Page 1

THURSDAY, FEBRUARY 6, 2014

VOL. 92 | NO. 6 | $4.25

Welcome to the big house An old hog barn becomes a new home for sheep | P. 73

GROWING WITH FARMERS FOR 90 YEARS

|

WWW.PRODUCER.COM

TRANSPORTATION | RAIL CAPS

ANIMAL HEALTH | HOGS

Would cap removal help farmers? Be careful what you wish for | Critics say cap removal won’t boost efficiency, just rail profits

PED here to stay in Ontario: veterinarian

BY SEAN PRATT

BY BARBARA DUCKWORTH

SASKATOON NEWSROOM

CALGARY BUREAU

Grain groups should reconsider their calls for an end to the railway revenue cap, says a grain transportation expert. “I would urge caution on the part of anybody who is looking to take away the revenue cap,” said Mark Hemmes, president of Quorum Corp., the government appointed monitor of Canada’s prairie grain handling and transportation system. “There isn’t any evidence that says just by allowing (railways) to charge more money that all of the sudden you get better service.” Federal agriculture minister Gerry Ritz said the proposal for eliminating the revenue cap will be on the table when Transport Canada conducts its 2015 rail review. “This is one solution some farm groups have been musing about that we should look at, but I’m not about to support giving the railways freedom to charge whatever the market will bear,” Ritz said during a recent conference call. Mercantile Consulting Venture and Agri-Trend are the latest groups to weigh in on the issue. They sent a joint letter to Ritz proposing that the government cancel the cap immediately and instead determine a minimum grain tonnage the railways have to carry each year. They suggested 39 million tonnes for this crop year. Marlene Boersch, partner in Mercantile Consulting Venture, said Agriculture Canada is forecasting a 13 million tonne increase in total grain and oilseed carryout in 2013-14. Using Agriculture Canada’s monthly average prices, she calculated that that represents $3.72 billion that will not be entering the Canadian economy, partly because of a 40,000 rail car shortfall between grain company demand and railway company supply.

Porcine epidemic diarrhea virus is probably a permanent disease in Ontario now that there have been five confirmed cases as of Feb. 2, say swine veterinarians. “PED is now endemic in the U.S.A. It is here to stay. I am wondering if Ontario is approaching that point,” Alberta provincial swine specialist Julia Kleenliside said in a Jan. 31 teleconference call. “It is a risk that is here to stay so biosecurity must be for the long term because PED is not going to disappear,” she said. One case was found in Middlesex Country, one in Norfolk County, one in Simcoe County and two in Chatham-Kent as of Jan. 31. All are located along Lake Erie. The potentially fatal virus has no cure and has also been found at a pig assembly yard, three trucking operations and a processor. Three of the infected farms are connected to one assembly yard.

MARK HEMMES PRESIDENT, QUORUM CORP.

SEE PED HERE TO STAY, PAGE 2

»

u|xhHEEJBy00001pzYv+:' FEBRUARY 6, 2014 Return undeliverable Canadian addresses to: Box 2500, Saskatoon, SK. S7K 2C4

MICHELLE HOULDEN PHOTO ILLUSTRATION

»

NOTHING HITS HARDER.

OR LASTS LONGER.

AND SAVE BEFORE FEBRUARY 20th.

PrePassTM delivers SoilActiveTM control for 21 days, guaranteed. It provides superior pre-seed control of winter annual and broadleaf weeds. Plus a 30 minute rainfast guarantee. Call 1.800.667.3852 or visit cerealsolutions.ca.

® TM

Trademark of The Dow Chemical Company (“Dow”) or an affiliated company of Dow. 01/14-35775-01 BulkUp WP

The Western Producer is published in Saskatoon by Western Producer Publications, which is owned by GVIC Communications Corp. Publisher: Shaun Jessome Publications Mail Agreement No. 40069240

SEE RAIL CAP DEBATE, PAGE 2

There isn’t any evidence that says just by allowing (railways) to charge more money that all of the sudden you get better service.


2

NEWS

FEBRUARY 6, 2014 | WWW.PRODUCER.COM | THE WESTERN PRODUCER

Rail cap sparks debate “It’s affecting everyone in the economy, not only farmers,” said Boersch. The federal government recently announced it will conduct a five-year review of the Canadian grain logistics system. “I find it very disappointing that out of that (Crop Logistics Working Group) meeting in Winnipeg, the only outcome is a study,” said Boersch. “Sitting and studying is not doing anything for year two or three or five.” Boersch said railways are selling locomotives and hopper cars and getting rid of employees at a time when growers can’t move the grain piled on their farms. She doesn’t think that would happen if railways faced penalties if they didn’t meet a minimum grain tonnage target. “We need to change the regulator framework around the duopoly. That’s what this is about,” said Boersch. The idea is percolating around the agriculture community. Eliminating the revenue cap was recently discussed at SaskCanola’s annual general meeting and has been making the rounds on Twitter. Hemmes said there is no evidence that the tactic will deliver the results farmers are seeking. Other commodity groups that pay higher rates are experiencing similar service prob-

lems as agriculture. The only factor that appears to result in better service is competitive forces. All but one potash mine is serviced by both railways, and oil can move by pipeline. By contrast, most grain elevators are captive to one railway. The railways know the grain will eventually move down their tracks, so raising rates may simply result in a widening basis for farmers and the same disappointing service. Hemmes said there are no shortterm fixes for this year’s grain transportation problem. He isn’t an apologist for the railways, but up until Sept. 1 they were planning to move the same volume of grain as the previous year. “The grain companies and everybody else around them was saying, ‘yah, that’s probably a pretty good bet,’ ” said Hemmes. Everybody was caught off guard by a harvest that shattered the previous record. “The fact is you don’t run down to the corner store and buy a bunch of locomotives. You can’t go to manpower and temporary services and pick up locomotive engineers and conductors. It’s a six to eight month planning cycle,” he said.

REGULAR FEATURES

INSIDE THIS WEEK

TRANSPORTATION | FROM PAGE ONE

Ag Stock Prices Classifieds Events, Mailbox Livestock Report Market Charts Opinion Open Forum On The Farm Weather

COLUMNS Barry Wilson Editorial Notebook Hursh on Ag Market Watch Perspectives on Management Animal Health TEAM Living Tips

Calf pain: A researcher measures depression in calves as a way to monitor pain levels. See page 42. | UBC PHOTO

NEWS

» WHEAT BREEDING: Farmers » » »

need to start debating how they want wheat breeding to look like in the future. 5 GRAIN CONTRACTS: Farmers need to pay closer attention to the contracts they sign with grain companies. 17 THEN AND NOW: Was wheat a more profitable crop 90 years ago? Its not always easy to tell. 26 SEEDING BEANS: Seeding beans at a denser rate may increase yields, an Alberta study is finding. 30

» WATER METER: Technology » » »

can help farms monitor how much water they use and how much they need. 31 WATER QUALITY: Irrigated water in southern Alberta receives top marks in quality testing. 35 GRAIN FIX: Canada’s grain shippers say new railway service legislation is failing them. 40 SOW HOUSING: A researcher says switching to group housing shouldn’t hurt longterm hog profitability. 75

MARKETS 6 ANIMAL HEALTH | FROM PAGE ONE

PED here to stay in Ontario Qu e b e c f o u n d s a m p l e s at a n Olymel plant that traced back to one of the Ontario farms. The five farms have voluntarily stopped all movement and are working with the province and processors to decide how to ship contaminated animals and keep the virus from spreading further. No disease has been found in Western Canada, but starting Feb. 3, provincial and private veterinarians were to begin taking samples at assembly yards and slaughter plants. PED and a similar condition, transmissible gastroenteritis (TGE), are reportable diseases in Alberta. No compensation is paid directly for dead pigs or other associated losses. Assistance will come from AgriStability to cover loss of income, and Growing Forward 2 can fund

improved biosecurity measures. Moving western feeder cattle to Ontario is an area of concern. Trailers are scraped out after unloading but may not be washed. The trucker may then pick up cull sows in Ontario and deliver them to U.S. processors, where there is PED contamination. That truck may or may not be scraped and washed before it comes back west. “These transporters are unquestionably coming into contact with PED virus at multiple points and present a very real risk to the Canadian swine herd,” said swine veterinarian Egan Brockhoff of Prairie Swine Health Services in Red Deer.

» CRUSHING SQUEEZE: The low prices that oil

crushers are offering angers canola growers. 6

» HERD EXPANSION: Cattle producers have been slow to expand their herds.

8

FARM LIVING 19

» BOYS WITH TOYS: Farm toy collecting brings out the little boy in farmers of all ages.

19

» ON THE FARM: Succession planning is on hold on this Saskatchewan farm.

20

PRODUCTION 82

» AUSSIE WEEDS: Aussie farmers burn, bale and smash weeds to fight resistance.

82

» SPRAYER TECHNOLOGY: Farmers are still

using spray technology from the 1950s. 84

LIVESTOCK 88 FOR RELATED STORIES, SEE PAGES 3 & 90

»

» ERGOT WARNING: Cattle producers are

A story on page 82 of the Jan. 23 issue, regarding Prairie Agricultural Machinery Institute ear tag research, incorrectly stated that RFID ear tags subjected to freezing are permanently weakened. The PAMI study found tag retention and strength are reduced if the tags are frozen at time of insertion. The study confirmed the importance of keeping tags warm when inserting them. A recipe in the Jan. 30 issue for lemon lentil soup duplicated the ingredient list. To see the correct recipe, visit www.producer.com/?p=120266.

» TIMED AI: Benefits abound when using timed artificial insemination.

89

AGFINANCE 92

» RAILWAY PROFIT: Grain plays a role in record railway earnings.

» CROWD FUNDING: A prairie paper company uses crowd funding to raise capital.

Subscriptions Ph: 800-667-6929 Advertising Ph: 800-667-7770 Newsroom inquiries: 306-665-3544 Newsroom fax: 306-934-2401 Shaun Jessome, Publisher Ph: 306-665-9625 shaun.jessome@producer.com Joanne Paulson, Editor Ph: 306-665-3537 newsroom@producer.com Michael Raine, Managing Editor Ph: 306-665-3592 michael.raine@producer.com Terry Fries, News Editor Ph: 306-665-3538 newsroom@producer.com Paul Yanko, Website Ph: 306-665-3591 paul.yanko@producer.com Barbara Duckworth, Calgary Ph: 403-291-2990 barbara.duckworth@producer.com Mary MacArthur, Camrose Ph: 780-672-8589 mary.macarthur@producer.com Barb Glen, Lethbridge Ph: 403-942-2214 barb.glen@producer.com

Ed White, Winnipeg Ph: 204-943-6294 ed.white@producer.com Ron Lyseng, Winnipeg Ph: 204-654-1889 ron.lyseng@producer.com

92 93

10 11 11 7 93 91 21

CONTACTS

Karen Briere, Regina Ph: 306-359-0841 karen.briere@producer.com

urged to watch for ergot contamination. 88

Correction

92 45 44 9 94 10 12 20 95

Robert Arnason, Brandon Ph: 204-726-9463 robert.arnason@producer.com

With 8% more yield than other inoculants, it makes a welcome addition to any operation. To find out more, visit agsolutions.ca/nodulatorxl


NEWS

THE WESTERN PRODUCER | WWW.PRODUCER.COM | FEBRUARY 6, 2014

CHAMPIONS STRUT THEIR STUFF

3

HOG VIRUS | PREVENTION

Vaccine not fully effective against disease targeting piglets BY BARBARA DUCKWORTH CALGARY BUREAU

Horse pull champions Nic, left, and JR, owned by Kim Hewalo of Pilot Butte, Sask., worked hard for three hours pulling wagons of festival goers at Montmartre’s Fire and Ice Festival on Jan. 25. | CHRISTALEE FROESE PHOTO

SEEDING | FERTILIZER

Nitrogen fertilizer shortage looms Tight supplies on hand | Lowered North American prices reduced nitrogen imports BY SEAN PRATT SASKATOON NEWSROOM

Growers in Western Canada could be facing a nitrogen fertilizer shortage this spring. “It’s probably not time to press the panic button, but in terms of nitrogen, it’s getting tight,” said Brian Kenyon, director of sales and marketing for Yara. He has polled growers at various meetings and events, and nobody is indicating they intend to apply less nitrogen fertilizer this spring than they did last year. “The odds of us being able to move the volumes that the farmers are talking about are very low, but it’s January,” said Kenyon. Canadian urea shipments were down 22 percent during the July to September period last year, according to Statistics Canada. The situation hasn’t improved much in the second quarter, based on Yara’s sales. Western Canadian shipments were way down in October and November, and Kenyon doesn’t expect big December numbers either. He said the lackluster demand is the result of growers waiting for prices to fall and a lack of on-farm storage because of last year’s large harvest and poor grain movement. Statistics Canada will release official numbers for the second quarter Feb. 15. Kenyon said there would have to be record shipments every month for the last half of the fertilizer marketing year to make up for the first

half deficit. “I don’t see how we can possibly hit the urea volumes that we did last year,” he said. Richard Downey, a spokesperson for Agrium Inc., agreed with that assessment. “You’ve seen urea prices go up globally and in North America because I think there’s a view generally across North America that the import levels were fairly weak earlier in the year, and there is some concern that urea inventories within North America aren’t where they need to be for the spring,” he said. The urea price in New Orleans, Louisiana, (NOLA) recently peaked at $420 (US) per short ton, up from $285 in the fall. The NOLA price was below the world price in October and November because of limited fall fertilizer demand in the U.S. due to the late harvest, which prevented regular fall field work. The dismal North American price reduced the amount of imported nitrogen fertilizer coming into the United States, causing a supply shortage that was exacerbated by production problems at North American manufacturing facilities. What little product that was available was snapped up by winter wheat growers in Texas, who had decent moisture for the first time in years and wanted to top-dress their crops. The shortfall led to a run-up in NOLA prices to the point where imports are once again coming into the market. However, it could be a case of too little, too late.

“That’s a pretty common perception, that inventories are going to be fairly tight as we head into spring here,” said Downey. Prices are reaching the point where companies are considering importing product into Western Canada to help offset the growing nitrogen fertilizer deficit. “The prices are going to stay high because we need imports to come in here now because there isn’t enough product based on traditional shipping patterns,” said Kenyon. He estimates 100,000 to 200,000 tonnes of nitrogen fertilizer production has been lost because of unscheduled plant shutdowns. Western Canada exports 1.3 to 1.6 million tonnes of urea to the U.S. annually. Some growers wonder why fertilizer companies don’t just stop those exports and redirect the supplies to Canadian farmers. Kenyon said he can’t abandon his U.S. customers, but he can bring in product from the U.S. “I’m trying to figure out, can we do it? Can we bring in production to offset some of our production issues?” It will depend on whether growers are willing to pay a premium for imported product. “They may not like the price that they have to pay, but that’s the price you pay for waiting, and I think that’s probably what is going to happen this year,” he said. Crop prices are down, but Kenyon said last year’s large crop depleted soil nutrients. “You don’t really have to soil test to know that when you remove one-

and-a-half times the normal crop, that you probably have depleted the soil of a lot of the nutrients,” he said. Ken Greer, president of Western Ag Professional Agronomy, said that’s not necessarily true because nitrogen is stored and released every year by organic matter in the soil. “Anywhere from 10 to 70 pounds of nitrogen can be supplied from the organic matter. It’s totally possible,” he said. Growers who decide to apply nitrogen will want to keep an eye on U.S. corn planting intentions. At one time analysts were forecasting 90 million acres, down from 95 million acres last year. It would represent a one million tonne decline in nitrogen fertilizer demand if all the nitrogen applied was urea, said Kenyon. However, analysts are now suggesting that U.S. growers could plant 93 million acres or more of corn. As well, there could be a fair amount of pentup demand in the U.S. because many growers didn’t apply fertilizer in the fall due to the late harvest, which could add to the Canadian supply shortage. Kenyon said an early spring would also exacerbate a supply deficit in Western Canada. The good news is there is plenty of time to address at least a portion of the growing shortfall, and growers who miss applying nitrogen in the spring can always top-dress the crop when fertilizer supplies are more readily available. “I don’t think you’re sacrificing a lot of yield for doing that,” said Kenyon.

Pig farms are vulnerable to a host of nasty viruses, but in the case of porcine epidemic diarrhea, no immunity develops after the disease strikes. Transmissible gastroenteritis, similar to PED, is found on many farms but it does not provide immunity to PED, said Egan Brockhoff of Prairie Swine Health Services in Red Deer. “It is a devastating virus to young pigs and it will be a devastating virus to the pork industry and an individual pig farm,” he said in a teleconference Jan. 31. Farms in the United States that had PED are now seeing recurring outbreaks. Fifteen to 20 percent of the U.S. pork industry has been affected, and more than 100 new cases were reported in recent weeks. About three million pigs have been affected. “All reports indicate this virus will continue to spread, and it is not slowing down,” he said. Infection of a naïve sow herd results in an acute outbreak of severe vomiting and diarrhea in most, if not all, pigs on the farm. Mortality is variable, depending on age, but it often kills all the young pigs. The disease takes two to four days to incubate, but there are cases where young pigs were sick within 24 hours. Grow-to-finish pigs can get the disease, but the symptoms are more subtle and mortalities are lower. Mature animals will start to develop immunity within three weeks, but they are still susceptible. The Canadian Food Inspection Agency will issue emergency permits so veterinarians can import a vaccine from the U. S. The vaccine does not provide full immunity, said Brockhoff. “Vaccination certainly will not prevent infection of your herd with PED virus,” he said. “A vaccine may help reduce the impact of the disease or may help minimize the risk of a herd becoming endemically infected.” It has not been given to uninfected herds in the U.S. There may be less viral shedding and infection among mature pigs after vaccination, but it will not protect young ones. Suckling pigs from vaccinated sows will have no resistance, and mortality will be the same. A vaccine is not a replacement for diligent biosecurity efforts, Brockhoff said. A mild form of PED was first discovered in Europe in the 1970s, and it appeared in Asia in the early 1980s. The disease evolved into a more virulent form once it established in Asia, and it arrived in the U.S. in May 2013. The strain found in the U.S. and Ontario is the same as the virus circulating in China. “It is more infectious and more dangerous than what we see in Europe,” he said. FOR MORE ON THE PED VACCINE, SEE PAGE 90

»


4

FEBRUARY 6, 2014 | WWW.PRODUCER.COM | THE WESTERN PRODUCER

NEWS

U.S. COUNTRY-OF-ORIGIN LABELLING | WTO VIOLATIONS

U.S. cattle industry fears retaliation over COOL Amendments not made | Congress passed the farm bill retaining COOL which opens the door for Canada to impose tariffs BY BARBARA DUCKWORTH CALGARY BUREAU

U.S. livestock groups and manufacturers fear punishing tariffs if the country-of-origin labelling law continues in its present form. Hopes faded that the law could be changed in the 2014 U.S. farm bill when the House of Representatives passed the Agricultural Act of 2014 with a vote of 251 to 166. The Senate is also expected to pass it. The National Cattlemen’s Beef Association said it was disappointed that Congress passed the bill without the requested amendments, which would have made the program compliant under World Trade Organization rules. The NCBA, the National Pork Producers Council (NPPC) and the National Association of Manufacturers were urging politicians not to pass the bill until changes were made.

SCOTT GEORGE NCBA PRESIDENT

“We are also concerned the conference report does not address mandatory country-of-origin labelling to find a WTO-compliant resolution so our cattle producers are not left with retaliation from two of our largest export markets for U.S. beef,” NCBA president Scott George said in a statement Jan. 30. A WTO appeal will be heard the week of Feb. 18 in Geneva to decide if the latest version of the COOL law is compliant. An appeal to that decision is also possible. Canada and Mexico won the first

challenge against the law in 2012 and threatened tariffs if changes were not made. The U.S. Department of Agriculture did make changes, but the two countries claim they are worse than before. Canada could be allowed to start imposing retaliatory tariffs by 2015. Mexico is also planning tariffs. Canada could impose tariffs on U.S. products that include live animals, beef, pork, furniture, alcohol and spirits, baked goods and fruits. An arbiter will decide later in the year what may be included on the list and what level of duty may be applied. “We have had a negative ruling at the WTO, and we are very concerned about our export markets,” said NPPC president Randy Spronk said in a teleconference call Jan. 28. “Mexico is our No. 1 volume export market, and if they retaliate against

us it will be costly,” he said. “We are looking for a full repeal of the country-of-origin law.” A 20 percent tariff that Mexico placed on 99 U.S. pork products when the United States violated trucking regulations cost the industry $2.4 billion. Exports to Mexico fell ,and Canada filled in the gap. “If country-of-origin isn’t fixed … pork producers like me will suffer, as will dozens of other U.S. businesses,” said Spronk. The U.S. National Farmers Union and consumer groups support COOL, saying it offers more choice for consumers. However, the NCBA worries that producers do not understand the full implications of forcing packers to handle more paperwork and segregate animals from the time they arrive at the plant until the final beef products are packed.

George said those added costs are passed back to cattle producers. “Unfortunately, we have a number of producers in this country who do not understand the costs coming to them today,” he said. “Some say it is only a packer problem. It is not a packer problem. It is a producer problem in the beef sector.” George worries that more costs incurred at the processing level will force more feedlots and packers to close. The costs come from setting aside scheduled slaughter dates for imported livestock, sorting and segregating carcasses and packages and increasing storage to keep the products separate. It is estimated that COOL has cost the Canadian cattle industry $1 billion per year since 2008. A Canadian Pork Council study placed the total export losses at nearly $2 billion by the end of 2012.

HI HO, HI HO, TO THE WATERING HOLE WE GO …

The replacement yearling heifers at the Trask Ranch in northeastern British Columbia get plenty of exercise as they travel about a half mile to get water from the creek. The heifers were feeling frisky during a week of mild temperatures and sunshine. | JOAN TRASK PHOTO

RAIL TRANSPARENCY | DELIVERY STATS

Railways now required to supply car movement info weekly BY ED WHITE WINNIPEG BUREAU

WINNIPEG — The federal government is now requiring the railways to release week-by-week statistics on rail car deliveries and movement. The measure was immediately greeted with pleasure by farmers and shippers, including the Inland Terminals Association of Canada. “Work is being done to make things better,” ITAC chair Eric Ponath said after a meeting with agriculture minister Gerry Ritz Feb. 3. “Any time you take steps to have more transparency and to bring things more into the open so that everybody understands and knows what’s going on, it usually leads to some sort of concrete improvement.” Ritz said railways will be required to

release data on crucial rail car orders, delivery, unloads and rail car fleet size, broken down on a week-by-week basis and reported monthly rather than the present system of quarterly reporting. Grain companies and other parts of the grain transportation system will also have to reveal rail car order and movement data. “Our government knows that action is needed now and in the long term,” Ritz said at a news conference. Terminal unload numbers, western Canadian rail grain traffic to Eastern Canada, the United States and Mexico, and containers shipped to port will all be collected and provided. Ritz said the railways are expected to deliver the rail cars that shippers order. They need to show how well they have done and be able to explain failures to supply all cars requested.

GERRY RITZ FEDERAL AG MINISTER

“It really doesn’t reflect the reality of the new reality,” Ritz said about how the railways communicate rail car availability to grain companies. He said he believes the railways will be willing to co-operate. “They have alluded that they can do better,” said Ritz. However, if they don’t, “government always has the ability to regulate.” Grain movement far beneath the levels needed to clear the 2013-14 crop is vexing farmers and grain com-

panies. Farmers often can’t move grain off their farms at all, and if they can, it is only by paying massive basis levels. Grain companies are finding they can’t get grain to port or to buyers, even with existing sales. Saskatchewan agriculture minister Lyle Stewart said he was glad to see Ritz move on the issue. “It’s a serious situation for everyone.” Less than two weeks before the Feb. 3 weekly reporting announcement, Ritz was in Winnipeg to announce the beginning of a five-year study of the crop logistics system. Many farmers and shippers said a long-term study, planned before the present congestion crisis, was insufficient to resolve the problems. It was the early recommendations of the Crop Logistics Working Group that has just begun the study that led

to the beefed-up reporting requirements, Ritz said. “Our common goal is a more transparent system so that all participants in the supply chain, especially farmers, have the information they need to make the right decision for their businesses and the overall economy.” Ponath said farmers should be relieved by the announcement. “Our organization is willing and looking forward to working alongside all the stakeholders to find a solution to this problem.” The railways said they are studying Ritz’s announcement.

Visit us online at www.producer.com to see a video about this story.


NEWS

THE WESTERN PRODUCER | WWW.PRODUCER.COM | FEBRUARY 6, 2014

5

FARMTECH | SEED QUALITY

Seed cleaning plants play a quiet but important role Farmer-owned co-ops are still a part of community BY MARY MACARTHUR CAMROSE BUREAU

EDMONTON — Seed cleaning plants are just like the grinders in a hockey game: not flashy, often under-appreciated but very important. Alberta’s 69 seed cleaning plants cleaned 36 million bushels of grain last year, said Ron Wirsta, manager of the St. Paul Seed Cleaning Plant and a member of the Association of Alberta Co-op Seed Cleaning Plants. “We keep good seed going in the ground,” he said. “Your local seed plant plays an important role to crop improvement through the prevention and control of weeds and commercially applied seed treatments.” Seed cleaning plants were first established in Alberta 61 years ago to help producers plant the best crop possible. The cleaning facilities have grown and changed since then, but they are still farmer-owned co-operatives, one of the few remaining farmer co-operatives in the province, he told FarmTech 2014. In some places, they’re also the only businesses remaining in the rural community, he said. Not all plants have modernized and expanded, but six of them clean more than one million bushels each. They clean seed to pedigreed standards, treat seed and clean dockage from grain to increase grade. Wirsta said some plants have started selling seed, feed, chemical and fertilizer to stay competitive. Many have renovated over the last six years and installed colour sorters to help farmers boost grades, he added. These renovations have included more than $100 million in technology and building upgrades. Don Boles, a director with the Three Hills Seed Cleaning plant, said the facility plays a vital role in his community, particularly as other towns shrink. “It helps make the town more vibrant.”

New breeding techniques are expected to accelerate yield gains in future wheat varieties. |

FILE PHOTO

FARMTECH | RESEARCH

Private sector pivotal in wheat’s future Variety development | Breeders need greater royalties as incentive, says wheat commission chair BY MARY MACARTHUR CAMROSE BUREAU

EDMONTON — Farmers need to discuss ways to increase investment in wheat research so they retain the cereal as a viable crop. Kent Erickson, chair of the Alberta Wheat Commission, said they must start asking themselves if more producer involvement is needed, if they want to own plant breeding programs or facilities and what role Agriculture Canada should play in future plant breeding. “We need private industry, public and producers to step up if we want to advance cereals in Canada,” he told a meeting during FarmTech, held Jan. 28-30 in Edmonton. He said canola has been profitable for farmers, and they need to look closely at that model for possible ideas. Erickson said more than $300 million of the $1 billion in canola seed sales in Canada goes back into

plant breeding. With cereals, 90 percent of seeded acres are public varieties through conventional breeding, and little is returned to the plant breeder for new innovation. Agriculture Canada invests $22 to $25 million in variety development with only $5 million returned in royalties. “What private farm would invest in a business plan with that type of return,” Erickson said. Simon Phillips, a plant breeder with Syngenta, said the company is the largest cereal breeder in the world and wants to continue to develop new wheat varieties. “There are 550 million acres of wheat worldwide. It is a very important crop,” he said. Phillips said a partnership between private breeders, public breeders and producers is working in other countries. For example, public breeders in the United Kingdom do a lot of pre-

breeding research, looking for traits and germplasm. The private companies use the germplasm in their crop development programs. “You need better varieties going forward,” he said. “You need the right quality of products going forward. You’ve got an incredible name in Canada for your high quality spring wheat. You need to keep this, but maybe not 80 percent of your crop needs to be that.” Phillips said more money needs to be spent to get better plant varieties in Canada. Syngenta has increased spending in Canada considerably over the past three years, he added. “We believe in the future.” Phillips said the company is working intensively on hybrid wheat, which is one of the ways it believes it can improve yields and introduce new traits. Conventional plant breeding in most countries increases yields three-quarters to one percent a year.

New breeding techniques have dramatically reduced the amount of time it takes to pinpoint traits and bring them to commercialization. He said his company’s hybrid winter barley increased yields 15 to 18 percent in Europe. “We were able to bring up the average yield across the entire field. That is what a hybrid can do. That is what hybrids can do in corn and soy.” Neil Gorda, who farms near Willingdon, Alta., said he is worried that turning cereal plant breeding over to private researchers will eliminate any involvement with public breeders. “That does concern me. Can we overcome that problem today and in the future?” he said. “As a farmer, as Canadians, we get more value for farmers if plant breeding is fully funding and a public institution.” Erickson said producers have an obligation to put money into seed research. “We’re going to have to try and find some way of returning investment.”

FARMTECH | HEALTH

Grain industry mobilizes to debunk persistent anti-wheat claims Promotional effort | Healthy Grains Institute says more funds are required to educate public BY MARY MACARTHUR CAMROSE BUREAU

EDMONTON — Farmers need to arm themselves with facts and defend their industry against bogus anti-wheat claims, said Christine Lowry, a nutrition and policy adviser with the Healthy Grains Institute. “We think having the farmer give the message may be the most acceptable way for the consumer to accept it,” she said. Industry associations established the institute a little more than a year

ago to help debunk anti-grain myths. “We want to help inform and educate Canadians on the health benefits of whole grain,” Lowry said. “We want to balance the conversation.” The institute has developed fact sheets that debunk myths and quote credible scientists. Contrary to the anti-wheat messages that are circulating, Lowry said whole grains help lower the risk of heart disease, regulate diabetes and reduce colorectal and pancreatic cancer.

Studies show weight gain and increased abdominal fat are lower in people who eat more whole grains. However, it will be difficult for farmers to defend their industry unless they know the facts and can argue logically. Lowry said more money and people are required to spread the message. “We want to be seen as the authority and expert and go-to organization for grain,” she said. Spencer Hilton of Strathmore, Alta., said farmers need to help

defend their industry against the myths. “We have a vested interest in cereal production in Canada,” he said. “We can no longer ignore this thing anymore. We have to get engaged and defend our industry.” Hilton said grain and chemical companies that spend money on big social events for farmers should redirect it to the institute to help defend the industry. “Farmers need the background facts to defend the industry,” he said. “We need to get farmers educated and ready for this debate.”

The Healthy Grains Institute says consumption of cereal crops can reduce the risk of heart disease and other ailments. | FILE PHOTO


6

FEBRUARY 6, 2014 | WWW.PRODUCER.COM | THE WESTERN PRODUCER

www.secan.com

MARKETS

NEW

AC Carberry CWRS Wheat ®

Strong straw. MR to FHB. ‘AC’ is an official mark used under license from Agriculture & Agri-Food Canada

M A RKE T S EDIT O R : D ’ A R C E M C M ILLAN | P h : 306- 665- 3519 F: 306- 934-2401 | E-MAIL: DARC E.M C M ILLAN @PRODUC ER.C OM | TWITTE R : @ D AR CE MCMILLAN

CANOLA | PRICE, VOLUME

Rail jam blamed for tepid crush pace Slow start last fall | Growers are annoyed with low prices being offered, saying crusher profits are excessive BY SEAN PRATT SASKATOON NEWSROOM

Canola farmers are disappointed with the prices they are receiving for their seed at crush plants and the volumes running through those facilities. Members of the Canadian Oilseed Processors Association (COPA) had processed 3.36 million tonnes of canola as of Jan. 29, down from the previous year’s pace of 3.58 million tonnes. Although processing is profitable, crush capacity use is 80 percent yearto-date compared to 89 percent at the same time in 2012-13. Producers wonder how that can be the case in a year when there is more than ample seed supply. Farmers grew four million tonnes more canola than the previous year and exports are running 561,000 tonnes below last year’s pace. COPA executive director Jim Everson said it is because the year got off to a slow start. Crush volumes in August and September were down considerably compared to a year ago. “Seed was in pretty tight supply from the (previous) crop year earlier on. Mostly that was the issue,” he said. Crush volumes picked up in November and December and were on pace with the previous year for those two months. However, a look at January’s weekly crush reports shows that crush capacity use has been about 75 to 80 percent for most of the month. “ Th e c u r re nt t ra n s p o r t at i o n issues are likely a factor. I wouldn’t want to say much more than that,” said Everson.

Seed shortage at the start of the crop year slowed the canola crush, but the industry still is not operating close to capacity even though crush margins are strong and seed supply is ample. | FILE PHOTO The oil and meal produced by Western Canada’s crush facilities travels to export markets primarily by rail. He said crushers are facing the

same difficulties and frustrations as grain shippers trying to get their product moved down clogged rail lines.

“The industry is crushing what it can under the circumstances, and I think transportation is part of those circumstances,” said Everson.

Crush volumes aren’t the only thing that growers are angry about. Doug Chorney, president of Keystone Agricultural Producers, spoke to a number of farmers at Manitoba Ag Days who felt they are being exploited by crushers. “(Crushers) have lowered the price of canola that they’re buying at the facilities within Western Canada to reflect the export price, and we know that the oil and meal prices are still high, so the crush margins are excessive right now,” he said. Canola crush margins are the highest in years. Norm Hall, president of the Agricultural Producers Association of Saskatchewan, agreed that crusher profits are excessive. “I’ve heard the crush margin is in that $160 to $180 per tonne (range). I guess the more normal level is closer to $50 to $60,” he said. “What it’s reflecting is the crushers being able to increase their margin at will because there’s so much canola out there, producers are willing to move it at lower prices because there’s such slow cash flow on other products.” Everson didn’t want to talk about crusher margins. “It’s best we just stay out of that,” he said. “I can’t comment on the pricing.” Chorney said crushers are playing a dangerous game with growers that could come back to haunt them. “I would send out a warning to processors that this is not a good way to forge relationships with farmers,” he said. “People will be reluctant to work with them in the future if they feel they take advantage of them in times when they can be opportunistic.”

GRAIN MOVEMENT | MARKETING

Huge carryover will be headache until 2015 CWB market analyst is particularly worried that large domestic and international oilseed supply could sink canola prices BY SEAN PRATT SASKATOON NEWSROOM

Prairie farmers will feel the reverberations of last year’s large crop and the inability to move it well beyond this crop year, according to two new forecasts. There has been plenty of talk about the looming carryout at the end of 2013-14, but it’s the following year that worries Neil Townsend, director of CWB Market Research. In its latest supply and disposition report, Agriculture Canada is esti-

mating 19.8 million tonnes of total grains and oilseeds carryout in 2014-15. It would be the second largest ending stocks since Agriculture Canada first started producing the

reports in 1982-83. The only year that would beat it is the current marketing year, based on the estimate for 22 million tonnes of ending stocks in 2013-14. Townsend has produced a similarly

depressing outlook for 2014-15, even though he doesn’t usually look that far into the future at this time of year. “The reason why I did that is that it shows the extent of the problem,” he said.

MARKET ANALYST SAYS IN 2013 FARMERS GREW A

30-month crop

“It shows we’re still going to be exporting 2013-14 (crop) next year.” In fact, this year’s oversupply issue could weigh on markets beyond 2014-15. “Originally, I said we grew an 18-month crop. Now I’d say we probably grew a 24-month crop in terms of getting it worked through the system,” he said. “When you add in the export problems, it’s like now we’ve grown a 30-month crop.” CONTINUED ON NEXT PAGE


MARKETS CONTINUED FROM PREVIOUS PAGE

Townsend’s carryout numbers are based on ambitious export estimates, given the current logjam in getting grain to the West Coast. “Any missed export slots because they don’t have the right grain out there or because they don’t have enough grain out there is going to add to the bottom line of those ending stocks numbers,” he said. Recent weekly export numbers supplied by the Canadian Grain Commission make him increasingly nervous about the burdensome supply. “The cumulative total is barely budging over the last little while from the West Coast.” Townsend is forecasting 2.7 million tonnes of canola carryout in 2014-15, which is close to Agriculture Canada’s three million tonne estimate. Townsend expects 11.8 million tonnes of all wheat ending stocks next crop year, which is well above the government estimate of 7.9 million tonnes. He is projecting 2.9 million tonnes of barley carryout, which is quite a bit higher than Agriculture Canada’s 1.8 million tonnes. Agriculture Canada also released its first acreage estimates for 2014. Canola leads the way, claiming 21.6 million acres of farmland, up eight percent from last year’s levels. Townsend has penciled in 19.5 million acres, but he thinks there is considerable upside potential because canola prices haven’t fallen as much as wheat prices. He was struck by how ever y grower he polled at winter meetings said they intend to grow canola again this year. “One thing you’ve got to be scared about is that (farmers) might plant more canola than they’ve ever planted in their lives,” said Townsend. It’s partly why he is most bearish about the oilseed complex. Other factors include the potential for a massive South American soybean harvest, big soybean acres seeded in the United States and the distinct possibility that China will back out of previously announced soybean purchases from the U.S. “That tail-end of the canola is going to be pretty ugly, so if you are planting canola because you like today’s futures prices relative to today’s wheat prices, well you better make sure you have today’s canola prices locked in,” said Townsend. Agriculture Canada is forecasting 23.8 million acres of all wheat, down five percent from last year. Townsend believes it will be a slightly bigger crop of 24.4 million acres, but he agreed wheat is languishing. “It looks like a dog and it’s behaving like a dog and people are looking for alternative choices,” he said. Canada wasn’t the only big wheat producer last year. Russia recently sold 180,000 tonnes to Egypt. “The last Black Sea region wheat to be sold to Egypt last marketing year happened in October. This year they’re still selling in January and selling in quantity in January.” “We think there is a good chance in 2014-15 that wheat prices go below $5 a bushel on the futures side.” Agriculture Canada is forecasting a seven percent increase in pulse and special crops acreage, while Townsend expects soybean acres to “go through the roof ” in Manitoba.

