Edgar Osuna and INF Kevin Moesquit to Sioux City to complete an earlier trade. Atlantic League CAMDEN RIVERSHARKS_Sent INF Matt Padgett and RHP Lucas Irvine to New Jersey (Can-Am) and INF Danny Bomback to Rockland (Can-Am) to complete earlier trades. Can-Am League ROCKLAND BOULDERS_Exercised the 2014 option on RHP Alex Kreis. BASKETBALL National Basketball Association CHICAGO BULLS_Promoted Randy Brown to assistant general manager, Ivica Dukant to director of international scouting/special assistant to the general manager and Nick Papendieck to head strength coach. Named Matt Johnson assistant strength coach. FOOTBALL National Football League ARIZONA CARDINALS_Signed WRs Dan Buckner and Brittan Golden to the practice squad. Released WR Sam McGuffie from the practice squad. ATLANTA FALCONS_Placed LB Sean Weatherspoon on the injured reserve/return list. CAROLINA PANTHERS_Placed S Charles Godfrey on injured reserve. Signed S Robert Lester from the practice squad. CINCINNATI BENGALS_Terminated the contract of RB Bernard Scott. CLEVELAND BROWNS_Waived WR Tori Gurley. Released WR Arceto Clark. DALLAS COWBOYS_Released DT Landon Cohen. Signed DT David Carter. Released WR Danny Coale from the practice squad. Signed WR Jamar Newsome to the practice squad. INDIANAPOLIS COLTS_Placed G Donald Thomas on injured reserve. Waived FB Dan Moore. SAN DIEGO CHARGERS_Signed CB Crezdon Butler. Waived DE Drake Nevis. SAN FRANCISCO 49ERS_Placed NT Ian Williams on injured reserve. Signed FB Owen Marecic to a oneyear contract. Canadian Football League CFL_Named Jim Lawson chairman of the Board of Governors. WINNIPEG BLUE BOMBERS_Added OL Dan Knapp and Jarvis Jones to the practice roster. Arena Football League LA KISS_Named Bob McMillen coach. HOCKEY National Hockey League CHICAGO BLACKHAWKS_Assigned F David Gilbert to Rockford (AHL), D Dillon Fournier to Rouyn-Noranda (QMJHL), D Travis Brown to Moose Jaw (WHL) and G Brandon Whitney to Victoriaville (QMJHL). Released Fs Wade Brookbank and Pat Mullane

and D Joe Gleason, Jared Nightingale and Bobby Shea. MONTREAL CANADIENS_Assigned Fs Louis Leblanc, Joonas Nattinen, Stephen MacAulay, Sven Andrighetto, Stefan Fournier and Erik Nystrom; D Morgan Ellis, Darren Dietz and Dalton Thrower; and G Robert Mayer to Hamilton (AHL). OTTAWA SENATORS_Signed F Curtis Lazar to a three-year, entry-level contract. Returned D Ben Harpur to Guelph (OHL), G Chris Driedger to Calgary (WHL), F Vincent Dunn to Gatineau (QMJHL) and G Francois Brassard to Quebec (QMJHL). PHOENIX COYOTES_Assigned RW Henrik Samuelsson to Edmonton (WHL). SAN JOSE SHARKS_Assigned D Konrad Abeltshauser, G JP Anderson, D Kyle Bigos, LW Jimmy Bonneau, RW Riley Brace, RW Chris Crane, D Dylan DeMelo, RW James Livingston, C Travis Oleksuk, C Sebastian Stalberg and C Marek Viedensky to Worcester (AHL). TAMPA BAY LIGHTNING_Signed F Joel Vermin to a three-year, entrylevel contract. Released F Brett Welychka, D Jake Dotchin and G Eric Brassard from their amateur tryout agreements. American Hockey League GRAND RAPIDS GRIFFINS_Named Kelsey Perras corporate sales fulfillment coordinator, Alan Cross public relations manager, Marissa Malson social media sales and marketing manager and Nathan Hone video coordinator. COLLEGE CARTHAGE_Named Dennis Cox II women’s lacrosse coach. KANSAS STATE_Named Candace Perry-Fairer assistant track coach. MAINE-FARMINGTON_Named Tess Perry men’s and women’s assistant cross country coach, Matt Lamb men’s assistant soccer coach, Alyssa St. Pierre and Hattie Laliberte assistant field hockey coaches, Dave Ronald women’s assistant soccer coach, Devorn Hansack assistant baseball coach and Orion Cochrane assistant golf coach. MISSISSIPPI STATE_Announced basketball G Jalen Steele will not play his senior season. NEW MEXICO_Suspended DL Gerron Borne and Paytron Hightower indefinitely. SETON HALL_Named Oliver Antigua men’s assistant basketball coach. VANDERBILT_Dismissed WR Chris Boyd following his conditional guilty plea for his role in attempting to cover up the rape of an unconscious student.

TV SportsWatch Today MAJOR LEAGUE BASEBALL 1 p.m. WGN — Minnesota at Chicago White Sox 6 p.m. ESPN — Texas at Tampa Bay 9 p.m. ESPN — L.A. Dodgers at Arizona SAILING 3 p.m. NBCSN — America’s Cup, race 11 and 12 at San Francisco SOCCER 1:30 p.m. FSN — UEFA Champions League, Celtic at AC Milan FS1 — UEFA Champions League, Ajax at Barcelona

PELINI

Quick Way Open on Saturdays

Pct GB .605 — .547 9 .533 11 .523 12½ .460 22

59 91 .393 28½ West Division W L Pct GB Oakland 88 62 .587 — Texas 82 68 .547 6 Los Angeles 73 77 .487 15 Seattle 66 85 .437 22½ Houston 51 100 .338 37½ ___ Monday’s Games Detroit 4, Seattle 2 Tampa Bay 6, Texas 2 Cincinnati 6, Houston 1 Kansas City 7, Cleveland 1 Chicago White Sox 12, Minnesota 1 L.A. Angels 12, Oakland 1 Tuesday’s Games Toronto 2, N.Y. Yankees 0 Detroit 6, Seattle 2 Baltimore 3, Boston 2 Texas 7, Tampa Bay 1 Cincinnati 10, Houston 0 Cleveland at Kansas City, (n) Minnesota at Chicago White Sox, (n) L.A. Angels at Oakland, (n) Today’s Games Minnesota (Diamond 5-11) at Chicago White Sox (Joh.Danks 4-13), 1:10 p.m. L.A. Angels (Vargas 8-7) at Oakland (Griffin 14-9), 2:35 p.m. N.Y. Yankees (P.Hughes 4-13) at Toronto (Happ 4-6), 6:07 p.m. Seattle (Iwakuma 12-6) at Detroit (Verlander 13-11), 6:08 p.m. Baltimore (W.Chen 7-7) at Boston (Peavy 11-5), 6:10 p.m. Texas (D.Holland 9-9) at Tampa Bay (Archer 9-7), 6:10 p.m. Cincinnati (G.Reynolds 1-2) at Houston (Peacock 5-5), 7:10 p.m. Cleveland (Salazar 1-2) at Kansas City (B.Chen 7-3), 7:10 p.m. Thursday’s Games Seattle at Detroit, 12:08 p.m. Houston at Cleveland, 6:05 p.m. N.Y. Yankees at Toronto, 6:07 p.m. Baltimore at Boston, 6:10 p.m. Texas at Tampa Bay, 6:10 p.m. Minnesota at Oakland, 9:05 p.m.

Corinth

Car Title - Personal Check

5

$

99 each

Medium 2-Topping Pizza • 8pc Chicken Oven Baked Sandwich • Pasta in a Tin Stuffed Cheesy Bread Best deals Dominos.com

NOW OPEN Sun-Thur. 10:30AM-11PM; Fri. & Sat. 10:30AM-Midnight

Online code:9193 Carry Out Limited Delivery Area

1102 Hwy 72 E Corinth

662-284-9099

TWISTED SPIRITS 1005 Hwy 72 W Corinth, MS

(Beside Southern Motel) Monday-Saturday 10am-9pm

year. The Deadspin audio surfaced two days after the Huskers squandered a 21-3 lead and lost 41-21 to UCLA. Pelini said he didn’t know who leaked the audio and had not considered legal action against IMG College, the company that owns the Husker network. “I’ll be interested to hear who did that,” he said of the source of the Deadspin audio. He declined to comment on his thoughts about the source. “I don’t want to go there ... Everybody out there knows that obviously there was an agenda

behind it and it’s unfortunate,” he said. Pelini said there shouldn’t be a perception that he isn’t happy at Nebraska. “I’ve had opportunities to leave Nebraska, so obviously I enjoy it here,” he said. “My family enjoys it here. I’ve had a good experience here. I’ve been very active in the community. I have great relationships here. I’ve had great support here, by the fans.” Pelini said he’s never pursued another job since he’s been at Nebraska. “I’ve had people pursue me,” he said.

SMITH CABINET SHOP CABINET BARGAINS

LARGEST SALE IN OUR 30 YEAR HISTORY! We have recently made changes in the materials and finishes used in some of our cabinet lines. Because of this, we have accumulated several loads of discontinued merchandise. We are selling these cabinets at unbelievable discounts!

Pre-FInished White Cabinets with Raised Panel Doors

50% OFF We have unfinished Cabinets in various styles and sizes that have been picked up due to dealer closings.

30% OFF

(These may be slightly discolored) We are also replacing our showroom display sets! Example: Raised Panel Oak Display

50% OFF

Regularly Priced at $1,823.54

NOW $911.77

SMITH CABINET SHOP

1505 Fulton Drive Corinth, MS 388834 • 662-287-2151


14A â&#x20AC;˘ Daily Corinthian

Home & Garden

Wednesday, September 18, 2013

Pumpkins, gourds make attractive fall displays Sept. 22 may be the first day of fall, but the best way to know summer is ending is to look at all the colorful pumpkin and gourd displays at local garden centers around the state. These displays are not only for Halloween. Fall harvest displays can add charm and interest throughout the season. What is more seasonally appropriate than using pumpkins and gourds along with fall-flowering mums and colorful marimums? Besides basic orange, pumpkin colors include red, yellow, white, blue and multicolored stripes. Pumpkins can be miniature, flattened, necked, smooth, winged and warty. There are hundreds of different varieties of pumpkin, squash and gourd, and pumpkin patches are springing up all over Mississippi. Letâ&#x20AC;&#x2122;s take a look at a few fall favorites. The Cinderella pumpkin is an heirloom variety that originated in France. This pumpkin has been a fall favorite since the late 1880s. If the shape seems familiar, think back to an old Disney movie you may have seen. Popular opinion is that this pumpkin variety was used as the model for Cinderellaâ&#x20AC;&#x2122;s carriage in the classic animated film. The flattened shape also makes this a good stacking pumpkin. Not all pumpkins have smooth skins. One of the more interesting varieties is the peanut pumpkin, which is a cross between an unknown pumpkin variety and a Hubbard squash. This pumpkin has a warty surface that

resembles peanuts. It is a great choice for adding coarse texture to any Gary display. W h i l e Bachman the large Southern pumpkins Gardening get the most attention, miniature pumpkins are very versatile. There are plenty of cute mini varieties, including some that are solid white, traditional bright orange, or white with orange, vertical stripes. Try displaying minis in big flowerpots or bowls. Mini pumpkins will keep all through the season sitting on the front porch. Why stop with pumpkins when there are interesting squash and gourds available for displays? Turban squash is a popular, hat-shaped variety that Native Americans grew. The bulb-like top makes a good fall decoration with its bizarre shape and multicolored stripes. This squash would make a fantastic centerpiece for any gathering of family and friends. Other good squash varieties for decorations include Hubbard and any of the winter squash. Gourds come in amazing varieties. Some of the more interesting have wings and warts, and the swan-shaped gourds are colorful and spectacular. Believe it or not, most are delicious when baked or made into a pie. A Bachman family favorite is homemade pumpkin seeds. After carving a jack-o-lantern, save and thoroughly wash the seeds.

Toss with melted butter, sprinkle with sea salt and bake at 300 degrees until slightly toasted. It will be hard, but let the seeds cool and then enjoy. Be sure to inspect your pumpkins, squash and gourds before purchasing. They will last longer if there is no surface damage, and that includes pumpkins for carving before Halloween. To extend their usefulness, try painting scary faces on their surfaces instead of carving them. If you just have to carve a pumpkin, you can coat the cut surfaces and inside with petroleum jelly. This will help to seal and keep the flesh firm. Enjoy locally grown pumpkins, squash and

Photos by MSU Extension Service /Gary Bachman

Colorful pumpkin, squash and gourd displays at local garden centers around the state are indications that summerâ&#x20AC;&#x2122;s days are nearing an end, above. Turban squash is a popular, hat-shaped variety that Native Americans grew. The bulb-like top makes a good fall decoration with its shape and multicolored stripes, right. gourds in festive displays this fall. (Daily Corinthian columnist Dr. Gary Bachman is an associate Extension research professor of horticulture at the Coastal Research and Extension Center in Biloxi.)

Southgate Shopping Center CASS ST R EET. CORIN TH

1018 South Cass Street Corinth, MS 38834 (662) 286-2216

810 South Cass Street Corinth, MS 38834 (662) 287-31 708 S. Cass Street in Corinth

H]de]ZgZ[dgndjgZaZXig^XVa^iZbh/ WadlYg nZgh!Xjga^c\^gdch! Ă&#x201E;Vi^gdch!ZiX### AVg\ZHZaZXi^dcd[<^[i8VgYh

606 Cass St. Corinth, MS 662-665-0608 Fax 662-665-0732

+&'8VhhHiÂ&#x2122;Hdji]\ViZEaVoV 8dg^ci]!BHÂ&#x2122;'-+"-'%) =djgh/Bdc"HVi.Vb",eb ;g^Hjc&eb"+eb

check us out and

SAVE

20%

OFF

any single regular priced item

maurices

Weâ&#x20AC;&#x2122;ve got fashion that is real freash and fun. Denim to dressy. Work week to weekend. Find the clothes that seak to you.

Plunkâ&#x20AC;&#x2122;s Computers

704 South Cass Street Corinth ,MS 38834 Phone: 662-287-5151 Hours:Monday- Friday 10am-5pm www.plunkscomputers.com

.%'H#8VhhHi# 8dg^ci] Hdji]\ViZEaVoV ++'"'-,")%+% A Dining Experience Like No Other

Come See Us For The Latest Best Sellers! 802 Cass St Southgate Plaza Corinth, MS 662-286-2335

Classic Old Style Iron Skillet Cooking 602 South Cass Street, Corinth, MS 38834 (662) 287-2323

Your Your way.  taxes.

  

 You people.  got 

  H&R Block Tax Professionals          are ready to help. #,"   %($1(-".&(*,"'(&)'1"#'1(-(-

With H&R Block, you have more than a company behind you. You ".('('('*%,#('+"#)/#,"('(    %($+ ,0 have one-on-one relationship with one of H&R Blockâ&#x20AC;&#x2122;s 90,000 tax )*( a ++#('%+/(*$#'! (*1(-#')*+('1)"('(*.#&#% professionals working for you, in person, by phone, or via e-mail.

8]VYGZYY^c\

,()#',(1(-*'*1   %($%(,#('%#+,%(/

(*(,"*%(,#('+%%  (*.#+#,"*%($(& ,%)H#8VhhHigZZi Stop into your nearby H&R Block location listed below. 8dg^ci]!BH for other locations call 1-800-HRBLOCK or visit hrblock.com     CZmiid7Za`h9ZeVgibZciHidgZ  

    604 Cass Street 412 &&'%' ++''-)"%,%,      Street Address X]VYgZYY^c\5VaahiViZ#Xdb #%"' Corinth, MS City, State Zip 000-000-0000 44065012 Mon.-Fri. 7:00-7:00 662-287-0114

          Street Address City, State Zip 000-000-0000 Mon.-Fri. 7:00-7:00

Corinth â&#x20AC;˘ 286-0058 Southgate Shopping Plaza Mon.-Thurs. 10-8; Fri. & Sat. 10-9; Sun. 1-6


Taste

1B â&#x20AC;˘ Daily Corinthian

Wednesday, September 18, 2013

Healthy potato soup packs porky flavor BY SARA MOULTON Associated Press

7KLVVRXSLVDVWLFNWR\RXU ULEVĂ&#x20AC;H[LWDULDQVSHFLDO0DNHLW ZLWKFKLFNHQEURWKDQGSUR VFLXWWRDQG\RXHQGXSZLWKD FDUQLYRUHÂśVGHOLJKW0DNHLWZLWK YHJHWDEOHVWRFNDQGQRSURVFLXW WRDQG\RXÂśYHJRWDYHJHWDULDQÂśV GHOLJKW(LWKHUZD\LWÂśVSOHQW\ KHDUW\7KHSRWDWRHVJLYHLWERG\ DQGFUHDPLQHVV7KHVSLQDFK DQGNDOHJLYHLWHDUWKLQHVVDQGD EULJKWJUHHQFRORU 7KHJUHHQVDOVRKDSSHQWREH QXWULWLRQDOVXSHUVWDUV²ERWK VSLQDFKDQGNDOHDUHWHUULÂżF VRXUFHVRIYLWDPLQV$&DQG. QRWWRPHQWLRQÂżEHU)RUIRONV ZKRJHQHUDOO\ÂżQGNDOHDOLWWOH WRRDVVHUWLYHWKHWLPHWRHDWLW LVQRZLQWKHFRROHUPRQWKV ZKHQLWVWDVWHLVPLOGHU$QG JLYHQNDOHÂśVFXUUHQWÂłLW´YHJHWDEOH VWDWXV\RXÂśOOFHUWDLQO\KDYHQR WURXEOHÂżQGLQJLWDWWKHVWRUH 6RPHVXSHUPDUNHWVHYHQFDUU\ WKHEDJJHGVKUHGGHGOHDYHVDV FRQYHQLHQWDVSUHZDVKHGOHWWXFH RUVKUHGGHGVODZPL[ )RUWKHSRWDWRHV,ZHQWZLWK <XNRQJROGEHFDXVH,OLNHWKHLU EXWWHU\WDVWHDQGEHFDXVHWKH\ KROGWKHLUVKDSHZKHQFRRNHG XQOLNHKLJKVWDUFKWKLFNVNLQQHG EDNLQJSRWDWRHV+RZHYHUDQ\ SRWDWRZLOOGRDVORQJDV\RXFXW LWLQWRLQFKFKXQNV,IWKHRQO\ VSXGV\RXKDYHRQKDQGDUHEDN LQJSRWDWRHV VXFKDVUXVVHWV  MXVWEHVXUHWRSHHOWKHPÂżUVW 2WKHUZLVHWKHVNLQZLOOEHWRR FKHZ\LQWKHVRXS 7KHUHÂśVYHU\OLWWOHIDWLQWKLV UHFLSH7KHYHJHWDULDQYHUVLRQ XVHVMXVWWDEOHVSRRQVRIH[WUD YLUJLQROLYHRLODQGKDOIDQRXQFH RIJUDWHG3DUPLJLDQR5HJJLDQR $OLWWOHELWRIWKDWMXVWO\FHO HEUDWHGFKHHVHJRHVDORQJZD\ $QGFDUQLYRUHVFDQNHHSWKHIDW FRQWHQWORZE\WULPPLQJRIIWKH SURVFLXWWRÂśVIDW :KDWÂśVWKDW"7KHOLWWOH0DULR %DWDOLGHYLORQ\RXUVKRXOGHU LQVLVWVWKDWWKHĂ&#x20AC;DYRUZLOOJR E\HE\HDORQJZLWKWKHIDW"1RW QHFHVVDULO\,ZDVWKULOOHGWRGLV FRYHUWKDWLI\RXEULHĂ&#x20AC;\EDNHWKH SURVFLXWWRRQDUDFNLQWKHRYHQ LWEHFRPHVGRZQULJKWEDFRQ HVTXH²FULVSVDOW\DQGUHGROHQW RISRUN-XVWEHVXUHWRSXOOWKH SURVFLXWWRRXWRIWKHRYHQEHIRUH LWLVFRPSOHWHO\FULVS,WZLOO FRQWLQXHFRRNLQJHYHQRXWVLGH WKHRYHQ,ILWGRHVQÂśWUHDFKWKH GHVLUHGVWDWHZLWKLQDPLQXWHRU WZRVOLGHLWEDFNLQWRWKHRYHQ DQGJLYHLWDQRWKHUTXLFNMROW 1RZ\RXÂśYHJRWDOOWKHĂ&#x20AC;DYRU \RX²RU\RXULQQHU0DULR² FRXOGDVNIRU-XVWNHHSDQH\H

RQWKHVDOWLQWKHUHVWRIWKH UHFLSH%RWKWKHFKHHVHDQGWKH PHDWDUHKLJKLQVRGLXP

Associated Press

Potato and greens soup features vitamin-rich greens such as spinach and kale.

Potato and greens soup with parmesan toasts Start to finish: 1 hour (40 minutes active) Servings: 4 2 tablespoons extra-virgin olive oil, divided 1 cup finely chopped yellow onion 1 tablespoon minced garlic 1 pound Yukon gold (or other thin-skinned potatoes), cut into 1-inch chunks 4 to 5 cups low-sodium chicken or vegetable broth 1â &#x201E;2 cup dry white wine 6 cups packed torn kale leaves 6 cups packed baby spinach leaves 1 teaspoon red pepper flakes, or to taste Salt 1â &#x201E;4 pound thinly sliced prosciutto Twelve 1â &#x201E;2 -inch-thick diagonally cut slices of baguette 1â &#x201E;2 ounce finely grated Parmigiano-Reggiano cheese +HDWWKHRYHQWR ) ,QDODUJHVDXFHSDQ RYHUPHGLXPKHDW WDEOHVSRRQRIWKHRLO $GGWKHRQLRQDQGFRRN VWLUULQJRFFDVLRQDOO\XQWLO VRIWHQHGDERXWPLQXWHV$GG WKHJDUOLFDQGFRRNVWLUULQJIRU PLQXWH $GGWKHSRWDWRHVFXSVRIWKH VWRFNDQGWKHZLQH%ULQJWRD ERLOFRYHUWKHSDQDQGVLPPHU IRUPLQXWHV $GGWKHNDOHFRYHUWKHSDQ WKHQVLPPHUIRUDQRWKHUPLQ XWHV$GGWKHVSLQDFKDQGWKH SHSSHUĂ&#x20AC;DNHVFRYHUDQGVLPPHU IRUDQRWKHUPLQXWHV :RUNLQJLQEDWFKHVWUDQVIHU DERXWFXSVWRWDORIWKHVRXS VROLGVZLWKDOLWWOHDGGHGEURWK HDFKWLPHWRDEOHQGHUDQGSX

UHH XQWLO VPRRWK %HFDUH IXOKRWIRRGV H[SDQGLQWKH EOHQGHU5HWXUQ WKHSXUHHWRWKH VDXFHSDQDGGVDOWWRWDVWHDQG WKHDGGLWLRQDOFXSRIVWRFNLI QHFHVVDU\WRDFKLHYHWKHGHVLUHG WH[WXUH+HDWXQWLOKRW 0HDQZKLOHVHWDZLUHUDFN

RYHUDULPPHGEDN LQJVKHHW$UUDQJHWKH SURVFLXWWRVOLFHVLQD VLQJOHOD\HURQWKHUDFN WKHQEDNHRQWKHRYHQÂśV PLGGOHUDFNIRUWR PLQXWHVRUXQWLOWKH\ EHJLQWRFULVS5HPRYH WKHUDFNIURPWKHVKHHW SDQDQGVHWLWRQWKH FRXQWHUWROHWWKHSURVFLXW WRFRRO:KHQFRROFUXPEOH WKHSURVFLXWWR $UUDQJHWKHEDJXHWWHVOLFHV LQVLQJOHOD\HURQWKHVKHHWSDQ DQGEUXVKWKHPZLWKWKHUH PDLQLQJWDEOHVSRRQRIROLYHRLO %DNHWKHPRQWKHRYHQÂśVPLGGOH

VKHOIXQWLOJROGHQEURZQWR PLQXWHV6SULQNOHWKHJUDWHG FKHHVHHYHQO\RYHUWKHPUHWXUQ WKHVOLFHVWRWKHRYHQDQGEDNH XQWLOWKHFKHHVHLVMXVWPHOWHG WRPLQXWHV 7RVHUYHODGOHWKHVRXSLQWR ERZOVWKHQWRSHDFKSRUWLRQ ZLWKVRPHRIWKHSURVFLXWWR FULVSVDQGWRDVWVRQWKHVLGH 1XWULWLRQLQIRUPDWLRQSHU VHUYLQJFDORULHVFDOR ULHVIURPIDW SHUFHQWRIWRWDO FDORULHV JIDW JVDWXUDWHG JWUDQVIDWV PJFKROHVWHU ROJFDUERK\GUDWHJÂżEHU JVXJDUJSURWHLQPJ VRGLXP

Apple pie in an hour? Itâ&#x20AC;&#x2122;s as easy as it is delicious BY ALISON LADMAN Associated Press

$VVDWLVI\LQJDVLWLVWRHDWIUHVKO\SLFNHG DSSOHVVWUDLJKWXSDQGXQDGRUQHGWKHFKLOO RIIDOOPDNHVLWHTXDOO\WHPSWLQJWRKHDG EDFNWRWKHNLWFKHQDQGEDNHWKHPLQWRD SLH %XWWKDWÂśVZKHUHPRVWSHRSOHJHWWULSSHG XS7KH\IHDUDIXVV\SLHFUXVW7KH\ORDWKD ORQJEDNLQJWLPHRUDSHUVQLFNHW\ÂżOOLQJ6R ZHGHFLGHGWRFRPHXSZLWKDQHDV\DSSOH WDUWWKDWXVHVDIXVVIUHHFUXVWDQGFRPHV WRJHWKHULQXQGHUDQKRXU(YHQEHWWHU² EHFDXVHWKHÂżOOLQJLVRQO\JHQWO\FRRNHGRQ WKHVWRYHWRSWKHDSSOHVUHWDLQPRUHRIWKHLU FULVSIUHVKMXVWSLFNHGĂ&#x20AC;DYRU

Easy autumn apple tart Start to finish: 1 hour Servings: 12 14 tablespoons (13â &#x201E;4 sticks) unsalted butter, room temperature 1â &#x201E;2 cup granulated sugar 1â &#x201E;2 teaspoon salt, divided 13â &#x201E;4 cups all-purpose flour 4 apples, peeled, cored and sliced 2 tablespoons cider vinegar 1â &#x201E;4 cup packed brown sugar 1â &#x201E;4 cup apple cider 1â &#x201E;2 teaspoon cinnamon

2 teaspoons cornstarch 1 tablespoon water +HDWWKHRYHQWR)&RDWDQLQFK UHPRYDEOHERWWRPWDUWSDQZLWKEDNLQJ VSUD\ ,QDIRRGSURFHVVRUFRPELQHWKHEXWWHU VXJDUDQGÂťWHDVSRRQRIWKHVDOW3XOVHVHY HUDOWLPHV$GGWKHĂ&#x20AC;RXUDQGSXOVHWRFRP ELQHVFUDSLQJGRZQWKHVLGHVRIWKHZRUN ERZODVQHHGHG7UDQVIHUWKHGRXJKWRWKH SUHSDUHGSDQ3UHVVWKHGRXJKHYHQO\DFURVV WKHERWWRPDQGXSWKHVLGHVRIWKHSDQ3RNH WKHERWWRPDOORYHUZLWKDIRUN%DNHIRUWR PLQXWHVRUXQWLOJROGHQEURZQ :KLOHWKHFUXVWEDNHVPDNHWKHÂżOO LQJ,QDODUJHVNLOOHWRYHUPHGLXPKLJK KHDWFRPELQHWKHDSSOHVYLQHJDUEURZQ VXJDUFLGHUFLQQDPRQDQGWKHUHPDLQLQJ ÂťWHDVSRRQVDOW&RRNJHQWO\VWLUULQJWR SURPRWHHYHQFRRNLQJEXWZLWKRXWEUHDNLQJ WKHDSSOHVXQWLOMXVWWHQGHUDERXWWR PLQXWHV ,QDVPDOOJODVVPL[WKHFRUQVWDUFKDQG ZDWHU$GGWRWKHDSSOHVDQGFRRNVWLUULQJ JHQWO\IRUPLQXWHVRUXQWLOWKLFNHQHG :KHQWKHFUXVWDQGDSSOHVDUHFRRNHG VSRRQWKHDSSOHVLQWRWKHFUXVWDUUDQJLQJ Associated Press WKHPLQFRQFHQWULFFLUFOHVLIGHVLUHG3RXU This easy apple tart uses a fuss-free crust that comes together in less than an hour. The filling is gently cooked on the stovetop, so the apples retain more of DQ\H[WUDMXLFHVRYHUWKHVXUIDFHRIWKH their crisp, fresh, just-picked flavor. DSSOHV6HUYHZDUPRUURRPWHPSHUDWXUH


2B • Wednesday, September 18, 2013 • Daily Corinthian

Community events Assistance needed Financial assistance would be appreciated to help Mrs. Ethel Franks. Mrs. Franks, 93, who lost everything she owned recently when her mobile home was hit by lightning. Financial donations can be made to Regions Bank in Corinth to the account of Mrs. Ethel Franks.

Farm Bureau meets Alcorn County Farm Bureau is holding its annual meeting Tuesday, Sept. 24 at 6 p.m. The meeting is being held at the MS State Extension Office, located directly behind the Crossroads Arena. All Alcorn County Farm Bureau members are invited to attend. Bring a favorite dessert.

Coat drive Maurices, 720 S Cass Street, Corinth, is holding a Coat Drive to benefit the Boys and Girls Club. The coat drive continues through Saturday, Sept. 28. Customers can drop off their donations any time during store hours, which are Monday-Wednesday, 10 a.m.7 p.m.; Thursday-Saturday, 10 a.m.-8 p.m.; and Sunday, 1-5 p.m.

Class reunions • CHS ’83/’84 30-year class reunion is being held Saturday, Oct. 5. For more details, email calumni@yahoo.com or contact Callie at 4152206. • The Iuka High School Class of 1973 will celebrate its 40-year class reunion on Saturday, Oct. 5. All classmates and their guests are invited to attend. The celebration will be held at the J P Coleman State Park Conference Center from 6 p.m. until 9 p.m. Refreshments will be served, Cost is $25 per

person or $45 per couple. RSVP to Linda Murrah at Bancorp South, P .O. Box 377, Iuka, MS  38852 by Sept. 20. For more information, email chieftains73@gmail.com. 

Book signing Tom C. McKenney, author of “Jack Hinson’s One-Man War” is having a book signing Saturday, Oct. 5 from 11 a.m. to 3 p.m. at Taylor’s Grocery, Hwy. 57, Pocahontas, Tenn. USMC Ret. Lt. Col. McKenney’s book is about how a Tennessee gentleman farmer became a storied Civil War sniper. Hinson’s rifle is one of the most famous firearms of the Civil War and will be on display by it’s present owner, Judge Ben Hall McFarlin. Also present will be Joe McCormick, artist of the book’s dust cover and designer of the Jack Hinson solid bronze belt buckle. For more information, go to Facebook: Jack Hinson.

Suggs Pottery speaker Prentiss County Genealogical and Historical Society is holding its monthly meeting Monday, Sept. 23 at 6 p.m. at the George E. Allen Library in Booneville. Guest speaker will be Janis Suggs Dyson of Houston. She is the author of “Turning Clay Into History: The Story of W.D. Suggs Pottery.” Mrs. Dyson is very knowledgeable in Suggs pottery and would like to invite the public to bring their pieces of Suggs pottery for identification. If anyone has pottery they cannot identify, she will be interested in seeing these as well. The public is invited to attend.

Campus Country Northeast Mississippi Community College’s Campus Country is holding its first showtime performance of the 2013-14 academic year on Saturday, Sept. 21 in the Seth Pounds Auditorium on the Booneville campus. Curtain rises at 7 p.m. with doors opening at 6:30 p.m. on the initial showtime entitled, “Turn On the Radio.” Admission is free with a Northeast student, staff or faculty identification card and $5 for general admission. Campus Country’s set list includes both classic and modern country with a few surprises mixed in.

Activity center Bishop Activity Center is having the following activities for the week of Sept. 16-20: Today -- games, quilting, jigsaw puzzles and open discussion; Thursday -- pet therapy from CorinthAlcorn County animal shelter, Bingo, games, quilting, jigsaw puzzles and open discussion; and Friday -- Rogers’ supermarket for grocery shopping; games, quilting, jigsaw puzzles and open discussion. Senior citizens, age 60 and above, are welcome and encouraged to attend. A variety of activities is offered for everyone.

Kids/Family Day Tickets are now on sale to see A&E “Duck Dynasty” stars Willie Robertson and son John Luke at the Crossroads Arena. The two are scheduled to be part of the “Kids and Family Day” being co-hosted by the Arena and Alcorn County Fair. A 5 p.m. show is set for the final day of the fair on Sept.

21. Tickets to see the Robertsons include comp attendance to the Saturday fair only. Prices are $78 for the first five rows, $53 for the next five rows, $33 for remaining floor seats and $23 for riser seating. All seats are reserved and include a service charge. Tickets purchased online are an additional $1.50 per ticket. The Arena Box Office is open 9 a.m. to 5 p.m. Monday-Friday.

HB2 Victory Rally Area patriots’ group is holding its second rally, “HB2 Victory Rally” in Corinth at the Crossroads Regional Park (city park), Saturday, Sept. 21 from 10 a.m. to 2:30 p.m. This will be a victory celebration of the recent Supreme Court decision upholding the Miss. HB2 firearm law. There will be patriotic singing by TEA Party Activist Singers Bill and Melissa Beaty and by local talent Shelby Pratt. There will be other live music, jumpers and games for the kids, constitutional speakers, free door prizes and crafts booths. Bring lawn chairs. “Post the Colors” will begin at 10:30 a.m. followed by pledge and National Anthem. First guest speaker will be Corinth Mayor Tommy Irwin at 11 a.m. A public en mass swearing-in of patriots into the Miss. Oath Keepers will be held at noon by MIss. Oath Keepers president and Iraq War veteran John Moran.

Cruise-in The Magnolia Antique Car Club is hosting a Cruise-in at Arby’s in Corinth, Sunday, Sept. 22 from 1-4 p.m. This will be a “car guy fellowship.” There will be music by The Joe Rickman Band.” Bring lawn chairs.

There will also be a drawing for free food. Registration fee is $5. Money received will be given back as door prizes to participants. For more information, call Rick Kelley, 662-284-7110.

VFW meets VFW Post No. 3962 is holding its monthly meeting on Thursday, Sept. 19. A potluck supper will begin at 6 p.m. The combined Post member, ladies auxiliary and men’s auxiliary meeting will begin at 7 p.m. followed by individual section meetings. The Post is located at 1 Purdy School in Corinth. For more information, call 287-6101. All VFW and auxiliary members are encouraged to attend.

Caregiver symposium Magnolia Regional Hospice is hosting its second annual Caregiver’s Symposium, Tuesday, Oct. 1 at the Mississippi State Extension Center (behind the Crossroads Arena) from 10 a.m. until 3 p.m. This is a free service to the public. Call 662-293-1405 to register with Lila Wade by Sept. 20.

‘Biloxi Blues’ Corinth Theatre-Arts, 303 Fulton Dr., Corinth, is presenting “Biloxi Blues,” a Neil Simon play focusing on U.S. Army recruit Eugene Morris Jerome at basic training in Biloxi during WWII. Eugene wants to be a writer so he keeps detailed memoirs about his experiences which include a difficult drill sergeant, unpalatable mess hall meals and a visit to a local madam with five other enlisted men. Performances for “Biloxi Blues” are ThursdaySaturday, Sept. 19-21

beginning at 8 p.m., and a Sunday matinee showing Sept. 22 at 2 p.m. Tickets are $12 for adults and $6 for students. Tickets may be reserved by calling CT-A at 662-287-2995 or by purchasing tickets at the theatre between 1-6 p.m. Tuesday-Friday or at the door prior to performances.

Library book sale     The Friends of the Corinth Library are having a “gigantic” book sale in the library garage on Saturday, Sept. 21. Books, books on tape and CDs, DVDs and Christian music book collections will be available for purchase from 9 a.m. until late afternoon. Items range in price from 25 cents to $1. All sales will benefit the Corinth Library. Donations are still being accepted at the library.  For more information, call 287-2441.

New theatre production The Baldwyn Main Street Players will christen the new Claude Gentry Theatre in Baldwyn with its production of “And Then There Were None,” a suspenseful mystery written by the best-selling author Agatha Christie. This play is a classical murder mystery that is sure to keep viewers guessing until the very end. The play will be presented Thursday, Sept. 19, Saturday, Sept. 21, Monday, Sept. 23, Thursday, Sept. 26 and Saturday, Sept. 28 at 7 p.m. and a Sunday afternoon matinee at 2 p.m. on Sept.22. Tickets are $12. Nightly seating is limited so to guarantee getting a ticket, theatrePlease see EVENTS | 3B

Much pull.

Visit our Corinth locations today, 1108today, South Cass Street Visit our Corinth locations 1108 South Cass and 2301 S. Harper Road inside Walmart Street and 2301 S. Harper Road inside Walmart

“Serving needs of our communities, “Serving the the needs of our communities,

patientatataatime. time.”” oneonepatient

We are proud to offer: s"ED4RANSITIONAL#ARE5NIT s2EHABILITATION4HERAPYINCLUDING 0HYSICAL /CCUPATIONAL3PEECH4HERAPY s#HRONIC4RACHEOSTOMY#ARE s3TROKE2EHABILITATION s0ULMONARY7OUND#ARE s/RTHOPEDIC0OST3URGICAL2ECOVERY s/UTPATIENT2EHABILITIATION3ERVICES

-

CORNERSTONE HEALTH & REHAB OF CORINTH Another Covenant Dove Community

!LCORN$RIVEs#ORINTH -3s  

www.covenantdove.com/cornerstone

24/7 24/ 24 /7 Adm dm missions: (662) 2112-0487 -EDICARE -EDICAAID 0RIVATE0AY 0RIVAT 0RI VATEE)NSU VAT E )NSU NSURA RAANCEACCEPTED


Daily Corinthian â&#x20AC;˘ Wednesday, September 18, 2013 â&#x20AC;˘ 3B

EVENTS CONTINUED FROM 2B

goers should call 662678-3931.

Alcorn County Fair The Alcorn County Fair is set for its third year with gates opening now through Saturday, Sept. 21 at the Crossroads Arena. The Crescent City Carnival will be ongoing all five nights, opening at 1 p.m. on the final day. There will be free events including pony rides, a petting zoo and a childrenâ&#x20AC;&#x2122;s health screening (Thursday night). Entertainment will include Revolve, a contemporary Christian event tonight, Pickinâ&#x20AC;&#x2122; on the Square featuring Breaking Grass on Thursday night and A&E â&#x20AC;&#x153;Duck Dynastyâ&#x20AC;? stars Willie and John Luke Robertson on Saturday night. The Mid-South Talent Show is slated for Friday night. Miss Fairest of the Fair and a livestock show will be two big events on Saturday. A quilt show, canned and baked goods contest and an art contest are also planned for the fair. Admission to the fair is free tonight. The carnival opens 5-10 p.m. and other events begin at 5 p.m., including the Magnolia Car Show.