THE WESTERN PRODUCER | WWW.PRODUCER.COM | FEBRUARY 6, 2014

7

AG ECONOMICS | TALLYING THE NUMBERS

Cost control is order of the day Pencil in the numbers | It will take skill to cover even variable costs, says management specialist BY ED WHITE WINNIPEG BUREAU

BRANDON — Making a profit on crops grown this year is going to be a challenge, according to Manitoba Agriculture analysis. All the main crops will lose money when all costs, including fixed costs, are considered, based on average yields, average total costs and the new crop market outlook. “Biggest take-home: could be a tough year,” Manitoba Agriculture farm management specialist Gary Smart said in a presentation at Manitoba Ag Days. Smart’s calculations, which look at western Manitoba, show that an average yielding crop will provide profits over operating costs. Operating costs include inputs such as seed, fertilizer and fuel. Winter wheat, which is already in the ground,will make a farmer with average yields and operating costs about $163 per acre. That’s a huge advantage over the next best crop, oilseed sunflowers, which produce an operating return of $98 per acre. Other expected returns include Nexera canola at $83, oats at $77, soybeans at $71, InVigor at $61, spring wheat at $60 and barley at less than $3 per acre. However, everything slips into the red when fixed costs such as machinery and land are added. Winter wheat loses $2.77 per acre, Nexera loses $79, oilseed sunflowers lose $83, oats lose $89, soybeans lose $92, InVigor loses $100, spring wheat loses $102, and barley loses $160. Smart said this sobering outlook means farmers need to focus on cost control and careful decisionmaking. “Planning’s going to be important,” said Smart. “Budgeting is going to be important.” It is too late to use some return

Farmers should keep an eagle eye on expenses such as fertilizer and seed this year. Current price forecasts and average yields will produce modest returns over operating costs, but fail to cover fixed costs. | FILE PHOTO

TOUGH CALL

Planning’s going to be important. Budgeting is going to be important. GARY SMART MANITOBA AGRICULTURE

maximization strategies this year, but they are worth noting for future years because high profits don’t appear to be coming back soon. Smart said fertilizer comprises 30 percent of a crop’s operating costs, so trying to price fertilizer well can be as important as pricing the crop well. Fertilizer is often cheapest in the fall, so farmers should at least think about their fertilizer plan soon after the last crop is off the field. Smart acknowledged that some

Based on average yields, average costs and present new crop prices, Manitoba Agriculture can’t find any major crop that will produce a profit over total costs for 2014-15. Returns over costs for Western Manitoba, 2014 ($/acre): average yields price returns over returns over (bu./acre) ($/bu.) operating costs total expenses Winter wheat Oil sunflower Nexera canola Oats Soybeans InVigor canola Red spring wheat Barley

71.8 1,385 lb. 34.6 101.2 28.0 36.4 52.0 68.0

$4.84 0.22/lb. 9.47 2.23 9.13 8.55 4.71 2.57

$163.11 98.34 83.34 77.38 71.21 61.56 60.29 2.57

-$2.77 -79.16 -83.22 -89.55 -92.50 -100.93 -102.77 -160.31

Source: Manitoba Agriculture | MICHELLE HOULDEN GRAPHIC

farmers can make well above average yields, and good growing conditions can add bushels that would substantially change the result.

However, long term averages and normal conditions should be assumed for planning.

WP VIDEO | LATEST AND GREATEST AG NEWS

Forget cartoons; weekends are for Producer video MARKET WATCH

D’ARCE McMILLAN

I

n addition to trying to provide the best agricultural news and information in print, online and in social media and email reports, we at The Western Producer are beginning to produce video content.

We’ve had videos on Producer.com for several months, most of them focused on agricultural machinery and farm life. In the last couple of weeks we’ve starting producing a weekly news and market information wrap-up in a format similar to a TV newscast. Managing editor Mike Raine and I are the hosts, and Robin Booker provides the technical assistance. We bring all the smooth presentation, good looks and sex appeal that print reporters are famous for. Actually, we look rather pasty and my grey hair fails to provide the air of authority I had hoped for, but we

believe we are providing information of value to western Canadian farmers. We review the factors influencing grain and livestock markets, update the agricultural news and give you a taste of some of the production and feature articles you can expect to read in the coming print edition. We record it on Friday and after editing, it’s posted on Producer.com. Our goal is to have it ready by Saturday morning. Our video and online content, supplemented by our Twitter and Facebook feeds, provide us with the opportunity to better connect with you on an up to the minute basis.

That is great for markets news. In the newspaper, we can provide detail, explanation and analysis of the big forces that drive market trends, but with Twitter, our daily web stories and video newscasts we can alert you to weather, crop reports and other daily factors you need to know to help keep on top of your marketing plan. So check out our video offerings and let us know what you think. If you have suggestions about what you’d like to see in the videos, email us at newsroom@producer.com. Follow D’Arce McMillan on Twitter @darcemcmillan.


8

MARKETS

FEBRUARY 6, 2014 | WWW.PRODUCER.COM | THE WESTERN PRODUCER

ALBERTA CATTLE FEEDERS ASSOCIATION | HERD OUTLOOK

Alta. cattle official hopes herd contraction over Beef prices soar | High beef prices and consumers’ demand for value are putting beef sales on the back burner BY BARBARA DUCKWORTH CALGARY BUREAU

LETHBRIGE — Brent Chaffee hopes the tumultuous times experienced during his tenure are over as he hands over the reins of the Alberta Cattle Feeders Association to a new administration. An increasing number of feedlots in North America have called it quits in recent years because of elusive profits. “There have been enough years with marginal returns that people tend to get out when there is not enough money in it,” Chaffee said in an interview at the association’s annual meeting in Lethbridge Jan. 22. Page Stuart of Highland Feeders at Vermilion replaced him as chair of the association after two years on the job. Canfax reports that Alberta feeds 70 percent of the country’s cattle. The number of feedlots with a capacity of 1,000 head or more has dropped to 164 in 2012 from 172 in 2011 and 186 in 2010. About a dozen lots have a capacity of 20,000 head or more. Feedlots in Alberta and Saskatchewan had 990,330 cattle on feed in January, down from slightly more than one million in December. “I hope the industry is done contracting,” Chaffee said. “Consolidation is not a bad thing if you get the right players involved moving the industry forward.” Record prices are being paid for all classes of cattle, yet few producers

are interested in expanding. U.S. fat cattle cash prices recently soared to a record $150 per hundredweight, but at some point consumers will not pay more for beef, agricultural economist Bill Mies of Texas A & M University told the International Livestock Congress in Denver, Colorado, Jan. 14. He said a chuck roast sells for $3.25

per pound at Sam’s Club, a U.S. members-only supermarket owned by Walmart , while pork loin is much cheaper at $2.16. “That chuck roast better eat like the best chuck roast you have ever eaten in your life or the next trip into Sam’s will be a pork loin going out the front door,” he said. Robin Murphy, the meat buyer for

HEB, a 300 store grocery chain in Texas, knows consumers are discerning and looking for variety, whether it is organic, antibiotic free, Certified Angus Beef or some other branded product. However, he also knows consumers have limited budgets. The company’s consumer tracking has found that a lower income family is willing to pay $5 for a package of

meat while a middle income family may pay $10 to $15. As well, consumers are just as likely to buy ground beef as they are fancier meat cuts. “A steak on the grill is not as prevalent as it used to be,” Murphy said. These societal changes are contributing to the stagnation of the cattle cycle, she added.

The North American cattle herd is the smallest in decades, and if herd expansion does not begin soon, there will be more consolidation in the feedlot and packing industries. | FILE PHOTO

U.S. HERD DECLINE | CHALLENGES

Aging producers, drought aftermath hinders expansion feeding byproducts. It is going to be a tough deal if we are going to keep occupancy rates that are profitable.” Packers understand this and are

LESS IS MORE The U.S. cattle herd has fallen to its smallest size in decades, but improved genetics and management practices have caused cattle to grow larger and produce more meat per animal. Total U.S. beef production has grown as the total number of cattle fell. These charts show U.S. herd statistics from 1953 to 2013.

1,337

1,247

1,192

1,077

1,058

Source: USDA | WP GRAPHIC

25.7

26.3

23.0

23.2

21.3

16.4

’63 ’73 ’83 ’93 ’03 ’13

96.1

’53

99.2

’63 ’73 ’83 ’93 ’03 ’13

115.0

’53

121.5

12.4

Total beef production (million lb.)

89.3

Inventory of all cattle (million head)

1,074

974

’63 ’73 ’83 ’93 ’03 ’13

747

’53

706

’63 ’73 ’83 ’93 ’03 ’13

637

’53

652

804

Live weight of all cattle slaughtered (per head, in lb.)

608

Carcass weight average of all cattle slaughtered (per head, in lb.)

104.5

The expansion phase of the U.S. cattle cycle is long overdue but a host of factors are working against herd rebuilding and are forcing segments of the industry to consolidate. The cattle cycle, where the herd expands and contracts at regular intervals of 10 to 12 years, has been in place since the end of the U.S. Civil War. The cycle drives cattle prices, with periods of low supply encouraging higher prices and oversupply pressuring the market low. However, the U.S. herd has been shrinking for 16 of the last 18 years. At times prices should have triggered expansion but they didn’t, said Gary Brester, a Montana State University agricultural economist. Part of it was a lack of extended profitability as cost rose as fast, or faster than cattle prices, squeezing every sector from the cow-calf producer to the processor. Little or no profit has resulted in continuing consolidation of feedlots and packing plants, said Meis. He thinks American feedlots have 25 percent more capacity than they need, and some must shut down. “We built those hotels when there were 130 million cows,” he said, but now the herd is much smaller.

“Until they downsize to fit the cow herd, our margins are going to be elusive. I don’t care what price corn is and I don’t care how good we are at

525

CALGARY BUREAU

94.2

BY BARB DUCKWORTH

downsizing. More closures are expected to match the available supply of slaughter animals. In past cattle cycles, rising prices encouraged people to breed more c ow s, b u t b e t t e r g e n e t i c s a n d improved management allow more meat production with fewer cattle. Today’s herd of 90 million head can produce the same amount of beef as 130 million head in previous decades. That cannot continue as numbers keep falling. Another factor that extended the U.S. herd decline this cycle was the multi year U.S. drought that damaged pastures in key cow-calf producing regions. Also, feedgrain prices soared with the drought and with increased demand from the growing ethanol sector. But moisture has improved, pastures are rebounding in some areas and corn prices are going down. However, the average rancher is getting older, and few want to work hard raising cattle. They also have a drought phobia. Meis said most American ranchers have low debt ratios on mature operations, partly because they did not expand their land base or add more cattle. When they saw their pastures burn off, they feared losing the entire farm if they restocked it when the grass started growing again.

Others face regulatory conflicts with the Environmental Protection Agency and the Bureau of Land Management, which handles federal grazing lands. Some ranchers have also sold land for housing developments. For those remaining, Meis predicts more will raise 100 cows instead of 30. As well, he predicts more consolidation, in which producers are professional beef producers rather than keeping a few cows on the side for diversification. Herd rebuilding looks feasible on paper this year, but it takes time to recover, said Derrell Peel of Oklahoma State University. He thinks the U.S. needs 1.8 million more cows to maintain production, but it could take until January 2017 to get there. Government statistics indicate that some heifers are being held back for breeding. Experience shows those reported on farms in January are gone by summer because the producers could not sustain them, he said. Other heifers were kept back to replace culled cows sold off when the drought hit. The beef supply is now showing the consequence of a shrinking herd. CONTINUED ON NEXT PAGE


MARKETS

THE WESTERN PRODUCER | WWW.PRODUCER.COM | FEBRUARY 6, 2014

9

CANFAX REPORT FED PRICES DOWN SLIGHTLY U.S. cash cattle prices fell from the record of about $150 US per hundredweight the previous week, and beef values also backed off. Packer competition was light in Canada, but the Canadian dollar traded at a 4 1/2 year low, which encouraged U.S. packer inquiries. Bids from the United States were reported at a premium over local trade, but no sales were confirmed. In light trade, steers averaged $139.78 Cdn per cwt., down $2.74. Rail grade trade in Alberta was around $237-$238 per cwt. delivered. Sale volumes were light. Feedlots are current in their marketing, and short-fed cattle are being marketed aggressively. Canadian steer carcass weights are down 36 pounds and heifer are down 31 lb. from last year. Weekly Canadian fed exports two weeks ago totalled 6,296 head, the largest export volume since mid-October. The Alberta-Nebraska cash-to-cash basis is the weakest since March 2007, which is encouraging exports of a little more than 6,000 head per week. Western Canadian fed slaughter topped 32,000 head the first time since the beginning of November. Cash-to-futures basis levels tend to weaken from January to February. Was the recent rally a short-term flash or is a new trading range developing? The market was getting toppy, but given snug North American fed supplies and weak basis levels in Canada, there is near term price support.

COW PRICES UP Large volumes of slaughter cows

were carried over into the new year, and many have been marketed at auction over the past couple of weeks. However, strong grind demand has maintained keen buyer interest. D1,2 prices were $75-$90 to average $81.92 per cwt., up $2. D3 cows were $65-$79 to average $71.60, up 67 cents. Rail grade bids were $163-$168 delivered. Butcher bulls were steady, averaging $88.95 per cwt. Weekly western Canadian non-fed slaughter to Jan. 25 rose three percent to 9,147 head. Weekly exports to Jan. 18 jumped to 10,569 head. Trade should ease following recent large volumes, which will support prices.

MOST FEEDERS JUMP HIGHER Feeder prices rose $1-$2 per cwt. on strong demand. The auction offering the past two weeks has been large for this time of year. Strong prices and co-operative weather flushed out more than twice the volume of the same period last year. However, stockers weighing 300-400 lb. saw prices fall $1.50-$2.50 on inconsistent supply. Solid, broad based buyer interest lifted 400-700 lb. calves $2- $2.75, and 700-800 lb. surged $2-$3.75. Feeders 800-900 lb. were mixed with steers $2.25 higher while similar weight heifers fell 75 cents. Large short keep steers heavier than 900 lb. jumped $4.60 higher, and comparable heifers rose 54 cents. The Alberta auction volume rose five percent to 45,918 head. Auction volume is up 70 percent at 120,602 head so far this calendar year. Weekly exports to Jan. 18

CONTINUED FROM PREVIOUS PAGE

Fewer yearlings and cows are available, so slaughter is dropping and less beef is produced every year. Ironically the first stage of rebuilding squeezes beef supply because females that would go to slaughter are held back for breeding. Other changes have hurt the industry. People switched from growing irrigated alfalfa to high priced corn. In addition, life was made easier for crop producers with the introduction of crop insurance. Nearly 90 percent of all principal crops grown in the United States are covered by crop insurance, up from 20 percent 30 years ago. This was not available for cattle producers. More crop insurance equals fewer cattle because people do not need to turn to livestock as a diversification strategy. The industry also wrestles with how to attract young people. Brester argues they will return if there is money to be made. However,

AG EXPO

attitudes about financing, land and equipment purchases must change so that young people learn the difference between asset control and ownership. In addition, older producers did not want to give up control until recently because there was no income to transfer to fund retirement. However, there is a growing number of ranchers 70 or older who want to move on, so intergenerational transfer may become more common.

LIMOGES SEED FARMS

Fusarium Free Seed AC Foremost CPS RED

CDC Austenson

North American Seed Fair

HIGH YIELDING FEED BARLEY

Feb. 26, 27 & 28 9 to 5 pm daily

Tel. 403 – 328 – 4491

U.S. boxed beef prices fell from last week’s record highs, with Choice down $7.14 at $230.75 US Jan 30 and

dle meats are generally in line with the U.S. Montreal wholesale prices for delivery this week increased to $227$229 per cwt. This cattle market information is selected from the weekly report from Canfax, a division of the Canadian Cattlemen’s Association. More market information, analysis and statistics are available by becoming a Canfax subscriber by calling 403275-5110 or at www.canfax.ca.

WP LIVESTOCK REPORT HOG PRICES STEADY U.S. hog prices varied little as cold weather and icy roads made transportation to packers difficult. Slaughter was affected by plant closures caused by bad weather. A larger Saturday slaughter was planned to make up for lost time during the week. Tyson Foods said the porcine epidemic diarrhea virus is expected to contribute to a two to four percent decrease in U.S. pork production this year. Iowa-southern Minnesota hogs delivered to packing plants sold at $60-$61 US per hundredweight Jan. 31, about steady with $60-$60.50 Jan. 24. The estimated pork cut-out value was $89.30 per cwt. Jan. 31, up from $88.11 Jan. 24. Estimated weekly U.S. slaughter to Feb. 1 was 2.132 million, down from

2.222 million in the previous week. Slaughter was 2.169 million last year in the same week.

BISON PRICES STEADY The Canadian Bison Association said Grade A bulls younger than 30 months in the desirable weight range were in balanced supply. Prices reached as high as $3.85 Cdn per pound hot hanging weight. Grade A heifers sold at prices up to $3.70. Cull cows fetched prices as high as $2.10 in limited trade. Animals outside the desirable buyer specifications may be discounted.

SHEEP MOSTLY STEADY Beaver Hill Auction in Tofield, Alta., reported 845 sheep and 79 goats sold Jan. 27. Wool lambs lighter than 70 lb. were $125-$164 per cwt., 70-85 lb. were

$135-$161, 86-105 lb. were $138$149 and 106 lb. and heavier were $134-$149. Wool rams were $45-$75 per cwt. Cull ewes were $45-$65 and bred ewes were $70-$135 per head. Hair lambs lighter than 70 lb. were $115-$149 per cwt., 70-85 lb. were $130-$155, 86-105 lb. were $130$146 and 106 lb. and heavier were $128-$135. Hair rams were $50-$70 per cwt. Cull ewes were $51-$90. Good kid goats lighter than 50 lb. were $160-$227.50. Those heavier than 50 lb. were $177.50-$227.50 per cwt. Nannies were $62.50-$87.50 per cwt. Billies were $95-$120. Ontario Stockyards Inc. reported 783 sheep and lambs and 74 goats traded Jan. 27. All classes of lambs sold steady to slightly higher on a light run. Sheep basically sold steady, except for fatter types. Goats were steady.

NITROGEN MISER Make Better Nitrogen Decisions for Your Unique Operation Nitrogen is an essential input for your crop. Are you putting enough thought into your nitrogen management plan? (QKDQFHGHIÀFLHQF\ IHUWLOL]HUV OLNH XUHD treated with AGROTAINŽ nitrogen VWDELOL]HU PD\ EH WKH EHVW ÀW IRU \RXU operation. Two common options are urea treated with AGROTAINŽ VWDELOL]HU DQG polymer-coated urea. There are several factors to consider when deciding between the two: Is seed safety a concern? If you are applying your nitrogen directly in-furrow with the seed, the polymer-coated nitrogen product may be a good choice. The nitrogen slowly diffuses through the SRO\PHUFRDWLQJPDNLQJDPPRQLDWR[LFity less of a concern. $UH \RX ORRNLQJ WR VSHHG XS VHHGLQJ and avoid the slow pace of using an air drill to apply your nitrogen? Consider a

0DUF'DY\ Manitoba 204.451.0536

Presented by Fortis Alberta

www.exhibitionpark.ca

BEEF FALLS FROM RECORDS

Select down $7.80 at $229.79. Weekly Canadian cut-out values to Jan. 25 were still rising with AAA up $12.53 at $236.97 Cdn per cwt. and AA up $10.39 at $233.47. The Canadian cutout was up 13-14 percent in the first four weeks of January, while the U.S. cutout was up 19-20 percent and the Canadian dollar weakened four percent. Consequently, Canadian cutouts are at a sharp discount to American prices. Most of the discounts are attributed to end meats, while mid-

à RDWHU DSSOLFDWLRQ RI XUHD WUHDWHG ZLWK AGROTAINŽVWDELOL]HU AGROTAINŽ VWDELOL]HU FDQ EH DSSOLHG to urea or added to urea ammonium nitrate (UAN) to reduce ammonia volatilL]DWLRQ DQG LPSURYH FURS XSWDNH DQG XWLOL]DWLRQRIWKHDSSOLHGQLWURJHQ 8WLOL]LQJ$*527$,1Ž VWDELOL]HU JLYHV \RX WKH à H[LELOLW\ WR PDQDJH \RXU WLPH PRUH HIÀFLHQWO\ %\ UHPRYLQJ WKH QLWURJHQ IURP \RXU DLU WDQN \RX FDQ VHHG more acres in a day, and apply urea treated with AGROTAINŽVWDELOL]HUZKHQLW¡V convenient. ,IVHHGLQJHIÀFLHQF\LVOHVVRIDFRQFHUQ side-banding nitrogen may be an effective option. However, if the bands at the time of seeding are shallow, new research LQGLFDWHV \RXU QLWURJHQ PD\ EH DW ULVN GXH WR YRODWLOL]DWLRQ 8UHD WUHDWHG ZLWK AGROTAINŽ VWDELOL]HU FDQ KHOS SURWHFW your nitrogen investment.

:DQWKHOSGHWHUPLQLQJLIDQHQKDQFHGHIĂ€FLHQF\IHUWLOL]HUSURGXFW LVULJKWIRU\RX"+DYHTXHVWLRQVIRUWKH1LWURJHQ0LVHU"

Presented by Farm Credit Canada

Lethbridge, Alberta

totalled 5,678 head, bringing the year’s total to 7,521. Feeding margins remain profitable and feedlot interest is again anticipated from both sides of the border. Interest in grass cattle has surfaced, and feeder competition could intensify.

Tom Barrie Saskatchewan 306.812.7343

Earl Greenhough Alberta 780.850.1679

Ž ™

Richard & Marcel Limoges

780-324-3024

Š2014 Koch Agronomic Services, LLC. All rights reserved. AGROTAINŽDQGWKH$*527$,1ORJRDUHWUDGHPDUNVRI.RFK$JURQRPLF6HUYLFHV //&7KH.RFKORJRLVDWUDGHPDUNRI.RFK,QGXVWULHV,QF:(67352


10

FEBRUARY 6, 2014 | WWW.PRODUCER.COM | THE WESTERN PRODUCER

WPEDITORIAL

OPINION

Editor: Joanne Paulson Phone: 306-665-3537 | Fax: 306-934-2401 E-Mail: joanne.paulson@producer.com

HOG INDUSTRY | COMMUNICATIONS

CRAIG’S VIEW

Kudos to Ontario Pork for fast PED response

F

arm groups, governments and agribusinesses should swipe a page from the communications book written by Ontario Pork and the Ontario Swine Health Advisory Board. When Canada’s first case of porcine epidemic diarrhea was diagnosed on an Ontario farm Jan. 22, the public learned about it Jan. 23, as close to immediately as possible. PED has been devastating the American pork industry since May 2013, to the tune of hundreds of millions of dollars. The virus viciously attacks piglets and can kill them in a matter of days. The Ontario pork organizations were ready for it. Because the virus was first found in Ontario, the Ontario organizations were the first to enact a strategy arrived at by pork organizations across the country, along with the Canadian Swine Health Board, all of whom deserve a pat on the back. The groups realized in the fall that it was only a matter of time before PED showed up in Canada, and they established a working group in November to come up with a protocol. Therefore, when the expected happened in January, the Ontario groups were prepared and implemented a communications strategy of “tell everyone right now.” Producers across the country have every reason to be grateful for the fast response. Compare it to the disastrous roll-out of information surrounding the E. coli found at XL Foods in 2012. In that case, several weeks passed before the Canadian public was told of the problem. XL Foods, which has since been sold to JBS, was slow in providing information to the Canadian Food Inspection Agency, but the CFIA was also not assertive enough in demanding and gathering the information. Ultimately, the closure of the plant created enormous hardship for cattle producers, who could not deliver animals there. The PED problem is not a human health

issue, as E. coli contamination is, so the CFIA is not involved to the same extent. PED is largely a business problem for pork producers, although it could also eventually evolve into a consumer problem if pork supplies plummet and prices rise. Yet Ontario Pork was able to jump on its arrival in Canada and tell the public about it within one day. The CFIA and XL Foods, despite the higher public stakes of E. coli illness, couldn’t pull that off in less than a few weeks. It was not heartening to hear federal agriculture minister Gerry Ritz declare that hog producers must look to provincial governments for help in combatting the potentially catastrophic swine disease. “This is a provincial issue,” said Ritz in the House of Commons six days after PED was found. “Having said that, CFIA stands ready to assist in any monitoring that is required.” CFIA readiness is likely not comforting to hog producers, since the agency has little to do with PED. Furthermore, PED should definitely be a national issue because its arrival in Canada was almost certainly borne on trucks coming in from the United States — across an international border monitored by border security, which is a federal jurisdiction. Meanwhile, while waiting for the federal government to do the right thing, provinces should follow Alberta’s lead and declare PED a reportable disease. It may not be a problem for human health, but it is crucial to animal health and farm economics and may affect food supply. Ontario Pork has ushered in a new era of accountability and transparency, which with any luck will rub off on the entire industry and governments. With a national strategy behind it, Ontario Pork should be commended for its vision, fast action and leadership. Bruce Dyck, Terry Fries, Barb Glen, D’Arce McMillan and Joanne Paulson collaborate in the writing of Western Producer editorials.

PED | MANAGEMENT

Vaccination certainly will not prevent infection of your herd with PED virus. A vaccine may help reduce the impact of the disease or may help minimize the risk of a herd becoming endemically infected.

PED is now endemic in the U.S.A. It is here to stay. I am wondering if Ontario is approaching that point. It is a risk that is here to stay so biosecurity must be for the long term because PED is not going to disappear.

EGAN BROCKHOFF

JULIA KEENLISIDE

PRAIRIE SWINE HEALTH SERVICES, RED DEER

ALBERTA AGRICULTURE VETERINARIAN

SENATE REFORM | PREDICTIONS

Senate’s fate remains solid despite years of treading on shaky ground NATIONAL VIEW

BARRY WILSON

S

poiler alert : if there are any precocious five-year-olds out there reading this column, the chances of significant Senate change during your lifetime are slim to none. But you would never imagine that listening to federal politicians make wild promises about changing one of the political institutions that has fascinated, enraged and bemused Canadians since it was sanctified by the British North America Act that

created Canada in 1867. Meaningful change is all but impossible, but more about that later. For context, it is useful to remember why the Senate was created and has endured, despite the best efforts of some senators over many decades to discredit it. In many ways, it was the promise that made the Confederation bargain possible and the glue that held it together despite periodic bouts of provincial discontent. Smaller provinces saw their constitutionally guaranteed allotment of Senate seats as a promise that their influence in the federal government would never become irrelevant. The appointed Senate was supposed to be a chamber of “sober second thought” that would ride herd over the excesses of democracy while making sure that regional and pro-

vincial interests were given voice. And of course, since the days of John A. Macdonald, prime ministers have seen the Senate as a way to reward their friends and party stalwarts and to strengthen their political power. Now, with Senate expense scandals afoot, with Senate intrigues as much an interest for police departments as political scientists and voters increasingly fed up with the Parliament Hill gong show, politicians are doing what politicians so often do — making promises they cannot keep. Prime minister Stephen Harper, once a Reform party Senate Triple E stalwart and now the prime minister with one of the longest lists of appointments in history, insists the Senate must reform, become elected or disappear. He has asked the Supreme Court how far Ottawa can go without the

full consent of provinces. The answer next autumn is almost certain to be: “Not very far.” Then there is NDP leader Thomas Mulcair leading a campaign to abolish the Senate. And last week, Liberal leader Justin Trudeau tried to carve out his own ground by announcing that in the interests of non-partisanship, all 32 Liberal senators would leave the Liberal caucus and would no longer be recognized as Liberal legislators. The Liberal senators quickly announced they would essentially become Independent Liberals, still supporting the party even if not being told what to do by the leader. Harper scoffed that the announcement was a publicity stunt, that nonelected Liberal senators would merely become unelected senators “who happen to be Liberal.”

However, in some quarters Trudeau was given credit for at least proposing something different, and he correctly nailed the problem that faces Mulcair and the abolitionists: abolition would require a constitutional amendment and there is almost no appetite for a renewed constitutional debate in Canada or chance of success. As well, there is no chance there would be enough provincial support to change the rules anytime soon, rhetoric from Alberta and Saskatchewan governments notwithstanding. So the debate is a side show: good to inspire political fundraising campaigns and partisan passion but leading nowhere. As it has for almost 147 years, the Senate with its strengths and problems remains an insoluble political conundrum, right up there with the weather.


THE WESTERN PRODUCER | WWW.PRODUCER.COM | FEBRUARY 6, 2014

11

& OPEN FORUM ORGANIC FOOD | CFIA COMMUNICATION

FAREWELL | RETIREMENT

CFIA should release food test results

Barry Wilson’s unique insight will be missed

BY SYLVAIN CHARLEBOIS

T

he organic movement was served a toxic dish recently when the media disclosed that a Canadian Food Inspection Agency study suggests organic food contains pesticide residues. The report claimed that half of a sample of organic products randomly tested had traces of pesticides. To explain why results were not disseminated when the study was completed more than a year ago, the CFIA told the media that none of the test results posed a health risk because farming practices complied with Canadian-approved standards. In this era of skepticism, mistrust and scandals, it makes one wonder why the CFIA allowed the media to unveil the information before it did in its role as our country’s premier risk communicator. Basically, the CFIA was outright undermined by a study it actually conducted itself, which made the story quite surreal. The way that these findings were made public should be a cause for concern for organic farmers in Canada. Many Canadians were surprised by the findings and were hard-pressed to find clear answers from regulators. Some organic products cost double or triple the average price of their conventional counterparts. The organic industry is an environmentally focused niche market that offers an alternative production system for certain farmers. The findings of the recently revealed CFIA study are not consistent with what the industry is trying to

CFIA failure to report test results that showed trace pesticides in organic foods has created consumer skepticism over industry standards, says the author. | FILE PHOTO achieve. In a sense, the organic movement is now paying the price for its pesticide-free campaign. For years, studies have suggested that it is nearly impossible to find organic produce at the retail level with zero pesticide residues unless, of course, production distribution and retail chains operate in complete isolation from conventional supply streams. Such an approach would likely increase the prices of products, which are already expensive enough. Organic production allows the use of only natural pesticides. From an ecological standpoint, it makes the

organic case much more compelling than conventional farming. However, agriculture has seen some dramatic changes in Canada and elsewhere in the last decade. Farming is now much wiser and more frugal when using chemicals in the field. Sound practices have led to the elimination of many problematic, old pesticides. This is something we need to recognize more often. Nonetheless, consumers are often oblivious about how our organic operations become certified. The certification process for any commodity in Canada is compre-

hensive and rigorous, but our climate makes the organic industry much less efficient than in other countries. In fact, more than 80 percent of all organic foods bought by consumers in Canada are imported, so certification processes are complex, to say the least. This means reviews and access to proper data will remain a challenge, particularly when dealing with emerging countries where regulatory oversight is lacking. The CFIA, in partnership with the domestic organic industry, should commit to expanding the scope of its surveillance and compliance guidance with our trading partners. Consumers ought to continue to buy organics for reasons they feel strongly about. However, they also deserve to have access to proper data so they can make educated decisions in relation to their diets, organic or not. Science remains inconclusive about the health benefits of organic food products compared to conventional offerings. What we do know is that they are certainly not unhealthier. Organic products generally have fewer pesticides on them, full stop. Therefore, the premium we pay is justified. However, the CFIA should stop allowing the media to be the food safety bogeyman and make its studies readily available to the public. Sylvain Charlebois is professor of food distribution and policy, and associate dean of management and economics at the University of Guelph.

SUPPLY AND DEMAND | STAYING IN THE GAME

Constant yield, quality improvement necessary HURSH ON AG

KEVIN HURSH

“S

o why are we investing money to increase crop yields? Higher yields just lead to surpluses and that causes lower prices. “Besides, we don’t have the transportation capacity to move higher volumes anyway. This year’s malaise proves it. “We’d be better off growing less and keeping the price higher.” This viewpoint is voiced with increasing frequency, and sometimes it even comes from experienced observers who should know better. While there’s a grain of truth, overall the premise doesn’t withstand scrutiny. It’s certainly true that greater sup-

ply leads to lower prices. But on many commodities, Canadian production is a minor portion of world production. We could hold our yields constant and the price could still be driven down by production increases in other parts of the world. We might think we’re a big deal on a crop like canola, but the crop competes with and is dwarfed by world soybean production. It’s hard to believe that over the long term we’d make more money by growing fewer bushels. Canada dominates the world export market in a number of other crops, including lentils, flax, field peas, oats, durum, mustard and canaryseed, and it may seem logical to produce less to force buyers to pay up. While plausible in theory, any gain would be short term. All of these crops can and will be grown elsewhere in the world if the price becomes sufficiently attractive. We may have natural advantages because of our varieties, climate, location and experience, but farmers in the United States, Ukraine and

Argentina aren’t stupid. Like farmers here, they’re always on the lookout for new cropping options that might be profitable. Farmers in Eastern Europe have been trying recently to hone in on flax and mustard production when opportunities appeared. It isn’t difficult for farmers in other regions to gear up and grow any of our common field crops. And unfortunately, it can be difficult to prevent farmers in some nations from pirating the varieties that Canadian farmers and taxpayers have paid to develop. Another result of high prices is demand destruction. When prices get out of line, buyers look for alternatives and once they switch to something else, it’s difficult to get them back. Flour mills have ways to deal with low protein in the wheat they use. Pasta can be produced without using durum. Meat processors don’t have to use mustard products if the price becomes extravagant. However, while the push for higher yields should and must continue for

all our crops, it’s important to note some logistical realities. Our production is a long way from salt water and it will always be expensive to move product to export position. No matter what happens with rail transportation in the years ahead, it isn’t going to get less expensive. Being landlocked is our competitive disadvantage. It’s why exporting feed barley seldom makes economic sense. Feed barley is sold mainly to the domestic livestock industry. Oats can work because of the crop’s proximity to domestic oat processing plants and the U.S. marketplace. However, for crops that need to be shipped to port position and exported overseas, it’s helpful to have a higher value so that the freight cost doesn’t take up such a major chunk. Yet no matter whether the end-use market is domestic or export, a crop will remain viable only if yield and quality continue to be improved. Kevin Hursh is an agricultural journalist, consultant and farmer. He can be reached by e-mail at kevin@hursh.ca.

EDITORIAL NOTEBOOK

JOANNE PAULSON, EDITOR

Reporting from around the world for 35 years

T

his is the last edition of The Western Producer that will contain content from Barry Wilson. As I write this, it is Barry’s final day of work (at least at The WP) before his retirement. While I have thought about this day more or less constantly over the last four months, I didn’t realize how much folks outside The WP would also take notice. Jennifer Ditchburn of the Canadian Press wrote a beautiful profile of Barry under the headline, Canadian farmers to lose veteran political correspondent in Ottawa. To Barry’s complete amazement, several papers picked up the story and posted it on their websites, including The Globe and Mail. You can find it at bit.ly/1mkTEDP, or via @JenDitchburn. It’s a great read, and it comes with a truly incredible photograph of Barry in his office. You have to see this picture. I am fairly confident you have never seen an office quite that submerged in papers, photos, newspapers, files and memorabilia. Digs at Barry’s messy office aside (after all, he is a busy guy), it’s obvious from feedback over the past few weeks that journalists and people in the agriculture industry understood Barry’s weight on the Hill. “Every agriculture minister from Eugene Whelan to Gerry Ritz has needed to know Barry Wilson,” Ditchburn wrote in her article. Certainly the Canadian Agricultural Hall of Fame thought Barry was important to agriculture when it inducted him about a year ago. He was only the second journalist to be so honoured. Everywhere we go, people ask about Barry — how he is doing, what he will do next. Many have asked us to send along their regards. Many have emailed him directly to express their best wishes. He spent 35 years with us, and with you. He is the consummate journalist, always insisting that he was never part of the story but only the scribe bringing the information to his readers. Even his last column lines up with that ideal. But at the end of his career, a bit of the limelight shone upon him, and rightly so. He truly was a servant to the higher goals of journalism, which means he always considered his readers first. Barry, we wish you well, and farewell. It is the end of an era.


12

FEBRUARY 6, 2014 | WWW.PRODUCER.COM | THE WESTERN PRODUCER

OPEN FORUM LETTERS POLICY:

GGC POSITION CLARIFIED

Letters should be less than 300 words. Name, address and phone number must be included for verification purposes and only letters accepted for publication will be confirmed with the author.

To the Editor:

Open letters should be avoided; priority will be given to letters written exclusively for the Producer. Editors reserve the right to reject or edit any letter for clarity, brevity, legality and good taste. Cuts will be indicated by ellipsis (…) Publication of a letter does not imply endorsement by the Producer.

In The Western Producer article of Jan. 23, “Rail service gets Ottawa’s ear,” an editing error implied that the Grain Growers of Canada supports the removal of the railway maximum grain revenue entitlement, or what is commonly known as the revenue cap. We would like to clarify this is not correct. As a grower driven organization, we would need to see conclusive proof that lifting the cap would actually improve rail service and return more money to us before giving consideration to such a proposal. GGC is a member of the Coalition of

Rail Shippers, which is made up of shippers that generate 80 percent of Canadian National Railway’s and Canadian Pacific Railway’s annual revenue. In our experience with the coalition, we talk to many other sectors which do not have the railway revenue cap. They too have huge concerns over their level of service from railways across Canada, leading us to believe that the simple removal of the cap would likely increase farmers’ costs with no guarantee of better service and that would not be in producers’ best interests. I can assure all farmers that the Grain Growers of Canada is aggressively advocating on behalf of pro-

ducers at all levels with the railways, industry and government to find solutions to get our grain moving to meet our customers’ needs. Gary Stanford, President, Grain Growers of Canada

ORGANIC ABUNDANCE To the Editor: I am writing in response to the WP, Nov. 28/13 op ed, “Can world afford luxury of organics?” The piece talks about food security. The author states the world population will grow by two billion people over the next 20 years and wonders

Outback MAX™ with ISOBUS Capability Outback MAX™ continues to redefine simplicity with its introduction of ISOBUS Universal Terminal and task controller functionality for automated section control, data management, and rate control with variable rate capabilities. Connect to ISO ready implements regardless of brand/color for display and control purposes. The system features section and variable rate control within the rugged, high-definition console.

Seamlessly transition from guidance to planting with Outback MAX™ with ISO

We’ve also enhanced the industry’s best steering solution. In another industry exclusive, Outback eDriveX™ with eTurns™ has been taken to a whole new level with the ability to initiate a turn based upon the headland or a field boundary.

www.AgJunction.com 326 Saulteaux Crescent Winnipeg, Manitoba R3J 3T2

Phone: (204) 888-4472 Toll Free: (866) 888-4472 Fax: (204) 888-0991

how we will feed these people. As an organic farmer, I wonder the same thing. I also wonder about herbicide resistance to weeds, soil degradation from overuse of fertilizer and chemicals and insect resistance to pesticides. As more weeds become resistant to herbicides and spread, at some point the chemicals we are using won’t be effective. Now what do we do? Many farmers, researchers, governments are also starting to ask what do we do next? Organic farming practices are pioneering sustainable agricultural methods that work with the environment. These methods will continue to work when herbicide resistant weeds cannot be controlled with chemicals. The current model of conventional farming is very fragile. Once chemicals are no longer effective, food production will begin to decline. The organic model is sustainable and with further research can be improved to increase production. Good organic farming practices can produce abundant healthy crops to feed the growing world population. Maybe organic farming is a luxury we cannot let fail. Brent Blackburn, Estevan, Sask.

HURT NOT HELP To the Editor: Re: “Ritz reshapes ag sector”, WP Jan. 2. (Agriculture minister) Mr. (Gerry) Ritz is thumping his chest and claiming he has done so much for farmers. He has done more to hurt farmers than any recent agriculture minister by giving in to multinationals and chemical companies at farmers’ expense. Every move he makes has taken power away from the farmers he claims to be helping. His original Bill C-18 exposed the grain industry to multinational greed and largess. The Canadian Wheat Board distributed profits back to farmers. With our glut of production this year we are seeing the grain companies saying “here is the price, take or leave it.” This was the making of the CWB in the first place. He claims the rail companies are doing a real good job and would be able to do better if the revenue cap was removed. Who pays for this? The farmer. Getting rid of the Crow didn’t improve rail service. The new Bill C-18 is taking income from farmers again and giving it to private companies. He says international companies are interested in investing in Canada, certainly if the government gives them the opportunity to make money with this bill. What happened to AgriInvest and AgriStability? We get Going Forward 2, which is leaning more to industry than producers. Revamping the Canadian Grain Commission is taking more money out of farmers’ pockets. Not being concerned about the high farm debt is false economy. The cure for high prices is high prices, so we can see which side of the curve we are on. This all depends on world weather conditions. The Canada-EU trade deal is wishful thinking. It will benefit Europe


OPINION more than Canada. Prime minister (Stephen) Harper used this deal to mask problems at home. We can’t get rid of this kind of farmer help fast enough. Bernie von Tettenborn, Round Hill, Alta.

GOVERNMENT TO BLAME To the Editor: All the talk this winter has been about the congested grain handling system. Yes, the Prairies had a good crop last year. Yes, we have had a number of good years in the price department. What is happening now with the lack of movement of grain and the falling prices is ridiculous and unacceptable. A few years back, this situation

would have been more than enough to spur government-appointed organizations such as the Alberta Wheat Commission, the Alberta Barley Commission and the Canola Council of Canada to point fingers at the Canadian Wheat Board. The CWB was blamed for the mounting costs to farmers for demurrage as ships waited at the ports. The CWB was blamed for not having better control on the grain handling system. Well, they don’t have the CWB to blame anymore. Oddly, those same accusing voices are now quiet. If you’re looking to pin blame on anyone, let’s start with the provincial and federal governments. It was the Alberta government who pushed the hardest to dismantle the CWB and it was the federal Conservative government that unilaterally took away the single desk marketing ability of the CWB. The federal government is also

responsible for overseeing railway operations and should be held accountable for the miserable record of grain movement to the ports. As a result of the negligence of the federal government on this issue, we find our grain handling system totally congested, leaving us unable to move our grain. This has been a significant contributing factor in the falling grain prices. So, if there are ships waiting to be filled and there are full grain elevators across the Prairies waiting for rail cars, the question you have to ask is why the federal government has not been more proactive. New hopper cars need to be added to the fleet and turnaround times have to be tightened up. Delivering the right grain to the right terminal in a timely fashion, previously a well-managed CWB function, appears to no longer be anyone’s responsibility.

THE WESTERN PRODUCER | WWW.PRODUCER.COM | FEBRUARY 6, 2014

You don’t need a commission to solve these issues. However, if there are other larger factors at play, perhaps a commission would serve a valuable purpose. But, for the moment, let (agriculture) minister (Gerry) Ritz stop the rhetoric and use his mandate to take action on the immediate transportation problems.

catching on to the uncanny correlation between scientifically reported results and who is paying the scientists. Greg deJong, Clearwater, Man.

FALL DELIVERY Neil Gorda, Willingdon, Alta.

PEOPLE CATCHING ON To the Editor: Re: ‘Prepare for more to succumb to anti-GMO pressure’ (WP, Jan. 9). (Kevin) Hursh’s use of the term “antiscience” (implies) that an anti-GMO stance is a flat-earth stance. The reason science is failing to sway the masses is that people are

To the Editor: I can’t understand why grain producers are complaining about not being able to deliver grain to their elevators. Have they forgotten that (agriculture minister) Gerry Ritz said farmers wouldn’t have to start their trucks in winter because in an open market they could deliver all their wheat in fall? Bev Currie, Swift Current, Sask.

INTEGRITY | GOD’S GIFT

Chariots of Fire has message SPIRITUAL VIGNETTES

JOYCE SASSE

N

inety years ago, the Summer Olympics were held in Paris. The story of two British competitors has been immortalized in the movie Chariots of Fire. The men came from vastly different backgrounds. Harold Abrahams had to fight for recognition because he was a Jew: always an outsider, always trying to rise above the prejudices that bedeviled his life. He had something to prove, and he worked hard in the months leading up to the games to show that he was as good as his opponents. Eric Liddell had been raised in China by Scottish missionary parents, but he was in Britain completing his university studies. Though Liddell planned to answer God’s call to return to the China mission field, he felt God had gifted him with the ability to run like the wind. His will to compete were offered “to the glory of God.” He was the record-holder for the 100 metre dash. But the race schedule posed a problem for Liddell. The 100 metre heat, which he was most confident he could win, was scheduled for Sunday, a day on which he would not run. Royalty and politicians tried to have the program amended to no avail. Though he didn’t feel the 400 metre race was his strength, Liddell surged to the front, winning a gold medal and a new world record. Abrahams won gold in the 100 metre dash and silver in the 100 metre relay. Both teammates returned to Britain having maintained their integrity. Of Liddell, to the tune Chariots of Fire, songwriter Jim Manley wrote: “I run for my Maker, each race I begin … my burning desire to be a Chariot of fire. And all of my days I’ll sing your praise in all I do … And every step along the way, I’ll run it for you.” Joyce Sasse writes for the Canadian Rural Church Network at www.canadian ruralchurch.net.

13

www.fmccrop.ca

Always read and follow label directions. FMC and Authority are trademarks and Investing in farming’s future is a service mark of FMC Corporation. ©2014 FMC Corporation. All rights reserved. F101-032481 2/14


14

FEBRUARY 6, 2014 | WWW.PRODUCER.COM | THE WESTERN PRODUCER

NEWS

PLANT BREEDERS’ RIGHTS | END POINT ROYALTIES

End-point royalties on seed may become reality Royalties benefit research | Farmers say plant breeders’ rights legislation would create restrictions on farm-saved seed BY BRIAN CROSS SASKATOON NEWSROOM

A plan to update Canada’s plant breeders’ rights laws could potentially cost grain farmers tens of million of dollars per year through a new system known as end-point royalties. End-point royalties (EPRs) are charged on harvested grain. In countries where they exist, the royalties generally range from $1 to $3 per tonne, although rates can be set at any level. In Australia, where EPRs have been in place for several years, EPR rates vary from variety to variety and are set by companies that develop new seed varieties and successfully apply for plant breeders’ rights protection. The royalties are normally paid by producers on harvested grain at the

point of delivery. In most cases, the system requires that producers declare the variety of grain they are selling. If an EPR is in effect on that variety, the grain buyer deducts the royalties that are due and submits the money to the seed company or its agent. Seed companies are not required to charge end point royalties on PBR protected varieties, but it is widely expected that they will if Canada updates its plant breeders’ rights legislation to conform with UPOV 91 provisions. Last year, federal agriculture minister Gerry Ritz signaled to the Canadian grain industry that Ottawa is considering ratifying UPOV 91 and updating Canadian legislation. Ritz said updated PBR legislation that allows for the collection of end

COMMUNITY PASTURES | LEASING AGREEMENTS

Pasture group seeks reduced liabilities, grazing fee for patrons Saskatchewan ag minister says the leasing fee is fair and he may provide money for noxious weed control BY KAREN BRIERE REGINA BUREAU

DAVIDSON, Sask. — The organization that represents most of the federal pastures switching over to patron administration says grazing costs will be too high and patrons are taking on too much risk. The Community Pasture Patron Association of Saskatchewan wants changes to the lease agreements its members are signing with the province and told agriculture minister Lyle Stewart that at a January meeting. “We asked for some movement on the question of risk,” said chair Ian McCreary after the association’s Jan. 30 annual general meeting. “We asked for some movement on the question of the non-reversionary lands and we asked for some movement on the question of cost because our costs are out of line and we’re being asked to take on a business proposition that is very, very questionable.” Patrons are concerned about the liability they will assume if pastures have species at risk or noxious weeds, as well as access issues for hunters and birdwatchers. Non-reversionary land is a problem because it will stay in federal government hands for the time being. Patrons have been granted licence to occupy and use the land under an agreement between the province and Ottawa, but McCreary said the possibility of losing an asset affects producers’ business plans. He said cost is the most difficult issue.

Cattle prices are good right now, but the margin is only $50 a cow, he added. As well, grazing costs of $1 to $1.25 per animal unit month per day are just too high when compared to 87 cents in Manitoba and a maximum of 70 cents in Alberta. McCreary said he was optimistic that the province would make changes to help patrons be successful. “Now the question is, are they really committed to patrons or is this just a process we’re all going through?” McCreary said. “Because I’ve got better things to do with my time if this is just a song and dance process for political reasons.” Stewart said reduced rent or grants in lieu of taxes on the pastures are not in the cards. “We are charging the same rent to patrons’ groups that we are charging to individuals that rent other Crown grazing land,” he said. It averages 27 cents per day. Patrons will be responsible to pay municipal taxes just as other crown leaseholders are, he said. However, Stewart said he might consider helping patrons deal with noxious weeds by holding Ottawa’s feet to the fire on the issue before the land transfers and by allocating some of the money available for pasture transition to weed control. He also said federal and provincial officials were scheduled to meet Feb. 4 to further discuss the thorny question of non-reversionary land. He expects it could be years before the issue is sorted out, and in the meantime patrons will have the assurance of the licence to occupy and 90 days of notice if they have to vacate the land.

END POINT ROYALTIES RANGE FROM

$1-$3 PER TONNE point royalties could be enacted before Aug. 1, 2014. If that happens, end point royalties could be imposed on any new varieties that are registered after Aug. 1, 2014, and covered by plant breeders’ rights. EPRs have been discussed this winter at grain industry meetings. Supporters see them as a way to ensure that seed companies and developers of new seed varieties can generate greater returns from their plant breeding investments.

However, others view EPRs as yet another attempt to increase the amount that farmers pay for access to new seed varieties. If UPOV 91 is ratified by Ottawa, EPRs could not be applied retroactively to varieties that have already been granted PBR protection. Nor would UPOV 91 eliminate a farmer’s right to save harvested grain and plant farm-saved seed. However, what often isn’t made clear is that end point royalties could be collected. Stuart Garven, a Saskatoon-based consultant who has examined funding issues affecting cereal breeding, said EPRs are viewed by many as a mechanism that could help build a sustainable funding environment for cereal breeding, particularly as Ottawa scales back investments in cereal breeding programs.

“We’ve had an incredible 100-year history of public breeding in wheat and barley in Canada, but the reductions in (government) spending are jeopardizing the success of that program,” said Garven. He also acknowledged that the concept of charging royalties on harvested grain is new to many Canadian producers. “The changes (being proposed to cereal breeding funding) are complex,” Garven said. “We’re in transition to something new and no one really knows exactly what … it’s shape is going to look like 10 years from now.” Terry Boehm, past president of the National Farmers Union, said UPOV 91 would result in increased costs for farmers and more stringent controls on what farmers can do with farmsaved seed.


NEWS

THE WESTERN PRODUCER | WWW.PRODUCER.COM | FEBRUARY 6, 2014

15

CFIA RED TAPE | IMPACT ON BUSINESSES

CFIA food safety rules costly, frustrating: report Regulations hurt small businesses | Canadian Federation of Independent Business says inconsistent decisions among issues BY BARRY WILSON OTTAWA BUREAU

The cost of complying with Canadian Food Inspection Agency regulations has risen to $657 million a year, according to a report from the Canadian Federation of Independent Business. The CFIB said last week the cost and time needed to deal with agency bureaucracy is a blow to competitiveness and productivity in the industry. A senior CFIA official said the agency is improving, but it takes the criticism to heart. Industry representatives, while uncertain about the cost calculation, said the CFIA should acknowledge industry frustration. The CFIB based the cost calcula-

tion on survey responses from 402 of its 7,200 farm and small to mediumsize agriculture business members. The report said compliance costs have risen more than seven percent in seven years to more than $20,000 per member. “Farmers support rules necessary to ensure safe food and are tired of getting the run around from the CFIA,” Marilyn Braun-Pollon, the federation’s vice-president for agribusiness, said in a statement. “Spending thousands of dollars and countless hours navigating through confusing forms and contradictory information leaves farmers feeling completely frustrated, and this does nothing to promote food safety.” Paul Mayers, CFIA vice-president for policy and programs, said he could not verify the number but accepted

the points about costs and industry frustration. He said the agency has been working with the federation on ways to improve service. “We have been working closely with the CFIB as it relates to the cost of compliance,” he said. “The number, I really can’t say if it is good, bad or indifferent, but we certainly agree with the CFIB that there is a challenge for small and medium enterprises, and we have been working with them to enhance the experience. CFIB has been very useful in terms of providing input around how we can contribute to improved compliance without necessarily adding costs.” He said the CFIA has established a statement of rights and services and an appeal process for industry members who believe they have been treated unfairly.

“But they certainly are saying we need to do more and we hear that.” Braun-Pollon said the sur vey showed improvement in accessibility and CFIA employee attitude, but she also noted that only 20 percent of respondents rated CFIA’s “overall performance” as good. “CFIA clearly still has a lot more work to do when it comes to communications and overall service.” Industry reaction was that while the actual cost calculation is suspect because it is an extrapolation from a small sample, the underlying issues raised are valid. “It sounds like a high number, and we would have to bore into that to see how valid it is,” said Canadian Federation of Agriculture president Ron Bonnett. “But I think it does raise some valid

issues about the hassle and cost of compliance with regulations that should be addressed.” The Canadian Meat Council, whose federally regulated meat plants typically would not fit into the small and medium size enterprise category and have a more intense relationship with the federal regulator, said in a statement that many of the complaints lodged by CFIB members resonate with its members. Despite efforts by CFIA to improve service and processes, businesses continue to complain that some policies impose unnecessary costs and bureaucracy. There are also complaints about the lack of consistency in inspector decisions and “the limited knowledge of some CFIA staff about the industry they regulate.”

CALGARY STAMPEDE | LESSONS FROM FLOOD

Stampede official says staff dedication helps recovery BY BARB GLEN

ELITE WILD OAT CONTROL

LETHBRIDGE BUREAU

IS JUST THE BEGINNING.

Success starts with the #1 Graminicide brand in wheat. • Growers who use it say it works the best • High performing on a wide range of weeds • Superior wild oat control + bonus broadleaf control • You’ve got to use it to know how good it is

AND SAVE BEFORE MARCH

20th.

Go to cerealsolutions.ca or call 1.800.667.3852. ® TM

Trademark of The Dow Chemical Company (“Dow”) or an affiliated company of Dow. 0114-22012-11

The designation 101 identifies a basic lesson or application, but Stampede 101 was anything but basic. Fourteen days before the 101st Calgary Stampede was set to begin last summer, the most extensive flood in Alberta history flooded the grounds, part of the city and a large area of southern Alberta. However, Stampede 101 was held “come hell or high water,” as officials proclaimed. After thousands of man hours and round-the-clock cleanup and construction effort, 1.1 million people attended the July event, 300,000 fewer than the centennial Stampede of 2012. Jim Laurendeau, director of Stampede park and facility services, told the story of flood and recovery to a Lethbridge Exhibition Park crowd Jan. 30. Afterward, he had advice. “Number one is preparedness,” he said about lessons learned. “Be ready. Practice.” He said Stampede staff regularly discussed various crisis scenarios that could affect the event, such as a barn fire or midway ride collapse. Flooding wasn’t one of the examples he recalled discussing, but emergency plans were modified to fit the need. “Practicing is the first thing. The second thing is ownership,” said Laurendeau. “We work really hard to not demotivate people at the Stampede, and have them feel that ownership.” Dedication of staff members became evident during early flood damage mitigation efforts and the extensive cleanup that came later. “The third thing is insurance. I hate to say it, but at the end of the day you really need to pay attention to that piece.” He said losses of $52.3 million have been tallied, and reconstruction is only 50 percent complete. Stampede 101 was made possible largely through temporary measures,

but one acre of the park was lost to erosion and a bridge that used to span the river won’t be rebuilt until next year. The 1957 Big Four building, a fixture on the grounds, is expected to be back in commission in March. Its 10-foot deep basement, plus another three feet of the ground floor, was filled with water at the flood’s peak. At one point, fish were swimming in its lobby, said Laurendeau. The chuck wagon track, rodeo infield and stage sustained extensive damage, as did the entire park. When the waters receded, video showed the extent of debris, soil and filth left behind. However, Laurendeau said there were only momentary doubts that the 101st running of “the greatest outdoor show on earth” would go on. “The only sort of crisis of faith would have happened the second full day that the water had still not gone down even an inch. It stayed up there for 24 plus hours,” he said. “That was tough.” Stampede officials announced the show would run, “come hell or high water,” but only after they determined that Calgarians supported the idea. A few months earlier, New York mayor Michael Bloomberg had been criticized for suggesting the city’s famous marathon would go ahead in the aftermath of Hurricane Sandy. Citizens there were outraged, and the event was later cancelled. “We pride ourselves in being really connected with our community, so unlike the (New York) example that I gave, where it might be seen as a sporting event for a small group of people, our organization, I think, has a little deeper roots in our community and we’re able to talk to our community informally and be able to gauge that,” said Laurendeau. A T-shirt campaign, featuring the “come hell or high water” expression, sold 160,000 shirts, and proceeds of $2.1 million were donated to the Red Cross to help flood victims.


16

FEBRUARY 6, 2014 | WWW.PRODUCER.COM | THE WESTERN PRODUCER

TOUGH WEEDS, MEET EXPRESS . ®

Crank up the rate all you want, glyphosate alone still misses a number of hard-to-kill weeds like narrow-leaved hawk’s-beard, flixweed, stinkweed, dandelion and volunteer canola. With hotter-than-hot systemic activity, DuPont™ Express® herbicides don’t just control weeds, they smoke them from the inside out, getting right to the root of your toughest weed challenges with performance that glyphosate alone can’t match. It’s no wonder Express® goes down with glyphosate more than any other brand in Western Canada!

Visit expressvideo.dupont.ca to see Express® in action – torching tough weeds like dandelion and volunteer canola right down to the roots, so they can’t grow back.

Express® brand herbicides. This is going to be hot. Questions? Ask your retailer, call 1-800-667-3925 or visit express.dupont.ca

As with all crop protection products, read and follow label instructions carefully. The DuPont Oval Logo, DuPont™, The miracles of science™ and Express® are registered trademarks or trademarks of E. I. du Pont de Nemours and Company. E. I. du Pont Canada Company is a licensee. All other products mentioned are registered trademarks or trademarks of their respective companies. Member of CropLife Canada. ©Copyright 2014 E. I. du Pont Canada Company. All rights reserved.


NEWS

THE WESTERN PRODUCER | WWW.PRODUCER.COM | FEBRUARY 6, 2014

17

CROPS | MARKETING

Grower group looks to simplify grain contracts Producer concerns | Separate study finds that only a small minority of growers actually read contracts with grain companies BY MARY MACARTHUR CAMROSE BUREAU

EDMONTON — Concerns over one-sided grain company contracts have prompted industry officials to study grain contracts, says Cheryl Mayer, a policy analyst with the Canadian Canola Growers Association. She hopes the initiative will encourage companies to make contracts easy to read, understand and less one sided. “We wanted to better understand the frustrations and concerns of farmers,” Mayer told a session at FarmTech 2014. Mayer said the association will study contracts from a variety of grain companies, compare the differences, similarities and concerns in the fine print and discuss some of the concerns with the companies. She hopes they will be receptive to their customer’s concerns. Raymond Blanchette of the Alberta Canola Producers Commission said the study came out of a meeting last year where farmers felt like they were treated unfairly by grain companies. “We as producer directors had concerns. We have dealings with the way the grain companies work,” said Blanchette. Mayer encouraged farmers to read their contracts as the first step to understanding what recourses they have, especially when grain isn’t moving. A recent study by University of Manitoba’s Jared Carlberg showed only 17 percent of Manitoba farmers read their entire grain contract. “If only 17 percent of Manitoba farmers have read the contract, I am sure it is the same in Alberta,” said Blanchette. “Personally, I have never read one entirely to the end. I have read certain clauses. I am just happy when they take my grain.” He said he hopes contracts become standardized, or at least easier to read. “A lot of farmers don’t know how far they can push back,” he said.

After farmers voiced concerns about unfair contracts with grain companies, the Canadian Canola Growers Association initiated a study to look into it. | FILE PHOTO The same study found that only 12 percent of farmers agreed or strongly agreed that their rights were protected in the contracts. “That really speaks to some of the concerns. They are written in favour of the grain companies,” said Mayer. She said reading the entire contract is one of the easiest things farmers can do to help themselves.

“There is nothing wrong with asking questions how the contracts work and make suggestions how they can be improved in your eyes.” She said the local elevator manager may be a farmer’s good friend, but a special deal carries little legal weight unless it is written down and agreed upon by both parties. “Get it in writing. Hand shakes are

risky,” she said. “While they might be legally enforceable, they are really risky and may not hold up. Most of the contracts contain some kind of clause that says this contract contains all the information.” If a contract has two parts, one dealing with pricing and a second with conditions, then farmers need to

have copies of both contracts. “This is common. We found a lot of examples of two part contracts. Our message is to ask for the entire contract.” Contracts usually require companies to accept only the exact grade specified. Farmers must know how grade differences will be treated and know the discounts up front. Mayer said grading is the most common area where disputes arise, and farmers should have a good understanding of grading practices and their rights. Farmers have a legislated right to ask for an official Canadian Grain Commission grade at a primary elevator if they don’t agree with the elevator grade. Mayer said delivery times have caused frustration across the Prairies this year. “It is a huge issue this year. This was a main point of contention or concern.” Grain companies can extend delivery contracts 30, 60 or 90 days, but farmers don’t have the right to cancel the contract. “It is a one sided clause for sure, and I know farmers are frustrated with that.” Mayer said that when a grain company delays delivery, farmers should calculate their carrying, storage and interest charges and see if they can receive compensation for the delays. Farmers have no issues this year about ability to fill their contracts, but it has caused problems in the past. Mayer recommended that farmers let elevators know as soon as possible if they have a short crop and can’t deliver. A farmer who calls the elevator first may be treated more favourably than the 30th person that calls. Mayer said almost half of the farmers in the study believed that their contracts contained an act of God clause. They might, she said, but it is for the elevator’s benefit and not the farmer. “They are rare for growers. They are out there, just not on the side of the farmer.”

Speed Tills.

The Joker RT Series from HORSCH

The unique design of the Joker allows you to accomplish light to aggressive tillage and excellent soil finishing. With depth management from 1”-5” the RT Series gives you precise tillage at high speed. The Joker gives you what vertical tillage can’t. Unlike vertical tillage, the Joker is a true residue management system. That means it perfectly sizes residue and incorporates it into the soil for fast consolidates ddecomposition. de c mp co m os ositititioon. n. TThe h JJoker he oker ok er aalso lso cco ls ons nsol o id ol idat idat ates es tthe he soi ssoil ol oi promotes helps manage aand an ndd pr prom omot om otes ot es faster ffas aste as terr warming. te waarm r inng. TThis hiss he hi elpps ma m ana nage nage ge moisture faster. mo ois i ture ture better tu bette etteer an et andd gets gets yyou ouu pplanting laant ntin inng fa fast ster st er.. er

Manage heavy residue/stubble Fast seedbed preparation Pasture/hayland/CRP renovation Manure/Fertilizer incorporation

www.horsch.com 1-855-4HORSCH


18

NEWS

FEBRUARY 6, 2014 | WWW.PRODUCER.COM | THE WESTERN PRODUCER

MANITOBA BEEF PRODUCERS | PUBLIC RELATIONS

Listening called key to combatting ag critics Lead a discussion | Take on the critics by plopping your butts down next to them and comparing notes, says rural advocate BY ROBERT ARNASON BRANDON BUREAU

Bruce Vincent, a logger and rural advocate, has a piece of advice for Canadian cattle producers: defending industry practices doesn’t work because defence isn’t an effective public relations strategy. Too often, he said, loggers, miners, farmers and others like to play a public relations game that he calls reverse jeopardy, in which industry associations provide answers to questions the public isn’t asking.

“Instead of screaming our truths at them, we need to take a step back and listen, to find out what their concerns are,” Vincent said in an interview prior to his scheduled appearance at the Manitoba Beef Producers annual meeting held in Brandon Feb. 4-5. Vincent, a third generation logger from Libby, Montana, is a board member of several forestry and environmental associations and regularly speaks to agriculture and resource industry groups across North America. He learned the do’s and don’ts of

public relations the hard way, when environmentalists wanted to shut down the logging industry in his state. Like other loggers, Vincent belonged to the Montana Logging Association and attended meetings several times a year, but he was passive until it became apparent that environmental groups had convinced the public that logging equaled ecosystem destruction. In response, he participated in public demonstrations and marches, defending loggers and the forestry

industry. “I was the guy with the bullhorn,” he said. He later realized that yelling back at critics and shouting slogans to the public does not work. “We were doing a noble job of fighting, but it’s not the same as leading…. We should have been advocating … for a sustainable forest future.” The timber industry eventually learned it had to back away from the fight, listen to the public and speak to its critics, which helped move the industry forward.

Vibrant roots fuel better performance. Crops thrive with Cruiser Maxx® Vibrance®. When the Vigor Trigger ® effect meets Rooting Power ™, you get enhanced crop establishment from stronger, faster-growing plants, above and below the ground. It also protects your wheat and barley crops against a broad range of insects and diseases and delivers best-in-class Rhizoctonia control.

Visit SyngentaFarm.ca or contact our Customer Resource Centre at 1-87-SYNGENTA (1-877-964-3682). Always read and follow label directions. Cruiser Maxx® Vibrance® Cereals, Rooting PowerTM, Vigor Trigger®, the Alliance Frame, the Purpose Icon and the Syngenta logo are trademarks of a Syngenta Group Company. © 2013 Syngenta.

He said cattle producers, farmers and others in rural industries need to understand that advocacy, conversation and discussion aren’t a sideline activity. They should be a line item in a business plan. “Ag, timber or mining or fishing or anything that deals with the environment, we have a social licence. And society has an interest in our licence…. Figuring out how to lead this discussion, being engaged in the discussion needs to be part of doing business.” And cattle producers shouldn’t rely on their provincial or national associations to fight battles for them, he added. “It’s not the job of the association to telegraph our answers. The job of the association is to prepare us with the tools … so we can talk to our neighbour.” With that in mind, he said there are two rules regarding public relations and public policy that farmers need to know: • Democracy works but it’s not a spectator sport. • The world is run by those who show up. Yes, it is frustrating that a vocal minority often has an oversized influence on public policy when it comes to things like animal welfare and water quality. However, if you can’t beat them, join them, he said. “We can complain that some religious zealots that show up and demean us, or we can plop our butts down next to them and compare notes.” Kelly Daynard, communications manager with Farm & Food Care Ontario, which has the mandate of providing credible agricultural information, said farmers are becoming more engaged through tools like Twitter. “Until the advent of social media, there was always an unfair playing field when it came to anti-agricultural groups. Some of those movements are really well funded … and they would tell their stories, put up their billboards and their advertising campaigns and we never had the ability to touch them … because we just don’t have the finances.” Vincent said there is an entrenched conflict industry in North America, which depends on causes for its existence. As soon as it has resolved one issue, it needs another to survive. Those groups may never accept agricultural practices and have been successful at converting issues like growth promotants into a black and white issue. “They have simplified the discussion into an either/or…. Should we allow beef producers to pump up their beef with hormones and sell it to an unknowing public or not?” Vincent said. “We’ve done a terrible job of figuring out the public’s real concerns and how do we answer them.” Vincent said farmers have to engage directly with folks who demonize agricultural practice because that discussion is already occurring. “I think we are in a conversation with them whether we want to be or not. The question is, do we just want the conversation reported on the front page,” he said.


THE WESTERN PRODUCER | WWW.PRODUCER.COM | FEBRUARY 6, 2014

FARMLIVING

19

CENTURY FARM Andrew Zdunich hopes his family farm at Hanley, Sask., can be sustained for generations to come. | Page 20

FARM LIVING EDITOR: KAREN MORRISON | Ph: 306-665-3585 F: 306-934-2401 | E-MAIL: KAREN.MORRISON@PRODUCER.COM

COLLECTIBLES | FARM TOYS

Little toys for big boys Buy, sell, trade | Collectors share their love of vintage childhood toys BY KAREN MORRISON SASKATOON NEWSROOM

A mostly male crowd spills into the expansive room to pore over rows of tiny tractors, implements and farmyard dioramas featured at the Saskatoon Farm Toy and Collectible Show. It’s the start of another show for seasoned veterans of the show circuit such as Bill Wilke, who will spend the next few days looking for pieces for his collections, selling some and boxing the rest to take home to Yellow Grass, Sask. The 67-year-old likes to collect the tractors and combines he grew up and worked with on the farm. Collector Neil Isley is a couple of decades younger but also loves these antiques. “I was told I had an old soul. Maybe that’s what connects me to them,� he said. Isley, who rents out his farmland near Delisle, Sask., was drawn to the Lincoln toys, made in Windsor, Ont., from 1946-59. His most valuable piece, priced at around $1,000, is a rare Lincoln garbage truck in its original condition. Isley’s favourites include a Massey 44 tractor, a toy he played with as a boy at his grandparents’ house. “Because of its sentimental value, it’s priceless,� Isley said. “Every toy tells a story.� He started collecting in 1997, drawn to the Lincoln toys’ primitive styling and unique stamp. His father-in-law started giving him “ugly ones that needed fixing up� as Christmas presents.

“As the market changes, that $80 toy is now worth $125,� Isley said. He started attending shows as a teenager, looking for fixer uppers. “I looked for old toys that needed some love and needed to be restored,� said Isley, whose day job as an autobody technician is a great asset for restoration work. “There’s always a different style, colour that will keep me looking for something different.� The rule of thumb for his 1/16 to 1/18th scale collection is to maintain three: one original, one restored and maybe a third for trading. He estimates the value of his 130 piece collection at $18,000. He draws special pleasure from people’s reactions at shows. “They’ll stop and stare and say, ‘now that’s a toy.’ I’m bringing back a memory. That’s what I get a kick out of.� Wilke, now semi-retired and no longer farming, said collecting gives him something to do, but it’s also something he can share with a grandchild. “What would I be doing if not going to a toy show. It occupies your time,� he said of his 1/16th scale collection of about 800 pieces. His favourite, the 1938 Massey Harris Clipper combine with a box, which was the first Massey Harris scoop type combine, is valued at $2,000.