Employees meet The National Association of Active and Retired Federal Employees  (NARFE) Jacinto Chapter 1879 will hold its Thursday, Sept. 19 monthly meeting at Ryanâ&#x20AC;&#x2122;â&#x20AC;&#x2122;s, 2210  Harper Road,  Corinth at 11:30 a.m.  All active and retired federal employees are invited to attend.

until at the McNairy County Fire Department, Hwy. 57 near Big Hill Pond State Park entrance between Pocahontas and Ramer, Tenn. This is a potluck. There will be door prizes included. For more information, contact Shirley at 662-720-7028, cowgirlms63@aol.com. â&#x20AC;˘ The Crabb reunion is being held Sunday, Sept. 22 at Eastview Civic Center in Eastview, Tenn. (at Hwys. 45 and 57 intersection). Bring pictures. Doors will open at 10 a.m. with lunch at noon.

Fall dinner The McNairy County Forest Landowners Association is holding its annual Fall Dinner meeting, Thursday, Sept. 19 at the Eastview Civic Center, beginning at 6:30 p.m. Meal provided. All members and individuals interested in learning about forestry and sharing with other landowners are urged to attend. Also scheduled are TFA and legislative updates. RSVPs must be phoned to area forester, 731645-3531, UT Extension office, 731-645-3598 or the Association, 731645-9384 by today. Call for more information.

WIN Job Fair The Northeast Mississippi Workforce Investment Network (WIN) is having a job fair, Tuesday, Sept. 24 from 9 a.m. to 2 p.m. at the Crossroads Arena., 2800 South Harper Rd. in Corinth. No admission required. Employers will be on hand with job opportunities in many different fields.

â&#x20AC;˘ The Russell Reunion is being held Saturday, Sept. 21 from 10 a.m.

VFW Post No. 3962 hosts a Karaoke Night every Friday at the post on Purdy School Rd. in

tember, cans can be dropped off at Pioneer Machinery, 901 S. Tate St., Corinth or call Roy Cummings at 662-3961326.

â&#x20AC;&#x2DC;Just Plain Countryâ&#x20AC;&#x2122; Just Plain Country performs at the Tishomingo County Fairgrounds in Iuka every Saturday from 7-10 p.m. Good family entertainment.

Friday night music â&#x20AC;˘ There is music every Friday night with the band, The Renegade, from 7-10 p.m. at the Guntown Community Center. This is a familyfriendly event. â&#x20AC;˘ Joe Rickman and band will be performing country and gospel music at the American Legion building in Iuka every second and fourth Friday of the month at 7 p.m. This will be a familyfriendly event. Donations will be accepted.

Quilt raffle The 4H Mod Squad is selling chances for a quilt for $2 for one chance or $5 for three chances. The quilt was made and donated to the club by ladies of the Piecemakers Quilt Guild and measures 76 by 94. It is done in the green and white colors that represent 4H. The club will be selling chances until Sept. 29. Proceeds from the raffle will go to help 4Hers go to the state Showdown in Jackson in October. To purchase a raffle ticket, call Judy at 662-287-5527 or Elizabeth at 731-2395539.

Cans for Kids Karaoke/dance night

Family reunions

Corinth. Karaoke begins at 8 p.m. with music by D.J. Lanny Cox. Lanny Cox also provides music at the VFW on Saturday Dance Night which begins at 8 p.m.

Everyone is encouraged to donate their cans to help find a cure for Cystic Fibrosis. During the month of Sep-

Wounded Warrior Project Generations, a Salute to Journey and the Wounded Warrior Project will hold a benefits concert at the Corinth Coliseum-Civic Center, Saturday, Oct. 5, with all the proceeds going directly to helping our service members. The Wounded Warrior Projectâ&#x20AC;&#x2122;s (WWP) mission is to honor and empower wounded warriors who have been injured in combat. Doors open at 6:30 p.m. with the show set to start at 7 p.m. With a $100 donation, the donor will get four general admission tickets and will be mentioned as a â&#x20AC;&#x153;Friend of Generations and the WWP.â&#x20AC;? Sponsorship packages are available from Platinum for $500, Gold for $300 and Silver for $200. Tickets for the show are available at the Alliance and The Tourism Office in Corinth and will also be available at the door for $15 for general admission. For more information and details on these sponsorship packages and other questions, call 662-802-9047 or email at deannajets@ yahoo.com.

Art on display The paintings of Jim Tidwell and Kay Morgan will be on display at Northeast Mississippi Community College in Anderson Hall Art Gallery through Oct. 7. Gallery hours are Monday-Friday, 8 a.m. - 3 p.m. Contact Terry Anderson at 662720-7336 or tfander-

son@nemcc.edu for more information.

Town hall meeting Local residents will get a rare audience with the Mississippi Speaker of the House in an upcoming town hall meeting. It is set for 1 p.m. on Tuesday, Oct. 8, in the board room at Corinth City Hall. It is expected to be one of a series of meetings that Philip Gunn (R-Clinton) will hold to discuss issues. He will be talking about what he foresees in the upcoming session of the Legislature. The representative for District 56 (Hinds, Madison, Warren and Yazoo counties) is an attorney who was elected in 2004 and is a native of Hattiesburg. He has served as chairman of the Republican House Conference since it was formed in 2006 and has served on the executive committee of the Mississippi Republican Party. As an attorney at Wells, Marble, Hurst PLLC in Ridgeland, he practices primarily in insurance defense and civil litigation. This is a non-partisan forum for people to bring ideas on various issues.

Volunteers needed Event organizers are looking for volunteers, sponsors and donations for the 151st Battle of Farmington Reenactment. Hosted by the Blue-Gray Alliance, the event will be held Oct. 10-13 on over 160 acres of the original battleground in Farmington. Reenactors have signed up from as far away as Texas, Gettysburg, Pa., and 16 other states. A new addition to this yearâ&#x20AC;&#x2122;s event will be a fundraiser for the Verandah-Curlee House featuring a night with the generals at the Corinth

Coliseum on Friday, Oct. 11. The fundraiser will give the public a chance to visit with living history portrayals of 10 famous generals from the War Between the States. Admission will be free, and funds will be raised via donations. For more information about the Farmington Reenactment visit www. battleoffarmington.com.

Casting Crowns playing Oct. 26 The contemporary Christian-rock band Casting Crowns is slated to be performing some of its top hits when it brings its Acoustic Sessions Live Tour 2013 to the Crossroads Arena on Saturday, Oct. 26. Dara Maclean will open for the award-winning band. The Acoustic Sessions: Volume One is the first compilation album of the group, formed in 1999 by youth pastor and lead vocalist Mark Hall. Castings Crowns is the second fastest Christian band in history to have their first two albums certified platinum. In 2007, the band was the most played artist on Christian Radio. The band has won numerous Dove Awards, Grammyâ&#x20AC;&#x2122;s, and AMAâ&#x20AC;&#x2122;s, and sold over 8.2 million albums. Some of the bandâ&#x20AC;&#x2122;s popular hits include â&#x20AC;&#x153;Until the Whole World Hearsâ&#x20AC;?, â&#x20AC;&#x153;Lifesongâ&#x20AC;?, â&#x20AC;&#x153;East to Westâ&#x20AC;?, â&#x20AC;&#x153;Who Am Iâ&#x20AC;?, â&#x20AC;&#x153;Jesus, Friend of Sinnersâ&#x20AC;? and â&#x20AC;&#x153;Voice of Truthâ&#x20AC;?. Tickets are now on sale. Prices are $48, $28 and $23. Group tickets of 20 or more can be purchased at a discounted rate at Arena Box Office only. The Box Office is open Monday through Friday from 9 a.m. to 5 p.m.

Legal Scene Your Crossroads Area Guide to Law Professionals )  ($ )* 

/) 

 $ 

Odom and Allred, P.A. Attorneys at Law

 ) - - ('             "  

# )(!* () *&! 

/ 

**

/#

 /(

* (

         

 

(     ! &% Serving Northeast Mississippiâ&#x20AC;&#x2122;s legal needs...

"!$ $!  # v  (Payment Plans available)  !  " ! %!              '   $     &%    "$"!! " ! v# "(    #" !$ v    " "!$"!

+++ - (' +.) ( #'$"#  * %($*& ) ($)*   ( (*  * -  )* .* (() , )*  *& ) 

John O. Windsor A T T O R N E Y

Bankruptcy * Criminal Defense * Personal Injury

401 E. Waldron St. Corinth, MS

Call for an appointment:

662-872-0121







                                      

Contact Laura Holloway at 662-287-6111 ext. 308 to advertise your Law Firm on this page.

404 Waldron Street â&#x20AC;˘ Corinth, MS _________________________________________            '    3 

    -    1 / 2 1* '  0 /  1 .2&  &  2

662-286-9311 William W. Odom, Jr. Rhonda N. Allred Attorney at Law Attorney at Law bodom43@bellsouth.net rallred@bellsouth.net ___________________________________________  &'&#$)#(& ,!"'#"&#$' #&"#'"'",''#"#+$'&'"

*' ", * $$#$  # ("'"($',# #(""#!'#")  ($#"%(&'

Come see us at our new location:

311 W. Eastport Street, Iuka, MS 38852 Tacey Clark Locke Attorney at Law

ComeTacey see usClark at our new location: Locke Telephone: (662) 424-5000 Attorney at Law

Telephone: (662) 424-5000 Ashlee Clark Cook

Ashlee Clark Cook Paralegal Paralegal

Chapter 7 Bankruptcy; Contested and Uncontested Divorces; Child Custody; Wills; Estates; Federal Court Litigation; Adoption; Personal Injury; Wrongful Death; Social Security; Deeds; Automobile Accidents and Insurance Disputes.


Variety

4B â&#x20AC;˘ Daily Corinthian

Mom needs to reach out to sonâ&#x20AC;&#x2122;s wife 'HDU $QQLH 0\ VRQ UH FHQWO\ PDUULHG D \RXQJ ZRPDQ IURP DQ DIĂ&#x20AC;XHQW IDPLO\ :KHQ KH ZDV ÂżUVW HQJDJHG ZH EHJDQ WR VHH OHVVRIKLP:HLQYLWHGKLP DQG KLV ÂżDQFHH WR GLQQHUV YDFDWLRQV HWF EXW ZHUH XVXDOO\ WXUQHG GRZQ 7KH\ GR KRZHYHU VSHQG D JUHDW GHDORIWLPHZLWKKHUIDPLO\ VRZHKDYHMXVWEDFNHGRII 0\ KXVEDQG DQG , FRQ WULEXWHG DOPRVW KDOI RI WKH PRQH\IRUWKHZHGGLQJ:H RIIHUHG WR KHOS ZLWK ZKDW HYHUZHFRXOGEXWZHUHWROG WKDWRXUKHOSZDVQRWQHHG HG+HUIDPLO\GLGDOORIWKH SODQQLQJ6KHDQGKHUPRWK HUFRQMXUHGXSOLHVWRWKURZ XV RII IURP SODQQLQJ RXU JXHVW OLVW ZKDW ZH VKRXOG ZHDUWRWKHZHGGLQJHWF :H KRVWHG D EHDXWLIXO UHKHDUVDO GLQQHU ZLWK QR ÂłWKDQN\RX´RUHYHQDVPLOH IURPWKHEULGH2QWKHGD\ RIWKHZHGGLQJRXUGDXJK WHULQODZ ZDV HPEDUUDVV LQJO\ UXGH WR P\ KXVEDQG

Ask Annie DQGPH,WZDVQœWXQWLOWKH QH[WGD\ZKHQVKHUHIXVHG WRDWWHQGDIDPLO\IXQFWLRQ EHIRUH JRLQJ RQ WKHLU KRQ H\PRRQ WKDW , IRXQG RXW VKHZDVDQJU\ZLWKPHEH FDXVH RI ZKDW , ZRUH $Q QLH,ZRUHWKHGUHVVP\VRQ WROGPHWRZHDUEXWKHZLOO QRWDGPLWWKDWWRKLVZLIH :HKDYHQRWKHDUGIURP HLWKHU RI WKHP VLQFH WKDW GD\ , DP VR LQFUHGLEO\ KXUW,WUHDWHGWKLVJLUOOLNH SDUW RI WKH IDPLO\ , FDQœW EHOLHYHVKHZRXOGUXLQDUH ODWLRQVKLS RYHU VRPHWKLQJ VR WULYLDO $Q\ DGYLFH" ² 0RPIURP0RQWDQD 'HDU0RP7KHGUHVV LVMXVWDQH[FXVHWROLP LW FRQWDFW ,W VRXQGV DV LI \RXU QHZ GDXJKWHU LQODZ GRHVQœW ZDQW D UHODWLRQVKLS ZLWK KHU KXVEDQGœV IDPLO\ DQG KH SHUPLWV LW ² HLWKHU

EHFDXVH KH DJUHHV RU PRUHOLNHO\EHFDXVHKH GRHVQÂśW ZDQW WR XSVHW WKHDSSOHFDUW <RX QHHG WR ÂłPDNH QLFH´ HYHQ WKRXJK LW ZLOO EH GLIÂżFXOW &DOO RU HPDLO \RXU VRQ DQG KLV ZLIHDSRORJL]HIRUXQLQ WHQWLRQDOO\VHOHFWLQJWKH ZURQJ GUHVV PHQWLRQ VRPHWKLQJ QLFH DERXW WKH ZHGGLQJ DQG DERXW WKH EULGH DQG VLJQ RII E\ VD\LQJ \RX KRSH WR VHHWKHPVRRQ:HKRSH \RXUVRQYDOXHVKLVIDP LO\ HQRXJK WR SXW KLV VSLQHEDFNLQWRSODFH Annieâ&#x20AC;&#x2122;s Mailbox is written by Kathy Mitchell and Marcy Sugar, longtime editors of the Ann Landers column. Please email your questions to anniesmailbox@comcast.net, or write to: Annieâ&#x20AC;&#x2122;s Mailbox, c/o Creators Syndicate, 737 3rd Street, Hermosa Beach, CA 90254.

Marvin

Blondie

Garfield

B.C.

Dilbert

Zits

Edited by Rich Norris and Joyce Nichols Lewis ACROSS 1 Nation between Togo and Nigeria 6 â&#x20AC;&#x153;Look over here!â&#x20AC;? 10 CSNY member 14 Private line? 15 Elevator man 16 â&#x20AC;&#x153;Itâ&#x20AC;&#x2122;s clear nowâ&#x20AC;? 17 *Edward Cullenâ&#x20AC;&#x2122;s rival for Bellaâ&#x20AC;&#x2122;s hand, in the â&#x20AC;&#x153;Twilightâ&#x20AC;? series 19 Genghis __ 20 â&#x20AC;&#x153;The Plains of Passageâ&#x20AC;? author 21 Former SSR 22 Pharmaceutical repâ&#x20AC;&#x2122;s samples 23 *She played Michelle on â&#x20AC;&#x153;Full Houseâ&#x20AC;? 26 Dogpatch creator 31 Alley cats, e.g. 33 Some crowns 34 Desert tableland 35 Blue bird 37 Looking for a fight 38 Suffix with infer 39 Cook, in a way 41 Bar bowl item 42 â&#x20AC;&#x153;Donâ&#x20AC;&#x2122;t tell me!â&#x20AC;? 44 2007 â&#x20AC;&#x153;American Idolâ&#x20AC;? winner Sparks 45 *Brother of Helen of Troy, some say 47 Fails to pronounce 48 Image to identify on a driverâ&#x20AC;&#x2122;s license exam 51 Drifters 53 Diarist AnaĂŻs 54 Neighbor of a Cambodian 58 Short race, briefly 59 *Beach Boys title girl 62 Ruse 63 Duel tool 64 Target Field team, and each pair of intersecting names in the answers to starred clues 65 Funny Dame 66 Bombs 67 Narrow piece, as of cloth DOWN 1 __ California 2 *Biblical birthright seller

40 First name in 3 â&#x20AC;&#x153;Great shot!â&#x20AC;? 51 Garden waterer shipping 4 Teen Vogue 52 Burned, in a high43 1963 subject tech way Newman/Neal 5 Lincolnâ&#x20AC;&#x2122;s st. 54 â&#x20AC;&#x153;I __ I taw ...â&#x20AC;? film 6 Beer garden 55 It may have 44 *â&#x20AC;&#x153;Todayâ&#x20AC;? music highlights correspondent __ 56 Years, to 7 Super Bowl I and Bush Hager II MVP Caesar 46 Start of a show-off 57 Clouseauâ&#x20AC;&#x2122;s rank: 8 [Not my error] kidâ&#x20AC;&#x2122;s cry 9 â&#x20AC;&#x153;That wasnâ&#x20AC;&#x2122;t niceâ&#x20AC;? Abbr. 49 How traditional 10 Former Soviet 59 Place to sleep leader Chinese brides 60 Bartâ&#x20AC;&#x2122;s Squishee dress Khrushchev provider 50 Taunts 11 *â&#x20AC;&#x153;High Crimesâ&#x20AC;? 61 ACLU concerns actress ANSWER TO PREVIOUS PUZZLE: 12 Corporate emblem 13 Egg sources 18 Bruises partner 22 Shade provider 24 North Sea feeder 25 Naut. speed units 26 Env. router 27 Stay awake in bed 28 *Source of an age-old medicinal oil 29 Part of MOMA 30 Promotional bribes 32 Composer Erik 34 Cattle call 36 Hankerings 38 â&#x20AC;&#x153;Need You 09/18/13 xwordeditor@aol.com Tonightâ&#x20AC;? band

Beetle Bailey

Wizard of Id

Dustin

Baby Blues

Barney Google and Snuffy Smith

By C.C. Burnikel (c)2013 Tribune Content Agency, LLC

09/18/13

Wednesday, September 18, 2013


Daily Corinthian • Wednesday, September 18, 2013 •5B

Make Room for Change!

With the Classifieds, you can clean the clutter, earn extra cash and find great deals on the things you really want!

662-287-6111 • classad@dailycorinthian.com

BUSINESS & SERVICE GUIDE RUN YOUR AD FOR ONLY $200 A MONTH ON THIS PAGE (Daily Corinthian Only 165)

In The Daily Corinthian And The Community Profiles $

CHIROPRACTOR Your Comfort Is Our Calling

CrossRoads Heating & Cooling Dr. Jonathan R. Cooksey

Loans $20-$20,000

Neck Pain • Back Pain Disc Problems Spinal Decompression Therapy

We Service All Makes & Models

15% Senior Citizen & Vet Disc. Mention this ad & save 10%

3334 N. Polk Street Corinth, MS 38834 (662) 286-9950

Pawsitively DIRT CHEAP Fabulous

- Fast & Reliable -

40 Years

Heating & Cooling Help

Clergy Appreciation Day

HOUSE FOR SALE OCTOBER 14, 2012

3508 Thornwood Trail Tell Your Minister, Priest or Pastor How Much You Appreciate them!

Ad will run in color October 14, 2012

$70 PER LOAD Taking care 1 LOAD OR of your pet sitting and grooming 50 needs LOADS Corinth Area

Brooke Roberson Located at: Corinth Alcorn Animal Shelter 3825 Proper St. Corinth MS 38834 662-284-5800 BY APPOINTMENT ONLY Like us on facebook facebook/Fetch12

BUDDY AYERS CONSTRUCTION 662-286-9158 OR 287-2296

Deadline to have ad submitted is Monday, October 8th by 5 P.M. 5 SIZES AVAILABLE:

3

2x3 (3.292" x 3") - $35.00 2x6 (3.292 x 6") - $70.00 4x3 (6.708" x 3") - $70.00 BR, 2.5 BATHS. Backyard overlooks 6x3 (10.125 x 3") - $105.00 4x6 (6.708" x 6") $140.00 Shiloh Ridge Golf-Course.