Wilke recalled skipping school to attend a John Deere show, where he won a toy tractor. It eventually ended up in the garden, where it was driven over. A friend repaired it and Wilke’s son played with it as a child. Sentimental favourites like that one will remain in his collection, he said. He takes in about six shows a year in Canada and the United States, where there is a healthy market for farm toys and big collectors. Values wax and wane, Wilke said. “It works on supply and demand. If there’s lots of them, they’re not going to be worth as much. Sometimes they’re worth a lot more.�

Bill Wilke, left, frequents several farm toy shows each year in search of special items for his collection, which hovers around 800 pieces. Neil Isley, above, has a special fondness for the unique stylings of Lincoln toys, made from 1946-59 in Windsor, Ont. Prices fluctuate for collectibles depending on supply and demand and collectors abound, especially in the United States. | KAREN MORRISON PHOTOS

        ͳͲ–Šnjͳͳ–ŠǥʹͲͳ͜

Š‡ƒŽ–Š›’‡‘’Ž‡ǥ Š‡ƒŽ–Š›ŽƒÂ?† ƒÂ?†Š‡ƒŽ–Š›’”‘Ď?‹–•Ǩ

Ž‘›†�‹�•–‡”‰”‹…—Ž–—”ƒŽšŠ‹„‹–‹‘�

ʹͲͳ͜‘Â?ˆ‡”‡Â?…‡

‘Ž‹•–‹…ƒÂ?ƒ‰‡Â?‡Â?–‹•ƒÂ?ƒ’’”‘ƒ…Š–‘Â?ƒÂ?ƒ‰‹Â?‰”‡•‘—”…‡•–Šƒ– „—‹Ž†•Â„Â‹Â‘Â†Â‹Â˜Â‡Â”Â•Â‹Â–Â›ÇĄ‹Â?’”‘˜‡•’”‘†—…–‹‘Â?ƒÂ?†‰‡Â?‡”ƒ–‡• Ď?‹Â?ƒÂ?…‹ƒŽ•–”‡Â?‰–ŠǤ –‹Â?’”‘˜‡•“—ƒŽ‹–›‘ˆŽ‹ˆ‡™Š‹Ž‡‡Â?ŠƒÂ?…‹Â?‰ –Š‡‡Â?˜‹”‘Â?Â?‡Â?––Šƒ–•—•–ƒ‹Â?•—•ƒŽŽǤ

‡‰‹•–‡”‘™ Š‘�‡ǣ͚ͺͲnj͚ʹ͚nj͚͜͜͜

™™™Ǥ™‡•–…‡�–”ƒŽˆ‘”ƒ‰‡Ǥ…‘�



   

  ̈́ͳ͸͡Â’Â’‡ƒ†Ž‹Â?‡ǣ ƒÂ?—ƒ”›;ͳǥʹͲͳ͜ 

  ̈́ʹͲͲÂ’Â’ƒˆ–‡” ƒÂ?—ƒ”›;ͳǥʹͲͳ͜  ̈́ͳʹ͡Â’Â’    ̈́;Ͳ‡ƒǤ


20

FEBRUARY 6, 2014 | WWW.PRODUCER.COM | THE WESTERN PRODUCER

FARM LIVING

ON THE FARM | FARM SUCCESSION

Farm to stay in family but passing torch difficult Reluctant to give up reins | Aging farmer not eager to leave homestead BY KAREN MORRISON SASKATOON NEWSROOM

HANLEY, Sask. — Andrew Zdunich doesn’t mince words. He leans to the right politically and he’s quick to point out in a radio voice who has and hasn’t done a good job in government office. He’s also adamant he will leave the farm founded by his parents a century ago on his terms. Andrew was one of 14 children born to Mike and Mary, Croatian immigrants who settled in the Hanley district. Mike turned over a half section of land to Andrew to jump start his mixed farm, where he raised six children with his wife, Thelma. Over the years, Andrew served on the rural municipality council and maintained his membership in the Knights of Columbus, while both of them enjoyed watching their sons play hockey. Now widowed and with health problems that makes a move into town imminent, the 83-year-old wants to measure this decision as he has all others in his farm and family life. Andrew has regrets about some of his choices, including not buying land when it was cheap and not adopting air seeders because of the high cost. However, he is adamant the family farm be sustained. “That’s what I wanted. I want it to stay in my family,” said Andrew, citing his numerous grandchildren and great-grandchildren. His son, Greg, and daughter-inlaw, Cathy, farm Andrew’s home quarter while also operating their own farm a short drive away. They say their son, Rocky, one of four children, is interested in living on and helping farm his grandfather’s land, but he is currently a full-time mechanic at a nearby potash mine. Farm succession is a touchy subject

Andrew Zdunich, below, and his family settled in Hanley, Sask., a century ago. His son, Greg, and daughter-in-law, Cathy, above, look to a future on the farm that might include their son. | KAREN MORRISON PHOTOS for the Zdunich family. “Some days (Andrew’s) interested in talking about it and some days absolutely not,” said Greg. “We’ve been in a holding pattern for years.” Greg started his farm 38 years ago, buying land, adding equipment and buildings and paying for the improvements with income from offfarm work on the pipeline in the winter. “We could never have paid the bills without off-farm income,” Cathy said. “Not a chance. Even so, we had a lot of lean years.” Their mixed farm has grown to eight quarters and an additional six quarters of land leased from Andrew, which he plans to turn over to Greg in the future. Andrew still derives income from his home quarter. The Zdunich family plants hay, wheat, canola and barley crops and has 25 head of cattle, down from a high of 80. “BSE hurt the cattle,” said Greg, citing the culling that took place because of it. “We just rode it through the first couple of years. The financials have always being a challenge on the farm.… Mostly it’s been a great place to be, other than the finances some-

times are a chore.” Andrew agreed: “There’s a freedom. You feel close to the land and nature. I loved the birds, the sun and open spaces. There’s no nicer smell than freshly mown hay.” Tending to the commercial cowcalf operation fell largely to Cathy when Greg was working away for days at a time. “She is helpful in every aspect of this farm,” said Greg. Cathy is modest about her contributions. “It’s just being a mom and a wife,” she said. She credited Greg with being organized and a good planner. Greg has coached sports teams, and the pair spent many hours at games and recitals as their children grew. “We’d be meeting each other on the road,” said Greg. They were busier then but enjoyed all of it. Now they visit and support their six grandchildren and their activities. They keep six horses, partly to do chores but mostly for family recreation. “It’s what we get our enjoyment from,” Cathy said about family life. Added Greg: “ ’Cause there’s more to life than just sitting on the farm.”

NEGOTIATING SETTLEMENTS | CONSIDER OPTIONS

Emotional issues can cloud judgment in settling disputes A PRAIRIE PRACTICE

GAIL WARTMAN, B.A., J.D.

T

he phrase “it’s the principle of it” is a noble and praiseworthy notion but it also causes knots to form in the stomach of negotiators and mediators. Our legal system is predicated on the administration of justice, and the goal is to afford justice to all members of society. However, our justice system is an imperfect, blunt instrument. The

modes of compensation are limited. Claims in civil cases often aim to financially compensate an aggrieved party for some harmful act. A contractor botched a roof repair. How much will it cost to fix? But disputes rarely fall solely within the realm of “how much will it cost to fix this?” The couple with the botched roof is probably pretty cross with their contractor. Maybe they want an apology. Maybe they don’t feel as though they have been treated fairly by the contractor and resent that it took starting a court case to get the contractor’s attention. Conflicts can often be as much about the emotional and procedural issues as they are about the substance of the matter. Sometimes these emotional issues, while valid, can get in the way of the

best outcome. The problem is that courts can generally deal only with the substantive issues. While the couple might feel vindicated by a court decision in their favour, it will cost a lot of money to get there. This is why most courts mandate some form of mediation before trial. Most cases do settle. When attempting to settle a dispute, it is always important to identify your best alternative to a negotiated agreement. What happens if you can’t settle? How much will court cost? What is the probability of success? What orders can a court make to remedy the problem? Imagine a situation where your neighbour’s house has badly damaged downspouts and eavestroughs. A particularly heavy rain results in

water pooling between the houses and floods your basement. You decide to take them to court to recover the cost of your insurance deductible. In pre-trial mediation, they offer to pay half your deductible and fix the faulty downspouts that caused the flooding. “No. I want them to pay the full cost and fix their downspouts,” you reply. “It’s the principle of it.” But consider the alternative: A court will not order them to fix their downspouts. It would be up to you to take them to court to recover damages if it were to happen again. All of that costs money. Therefore, it is important to seriously consider the proposed settlement, even if it is not the ideal outcome. It is superior to your next best option.

The courts can enforce a settlement agreement like any other contract, effectively giving you the teeth to fix the problem for good. In my experience, both sides are far more likely to honour agreements reached between them than they are an order imposed by the court. Is it worth modifying your principles to solve the problem for good? Sometimes you have to make the best of a bad situation. Brayden Gulka-Tiechko, associate lawyer in McDougall Gauley’s Moose Jaw office, helped research and draft this article. This article is presented for informational purposes only and does not constitute legal advice. The views expressed are solely those of the author and should not be attributed to McDougall Gauley LLP. Contact: gwartman@ producer.com.


FARM LIVING

THE WESTERN PRODUCER | WWW.PRODUCER.COM | FEBRUARY 6, 2014

21

CHICKEN | PROCESSING

Flatten chicken for easier barbecuing, faster baking TEAM RESOURCES

BETTY ANN DEOBALD, BSHEc

S

patchcocked chicken is the process of removing the backb o n e f ro m a w h o l e f r y i n g chicken and splitting the breast bone, allowing the chicken to lie flat. The chicken will cook more quickly and is more convenient when barbecuing. An older cooking term, spatchcock was used to describe the splitting of any small bird down the back and then opening out and flattening the two sides like a book. Flattened or butterflied are terms also used to describe this process, but generally spatchcock refers only to fowl. Butterflied typically applies to boneless cuts of meat, poultry, fish or shrimp. To spatchcock, use a fresh or completely thawed frying chicken. Place breast side down on a cutting board. Using strong kitchen sheers, begin cutting on one side of the neck through the rib bones. Stay as close as possible to the backbone. Cut as far down the back as possible on one side and then cut down the other side of the neck and backbone. Turn the chicken and cut from the tail up to your initial cuts. It may be necessary to give a bit of a twist to dislocate the larger bone from the spine area. Once the backbone has been removed, use a paper towel to remove small bone pieces from the breast cavity. To flatten the breast, lay the bird breast side down, place a large chef’s knife against the cavity side of the breastbone and press down on the breast or keel bone to split it. Cut through the wishbone at the neck end of the chest. Turn the chicken over and press down on the breastbone to flatten the chicken. Pull out the legs and thighs so they lie flat as well. If desired, the wing tips can be cut off at the first joint. The breastbone can be completely removed by using a sharp pointed knife to cut the meat away from the bone. With or without the breastbone removed, the chicken can also be split into two pieces by cutting

LEFT: Add your favourite seasonings to roast chicken with vegetables. ABOVE: Toasted almonds add crunch to Craisin salad. | BETTY ANN

HERB ROASTED SPATCHCOCKED CHICKEN AND VEGETABLES

TOP: Cut out the backbone starting at the neck, cutting on both sides of the backbone through the ribs. CENTRE: Cut through the breast to split. Also cut through the wishbone at the neck end of the chest. Turn chicken over and press down on breastbone to flatten. ABOVE: Add herb butter under the breast skin and over legs and thighs. through the breastbone. Small birds like Cornish game hens are often served as a half bird. Wash the cavity out and pat dry. Place the flattened chicken in a roaster or on a rimmed cookie sheet to prepare for cooking.

1/4 c. butter, at 60 mL room temperature 1 tsp. dried thyme 5 mL 1 tsp. dried savory 5 mL 2 tsp. onion salt 10 mL 2 tsp. garlic powder 10 mL 1/2 tsp. fresh ground 2 mL black pepper 1 spatchcocked frying chicken 3 tbsp. extra-virgin olive oil 15 mL 2 large red potatoes, quartered 4 medium carrots, peeled and halved lengthwise 2 large parsnips, peeled and quartered lengthwise 2 large onions, peeled and quartered 1 clove garlic, peeled 1 tsp. dill weed 5 mL 1 tsp. dried thyme 5 mL 1 tsp. salt, plus more for seasoning 1/2 tsp. freshly ground black 2 mL pepper, plus more for seasoning 1/2 c. low-salt chicken 125 mL broth Preheat the oven to 375 F (190 C) Prepare the chicken as described. Mix the butter and herbs together to form a paste. Place the chicken, breast side up and flattened, in a roasting pan. Starting at the neck end of the chicken, gently lift the breast skin and using your fingers, insert and rub about half of the herb butter over the breast, being careful not to tear the skin. Using the remainder of the herb butter mixture, rub it over the outside of the breast skin, thighs and legs.

Prepare the vegetables and put into a large bowl, toss together with the oil and seasonings. Arrange the vegetables around the chicken in a single layer. Add the broth and roast until the vegetables are tender and an instant read thermometer inserted into the thickest part of the chicken thigh registers 185 F (85 C), about 1 1/2 hours. Let the chicken rest for 20 minutes. Transfer the chicken to a platter. Arrange the vegetables around the chicken. Scrape the contents of the roaster into a bowl and spoon off the layer of fat that rises to the top. Season the pan juices with salt and pepper, if needed and serve with the chicken. You can also use your favourite seasonings or barbecue sauce and roast or grill the spatchcocked chicken. The following broccoli slaw is a tasty alternative to cabbage coleslaw and complements the chicken and roasted vegetables meal.

ALMOND CRAISIN SALAD 4 c. broccoli stems, 1L coarsely shredded 1 c. carrot, coarsely 250 mL shredded 1 c. red cabbage, 250 mL coarsely shredded or 6 c. broccoli coleslaw mix 2 c. Craisins 500 mL 3/4 c. mayonnaise, 175 mL regular or reduced fat 1 tsp. sugar or sweetener 5 mL 1/2 tsp. dried dill weed 2 mL 1/2 tsp. celery salt 2 mL 2 – 4 tbsp. rice or apple 30-60 mL cider vinegar

DEOBALD PHOTOS

sea salt & fresh ground pepper to taste 1/2 c. almonds, slivered 125 mL To plump the Craisins (dried cranberries), pour boiling water over them in a bowl and allow them to sit 10 minutes. Drain, reserving the water. While the Craisins are soaking, prepare the dressing. Place the mayonnaise, sugar and seasonings in a bowl. Whisk to mix, continue mixing as you pour in the vinegar until desired consistency is reached (about 1/4 cup). Add the plumped Craisins to the dressing and mix together. Refrigerate the dressing until ready to use. If the dressing has thickened, add some of the Craisin water to thin, adding a spoonful at a time. Just before serving, add the dressing to the broccoli mixture and toss to coat the broccoli mixture well. The salad can be mixed and refrigerated up to two hours before serving.

TOASTED ALMONDS Put slivered almonds in a small frying pan and toast over a medium heat, just until they start to brown and are fragrant, stirring frequently to prevent over browning. Add the almonds to garnish the salad just before serving. Adapted from www.veggiesmade easy.com. Betty Ann Deobald is a home economist from Rosetown, Sask., and a member of Team Resources. Contact: team@producer.com.

HUMOUR | OLDEN DAYS

Kids intrigued by life in the olden days — for a few minutes THE MORE THINGS CHANGE …

MICHAEL GILLGANNON

O

ne of the perks of belonging to an older generation is the bragging rights earned

over Generation W. Generation Whippersnapper has to accept on faith the claim that life was tough — oh, was it ever — back in the olden times. “Yes, sonny, by crikey, I remember when video games were controlled with a fourdirection joystick and a single button.” “Really, Grampa?” “There was even a time, stretching back, like forever, when there were no video games at all, and people had to play canasta. They would sit on

their front porches — houses used to have front porches — and complain about the communists.” “What were the communists, Grampa?” “They were people who lived in a faraway land working for the overthrow of capitalism by churning out lies in their propaganda mills and building death ray generators on hilltops. But their evil plans never worked quite right and they ended up clutching capitalism to their own impious breasts. Now look at ’em. A

sorry sight. It’ll be a hundred years before they know the first thing about making a decent pair of jeans.” “How long did it take you to walk to school, Grampa?” “How long? Hours, that’s how long. It took hours. And since electronic calculators weren’t part of the picture then, we had to learn arithmetic, by jigger. “And I’ll tell you something else — when our shoes wore out, we kept wearin’ ’em till they wore out some more, and then we wore ’em for a

while after that. “Folks seemed to be happier in their misery back then. Course, that was before they started putting chlorine in the water and fooling around with D and A. ... “Now where did that fool child run away to? I haven’t told him about the time I was kidnapped by aliens.” Michael Gillgannon is the former news editor of The Western Producer and managing editor of Western People. Contact: humour@ producer.com.


22

FEBRUARY 6, 2014 | WWW.PRODUCER.COM | THE WESTERN PRODUCER

FARM LIVING

ARGENTINA | 275 WATERFALLS

Iguazu Falls affords stunning views from trail, boat and walkway TALES FROM THE ROAD

ARLENE & ROBIN KARPAN

W

e’re surrounded by a fairytale landscape of multilayered cataracts, interspersed with basalt cliff faces and deep green, jungle-like rainforest. Iguazu Falls is so expansive that every time we round a corner on the network of paths, we’re faced with yet another stunning scene. Iguazu boasts a string of superlatives from UNESCO World Heritage Site to one of the New 7 Wonders of Nature in a worldwide vote in 2011 (www.new7wonders.com). What sets Iguazu apart from other famous waterfalls is that this is not just one wall of water, but a series of 275 cataracts that stretch for almost three kilometres. The wide Parana River takes a sharp curve, flooding a huge area resembling a small lake, then plunges 80 metres over a horseshoeshaped fault line. The falls straddle the ArgentinaBrazil border with national parks and visitor facilities on both sides. Most falls are on the Argentina side,

Waterfalls plunge over the fault lines at Iguazu Falls, which straddles the border of Argentina and Brazil. | where it is generally easier and cheaper to visit. The tourist town of Puerto Iguazu has plenty of accommodation and other services and is close to the park. We walk trails and boardwalks above the tops of falls where we peer over the drop, then follow paths along the base of the walls of water and to intermediate levels where

we’re doused by constant spray. If that’s not wet enough for you, boat trips head right underneath the falls for a proper soaking. The highlight is at the far end of the park, reached by a 20-minute trip on a miniature railway, not much bigger than a kids’ amusement park ride. At the end, we follow a kilometre-long walkway right over the river

PRIMERS / STARTERS / FOLIARS

Challenge Accepted The Canola Council of Canada’s bold new Keep it Coming 2025 plan challenges producers to harvest an average of 52 bushels per acre by 2025. Research at Omex Agriculture Inc. has focused on plant nutrition and health since 1999, dedicated to helping canola reach its genetic potential for quality and yield.

ARLENE AND ROBIN KARPAN PHOTO

to the Devil’s Throat. An observation deck looks over the brink and into the depths of the narrow end of the powerful crescentshaped 80-metre drop. The awesome force of the water, deafening roar and clouds of spray add to the devilish aura. The river is lined by sub-tropical rainforest, where we follow other trails through stands of bamboo, palms and mixed woods. An array of birds and butterflies abound and the occasional capuchin monkey peeks through the canopy. Signs showing a coiled snake don’t need any translation, making it clear that you should stay on the trail. Seeing coatis is practically guaranteed. These sly, raccoon-like critters with long tails and pointy noses are notorious for trying to snatch your food. Iguazu’s most iconic wildlife is the great dusky swift. These small birds constantly dart around the falls, then suddenly seem to disappear. They fly right through the torrents of water to roost and nest on the cliff faces behind the falls. Curious behaviour at first glance, but it’s the ideal haven where no

predators can reach them. From the Argentine capital of Buenos Aires, the falls are 1,400 kilometres northeast. Just getting there turned out to be half the fun. Instead of flying, we opted for an overnight bus. Sixteen hours on a bus isn’t normally our idea of a good time, but we were quickly won over by Argentina’s luxury intercity buses. Most are double-decker, with seats the size of first class on airlines. The seat back folds down and the footstool folds out, which turns it into a bed. Shortly after we left Buenos Aires, the bus attendant came around with champagne. Then supper was served, accompanied by a nice Argentine wine. Before bedtime, the attendant came around again, this time offering a whiskey or liqueur nightcap. With city centre to city centre service and fares a fraction of the cost of flying, this soon became our preferred way of travelling around the country. Arlene and Robin Karpan are well-travelled writers based in Saskatoon. Contact: travel@producer.com.

&XVWRP6ROLG:RRG+HLUORRP3LHFHV

0RGHUQ )XUQLWXUH

'LQLQJ6DOH 6WDUWLQJ )HE0DU

%HVW 4XDOLW\ Speak to an Omex Plant Health Professional at 866-860-9660 or visit omexcanada.com Omex Agriculture Inc. is a market leader in the research, development and manufacturing of the most innovative line of plant nutrition products for the agriculture and horticulture sectors. Visit canolacouncil.org for more information on Keep it Coming 2025.

&LUFOH'ULYH6DVNDWRRQ6.

_DXWKHQWLFIXUQLWXUH#VDVNWHOQHW


FARM LIVING

THE WESTERN PRODUCER | WWW.PRODUCER.COM | FEBRUARY 6, 2014

23

MANITOBA YOUNG FARMERS FORUM | SUCCESSION PLANNING

Succession plan essential to avoid sibling rivalry “Fair is not equal” | Agreement needed for on-farm and off-farm children BY ED WHITE WINNIPEG BUREAU

WINNIPEG — Five University of Manitoba agriculture diploma students who attended the Manitoba Young Farmers Forum Jan. 29 were asked what they hoped to do in agriculture. “I’d like to continue farming and keep it in the family,” said Darren Bestland.

“Fair is not equal,” MacLeod said about the complexities of allowing on-farm children to earn an equity stake in the operation while preventing off-farm children from feeling cheated. “Having a plan for how everybody gets their inheritance is part of that long-term wealth management plan.” MacLeod told young farmers that they also need to encourage their fathers to take money out of the farm operation as profits every year rather than reinvesting everything

in the farm. That practice may help the father avoid paying taxes while he is still actively farming, but the children who take over the farm can face massive tax bills that they will have to borrow money to cover. Adding those interest costs to the other costs of farming can break a young farmer. MacLeod urged young farmers to find a way to get their fathers to deal with these issues. At the KAP conference, he urged delegates to take the lead in showing

Having a plan for how everybody gets their inheritance is part of that long-term wealth management plan. CEDRIC MACLEOD MACLEOD AGRONOMICS

other farmers that succession issues need to be dealt with before retirement or death. Too many young farmers face an impenetrable wall when trying to determine their father’s plans for the

farm, which can prompt them to walk away from the farm. “Don’t be the brick wall,” said MacLeod. “Have a courageous conversation.”

DARREN BESTLAND MANITOBA FARMER

FARM&FAMILY Get succession planning that works for both. Passing your family business to the next generation can seem like a daunting task. As easy as it is to put off, it’s vital to the future welfare for you and your family. With more than 65 years of business succession experience, MNP can assist you with every aspect of the succession process including tax and estate planning, wealth and asset management and valuations. A well-structured plan can also result in significant tax savings and increased value of your operation. Taking stock of your own situation is the first important step. We’re here to help you develop and complete a plan that gives you peace of mind and allows you to successfully transition on your terms. For more information on our TransitionSMART™ program, contact Bruce Tait at 1.800.661.8097 or e-mail bruce.tait@mnp.ca.

TransitionSMART.ca

11/13-21628

Jordan Friesen had the same idea. “That’s what Dad did, that’s what Grandpa did,” said Friesen. “It’s bred in the family and we’re going to keep it going.” Ditto for Mike Wiebe. “The farm has been in the family for a number of years and I just want to keep it going.” Everyone in the group planned to continue with the family farm, but over the next few hours they heard that this will be no simple, automatic or achievable process. Many family farms disappear, and not just because farming is a challenging business. Adviser Cedric MacLeod told the young farmers — as well as a group of older farmers attending the Keystone Agricultural Producers annual meeting the next day — that failing to work out how to give young farmers equity in their family farms is a disaster waiting to happen. Young farmers need to force their fathers to deal with succession planning, and aging fathers need to bite the bullet and make formal plans so that everyone else on the farm knows what’s planned for them. And it isn’t good enough to have a few casual conversations about the future. “If it is not written down, it didn’t happen,” said MacLeod, who operates MacLeod Agronomics in Fredericton, N.B. He said he knows of cases where a young farmer thought he had a certain understanding with his father, but then the father changed his mind, made other commitments or didn’t work everything out, leaving the young farmer in trouble and feeling betrayed. It can lead to families tearing themselves apart after a father dies or retires and on-farm and off-farm siblings discover they are all expecting a bigger share of the farm than they are likely to receive. The off-farm family members expect their fair share, but the ones who have stayed on the farm and put sweat equity into the operation expect to be able to continue farming. Farm succession can easily become impossible if the father hasn’t carefully written down how the assets are to be divided.


24

FEBRUARY 6, 2014 | WWW.PRODUCER.COM | THE WESTERN PRODUCER

FARM LIVING

HEALTH | H1N1

ALCOHOLISM | FAMILIES

Get flu shot to ward off expected March wave Sobriety not Feb. 10 deadline | Influenza has peaked in Saskatchewan but some expect another outbreak next month BY KAREN BRIERE REGINA BUREAU

Saskatchewan residents have until Feb. 10 to protect themselves from an expected second wave of H1N1. Until that date, health regions will offer drop-in and by appointment clinics to vaccinate as many people as possible. Dr. Denise Werker, the province’s deputy chief medical health officer, said Jan. 31 that public health officials have a limited opportunity to vaccinate people. “The reason that Feb. 10 is a turning point is that we now have informa-

tion that, although influenza is circulating throughout the province and still has not yet peaked in the north, we know that this wave is on the way down and the next wave may occur in March,” she said. “If we want people to be protected, it takes two weeks for them to get protected.” The other reason Feb. 10 is important is that the extra doses of the nasal vaccine FluMist the province purchased expire that day. After Feb. 10, vaccinations will still be available for people who require them, such as children younger than nine who need their second dose. As of Jan. 31, the province had 1,184

EXPENDITURES

confirmed laboratory cases, 60 people who had been hospitalized in the intensive care unit and 16 deaths. Three new hospitalizations in the last week included a child younger than five and two adults between 20 and 50. Alberta, as of Jan. 27, had 2,476 confirmed cases, 707 hospitalizations and 17 deaths. In Manitoba, about 400 confirmed cases, 14 ICU admissions and one associated death had been reported as of Jan. 24. H1N1 has not yet peaked in eastern provinces. It has now begun circulating in Europe and Werker said anyone travelling in the next couple of

months should consider a flu shot. Saskatchewan typically spends $1.6 million on influenza vaccine each year and usually vaccinates about 25 percent of the population. The extra doses purchased as a result of the high number of H1N1 cases have cost $1.4 million, Werker said. FluMist is double the cost of injectable vaccine, she said. She added that vaccination rates in children have doubled since Dec. 31 as a result of the extraordinary efforts to protect them. That is critical because influenza is affecting children younger than five at three times the rate it is affecting adults.

answer to all problems SPEAKING OF LIFE

JACKLIN ANDREWS, BA, MSW

Giving up drinking makes spouse irritable, impatient

Q:

My boys and I were excited last year when my husband decided to quit drinking. He was serious this time. He joined AA and spent every night working with his sponsor on his 12-step program. He was a heavy drinker for years, for most of our married life, but he has stuck to it and in a couple of weeks he will celebrate his first year of sobriety. The problem is that he is not all the peaches and cream I imagined he would be once he quit drinking. He is often irritable and is more impatient with our animals than he used to be. I think something needs to change. What do you suggest I do?

A:

Seed

31%

Fertilizer

27%

Crop Protection

18%

Parts and Service 12% Fuel

9%

Feed

3%

Get the inputs you need to keep your business rolling. When you’re empowered with a fast and easy alternative to cash, there’s no stopping what you can do. A multi-use account ensures you have the øe[ibility to purchase the inputs reTuired to keep your business moving forward. Do more with a company that’s been empowering producers for more than 175 years. To learn more, visit JohnDeereFinancial.com/Advantage.

Customers earn one (1) AIR MILES reward mile for every $50.00* charged to their multi-use account. E[cluding fees, late payment charges, interest on late charges and interest on past due interest. AIR MILES rewards miles are awarded based on monthly net purchases. Account must be in good standing. ®™Trademark of AIR MILES International Trading B.V. Used under license by LoyaltyOne, Inc. and John Deere Financial. CR3210870

Alcoholism is a family disease. Du r ing th o se y ea r s wh en you were making compensations for your husband’s addictions and struggling to keep your house in order, you may not have followed a healthy lifestyle. Attend a few sessions of Alanon. It is structured to help spouses and children of alcoholics deal with them better both while they are drinking and once the drinking has stopped. Often, people who are addicted to alcohol and drugs had problems long before they caved in to their addictions. Drinking did not solve the problems but sometimes it masked them. When the drinking stopped, those problems sprang back to the surface. Now that your husband is dry, he could consider talking to a mental health counsellor to make sure the issues in place before he hooked up with alcohol will not come back to haunt him. If his anxiety, inability to focus, h i g h e x p e c t at i o n s o r b o u t s o f depression have resurfaced and they are not challenged, he is vulnerable to another round of alcohol abuse. You could consider joining your husband in counselling. The relationship that the two of you developed to survive those years of alcohol abuse is not likely going to survive his sobriety. It has to change. I do not know the statistics but I know from the many clients I had in counselling that a number of couples separate once the addict has cleaned up. If you and your husband start now rebuilding your marriage, you might not only save it but find peace in his sobriety. Jacklin Andrews is a family counsellor from Saskatchewan. Contact: jandrews@ producer.com.


NEWS

THE WESTERN PRODUCER | WWW.PRODUCER.COM | FEBRUARY 6, 2014

25

SNOWSHOES | TUBBS JOURNEY

Tubbs Journey good choice for those new to snowshoeing OUTDOOR PURSUITS

KIM QUINTIN

T

ubbs Journey snowshoes are constructed from modern designs and materials. They come in 8 x 25 inch, 9 x 30 inch and 10 x 36 inch sizes and weigh 3.9 to 5.6 pounds. An aluminum frame provides support for each shoe. Synthetic material is used for decking, which is what compresses the snow under your step. The decking is wrapped around and connected to the frame with rivets. An adjustable binding accommodates almost any kind of boot. The binding is attached to a rotating pivot designed to ease stepping motion, reduce snow kick up and provide some snowshoe control. Crampons underneath the toe and heel locations of a boot provide enhanced terrain grip. A flip-up bar under the heel is an option for ascending hills with reduced ankle and leg strain. Tubbs makes recommendations about what size of snowshoe to use based on a wearer’s weight and gear, but we found great success in using models one size larger. The snowshoes feel remarkably light when strapped on and the difference in felt weight between models was so negligible that the additional snow float from the larger surface area was worth it. Traditional snowshoes tend to float a wearer higher on the snow than modern designs. However, contemporary snowshoes are generally easier to put on and take off, more comfortable, lighter, more manoeuvrable and easier to maintain and store. Snow compression is more effective because of the normally larger surface area on traditional snowshoes. However, it requires a wider positioning of the feet when traversing, which is uncomfortable and takes time to get used to. Modern snowshoes have a narrower design, which reduces surface area and snow compression but also allows users to position their feet closer together in a more comfortable and natural walking posture. Modern travel has eliminated much of our need for snowshoes, but they still have useful applications. Anyone who has walked through deep snow knows how physically taxing it can be over even short distances. Acreage owners and farmers will benefit from a good pair of snowshoes when needing to attend chores

in areas that are difficult to approach by vehicle. Even areas that can be accessed by all-terrain vehicle or snowmobile may find producers working up to their knees or even hips in snow banks. A pair of snowshoes would make working on the surface of deep snow much easier. Spot and stalk hunters in snow would benefit from a good pair of snowshoes. Even hunters making their way to and from blinds or stands on foot would find traversing snowy fields and trails a lot easier. Snowshoeing is a growing sport for urban residents. People who are

interested in exercising outside should consider it a fun option. Parks and trails during the winter take on a new perspective when exploring them in the winter. If you can walk, you can snowshoe. The Tubbs Journey snowshoes are an excellent choice for beginning or intermediate owners. They provide an excellent cost-to-features balance. We enjoy ours and will continue to use them when the winter temperatures allow. For more information, visit tubbs snowshoes.com. Kim Quintin is a Saskatoon outdoor enthusiast and knife maker. He can be reached for column content suggestions at kim.quintin@producer.com.

Tubbs snowshoes allow a natural walking posture. |

Confidence, right from the start. Axial® provides superior control of even the toughest grass weeds in spring wheat and barley – the kind of reliability you can build an operation around. And that’s why Axial is the #1 graminicide in Western Canada.

SNOWSHOES HAVE BEEN IN USE FOR

6,000 years

Visit SyngentaFarm.ca or contact our Customer Resource Centre at 1-87-SYNGENTA (1-877-964-3682). Always read and follow label directions. Axial ®, the Alliance Frame, the Purpose Icon and the Syngenta logo are registered trademarks of a Syngenta Group Company. © 2014 Syngenta.

MICHAEL RAINE PHOTO


26

NEWS

FEBRUARY 6, 2014 | WWW.PRODUCER.COM | THE WESTERN PRODUCER

1923 THEY PAID

Average price for all types of U.S. wheat was $0.923/bu. (U.S.) A Western Producer subscription was $2/year The average car cost $393 (U.S.) The average house cost $8,142 (U.S.)

Cost of common items

WHAT? through the years:

1943

Average price for all types of U.S. wheat was $3.40/bu. (U.S.) A Western Producer subscription was $54/year The average car cost $25,523 (U.S.) The average house cost $195,000 (U.S.)

1963

TOPLINE PERFORMANCE

Average price for all types of U.S. wheat was $3.51/bu. (U.S.) A Western Producer subscription was $12/year The average car cost $8,500 (U.S.) The average house cost $75,300 (U.S.)

2003

Average price for all types of U.S. wheat was $1.35/bu. (U.S.) A Western Producer subscription was $1/year The average car cost $900 (U.S.) The average house cost $7,608 (U.S.)

Average price for all types of U.S. wheat was $1.85/bu.(U.S.) A Western Producer subscription was $1.50/year The average car cost $3,233 (U.S.) The average house cost $21,102 (U.S.)

1983

2013

Source: Thecostofliving.com, staff research | MICHELLE HOULDEN GRAPHIC

Average price for all types of U.S. wheat was $6.25/bu. (U.S.) A Western Producer subscription was $83/year The average car cost $31,252 (U.S.) The average house cost $391,820 (Cdn.)

then th now n &n

WHITHER WHEAT PRICES? In 1924, projected returns for No. 1 wheat were $1.66 per bu. By the fall of 2013, projected returns at port for No. 1 CWRS, 13 percent protein, were estimated at $8.35 a bu. | BY BRIAN CROSS, SASKATOON NEWSROOM

THE RISING COST OF LIVING

BOTTOM LINE

RESULTS

Full strength value. TopLine™ delivers multiple modes of action with florasulam and MCPA ester, the same actives as Frontline™. TopLine gives cereal growers top-notch control of broadleaf weeds including wild buckwheat, cleavers and chickweed, as well as grassy weed tank-mix flexibility. Support choice – ask for TopLine by name.

manainc.ca ™ TopLine is a trademark of Makhteshim Agan of North America, Inc. All others are trademarks of their respective companies. Always read and follow label directions. 13047.12.13

Was wheat a more profitable crop 90 years ago?

T

hose were the good old days. When The Western Producer, then known as The Progressive, published its first edition in August 1923, times were simpler. Neighbours helped neighbours, fresh bread was a dime a loaf and you could buy a brand new Ford Model T for less than $600. But that’s not to imply that everything was peaches and cream. After all, running water was still considered a luxury by most farm families, rural telephone service was non-existent in most parts of the West and the vast majority of prairie farmers were still hauling grain by horse and wagon. So was life really better in the 1920s? When leafing through past editions of The Western Producer, some interesting comparisons can be made between rural life today and life on the Prairies 90 years ago. For example, an annual subscription to the paper in 1924 was $2, just a bit more than the value of a bushel of No. 1 Northern spring wheat marketed through Saskatchewan’s recently formed provincial wheat pool. On Sept. 3 of that year, the newspaper reported on its front page that a proposed final payment of 11 cents per bushel would be distributed to farmers who sold No.1 Northern wheat through newly formed provincial wheat pools in Saskatchewan, Manitoba and Alberta.

That final payment, when combined with initial and interim payments of $1.55, bumped the total payment up to $1.66 a bu. “The first year’s operation of the joint pools will be most satisfactory to their members,” the paper reported. “Not only has the influence of orderly marketing had the effect of stabilizing the price upward for the whole market, but the real average price of the season on this basis has been obtained for some 50 percent of the farmers of the West. Every expectation of the advocates of this system of marketing has been more than realized.” The value of wheat in 1924 relative to today makes for an interesting comparison. Projected returns for No. 1 wheat were $1.66 per bu. nearly 90 years ago. In the fall of 2013, projected returns for No. 1 CWRS, 13 percent protein, were estimated $307 per tonne in store at port, or roughly $8.35 a bu. Assessing the real value of a bushel of wheat in 1924 is difficult, largely because it is impossible to accurately gauge inflation over that period. However, a review of consumer prices in 1924 provides context. According to the Chicago Daily News Almanac, bacon was 37 cents per pound in 1924 Chicago, eggs were 48 cents a dozen and milk was 56 cents a gallon. Thecostofliving.com, an American website that monitors inflation and the price of consumer goods, says the average car in 1924 was priced

around $375 while the average worker earned $1,066 per year. The average house price in the United States was $8,142, or 7.6 times the average annual income. According to the Bank of Canada, a basket of consumer goods that cost $10 in 1924 would cost roughly $137 today, denoting a annual compounded inflation rate of 2.98 percent over the past 89 years. Using that same rate of inflation, a bushel of wheat that was worth $1.66 in 1924 should be worth roughly $22.75 today. Comparing the value of any single commodity over such a long period is difficult, suggests U of S economist Robert Lucas. That’s because products available in the marketplace were far different in the 1920s than they are today. As such, direct comparisons can be misleading. “According to the Bank of Canada calculator, www.bankofcanada.ca/ rates/related/inflation-calculator/, something that cost $1 in 1924 would cost $13.70 today,” Lucas said. “But this figure should be taken with a grain of salt, since most of the goods today did not exist in 1924.” University of Saskatchewan agricultural economist Richard Gray recently provided more context about Canadian wheat prices and their value relative to the consumer price index (CPI). CONTINUED ON NEXT PAGE

»


NEWS He said in an email that the price index was established at a base value of 100 in 1981. Working backward from that value, Gray estimates the 1924 CPI at 18.2 and the 2013 CPI at roughly 215. In other words, a basket of consumer goods that cost $18.20 in 1924 is now worth roughly $215. Extrapolating from those numbers, Gray estimates that the real value of a

bushel of wheat today, all other things being equal, should be in the neighbourhood of $19.40 per bu. “This (is) a little approximate … but it is in the park.” Saskatoon economist Bill Brown agreed that the current value of wheat relative to other consumer goods appears to be lower today than it was 90 years ago. However, Brown said Canadian

wheat farmers are more productive today, as are domestic and global wheat supplies. As well, supply and demand are the primary factors that determine the value of any commodity. “Obviously there was deflation in the 1930s, but it would appear the current price is lower than in 1924,” Brown said. “However, the early 1920s were

THE WESTERN PRODUCER | WWW.PRODUCER.COM | FEBRUARY 6, 2014

pretty good years for wheat and now farmers produce a lot more wheat per acre as well,” he said. “These kinds of comparisons are always dangerous because so many things have changed.” And how about The Western Producer? How have its annual subscription rates fared over the past 90 years, relative to the consumer price index?