You may email your information & picture to:

classad@dailycorinthian.com or bring by 1607 S. Harper Rd. Call for more information:

662-287-6147

REMEMBER DEADLINE IS Call Robert Williams MONDAY, 0CTOBER 8TH AT 5 P.M.

662-286-2255 for more info or view virtual tour at www.corinthhomes.com

FOR RENT 3 BR 1 BATH 1152 SQ. FEET 1.4 ACRES IN TIPPAH COUNTY SHILOH RIDGE CR 253 IN SHILOH PRIME GOLF COMMUNITY

COURSE LOTS $48,500 AVAILABLE FOR INFORMATION

CALL: Call April Tucker TRENT EATON for information. 662-279-2490 662-837-1779

DOWNTOWN OFFICES • REASONABLE RATES • UTILITIES INCLUDED

www.southernhomesafety.com

(662) 212-4735 Bill Crawford •Maintenance Programs •HVAC Systems •HVAC Tune-ups & Inspections

Most Insurance Accepted Mon., Tues., Wed. & Fri. 9-5

SOUTHERN HOME SAFETY, INC. TOLL FREE 888-544-9074 or 662-315-1695

Bill Phillips Sand & Gravel 1299 Hwy 2 West (Marshtown) Structure demolition & Removal Crushed Lime Stone (any size) Iuka Road Gravel Washed gravel Pea gravel Fill sand Masonry sand Black Magic mulch Natural brown mulch Top soil

TORNADO SHELTERS Large full size 6x12 tall x 6’9” concrete

OR

662-287-0330

AREA RUG 46 YANCEY DOZER SERVICE 69 SPECIALS! $

Air Compressors.Starting at Huge Selection of $ Area Rugs ...................Starting at

95 95

Free ...................................................... Estimates Croft Windows $ 95 Foil Top Back ... Soil,Foamboard Fill Dirt, Sand 1/2” Hauled, Land $Work95 Pond Repair, Bush FoilClearing, Back Foamboard 3/4”Hog ... $ 95 Foil Back Foamboard 1” ..... Michael Yancey Michael Yancey $ 95 662-665-1079 5/8 T1-11 ....................................... 662-665-1079

5 We have purchased 6 several hundred8 “Let us help with your project” 17 name brand Orientals “Large or Small” 1x6 & 1x8 White Pine Bill Jr., 284-6061 543 $ and00 G.E. 284-9209 (made in16 CRMSIndia) Rienze 38865 Pattern Board 500 $ are now offering 4x8 Masonite 1695 Building for Sale Vinyl Floor Remnants $100 them for sale.$ 95 CROSSTIES 6 $ 95 Some are slightly 25 Year 3 Tab Shingle 54 35 Year Architectural 95 62 Shingle damaged, but$¢-$ this VERY NICE HOME IN 09 Laminate Floor SCHOOL From 39 1 KOSSUTH DISTRICT $the 00-$best00 Padisfor probably Laminate Floor 5 10 3 BEDROOMS $ 2 BATHS Handicap Commodes 6995 selection of high LARGE MASTER BEDROOM $ WITH Round Commodes 4995 4000 sq ft DOUBLE TRAY CEILINGS $ 95 quality Orientals ever BATH 12 MASTER x 12 Celotex Ceiling (40SqHAS Ft) BEAUTIFUL 39 Commercial LARGE STOCK OF STAINED CONCRETE FLOOR, $ 00 Tubs & Showers 215 DOUBLE VANITY, WHIRLPOOL TUB offered in this area. (662) 284-9225 cell & TILE SHOWER LAMINATED FLOORING Don’t Waste DELIGHTFUL KITCHEN WITH OAK 287-3090 Prices start at CABINETS, HARDWOOD FLOORS, WE’RE TOLD THAT WE HAVE THE Your Money... 42 CR 278 just off Hwy 72 GE MONOGRAM REFRIGERATOR. west of Central School Road $79.95 and up! Shop With Us! LARGEST INVENTORY IN THE NORTH CONTACT 901-412-6441 .......................

1,000 Board Ft.

.......... starting

at

.....

sq. yd.

......................................

...

.............................................

...

...

.......

...........

.... starting

box

at

MISSISSIPPI AREA

APARTMENT FOR RENT

• ALL TYPES, COLORS & STYLES

2 BEDROOM 1 BATH STOVE & REFRIGERATOR FURNISHED $400 PER MONTH RENT $400 DEPOSIT

10X16 Self Contained Building

662-808-1694

662-287-2509 or 662-808-3908

Shop, Office or Man’s Cave Insulated, wired, sheet rock & painted Through-the-wall Heating & Cooling Unit Ceiling Fan Bath only needs fixtures READY TO MOVE $3000

VERY NICE HOME IN KOSSUTH SCHOOL DISTRICT 3 BEDROOMS 2 BATHS LARGE MASTER BEDROOM WITH DOUBLE TRAY CEILINGS MASTER BATH HAS BEAUTIFUL STAINED CONCRETE FLOOR, DOUBLE VANITY, WHIRLPOOL TUB & TILE SHOWER DELIGHTFUL KITCHEN WITH OAK CABINETS, HARDWOOD FLOORS, GE MONOGRAM REFRIGERATOR.

CONTACT 901-412-6441

WE DO IT ALL NO JOB TOO SMALL

• Light Construction • Pressure Washing - Homes, Sidewalks, Driveways, Patios • Interior/Exterior Painting • Debris Removal FREE ESTIMATE

(662) 284-6848

• BETTER PRICES STARTING @ 39¢ SQ. FT. WE HAVE EVERYTHING YOU WILL NEED (SUPPLIES) AT THESE PRICES YOU CAN COVER A 12X10’ ROOM FOR LESS THAN $50.

$1,000,000 LIABILITY INSURANCE

• SAME PHONE # & ADDRESS SINCE 1975 • LIFETIME WARRANTIED OWENS CORNING SHINGLES W/TRANSFERABLE WARRANTY (NO SECONDS) • METAL, TORCHDOWN, EPDM, SLATE, TILE, SHAKES, COATINGS. • LEAK SPECIALIST WE INSTALL SKYLIGHTS & DO CARPENTRY WORK

662-665-1133 662-286-8257

JIM BERRY, OWNER/INSTALLER

BOAT & Christ Centered VEHICLE Elementary

Clergy Appreciation Day OCTOBER 14, 2012

Tell Your Minister, Priest or Pastor How Much You Appreciate them!

412 Pinecrest Road 287-2221 • 287-4419

All types of lumber regular and treated

JIMCO ROOFING.

SELDOM YOUR LOWEST BID ALWAYS YOUR HIGHEST QUALITY

Smith Discount Home Center

.......

662-287-1464

JT’S HANDY MAN SERVICE

REMODELING OR NEW BUILDING You owe itDOZER to yourself to YANCEY SERVICE shop with us fi rst. Free Estimates Examples:

Top Soil, Fill Dirt, Sand Hauled, Land White Clearing, PondPine Repair,Boards Bush Hog Work

1X6 or 1X8 Michael Yancey 50¢ Board Ft. Michael Yancey 662-665-1079 662-665-1079

Architectural Shingles 16 CR 543 “Will dress up any roof, just ask Rienze MS 38865 your roofer.” $62.95 sq. 3 Tab Shingles $54.95 per sq.

Ad will run in color October 14, 2012

Inside School Climate Controlled Deadline to have ad submitted is Monday, October 8th by 5 P.M.

STORAGE AVAILABLE Corinth 5 SIZES AVAILABLE:

2x3 (3.292" x 3") - $35.00 2x6 (3.292 x 6") - $70.00 4x3 (6.708" x 3") - $70.00 6x3 (10.125 x 3") - $105.00 4x6 (6.708" x 6") - $140.00

1011 HwySchool 72 E Adventist

You may email your information & picture to:

Can Accommodate orCorinthAdventistSchool.com bring by 1607 S. Harper Rd. up(662) tomore 12information: ft. cell tall Call for 415-9160

classad@dailycorinthian.com

662-287-6147

Fullyfor Accredited Call more Just Off Highway 72 East information

REMEMBER DEADLINE IS MONDAY, 0CTOBER 8TH AT 5 P.M.

662-415-2330

PLUMBING & ELECTRIC

Concrete Steps.

$37.95 perHOME tread. IN VERY NICE KOSSUTH SCHOOL DISTRICT Vinyl Floor Covering 3 BEDROOMS Best Selection 2 BATHS PricesMASTER start @ $1.00 per yard. LARGE BEDROOM WITH

DOUBLE TRAY CEILINGS MASTER BATH HAS BEAUTIFUL All types of treated STAINED CONCRETE FLOOR, DOUBLE VANITY, WHIRLPOOL TUB lumber in-stock. & TILE SHOWER DELIGHTFUL KITCHEN WITH OAK CABINETS, HARDWOOD FLOORS, ONEREFRIGERATOR. BEATS GE“NO MONOGRAM

OUR PRICES” CONTACT 901-412-6441

PORTABLE DINER

Licensed & Bonded

• Bucket Truck Service • Backhoe

662-396-1023 JASON ROACH-OWNER R 1159 B CR 400 Corinth, MS 38834

HANDYMAN REPAIR SPECIALISTS INDUSTRIAL, HOME & BUSINESS

16’X 42’ Fully Equipped Operated 11 months

$49,000

(731)239-4766 (371) 239-4766

(662) 212-4601

PLUMBING & ELECTRICAL CARPENTRY, WOOD ROT, FLOORS SHEETROCK & ACOUSTIC CEILINGS MUCH, MUCH MORE!!! LICENSED & BONDED

TRAVIS HASTINGS 662-286-5978

OWNER RELOCATING & MOTIVATED TO SELL!

REDUCED

$10,000 TO $108,900 FARMINGTON AREA (CR 200)

Charming Country Home in Kossuth School District 30 CR 713 Corinth-Alcorn County 4 BR, 3 Bath Master Bath has Whirlpool Tub & Walkin Closet Wrap-around Porch w/ Attached 2-Car Carport/Storage Rm. 1772 Sq Ft on 1.89 Acres with Large Yard To Schedule Showing Call

662-415-5697

2103 W Linden 3 Bedroom home with shady backyard 2 baths - Master bath with whirlpool Stove, Refrigerator, dishwasher, washer & dryer HVAC Large Deck, Hot Tub Detached Carport with storage Extra lot available. Both lots equal 1.2 acres.

662-415-1707

3 BEDROOMS, 2 BATHS SUNROOM & OFFICE NEW ROOF & HVAC LOCATED ON 1.75 ACRES WEEKEND SHOWINGS AVAILABLE. CALL TO SCHEDULE APPOINTMENT

662-279-3679

Prestigious lots available surrounding the Shiloh Ridge Golf Course. Move to one of Corinth’s finest neighborhoods. One year all access Shiloh Ridge membership free with lot purchase. Call April today for a golf cart tour of these elite properties. 662-279-2490

ADVERTISING WITH US REALLY WORKS!!


6B â&#x20AC;˘ Wednesday, September 18, 2013 â&#x20AC;˘ Daily Corinthian

0107 SPECIAL NOTICE

0232 GENERAL HELP

BUTLER, DOUG: Foundation, floor leveling, bricks cracking, rotten wood, basements, shower floor. Over 35 yrs. exp. Free est. 731239-8945 or 662-2846146.

CAUTION! ADVERTISEMENTS in this classification usually offer informational service of products designed to help FIND employment. Before you send money to any advertiser, it is your responsibility to verify the validity of the 0135 PERSONALS offer. Remember: If an ad appears to sound *ADOPTION:*AFFECâ&#x20AC;&#x153;too good to be trueâ&#x20AC;?, TIONATE Artistic Musicthen it may be! Inquiral Financially Secure ies can be made by conCouple awaits baby. tacting the Better BusiExpenses paid. 1-800ness Bureau at 557-9529 *Lisa & 1-800-987-8280. Kenny**************

GARAGE/ESTATE 0151 SALES

MOVING SALE, furniture, h/h items, tools, clths, toys & Much, Much, more. 301 Westview Dr. All Day 9/17-9/21.

CUSTOMER SERVICE Associate needed in Fast Pace Printing Company. Mail or Drop Resume @ 130 S. Fillmore St.;Corinth MS 38834. NO PHONE CALLS PLEASE

0232 GENERAL HELP

0252 RETAIL HELP

FOOD SERVICE Coordinator Lynnfield Place Assisted Living: FT positon. Please apply in person. 150 High School Road, Selmer, TN

P/T MERCHANDISER-JOB #1114-stocking "general merchandise" items in Corinth/Savannah stores. 5 hrs/mthly, $11.00/hr. www.ataretail.com or 800-287-1604X220

G&G Steel Team Members Needed G&G Steel Mississippi Works is hiring for the positions of: â&#x20AC;˘Welder/Maintenance/ Fitter/Sandblaster/ Painter If you have initiative, good work ethic, accountability, & are eager to learn & excel at a challenging new responsibility, download application at G&G Steel.com, apply in person at the Tri-State Commerce Park, Iuka, MS, or at the WIN Job Center in Iuka, MS. Prove your ability at interview by hands on/written tests.

0244 TRUCKING DRIVER TRAINEES Needed for McElroy Truck Lines Local CDL Training No Experience Needed Weekly Home Time Call Today 1-888-540-7364

COMMERCIAL RENTAL Intersection Hwy 72 & S Tate St.

High Traffic Location- Easy Access 2 offices, 2 bedrooms. Paved Lot, Bathroom

PEOPLE SEEKING 0272 EMPLOYMENT SCHOOL HAS started. Do you need a sitter? Private duty sitter for elderly also avail. CPR cert. 662-415-4250

0320 CATS/DOGS/PETS FREE KITTENS!!! Four. Adorable. 662-287-2357

HOUSEHOLD 0509 GOODS ELECTRIC BLANKET. Queen Size. New!!! $60. Call 662-287-7670

0515 COMPUTER

MISC. ITEMS FOR 0563 SALE

UNFURNISHED 0610 APARTMENTS

BUD VASE w/ glass stopper. Green glass. Avon. D O W N T O W N A P A R T MENT Available. $550 $5. Call 662-286-5116 month. 510 Waldron St. GE CLOTHES Dryer & 662-643-9575 WHIRLPOOL WASHER. WHITE. LIKE NEW. $300. LOFT APT. 1 BR, $150 wk. util. incl. Corinth Area. 662-212-2492 Call 662-594-1860 HITCH EXTENSION for over sized slide-in truck M A G N O L I A A P T S 2 B R camper. 80"w/basket 1BA, Stv.& Frg. furn. Wafor gen. & hitch. $250. t e r & G a r b a g e P a i d ! $425m, $300d Call 662Tom@ 662-872-3109 603-4127 KNICKKNACKS $1/each. Call 662-286-5116 WEAVER APTS. 504 N. Cass, 1 BR, scr.porch, LEER TRUCK Cap fits w/d. $375+util, 284-7433. Ford F250 Long Bed. New mighty lifts on rear HOMES FOR door. Good Cond. $275. 0620 RENT 662-872-3109 3 BR, 2 BA, Waukomis METAL CHANDELIER w' 6 Lake Rd. $495 mo. $250 lights. $20. Call 662-286dep. 662-287-8935. 5116 F ' M I N G T O N, 3 B R , 2 B A , METAL CULVERT. 16"X20' CHA,shop,$625mo,$600 LONG. WILL DELIVER. dep 731-439-2900 $100 OR OBO. 662-6603392 IN CITY, Nice 2BR. No QUILT BOOKS. 50 cents p e t s . R e f . r e q u i r e d . each. Call 662-286-5116 Quiet Area. 662-286-3266

ACER ASPIRE one 10.1 FOR SALE. $100/OBO. QUILT FABRIC. Prints & Solids. 1/4-5yds. $1/yd. 662-415-5194 Call 662-286-5116

DUPLEXES FOR 0630 RENT

DOWNTOWN 2BR, 1 BA SPINNING JENNY. High duplex, appl. incl. $450 Tensile Wire. W/brake & mo. + dep/ref. 665-2322. BROWN LEATHER Lazy almost full roll of wire. MOBILE HOMES Boy Rocker Recliner. 12 1/2G. 155K-psi 4000' $200. Tom@662-872-3109 0675 FOR RENT $135. Call 287-0315

0533 FURNITURE

HOMES FOR 0710 SALE

KING HICKORY Sofa. Pink floral w/ yellow background. $200. Call 662286-6493

FERROUS METAL TRANSFER Hiring for OTR & 2nd shift Truck Drivers. LAZY BOY Recliner. Moss Clean Driving Record & Green. $100. Call 662Background. At least 286-6493 25 yrs. old. Min. 6 months experience. WANTED TO Call 662-424-0115 0554

HOUSE FOR SALE BY OWNER - Large multi-level family WANT TO make certain home on 2 acres (with your ad gets attention? additional acres availAsk about attention able), 4-5 BR's, 3 BA's, getting graphics. finished basement, game room, shop, RENT/BUY/TRADE 0610 UNFURNISHED pond, lots of room to APARTMENTS grow. 8 CR 522. BigM&M. CASH for junk cars & trucks. We pick up. 2 BR, 1 BA, Washer/dry- gersville/Kossuth area. 662-415-5435 o r er incl. $400 mo., $200 662-284-5379, by appt. only. dep. 662-415-1397. 731-239-4114.

Call 662-808-5734

:(¡5('($/,1*21-((36

BRAND NEW

BRAND NEW

&+5<6/(57285,1* :63.*

5$0

63(&,$/

,1&/8'(6+(0,9



63(&,$/

A





%8<,712: =(52'2:1 3(502

%8<,712: =(52'2:1 3(502



A

67.'' '($/

67.55 '($/

5(&(17&2//(*(*5$'6$9($127+(5 BRAND NEW

&+5<6/(5



BRAND NEW

5$0;

,1&/8'(6/8;85</($7+(56($7,1*+256(32:(5 9 63(('$872:,7+(6+,)7(5 63(&,$/

35,&( 3$<0(17,1&/8'(6 A5$075$'(,1$66,67%21865(%$7(

BRAND NEW

,1&/8'(6+(0,9

63(&,$/



%8<,712: =(52'2:1 3(502

63(&,$/



%8<,712: =(52'2:1 3(502

A

%8<,712: =(52'2:1 3(502

'2'*('$576;7

A

67.' '($/

Â&#x2021;$8720$7,& Â&#x2021;/('5$&(75$&.7$,//$036 ,1&+$/80,180:+((/6 Â&#x2021;,1&+$/80,180:+((/6 5,866$7(//,7(5$',2 Â&#x2021;6,5,866$7(//,7(5$',2 2208&+72/,67 Â&#x2021;72208&+72/,67 

67.55 '($/5

67.' '($/

HOMES FOR 0710 SALE HUD PUBLISHERâ&#x20AC;&#x2122;S NOTICE All real estate advertised herein is subject to the Federal Fair Housing Act which makes it illegal to advertise any preference, limitation, or discrimination based on race, color, religion, sex, handicap, familial status or national origin, or intention to make any such preferences, limitations or discrimination. State laws forbid discrimination in the sale, rental, or advertising of real estate based on factors in addition to those protected under federal law. We will not knowingly accept any advertising for real estate which is in violation of the law. All persons are hereby informed that all dwellings advertised are available on an equal opportunity basis.

WHEREAS, on September 9, 2010, Michael B. Keith, An unmarried person, executed a certain deed of trust to DenLEGALS 0955 ise McLaurin, Trustee for the benefit of Mortgage Electronic Registration Systems, Inc., as nominee for Regions Bank d/b/a Regions Mortgage, its successors and/or assigns which deed of trust is of record in the office of the Chancery Clerk of Alcorn County, State of Mississippi in Instrument No. 201004237; and

WHEREAS, said Deed of Trust was subsequently assigned to Regions Bank d/b/a Regions Mortgage by instrument dated January 26, 2012 and recorded in Instrument No. 201200552 of the aforesaid Chancery Clerk's office; and

WHEREAS, Regions Bank d/b/a Regions Mortgage has heretofore substituted Shapiro & Massey, LLC as Trustee by instrument dated January 4, 2013 and recorded in the aforesaid Chancery Clerk's Office in Instrument No. 201300228; and

WHEREAS, default having been made in the terms and conditions of said deed of trust and the entire debt se0734 LOTS & ACREAGE cured thereby having been 13.5 Ac. Mitchell Hill Rd, declared to be due and pays o m e m i x e d t i m b e r . able in accordance with the $2000 ac. 662-808-0396 terms of said deed of trust, Regions Bank d/b/a Regions MOBILE HOMES Mortgage, the legal holder of 0741 FOR SALE said indebtedness, having requested the undersigned Substituted Trustee to execute LOOKING FOR the trust and sell said land and QUALITY??? property in accordance with We offer premier homes from Buccaneer the terms of said deed of trust and for the purpose of Homes featuring: 1/2" finished sheetrock, 2" X raising the sums due thereunder, together with attorney's 6" walls, Wood Cabinetry, 8' ceilings, & fees, trustee's fees and exmuch more... pense of sale. WINDHAM HOMES, Inc. 662-287-6991 NOW, THEREFORE, I, Shapiro & Massey, LLC, Substituted Trustee in said deed of MANUFACTURED 0747 HOMES FOR SALE trust, will on October 2, 2013 offer for sale at public outcry and sell within legal hours CREDIT A little LOW? With a qualified income (being between the hours of 11:00 a.m. and 4:00 p.m.), at we CAN get you the South Main Door of the APPROVED On a new home with a County Courthouse of Alcorn County, located at Corcredit score as inth, Mississippi, to the low as 575! highest and best bidder for Windham Homes, Inc. cash the following described 662-287-6991 property situated in Alcorn County, State of Mississippi, AUTO/TRUCK to-wit: 0848 PARTS &

ACCESSORIES

Situated in the Northeast 5X9 TILT tailgate METAL Quarter of Section 33, TownT R A I L E R . 4 W H E E L S . ship 2 South, Range 7 East, $490. CALL 662-643-3565 Alcorn County, Mississippi, to-wit:??Commencing at the Southwest Corner of the 0955 LEGALS Northeast Quarter of Section 33, Township 2 South, SUBSTITUTED TRUSTEE'S NOTICE Range 7 East; thence run East 608.35 feet; thence run South OF SALE 55 degrees 58 minutes 45 seconds East 42.53 feet to a WHEREAS, on September 9, steel pin; thence run North 2010, Michael B. Keith, An 35 degrees 23 minutes 34 unmarried person, executed a seconds East 203.40 feet to a certain deed of trust to Den- steel pin; thence run North ise McLaurin, Trustee for the 08 degrees 59 minutes 02 benefit of Mortgage Electron- seconds West 87.33 feet to a steel pin and Point of Beginic Registration Systems, Inc., ning; thence run South 78 deas nominee for Regions Bank grees 15 minutes 25 seconds d/b/a Regions Mortgage, its West 151.12 feet to a steel successors and/or assigns pin; thence run North 83 dewhich deed of trust is of re- grees 54 minutes 28 seconds cord in the office of the West 77.60 feet to a steel pin Chancery Clerk of Alcorn on the East-side of a gravel County, State of Mississippi in driveway; thence run along East side of said gravel driveInstrument No. 201004237; way North 11 degrees 20 and minutes 43 seconds East 20.95 feet, North 26 degrees WHEREAS, said Deed of 05 minutes 28 seconds East Trust was subsequently as- 47.81 feet, North 41 degrees signed to Regions Bank d/b/a 45 minutes 31 seconds East Regions Mortgage by instru- 20.40 feet, North 39 degrees 48 minutes 34 seconds East ment dated January 26, 2012 56.83 feet, North 32 degrees and recorded in Instrument 11 minutes 18 seconds East No. 201200552 of the afore- 31.21 feet; North 14 degrees said Chancery Clerk's office; 16 minutes 52 seconds East 18.60 feet to a steel pin; and ..................................... thence run South 41 degrees WHEREAS, Regions Bank 26 minutes 32 seconds East d/b/a Regions Mortgage has 192.24 feet to a steel pin and Point of Beginning. ContainFt. heretofore substituted Sha- ing............ 0.46 acres, more or piro & Massey, LLC as Trust- less.??Together with a peree by instrument dated Janu- .Starting petual atnon-exclusive easeary 4, 2013 and recorded in ment and right-of-way for the the aforesaid Chancery following purposes, namely, ............................ Clerk's Office in Instrument the right to enter upon the hereinafter described land No. 201300228; and to do any and all work 40 gal.and ............... necessary to build, maintain WHEREAS, default having and repair a road, together sq. yd. been made in the terms and with ..the right to use said conditions of said deed of easement for the purpose of for Laminate From sq. ft. trust and theFloor entire debt se- ingress and egress and cured thereby having been public utilities all over, upon declared to be due and pay- and across the following deable in accordance with the scribed land:??A 20 foot wide strip, being either 10 feet terms of said deed of trust, either side of and parallel to .................Starting at Regions Bank d/b/a Regions the following described Mortgage, the legal holder of line;??Commencing at the said indebtedness, having re- Southwest ..... Corner of the quested the undersigned Sub- Northeast Quarter and the stituted Trustee to execute Northwest Corner of the ......... Quarter of Section the trust and sell said land and Southeast 33, Township 2 South, Range property in accordance with 7 East; thence run East 608.35 each ..................... the terms of said deed of feet; thence run South 55 detrust and for the purposeeach of ..................... grees 58minutes 45 seconds raising the sums due thereun- East 42.53 feet to a 1/2 inch der, together with attorney's steel pin; thence run North . 23 minutes 34 fees, trustee's fees and ex- 35 degrees seconds East 203.40 feet to a pense of sale. 3/8 inch steel pin; thence run North 08 degrees 59 minutes ........................................... NOW, THEREFORE, I, Sha- 02 seconds West 87.33 feet piro & Massey, LLC, Substi- to a 3/8 inch steel pin; thence tuted Trustee in said deed of run South ...78 degrees 15 trust, will on October 2, 2013 minutes 25 seconds West offer for sale at public outcry 151.12 feet; thence run North and sell within legal hours 83 degrees .54 minutes 28 (being between the hours of seconds West 86.09 feet to the center of a gravel drive; 11:00 a.m. and 4:00 p.m.), at thence run along . said centerthe South Main Door of the line North 11 degrees 20 County Courthouse of Al- minutes 43 seconds East box corn County, located at Cor- 23.13......feet; North 26 degrees 05 minutes 28 seconds East inth, Mississippi, to the ...................................................... highest and best bidder for 50.48 feet; North 41 degrees 45 minutes 31 seconds East cash the following described .. starting at property situated in Alcorn 21.60 feet; North 39 degrees 48 minutes 34 seconds East County, State of Mississippi, 56.00 feet; North 32 degrees ........starting at to-wit: 11 minutes 18 seconds East 28.97 feet; North 14 degrees Situated in the Northeast 16 minutes 52 seconds East Quarter of Section 33, Town- 39.20 feet; North 09 degrees ship 2 South, Range 7 East, 49 minutes 38 seconds East Alcorn County, Mississippi, 113.62 feet; North 28 degrees 21 minutes 22 seconds to-wit:??Commencing at the East 41.11 feet; North 48 deSouthwest Corner of the grees 38 minutes 54 seconds Northeast Quarter of Sec- East 31.00 feet; North 56 detion 33, Township 2 South, grees 50 minutes 16 seconds Range 7 East; thence run East East 137.74 feet; North 56

Smith Discount Home Center 412 Pinecrest Road 287-2221 â&#x20AC;˘ 287-4419

35,&( 3$<0(17,1&/8'(6 A5$0 75$'(,1$66,67%21865(%$7(

5(&(17&2//(*(*5$'6$9($127+(5

5(&(17&2//(*(*5$'6$9($127+(5

$//'($/6 3$<0(176$5(3/867$;(67,7/(67$7(,163(&7,2167,&.(5 '2&80(17352&(66,1*)((3/($6(81'(567$1'7+(6($5(127,1&/8'(',17+(35,&(253$<0(17/,67(' $//'($/(5',6&281760$18)$&785(6Âś5(%$7(6$/5($'<$33/,('72385&+$6(35,&(81/(6663(&,),('35,25'($/6(;&/8'(')520'($/(5672&.21/<12'($/(575$16)(56$77+(6(35,&(6$&78$/9(+,&/(0$<',))(5)5203,&785('8(7238%/,&$7,21'($'/,1(69(+,&/( 0$<%($/5($'<%(62/'3$<0(176),*85('$702$357,(5&5(',75$7,1*:$& 721/< A,1&/8'(67+(&+5<6/(575$'(,15(%$7(%2186:+,&+5(48,5(6<287275$'(,1$48$/,),('9(+,&/(72*(77+(35,&( 253$<0(176+2:16((6$/(63(5621)2548$/,)<,1*'(7$,/6 5(&(17&2//(*(*5$'62583&20,1*&2//(*(*5$'60$<%((/,*,%/(726$9($127+(52))285$/5($'</2:35,&(6&(57$,17(506 &21',7,216$33/<6((6$/(63(5621)25&203/(7(48$/,)<,1*'(7$,/6 *22'7,//

%5$1'1(:



1,66$1$/7,0$6



#6:*5/08;&30%08/

3(502





,1&/8'(610$& ),1$1&(5(%$7(

EURVHQLVVDQFRP

&+226()520 ,1672&.#7+,6 35,&( ^^RECENT COLLEGE GRADS SAVE ANOTHER $600.

$//1(:

1,66$19(56$127(



%5$1'1(:

1,66$1)5217,(56.,1*&$% 66$1)5217,(56.,1*&$% 

67.171717 02'(/ 9,1 '($/

3(502 2





,1&/8'(6 10$& ),1$1&( 5(%$7(

 67.11 02'(/ 9,1 '($/

$9$,/$%/(# 7+,635,&( AA5(&(17&2//(*(*5$'66$9($127+(5

$9$,/$%/(#7+,635,&( ( # 7+,6 35,&(

%5$1'1(:



 

#6:*5/08 ;&30%08/

#6:*5/08 ;&30%08/

3(502



67.11111 9,102'(/ '($/

1,66$1085$12

2)) 2))

758(065321$//1(: 1,66$1085$126,1672&.

INCLUDES AUTOMATIC & AIR!

%5$1'1(:

1,66$1$50$'$

2)) 2))

$9$,/$%/(#7+,6 /(#7+,6 7 ',6&2817

$9$,/$%/(#7+,6 $,/$%/(#7+,6 2817 ',6&2817

',6&2817 ,1&/8'(6  &( 10$&),1$1&( 5(%$7(

67.17 02'(/ 9,1 '($/

758(0653

67.1717 7 171717 17 17 171717 02'(/ 9,1 $//'($/6 3$<0(176$5(3/867$;(67,7/(67$7(,163(&7,2167,&.(5 '2&80(17352&(66,1*)((3/($6(81'(567$1'7+(6($5(127,1&/8'(',17+(35,&(253$<0(17/,67(' /86 7$;(6 7,7/( 67$7( ,163(&7,21 67,&.(5  '2&80(17 352&(66,1* )(( 3/($6( 81'(567$1' 7+(6( $5( 127 ,1&/8'( ( 25 3$<0(17 /,67(' $//'($/(5',6&281760$18)$&785(6Âś5(%$7(6$/5($'<$33/,('72385&+$6(35,&(81/(6663(&,),('35,25'($/6(;&/8'(')520'($/(5672&.21/<12'($/(575$16)(56$77+(6(35,&(6$&78$/9(+,&/(0$<',))(5)5203,&785('8(7238%/,&$7,21'($'/,1(69(+,&/(0$<%( $/5($'<%(62/'3$<0(176),*85('$702$357,(5&5(',75$7,1*:$& 721/< ,1&/8'(67+(10$&&$37,9(&$6+5(%$7(:+,&+5(48,5(6<2872),1$1&(7+(385&+$6(:,7+10$&72*(77+(35,&( 253$<0(176+2:1:$& 721/<6((6$/(63(5621)25'(7$,/6AA5(&(17&2//(*(*5$'66$9($127+(5:,7+7+(1,66$1&2//(*(*5$'352*5$0&(57$,1 58/(6 5(675,&7,216$33/<6((6$/(63(5621)25&203/(7(48$/,)<,1*'(7$,/6*22'7,//

ZZZEURVHQLVVDQFRP HWY 72 EAST â&#x20AC;˘ CORINTH, MISSISSIPPI

LOCAL: 662-286-6006 â&#x20AC;˘ TOLL FREE: 1-888-286-6006

All types of lumber regular and treated

1795 $ 00 1 $ Air Compressors 4695 $ 95 3/4 OSB T&G 18 $ Elec. Water Heater 239 $ 00 Vinyl Floor Remnants 1 39¢-$109 $ 00-$ Pad for Laminate Floor 5 1000 Huge Selection of $ Area Rugs 6995 $ Handicap Commodes 6995 $ 95 Round Commodes 49 $ 95 3/4â&#x20AC;? Plywood 22 $ 1/2â&#x20AC;? Plywood 1650 $ 95 25 Year 3 Tab Shingle 54 35 Year Architectural $ 6295 Shingle $ 95 Foil Back Foamboard 1â&#x20AC;? 8 $ 95 Foil Back Foamboard 3/4â&#x20AC;? 6 $ 95 Foil Back Foamboard 1/2â&#x20AC;? 5 $ 12 x 12 Celotex Ceiling (40Sq Ft) 3995 Croft Windows $ 00 Tubs & Showers 215 $ 4x8 Masonite 1695 The Best Deals on Building & Remodeling Products!! Check Here First! 5/8 T1-11 Corrugated metal 2ft wide 8, 10,12 ft length

$


steel pin; thence run North 35 degrees 23 minutes 34 seconds East 203.40 feet to a steel pin; thence run North LEGALS 0955 08 degrees 59 minutes 02 seconds West 87.33 feet to a steel pin and Point of Beginning; thence run South 78 degrees 15 minutes 25 seconds West 151.12 feet to a steel pin; thence run North 83 degrees 54 minutes 28 seconds West 77.60 feet to a steel pin on the East-side of a gravel driveway; thence run along East side of said gravel driveway North 11 degrees 20 minutes 43 seconds East 20.95 feet, North 26 degrees 05 minutes 28 seconds East 47.81 feet, North 41 degrees 45 minutes 31 seconds East 20.40 feet, North 39 degrees 48 minutes 34 seconds East 56.83 feet, North 32 degrees 11 minutes 18 seconds East 31.21 feet; North 14 degrees 16 minutes 52 seconds East 18.60 feet to a steel pin; thence run South 41 degrees 26 minutes 32 seconds East 192.24 feet to a steel pin and Point of Beginning. Containing 0.46 acres, more or less.??Together with a perpetual non-exclusive easement and right-of-way for the following purposes, namely, the right to enter upon the hereinafter described land and to do any and all work necessary to build, maintain and repair a road, together with the right to use said easement for the purpose of ingress and egress and for public utilities all over, upon and across the following described land:??A 20 foot wide strip, being either 10 feet either side of and parallel to the following described line;??Commencing at the Southwest Corner of the Northeast Quarter and the Northwest Corner of the Southeast Quarter of Section 33, Township 2 South, Range 7 East; thence run East 608.35 feet; thence run South 55 degrees 58minutes 45 seconds East 42.53 feet to a 1/2 inch steel pin; thence run North 35 degrees 23 minutes 34 seconds East 203.40 feet to a 3/8 inch steel pin; thence run North 08 degrees 59 minutes 02 seconds West 87.33 feet to a 3/8 inch steel pin; thence run South 78 degrees 15 minutes 25 seconds West 151.12 feet; thence run North 83 degrees 54 minutes 28 seconds West 86.09 feet to the center of a gravel drive; thence run along said centerline North 11 degrees 20 minutes 43 seconds East 23.13 feet; North 26 degrees 05 minutes 28 seconds East 50.48 feet; North 41 degrees 45 minutes 31SERVICES seconds East AUTO 21.60 0840feet; North 39 degrees 48 minutes 34 seconds East 56.00 feet; North 32 degrees 11 minutes 18 seconds East 28.97 feet; North 14 degrees 16 minutes 52 seconds East 39.20 feet; North 09 degrees 49 minutes 38 seconds East 113.62 feet; North 28 degrees 21 minutes 22 seconds East 41.11 feet; North 48 degrees 38 minutes 54 seconds East 31.00 feet; North 56 degrees 50 minutes 16 seconds East 137.74 feet; North 56 470 TRACTORS/ degrees 48 minutes 34 FARM EQUIP. seconds East 104.28 feet to the right of way of Alcorn County Road 511. 1997 Ford

line North 11 degrees 20 minutes 43 seconds East 23.13 feet; North 26 degrees LEGALS 0955 05 minutes 28 seconds East 50.48 feet; North 41 degrees 45 minutes 31 seconds East 21.60 feet; North 39 degrees 48 minutes 34 seconds East 56.00 feet; North 32 degrees 11 minutes 18 seconds East 28.97 feet; North 14 degrees 16 minutes 52 seconds East 39.20 feet; North 09 degrees 49 minutes 38 seconds East 113.62 feet; North 28 degrees 21 minutes 22 seconds East 41.11 feet; North 48 degrees 38 minutes 54 seconds East 31.00 feet; North 56 degrees 50 minutes 16 seconds East 137.74 feet; North 56 degrees 48 minutes 34 seconds East 104.28 feet to the right of way of Alcorn County Road 511. I WILL CONVEY only such title as vested in me as Substituted Trustee. WITNESS MY SIGNATURE on this 27th day of August, 2013. Shapiro & Massey, LLC SUBSTITUTED TRUSTEE Shapiro & Massey, LLC?1910 Lakeland Drive?Suite B?Jackson, MS 39216 (601)981-9299 37 County Road 511?Corinth, MS 38834 12-004688BE Publication Dates: September 4, 11, 18 and 25, 2013 4 t's #14370 SUBSTITUTED TRUSTEE’S NOTICE OF SALE

corded in the Office of the aforesaid Chancery Clerk in Book 517 at Page 694; and WHEREAS, the aforesaid 0955 deed of LEGALS trust was assigned to Lehman Capital, a Division of Lehman Brothers Holdings, Inc. by instrument effective October 31, 2000, and recorded in the Office of the aforesaid Chancery Clerk in Book 566 at Page 343; and WHEREAS, the aforesaid deed of trust was assigned to Financial Freedom Senior Funding Corporation by instrument effective May 5, 2004, and recorded in the Office of the aforesaid Chancery Clerk in Book 663 at Page 521; and WHERE AS, the aforesaid deed of trust was assigned to Secretary of Housing and Urban Development by instrument dated March 17, 2009, and recorded in the Office of the aforesaid Chancery Clerk as Instrument No. 200901506; and WHEREAS, the aforesaid, Secretary of Housing and Urban Development, the holder of said deed of trust and the note secured thereby, substituted Underwood Law Firm PLLC, as Trustee therein, as authorized by the terms thereof, by instrument dated July 19, 2013 and recorded in the Office of the aforesaid Chancery Clerk as Instrument No. 201303157; and WHEREAS, default having been made in the terms and conditions of said deed of trust and the entire debt secured thereby, having been declared to be due and payable in accordance with the terms of said deed of trust, and the legal holder of said indebtedness, Secretary of Housing and Urban Development, having requested the undersigned Substituted Trustee to execute the trust and sell said land and property in accordance with the terms of said deed of trust for the purpose of raising the sums due thereunder, together with attorney’s fees, Substituted Trustee’s fees and expense of sale; NOW, THEREFORE, WE, Underwood Law Firm PLLC, Substituted Trustee in said deed of trust, will on the 2nd day of October, 2013, offer for sale at public outcry for cash to the highest bidder, and sell within legal hours (being between the hours of 11:00 A.M. and 4:00 P.M.) at the South front door of the County Courthouse at Corinth, County of Alcorn, State of Mississippi, the following described property situated in the County of Alcorn, State of Mississippi, to-wit:

trust and the entire debt secured thereby, having been declared to be due and payable in accordance with the 0955 ofLEGALS terms said deed of trust, and the legal holder of said indebtedness, Secretary of Housing and Urban Development, having requested the undersigned Substituted Trustee to execute the trust and sell said land and property in accordance with the terms of said deed of trust for the purpose of raising the sums due thereunder, together with attorney’s fees, Substituted Trustee’s fees and expense of sale; NOW, THEREFORE, WE, Underwood Law Firm PLLC, Substituted Trustee in said deed of trust, will on the 2nd day of October, 2013, offer for sale at public outcry for cash to the highest bidder, and sell within legal hours (being between the hours of 11:00 A.M. and 4:00 P.M.) at the South front door of the County Courthouse at Corinth, County of Alcorn, State of Mississippi, the following described property situated in the County of Alcorn, State of Mississippi, to-wit: Situated in the City of Corinth, County of Alcorn, State of Mississippi, to-wit: Commencing at a point where the North line of Cruise Street intersects the East line of Young Street as said Young Street might run if extended North to the North line of Cruise Street, the said extension of Cruise Street being shown by the fence running North and South, and this intersection point being the Southeast Corner of the Samuel E. Hearn home place; run thence North 200 feet for the Beginning Point; thence West 150 feet; thence North 112 feet, more or less, to the South line of Waldron Street; thence East along South line of Waldron Street 151 feet, more or less, to the Northeast Corner of the old J. C. Lipford lot; thence South 112 feet to the said Beginning Point.