27

That $2 annual subscription rate in 1924 has since increased to $82.92 per year plus applicable taxes, a cumulative inflation rate of 4,146 percent, before tax. At today’s prices, that’s roughly 10 bu. of wheat for 52 issues. A brief footnote: The Western Producer published about 16 pages per week in the mid-1920s, compared with roughly 88 per week today.

IN THE FEB. 13 ISSUE:

Then & Now: Landrace pigs were an important part of the Canadian hog industry, even if you won’t find one on most farms. See the rest of this series online at www.producer.com.

FEEL THE

RUSH

Beat broadleaf weeds FAST! EXCERPT | SEPT. 3, 1925

EXCERPT | SEPT. 3, 1925

GREATEST ACHIEVEMENT IN AGRICULTURAL HISTORY

SENATE REFORM

FINAL PAYMENT OF THE WHEAT POOL IS DECLARED; BRINGS THE PRICE TO $1.66 BUS., BASIS NO. 1 The final Pool payment for the 1924 crop is now ready for distribution. The basis of payment is $1.66 per bushel, after deducting carrying charges in both country and terminal elevators. The first year’s operation of the joint Pools will be most satisfactory to their members. Not only has the influence of orderly marketing had the effect of stabilizing the price upward for the whole market, but the real average price of the season on this basis has been obtained for some 50 percent.

The executive report of the Trades and Labor Congress, meeting in Ottawa this week, states that “the time has arrived when amendments to the British North American Act should be secured, which would give greater authority to the Dominion parliament and bring about more centralization of our laws which vitally affect the condition of wageearners in this country, and that it is only by such a step that any essential special reform can be brought about and made equally applicable to all citizens of Canada.”

Rush 24™ contains the powerful combination of fluroxypyr and 2,4-D ester, two highperformance Group 4 actives. With the same active ingredients, rates and weed control as OcTTain™ XL, Rush 24 controls a wide spectrum of broadleaf weeds in wheat and barley. Support choice – ask for Rush 24 by name.

manainc.ca ™ Rush 24 is a trademark of Makhteshim Agan of North America, Inc. All others are registered trademarks of their respective companies. Always read and follow label directions. 13048.12.13


28

FEBRUARY 6, 2014 | WWW.PRODUCER.COM | THE WESTERN PRODUCER

ol of many broadleaf weeds, including: cleavers, narrow-leaved hawk’s beard, kochia, flixweed, lamb’s-quarters, cow cockle, volunteer canola wild buckwheat and wild mustard.

rassy weed ix partners

de® II

Barricade® II herbicide is powere Soluma

Barricade® II delivers multiple modes of action from two different herbicide groups – Group 2 and Group 4.

Barric

Barricade® II herbicide is today’s smart choice for preventing weed resistance

NOTHING GETS PAST BARRICADE II. ®

When tough broadleaf weeds invade your cereal crops, it’s no time for half-measures. You need action now. With a new and more concentrated formulation, DuPont™ Barricade® II herbicide leverages the strength of three active ingredients from 2 different groups (Group 2 and Group 4) to keep broadleaf weeds far away from your crop. Powered by Solumax® soluble granules, Barricade® II also delivers one-hour rainfastness and easier, more consistent sprayer cleanout. It’s no wonder growers made it Western Canada’s premier broadleaf herbicide for cereals.

Barricade® II. Raise the bar on your broadleaf weed control. Questions? Ask your retailer, call 1-800-667-3925 or visit barricade.dupont.ca As with all crop protection products, read and follow label instructions carefully. The DuPont Oval Logo, DuPont™, The miracles of science™, Barricade® and Solumax® are registered trademarks or trademarks of E. I. du Pont de Nemours and Company. E. I. du Pont Canada Company is a licensee. Member of CropLife Canada. © Copyright 2014 E. I. du Pont Canada Company. All rights reserved.

Powerful control


THE WESTERN PRODUCER | WWW.PRODUCER.COM | FEBRUARY 6, 2014

29

many grassy weed tank-m partners Superior crop safety recropping flexibility.

ed by ax® soluble granules

Solution for

cade® II

An effective, time-savin formulation. Barric is powered by DuPont™ Solumax® solub granules, combining the

rotatation Barricade® II

cereal c


30

NEWS

FEBRUARY 6, 2014 | WWW.PRODUCER.COM | THE WESTERN PRODUCER

BEAN RESEARCH | AGRONOMY

Bean trials examine ways to increase yield, profits Trials showed a yield increase of 80 kilograms per acre in densely planted rows BY BARBARA DUCKWORTH CALGARY BUREAU

Alberta researchers are evaluating seeding rates, row spacing and fertilizer use to maximize yields and reduce input costs. | FILE PHOTO

LETHBRIDGE — Beans are big business in southern Alberta. Up to 50,000 acres of irrigated land are planted each year to pinto, white, great northerns, red, yellow and black beans worth about $60 million. Alberta Agriculture agronomist Pat Pfiffner said it is the second highest valued irrigated crop on a per acre basis. Beans, which have been grown since the early 1970s, are seeded in neat, wide rows. However, Pfiffner told an irrigation production conference in Lethbridge Jan. 21 that recent research shows they could be planted more densely for better yields.

Public Notice FUNDING AVAILABLE TO PARTICIPATE IN THE NEB’s REGULATORY PROCESS REGARDING THE INTEGRATION ASSET TRANSFER PROJECT

The National Energy Board (the NEB or the Board) is making available $250,000 under its Participant Funding Program to assist landowners, Aboriginal groups, incorporated nonindustry, not-for-profit organizations, and other interested persons as they participate in the regulatory process to considerthe Integration Asset Transfer Project, as proposed by NOVA Gas Transmission Ltd. (NGTL). NGTL filed an application with the Board requesting approval for the acquisition of certain assets currently owned by ATCO Gas and Pipelines Ltd (ATCO) to become part of the ongoing operations of the NGTL System. The Board is also being asked to approve the sale by NGTL to ATCO of certain assets currently forming part of the NGTL System. The exchange of assets includes: • NGTL Transferred Assets, which are comprised of metering facilities (31 delivery and 89 receipt meter stations) and pipeline facilities (1,1418 km); and • ATCO Transferred Assets, which are comprised of compressor stations (1), metering facilities (12 delivery and 21 receipt meter stations) and pipeline facilities (1,303 km). To accommodate the number of assets involved and the field work required to complete the transfer of ownership, NGTL and ATCO plan to execute the assets swap in four stages (tranches). NGTL is proposing that a separate certificate of public convenience and necessity (CPCN) be issued for each Tranche and each CPCN be made effective as of the date of the closing of the respective stage.

Funding is being made available to help those persons who are directly affected or have relevant information or expertise as they review and comment on this project application submitted by NGTL. Funding must be used to prepare for and participate in the hearing process, which will be announced by the Board at a later date. A funding review committee, independent of the regulatory process, will consider all applications for funding and make recommendations on the allocation of funds. Funding applications should be submitted as soon as possible. The hearing date will be made public once it’s been confirmed. Funding will only be awarded for hearing related activities conducted after a PFP application has been approved. Please review the Participant Funding Program Guide to determine when and how to apply for funding and what will be covered by this funding. Interested persons are encouraged to review information on the proposed project before submitting an application. This information, as well as the Participant Funding Program Guide, the Application for Funding Form and the Contribution Agreement can be found on the Board’s website (www.neb-one.gc.ca) under Public Participation.

For more information about the Participant Funding Program: Lou Prieto, Participant Funding Program Coordinator Telephone: 403-299-3130 Telephone (toll free): 1-800-899-1265 ext. 3130 E-mail: PFP.PAFP@neb.one.gc.ca Web site: www.neb-one.gc.ca

A four year trial starting in 2010 evaluated seeding rates, row spacing and use of seed inoculants and fertilizer to increase yields. Beans yield about 2,300 pounds per acre, and they are planted in wide rows 22 to 30 inches apart. Seeding is done with a row crop planter, and the crop is rolled after seeding to smooth out fields. Harvest requires specialized equipment. The research tried narrow row spacings ranging from seven to 15 inches apart. They also used varying rates of fertilizer because beans benefit from a shot of nitrogen. “As we increase our nitrogen fertilizer rates, we have a dramatic yield increase,” Pfiffner said. “Beans are a highly responsive crop to nitrogen fertilizer application.” More seeds in narrower rows means farmers can expect better seed bed use, which is the percentage of the seed bed occupied by seed. Research plots were seeded at rates of 10, 25, 40 and 55 seeds per sq. metre on the assumption that more plants would make better use of nitrogen and water and would have reduced runoff. Closer rows use the space better, but there were challenges with crusted soil and good plant emergence. There may also be more susceptibility to white mould once the plants start to fill in the canopy. However, researchers found that densely planted, narrow rows tended to have increased yields by as much as 80 kilograms per acre. Fertility experiments with and without inoculants showed differences in nitrogen fixation. Researchers used zero, 27, 53 and 80 pounds of nitrogen per acre with and without inoculants. Beans tend to be the least efficient nitrogen fixers among the legume family when fertilizer and inoculants aren’t added. Conversely, fababeans and peas are the most efficient. Researchers saw as much as a 50 percent improvement in bean yields when inoculants were used, increasing them by as much as 70 kg per acre. The inoculant invades the root hairs of the bean plant, and the cortex cells begin to multiply to use nutrients and energy to make root nodules. The bacteria convert or fix different forms of nitrogen within the nodules. Researchers also learned that nodulation performance is sensitive to genotype, in which one strain of beans fixes nitrogen better than others. Drought, high temperature and soil nutrient levels affect nitrogen fixation of these plants. Researchers tried urea and slow release nitrogen products but did not see much difference between the two. Pfiffner said more study is needed because researchers think fertilizer should be applied earlier in the season. “With in-crop nitrogen application, the timing is critical,” he said. The concept of tighter seeding rates and solid seeded fields is not new. Fifteen percent of farmers contracted to Viterra are trying this style, but Pfiffner said it is not likely going to take over from row crop farming. “If you are a grower and this fits into your farming operation, you have to place a value on that.”


NEWS

THE WESTERN PRODUCER | WWW.PRODUCER.COM | FEBRUARY 6, 2014

31

WATER CONSUMPTION | CALIBRATING THE COST

Assessing water use can be expensive, difficult task Systems to determine soil moisture | Programming the soil probes or metering systems and interpreting data requires expertise BY BARBARA DUCKWORTH CALGARY BUREAU

LETHBRIDGE — LeRon Torrie wanted to know what his water was costing him. The only way to find out was to install meters on his irrigation system near Grassy Lake, Alta. He also wanted to know how much the electricity cost to run his pumps because even though he analyzed his bill every year, there were still gaps in the information. “I want to know what an acre inch really costs,” he said at an Alberta irrigation production conference in Lethbridge Jan. 21-22. Torrie has watched the irrigation business evolve from gravity fed waterers to low pressure pivots, which along with computers were brand new when he returned to the farm from university in 1976. Different crops use different amounts of water, which can be significant in cost. He sees society forcing changes on sharing and allocation as the competition for water increases. Farmers are now charged for the delivery of water but not the amount. “I think we are going to be forced into water metering,” he said. Torrie wanted something simple to assemble and maintain that would still give him a reliable measure of water use on his sandy soil. He also wanted to know how much domestic water his family was using. He is a board member for the St. Mary’s Irrigation District, which allows farmers to use one to four acre feet of water for domestic purposes on any irrigated parcel. However, it is not metered. He has two yards of two acres each and fills a dugout with irrigation water for domestic use. Torrie quickly learned that water meters can be expensive and might be difficult to maintain, but he eventually found one that cost less than $2,000. The Seametrics AG2000 flow metre runs on lithium D batteries, and the accuracy of the meter is plus or minus one percent. The battery life appears acceptable and it has overwintered well. However, the manufacturer recommends covering it. He has learned after two years of use that his family uses 2.35 acre feet of water for domestic use, which puts them within the district allowance. They are learning which pivots work efficiently and which need upgrades to deliver water on crops rather than into the atmosphere. The ability to assess water use can also improve yields, said Ted Harms, a soil and water specialist with Alberta Agriculture. Many farmers still dig into the soil with an auger to assess moisture, but numerous soil water sensors are available to help decide when to turn on the water. They measure the water in the soil profile so farmers know if there is enough or too little available for plant roots to reach. A tensiometer uses soil parametres to assess water availability. Tension goes up as soil dries. Low tension means low water levels, although soil texture also influences the readings. “Tension is related to the soil moisture, but the value is nothing unless

Irrigation rates must be adjusted to soil type. | you know your soil texture,” he said. Other systems use probes to send pulses into the soil. The slower the velocity of the signal, the higher the

FILE PHOTO

water content. Harms has tested the various systems and found good and bad qualities. Some were hard to figure out and

others took an entire growing season to calibrate properly. In the United States, 10.4 percent of irrigators use soil water instruments for irrigation schedules, while the use rate varies from six to nine percent in southern Alberta, where most growers prefer a manual auger. However, producers who switch to variable rate irrigation will need better probes because they must know their soil water status so the pivot computer can be programmed to supply varying rates of water to different zones in the field. Harms has concluded the systems

are not for everyone. In many parts of the world, consultants continually monitor soil water and advise clients on soil water status within irrigation fields. “These systems are expensive addons to an irrigation system and they all work,” he said. Many require soil specific calibrations to improve accuracy. “The expertise required for interpretation of sensor data to determine when I irrigate and how much, and programming the specific software, limits this technology to the research or consultant’s realm,” he said.

The 24/7, all season nitrogen buffet. ESN® SMART NITROGEN® is always there for your crops. One application will typically give your crops the N they need throughout the growing season. The polymer coating reduces the risk of nitrogen loss to the environment, and you can apply ESN at up to three times the seed-safe rate of urea. It improves crop quality and yield. Get the facts from your retailer, or visit SmartNitrogen.com.

©2014 Agrium Advanced Technologies. ESN; ESN SMART NITROGEN; SMARTER WAYS TO GROW; A SMARTER SOURCE OF NITROGEN; A SMARTER WAY TO GROW; and AGRIUM ADVANCED TECHNOLOGIES and designs are all trademarks owned by Agrium Inc. ESN is a fertilizer and not meant for human consumption. 01/14-22720-B-01r


32

FEBRUARY 6, 2014 | WWW.PRODUCER.COM | THE WESTERN PRODUCER

NEWS

ONTARIO TOMATO PROCESSING | HEINZ PLANT CLOSURE

Ontario tomato growers hope Heinz will retain juice processing division BY JEFFREY CARTER FREELANCE WRITER

LEAMINGTON, Ont. — A small reprieve is expected for Ontario’s processing tomato growers, who are still reeling from the announcement that H.J. Heinz Company plans to close a local plant. “Everyone thinks the juice business is going to stay in Ontario. Of the 225,000 to 250,000 tons Heinz did (per year), 40,000 to 50,000 tons was for juice. You can’t make it out of paste in Canada and call it juice,” said Ontario Processing Vegetable Growers director Walt Brown. “As of the moment, there has been no announcement.… We were talk-

ing to the Heinz people and they said it (a decision) would come in a week or two.” Brown said a co-packing arrangement with one of the remaining tomato processors is the most likely outcome. He doubts that a deal will be struck to keep the 100-year-old Heinz plant in Leamington open. Four tomato canners are left in the province, all located in southwestern Ontario. The two largest are ConAgra Foods in Dresden and SunBrite Foods near Leamington. Brown, a processing tomato grower for 47 years, is among the former Heinz growers resigned to growing just corn, wheat and soybeans.

Others, like Frank Furlan near Chatham, are looking for a replacement crop. “It will be difficult to find a transition crop that will supply that kind of cash flow that tomatoes had.… Not that tomatoes were all that profitable, but they provided cash flow and some years they were the most profitable crop we grew,” he said. “I was born in tomatoes. My father had tomatoes. We went from handpicked to machine harvest. It will be quite a transition on our farm to switch to something else.” Furlan and his brother already grow fresh market pumpkins and gourds and would like to add another specialty crop to the mix, but only if

there’s a reasonable opportunity for profit. Ontario’s agriculture ministry has been promoting crop alternatives for several years. Most recently, it has focused on replacing fresh produce that is mainly imported. Lana Culley with the Vineland Research and Innovation Centre said niche crops have potential but demand is limited. For example, 500 acres of okra production could replace imports to Canada during the few weeks the crop can be harvested in southern Ontario. Similarly, 200 acres of production would be needed to replace long and

354,999 TONS OF TOMATOES WERE HARVESTED IN ONTARIO IN 2013 round eggplant imports. “We’d like to get to 20 percent of import replacement in Ontario and then let the market decide from there,” Culley said. The 46 farmers who grew for H.J. Heinz in Ontario last year grew 6,000 acres of tomatoes. Average production in the province has grown substantially over the past 20 years to rival California yields. Many of the tomato acres are irrigated through a system of ponds and a multimillion-dollar irrigation system near Leamington, which draws Lake Erie water. The farmgate value of Ontario processing tomatoes has been $50 to $65 million in recent years.

FARM LABOUR | HIRING

Software designed to help find ideal rural employees BY REBECA KUROPATWA FREELANCE WRITER

An Ontario professor has created computer software that helps rural employers better manage their workforce. Sarah Mann, an associate professor of organizational behaviour and strategic human resource management with the University of Guelph, said properly worded interview questions and performance appraisal questions are vital when hiring and retaining workers. “(But) through my research … it was found that rural employers rarely implement HRM (human resource management) practices at all: no structured interview questions or performance appraisals,” she said.  “Throughout my interactions with many growers, farmers, producers, etc., in rural Ontario, it’s been brought to my attention that they’d benefit greatly from a computer program that would help them develop such questions.” Her software prompts Ontario

employers to enter the duties of a particular job. It then produces structured interview questions and performance appraisal measures that are job content valid and reliable. Mann said the questions and measures are legally defensible because they are based on the job content. They are also expected to increase employees’ motivation and performance as they realize that the process is fair and transparent. As well, it is hoped the structured interview questions increase the likelihood of finding workers who are a strong fit for the job. Mann hired a graduate research assistant to help develop the website and human resources tools, using publicly available data on jobs and job descriptions in the agricultural sector. Some of the tools are free and the rest have a minimal cost to recover what was spent on development.   “Just because you pay for a tool doesn’t make it any more valuable.” The website can be found at aghr management.com.

ACQUISITION | CANADIAN COMPANY EXPANDS

Saputo wins majority control of Australia’s Warrnambool SYDNEY, Australia (Reuters) — Canada’s Saputo Inc. has secured majority control of Australia’s Warrnambool Cheese and Butter Factory Co. Holdings Ltd., putting pressure on rival bidder Murray Goober Co-operative Co. to concede defeat. Saputo said it had increased its shareholding in Australia’s oldest dairy maker to 52.7 percent, giving it control after a months-long battle aimed at tapping growing demand in Asia for traditional dairy products and high-tech milk extracts. Murray Goulburn said it would

“commercially assess” its 17.7 percent shareholding, noting that Saputo’s offer rises to $9.20 Aus per share from the base $9 per share, or $515 million, having reached the 50 percent threshold. Saputo’s offer will rise again to $9.40 per share on 75 percent acceptances, and $9.60 per share, or $537 million, on 90 percent acceptances. That top level puts it above Murray Goulburn’s $9.50 per share, or $532 million, offer, but it is conditional on the acceptance of 50 percent and regulatory approval.

ANOTHER STELLAR TM

PERFORMANCE.


NEWS

THE WESTERN PRODUCER | WWW.PRODUCER.COM | FEBRUARY 6, 2014

33

RESEARCH | FLUKE ELIMINATION

Portable diagnostic test kit designed to speed treatment Detecting fluke parasite | The on-farm testing kit delivers results in less than 10 minutes, allowing producers to protect their herds BY MARGARET EVANS FREELANCE WRITER

LINDELL BEACH, B.C. — Irish scientists are working on an innovative tool to accelerate the fight against liver fluke in sheep and cattle. The Flukeless diagnostic test kit combines the latest in diagnostic devices, tracking systems and DNA testing to help identify and eradicate the parasite. Blood testing and/or a fecal egg count from retrieved dung are the current methods used to detect the parasite. “(The idea) is that the tool Flukeless can be taken out to the farm,” said Dr. Alan O’Riordan, principal investigator at the Tyndall National Institute in Cork, Ireland. “There is (currently) no electronic

ALAN O’RIORDAN TYNDALL NATIONAL INSTITUTE

device that you can take into the field, take a blood sample from a cow and find out if that cow has liver fluke or bovine respiratory disease or any other disease that cattle get.” Currently, blood samples can take up to three weeks to get laboratory results. And fecal egg counts require a lab technician to look at stool samples under a microscope to identify eggs. But eggs aren’t visible until the cow has built up enough parasites in

the liver to produce the eggs, which are then passed through its system. “A (on-farm) blood test would be simpler, quicker, cheaper and more pleasant all around,” said O’Riordan. “We can design the chips. We can do multiple testing on one chip, we can test 12 cows on one chip or one chip can test for 12 different diseases in one cow. You will be able to get results back in five to 10 minutes.” That efficiency should help farmers find effective treatments quickly, mitigate against antibacterial resistance and protect the overall herd. The goal is to develop a low-cost, electro-chemical biosensor on plastic chips that can be used to diagnose animal diseases on site. The Flukeless kit will also be able to examine an animal’s genetics so

farmers can make informed breeding decisions. “Flukeless is different in that we’re going to use the sensor for genomics,” said O’Riordan. “Some animals are more predisposed to liver fluke than others. With this information, you can do selective breeding.” O’Riordan said the kit will help farmers avoid having to medicate all animals. “A farmer may say that an animal looks a bit dodgy so he whacks it full of antibiotics. Then you have this immune resistance buildup. Those

residues are in the milk and meat. That’s a waste economically, and you are exposing humans to traces of medication.” He said producers will also be able to test for where an outbreak is located and assess risk. The animal health company Zoetis has joined with the project and uses the data to develop a geographical system. “The data can be collected quickly and cheaply on farms and the information will be fed into geographical systems. Then we can predict where fluke outbreaks could occur.”

ALL ABOUT FLUKES • Various species of liver fluke exist in North America. • The parasite can depress appetite and affect digestion, which leads to cattle being underweight and more susceptible to other infections such as salmonella and tuberculosis. • Sheep can suffer from bottlejaw, reduced fertility and anemia, which can be fatal for lambs. • Left unchecked, liver fluke can also cause liver damage. Life cycle • The liver fluke is a flatworm with a life cycle that starts as an egg and requires moisture and warm temperatures. • The egg passes out of the cow or sheep in dung and then seeks a mudsnail as an intermediate host. • Inside the mudsnail, they morph from their miracidia stage into the cercaria stage. For every miracidium entering a snail, 600 cercaria may emerge. • They migrate to grass, where they transform into their next stage, metacercaria. • Livestock eat the grass and once larvae are inside the host body

A liver damaged by fluke parasites. | FILE PHOTO they migrate through the liver to the bile ducts, where they become 2.5 centimetre adult fluke worms, consuming blood, producing eggs and starting the next cycle. • The common liver fluke infects cattle, sheep, bison, deer, swine, and llama. Elk and caribou are the main hosts for the giant liver fluke. • Depending on the degree of infection, liver fluke can reduce meat production by 20 percent in cattle and 30 percent in sheep and reduce milk production by up to eight percent in dairy cows. Beef cattle may take an extra 80 days to reach market weights. Source: Margaret Evans

GM CORN | CONTAMINATION FEAR

U.S. grain groups ask Syngenta to delay GM corn banned by China

Top-performing annual broadleaf weed control + superior resistance management. • The best weed control performance in wheat, barley and oats • Controls cleavers, buckwheat, chickweed, hemp-nettle, kochia, more • Two modes of action, three actives, overlapping control • Get all the benefits of Stellar in your oats too

AND SAVE BEFORE MARCH

20th.

Go to cerealsolutions.ca or call 1.800.667.3852. ® TM

Trademark of The Dow Chemical Company (“Dow”) or an affiliated company of Dow. 0114-22076-11

WASHINGTON, D.C. (Reuters) — Two leading U.S. grain groups have asked Syngenta AG to suspend the commercialization in the United States of two genetically modified strains of corn not approved in China. The National Grain and Feed Association and the North American Export Grain Association wrote to Syngenta, asking it to hold back on its Agrisure Viptera and Duracade corn varieties until China and other U.S. export markets have granted regulatory approval. “Numerous negative consequences” follow when export markets are put at risk through commercialization of GM seeds before import approvals are obtained, the groups said. Multiple cargoes of U.S. corn, totalling 600,000 tonnes, have been rejected by Chinese authorities since November because they contained the Agrisure Viptera variety, known

as MIR 162, which has been awaiting Beijing’s acceptance for more than two years. “NAEGA and NGFA are gravely concerned about the serious economic harm to exporters, grain handlers and, ultimately, agricultural producers ... that has resulted from Syngenta’s current approach to stewardship of Viptera,” the groups said. The intended product launch of Duracade “risks repeating and extending the damage. Immediate action is required by Syngenta to halt such damage,” the associations said. They also urged U.S. farmers to “evaluate these issues” when preparing to plant corn this year. Syngenta recently said its Agrisure Duracade variety will be available for planting for the first time this year in “limited quantities” after U.S. authorities cleared it for sale and cultivation last year.


34

FEBRUARY 6, 2014 | WWW.PRODUCER.COM | THE WESTERN PRODUCER

NEWS

FORAGE | TRITICALE PRODUCTION

Ont. dairy producers pleased with triticale forage Addition to corn | Triticale is highly digestible and milk yields are good TOM KILCER AGRONOMIST

BY JEFFREY CARTER FREELANCE WRITER

RIDGETOWN, Ont. — Interest among New York dairy farmers in triticale as a silage crop is spilling over into Ontario. Performance trials are underway and at least one small field was planted last fall, says Peter Johnson, a wheat specialist with Ontario’s agriculture ministry. Dairy farmers in western New York state are growing 15,000 to 20,000 acres a year, said U.S. agronomist Tom Kilcer. “It gives you some of the highest quality forage you can produce, and dairy farmers want it,” he said during the Southwest Agriculture Conference Jan. 7. Kilcer, a former Cornell University extension worker, said triticale was developed in the late 19th century as a cross between winter wheat and rye. It can be grown for its grain, but it’s the forage potential that’s caught the attention of the dairy industry. Harvested in May, protein comes in around 16 to 17 percent and the

For high yields, triticale that is grown as forage must be planted early with applied nitrogen. | neutral detergent fibre is highly digestible. Allan Spicer of CanGrow Crop Solutions said he sold the Fridge variety to a dairy farmer near Tillsonburg, Ont., who is growing 60 acres. Ontario farmers could potentially harvest three crops over two years with triticale in the rotation, he

added. It can be planted following wheat or silage corn, while no-till soybeans can follow when harvested as silage in May. When grown for grain, Kilcer said triticale should be planted around the same time as winter wheat in Ontario: the latter half of September or early October.

FILE PHOTO

When used as a forage crop, it needs to be planted earlier with nitrogen applied to increase the yield. Kilcer said New York dairy farmers have been harvesting eight to 12 tons per acre. “We’ve planted it at the end of October,” he said. “For forage, your yield goes down

with a later planting. If you drill it at the right depth it over-winters just fine.” Kilcer said dairy producers have been pleased with their milk yield when feeding triticale. He doesn’t see it as a replacement for corn silage but rather as a way dairy producers can spread their risk over two different crops. Castor is another potential crop alternative for Ontario farmers, Kilcer said. The oilseed is used primarily as a feedstock for industrial lubricants but is also found in paint, insulation, solvents and cosmetics. Yields of more than 2,500 pounds per acre with a 50 percent oil yield are possible. The crop’s ricin content is a challenge. The toxin can be easily denatured with heat processing, but Canadian farmers require a special government permit to grow the crop. Marketing is another challenge. Demand is rising, but growers would still need to establish a relationship with end users.

oktire.com

Service THAT STACKs UP.

OK Tire carries a wide range of tires for farm equipment - everything from tractors to combines. The best part is we service every tire we sell – and with locations across the country, you’re always close to help when you need it. For the latest specials on farm tires stop into your local OK Tire or visit oktire.com.

™ The OK Tire mark is a trademark of O.K. Tire Stores Inc.

®

Firestone is a registered trademark of Bridgestone Licensing Services Inc., used under license.


NEWS

THE WESTERN PRODUCER | WWW.PRODUCER.COM | FEBRUARY 6, 2014

35

GRAIN MOVEMENT | SOLUTIONS

ALBERTA IRRIGATION | WATER QUALITY

Oil pipelines touted as way to ease rail congestion

Few water quality problems in irrigated regions

Gary Stanford isn’t having the same problems with the congested grain transportation system this winter that many other farmers are experiencing. Fifty percent of last year’s harvest is still in the bins, but it has all been forward contracted and will be off his southwestern Alberta farm by May. However, as president of Grain Growers of Canada, he knows the frustration producers are going through as they struggle to sell crops. “We’re doing some work now at the Grain Growers with the other farming groups in Western Canada,” said Stanford. “We’re trying to measure to see how much more railways can handle, if there is enough locomotives to handle moving the grain, enough conductors to run the locomotives, and to find out how many more trains can be put on the track.” One of the culprits this winter has been increasing oil shipments by rail, which Stanford said is only expected to get worse. “In five years, they’re talking about quadrupling the amount of oil going on the railways,” he said. “If that happens, it would congest more of the railway system.” He said one solution is to build more oil and gas pipelines. “I wouldn’t mind having my field dug to put in a pipeline,” he said. “The companies that do it are very good at restoring the field to its original condition, so the farmer can resume cropping with as few interruptions as possible.” Stanford said he has spoken with representatives from the railways and grain companies to ensure that it is possible to continue moving at full speed for the rest of the winter and into the spring because most bins need to be empty before harvest. “We’re looking at short-term solutions, but also our major concern is long-term solutions to prevent this from happening again.” Stanford said it’s important that farmers have a place at the table during these discussions and voice their concerns so that government ministers can understand the problem and know that they need to figure out a way to make the situation better right now as well as for the long haul. “When it’s busy in the winter, there will always be a few ships waiting for a few days to get loaded at the ports,” said Stanford. “That’s the norm. We don’t want to see them sitting there any longer than they have to, as then farmers end up paying the waiting bill.” He said the responsibility for solving the problem lies with the entire industry and not just the railways. “Grain companies need to ensure they are in good standing with the other countries or companies buying the grain, keeping on top of what needs to happen right after harvest to timely meet the demand,” he said. “We, as farmers, want to move it as fast as we can, but countries need to put in their orders with grain companies and ensure ships will be there to take the grain.”

CALGARY BUREAU

LETHBRIDGE — Water in Alberta’s irrigation canals is getting top grades. The province has been testing water in the province’s 13 irrigation districts since 2011, and with a few exceptions the results have been good, said Jollin Charest of Alberta Agriculture’s irrigation branch. The most recent results produced an average score of 91.3 out of 100 for irrigation. Five sites did not have excellent or good water quality, largely because of pesticides and fecal coliforms.

Clean water for livestock, aquatic life and food production is essential, but quality tends to degrade in some places as agricultural activity increases, Charest told an irrigation conference in Lethbridge Jan. 22. Southern Alberta’s irrigation system delivers water for agriculture as well as about 40 municipalities, wildlife habitat and recreation on the reservoirs. Sixty percent of fed cattle are finished in irrigation regions. Samples are tested four times during the irrigation season, starting in May and continuing throughout high demand periods. Fields are tested to measure nitrogen and phosphorus

levels, salts, metals, pathogens and pesticides to determine if water is safe for a specific use, such as livestock, irrigation and recreation. Charest said nutrients are present in the water supply. “Phosphorus and nitrogen are essential for plant growth, but if they are too high they contribute to algae growth,” he said. Their presence may also contribute to eutrophication, which depletes water oxygen and kills fish. Salinity is naturally present and includes sodium, potassium, calcium, chloride and sulfates. “These can be problematic if they

are in high concentration as they can interfere with root water uptake,” he said. Samples show salt concentrations are still within guidelines. Staff tested for 25 metal compounds, including arsenic, lead, copper, iron, mercury, zinc and aluminum. Compliance was 98 percent under irrigation and livestock guidelines. Testing has found small traces of E. coli O157:H7, salmonella and campylobacter. Guidelines differ for irrigation and recreation. Testing also looked for 107 pesticides. Among herbicides, 2,4-D was detected 85 percent of the time but at extremely low levels.

Get the cleanest fields in the fastest way possible this spring. Tank-mix glyphosate with Heat® herbicide and you’ll get the most complete control from your pre-seed and chemfallow applications. Learn more by visiting agsolutions.ca/heat or calling AgSolutions® Customer Care at 1-877-371-BASF (2273).

AgSolutions is a registered trade-mark of BASF Corporation; HEAT and KIXOR are registered trade-marks of BASF SE; all used with permission by BASF Canada Inc. © 2014 BASF Canada Inc.

FREELANCE WRITER

BY BARBARA DUCKWORTH

Always read and follow label directions.

BY REBECA KUROPATWA

Most score top marks | Pesticide residue and fecal coliforms were found in five irrigation districts

For the

Ultimate

Burndown.


36

NEWS

FEBRUARY 6, 2014 | WWW.PRODUCER.COM | THE WESTERN PRODUCER

FRUIT | DISEASE CONTROL

Prairie fruit growers fight fire with fire Fire blight | Producers have learned that controlled burns are an effective way to control this devastating disease BY WILLIAM DEKAY

FIRE BLIGHT DISEASE CYCLE

SASKATOON NEWSROOM

An ancient way is new again. Forrest Scharf of Saskatchewan Agriculture says burning saskatoon berry plants infected with fire blight is a proven method of controlling the disease. “The way people are handling fire blight is unique and somewhat new,” the fruit crop specialist told the Saskatchewan Fruit Growers Association conference held last month during Crop Production Week in Saskatoon. “What they have discovered is if you cut the plant down to the ground and burn overtop, you clean up the orchard. Most of the other diseases that possibly could be infecting the plants will basically be killed off.” Fire blight is one of the most damaging diseases that affect saskatoon berries. It’s a bacterial disease that favours warm and wet conditions during longer bloom times with severe outbreaks following a six to seven year infection cycle. “I think 2010 was one of the worst ones that I’ve seen,” said Scharf. The bacterium, erwinia amylovora, contains plasmids and can propagate itself. Insects are the main vectors. “Whether it’s pollination (insects) or just flies looking to get something from the nectar, they spread that bacteria from flower to flower,” he said. The point of infection is through the flower’s pollen tube and into the twigs and branches. It creates cankers, usually on the bark tissue, on which insects can land. Fire blight is aptly named. Vascular flow in the plant is interrupted, and a lack of nutrients and water to the leaves from infected branches creates a brown, scorched look.

Fire blight is a disease of fruit trees and shrubs, including apple, pear, sour cherry and saskatoon. It is caused by a bacterial infection and spreads from plant to plant through rain, wind, hail and insects. Here’s how the cycle works:

Later in the season, new shoots are less susceptible to infection and bacterial growth slows. Cankers form at infection sites. FORREST SCHARF SASKATCHEWAN AGRICULTURE

In spring, the bacteria multiply and ooze from the cankers where insects or rain spread it to flowers. From there, insects spread the bacteria between blossoms. Rain washes the bacteria into the base of the flower and infection sets in, wilting and killing the blossoms within one to two weeks. Leaves may appear scorched. The multiplying bacteria oozes from the dying blossom and droplets infect nearby shoots and wounds. Infected young fruit appears watery, then turns brown or black.