line of Cruise Street, the said extension of Cruise Street being shown by the fence running North and South, and LEGALS point being 0955 this intersection the Southeast Corner of the Samuel E. Hearn home place; run thence North 200 feet for the Beginning Point; thence West 150 feet; thence North 112 feet, more or less, to the South line of Waldron Street; thence East along South line of Waldron Street 151 feet, more or less, to the Northeast Corner of the old J. C. Lipford lot; thence South 112 feet to the said Beginning Point. Being the same property as conveyed to Lawrence E. Archer and wife, Ella B. Archer by J. C. Lipford and wife, Ruby Lipford by Warranty Deed dated May 14, 1953 and recorded in Deed Book 94 at Page 205, and by warranty deed to Lawrence E. Archer and wife, Ella B. Archer from C. H. Butler and wife, Lila Frances Butler dated October 16, 1953 and recorded in Deed Book 95 at Page 300, and by warranty deed to Lawrence E. Archer and wife, Ella B. Archer from Samuel E. Hearn and wife, Ina Earline Hearn dated October 29, 1953 and recorded in Deed Book 95 at Page 439 in the land records of Alcorn County, Mississippi, in the Office of the Chancery Clerk thereof. WE WILL CONVEY only such title as is vested in Underwood Law Firm PLLC as Substituted Trustee. WITNESS OUR SIGNATURE, this the 30th day of August, 2013.

ber, 2013, at the Alcorn such title as is vested in UnCounty 18, Chancery derwood Law Firm PLLC as Daily Corinthian • Wednesday, September 2013Building, •7B SUMMONS Corinth, Mississippi, and in Substituted Trustee. case of your failure to appear WITNESS OUR SIGNALEGALS LEGALS 0955 LEGALS 0955STATE 0955 OF MISSISSIPPI and defend a judgment will be TURE, this the 30th day of THE entered against you for the August, 2013. T O : A L L U N K N O W N things demanded in said ComHEIRS-AT-LAW OF MARIE plaint. You are not required to Underwood Law Firm PLLC SANDERS, DECEASED file an answer or other pleadSUBSTITUTED TRUSTEE You have been made a de- ing, but you may do so if you BY: John C. Underwood, Jr. fendant in the complaint filed desire. ISSUED under my hand Managing Member in this Court by Crissie Fowler McMahan, individually and and seal of said Court this the as administratrix cum testaControl #11091160 9th day of September, 2013. mento annexo of the estate of Marie Sanders, deceased, 3t's BOBBY MAROLT PUBLISH: 0 9 / 1 1 / 2 0 1 3 , and you must take immediate CHANCERY COURT CLERK action to protect your rights. 09/18/2013, 09/25/2013 #14380 44644.WPD Respondents other than you in this action are: None 3T'S IN THE CHANCERY 9/11,9/18,9/25/2013 COURT OF ALCORN You are summoned to ap#14386 COUNTY, MISSISSIPPI pear and defend against said Complaint to establish and IN THE CHANCERY RE: ADMINISTRATION OF COURT OF ALCORN THE ESTATE OF MARIE determine heirs-at-law of Marie Sanders at 9:00 o'clock COUNTY, MISSISSIPPI SANDERS, DECEASED a.m. on the 15th day of October, 2013, at the Alcorn IN THE MATTER OF THE NO: 2009-0489-02 County Chancery Building, LAST WILL AND TESTACorinth, Mississippi, and in MENT OF SUSIE M. NASH, SUMMONS case of your failure to appear DECEASED and defend a judgment will be THE STATE OF MISSISSIPPI entered against you for the CAUSE NO. 2013-0498-02 T O : A L L U N K N O W N things demanded in said ComNOTICE TO KNOWN HEIRS-AT-LAW OF MARIE plaint. You are not required to CREDITORS SANDERS, DECEASED file an answer or other pleading, but you may do so if you PLEASE TAKE NOTICE, You have been made a dePURSUANT TO SECTION fendant in the complaint filed desire. ISSUED under my hand 91-7-145(1)of the Missisin this Court by Crissie FowlMetroCast Communications is a leading, local provider of Cable TV, Anand seal of said Court this the sippi Code of 1972 er McMahan, individually and 9th day of September, 2013. notated, as services. amended, High-Speed cum Internet, as administratrix testa- and other advanced telecommunications I have thisoffi day mento annexo isofavailable the estateto responsible candidates in that Position our Booneville ce.forBOBBY MAROLT warded to the Daily of Marie Sanders, deceased, Successful candidate must be able to promote and Corinthian sell programming and CHANCERY COURT CLERK for publicaand you must take immediate customer work orders and payments, be willing tion, a and Notice to Creditactionservices, to protectprocess your rights. 44644.WPD a copy of which work non-traditional hours. Computer skills and ors, electronic skills a must.is attached your inRespondents other than For training, the schedule would be Monday to Fridaytofrom 3T'S formation. If you are a you in this action are: None 8:00 AM to 5:00 PM. After training, the schedule be estate 9/11,9/18,9/25/2013 creditorwould of the #14386 Tuesday to 9PM. above, and You are summoned to ap-to Saturday from 12:30 PMreferenced you fail to have your pear and defend against said claim against said esComplaint to For establish andcomplete description of job qualifi a more cations and retate probated determine heirs-at-law of Marie Sanders at 9:00 o'clock & responsibilities go to: gistered by the Chancery Court of Alcorn a.m. on the 15th dayhttp://www.metrocast.com/employment.cfm of OctoCounty, Mississippi ber, 2013, at the Alcorn within ninety (90) days County Chancery Building, Competitive salary and benefi ts. Candidates must after thepass first publicaCorinth, Mississippi, and in check including drug tion screen.of the enclosed case of your failure tobackground appear Notice, such will bar and defend a judgment will be your claim as provided entered against you the Thisforposition is for our Booneville, MSinlocation. Section 91-7-151 of things demanded in said Comthe Mississippi Code of plaint. 1972 Annotated, as Send resume to: You are not required to file an answer or other plead-MetroCast Communicationsa m e n d e d . ing, but you may do so if you Attn: Laurie Pell THIS the 16th day of desire. 105 Allison Cove September, 2013 ISSUED under my hand and seal of said Court this the Oxford, MS 38655 BOBBY MAROLT 9th day of September, 2013. Fax: 662-259-2828 CLERK E-mail: lpell@metrocast.com BOBBY MAROLT GARY NASH CHANCERY COURT CLERK

Customer Service Representative

Underwood Law Firm PLLC WHEREAS, on July 19, SUBSTITUTED TRUSTEE 1999, Lawrence E. Archer and Ella Lea Archer, husband and BY: John C. Underwood, Jr. wife, executed a deed of trust Managing Member to Guaranty Title Company, Trustee for the benefit of Control #11091160 First American National Bank, Operating as Deposit Guar3t's anty Mortgage Services, which PUBLISH: 09/11/2013, deed of trust is recorded in 09/18/2013, 09/25/2013 Deed of Trust Book 514 at #14380 Page 117 in the Office of the Being the same property as Chancery Clerk of the conveyed to Lawrence E. County of Alcorn, State of Archer and wife, Ella B. ArchMississippi; and er by J. C. Lipford and wife, WHEREAS, the aforesaid Ruby Lipford by Warranty deed of trust was assigned to Deed dated May 14, 1953 and Wendover Financial Services recorded in Deed Book 94 at Corporation by instrument Page 205, and by warranty dated July 23, 1999, and redeed to Lawrence E. Archer corded in the Office of the and wife, Ella B. Archer from aforesaid Chancery Clerk in (Please indicate on resume title of the position for which you are applying.) C. H. Butler and wife, Lila 3 t's Book 517 at Page 694; and 44644.WPD No phone calls please. 9/18, 9/25, 10/2 Frances Butler dated OctoWHEREAS, the aforesaid ber 16, 1953 and recorded in MetroCast is an EEO employer.#14397 deed of trust was assigned to 3T'S Deed Book 95 at Page 300, Lehman Capital, a Division of 9/11,9/18,9/25/2013 and by warranty deed to Lehman Brothers Holdings, #14386 Lawrence E. Archer and wife, Inc. by instrument effective October 31, 2000, and recor- Situated in the City of Cor- Ella B. Archer from Samuel E. ded in the Office of the afore- inth, County of Alcorn, State Hearn and wife, Ina Earline Hearn dated October 29, said Chancery Clerk in Book of Mississippi, to-wit: 1953 and recorded in Deed 566 at Page 343; and WHEREAS, the aforesaid C o m m e n c i n g a t a p o i n t Book 95 at Page 439 in the deed of trust was assigned to where the North line of l a n d r e c o r d s o f A l c o r n Financial Freedom Senior Cruise Street intersects the County, Mississippi, in the OfFunding Corporation by in- East line of Young Street as fice of the Chancery Clerk strument effective May 5, said Young Street might run if thereof. 2004, and recorded in the Of- extended North to the North WE WILL CONVEY only fice of the aforesaid Chan- line of Cruise Street, the said cery Clerk in Book 663 at extension of Cruise Street such title as is vested in Unbeing shown by the fence run- derwood Law Firm PLLC as Page 521; and 864 864 Substituted Trustee. 864 North and South, and 868 WHERE AS, the aforesaid ning868 816 816 804 WITNESS OUR SIGNATRUCKS/VANS deed of trust was assigned to this intersection point being TRUCKS/VANS TRUCKS/VANS RECREATIONAL RECREATIONAL of BOATS AUTOMOBILES the Southeast CornerAUTOMOBILES of the TURE, this the 30th daySUV’S Secretary of Housing and VEHICLES VEHICLES SUV’S SUV’S Urban Development by in- Samuel E. Hearn home place; August, 2013. strument dated March 17, run thence North 200 feet AK M E OFFER 2009, and recorded in the Of- for the Beginning Point; New Holland Underwood Law Firm PLLC I WILL CONVEY only such fice of the aforesaid Chan- thence West 150 feet; thence SUBSTITUTED TRUSTEE title as vested in me as Substi- cery Clerk as Instrument No. North 112 feet, more or less, Tractor 361V W/MATCHING tuted Trustee. to the South line of Waldron 200901506; and Model 3930, diesel, TRAILER & COVER, 2001Jr.WHITE FORD thence East along BY: John C. Underwood, WHEREAS, the aforesaid, Street; 2004 MERCURY 1974 VW Cruisemaster 2006 Volvo XC90 RASPBERRYof& Housing GRAY, excellent Managing Member WITNESS MYcondition!, SIGNATURE Secretary and South line of Waldron Street RANGER XLT MONTEREY Motorhome by BEETLE EVINRUDE 150XP, on this 27thwith dayforward, of August, Urban 151 feet, more or less, to the V8 AWD Development, theSUPER 8-speed fully loaded, DVD/ gas burner, workhorse eng., 2 1600CC ENG,Corner NEW of theLeather-Sun Georgieboy, 1997 GM #11091160 3.0 V6, Automatic 2013. Northeast old Control Roofholder of said deed2 of trust 24-V TROL. MTR., slideouts, full body paint, walk-in reverse transmission. CD system, new tires, Extended Cab TIRES, shower, SS sinks & s/s refrig w/ 454 ci chassie, 37’ J. C.RUNS LipfordGOOD, lot; thence South and note secured 350 V8 FISHtheFINDERS, NEW thereby, New Tires- Show mileage 80,700, climate im, Onar Marq gold 7000 gen., hrs. Power New Tires, Cold Air MOSTLY RESTORED, Shapiro 800 & Massey, LLC 112 feet to the said Beginning substituted Underwood Law with slider, 45,000 3-ton cntrl. unit, back-up camera, Room3t's New - One BATTS., 4 Wheel Drive controlled air/heat, heat/ auto. leveling, 2-flat screen TVs, BLISH : 0 9 / 1 1 / 2 0 1Bed 3 , Liner SUBSTITUTED TRUSTEE Point. PARTS. F iNEW r m PLED LLC , a s T r u s t e e EXTRA Steering, Wet Brakes. miles with white Oak Owner P-U148K Miles cool power seats. Allison 6-spd. A.T., 10 cd stereo TRAILER Long Wheel Base w/s.s, 2-leather capt. seats & 1 09/18/2013, 09/25/2013 therein, as authorized by the 158,000 Miles interior. $19,500. Independent PTO LIGHTS, EXC. COND., lthr recliner, auto. awning, qn Shapiro & Massey, LLC?1910 terms thereof, by instrument Being the same property as #14380 bed, table & couch (fold into bed), Automatic & Air $14,999 $4500/OBO $8,900. micro/conv oven, less than 5k mi. Lakeland Drive?Suite B?Jack- dated July 19, 2013 and recor- conveyed to Lawrence E. Call or text 662-808-7777 or son, MS 39216 956-334-0937 ded662-808-0113. in the Office of the afore- Archer and wife, Ella B. Arch731-926-0006. 662-287-4528 $85,000 662-415-9020 (601)981-9299 said Chancery Clerk as In- er by J. C. Lipford and wife, 662-415-0590 37 County Road 511?Corinth, strument No. 201303157; and Ruby Lipford by Warranty MS 38834 868 default having Deed dated May 14, 1953 and WHEREAS, 832 12-004688BE been made in the terms and recorded in Deed Book 94 at MOTORCYCLES/ AUTOMOBILES conditions of said deed of Page 205, and by warranty ATV’S Publication Dates: deed Nissan to Lawrence E. Archer trust and the entire debt se2009 long wheel base, September 4, 11, 18 and 25, cured thereby, having been and wife, Ella B. Archer from Murano SL, 2013 C. H. Butler and wife, Lila declared to be due and payrebuilt & 350 HP 2000 Jeep leather 4 t's Butler dated Octoable in accordance with the Frances Grand 2004 Nissan engine & auto. #14370 ber 16, 1953 and recorded in terms of said deed of trust,upholstery, Cherokee 4x4 Murano, $3200 Deed Book 95 at Page 300, and the legal holder of said in-sunroof, 228k miles. trans., needs rear V-8 with Tow black, 120k and by warranty deed to debtedness, Secretary of camera, blue Package 1989 paint & some miles, loaded, Housing andFord Urban Develop- Lawrence E. Archer and wife, 180,000 Miles tooth, Crown Victoria Ella B. loaded Archer from Samuel E. Cold A/C, Cruise ment, having requested the adult driver, work. Control, All power, the and max! Hearn wife, Ina Earline uRare n d efind, r s iGarage g n e d Kept. S u b33K s t i t u t e dto garage kept, All Leather, Great actual miles, new in/ October 29, Trustee toLooks execute the trust 76,Hearn 000 dated Miles Stereo, Very Clean Bose, leather, out, 302, great gas mileage, 1953 and recorded in Deed Burgundy Color andnew sell said land and proptires, fresh belts/ $21,500/OBO exc. cond., 864 Call or Text erty inoriginal accordance hoses, books andwith the Book 95 at Page 439 in the 770-367-4615 $10,500. lcorn terms saidlike deed of trust 662-808-9764 for l a n d r e c o r d s o f ATRUCKS/VANS stickers,of Rides a dream. Corinth Resident the purpose of raising the County, Mississippi, in the Of-SUV’S 804 662-284-6559. sums due thereunder, togeth- fice of the Chancery Clerk BOATS Call 662-424-0226 er with attorney’s fees, Substi- thereof. REDUCED tuted Trustee’s fees and exREDUCED WE WILL CONVEY only pense of sale; CED THEREFORE, WE, such title as is vested in UnREDUNOW, Underwood Law Firm PLLC, derwood Law Firm PLLC as Substituted Trustee in said Substituted Trustee. 18’ long, 120 HP 1991 Ford WITNESS OUR SIGNAdeed of trust, will on the 2nd Johnson mtr., 2012 STARCRAFT Econoline 1984 CORVETTE Raised Roof day of October, 2013, offer TURE, this the 30th day of 383sale Stroker, alum. trailer & mtr., for at public outcry for August, 2013. CAMPER WITH TOMMY Van, 48,000 Custom Interior, super duty, diesel, hightoriser, alum. bidder, cash the highest Fiberglass 18’ bunk new paint, new GATE miles, good Extra Clean !!! 7.3 ltr., exc. heads, dual hours and sellheaders, within legal house, gray & transel, 2 live drive train, 215k line holly, everything cond., one Underwood Law Firm PLLC 130,000 Miles (being between the hours of RUNS GOOD black water tanks, miles, excellent, on carA.M. new and or rebuilt wells, hot foot SUBSTITUTED TRUSTEE 11:00 4:00 P.M.) at owner, serious Turbo, exc. cond. cable ready w/TV. great mechanical thew/new South paint front job door of the control. interest. (silver flCourthouse eck paint). at Cor- BY: John C. Underwood, Jr. County condition”. Managing Member inth, County of Alcorn, State $6500 $9777.77 662-396-1390 of Mississippi, the following662-415-1482 Call Keith 287-5206. 662-596-5053 described property situated in Control #11091160 662-664-3538 662-415-0017. the County of Alcorn, State REDUCED 3t's of Mississippi, to-wit: PUBLISH: 09/11/2013, Situated in the City of Cor- 0 9 / 1 8 / 2 0 1 3 , 0 9 / 2 5 / 2 0 1 3 #14380 inth, County of Alcorn, State 2000 TOYOTA 1998 CHEVROLET of Mississippi, to-wit: 2000 MERCURY

GUARANTEED Auto Sales

Advertise your CAR, TRUCK, SUV, BOAT, TRACTOR, MOTORCYCLE, RV & ATV here for $39.95 UNTIL SOLD! Ad should include photo, description and price. PLEASE NO DEALERS & NON-TRANSFERABLE! NO REFUNDS. Single item only. Payment in advance. Call 287-6147 to place your ad.

‘07 Dolphin LX RV, 37’

‘90 RANGER BASS BOAT

1987 GMC PICK UP $1,500

SOLD

$6,400.

$4800

662-424-0226

53’ GOOSE NECK TRAILER STEP DECK BOOMS, CHAINS AND LOTS OF ACCESSORIES $12,000/OBO

$9850

662-808-2105

$7,000 OBO

662-212-2492

1977 Chevy Big 10 pickup,

2000 PONTIAC GRAND PRIX GT

$2500 obo.

662-643-6005

$1500

731-453-5031

662-664-3958

$8800

1989 FOXCRAFT

1983 NISSAN DATSUN 280 ZX $5000.

$6500.

Optimax, 225 H.P. Imagine owning a likenew, water tested, never launched, powerhouse outboard motor with a High Five stainless prop, $

for only

7995.

Call John Bond of Paul Seaton Boat Sales in Counce, TN for details.

731-689-4050 or 901-605-6571

1991 Mariah 20’

ski boat, 5.7 ltr. engine, new tires, $6700. 662-287-5893, leave msg. & will return call.

COROLLA CE

1984 C o m m CHRYSLER e n c i n g a t a p o i n t 4 cylinder, where the North line of automatic LEBARON Cruise Street intersects the convertible, Extra Clean East line of Young Street as antique tag, said Young Street might run if136,680 miles 39,000North actual extended to the North $4200 line of miles. Cruise Street, the said

662-462-7634 or 662-664-0789

extension of Cruise Street being shown by the fence running North and South, and this 286-2261 intersection point being Rienzi the Southeast Corner of the Samuel E. Hearn home place; run thence North 200 feet for the Beginning Point; thence West 150 feet; thence North 112 feet, more or less, to the South line of Waldron 2012 thence HYUNDAIEast along1987 Honda Street; SouthELANTRA line of Waldron Street CRX, 40+ mpg, 15119,800 feet, more or less, to the miles, new paint, new Northeast Corner of the old garage kept w/all J. C. Lipfordrecords, lot; thence South leather seat service 112 feet to the said Beginning 38 mpg, tinted covers, after Point.

$3950.

windows & XM

market stereo,

radio. Being the Asking same property as $3250 obo. $17,500. conveyed to Lawrence E. 662-594-5830. Archer and wife, Ella B. Arch-

1989 FORD F350 DIESEL MOVING VAN

2000 Ford F-350

731-607-3173

2011 CANYON SLE PICKUP Almost every option avail, new topper & tow pkg, like new, all maintenance records, original window sticker. luka resident

SOLD

$18,000 256-577-1349

2004 Ford F350 work truck, V10, underbed tool boxes, towing package, DVD. $8600 obo. Truck is in daily use. Please call for appt. to see,

$7400.

SK1500 SILVERADO PICKUP

2008 Jeep Wrangler Sahara V-6, auto., power windows, hard top, Sirius radio w/nav cd, dvd, very clean & well maintained. 49,400k mi.

$7,000

662-396-1705 or 284-8209

joep4212@yahoo.com

2001 Chevy Venture mini-van, exc. mech. cond.

$2500.

731-239-4108 340-626-5904. 340-626-5904.

662-415-0811

1990 ISUZU PICKUP

Regular cab, 8’ long bed, air, stereo, power window & doors, 115,000 miles 662-462-5822 or 416-5482

$21,300. O.B.O.

2002 Chevrolet Z-71,4-dr., 4W.D., Am.Fm cass./CD, pewter in color, $6200. 662-643-5908 or 662-643-5020

SOLD

1985 30’ long motor home, new tires, Price negotiable.

662-660-3433

1999 Dodge Regency Van

$3000 FIRM

$3800

Excaliber made by Georgi Boy

New engine 2.3 liter, (old engine included), custom paint job, 54,000 miles!

$2800 CALL PICO: 662-643-3565

1976 Ford Ranger XLT

Runs great, new tires, original interior.

$2000 CALL PICO: 662-643-3565

$9,000

2005 AIRSTREAM LAND YACHT

30 ft., with slide out & built-in TV antenna, 2 TV’s, 7400 miles.

$75,000. 662-287-7734

1500 Goldwing Honda 78,000 original miles, new tires.

$4500

662-284-9487

2007 YAMAHA ROADSTAR SILVERADO 1700 20,000 Miles. Never Been Laid Down. Trunk has been taken off & sissy bar put back on. Lots ox extra add-ons. $5,500. Firm.

731-727-6602 or 731-727-6665


IN THE MATTER OF THE LAST AND TESTA8B •WILL Wednesday, September MENT OF SUSIE M. NASH, DECEASED

0955 LEGALS

CAUSE NO. 2013-0498-02 NOTICE TO KNOWN CREDITORS PLEASE TAKE NOTICE, PURSUANT TO SECTION 91-7-145(1)of the Mississippi Code of 1972 Annotated, as amended, that I have this day forwarded to the Daily Corinthian for publication, a Notice to Creditors, a copy of which is attached to your information. If you are a creditor of the estate referenced above, and you fail to have your claim against said estate probated and registered by the Chancery Court of Alcorn County, Mississippi within ninety (90) days after the first publication of the enclosed Notice, such will bar your claim as provided in Section 91-7-151 of the Mississippi Code of 1972 Annotated, as amended.

Jimmy B. Fisher in the of J. Patrick Caldwell as Trustee in the above r0955 e f e r eLEGALS nced Deed of Trust which Substitution of Trustee was recorded in the land records of Alcorn County, Mississippi, on September 12, 2013, as Instrum e n t n u m b e r 201304549 reference to which is hereby made; and

place and stead 18, 2013 • Daily Corinthian

0955 LEGALS

LEGAL NOTICE: The Mississippi Partnership Local Workforce Investment Board would like to announce its upcoming meetings on Thursday, September 19, 2013 at the ICC Belden Campus located at 3200 Adams Farm Road: the Youth Council and One-Stop Committee will meet at 11:00 a.m. and the Full Board will meet at 12:00 p.m. All interested parties are invited to attend.

ciary, which Deed of Trust was recorded on May 11, 2011 as Instrument 201101955 in the LEGALS of Alcorn 0955 records land County, Mississippi; and WHEREAS, on September 10, 2013, BancorpSouth Bank substituted Jimmy B. Fisher in the place and stead of J. Patrick Caldwell as Trustee in the above referenced Deed of Trust which Substitution of Trustee was recorded in the land records of Alcorn County, Mississippi, on September 12, 2013, as Instrum e n t n u m b e r 201304552 reference to which is hereby made; and

WHEREAS, on June 20, 2008, James C. Melton executed and delivered a Deed of Trust to J. Patrick Caldwell as Trustee, and BANCORPSOUTH BANK, Beneficiary, which Deed of Trust was recorded on June 26, 2008 as Instru1t ment 200803637 in the WHEREAS, default has 9/18 land records of Alcorn been made in the pay14393 County, Mississippi; and ment of the indebtedness secured by said WHEREAS, on Septem- aforementioned Deed SUBSTITUTE ber 10, 2013, Bancorp- of Trust, and the said TRUSTEE'S NOTICE South Bank substituted BancorpSouth Bank, beOF SALE Jimmy B. Fisher in the ing the owner and holdWHEREAS, on April 11, place and stead of J. er of the indebtedness 2007, James C. Melton P a t r i c k C a l d w e l l a s secured thereby, havexecuted and delivered Trustee in the above ing requested the una Deed of Trust to J. r e f e r e n c e d D e e d o f dersigned Substitute P a t r i c k C a l d w e l l a s Trust which Substitu- Trustee so to do, I will Trustee, and BANCORP- tion of Trustee was re- on October 10, 2013, ofTHIS the 16th day of SOUTH BANK, Benefi- corded in the land re- fer for sale and will sell, September, 2013 ciary, which Deed of cords of Alcorn County, d u r i n g l e g a l h o u r s Trust was recorded on Mississippi, on Septem- (11:00 a.m. - 4:00 p.m.) at BOBBY MAROLT April 13, 2007 as Instru- ber 12, 2013, as Instru- the South door of the CLERK n u m b e r Courthouse in Alcorn ment 200702206 in the m e n t land records of Alcorn 201304550 reference to County, Corinth, MissisGARY NASH County, Mississippi; and which is hereby made; sippi, to the highest bidder for cash at puband 3 t's lic outcry, the followWHEREAS, on Septem9/18, 9/25, 10/2 ber 10, 2013, Bancorp- WHEREAS, on August 17, ing described property: #14397 South Bank substituted 2009, James C. Melton Jimmy B. Fisher in the executed and delivered Situated in the County IN THE CHANCERY place and stead of J. a Deed of Trust to J. of Alcorn, State of MisCOURT OF ALCORN P a t r i c k C a l d w e l l a s P a t r i c k C a l d w e l l a s sissippi, to-wit: COUNTY, MISSISSIPPI Trustee in the above Trustee, and BANCORPr e f e r e n c e d D e e d o f SOUTH BANK, Benefi- TRACT 1: Beginning at IN THE MATTER OF THE Trust which Substitu- ciary, which Deed of that point on the East LAST WILL AND TESTA- tion of Trustee was re- Trust was recorded on boundary line of the MENT OF WILLIARD NASH, corded in the land re- August 25, 2009 as In- Southwest Quarter of DECEASED cords of Alcorn County, strument 200904157 in Section 4, Township 2, Mississippi, on Septem- the land records of Al- Range 7, 62 rods South CAUSE NO. 2013-0487-02 ber 12, 2013, as Instru- corn County, Missis- of the Northeast corner thereof, run thence m e n t n u m b e r sippi; and West 738 feet; run NOTICE TO KNOWN 201304548 reference to CREDITORS which is hereby made; WHEREAS, on Septem- thence South 1500 feet, ber 10, 2013, Bancorp- more or less, to the and South Bank substituted North right-of-way line PLEASE TAKE NOTICE, pursuant to Section 91-7- WHEREAS, on Novem- Jimmy B. Fisher in the of U. S. Highway 72 for 145(1) of the Mississippi ber 20, 2007, James C. place and stead of J. the true point of beginCode of 1972 Annotated, as Melton executed and P a t r i c k C a l d w e l l a s ning; run thence West amended, that I have this day delivered a Deed of Trustee in the above with the North right-offorwarded to the Daily Cor- Trust to J. Patrick Cald- r e f e r e n c e d D e e d o f way line of U. S. Highinthian for publication, a No- well as Trustee, and Trust which Substitu- way 72, 300 feet; run tice to Creditors, a copy of BANCORPSOUTH BANK, tion of Trustee was re- thence North 680 feet; which is attached to your in- Beneficiary, which Deed corded in the land re- run thence South 70 deformation. If you are a credit- of Trust was recorded cords of Alcorn County, grees 15 minutes East or of the estate referenced on November 28, 2007 Mississippi, on Septem- 8 0 f e e t ; r u n t h e n c e above, and you fail to have a s I n s t r u m e n t ber 12, 2013, as Instru- North 77 degrees 55 n u m b e r minutes East 224.6 feet; your claim against said estate 200707643 in the land m e n t probated and registered by r e c o r d s o f A l c o r n 201304551 reference to run thence South 700 the Chancery Court of Al- County, Mississippi; and which is hereby made; feet to the point of beginning, containing 4.61 and corn County, Mississippi withacres, more or less. in ninety (90) days after the WHEREAS, on Septemfirst publication of the en- ber 10, 2013, Bancorp- WHEREAS, on May 9, closed Notice, such will bar South Bank substituted 2011, James C. Melton TRACT 2: Beginning at a your claim as provided in Sec- Jimmy B. Fisher in the executed and delivered p o i n t o n t h e E a s t tion 91-7-151 of the Missis- place and stead of J. a Deed of Trust to J. boundary line of the sippi Code of 1972 Annot- P a t r i c k C a l d w e l l a s P a t r i c k C a l d w e l l a s Southwest Quarter of ated, as amended. Trustee in the above Trustee, and BANCORP- Section 4, Township 2, r e f e r e n c e d D e e d o f SOUTH BANK, Benefi- Range 7, 62 rods South THIS the 9th of the Trust which Substitu- ciary, which Deed of of the Northeast corner September, 2013. tion of Trustee was re- Trust was recorded on thereof; run thence corded in the land re- May 11, 2011 as Instru- W e s t 7 3 8 f e e t ; r u n GARY NASH cords of Alcorn County, ment 201101955 in the thence South 800 feet, 3t's Mississippi, on Septem- land records of Alcorn more or less, to a point 9/11, 9/18, & 9/25/13 ber 12, 2013, as Instru- County, Mississippi; and 700 feet North and perpendicular to the North 14387 m e n t n u m b e r 201304549 reference to WHEREAS, on Septem- right-of-way line of U. S. which is hereby made; ber 10, 2013, Bancorp- Highway 72; continue South Bank substituted thence South 700 feet and Jimmy B. Fisher in the to the North right-ofWHEREAS, on June 20, place and stead of J. way line of U. S. High2008, James C. Melton P a t r i c k C a l d w e l l a s w a y 7 2 ; r u n t h e n c e executed and delivered Trustee in the above West with the North a Deed of Trust to J. r e f e r e n c e d D e e d o f right-of-way line of U. S. P a t r i c k C a l d w e l l a s Trust which Substitu- Highway 72, 300 feet to Trustee, and BANCORP- tion of Trustee was re- the point of beginning; SOUTH BANK, Benefi- corded in the land re- continue thence West ciary, which Deed of cords of Alcorn County, 1 6 0 2 f e e t w i t h t h e Trust was recorded on Mississippi, on Septem- North right-of-way line June 26, 2008 as Instru- ber 12, 2013, as Instru- of U.S. Highway 72; run n u m b e r thence North 1542 feet, ment 200803637 in the m e n t land records of Alcorn 201304552 reference to more or less, to the County, Mississippi; and which is hereby made; South bank of Cane and Creek Canal; run thence in an easterly direction WHEREAS, on SeptemWHEREAS, default hascomplex with theon South bank of ber 10, confi 2013,rmation, Bancorp-Cane We are selling, with owners Creek apartment 5.70 acres Bank substituted been made in the pay- Cane Creek Canal to a +/- consisting of (32)South 2 br, 1 b apts. with 750 sq. ft. each, c/h/a, stove & refrigerator Jimmy B. Fisher in the ment of the indebted- point 62 rods South of secured the the North boundary are furnished in apts.,place 29 apts. currently rented. In the by lastsaid 12 mo. complex hasof and are stead of J. ness aforementioned Deed said quarter section; P a t r i cThis k C a lcomplex d w e l l a shas averaged 90% occupancy. a state approved sewage lagoon on site. Trustee in the above of Trust, and the said thence run East 1900 We will also sell withr eowners rmation, a 100’ x 250’Bank, commercial span metal be- feet, free more or less, to a f e r e n c econfi d De e d o f BancorpSouth ing the owner hold-roll point 738 feet Trust which Substitubuilding with 6” reinforced concrete, 20’ sidewalls, and (1)and 16’x16 up doors on West 12.31of er of the indebtedness the East boundary of of restroom, Trustee was acres +/-, shop has an tion office, & reshowroom, front office area has 8 offices, break corded in the land re- secured thereby, hav- said quarter section; requested the un- thence run 800 area, 3 restrooms, & cords retailofsales area, c/h/a,ing & upstairs apartment has 2100 sq.South ft. w/3 Alcorn County, dersigned Substitute feet; thence run South Mississippi, on Septembr, 2 b. These properties are located just outside the city limits in the Kossuth/Corinth 2013, as Instru- Trustee so to do, I will 77 degrees 55 minutes school district, and 1 ber mile12,from Magnolia Regional Health Center. m e n t n u m b e r on October 10, 2013, of- West 224.6 feet; run 201304550 reference to fer for sale and will sell, thence North 70 dewhich is hereby made; d u r i n g l e g a l h o u r s grees 15 minutes West (11:00 a.m. - 4:00 p.m.) at 80 feet, more or less, to and the South door of the a point due North of WHEREAS, on August 17, Courthouse in Alcorn the beginning point; 2009, James C. Melton County, Corinth, Missis- thence run South 680 executed and delivered sippi, to the highest feet, more or less, to a Deed of Trust to J. bidder for cash at pub- the point of beginning, P a t r i c k C a l d w e l l a s lic outcry, the follow- containing 62.81 acres, Trustee, and BANCORP- ing described property: more or less. SOUTH BANK, Benefiin the County Notwithstanding anyciary, Deed of Situated 2 Hobart Beta-mig 250 wirewhich welders, Snap-On industrial Ya212 230 mig welder, MillTrust was recorded on of Alcorn, State of Mis- thing herein to the conto-wit: Miller &trary, thewire location er-matic 251 wire welder, Lincoln AC325-S stick welder, Hobart weld-of August 25, 2009 as In- sissippi, the North right-of-way strument in air shear, US Industrial ers, Hypertherm plasma cutter,200904157 Wysong 10’ Machinery model land records of Al- TRACT 1: Beginning at of U. S. Highway 72 as 1025 hydraulic shear,the FMB-Titan model 16” band saw, Hyster (LP) 4000 lb. fork lift, corn County, Missis- that point on the East referred to in Tracts 1 boundary of saw, the chop and 2 saws, aboveGrizzly is at the Cat (LP) model TC100D lb. fork lift, Hitachiline table sippi;10,000 and Southwest Quarter of location of the said shaper & belt sander, Porter cable pocket cutter, routers, bit sets, Craftsman 12” band WHEREAS, on Septem- Section 4, Township 2, highway right-of-way in saw, Delta sander, bench grinder, drill presses, electric & battery hand saws, Range 7, 62 rods South powered 1983. ber 10, 2013, Bancorpthe Northeast corner South Bank substituted shop fans, work tables, welding tables, woodofclamps, welding clamps, staple guns, 20 thereof, run thence LESS AND EXCEPT from B. Fisher in the vices, Ton press, Tri Star 7”Jimmy v/h metal band saw, motor jack, attic fan, hand tools, tool place and stead of J. W e s t 7 3 8 f e e t ; r u n Tracts 1 and 2 the fol1500 feet, lowing propboxes & carts, batteryP achargers, re extinguishers, (new)described camper mit r i c k C a air l d wcompressors, e l l a s thencefiSouth more or less, units, to the erty: vents, electric Trustee in the above crowaves & (120 v./gas) refrigerators, camper roof ac/heat electric e f e r e n c e d D e e d o f North right-of-way line camper steps, electricrTrust tongue jacks, RV & trailer accessories, gondola shelving, bolt which Substitu- of U. S. Highway 72 for C o m m e n c i n g a t t h e true point of beginNortheast corner of the & nut bins, pallet racking &Trustee shelving, 3 hitches, Lincoln air bumper jack, 4 post tion of wasclass re- the thence West Southwest Quarter of in the tool land compartment re- ning; run doors, HD drive on lift, shopcorded vacs, trailer camper doors & windows, cords of Alcorn County, with the North right-of- Section 4, Township 2 office desks, chairs, computers, 50’Septem3 car goose trailer lb. winch, 5’ disk, way neck line of U. S. w/8000 High- South, Range 7 East; Mississippi, on 72, 300 tile, feet;electric run thence run South berjigs 12, & 2013, as Instrubushhogs, motor home frames, vinylway & ceramic tile cutter, wire, 262 North 680 feet; rods; thence run West m e nmetal t n u m b racks, e r thence tire machines, tire racks, storage shop built 30’ gooseneck self contained 201304551 reference to run thence South 70 de- 738 feet for a point of 15 Gr. minutes hydraulic tilt roller trailer, GMC Yukon, 01 Pont. Prix.East beginning; thence run which 96 is hereby made; grees 8 0 f expected. e e t ; r u n tDon’t h e n c eMiss West 316.5 feet; thence and More vehicles, trailers & heavy equipment This Sale!!! North 77 degrees 55 run South 1500 feet, WHEREAS, on May 9, minutes East 224.6 feet; more or less, to the run thence South 700 North right-of-way line TERMS: Cash, personal 2011, or company accepted with bank letter of guarantee made to Mid-South Jameschecks C. Melton to the point of beof U. S. Highwayis72sold as it Real Estate Sales & Auctions. Payment due in full on feet sale day on all personal property. Everything executed and delivered 4.61 existed in price. 1983; thence a Deed 10% of Trust J. ginning, as-is, where-is, with no guarantee. buyers to premium will becontaining added to determine the fi nal moreaccepted or less. with bank run in an easterly direcP a tCash, r i c k personal C a l d w eorl l company a s acres, REAL ESTATE TERMS: checks letter of guarantee tion along the North Trustee, BANCORPmade to Mid-South Real Estate Salesand & Auctions. 10%TRACT down day of sale, balance due in full upon delivery 2: Beginning at a right-of-way line of said BANK, Benefiof deed in 30 days or less.SOUTH Everything is believed true, but not guaranteed. Any announcement made sale ciary, which Deed of p o i n t o n t h e E a s t highway as it existed in day supersedes all advertisements. Property will be sold as-is, where-is with no guarantee. Trust was recorded on boundary line of the 1983 a distance of 316.5 Quarter tot. a point due May 11, 2011the as right InstruAuctioneer reserves to Southwest group & regroup asofhe feet sees fi ment 201101955 in the Section 4, Township 2, South of the beginning land records of Alcorn Range 7, 62 rods South point; thence run North County, Mississippi; and of the Northeast corner 1500 feet, more or less, thereof; run thence to the beginning point. WHEREAS, on Septem- W e s t 7 3 8 f e e t ; r u n ber 10, 2013, Bancorp- thence South 800 feet, LESS AND EXCEPT from South Bank substituted more or less, to a point said excepted parcel of Jimmy B. Fisher in the 700 feet North and per- land a perpetual nonplace and stead of J. pendicular to the North exclusive easement and P a t r i c k C a l d w e l l a s right-of-way line of U. S. right-of-way for the folTrustee in the above Highway 72; continue l o w i n g p u r p o s e s ; r e f e r e n c e d D e e d o f thence South 700 feet namely, the right to Trust which Substitu- to the North right-of- enter upon the hereinway line of U. S. High- after described land