“The dead tissue appears to be burned, and the young branches often keel over at the tip, creating a ‘shepherd’s crook’ appearance,” he said. Sandy and Ken Purdy of Prairie Berries are well versed on the damage that fire blight can do to saskatoon berry trees. It threatened their entire 10 acre orchard near Marquis, Sask., in 2006. “It was devastating our orchard and

therefore the business that we had built around it,” said Sandy Purdy. She said the disease reduced their production from 25,000 pounds in 2001, when they first experienced the disease, to 5,000 lb. in 2006. “We made the decision, as hard as it might sound, to burn the orchard. The logic behind it was the fact that in the wild things burn and then they re-grow. Being a perennial, we

Bacteria overwinter in bark at the edge of cankers that formed in the previous growing season and emerge the following spring.

Source: Cornell University | MICHELLE HOULDEN GRAPHIC

thought we could make the same thing happen with saskatoon berries,” she said. Scharf said the Purdy’s plan made sense. “Since saskatoons are a plant that used to be subject to grass fires in the natural environment, their root system is adapted to send up new shoots,” he said. The Purdys cut down the trees so

Midge tolerant wheat protects your crop against devastating pest damage, but it’s up to you to protect the technology. The Stewardship Agreement limits the use of farm-saved seed to one generation past Certified seed. It’s a simple step that keeps the interspersed refuge system at the proper level, preventing build-up of resistant midge.Without the refuge, we risk losing the one and only tolerant gene.There is no plan B. Protect this important tool. Plan for high yields and quality grades for years to come. Contact your retailer or visit www.midgetolerantwheat.ca.

t hat o n l y t h e s t u m p s s h ow e d . Branches were piled in rows and a thick layer of flax straw was piled on top. A slow back burn was completed on a windy day, and all the stumps burned off. Purdy said new trees were sprouting by the following spring. “They weren’t growing off of each of the stumps. They actually came from the soil, from the root system and started individually new plants,” she said. They grew about two feet the first year and new fruit buds were seen on the stems in the fall. A few flowers appeared the following May, and a small amount of fruit was harvested. The experiment proved successful the following year when each tree was laden with fruit. “They were loaded to the extent that it almost doubled the production we were getting on a normal year,” she said. The success of their trial by error approach has resulted in “a dual strategy” of using a cut and burn technique to manage their orchard’s diseases and old growth. They operating on a 10-year cycle, cutting down and burning a portion of their orchard each year. “It takes about 10 years for them to get so tall that we can’t get in with mechanical harvesters,” she said. “If we take out two acres in a 10 acre section, we don’t really miss the two acres because it’s still capable of the same production that the 10 acres did in the old way because there’s so much production in those first few years after the trees come back to normal growth cycle.” Purdy said infected plants and a four feet area around them are cut and burned, even in season, if fire blight is observed. She said the burn method is key to killing spores in the vicinity of the tree, which would otherwise survive if only a cut is done without fire. Soon after successfully controlling fire blight in 2006 they expanded their operation to 160 acres. “Typically, we bet the bank on 2,000 lb. an acre,” she said. “We’ve been pretty consistent. Even in poor years we’ve been able to keep that average up.”

Download the free app today.


NEWS

THE WESTERN PRODUCER | WWW.PRODUCER.COM | FEBRUARY 6, 2014

37

AGRONOMY | SOIL HEALTH

Better management urged for micro-organisms Vesicular-arbuscular mycorrhiza fungi | Not all crops have evolved to form symbiotic relationships with these organisms BY REBECA KUROPATWA FREELANCE WRITER

Scientists are becoming more familiar with the fungi and bacteria associated with plants and soil. “In the past, we couldn’t do much about these micro-organisms, as we didn’t have the tools to study their amazing diversity,” said Chantal Hamel of Agriculture Canada’s Semiarid Prairie Agricultural Research Centre near Swift Current, Sask. “Now, we’re getting the tools and it’s quite exciting.”

Vesicular-arbuscular mycorrhiza (VAM) fungi are important because of their role in plant nutrition uptake, protection from pathogens and soil structure. VAM fungi live partly inside plant roots, getting carbon and energy from the plant while providing nutrients and water. “If we manage the plant, we can manage these fungi,” said Hamel. “This hasn’t been the case for most fungi and bacteria in soil, as they use dead organic matter, which we don’t have many ways to manage. Even if

you put pesticides in the soil, you have to put a lot for them to have any effect on the organism in the soil, as they get bound to the soil. But if organisms are associated with plants, like VAM, we can manage them more easily.” Only some plants have this association. Most legumes are good at forming the symbiosis and benefiting from it. “Flax, cereals and corn are very dependent on VAM. Small grain cereals form the symbiosis but don’t usually benefit from it. But they do benefit

via protection from pathogens.” Soil organic matter on the Prairies is rarely excessive, but the region has micro-organism fungi most everywhere, unless a field is extremely over-fertilized. “A big question farmers want to know is if they should use the microorganism inoculants,” said Hamel. “Yet the companies that make them are afraid to tell farmers to reduce their fertilization, as if farmers aren’t happy, they’ll blame the inoculants. We, as scientists, would like to use inoculants to reduce our level of fer-

tilization while getting the same results. So, we save on fertilizer but pay for the inoculums. (It’s) more effective than paying for the inoculums and fertilization. ” Hamel would also like to test the persistence of the fungi in the soil because farmers want to know how often they need to inoculate. “We also want to collect the 36 local-to-the-Prairies native microcell fungi and be able to produce one inoculum with strains that go well together and that are designed for the Prairies,” said Hamel.

is available on select canola varieties from:

Seek Treatment

InVigor L120 InVigor L130 InVigor L150 InVigor L154 InVigor L159

InVigor 5440 InVigor L135C InVigor L156H InVigor L252 InVigor L261

45H29 RR 45H31 RR 45S52 RR 45S54 RR

46S53 RR 46H75 CL D3153 RR D3154S RR

1012 RR

2012 CL

V12-1 V12-2

v2045

The treatment of JumpStart on canola, that is. ®

Order your seed centrally treated with JumpStart to discover quicker emergence, improved vigour and higher yields. When you start out right, the results are more rewarding. For the love of canola, don’t forget your JumpStart. Seek treatment from your local retailer and order your seed centrally treated today.

For the love of canola

Novozymes is the world leader in bioinnovation. Together with customers across a broad array of industries we create tomorrow’s industrial biosolutions, improving our customers’ business and the use of our planet’s resources. Read more at www.novozymes.com.

73-75 RR 74-44 BL

www.useJumpStart.ca | 1-888-744-5662

VT 500 G VR 9560 CL

WinThisBin.ca

Contest is open to commercially active farmers in Western Canada (namely the provinces of Manitoba, Saskatchewan, Alberta and the Peace River region of British Columbia). Full contest details at WinThisBin.ca. ® JumpStart is a registered trademark of Novozymes A/S. All rights reserved. Meridian Trademarks used with permission. Printed in Canada. 13056 12.13

©2013 Novozymes. 2012-28074-03

6060 RR 6056 CR 6050 RR

74-54 RR

VR 9562 GC

6044 RR 6040 RR 5535 CL

CANTERRA 1970

Scan here for the latest information on varieties.

5525 CL

CANTERRA 1990


® The Cargill logo and FIELDSENSE are registered trade-marks of Cargill, Incorporated, used under licence. © 2014, Cargill Limited. All Rights Reserved.

38 FEBRUARY 6, 2014 | WWW.PRODUCER.COM | THE WESTERN PRODUCER

“Winter is the perfect time to come up with a crop protection plan to execute in the summer.”


THE WESTERN PRODUCER | WWW.PRODUCER.COM | FEBRUARY 6, 2014

Uproot a Growing Threat: Consider herbicide resistance when creating crop protection plans this year. The new year is upon us and many of you are focused on the upcoming growing season and crop protection planning. Crop protection products are important tools, and maintaining the chemistries available to us is imperative. It’s time to change the way we think about and approach herbicide management practices in our fields. As you put your crop protection plan together, keep the following points in mind to prevent and slow the spread of herbicide-resistant weeds and prolong the durability of available herbicides. First and foremost, it’s important to identify and understand the weed spectrum in your fields. Herbicide application and timing decisions should be based on your field’s weed spectrum and the stages those weeds are at, in addition to past and future herbicide rotations — and not on convenience. Pay particular attention to herbicide and crop rotations. In some cases, farmers are creating environments in which there is high selection pressure for resistance on particular weeds when crop rotations are too tight.

Rotating herbicides year to year by choosing different herbicide groups and crop rotations is also effective in the prevention of herbicide resistance and maintaining available chemistries. However, applying multiple modes of action on weeds within the same year is an important strategy to prolong herbicide durability and prevent or slow resistance. Resist the temptation to cut rates. Applying a sublethal dose of herbicide increases your risk of developing herbicide-resistant weeds in your fields. Winter is the perfect time to come up with a crop protection plan to execute in the summer. Understanding what’s going on in your fields is key to addressing the growing threat that herbicide resistance poses to Canadian producers. To read the complete story, visit asktheexpertnetwork.ca. Lisa Eastley, Agronomy Manager

39


40

FEBRUARY 6, 2014 | WWW.PRODUCER.COM | THE WESTERN PRODUCER

NEWS

FILE PHOTO

IN JANUARY, OTTAWA PROMISED TO SPEND

GRAIN TRANSPORTATION | LOGISTICAL ISSUES

$3.2 million

Rail service legislation showing little effect

FINDING SOLUTIONS TO TRANSPORTATION PROBLEMS

BY BRIAN CROSS SASKATOON NEWSROOM

More under your cap

CDC Meredith TWO-ROW MALTING BARLEY

✔ 13% higher yield* ✔ 1% lower grain protein* ✔ Top yields with malt quality

Genes that fit your farm. 800-665-7333 www.secan.com ®

*Compared to AC Metcalfe in Coop Registration Trials Developed by Crop Development Centre, University of Saskatchewan Genes that fit your farm® is a registered trademark of SeCan.

A law passed last year designed to improve service for railway customers has delivered no noticeable benefits for Canada’s agricultural shippers, says an executive with the Western Grain Elevators Association. That’s because no major grain companies have attempted to negotiate service agreements with Canada’s major railway companies since the Fair Rail Freight Service Act was passed by Parliament in June 2013, said WGEA executive director Wade Sokbowich. “There have been no service levels agreements that have been negotiated to my understanding nor have there been any service level agreements arbitrated by the Canadian Transport Agency,” Sobkowich said. “Our confidence in the ability of a shipper to successfully get a service level agreement with teeth is very low.” The Fair Rail Freight Service Act was passed last June after a lengthy process aimed at improving rail service for shippers. The grain industry, one of the biggest shipping groups served by Canada’s major railway companies, was a key stakeholder in the process. Farm organizations, grain companies and others involved in the grain trade told Ottawa that new legislative measures were needed to ensure more reliable and predictable rail service for agricultural shippers and to address a perceived imbalance between the railways and their customers. The Fair Rail Freight Service Act gives shippers the right to negotiate service level agreements (SLAs) with railways. It also appoints the Canadian Transportation Agency to arbitrate an agreement if shippers and railways are unable to negotiate a deal themselves. However, the process is untested so far, largely because shippers feel the provisions are insufficient. When draft legislation was being reviewed, the WGEA and other grain industry stakeholders proposed amendments aimed at strengthening shippers’ ability to negotiate agreements. Among other things, they wanted a process that gave shippers more power to negotiate monetary penalties in the event of poor railway performance. “We asked for a suite of six amendments to the legislation, which the government did not accept,” Sobkowich said.

“One of the reasons (no grain companies have tried to negotiate a service level agreement) is that we can’t negotiate a penalty into an SLA…,” he added. “You can try to negotiate that with the railways, but if you fail, it’s out of scope for the arbitrator. The arbitrator can’t rule on penalties.” The merits of the Fair Rail Freight Service Act have come into focus this winter as farmers and grain companies struggle to move a record-sized crop to market. Total production of Canada’s major agricultural crops was roughly 30 percent larger than production in 2012-13. Until a few weeks ago, grain car unloads at Canada’s key port locations were roughly on par with unloads last year. But recently, numbers have fallen due to cold weather and other factors. According to recent figures compiled by Quorum Corp., the federally appointed grain transportation monitor, total unloads are about three percent behind 2012-13 levels. In an interview with The Western Producer in late January, federal agriculture minister Gerry Ritz said Ottawa is taking steps to address rail service and other supply chain deficiencies. However, improvement won’t occur overnight, he said. Over the past few weeks, Ottawa has been consulting with railways and collecting feedback from dissatisfied shippers within the agriculture sector. Ritz has also held discussions with Quorum to discuss how to improve the way railway service and supply chain performance is measured. Ottawa has also kicked in $1.5 million toward a five-year industry-led initiative that will look for new ways to measure and report supply chain and railway performance. “The railways have assured me that they will take up the challenge … and I said, ‘we will be looking over your shoulder’,” Ritz said. “Having said that, there is also some co-ordination to be required by the line companies to make sure that they’re sending to port that which is needed to fill boats, not just what they have contracted from farmers.” Ritz acknowledged that the provisions contained in the Fair Rail Freight Service Act remain untested. “Well, no one’s made use of it.” He said the act and other regulatory components such as the railway revenue cap will likely be included in a review of rail transportation systems to be conducted by Transport Canada in 2015.


NEWS

THE WESTERN PRODUCER | WWW.PRODUCER.COM | FEBRUARY 6, 2014

41

AGRONOMY | SOIL HEALTH

Multi-species cover crops help soil in long term Practice common in Europe, U.S. Midwest | European farmers can use up to 14 species when designing their cover crops BY JEFFREY CARTER FREELANCE WRITER

RIDGETOWN, Ont. — Laurent Van Arkel has been developing his multispecies approach to cover crops largely in isolation. So it came as a surprise to the southwestern Ontario farmer when he learned that the idea is gaining popularity in Europe and the U.S. Midwest. However, where Van Arkel plants species like clover, rye and sunflowers following his wheat harvest, farmers like Fédéric Thomas in France has established as many as 14 different species. “You need to replace steel with living roots and fossil fuel with photosynthesis,” Thomas told the Southwest Agricultural Conference held in Ridgetown Jan. 7-8. “It does take time to see change. You have to be committed to the soil.” Thomas, founder of the magazine Techniques Cultural Simplifées, called the approach “ecologically intensive agriculture.” Despite the dry summer, his 14 species of cover crop produced close to three tonnes of dry matter per acre and recycled substantial amounts of phosphorus, potassium, calcium and other nutrients. As well, the three legume species in the mix contributed 65 of nitrogen per acres for the following corn. Cultivation, chemical fertilizers and herbicides are still part of Thomas’s farm, but they’re no longer viewed as the main inputs. Instead, more emphasis is placed on soil biology, diversity and captured solar energy through the generation of biomass. Thomas uses strip tillage and notill to reduce soil disturbance and keep weed seeds at the soil surface, where they can succumb to predation and deteriorate. He encourages the proliferation of soil life, especially mycorrhizae fungi that facilitate the exchange of nutrients between plants and the soil. Having a broad mix of species in a cover crop assures that at least some will perform well regardless of weather extremes. The diversity of plants also leads to a diversity of insect life. “Insects are an essential part of the food web,” Thomas said. “You get to the point where bugs are manageable without the need for insecticides. We focus too much on our enemies. We also need to think about our friends.” University of Manitoba soil scientist Mario Tenuta agreed: “Absolutely yes, the soil wants to be fed and the thing it wants to be fed is organic matter, and plants are the best way of supplying it.” It boils down to building a larger biological engine, he added. The sun’s energy is fuel for the plant, and the relationship between plants and soil organisms makes it work. “With conventional systems, commercial fertilizers are used. The plants say, ‘thank you very much, I don’t need the mycorrhizae,’ ” Tenuta said. Van Arkel said he is also motivated by his desire to improve soil health, maintain and increase organic matter, improve tilth, keep the soil from

straying, collect solar energy and store nutrients from one year to the next. He said his first cover crops were planted primarily to hold onto the nutrients from liquid swine manure. About five years ago, he began to developed strategies to keep something green on his farm year round. “I got rid of my plow and started going to no-till a bit. And with the sugar beets, I knew there are people in the United States using strip till,” he said. “I asked myself, ‘why work the entire profile if I only need to work an eight or 10 -inch strip?’ ”

LAURENT VAN ARKEL ONTARIO FARMER

Van Arkel under-seeds red clover in wheat in early spring, but he will later establish species such as cereal rye,

annual r ye and sunflowers if a manure application is in the works. The mix depends on costs. “I want something that will overwinter and I want to keep my cover crop costs to under $20 an acre,” he said. The rye-sunflower mix results in an impressive stand, filled with several bee species and other insects by fall. He bans spraying before winter sets in and follows up with a strip-tillage machine. In spring, he will plant directly into the tilled zones. Last year, Van Arkel used a pair of

tractor-mounted clover seeders in his corn to establish a mix of rye and crimson clover when the corn was about knee high. He’s heard of Quebec farmers who go in as early as the four-leaf stage. He also broadcasts cereal rye following his sugar beet harvest. It occurs late in the year, so there isn’t much time for growth before winter arrives. However, the rye is two or three feet high by the following spring. A herbicide burn-down is then applied before the soybeans emerge.

ALL OF OUR SEED IS FIELD TESTED. JUST LIKE OUR REPS.

45S54 • High yielding canola hybrid • Pioneer Protector® Sclerotinia resistance trait built-in • Rated R for blackleg • Very good standability

Sclerotinia can be one of the most devastating diseases your crop will face. But with Pioneer Protector® brand canola hybrids from DuPont Pioneer, you’ll get the protection you need without sacrificing yield. Pioneer Protector® Sclerotinia Resistant canola hybrids, like 45S54, are some of the highest yielding canola hybrids on the market. Plus, your sclerotinia protection is built right into the seed. Which means you’re getting more than just great seed, you’re getting a good night’s sleep too. Talk to your local Pioneer Hi-Bred sales representative or visit pioneer.com for more information.

Our experts are grown locally Field results show that Pioneer Protector ® Sclerotinia resistance can reduce the incidence of sclerotinia in a canola crop by over 50%. Individual results may vary. Depending on environmental and agronomic conditions, growers planting Pioneer Protector® Sclerotinia resistant hybrids may still require a fungicide application to manage sclerotinia in their crop. Pioneer® brand products are provided subject to the terms and conditions of purchase which are part of the labeling and purchase documents. The DuPont Oval Logo is a registered trademark of DuPont. ® TM SM , , Trademarks and service marks licensed to Pioneer Hi-Bred Limited. © 201, PHL.

@PioneerWCanada


42

FEBRUARY 6, 2014 | WWW.PRODUCER.COM | THE WESTERN PRODUCER

NEWS

ANIMAL WELFARE RESEARCH | EMOTIONS

Pain affects calves’ emotional state: study Pessimistic attitude | Researcher says the test linking calf pain to depression may apply to other animals and situations BY MARGARET EVANS FREELANCE WRITER

University of British Columbia researcher Heather Neave hopes her study encourages producers to treat postoperative pain for 24 hours after a surgical procedure. | UBC DAIRY EDUCATION AND RESEARCH CENTRE PHOTOS

LINDELL BEACH, B.C. — It may be relatively easy to measure pain in animals by observing behavioural or physiological changes, but understanding their emotional state is more difficult. Researchers at the University of British Columbia have conducted the first ever judgment bias test on a non-human species. They found that calves that recently had their horns removed showed signs of pessimism, or negative interpretations. “My interest in pain started when I was working at the UBC Dairy Education and Research Centre and helping with research projects,” said Heather Neave, a recent master’s graduate at UBC’s animal welfare program who led the project. “One of my chores at the farm was helping to dehorn the calves, and I noticed that calves often appeared despondent in the hours after the procedure. Farmers often give their calves a local (lidocaine) block. This helps to control the immediate pain but not the pain the calves experience in the hours after hot-iron dehorning.” It is becoming more common for farmers to treat the local pain, but it’s

often overlooked for the time period after dehorning, she said. It was the hours following the dehorning procedure that she was most interested in. “The available research shows that not only is there an immediate pain response but it continues for at least 24 hours.” Human studies have shown that an individual’s emotions can influence how they process information, including their attention, memory and judgment. These phenomena are known under the umbrella term cognitive biases. In judgment biases, people suffering depression may judge an ambiguous test negatively. For instance, in describing a partially filled glass of water, they will describe it as half empty rather than half full. Neave’s study, published in the December issue of the science journal PLoS One, defined pain as “an unpleasant sensory and emotional experience associated with actual or potential tissue damage.” It used 17 male Holstein calves, starting at around three days of age. They were housed in individual sawdust bedded pens and managed according to standard farming protocols. A separate pen was used for the test.

2014 SUV OF THE YEAR CHOSEN #1

by CONSUMER REPORTS &

The 2014 SUBARU FORESTER IS RANKED AS THE TOPSCORING SMALL SUV BY CONSUMER REPORTS The newly designed Forester earned a remarkable 88 points out of a possible 100. This score is 11 points higher than a Honda CRV, 13 points higher than Toyota Rav4 and 14 points higher than Mazda CX5.

MSRP FROM

The Subaru Forester, the logical choice.

25,295

$

*

It’s not hard to see why. With more cargo space, better fuel efficiency and Subaru’s symmetrical fulltime AWD, you’ll be ready for any adventure. Combine that with X-MODE*, a newly developed system that helps you navigate the most brutal terrain, and you’ve got an SUV unlike any other.

CONSUMER REPORTS TOP SCORE FOR PREDICTED RELIABILITY

JUST ARRIVED

46 MPG, 2014 IIHS + TOP SAFETY AWARD

subaru.ca

MANY MORE UNITS IN STOCK... OPEN 24 HOURS AT WWW.SUBARUOFSASKATOON.CA ELITE AUTOMOTIVE GROUP INC. O/A

Open 24 Hours @

www.subaruofsaskatoon.com

SUBARU OF SASKATOON 471 CIRCLE PLACE • 306-665-6898 OR 1-877-373-2662

Open 24 Hours @

www.bramerauto.com

BRAMER AUTOMOTIVE GROUP CORNER OF SARGENT & KING EDWARD • CALL 204-474-1011 • TOLL FREE 1-877-474-1011


NEWS Equipment included a nose touch start button, a 48 centimetre computer monitor that would display either a red (positive) screen or a white (negative) screen, and a milk bottle dispenser that would, or would not, dispense a reward. Each screen colour was displayed for three seconds. Calves learned that they needed to approach and touch the screen to receive a milk reward from the bottle if it was red but stay away from the screen if it was white because milk would be withheld. The colour red was chosen for its ease of recognition by the calves. Neave spent three weeks clicker training the calves to nose touch the start button, interpret the screen colou r an d d ecid e whe th e r to approach and touch the screen. The calves were trained and tested at the same time twice a day, and training and testing sessions lasted 15 minutes for each animal. The same number of displays of positive or negative colours was displayed during the duration of the test. Once the calves were trained, they were tested with three shades of pink: dark, medium and light. The pink shades offered an ambiguous challenge for each calf because they are a mix of red and white. Before dehorning treatments they interpreted the near-positive and near-negative pink screens the same way they did with the original red or white training screens. They treated the midway pink colour as intermediate, as expected. However, after dehorning, the calves approached the ambiguous pink screens much less frequently.

THE WESTERN PRODUCER | WWW.PRODUCER.COM | FEBRUARY 6, 2014

43

LEFT: A calf nose touches the start button to activate the monitor. ABOVE: It then nose touches the red screen to activate the milk bottle. BELOW: The calf enjoys its reward of milk. “ They interpreted these pink screens negatively,” said Neave. “This pessimistic bias indicated that the calves believed they were less likely to receive a milk reward and is indicative of a negative emotional state similar to depression or anxiety.” Neave’s study is consistent with earlier research that found post-operative pain can persist for 24 hours. The calves exhibited the pain by head shaking, head rubbing and ear flicking. As well, they experienced an elevated heart rate and cortisol levels for several hours. The calves were tested at six hours following dehorning, which is the peak of pain-associated behaviour, and at 22 hours, which is when pain behaviour begins to decline. The calves’ judgment bias of the ambiguous screen remained pessimistic in both tests. The calves were about 30 days old. “When starting the experiment, I wasn’t sure exactly how the training of the calves would go for the experi-

ment, but I was amazed at how quickly they were able to learn it,” she said. “The intelligence of the calves is something that really interests dairy producers and others who I have told about my study, especially when I show them the video of the calves performing the task.” Neave hopes the research will encourage farmers to consider the emotional impact of dehorning and move toward treating the pain associated with this procedure. “Xylazine and lidocaine can be used to treat local pain at the time of dehorning,” she said. “Ketoprofen and meloxicam are highly encouraged for treating post-operative pain for the 24 hour period following dehorning. The bias is an indication that something is going on cognitively, and it’s not simply a sensory response. This type of experiment could be used to investigate the effects of other common procedures, like castrating or tail–docking, on emotion and cognition.”

The 2013 edition of the Code of Practice for the Care and Handling of Beef Cattle requires dehorning to be done as early as possible with veterinary advice on pain control. The recommendations are to avoid dehorning at the time of weaning to minimize stress and to consider a breeding program using homozygous polled bulls to eliminate the need for disbudding or dehorning.

“Farmers’ practices are definitely changing,” said Neave. “In my experience, dairy producers realize that these practices cause pain and welcome changes in practices that can prevent or reduce the pain that calves experience.” UBC researchers are also using cognitive bias tests to look at the emotional impact of calves when separated from their mothers.

Breakthrough in plant health. The Stress Shield® component of Raxil® PRO Shield provides superior emergence, increased vigour and a healthier plant that’s better able to withstand unforeseen seasonal stresses. This NEW formulation combines three different fungicide actives, including NEW prothioconazole, for complete systemic and contact protection from the most serious seed- and soil-borne diseases. To learn more about Raxil PRO Shield, visit BayerCropScience.ca/Raxil

BayerCropScience.ca/Raxil or 1 888-283-6847 or contact your Bayer CropScience representative. Always read and follow the label directions. Raxil® and Stress Shield® are registered trademarks of the Bayer Group. Bayer CropScience is a member of CropLife Canada.

C-55-01/14-10150465-E


44

NEWS

FEBRUARY 6, 2014 | WWW.PRODUCER.COM | THE WESTERN PRODUCER

YIKES, IT’S COLD OUT

AG NOTES NOMINATIONS SOUGHT FOR OUTSTANDING YOUNG FARMERS

A squirrel emerges from its hole on a sunny day near Killarney, Man. | LILLIAN DEEDMAN PHOTO

Nominations for the 2014 Saskatchewan Outstanding Young Farmers’ Program will close March 1. Forms are available at www.saskoyf.ca. The program is open to individuals, couples or managing partnersshareholders of a farm group. Nominees must obtain at least two-thirds of their gross revenue from farming and have not reached age 40 by Jan. 1, 2014. The annual competition is in its 34th year of recognizing young farmers for their talent and leadership. Nominees are judged according to the progress made in their agricultural career, environmental and safety practices, crop and livestock production history, financial and management practices and contributions to the well-being

of their community, province and country. The 2014 winner will be announced at Canada’s Farm Progress Show in Regina June 20. They will go on to represent the province at the National Awards Program in Quebec City in November.

the B.C. Cranberry Marketing Commission and the B.C. Strawberry Growers Association. As well, the B.C. agriculture ministry, ES Cropconsult, the B.C. Institute of Technology and the University of the Fraser Valley will provide support.

BERRY SECTOR GETS FUNDING

COMPENSATION OFFERED FOR WILDLIFE DAMAGE

The Lower Mainland Horticulture Improvement Association in British Columbia will receive $2.8 million in federal funding to develop production practices and pest management tools for the industry. The project will specifically look at developing high quality berry cultivars that are resistant to pests and diseases. The association will also receive more than $1 million from the B.C. Blueberry Council, the Raspberry Industry Development Council,

New Brunswick’s new Wildlife Damage Compensation Program will compensate farmers for eligible livestock losses and crop damage caused by wildlife. Farmers will be able to apply to the federal-provincial cost-shared program starting in April. Eligible wildlife include black bears, foxes, coyotes, ravens, crows or birds of prey. Damage caused by dogs is not accepted. Eligible products include plants, trees and vines grown as commercial crops. Qualified livestock includes dairy and beef cattle, sheep and goats as well as beehives and beehive contents. FUNDING FOR OAT RESEARCH The Prairie Oat Growers Association is receiving $3.7 million from Growing Forward 2 to develop more nutritional and high-yielding varieties while capturing new markets. Of that money, $2.9 million is from the Agri Innovation program to help develop new varieties that will yield better and have additional attractive qualities. Another $600,000 is from the AgriMarketing program and will help promote oats to the U.S. horse industry.

Meet Ken Dutton Started farming: 1974 Crop rotation: Chemfallow, durum, spring wheat, barley First vehicle: ‘64 Chevy Half-Ton Loves: Family, Saskatchewan Roughriders Hates: Kochia, Edmonton Eskimos Will never sell: His 4020 John Deere tractor, a gift from dad Most memorable farming moment: “Last year, we filled all the bins.” PrecisionPac® blends: DB-858, DB-8454

FUNDING FOR ASPARAGUS Southwestern Ontario’s asparagus industry will receive up to $512,700 in federal research funding. Money will help increase asparagus production and quality and develop disease resistant varieties. Asparagus Farmers of Ontario will develop new hybrids that can be grown in Ontario, Nova Scotia, Quebec and Saskatchewan.

COMING EVENTS

JUST LIKE KEN, EVERY GROWER IS UNIQUE. THAT’S WHY WE HAVE PRECISIONPAC . ®

As a matter of fact, so is each and every farm in Western Canada, in terms of its field sizes, crop rotation and weed spectrum. It’s good to know there’s a weed control solution that’s as individual as you and your farm. DuPont™ PrecisionPac® herbicides are 12 customized blends of powerful DuPont crop protection, geared to your weed targets and calibrated down to the precise acre. You mix, you go, no mistakes, no waste. How’re we doing so far, Ken?

Feb. 18-19: CropConnect Conference, Victoria Inn Hotel and Convention Centre, Winnipeg (Leanne Campbell, 204-479-1115, leanne@mcgacanola. org or Roxanne Lewko, 204-7456488, roxanne@manitobapulse.ca, info@cropconnectconference.ca) Feb. 24-25: Wild Oats Grainworld ag outlook conference, The Fairmont Hotel, Winnipeg (800-567-5671, 204942-1459, wildoatsgrainworld.com) March 19-21: Saskatchewan Association of Watersheds conference, Saskatoon Inn, Saskatoon (Pat Rediger, 306541-9902, info@saskwatersheds.ca) For more coming events, see the Community Calendar, section 0300, in the Western Producer Classifieds.

For custom herbicides as unique as your fields, visit precisionpac.dupont.ca or call 1-800-667-3925 to find a certified PrecisionPac® herbicide retailer near you. As with all crop protection products, read and follow label instructions carefully. The DuPont Oval Logo, DuPont™, The miracles of science™ and PrecisionPac® are registered trademarks or trademarks of E. I. du Pont de Nemours and Company. E. I. du Pont Canada Company is a licensee. All other products are trademarks of their respective companies. Member of CropLife Canada. © Copyright 2014 E. I. du Pont Canada Company. All rights reserved.

“Would you like wake-up service?”


THE WESTERN PRODUCER | WWW.PRODUCER.COM | FEBRUARY 6, 2014

45

Farm Living. We’re writing the stories of farming. Your stories.

producer.com

CLASSIFIEDS

This is where you’ll findit. Stories and resources to help you with life on the farm.