PUBLIC AUCTION

SATURDAY - SEPTEMBER 21, 2013 @ 9:00 A.M. 1441 HWY 72 W & CR 735 - CORINTH, MS 38834 32 APARTMENTS & SHOP ON 18 ACRES +/-, SHOP/OFFICE EQUIPMENT

CONSIGNMENTS WELCOME (OUTSIDE ITEMS ONLY)

Directions: From Corinth, take Hwy 72 W, turn North on CR 735 auction will be held on site.

10% buyers premium will be added to determine the final bid. IF YOU WANT TO SELL IT, CALL US SCOTTY LITTLE (sales) mal#150 or STEVE LITTLE (broker)

MID-SOUTH REAL ESTATE SALES & AUCTIONS, LLC 110 HWY 72 E. CORINTH, MS 38834 662-286-2488 WWW.MS-AUCTION.COM

of the Northeast corner thereof; run thence West 738 feet; run thence South 800 feet, LEGALS 0955 or more less, to a point 700 feet North and perpendicular to the North right-of-way line of U. S. Highway 72; continue thence South 700 feet to the North right-ofway line of U. S. Highway 72; run thence West with the North right-of-way line of U. S. Highway 72, 300 feet to the point of beginning; continue thence West 1602 feet with the North right-of-way line of U.S. Highway 72; run thence North 1542 feet, more or less, to the South bank of Cane Creek Canal; run thence in an easterly direction with the South bank of Cane Creek Canal to a point 62 rods South of the North boundary of said quarter section; thence run East 1900 feet, more or less, to a point 738 feet West of the East boundary of said quarter section; thence run South 800 feet; thence run South 77 degrees 55 minutes West 224.6 feet; run thence North 70 degrees 15 minutes West 80 feet, more or less, to a point due North of the beginning point; thence run South 680 feet, more or less, to the point of beginning, containing 62.81 acres, more or less. Notwithstanding anything herein to the contrary, the location of the North right-of-way of U. S. Highway 72 as referred to in Tracts 1 and 2 above is at the location of the said highway right-of-way in 1983. LESS AND EXCEPT from Tracts 1 and 2 the following described property: Commencing at the Northeast corner of the Southwest Quarter of Section 4, Township 2 South, Range 7 East; thence run South 62 rods; thence run West 738 feet for a point of beginning; thence run West 316.5 feet; thence run South 1500 feet, more or less, to the North right-of-way line of U. S. Highway 72 as it existed in 1983; thence run in an easterly direction along the North right-of-way line of said highway as it existed in 1983 a distance of 316.5 feet to a point due South of the beginning point; thence run North 1500 feet, more or less, to the beginning point. LESS AND EXCEPT from said excepted parcel of land a perpetual nonexclusive easement and right-of-way for the following purposes; namely, the right to enter upon the hereinafter described land and to do any and all work necessary to build, maintain and repair a road, together with the right to use said easement for the purpose of ingress and egress and for public utilities all over, upon and across the following described land: Commencing at the Northeast corner of the Southwest Quarter of Section 4, Township 2 South, Range 7 East; thence run South 62 rods; thence run West 1029.5 feet for a point of beginning; thence run West 25 feet; thence run South 1500 feet, more or less, to the North right-of-way line of U. S. Highway 72 as it existed in 1983; thence run in an easterly direction along the North right-of-way line of said highway as it existed in 1983 a distance of 25 feet to a point due South of the beginning point; thence run North 1500 feet, more or less, to the beginning point. THERE IS ALSO EXCEPTED from Tracts 1 and 2 described herein a perpetual non-exclusive easement and right-ofway for the following purposes; namely, the right to enter upon the hereinafter described land and to do any and all work necessary to build, maintain and repair a road, together with the right to use said easement for the purpose of ingress and egress and for public utilities all over, upon and across the following described land: Commencing at the Northeast corner of the Southwest Quarter of Section 4, Township 2 South, Range 7 East; thence run South 62 rods; thence run West 1054.5 feet for a point of beginning; thence run West 25 feet; thence run South 1500 feet, more or less, to the North right-of-way line of U. S. Highway 72 as it existed in 1983; thence run in an easterly direction along the North right-of-way line of said highway as it existed in 1983 a distance of 25 feet to a point due South of the beginning point; thence run North 1500 feet, more or less, to the beginning point.

1500 feet, more or less, Situated in the County of Alto the beginning point. corn, State of Mississippi, towit: I will convey only such LEGALS 0955 0955 LEGALS title as is vested in me TRACT 1: That part of the as Substitute Trustee. Northeast Quarter of the Southeast Quarter of Section S I G N E D A N D P O S T E D 5, township 2, Range 7 which this 18th of September, lies East of Cane Creek Canal 2013. and containing one (1) acre, more or less. JIMMY B. FISHER, SUBSTITUTE TRUSTEE TRACT #2: Beginning at that 4 t's point on the East boundary line of the Southwest Quarter 9 / 1 8 , 9 / 2 5 , 1 0 / 2 , of Section 4, Township 2, 10/9/2013 Range 7, 62 rods South of the Northeast corner thereof, #14391 run thence West 738 feet; run thence South 1500 feet, PUBLIC NOTICE more or less, to the North September 16,2013 right-of-way line of U. S. Highway 72 for the true point T h e A l c o r n C o u n t y of beginning; run thence West Board of Supervisors at with the North right-of-way its September 16, 2013 line of U. S. Highway 72, 300 meeting, voted to sell feet; run thence North 680 equipment that was de- feet; run thence South 70 determined to be surplus. grees 15 minutes East 80 feet; Sealed bids will be re- run thence North 77 degrees ceived on October 7, 55 minutes East 224.6 feet; 2013 at 9:00 AM, in the run thence South 700 feet to Alcorn County Board of the point of beginning, conSupervisors Building taining 4.61 acres, more or located at 305 South less. Fulton Drive, Corinth, Mississippi. The surplus TRACT 3: Beginning at a equipment is as follows point on the East boundary line of the Southwest Quarter 1 9 9 6 E a s t T r a i l e r of Section 4, Township 2, 1 E 1 U I Y 2 8 8 T R L 2 0 4 6 1 Range 7, 62 rods South of the Aluminum live bottom Northeast corner thereof; T/A trailer run thence West 738 feet; run thence South 800 feet, 1 9 9 6 E a s t T r a i l e r more or less, to a point 700 1 E 1 U I Y 2 8 3 T R L 2 0 4 7 1 feet North and perpendicular Aluminum live Bottom to the North right-of-way line T/A trailer of U. S. Highway 72; continue thence South 700 feet to the 1 9 9 6 E a s t T r a i l e r North right-of-way line of U. 1 E 1 U I Y 2 8 0 T R L 2 0 3 3 9 S. Highway 72; run thence Aluminum live bottom West with the North rightT/A trailer of-way line of U. S. Highway 72, 300 feet to the point of 1 9 9 6 E a s t T r a i l e r beginning; continue thence 1 E 1 U I Y 2 8 X T R L 2 0 4 5 9 West 1602 feet with the Aluminum live bottom North right-of-way line of T/A trailer U.S. Highway 72; run thence North 1542 feet, more or 1 9 9 6 E a s t T r a i l e r less, to the South bank of 1 E 1 U I Y 2 8 5 T R L 2 0 4 7 2 Cane Creek Canal; run Aluminum live bottom thence in an easterly direcT/A trailer tion with the South bank of Cane Creek Canal to a point 1998 Trailstar Trailer 62 rods South of the North 1T9SF45B1W1066224 boundary of said quarter secAluminum live bottom tion; thence run East 1900 T/A trailer, has spread feet, more or less, to a point axle set up 738 feet West of the East boundary of said quarter sec2005 John Deere 544J tion; thence run South 800 544JZ595458 feet; thence run South 77 deEnclosed cab with A/C, grees 55 minutes West 224.6 h a s r o c k l a n d f r o n t feet; run thence North 70 debucket grees 15 minutes West 80 feet, more or less, to a point 1993 Chevrolet Kodiak due North of the beginning 1GBT7H4J2PJ106775 point; thence run South 680 T/A dump truck feet, more or less, to the point of beginning, containing 2000 Mack CX613 62.81 acres, more or less. 1M1AE06Y5YW004587 Standard day cab tract- Notwithstanding anything or with wet kit. Mack herein to the contrary, the powered w/10 speed location of the North righttrans. of-way of U. S. Highway 72 as referred to in Tracts 2 and 3 1997 Barko 160A 21575 above is at the location of the Knuckle boom loader said highway right-of-way in with grapple, mounted 1983. on Pitts trailer LESS AND EXCEPT from 2002 Case 580 Super M Tracts 2 and 3 the following 4x4 described property: JJG0284214 Open canopy, 4x4 4N1 Commencing at the Northfront bucket, standard east corner of the Southwest read boom & bucket. Quarter of Section 4, TownTires are foam filled ship 2 South, Range 7 East; thence run South 62 rods; 1994 Haybuster HI 12 thence run West 738 feet for 21-2-49-0058 a point of beginning; thence Tub grinder with con- run West 316.5 feet; thence v e y o r b e l t , D e t r o i t run South 1500 feet, more or powered less, to the North right-ofway line of U. S. Highway 72 1 9 9 7 V o l v o as it existed in 1983; thence 4 V 5 J B B R F 1 V N 8 5 5 3 6 5 run in an easterly direction Standard tandem axle along the North right-of-way day cab line of said highway as it existed in 1983 a distance of Each item will be sold as 316.5 feet to a point due is and to the highest South of the beginning point; bidder. Alcorn County thence run North 1500 feet, reserves the right to re- more or less, to the beginject any and all bids. ning point. The above described property may be inspected prior to the sale by contacting Paul Rhodes, Purchase Clerk, at 662-286-7708 The said items shall be sold as is. This the 16th day of September 2013 2 t's 9/18, 9/25/2013 #14395 SUBSTITUTE TRUSTEE'S NOTICE OF SALE WHEREAS, on October 21, 2002, James C. Melton executed and delivered a Deed of Trust to J. Patrick Caldwell as Trustee, and BANCORPSOUTH BANK, Beneficiary, which Deed of Trust was recorded on October 23, 2002 in Trust Deed Book 603, pages 278-283 in the land records of Alcorn County, Mississippi; and WHEREAS, on September 10, 2013, BancorpSouth Bank substituted Jimmy B. Fisher in the place and stead of J. Patrick Caldwell as Trustee in the above referenced Deed of Trust which Substitution of Trustee was recorded in the land records of Alcorn County, Mississippi, on September 12, 2013, as Instrument number 201304547 reference to which is hereby made; and WHEREAS, default has been made in the payment of the indebtedness secured by said aforementioned Deed of Trust, and the said BancorpSouth Bank, being the owner and holder of the indebtedness secured thereby, having requested the undersigned Substitute Trustee so to do, I will on October 10, 2013, offer for sale and will sell, during legal hours (11:00 a.m. 4:00 p.m.) at the South door of the Courthouse in Alcorn County, Corinth, Mississippi, to the highest bidder for cash at public outcry, the following described property:

LESS AND EXCEPT from said excepted parcel of land a perpetual non-exclusive easement and right-of-way for the following purposes; namely, the right to enter upon the hereinafter described land and to do any and all work necessary to build, maintain and repair a road, together with the right to use said easement for the purpose of ingress and egress and for public utilities all over, upon and across the following described land: Commencing at the Northeast corner of the Southwest Quarter of Section 4, Township 2 South, Range 7 East; thence run South 62 rods; thence run West 1029.5 feet for a point of beginning; thence run West 25 feet; thence run South 1500 feet, more or less, to the North right-of-way line of U. S. Highway 72 as it existed in 1983; thence run in an easterly direction along the North right-of-way line of said highway as it existed in 1983 a distance of 25 feet to a point due South of the beginning point; thence run North 1500 feet, more or less, to the beginning point. THERE IS ALSO EXCEPTED from Tracts 2 and 3 described herein a perpetual non-exclusive easement and right-of-way for the following purposes; namely, the right to enter upon the hereinafter described land and to do any and all work necessary to build, maintain and repair a road, together with the right to use said easement for the purpose of ingress and egress and for public utilities all over, upon and across the following described land:

erly direction along the North right-of-way line of said highway as it existed in 1983 a distance of 25 feet to a point LEGALS 0955South due of the beginning point; thence run North 1500 feet, more or less, to the beginning point. I will convey only such title as is vested in me as Substitute Trustee.

SIGNED AND POSTED this 18th of September, 2013. JIMMY B. FISHER, SUBSTITUTE TRUSTEE 4t's 9/18, 9/25, 10/2, 10/9 #14392 PUBLIC NOTICE

Pursuant to resolution of the Alcorn County Board of Supervisors adopted on September 16, 2013, at a regular meeting thereof, Alcorn County, Mississippi, does hereby give notice of its intention to borrow up to the sum of $900,000.00 to be evidenced by negotiable notes of Alcorn County, Mississippi, with a final maturing date of five years from execution date. All entities desiring to submit a bid for purchase of said negotiable notes shall submit a written, sealed bid therefor at the office of the Alcorn County Board of Supervisors located at 305 South Fulton Drive, Corinth, Mississippi, by 9:00 A.M. on the 7th day of October 2013.

Alcorn County, Mississippi, intends to accept the lowest rate of interest or the bid that represents the lowest net cost to Alcorn County, Mississippi, but Alcorn County, Mississippi, reserves the right to reject any and all bids.

The rate of interest to be quoted by interested bidders shall not exceed that authorized in Section 75-17-101, Mississippi Code of 1972. Said promissory note shall mature in approximately five (5) equal installments of principal and interest over a period of five (5) years from the date of issuance, with the first installment due one year from the date of issuance and one installment due on the same date in each of the next four years. The County shall reserve the right to prepay in whole or in part at any time without penalty.

This 16th day of September, 2013

ALCORN COUNTY BOARD OF SUPERVISORS BY: Lowell Hinton, President ATTEST: Bobby Marolt, Chancery Clerk 1t 9/18/2013 #14394 IN THE CHANCERY COURT OF ALCORN COUNTY, MISSISSIPPI RE: ADMINISTRATION OF THE ESTATE OF EDWARD FOWLER, DECEASED NO. 2009-0596-02 SUMMONS THE STATE OF MISSISSIPPI TO: ALL UNKNOWN HEIRS-AT-LAW OF EDWARD FOWLER, DECEASED

You have been made a defendant in the complaint filed in this Court by Crissie Fowler McMahan, individually and as administratrix of the estate of Edward Fowler, deceased, and you must take immediate action to protect your rights. Respondents other than you in this action are: None

You are summoned to appear and defend against said Complaint to establish and determine heirs-at-law of Edward Fowler at 9:00 o'clock a.m. on the 15th day of October, 2 013, at the Alcorn County Chancery Building, Corinth, Mississippi, and in case of your failure to appear and defend a judgment will be entered against you for the things demanded in said Complaint.

You are not required to file an answer or other pleading, but you may do so if you desire. ISSUED under my hand and seal of said Court this the 9th day of September, 2013. BOBBY MAROLT CHANCERY COURT CLERK 44633.WPD 3 T'S 9/11, 9/18, 9/25/2013 #14385

Commencing at the NorthHANDYMAN east corner of the Southwest Quarter of Section 4, TownH A N D YMAN'S Home ship 2 South, Range 7 East; thence run South 62 rods; care, anything. 662-643 thence run West 1054.5 feet 6892. for a point of beginning; STORAGE, INDOOR/ thence run West 25 feet; OUTDOOR thence run South 1500 feet, more or less, to the North AMERICAN right-of-way line of U. S. MINI STORAGE Highway 72 as it existed in 2058 S. Tate 1983; thence run in an eastAcross from erly direction along the North World Color Situated in the County of Al- right-of-way line of said high287-1024 I will convey only such corn, State of Mississippi, to- way as it existed in 1983 a title as is vested in me wit: distance of 25 feet to a point MORRIS CRUM as Substitute Trustee. due South of the beginning MINI-STORAGE TRACT 1: That part of the point; thence run North 1500 286-3826. S I G N E D A N D P O S T E D Northeast Quarter of the

091813 daily corinthian  

091813 daily corinthian

Read more
Read more
Similar to
Popular now
Just for you