C L A S S I F I E D S A L E S | P : 8 0 0 . 6 6 7.7 7 7 0 F : 3 0 6 . 6 5 3 . 8 75 0 | E M A I L : A D V E R T I S I N G @ P R O D U C E R . C O M

4 EASY WAYS TO BOOK YOUR AD 1 Online at www.producer.com 2 By phone: In Saskatoon 665-3515 Toll Free 1-800-667-7770

LINER AD RATES

$5.85/Printed Line (3 line minimum) NON-REFUNDABLE ADDITIONAL FEATURES Bolding = .75/word/wk Full Color Photo = $39.00/wk Black & White Photo = $25.00/wk Attention Getter = $15.00/wk Ask about our Priority Placement LINER FREQUENCY DISCOUNTS Start after 3 weeks Example: 4 weeks for the price of 3, (8 for 6) (12 for 9) (52 for 39) etc. (Does not apply to bolding)

LINER COMMUNITY CALENDAR RATES 2 For 1 Book an ad to run and the identical ad will appear in a second edition free of charge. (Maximum 4 ads)

CLASSIFIED DISPLAY AD RATES $118.80/column inch/week Talk with your sales rep about our Volume Discounts

CONDITIONS

producer.com

DEADLINES • Liner ads – Thursday previous to publication, 8:00pm CST • Display ads – Thursday previous to publication, Noon CST

findit

(anywhere in North America)

8:30am – 4:30 pm CST, Mon & Fri 8:30am – 8:00 pm CST Tues, Wed, Thurs. 3 Fax 306-653-8750 4 Email us at: advertising@producer.com

Tributes/Memoriams ..................... 0100 Announcements .............................0200 COMMUNITY CALENDAR British Columbia ..........................0310 Alberta ........................................ 0320 Saskatchewan ............................ 0330 Manitoba ..................................... 0340 Airplanes ........................................0400 Alarms & Security Systems ...........0500 ANTIQUES Antique Auctions .........................0701 Antique Equipment..................... 0703 Antique Vehicles ......................... 0705 Antique Miscellaneous ................0710 Arenas ............................................0800 Auction Sales .................................0900 Auction Schools .............................0950 AUTO & TRANSPORT Auto Service & Repairs............... 1050 Auto & Truck Parts .......................1100 Buses........................................... 1300 Cars ............................................. 1400 Trailers Grain Trailers .............................1505 Livestock Trailers....................... 1510 Misc. Trailers...............................1515 Trucks Newest to Oldest ....................... 1595 Four Wheel Drive .......................1670 Grain Trucks ............................... 1675 Gravel Trucks ............................. 1676 Semi Trucks.................................. 1677 Specialized Trucks .................... 1680 Sport Utilities ............................ 1682 Various .......................................1685 Vans..............................................1700 Vehicles Wanted .......................... 1705 BEEKEEPING Honey Bees ..................................2010 Cutter Bees ................................. 2020 Bee Equipment & Supplies .....................................2025 Belting ............................................ 2200 Bio Diesel & Equipment................. 2300 Books & Magazines ........................ 2400 BUILDING & RENOVATIONS Concrete Repair & Coatings .......................................2504 Doors & Windows ........................2505 Electrical & Plumbing .................. 2510 Lumber .........................................2520 Roofing.........................................2550 Supplies .......................................2570 Buildings .........................................2601 Building Movers ..............................2602 Business Opportunities ................. 2800 BUSINESS SERVICES Commodity/Future Brokers ........ 2900 Consulting ....................................2901 Financial & Legal .........................2902 Insurance & Investments ....................2903 Butcher’s Supplies .........................3000 Chemicals........................................3150 Clothing: Drygoods & Workwear ................. 3170 Collectibles .................................... 3200 Compressors .................................. 3300 Computers...................................... 3400 CONTRACTING Custom Baling..............................3510 Custom Combining ......................3520 Custom Feeding ........................... 3525 Custom Seeding ........................... 3527 Custom Silage ..............................3530 Custom Spraying ........................ 3540 Custom Trucking ..........................3550 Custom Tub Grinding ................... 3555 Custom Work............................... 3560 Construction Equipment................3600 Dairy Equipment .............................3685 Diesel Engines................................ 3700 Educational .................................... 3800 Electrical Motors.............................3825 Electrical Equipment ......................3828 Engines........................................... 3850 Farm Buildings ...............................4000 Bins ............................................. 4003 Storage/Containers .................... 4005 FARM MACHINERY Aeration .......................................4103 Conveyors ................................... 4106 Equipment Monitors ................... 4109

• The Western Producer reserves the right to revise, edit, classify or reject any advertisement submitted to it for publication. • The Western Producer, while assuming no responsibility for advertisements appearing in its columns, endeavors to restrict advertising to wholly reliable firms or individuals. • Buyers are advised to request shipment C.O.D. when purchasing from an unknown advertiser, thus minimizing the chances of fraud and eliminating the necessity of refund if the goods have already been sold. • Ads may be cancelled or changed at any time in accordance with the deadlines. Ads ordered on the term rates, which are cancelled or changed lose their special term rates. • The Western Producer accepts no responsibility for errors in advertisements after one insertion. • While every effort is made to forward replies to the box numbers to the advertiser as soon as possible, we accept no liability in respect of loss or damage alleged to arise through either failure or delay in forwarding such replies, however caused. • Advertisers using only a post office box number or street address must submit their name to this office before such an advertisement is accepted for this publication. Their name will be kept confidential and will not appear in any advertisement unless requested. • Box holders names are not given out. • NON-REFUNDABLE

Fertilizer Equipment.................... 4112 Grain Augers ................................ 4115 Grain Bags/Equipment ................ 4116 Grain Carts ................................... 4118 Grain Cleaners ............................. 4121 Grain Dryers ................................. 4124 Grain Elevators ............................ 4127 Grain Testers ................................4130 Grain Vacuums............................. 4133 Harvesting & Haying Baling Equipment ......................4139 Mower Conditioners .................. 4142 Swathers ....................................4145 Swather Accessories .................4148 H&H Various .............................. 4151 Combines Belarus ....................................... 4157 Case/IH ..................................... 4160 CI ................................................4163 Caterpillar Lexion ......................4166 Deutz ..........................................4169 Ford/NH ..................................... 4172 Gleaner ...................................... 4175 John Deere ................................. 4178 Massey Ferguson ....................... 4181 Python........................................4184 Versatile ..................................... 4187 White..........................................4190 Various ....................................... 4193 Combine Accessories Combine Headers ......................4199 Combine Pickups .......................4202 Misc. Accessories ......................4205 Hydraulics ................................... 4208 Parts & Accessories ..................... 4211 Salvage....................................... 4214 Potato & Row Crop Equipment ................................. 4217 Repairs .........................................4220 Rockpickers ................................. 4223 Shop Equipment .......................... 4225 Snowblowers & Snowplows.................................4226 Silage Equipment ........................4229 Special Equipment ...................... 4232 Spraying Equipment PT Sprayers ................................4238 SP Sprayers................................ 4241 Spraying Various .......................4244 Tillage & Seeding Air Drills .....................................4250 Air Seeders ................................4253 Harrows & Packers ....................4256 Seeding Various.........................4259 Tillage Equipment .....................4262 Tillage & Seeding Various.....................................4265 Tractors Agco Agco ......................................... 4274 Allis/Deutz ............................... 4277 White ...................................... 4280 Belarus .......................................4283 Case/IH ..................................... 4286 Steiger......................................4289 Caterpillar ..................................4292 John Deere .................................4295 Kubota....................................... 4298 Massey Ferguson .......................4301 New Holland ............................. 4304 Ford ..........................................4307 Versatile...................................4310 Universal.................................... 4313 Zetor...........................................4316 Various Tractors ........................4319 Loaders & Dozers ......................... 4322 Miscellaneous ..............................4325 Wanted .........................................4328 Fencing ...........................................4400 Financing/Leasing ......................... 4450 Firewood .........................................4475 Fish & Fish Farming...... ................. 4500 Food Products .................................4525 Forestry / Logging Equipment ....... 4550 Fork Lifts & Pallet Trucks ...............4600 Fruit / Fruit Processing .................. 4605 Fur Farming .....................................4675 Generators ...................................... 4725 GPS .................................................4730 Green Energy................................... 4775 Health Care .................................... 4810 Health Foods ...................................4825 Heating & Air Conditioning ........... 4850 Hides, Furs, & Leathers ................. 4880 Hobbies & Handicrafts .................. 4885

Household Items............................ 4890 Iron & Steel .................................... 4960 Irrigation Equipment ..................... 4980 LANDSCAPING Greenhouses ............................... 4985 Lawn & Garden ........................... 4988 Nursery & Gardening Supplies .................. 4990 LIVESTOCK Bison/Buffalo Auction Sales ............................5000 Bison/Buffalo............................ 5001 Cattle Auction Sales ............................ 5005 Black Angus .............................. 5010 Red Angus ..................................5015 Belgian Blue.............................. 5030 Blonde d’Aquitaine ....................5035 Brahman ................................... 5040 Brangus ......................................5042 Braunvieh ..................................5047 Brown Swiss ............................. 5049 BueLingo ....................................5052 Charolais ....................................5055 Dexter........................................ 5065 Excellerator................................5067 Galloway ................................... 5070 Gelbvieh.....................................5075 Guernsey ................................... 5080 Hereford ....................................5090 Highland ................................... 5095 Holstein......................................5100 Jersey .........................................5105 Limousin .....................................5115 Lowline ...................................... 5118 Luing .......................................... 5120 Maine-Anjou .............................. 5125 Miniature ...................................5130 Murray Grey ............................... 5135 Piedmontese ..............................5160 Pinzgauer ................................... 5165 Red Poll .......................................5175 Salers ......................................... 5185 Santa Gertrudis .........................5188 Shaver Beefblend ...................... 5195 Shorthorn.................................. 5200 Simmental..................................5205 South Devon .............................. 5210 Speckle Park .............................. 5215 Tarentaise ..................................5220 Texas Longhorn .......................... 5225 Wagyu ........................................5230 Welsh Black................................ 5235 Cattle Various ............................5240 Cattle Wanted ............................5245 Cattle Events & Seminars .................................. 5247 Horses Auction Sales .............................5305 American Saddlebred ................5310 Appaloosa .................................. 5315 Arabian ......................................5320 Belgian ....................................... 5325 Canadian .................................... 5327 Clydesdale .................................5330 Donkeys ..................................... 5335 Haflinger ....................................5345 Holsteiner .................................. 5355 Miniature ...................................5365 Morgan ....................................... 5375 Mules......................................... 5380 Norwegian Fjord ........................5385 Paint.......................................... 5390 Palomino ....................................5395 Percheron ................................. 5400 Peruvian.................................... 5405 Ponies ....................................... 5408 Quarter Horse ............................ 5415 Shetland.....................................5420 Sport Horses ..............................5424 Standardbred............................ 5430 Tennessee Walker ......................5445 Thoroughbred ........................... 5450 Welsh .........................................5455 Horses Various.......................... 5460 Horses Wanted ..........................5465 Horse Events, Seminars.................. 5467 Horse Hauling ........................... 5469 Harness & Vehicles ....................5470 Saddles ...................................... 5475 Sheep Auction Sales .............................5505 Arcott .........................................5510 Columbia....................................5520

Dorper ........................................ 5527 Dorset ........................................5530 Katahdin.....................................5550 Lincoln ....................................... 5553 Suffolk....................................... 5580 Texel Sheep ................................5582 Sheep Various........................... 5590 Sheep Wanted............................5595 Sheep Events, Seminars................... 5597 Sheep Service, Supplies ...................................5598 Swine Auction Sales ............................ 5605 Wild Boars .................................5662 Swine Various ............................5670 Swine Wanted ............................ 5675 Swine Events, Seminars ..................5677 Poultry Baby Chicks ...............................5710 Ducks & Geese ...........................5720 Turkeys.......................................5730 Birds Various ............................. 5732 Poultry Various ..........................5740 Poultry Equipment..................... 5741 Specialty Alpacas ...................................... 5753 Deer............................................ 5757 Elk ..............................................5760 Goats .......................................... 5765 Llama .........................................5770 Rabbits....................................... 5773 Ratite: Emu, Ostrich, Rhea .................... 5775 Yaks ............................................5780 Events & Seminars..................... 5781 Specialty Livestock Equipment. ................................ 5783 Livestock Various ........................5785 Livestock Equipment .................. 5790 Livestock Services & Vet Supplies ..................................... 5792 Lost and Found .............................. 5800 Miscellaneous Articles................... 5850 Misc Articles Wanted ......................5855 Musical ............................................5910 Notices ............................................5925 Oilfield Equipment..........................5935 ORGANIC Certification Services ..................5943 Food .............................................5945 Grains...........................................5947 Livestock ..................................... 5948 Personal (prepaid) ......................... 5950 Personal Various (prepaid)................ 5952 Pest Control ................................... 5960 PETS Registered ....................................5970 Non Registered ............................ 5971 Working Dogs ...............................5973 Pets & Dog Events ........................ 5975 Photography .................................. 5980 Propane ..........................................6000 Pumps ............................................ 6010 Radio, TV & Satellites ....................6040 REAL ESTATE B.C. Properties .............................6110 Commercial Buildings/Land .......................... 6115 Condos/Townhouses ...................6120 Cottages & Lots ............................ 6125 Houses & Lots ..............................6126 Mobile Homes .............................. 6127 Ready To Move ............................. 6128 Resorts .........................................6129 Recreational Property .................6130 Farms & Ranches British Columbia........................ 6131 Alberta ....................................... 6132 Saskatchewan ............................ 6133 Manitoba ....................................6134 Pastures .....................................6136 Wanted .......................................6138 Acreages ....................................6139 Miscellaneous ........................... 6140 RECREATIONAL VEHICLES All Terrain Vehicles ...................... 6161 Boats & Watercraft ...................... 6162 Campers & Trailers ......................6164 Golf Cars ......................................6165 Motor Homes ...............................6166 Motorcycles ................................. 6167 Snowmobiles ...............................6168 Refrigeration .................................. 6180

Move it! in print and online next day.

RENTALS & ACCOMMODATIONS Apartments & Houses ..................6210 Vacation Accommodations .......................6245 Restaurant Supplies .......................6320 Sausage Equipment ....................... 6340 Sawmills......................................... 6360 Scales ............................................. 6380 PEDIGREED SEED Cereal Seeds Barley ........................................ 6404 Corn...........................................6406 Durum ....................................... 6407 Oats ........................................... 6410 Rye .............................................6413 Triticale ......................................6416 Wheat .........................................6419 Forage Seeds Alfalfa.........................................6425 Annual Forage ........................... 6428 Clover .........................................6431 Grass Seeds .............................. 6434 Oilseeds Canola ...................................... 6440 Flax ........................................... 6443 Pulse Crops Beans ........................................ 6449 Chickpeas ..................................6452 Lentil ..........................................6455 Peas........................................... 6458 Specialty Crops Canary Seeds ............................ 6464 Mustard ......................................6467 Potatoes .................................... 6470 Sunflower...................................6473 Other Specialty Crops................. 6476 COMMON SEED Cereal Seeds ............................... 6482 Forage Seeds............................... 6485 Grass Seeds ................................ 6488 Oilseeds .......................................6491 Pulse Crops ................................. 6494 Various .........................................6497 Organic Seed ................. See Class 5947 FEED MISCELLANEOUS Feed Grain................................... 6505 Hay & Straw .................................6510 Pellets & Concentrates ................ 6515 Fertilizer...................................... 6530 Feed Wanted ............................... 6540 Seed Wanted ................................6542 Sewing Machines ............................6710 Sharpening Services ....................... 6725 Sporting Goods ...............................6825 Outfitters .....................................6827 Stamps & Coins .............................. 6850 Swap................................................6875 Tanks ...............................................6925 Tarpaulins .......................................6975 Tenders............................................7025 Tickets .............................................7027 Tires ............................................... 7050 Tools ............................................... 7070 Travel...............................................7095 Water Pumps...................................7150 Water Treatment ............................ 7200 Welding ...........................................7250 Well Drilling ................................... 7300 Winches.......................................... 7400 CAREERS Career Training .............................. 8001 Child Care....................................... 8002 Construction ..................................8004 Domestic Services .........................8008 Farm / Ranch .................................. 8016 Forestry / Logging .......................... 8018 Help Wanted .................................. 8024 Management ...................................8025 Mining .............................................8027 Oilfield ........................................... 8030 Professional ....................................8032 Sales / Marketing ...........................8040 Trades / Technical .......................... 8044 Truck Drivers .................................. 8046 Employment Wanted (prepaid) ..................................... 8050

Now your classified word ads will go online within one business day from when you book them to run in the Producer Classifieds. Our team of Classified Sales Associates has the product knowledge, marketing strategies and access to qualified buyers that is unmatched in the industry. Place your classified ad and experience our professional service first hand.

Monday to Friday, ads will be posted online within one business day. Real Time online will be placed a maximum of 11 days prior to first print insertion.

CLASSIFIEDS.PRODUCER.COM | 1-800-667-7770


46 CLASSIFIED ADS

THE WESTERN PRODUCER, THURSDAY, FEBRUARY 6, 2014

BASF KNOWLEDGE HARVEST. Join growers from your area to watch live plant demonstrations, speak to experts about what is new with biologicals and get strategies for managing herbicide resistance from industry leaders. Hear from acclaimed visionary and financial analyst Richard Worzel about the future of agriculture. February 25- Lethbridge; February 27- Portage la Prairie; March 4- Regina; March 6- Saskatoon; March 11- Yorkton; March 13- Edmonton. Register now at www.agsolutions.ca/knowledgeharvest

PRODUCER APPRECIATION NIGHT FEBRUARY 13, 2014 GALLAGHER CENTRE, YORKTON, SK 5 p.m.

AGENDA Introduction to Livestock Price Insurance

Jodie Griffin, Livestock Price Insurance Program Coordinator, Saskatchewan Crop Insurance Corporation

Roast Beef Supper Thinking Outside The Barn

Dan Ohler, Thinkin’ Outside The Barn Ltd., Sangudo, AB

1977 PIPER LANCE, TTSN 3933, SMOH 531, hangared, excellent condition. Call 780-871-4743, Lloydminster, AB. 1973 S2R-600 Thrush 8498 TT, geared eng. with Albatross prop, 804 SPOH, 700 SMOH or will install overhauled Covington engine, fresh annual, AC, metal tail, cool seat, Satloc 99, VGs, radio and more. Morden, MB. pembina.air@gmail.com 204-362-0406. 1971 CESSNA 150L, 3769 TTSN, 1864 SMOH, new C of A, Reg. #GNJW, $18,500 OBO. Call 306-435-7384, Moosomin, SK. 1964 CESSNA 172E, TTA 2731.9, 130.9 prop, 1434.2 TT. New: glass, paint, seats head liner, full orig. panel, Nav/Com, ELT, NDH, $43,000. 204-322-5614, Warren, MB

For more information or to pre-register contact: Yorkton Regional Office 306-786-1531

YORKTON FARM TOY SHOW 2014 St. Mary’s Cultural Center, Feb. 08 and 09. Sat. 9 AM - 5 PM; Sun. 9 AM - 4 PM. Pedal Tractor Raffle, 100% proceeds going to ‘Love for Leif’. 306-742-4772, Yorkton, SK.

*Pre-registration deadline is February 6, 2014. Tickets are $20.00/person

1991 RANS S-10 Sakota, midwing two place aerobatic taildragger, 304 TTAF, 583 Rotax, 90 HP, 110 MPH, inverted capability, affordable aerobatics, $24,000 OBO. Call 306-625-3922, Ponteix, SK. LYCOMING 0-320, 150/160 HP, excellent condition, 2200 hours. 403-327-4582, 403-308-0062, Lethbridge, AB.

CESSNA 414, 9046 AFTT, engines Ram Series VI, 1048/482 TSO, 1057/471 TSO, S-Tec autopilot; PIPER Aztec C, 4280 AFTT, engines 1245/409 hrs. TSO, props 269/269 TSO, new paint and int. 2007; 3 TRAVEL AIRs, 1964, 1966 and 1968, former flight school aircraft, IFR cert.; BEAVER, 1959, converted from US military L-20A Model, 8184 AFTT, eng. 274 hrs. TSO, overhauled by Covington aircraft eng. 2007; PIPER Navajo, 8859 AFTT, Cleveland wheels and brakes, cargo door, Kannad ELT. 403-637-2250, Water Valley, AB.

ARCTIC ENGINE COVERS, used. Cessna 1 7 2 , 1 8 2 , 1 8 5 ( 2 ) , 2 0 6 , N ava j o ( 2 ) . $225/ea. 250-579-9583 or 250-319-1724, Kamloops, BC. 1977 CESSNA 182Q, 3246 TT, 430 SMOH, Edo 2960s, Sportsman STOL, wing ext. 306-230-9258 or lcsharp@sasktel.net Saskatoon, SK. PERKINS POWERED DSL. airplane, tugger rated for 12.4 tonnes towing capacity, 274 hrs., $10,500. 306-668-2020, Saskatoon, www.northtownmotors.com DL #908171.

CLASSIFIED AD SUBMISSION FORM Complete name, address and phone number need not appear in your ad, although we must have this information for our files. NAME ________________________________________________________________________ DAYTIME PHONE# ___________________________ CELL# _________________________ EVENING PHONE# __________________________________ ADDRESS ________________________________________________ TOWN _________________________________________ PROVINCE _____________

SMALL ADS, BIG RESULTS This is where farmers buy and sell Canada’s largest agricultural classifieds.

Call our team to place your ad

1-800-667-7770

POSTAL CODE ____________________________________________ EMAIL ADDRESS _________________________________________

Entertainment Crossword by Walter D. Feener

PLEASE PRINT YOUR AD BELOW exactly as you want it to appear in the paper, including your phone number or The Western Producer box number. When using a phone or fax number within your ad copy, town and province are required (toll free numbers and WP Box numbers excepted). When using an email and/or website address within your ad copy, an alternative way for readers to contact you is required (ie: phone, fax or mailing address). Ads in the Personal column must be placed under a Western Producer box number or email address. There is a $45.00 charge for a box number ($95.00 International). A signature is required here for all Personal ads._________________________________________________

AD STARTS HERE:

a) Please circle the words you would like in bold print or b) ❑ entire ad.

$5.85/printed line (3 line minimum)

________________________________________________________________ _______________________________________________________________________ _______________________________________________________________________ Last Weeks Answers

_______________________________________________________________________ _______________________________________________________________________ Town (required) ________________________________________________________ Province (required) _____________________________________________________ CLASSIFICATION NAME & NUMBER: ______________________________________ # OF WEEKS ________

Please start my ad in the ________________ issue

ALL PACKAGES ARE NON REFUNDABLE PLEASE SEE FRONT PAGE OF CLASSIFIED SECTION FOR FREQUENCY DISCOUNTS, FEATURE PRICING AND OTHER CLASSIFIED INFORMATION

When we receive your order a classified representative will contact you to confirm your order, price and payment options. Are you a:

❑ ❑ ❑ ❑ ❑

❑ Subscriber ❑ Non-subscriber but a farmer ❑ Non-subscriber and not a farmer

Yes, I want a Western Producer box number. (Add $45.00 for handling replies) Yes, I want a photo. Full Colour photo $39.00/wk + line count. Black & White Photo $25.00/week + line count Yes, I want words in my ad bolded. (Add an additional .75¢ per word per week) Yes, I want to bold the entire ad. (Add .75¢ per word per week) Email/Weblink, Yes, I want to link my classified ad to my website or my email address (your website or email address must be in ad)

Mail to: The Western Producer Advertising Department, Box 2500, Saskatoon, Sask. S7K 2C4 Ph. 1-800-667-7770

Fax 306-653-8750

ACROSS 1. He stars in 27 Dresses 4. He plays Stu Macher in Scream 10. She falls in love with Buster while he was pretending to be in a coma on Arrested Development 11. He plays the lead villain in Mission Impossible: Ghost Protocol 15. The Way We ___ 16. ___ the Right Thing 17. Bob of Mr. Belvedere 19. Breaking ___ 20. He plays Grandpa Walton on The Waltons 22. ___ Mice and Men 24. Stand By ___ 25. Waxman of King of Kensington 26. She stars in CSI: Crime Scene Investigation 30. Rahman who wrote the music for Slumdog Millionaire 31. I ___ Legend 32. Film starring Charlton Heston (with The) 34. Vacancy director Antal 36. Actor Helms 37. ___ Dawn Chong 39. ___ Almighty 40. He plays Hoffy in Stalag 17 42. Lynda ___ George 44. This Is the ___ 45. She stars in Rookie Blue 48. But ___ Cheerleader (2 words) 51. Series about the 4077th 52. Chaney’s The Wolf Man role 54. Film starring Tom Cruise 56. Dolores ___ 57. ___ ’Em High 58. TV series about John Steed and Emma Peel (with The)

DOWN 1. She stars in Source Code 2. Actress Welch 3. ___ and Hayes 4. Actor Ayres 5. He plays A.J. Soprano on The Sopranos 6. ___ Park Lincoln 7. Director who was married to Marilu Henner 8. Initials of one of the stars of NewsRadio 9. Film starring Patrick Swayze (2 words) 12. Sofia from Colombia 13. Initials of the director who directed Curly Top 14. ___ Deep 18. She stars in Disturbia 21. 13 ___ 23. Jack’s Chico and the Man co-star 24. Anne ___ (Ben Stiller’s mother) 27. She played Simone Beck in Julia & Julia 28. Actor Hopkins 29. Initials of the actor who plays Jeff in Used Cars 33. Titan ___ 35. Canadian TV series whose subtitle was “The Secret Lives of Hockey Wives” 38. Film starring Martin Sheen and Sissy Spacek 40. The Hills Have ___ 41. Film starring Jennifer Aniston and Jason Bateman (with The) 43. This is 40 director 44. Boardwalk ___ 46. Mitra of Party of Five and Nip/Tuck 47. ___ Over Me 49. Actress Powers 50. Zach’s character in The Hangover 51. Married to the ___ 53. The ___ Bang Theory 55. Liz Lemon’s adoption agent on 30 Rock


THE WESTERN PRODUCER, THURSDAY, FEBRUARY 6, 2014

ADRIAN’S MAGNETO SERVICE Guaranteed repairs on mags and ignitors. Repairs. Parts. Sales. 204-326-6497. Box 21232, Steinbach, MB. R5G 1S5. JD 830, 820, H, A, AR, 3010 gas, Hart Parr 1836, Cockshutt, IHC, Massey, Case, Ford. Model A chassis, T28 Chev, IHC motors, LYCOMING 0-290-D, 135 HP, 1100 IHC trucks. 306-627-3445, Blumenhof, SK. SMOH, FWF c/w mount and exhaust, exc. cond. Lethbridge, AB., 403-327-4582, FORDSON MAJOR E27N LONGHORN 1949, Perkins P6 diesel, full 3 PTH, PTO, 403-308-0062. swing drawbar correct lights and elec., rebuilt fuel pump, injectors, 4 new tires, nice paint, $10,500. 780-467-2100, Sherwood Park, AB. FORDSON SUPER MAJOR 1953, new WIRELESS DRIVEWAY ALARMS, calving type? 4 cyl. dsl., full 3 PTH, live PTO, good barn cameras, backup cameras for RVs, oversize tires, 4 wheel weights, runs well, trucks and combines, etc. Home and shop $4500. 780-467-2100, Sherwood Park, AB. video surveillance. View from any comput- FACTORY BUILT DEARBORN FEL for 30-40 er or Smart phone. Free shipping. Call HP tractors c/w front mounted hydraulic 403-616-6610, Calgary, AB. pump off 1950’s Ford, $1500. 780-778-1270, Blue Ridge, AB. 1972 CESSNA 150L, TTSN 1425 hrs., 0-320 Lycoming 150 HP, TT 948 hrs., LR tanks, intercom push to talk, tow hook, always hangared, new C of A, updated transporder, family owned, $38,000 OBO. Colonsay, SK. 306-280-3231, 306-255-2611.

ANTIQUE CATERPILLAR COLLECTION, (1932 and up) 35 machines, running, parts books and toys. 204-748-1567, Virden MB FORDSON DEXTA 1958, 3 cyl. dsl., 3 SUPREME AUCTION SERVICES will con- PTH, live PTO, good tires and tin, runs, duct an Antique and Collectible Auction for needs a little fuel and hydraulic work, several consignors at 11 AM, Sunday, Feb. $3250. 780-467-2100, Sherwood Park, AB. 23 at the Kronau Memorial Hall in Kronau, SK. Huge selection of good quality items. Call Brad Steinberg 306-551-9411; Ken McDonald 306-695-0121. For details go to O L D M O T O R C Y C L E S O R PA R T S WANTED, any condition, size or make. www.supremeauctions.ca PL#314604. 1979 or older. Will pickup, pay cash. Call Wes 403-936-5572 anytime, all enquiries answered. Calgary, AB. 1980 LINCOLN CONTINENTAL, 2 dr., 352 motor, could be easily restored, $750 OBO. 204-669-9626, Winnipeg, MB.

CLASSIFIED ADS 47

ONLINE AUCTION. Natural Gas Pump Station and Generator. Closing Monday, February 17, Noon. Viewing by appointment only. If you would like to set up an appointment, you may do so by calling our office, please ask to speak with Riley. Items located at 5th Ave. and MacIntyre St., Regina, SK. 1-800-263-4193 www.McDougallAuction.com P.O. Box 3081 Regina, SK. S4P 3G7. DL #319916.

REG IN A O N -LIN E AUCTIO N

FIREARM S (R e s tricte d & N o n -R e s tricte d )

& CRO S S BO W ARCHERY C LOS IN G TH UR S D AY FEBR UAR Y 20 – N OON Ou r in ve n to ry fo r this s a le w ill b e ho u s e d a tPAW NK ING .C A 1801 Pa rk S tre e t, Re gin a fo r vie w in g pu rpo s e s d u rin g re gu la r b u s in e s s ho u rs , w hic h a re : M o n d a y - Frid a y 10 AM - 5:3 0 PM S a tu rd a y 9 AM - 3 :00 PM Bid d ers S hould Ha ve Firea rm s Ac quis ition C ertific a te T o Pa y For And Pic k Up Purc ha s es ! AC C EP TIN G C ON S IG N M EN TS D AILY!

w w w.M c D ou g a llAu c tion .c om 1-800-26 3-4193

O N LIN E AUCTIO N M AP LE LEAF BAKERY RETIREM EN T CLO S E O UT C LOS IN G TH U. FEB. 20TH – N OON UN R ES ER VED (w ith the excep tio n o f2 item s ) V iew in g: Fri., Feb . 7, 2014 12 n o o n till 4 pm Thu rs ., Feb . 13, 2014 9 a m till 12 N o o n Thu rs ., Feb . 20, 2014 9 a m till 11 a m a t 16 00 To ro n to S treet Regin a . A clea n lin e o f b a kery eq u ip m en t u p fo r p u b lic s a le. T he eq u ip m en t is very w ell ca red fo r, a n d cu rren tly in u s a ge u n til the en d o f Ja n u a ry. Y o u w ill w a n t to m a ke a rra n gem en ts to a tten d this s a le, w hether yo u o w n a b a kery, o r d ea l in b a kery eq u ip m en t! Bid d in g to co m m e n ce Fe b rua ry 1s t.

REMOTE CONTROL TRAILER CHUTE openers can save you time, energy and keep you safe this seeding season. FM remote controls provide maximum range and instant response while high torque drives operate the toughest of chutes. Easy installation. Brehon Agrisystems call 306-933-2655 or visit us online at: www.brehonag.com Saskatoon, SK. CHECK OUT OUR inventory of quality used highway tractors, view information at www.titantrucksales.com

S o u the rn In d u s tria l is the pro u d s u pplie r a n d s e rvic e s ho p fo r Ne ville Bu ilttra ile rs .

SANDBLAST AND PAINT your grain trailers, boxes, flatdecks and more. We use industrial undercoat and paint. Can zinc coat for added rust protection. Quality workmanship guaranteed. Prairie Sandblasting and Painting, 306-744-7930, Saltcoats, SK.

T ra ilers In S toc k: • 3 8.5’ ta n d e m o n a ir, 78” high s id e , s id e c hu te s , lo a d e d .........................$$37 ,000 • 45’ Tri-Axle , 78” high s id e s , 2 ho ppe r, a ir rid e ....................$$45 ,000 NEW TRAILERS ARRIVING DAILY! CALL FOR QUOTES.

w w w.M c D ou g a llAu c tion .c om 1-800-26 3-4193 P.O. Bo x 308 1 Regin a , S K . S 4P 3G7 Dea ler L ic #319 9 16

Call Today for your Equipment Trailer Needs.

HUGE FARM TOY AUCTION: Friday Feb. 7th, Legion Hall, Yorkton, SK. Doors open 4 PM, auction starts at 6 PM. Pictures and info. at www.jakz.ca or ph: 306-641-5850.

36’ S pring Rid e, S id e C hutes , 70” High S id es ......................$$29,900

P.O. Bo x 308 1 Regin a , S K . S 4P 3G7 Dea ler L ic #319 9 16

306 -8 42-2422

w w w .s outh e rn in dus tria l.ca

Hw y. Jc t. 13 & 3 9 | W e yb urn , SK

BORDER CITY COLLECTOR SHOW, Lloydminster Stockade Convention Centre, SK-AB, Sat. Mar. 8, 9AM to 6PM, Sun. Mar. 9, 10AM to 4PM, 2014. Featuring antiques, farm toys, coins and more! Mark your calendar now. Special this year, large model train display courtesy of the Edmonton Model Train Club. Must be seen. Brad: NEW TRACTOR PARTS. Specializing in 780-846-2977, or Don: 306-825-3584. engine rebuild kits and thousands of other parts. Savings! Service manuals and decals. Also Steiner Parts dealer. Our 40th year! www.diamondfarmtractorparts.com Call 1-800-481-1353. CO LLECTABLE SALE JOHN DEERE 730, diesel, SN #732308 nd th w/pony start, asking $4500; JD 830, diesel, SN #830138 w/pony start, asking $6000; Set of fenders for JD 4020, ofM ARK ET M ALL fers. 780-372-2491, Bashaw, AB.

AN TIQUE &

Fe b . 24 – M a r. 2

2325 Preston Ave.S. SASK ATO O N

LIV E UN RES ERV ED HARD W O O D FLO O RIN G AUCTIO N S AT., FEB. 15 - 10:30 AM AtBo th Our Lo ca tio n s : R EG IN A - EM ER ALD P AR K S AS KATOON - 335 0 ID YLW YLD D R . Ove r 20,000 s q/ftP e r Lo ca tio n o f Exo tic H a rd w o o d a n d La m in a te VIEW ING: FR I., FEB.14, 8AM - 4:30P M All New , W id e Pla n k, Prim e Qu a lity, Reta il Gra d e Pro d u ct. VisitOurW eb site forTerm s, Cond itions & Deta ils.

WANTED: TRACTOR MANUALS, sales brow w w.M c D ou g a llAu c tion .c om chures, tractor catalogs. 306-373-8012, 1-800-26 3-4193 Saskatoon, SK. P.O. Bo x 308 1 Regin a , S K . S 4P 3G7 Dea ler L ic #319 9 16 WHEELOCK (NEW YORK Pianola) upright piano, refinished, good condition. Contact UPCOMING AUCTION Antique and Col306-735-7250, Whitewood, SK. lectibles Auction, Saturday, Feb. 22nd, 2014, 9 AM. Nelson’s Auction Centre at Meacham, SK. Consign now to take advantage of our advertising. For more info. CHOICE OF 2 ice resurfacers: Zamboni or call 306-944-4320 or visit our website: Olympia, x-government, $17,500 - natural www.nelsonsauction.com gas, $20,500 - propane. Call 306-668-2020 WORKING STEAM TRACTORS! Double www.northtownmotors.com DL #908171. acting brass cylinder and piston, forward, reverse and neutral controls, plus working whistle. Flywheel has grooved pulley to run accessories! Runs 15 min. per fueling (fuel supplied). D405 Steam Tractor24/7 ONLINE BIDDING regular $449.95. Winter Sale $299.96. Refer to W eb site forTerm s & Cond itions Shipping $18.95. Our 40th year! 3 LO CATIO N S www.YesteryearToysCanada.com Ph. REG IN A, S AS KATO O N & M O O S O M IN : 1-800-481-1353. V EHICL ES & TRAIL ERS : 2009 F o rd WANTED: COCKSHUTT TRACTORS, espeRa n ger; 2007 Chevro let S u b u rb a n 1500 N EXT SALE cially 50, 570 Super and 20, running or L S ; 2009 Do ep ker T rid em E n d Du m p S ATUR DAY, 9:00 AM not, equipment, brochures, manuals and T ra iler. EQUIP: 40’ S ea Co n ta in er; Jo b memorabilia. We pick up at your farm. Jim AP R IL 5 , 2 014 Bo x (2’ 2” H x 4’ L x 2’ W ) 3 Po in t Hitch Harkness, RR 4, Harriston, ON., N0G 1Z0, G R EAT PLAIN S AUCTIO N EER S 519-338-3946, fax: 519-338-2756. L a n d Gro o m er p lu s Ho m e Ren o . M a teria l 5 M i. E. o f R egin a o n Hw y. #1 & S p ecia lty E q . s u ch a s a S electio n o fOil 2- JD AR tractors, in running order, one in G rea tPla in s In d u stria lPa rk Pro d u cts (Ba rrels , Ca s es , a n d Ju gs ). 1939 unstyled, one styled, $2000 ea. OBO. TELEPHO N E (306) 52 5- 9516 780-336-4061, 780-390-0075, Viking, AB. APPL IAN CES : F rigid a ire W a s hin g w w w .grea tpla in sa u ctio n eers.ca M a chin e; F rigid a ire Dryer; T a ylo r 490 w w w .glo b a la u ctio n gu id e.co m WANTED RESTORED MASSEY HARRIS T a b le T o p S ha ke M a chin e. PL US , a Rin g S ALES 1stS ATUR DAY O F EV ER Y M O N TH Pony tractor in good running cond., little P.L. #91452 9 a p p ra is ed @ $22,775 in o u r Va len tin e’s or no rust. 780-674-2868, Barrhead, AB. Da y Jew ellery E ven tClo s in g o n F eb 11th. 1948 JD D, complete, running, shedded, PBR FARM AND INDUSTRIAL SALE, last BUY N OW : Un u s ed - 2014 Bu llet T ra vel $2500 OBO. Located in Regina, SK. Email Saturday of each month. Ideal for farmers, T ra iler; 2012 36’ Ca n a d ia n Ha u ler Ca rgo contractors, suppliers and dealers. Consign jackseitz@mac.com Phone 832-799-9008. T ra iler; Us ed 53’ All. In s u la ted Co n ta in er; now. Next sale February 22, 9:00 AM. MASSEY 444 TRACTOR excellent rubber, PBR, 105- 71st St. West, Saskatoon, SK., New T o o l S hed M a gn u m Go ld 4000 E a s y good motor; Case 990 w/front end loader, www.pbrauctions.com 306-931-7666. K leen Pres s u re W a s her Gra n ite 3584 hrs. 403-443-5366, Three Hills, AB. Co u n terto p s ; New K itchen Ca b in ets ; New BRITISH DORMAN DIESEL engine, 130 HP, Res ta u ra n tE q u ip . & M o re used 18 hrs., early 1950’s, stored inside, REAL ES TATE IN S AS K ATCHEW AN & $7500. 306-854-2030, Elbow, SK. M AN ITOBA

A U CTIO

ON LIN E ON LY

AUCTIO N O P EN S

AUCTIO N CLO S ES

N

TUES ., FEB. 11 a t 9 AM W ED , FEB 12th a t 9 AM

ONLY 24 HRS TO BID TR ACTOR S : 2012 NH T9-505; 2003 NH TM 190 M FW D, FEL; 1997 JD 7210, M FW D, w / FEL; 2010 M F 1635 M FW D, w / FEL. COM BINES : 2010 NH CR 9060; NH TR98. S P R AYER : 2010 JD 4930. Plu s Ba le Kin g p roces s or; rou n d ba ler; Deg elm a n 7200, 16’ bla d e; M a cd on 35’ hea d er; Ezee-O n 7550 a ir d rill; O liver Cletra c Cra w ler; A .C. A D3 g ra d er. W ork ben ch; Ca n va s 30x85 Bu ild in g . Q u a n tity of tools , w in ches , cha in s a w s , g ra p p le. Plu s m u ch m ore.

GO TO: w w w.s cha p a ns ky.com TODAY To regis ter to b id .

Inc.

Toll Free Anytime 1-866-873-5488 PH: 306-873-5488 TISDALE, SASK. PL #912715

www.schapansky.com

WRECKING SEMI-TRUCKS, lots of parts. Call Yellowhead Traders. 306-896-2882, Churchbridge, SK. SASKATOON TRUCK PARTS CENTRE Ltd. North Corman Industrial Park. New and used parts available for 3 ton highway tractors including custom built tandem converters and wet kits. All truck makes/models bought and sold. Shop service available. Specializing in repair and custom rebuilding for transmissions and differentials. Now offering driveshaft repair and assembly from passenger vehicles to heavy trucks. For more info call 306-668-5675 or 1-877-362-9465. www.saskatoontruckparts.ca DL #914394 TRUCK BONEYARD INC. Specializing in obsolete parts, all makes. Trucks bought for wrecking. 306-771-2295, Balgonie, SK. WRECKING VOLVO TRUCKS: Misc. axles and parts. Also tandem trailer suspension axles. 306-539-4642, Regina, SK. WRECKING TRUCKS: All makes all models. Need parts? Call 306-821-0260 or email: junkman.2010@hotmail.com Wrecking Dodge, Chev, GMC, Ford and others. Lots of 4x4 stuff, 1/2 ton - 3 ton, buses etc. and some cars. We ship by bus, mail, Loomis, Purolator. Lloydminster, SK.

TWO NEW COMPLETE pairs OF 8” alum. hopper augers, c/w wireless remote to fit 2013 30’ Lode-King AHV. Call Dan at: 403-533-2205, Rockyford, AB.

WILSON ALUMINUM STOCK trailer, like new cond., just over 8’ wide, 32’ floor, 8’ on the neck. Winter kit and decking to haul smaller livestock, $27,000. 780-812-8733, Ardmore, AB.

NEW 2014 TANDEM or tri-axle, spring or WWW.DESERTSALES.CA Trailers/Bins air ride, steel or alum. Cheapest in western Westeel hopper bottom bins. Serving AB, Canada. 306-563-8765, Canora, SK. BC and SK. Wilson, Norbert, gooseneck, stock and ground loads. Horse / stock, 2004 LODE-KING SUPER B open end grain cargo / flatdeck, dump, oilfield, all in trailers, 11x22.5 tires 70%, air ride, safe- stock. 1-888-641-4508, Bassano, AB. tied, good condition, asking $32,500. YEAR END PRICING: On all in stock stock Phone 204-857-1700, Gladstone, MB. trailers, 20’ and 24’, steel and aluminum. 1993 LODE-KING TANDEM, springs, elec. Starting at $10,500. Assiniboia, SK. Call tarp, certified, some rust, $16,000 OBO. Glen 306-640-8034, gm93@sasktel.net 306-864-7945, Kinistino, SK. NEW BLUEHILLS GOOSENECK stock, 20’, 1998 TRIDEM GRAIN trailer, 3 tanks, air $13,900; 18’, $11,900. Call 306-445-5562, ride, tarp good, new tires, $18,500. Call Delmas, SK. 306-939-4529, Earl Grey, SK. 2007 WILSON cattle/hog trailer, $52,000; 2007 MERRITT cattle/hog trailer, $52,000. 403-625-4658, Claresholm, AB.

NORMS SANDBLASTING & PAINT, 40 years body and paint experience. We do metal and fiberglass repairs and integral to daycab conversions. Sandblasting and paint to trailers, trucks and heavy equip. VS TRUCK WORKS Inc. Parting out GM Endura primers and topcoats. A one stop 1/2 and 1 ton trucks. Call 403-972-3879, shop. Norm 306-272-4407, Foam Lake SK. Gordon or Joanne, Alsask, SK. www.vstruckworks.com 2005 INTERNATIONAL 9400. Warner Ind. ONE OF SASK’s largest inventory of used Moose Jaw 306-693-7253, Swift Current heavy truck parts. 3 ton tandem diesel mo- 306-773-3030, Regina 306-359-1930. tors and transmissions and differentials for www.warnerindustries.com DL #913604. all makes! Can Am Truck Export Ltd., 1997 DOPEKER SUPER B grain trailers, 1-800-938-3323. closed end, 24.5 tires, spring ride, $22,000 WRECKING LATE MODEL TRUCKS: 1/2 Will split. 306-424-2690, Montmartre, SK. tons, 3/4 tons, 1 tons, 4x4’s, vans, SUV’s. Also large selection of Cummins diesel 1996 LODE-KING SUPER B grain trailers motors, Chevs and Fords as well. Phone closed end, exc., spring ride, 24.5 tires at Edmonton- 1-800-294-4784, or Calgary- 50%, tarps vg, round fenders, very little 1-800-294-0687. We ship anywhere. We rust, paint vg. Farm used, lower mileage, $37,000. Lloyd Sproule, 403-627-2764 or have everything, almost. 403-627-7363, Pincher Creek, AB. DIESEL AND GAS ENGINES - Medium Duty. Cummins 5.9; Cat 3116; Ford 6.6- 6 2009 CANCADE TRIDEM pup trailer, 20’ cyl. w/auto. trans. Gas: IH 304, 345; Ford alum. box, 68” sides, air ride, low miles, 370; GM 366TBI. Call Phoenix Auto, Lucky $34,500. 306-743-2862, Langenburg, SK. Lake, SK., 1-877-585-2300. 2007 TIMPTE TANDEM trailer, 34’ long x SOUTHSIDE AUTO WRECKERS located 8.5’ wide x 6’ high, like new, $28,500. Weyburn, SK., 306-842-2641. Used car 306-452-7755, Alida, SK. parts, light truck to semi-truck parts. We 2000 LODE-KING SUPER B grain trailers, buy scrap iron and non-ferrous metals. closed end, exc., air ride, 22.5 tires at 50%, 1987 LT9000, 18 speed, wet kit, needs tarps very good, flat fenders, very little motor work, $3500. Call 306-445-5602, rust, paint vg, farm used, lower mileage, North Battleford, SK. $41,000. Ph Lloyd Sproule, Pincher Creek, AB., 403-627-2764 or 403-627-7363.

9’ WIDE TANDEM lowbed, beavertail, $26,000; Tri-axle detach 50 ton, $38,000. 306-563-8765, Canora, SK. COMPONENTS FOR TRAILERS. Shipping daily across the prairies. Free freight. See “The Book 2013” page 195. DL Parts For Trailers, 1-877-529-2239, www.dlparts.ca 2014 7x16 HD 14,000 lbs. GVW, two 7000 lbs axles. Regular $7500, Sale Price $6490 D&D Vehicle Sales and Service, Camrose, AB. 780-672-4400, www.ddsales.com BEHNKE DROP DECK semi style and pintle hitch sprayer trailers. Air ride, tandem and tridems. Contact SK: 306-398-8000; AB: 403-350-0336. 24’ GOOSENECK tridem 21,000 lbs, $7890; Bumper pull tandem lowboy: 18’, 14,000 lbs., $3975; 16’, 10,000 lbs., $3090; 16’, 7000 lbs., $2650. Factory direct. 888-792-6283. www.monarchtrailers.com 2006 MUVALL MACHINERY trailer, 53’ triaxle, hyd. beavertail and winch, alum. pullouts to 15’, pullout lights and rear strobes, $50,000. 780-305-3547, Neerlandia, AB. PRECISION TRAILERS: Gooseneck and bumper hitch. You’ve seen the rest, now own the best. Hoffart Services, 306-957-2033, www.precisiontrailer.com COMING SPRING 2014: The Industry’s strongest/ lightest alum. Super B trailer. Pre-Order today, get the best advantage! www.warnerindustries.ca DL #913604.

SCHOOL BUSES: 1986 to 2002, 20-66 pass., $1600 and up. Phoenix Auto, Lucky Lake, SK., 1-877-585-2300. DL #320074. TRUCK & TRAILER SALES

UP C OM IN G EVEN TS : L ive Un res erved Ha rd w o o d Flo o rin g Au ctio n s to Ta k e Pla ce in Bo th Regin a a n d S a s k a to o n o n Feb ru a ry 15th - 10:30 a m . Regin a : On lin e Au ctio n - N a tu ra l Ga s Pu m p S ta tio n a n d Gen era to r Clo s in g Feb . 17 - N o o n Regin a : On lin e Au ctio n fo r M a ple L ea f Ba k ery Co m plete Co n ten ts o f Co m m ercia l Ba k ery Clo s in g Feb . 20th Regin a : On lin e Au ctio n - Firea rm s (Res tricted & N o n -Res tricted ) & Cro s s Bo w Archery Feb . 20th N o o n

AC C EP TIN G C ON S IG N M EN TS N OW ! P LUS W EEKLY ON -LIN E AUC TION S P.O.T oBoBook x 308 Your 1 ReginL ive a , Sor K . Online S 4P 3G7Auc Deation ler L Ciconta #319c9t16

M CD O UG ALL AUCTIO N EERS LTD .

1-800-26 3-4193 Book m a rk : w w w.M c D ou g a llBa y.c om Regin a – S a s k a to o n – M o o s o m in

ESTATE CAR: 2004 Grand Marquis LS “Ultimate Edition”, 173,000 kms, exc. cond. will take grain on trade. Langham, SK. Call 306-283-4747 or 306-220-0429.

NEW WILSON SUPER B in stock, tridem, one 2 hopper, two 3 hoppers, also tandem; 2012 Doepker Super B, alum. rims; 2008 Lode-King alum. open end Super B, alum. rims, air ride, also 2009 w/lift axles; 1995 Castleton tridem, air ride; 17’ A-train pup, very clean, certified. 306-356-4550, Dodsland SK. DL #905231. www.rbisk.ca COMING SPRING 2014: The Industry’s strongest/ lightest alum. Super B trailer. Pre-Order today, get the best advantage! www.warnerindustries.ca DL #913604. 2012 GRAVE HAUL 2 hopper tridem, air ride, 24.5” steel wheels, 48’, $50,000. 306-287-8487, Watson, SK. 1994 DOPEKER SUPER B grain trailer, new pots and slacks, brakes and tarps are good, fresh safety, 11/24.5 at 75%, $27,000 OBO. 306-287-3826, Watson, SK.

D ecks 2013 E BY All Alu m in u m 20’ Deck Un d er 2014 F ellin g 53’ T ria xle Dro p Decks 2014 F ellin g 30’ Pin tle Hitch Deck, 30 T o n 2014 F ellin g T iltDeck w /a ir Ra m p s , 25 T o n 2013 F ellin g T iltDeck, 25 T o n 2014 F ellin g 48’x102’ 55 T o n T ri-a xle Deta cha b le w / O u triggers 2014 F ellin g 53’ T ria xle F la td ecks 2015 F ellin g 10’ w id e d eta cha b le w / Alu m in u m p u ll o u ts - Co m in g S p rin g

Live s toc k 2015 E BY 53’ Gro u n d L o a d T a n d em - Co m in g S p rin g

G oos e n e c k Tra ile rs 2013 E BY M a verick 20’ 2014 E BY W ra n gler 22’ 2014 E BY M a verick 30’ S la tS id e Go o s en ecks w ith T a n d em 7K a xles

Regina - 1-800-667-0466 | Keefe HallCell- 306-535-2420

w w w .sa sk v olv o.com

D.L#909069

C a ll fo rAva ila b ility a n d P ricin g Fin a n ce R e po ’s Acce ptin g Offe rs


48 CLASSIFIED ADS

53’ AND 48’ tridem and tandem stepdecks, w/wo sprayer cradles; Two 48’ tandem 10’ wide, beavertail, flip ramps, air ride, low kms; 1991 Trail King machinery trailer, hyd. tail; 53’, 48’, 28’ tridem and tandem highboys, all steel and combos. SUPER B HIGHBOYS; A-train tanker will separate water or fert.; Tandem and S/A converter with drop hitch; 53’-28’ van trailers; B-train salvage trailers; Tandem lowboy, 9’ wide; High clearance sprayer trailer w/tanks and chem handlers. 306-356-4550, www.rbisk.ca DL # 905231. 2011 DOEPKER RGN machinery trailer, 53’ tri-axle, c/w alum. pullouts, rear strobes, and pullout lights, side winches, alum rims $55,000. 780-305-3547, Neerlandia, AB. TRAILERS- ADVANTAGE AUTO AND Trailer. Livestock, horse and living quarter, flatdeck, goosenecks, tilts, dumps, cargos, utilities, Ski-Doo and ATV, dry van and sea containers. Call today over 250 in stock, 204-729-8989 in Brandon, MB. on the Trans Canada Hwy. www.aats.ca CHECK OUT OUR inventory of quality used highway tractors, view information at www.titantrucksales.com 2- LODE-KING DROPDECK 48’ sprayer trailers, w/cradles, 3250 gal. tank, 3” pump and handler. Call 306-397-2678, Edam, SK. 2012 BEHNKE 53’ trailer, tri-axle spring ride, 13’ upper, 35’ lower, 5’ beavertail, sprayer cradles and ramps, 2- 2600 gal. black poly tanks, 3” pump and chem handler, $55,000. 306-287-8487, Watson, SK. WANTED: TRI-AXLE 53’ hay trailer, air ride preferred. 306-753-2667, Macklin, SK. 2007 DOEPKER 53’ tri-axle highboy, pullout lights and rear strobes, $34,000. 780-305-3547, Neerlandia, AB.

THE WESTERN PRODUCER, THURSDAY, FEBRUARY 6, 2014

LACOMBE TRAILER SALES & RENTALS WE SELL AND RENT

Hi Boys, Low Boys, Drop Decks, Storage Vans, Reefer Vans and Freight Vans & More. 7 KM West of RED DEER from Junction of HWY. 2 & 32nd St.

403-347-7721

Kiefer Stock Horse Trailers Aluminum & Steel

We Take Trades

Give us a call, you’ll be glad you did! RPM Automotive Sundre: 1-888-638-4525 sales@kieferbuiltcanada.com Automan Trailers Prince Albert: 1-800-252-0840 automan@kieferbuiltcanada.com Smyl RV: St. Paul: 1-800-522-4105 smyl@kieferbuiltcanada.com F.M. Trailer World Vulcan, AB: 1-877-205-1999 stacey@kieferbuiltcanada.com Strathmore, AB: 403-934-6833 holly@kieferbuiltcanada.com

www.kieferbuiltcanada.com

2005 and 2003 ADVANCE TC406 alum. tankers, 34,000 liters, air ride VIPK, safetied, $38,500. 306-752-4909, Melfort, SK. 1991 JC TRAILERS, double drop lowbed, w/hyd removable gooseneck. Tandem axle spring ride, 28’ in the well. Flip over front ramps, 80% LowPro 22.5 rubber, w/2 new mounted spares, 9 swingouts and 10 lashing rings per side, recent AB. safety, nice straight trailer, $19,000. Email pictures available. Jeff 403-638-3934, Sundre, AB. 1995 BEELINE TRI-AXLE LOG TRAILER, 12x22.5 tires, extra bunks, air ride, safetied, winter use only, not used in last 6 years, good and straight. Phone Ken 306-468-7909, Canwood, SK. WANTED: 30’ SELF-UNLOADING gooseneck multi trailer for hauling round bales. 306-542-2575, Veregin, SK. GOOD TRAILERS, REASONABLY priced. Tandem axle, gooseneck, 8-1/2x24’, Beavertail and ramps, 14,000 GVW, $6900; or triple axle, $7900. All trailers custom built from 2000 to 20,000 lbs., DOT approved. Call Dumonceau Trailers, 306-796-2006, Central Butte, SK. NEW PRODUCT!! BEHNKE 53’ air ride sprayer trailer only $42,500. Call 1-888-435-2626 or visit your local Flaman location. www.flaman.com for more info. TOPGUN TRAILER SALES “For those who demand the best.” PRECISION AND AGASSIZ TRAILERS (flatdecks, end dumps, enclosed cargo). 1-855-255-0199, Moose Jaw, SK. www.topguntrailersales.ca 1991 STAINLESS TANKER, Tremcar Super B insulated tankers, 4500 Imp. gal. per tank, Spring Ride Reyco susp., recent safety, 22.5 Dayton wheels. Set up to transport liquid fertilizer, water, etc. Comes with Honda motor w/John Blue pump, $29,900. Call 306-861-5911, Weyburn, SK. 2007 TRAIL KING sliding axle trailer, 10’ wide, 55 ton rating, 20,000 lb. winch, in real good condition. 306-677-7303, Hodgeville, SK.

Andres

Trailer Sales And Rentals Andres specializes in the sales, service and rental of agricultural and commercial trailers. W IL S O N G O O S EN EC K S & C ATTL E L IN ER S

W IL S O N A L U M IN U M TA N D EM , TR I-A X L E & S U P ER B G R A IN TR A IL ER S

TR A N S C R A F T F L AT D EC K S & D R O P D EC K S AVA IL A B L E

WWW.TITANTRUCKSALES.COM to view information and to check out our inventory of quality used highway tractors! RING IN THE New Year with a great truck from Greenlight Auto & Truck. A huge selection of 2013 leather GM DuraMax’s. Saskatoon, SK. www.GreenlightAuto.ca CHECK OUT OUR inventory of quality used highway tractors, view information at www.titantrucksales.com 2014 CHEVROLET SILVERADO 1500 LTZ, 4 door, 5.3L, Stk# V243226. D&D Vehicle Sales and Service, Camrose, AB. 780-672-4400, www.ddsales.com 2013 DODGE RAM 2500, Outdoorsman, Cummins, crew cab, farm price $47,975. 1-800-667-4414, www.thoens.com DL #909250 2013 DODGE DURANGO Crew Plus, leather, nav., $43,975. Call: 1-800-667-4414, www.thoens.com DL #909250 2013 CHEV SILVERADO 3500 LTZ, loaded, dually 6.6L, 4x4, 15,000 kms, leather, sunroof, nav. Greenlight Truck & Auto, Saskatoon. www.GreenlightAuto.ca DL#311430. 2013 CADILLAC ESCALADE E, 4 door, SUV 6.2L, 6 Stk. #V22899, $81,900. D&D Vehicle Sales and Service, Camrose, AB. 780-672-4400, www.ddsales.com 2012 FORD SHELBY coupe, 2 door, 5.4L V-8 cyl., $51,900. Stk# V212046. Low kms, only 21,000! D&D Vehicle Sales and Service, Camrose, AB. 780-672-4400. 2012 DODGE RAM 3500 Laramies (3), 5/6 pass., Mega Cab, dsl., 40,000 kms, from $51,995. Greenlight Truck & Auto, Saskatoon. DL#311430. www.GreenlightAuto.ca 2012 DODGE RAM 3500 Laramie, Mega Cab, 6.7L, 4x4, dsl., 78,000 kms, black, $51,995. Greenlight Truck & Auto, Saskatoon. DL#311430. www.GreenlightAuto.ca 2012 DODGE RAM 1500 Laramie Long Horn, 5.7L Hemi, 4x4, $36,995. PST paid. Greenlight Truck & Auto, Saskatoon. DL#311430. www.GreenlightAuto.ca 2011 DODGE RAM 2500 SLT, longbox, dsl., loaded, 72,000 kms, was $38,995 now $35,995. Greenlight Truck & Auto, Saskatoon. DL#311430. www.GreenlightAuto.ca 2010 FORD F150 King Ranch, fully loaded, 4x4, 5.4L, navigation, $24,995. PST paid. Greenlight Truck & Auto, Saskatoon, SK. DL#311430. www.GreenlightAuto.ca 2009 NISSAN TITAN, 5.6L, silver, 40,409 kms, SK-U0721, $24,995. DL #914077. Call 1-888-240-2415 or visit our website: www.subaruofsaskatoon.ca 2009 CHEV AVALANCHE LTZ, loaded, 4x4 5.3L, leather, 58,000 kms, $29,995. PST pd. Greenlight Truck & Auto, Saskatoon, SK. DL#311430. www.GreenlightAuto.ca 2008 GMC SIERRA 1500 SLT, AC, CC, CD, leather, black, auto., 73,249 kms, Stk# SK-U0705, $28,995. 1-888-240-2415 or www.subaruofsaskatoon.ca DL #914077. 2008 DODGE RAM 3500 Laramie, dually, 6.7L, 178,000 kms, leather, $29,995. PST pd. Greenlight Truck & Auto, Saskatoon, SK. DL#311430. www.GreenlightAuto.ca 2007 CADILLAC ESCALADE EXT, 4 door, 6.2L V-8 cyl auto, $28,900. Stk# V259412. D&D Vehicle Sales and Service, Camrose, AB. 780-672-4400, www.ddsales.com 2006 FORD F350 V8, white, 224,555 kms, SK-U01140A, $18,995. Call for details 1-888-240-2415 or visit our website: www.subaruofsaskatoon.ca DL #914077.

2004 FORD F350, ext cab, 4x4, long box. 6.0L dsl, 274,000 km., runs awesome. Fully loaded, c/w 6 month Limited Powertrain Warranty. Resource Auto, 401 Albert St., Regina, SK. 306-522-7771, DL#317129

2001 STERLING 3-PEDAL, 10 spd. AutoShift, 430 HP 60 series Detroit, new rear grips, air ride, 1.1 kms, auto greaser, new CIM BH&T, fresh Sask. safety, very good, fleet maintained truck, $57,900. Cam-Don Motors Ltd., 306-237-4212, Perdue, SK.

2005 IH 9200 AutoShift and 2007 T800 KW, elec. tarp, pintle hitch, 13 spd. UltraShift, Cat C15, new 20’ BH&T; 1976 GMC 2004 FORD F-350, diesel, 6 spd., 4x4, 11’ 6 5 0 0 , 3 6 6 , 5 & 2 , 1 6 ’ w o o d b o x . flatdeck, 5th wheel trailer hitch, safetied, 306-356-4550, Dodsland, SK. DL #905231 www.rbisk.ca great farm truck, $8000. 1-866-938-8537. 2006 CHEVY SILVERADO Special Edition Silverado 1500, 4 dr., 5.3L engine auto., A/T/C, PW, PDL, CD, chrome package, burgundy, 222,000 kms, $9000 OBO. 306-442-4670, 306-442-7758, Parry, SK. 2006 HONDA RIDGELINE 4x4, dark green, Stk# SK-S2590A, 93,000 kms, $16,995. DL #914077. Call 1-866-980-0260 or www.subaruofsaskatoon.ca 2007 DODGE 2500 crewcab, 4x4, 5.7 Hemi eng., auto trans, PW, 269,000 kms, $10,900. Phoenix Auto, Lucky Lake, SK., 1-877-585-2300. DL #320074. 2007 FORD F150 Lariat, 4x4, leather, red, 5.4L 90,347 kms, Stock #SK-U0460, $26,495. Call 1-866-980-0260 DL#914077 www.subaruofsaskatoon.ca 2012 WHITE DODGE Ram, 4x4 Quad Cab, 4.7 V8, fully equipped, running boards and rails, 10,000 kms, lots of warranty $25,000 no taxes. 306-384-2428, Saskatoon, SK.

2006 FREIGHTLINER Columbia, Mercedes 460 HP, 12 spd. AutoShift, new 20’ Berg’s grain box w/remote chute/hoist, good rubber, full lockers, complete pintle plate, good clean truck. Contact Henry for price at 204-324-7593, Altona, MB.

2006 IHC 9200I 13 spd. UltraShift, 657,000 kms.; 2006 IHC 9200I 12 spd. Meritor auto., 1.1m kms.; 2006 Macks 10 spd Eaton AutoShifts. All with new 20x65” grain boxes and fresh SK safeties. Saskatoon, SK. 306-270-6399, DL# 316542, CHECK OUT OUR inventory of quality used www.78truxsales.com highway tractors, view information at www.titantrucksales.com DIESEL 2006 JEEP Liberty Sport, 115,000 kms, 4x4, auto., mint cond., $14,900; 2013 Lincoln MKX AWD SUV, black, 32,000 kms, heated/cool seats, balance of warranty, $38,900. K&L Equipment, Regina/Ituna, SK. 306-795-7779, 306-537-2027 or email ladimer@sasktel.net DL #910885. RING IN THE New Year with a great truck from Greenlight Auto & Truck. A huge selection of 2013 leather GM DuraMax’s. Sas- 2007 AND 2010 KENWORTH T800 trucks, AUTOSHIFT, 10 spd., new B&H, ISX Cumkatoon, SK. www.GreenlightAuto.ca mins, very clean. Also trucks available with no box. 2010 trucks have Cat engine. Call 204-673-2382, Melita, MB. DL #4525.

1990 FREIGHTLINER FLD 120, 235 WB, newer 425 CAT, 15 spd., 3.90, 40 rears, safetied Oct. 2013, truck completely gone through front to back, new 24.5 tires, 60” d o u b l e b u n k . T h u n d e r b o l t Tr u c k i n g 403-504-9740, Medicine Hat, AB. 2000 IHC 9200, C12 Cat, 430 HP, 10 spd. AutoShift w/clutch petal, 3-way locks, 51” flattop sleeper, 60% rubber, new rear brakes, cold AC, new AB safety, $15,000. Email pics avail. 403-638-3934, Sundre AB 2001 FREIGHTLINER, 12.7 Detroit, 13 spd. trans., 40,000 rears, good running truck, $12,500 OBO. 306-397-2599, Meota, SK. 2003 PETERBUILT 378, 48” sleeper, C-12 13 spd., 240” WB, $29,500 OBO. Fleet maintained. 204-224-1358, Winnipeg, MB. 2005 PETERBILT 379L, 63” bunk, C-15, 1,245,000 kms, 24.5 rubber, 13 spd. trans., good cond.; 2007 PETERBILT 378 daycab, heavy spec. truck, C-15, 411,000 kms, full lockers, wet kit, 14,000 fronts, 46 rears, 22.5 rubber, 18 spd. trans., good condition. Call 204-638-1068, Sifton, MB. 2006 T800, EXT. daycab, ISX 485, 12 spd. auto, 505,000 kms, diff. lock, traction control, $54,000. 306-398-2923, Cut Knife, SK

2007 FREIGHTLINER CLASSIC, 820,000 kms, 11x24.5 rear tires, 12,000 fronts, 40,000 rears (supers), 1 owner, only used in long haul. Certified until November, 2014. 780-387-1172, Wetaskiwin, AB. 2007 FREIGHTLINER CLASSIC. Warner Ind. Moose Jaw 306-693-7253, Swift Current 306-773-3030, Regina 306-359-1930. www.warnerindustries.com DL #913604. 2007 PETERBUILT 379L Super B spec., ISX 525, 700,000 kms, full locks, 54” midrise, excellent rubber, leather guts, fresh safety, shedded, premium truck, $70,000; Also 2001 aluminum Lode King super B, new virgin caps, shedded, real nice, $35,000. 403-823-1987, Standard, AB. 2007 WESTERN STAR, daycab, 550 Cat, 18 spd., 720,000 kms, 46 rears, wet kit. Call 780-990-8412, Edmonton, AB. 2008, 2- 2007, 2005, T800 KWs, 500 Cat, 18 spd., 46 diffs, 4-way locks w/Roobar bumpers; 378 and 379 Pete, 4- 2006s, AUTOSHIFT TRUCKS AVAILABLE: Boxed 2005, 2004, 2003, Cat, 18 spd., 4-way tandems and tractor units. Contact David locks, all w/Roobar bumpers; 2006 W900 306-887-2094, 306-864-7055, Kinistino, KW daycab, Cat, 18 spd; 2007 T800 KW, SK. DL #327784. www.davidstrucks.com Cat C15, 13 spd. UltraShift; 2003 Freightliner Classic, Cat, 18 spd, new rubber; 1999 9300 IH, dual stacks, dual breathers, 60 Detroit, 13 spd; 1996 T800 KW 500 Cat, recent work orders. 306-356-4550, Dodsland, SK. DL #905231 www.rbisk.ca

Hwy. 3, Seven Persons, AB (Medicine Hat, AB)

PH. 403-977-1624 rawlyn@automatictruck.com

www.automatictruck.com 1975 FORD F350, B&H, stock racks, approx. 45,000 miles, good condition. 780-336-4061, 780-390-0075, Viking, AB. 1976 CHEVY GRAIN truck w/hoist, C60, 350 Motor, 4 spd., 19,526 miles, $8700 +GST. Perfect for acreage owner (hauling water) or roofing contractor. Call Jan at 306-374-2733, Saskatoon, SK. 1985 CHEVY 7000 3 ton, 8.2L diesel, 2 speed automatic w/hoist. New tires, runs and starts great, $13,000 OBO. 306-287-3785, Watson, SK. 1987 FORD F700, 16x8.5’ B&H, seed tank, vg 370 gas engine, vg radial tires, 5 spd., $8900. Phoenix Auto, Lucky Lake, SK. 1-877-585-2300. DL #320074. 1997 MACK CH 613, 350 Mack, 9 speed, 20’ CIM B&H, remote opener, Michel’s tarp, B&H 5 years old, $45,000. 306-287-8487, Watson, SK. 1997 T800 KENWORTH, N14 Cummins, 13 spd., new tires, will have new B&H. Boissevain, MB. 204-534-7911 or 204-534-7747.

2001 FREIGHTLINER FL80, 300 HP, 9 spd. trans., new 16’ ultracell BH&T package, exc. cond., no rust, only $37,500. Call Fina ncing Is Av a ila b le!C a ll Us Tod a y! for details, 306-946-8522, Saskatoon, SK. Callfor a quote - We w illm atch 2004 FREIGHTLINER M2 tandem, Cat com petitor pricing spec for spec. dsl., Allison auto, new 20’ CIM box pkg, w/ tarp, safetied, no rust California truck, only Lethb rid g e,AB $59,500. 306-946-8522, Saskatoon SK 1 -888-834 -859 2 2005 FREIGHTLINER, 300 HP Cat, 10 Led u c,AB spd., new 20’ B&H, elec. tarp, $59,900; 1 -888-9 55-36 36 1970 GMC 2 ton, B&H, $3800; 1995 Ford Visit o ur w e bsite a t: E350, diesel, new auto. retired ambulance, www.andrestrailer.com $6500. Call Pro Ag Sales 306-441-2030 anytime, North Battleford, SK. SNOWMOBILE TRAILERS are in stock at Flaman. Check out the 2 place enclosed 1969 CHEV 1/2 ton, 327 V8 motor, runs CHECK OUT OUR inventory of quality used S u m m i t S e r i e s s t a r t i n g at $ 8 , 9 9 5 . g o o d , n e e d s b o d y w o r k . C o n t a c t highway tractors, view information at 306-735-7250, Whitewood, SK. www.flaman.com/trailers www.titantrucksales.com

3 MANURE SPREADER TRUCKS 2011 IHC 7600 tandems, 350 HP, auto. trans., air ride, full lockers, w/two McKee 800 manure spreaders, full hyd., one w/Burley Ironworks 20’ full hyd. swing out beaters. Approx. 3000 hrs. on units. $145,000/ea. Trucks and boxes can be sold separately; Hyundai 757 loader, skidder tires, 3000 hrs. Dennis 403-308-1400, Taber, AB. 2000 HINO FF3020, 6 cyl. dsl., 6 spd., 30,000 lb. GVW, 24’ dry freight box with ramp, stock #UV1019, $16,885. Camrose, AB. 780-672-6868, www.ontrackinc.net 1981 INTERNATIONAL DIESEL single axle livestock truck w/aluminum body, 400,000 kms, $8500. 780-305-3547 Neerlandia, AB. 1978 L8000 FORD cement truck, 8 yard mixer, $3800. Call 306-445-5602, North Battleford, SK.

Western Star Bale Truck · 2005 Western Star, 460 HP Mercedes, Allison auto, 4 way lockers, air ride suspension

403-977-1624 or 306-740-7771 Located at Medicine Hat, AB

1993 INTERNATIONAL w/Wilmar fertilizer tender, 3406 Cat eng., 15 spd., $18,000 OBO. 403-894-0435, Lethbridge, AB. X-GOVERNMENT AND fleet trucks, single axle, Detroit dsl., power pumper truck, extra cab, telesquirter, auto train, $17,500; 1997 Ford F450 4x4 pumper truck from British helicopter base at Suffield, 7.3 dsl. eng., auto, low kms; X-SaskPower digger and bucket trucks, service trucks, tandem axle picker trucks; F450 Haul-All, side load/end dump, 7.3 dsl. eng., auto; 2006 Freightliner M2 with Mercedes diesel eng., $34,500. 306-668-2020, Saskatoon, SK. www.northtownmotors.com DL #908171. 1997 FORD F250 Supercab, 4x4, 7.3 diesel, 5 spd, A/T/C, service truck, w/wo equipment, $7,000. 306-861-1680, Griffin, SK.

Trucks, Trailers, Truck Bodies, “The right choice, is AUTOMATIC!” Specializing in top quality, affordablypriced, work-ready trucks with boxes or as tractors, mostly 10-speed Autoshift or Ultrashift transmissions. Most trucks are from large American fleets: very little rust, strictly maintained, and all highway miles. Also a dealer for Cancade, truck bodies and trailers. Grain Trucks, Silage Trucks, Bale Trucks, Highway Tractors

2002 PETERBILT FUEL AND LUBE Truck, Cat C15, 475 HP, 102,000 kms, 6 spd. Allison, 46,000 rears, 20,000 fronts, 200 gal. fuel tank, 7 oil tanks w/air operated pumps and hose reels. Open to trades and offers. 780-679-7062, Camrose, AB.

WANTED: TANDEM MANURE truck(s) w/full hyd. McKee spreader. Prefer autoshift or auto., must be in very good cond., 350+HP. 780-842-2909, Wainwright, AB.

BERG’S GRAIN BODIES: When value and durability matter, ph. Berg’s Prep and Paint for details 204-325-5677, Winkler, MB. 2011 PROSTAR IHC 500 HP Maxxforge 15 engine, 18 spd. trans., 46,000 rears, 236 WB, 3-way lockers, only 137,000 kms, Webasto engine and bunk heater, alum. rims, 11R22.5 Michelin tires at 90%, full rear COMMERCIAL INDUSTRIAL MFG. for Cain rack w/doors, moose bumper, 73” grain box pkgs., decks, gravel boxes, HD bunk, gear ratio 3.73 GVW 52,000, combination grain and silage boxes, pup $94,000. 204-743-2324, Cypress River, MB trailers, frame alterations, custom paint, 2012 FREIGHTLINER CORONADO. Warner complete service. Visit our plant at Hum- Ind. Moose Jaw 306-693-7253, Swift Curboldt, SK or call 306-682-2505 for prices. rent 306-773-3030, Regina 306-359-1930. REMOTE CONTROL ENDGATE AND www.warnerindustries.com DL #913604. hoist systems can save you time, energy 2014 DOEPKER TRIDEMS. Call Warner and keep you safe this harvest season. Ind. Moose Jaw 306-693-7253, Swift CurGive Brehon Agrisystems a call at rent 306-773-3030, Regina 306-359-1930. 3 0 6 - 9 3 3 - 2 6 5 5 o r v i s i t u s o n l i n e at www.warnerindustries.com DL #913604. www.brehonag.com Saskatoon, SK. CHECK OUT OUR inventory of quality used WANTED: 3 TON GRAIN TRUCK, GM or highway tractors, view information at Ford, in good shape, 1980’s-1990’s. Brian www.titantrucksales.com 306-873-2437, 306-873-7067, Tisdale, SK. COMING SPRING 2014: The Industry’s strongest/ lightest alum. Super B trailer. Pre-Order today, get the best advantage! www.warnerindustries.ca DL #913604. 2005 STERLING TANDEM dump truck new BH&T, hitch, C13 Cat, $44,000; 2007 IH HEAVY DUTY 2007 Mack, daycab, 500 single axle dump, auto., hyd. brakes, HP, 14/46 axles, 18 spd., 460,000 kms, 4-way lockers, new wet kit, hi/low pres$35,000. 306-563-8765, Canora, SK. sure, $48,000. 306-563-8765, Canora, SK. COMING SPRING 2014: The Industry’s strongest/ lightest alum. Super B trailer. Pre-Order today, get the best advantage! www.warnerindustries.ca DL #913604.

FO R SALE

Tru ck S to ra g e/ L iv in g Q u a rters

• In FloorHea t • 2400 S q. Ft. 10 m inutes w es tofS a s ka toon (2)14’x14’ O HD / 2 a cre fenced ya rd

M L S $47 9,000

TO M N EUFELD

306-260-7838

Bu ying /Selling /Fu ll Serv ice Ag ent

1993 FREIGHTLINER, SERIES 60 Detroit 430 HP, 8LL, 3-way locks, 11/22.5 at 75%, $12,000 OBO. 306-287-3826, Watson, SK. 2- 2005 IH 9100 tractors, 550 Cat, 13 speed, 4-way locks, $30,000 each. Call 204-871-0925, MacGregor, MB. 2000 IH 8100, daycab, tandem, 370 HP Cummins, 10 spd., air ride, premium, no rust truck, only $24,500. Call for details, 306-946-8522, Saskatoon, SK.

1998 KENWORTH T-800, stainless steel paving box, 30” live belt, $30,000. 204-871-0925, MacGregor, MB. SPECIALTY TRUCKS AVAILABLE: Fire/ emergency trucks, garbage, bucket, deck and dump trucks. See us at our new location on Cory Rd., Saskatoon, SK. Summer of 2013. 306-668-2020. DL #90871 COMING SPRING 2014: The Industry’s strongest/ lightest alum. Super B trailer. Pre-Order today, get the best advantage! www.warnerindustries.ca DL #913604. CHECK OUT OUR inventory of quality used highway tractors, view information at www.titantrucksales.com 1996 CHEV CHEYENNE 1500 4x4, dually, dsl., std., w/8’x7’ Trailtech flatdeck w/fuel tank, needs eng. and rear tires, rest good. Best offer. 306-267-4471, Coronach, SK. MOBILE STEAMER/PRESSURE WASHER, very clean unit, 2002 FL80 Freightliner, SA, 280 HP Mercedes Benz, air susp., air brakes, new clutch, new 10 spd. trans, rebuilt 20’ van body, 1260 gal. water tanks, 880,000 BTU burner w/new coil, 650 Cat pump, 3 cyl. Isuzu dsl. eng., extra hoses, tooled and ready to work. Serious inquiries only. Call 780-524-2179, Valleyview, AB. 1984 IH BULK fuel truck, 18,600 litre capacity, 5 compartments, N14, 18 spd., $32,000. 306-861-7294, Weyburn, SK.

2007 WESTERN STAR 4900, 315,000 kms, w/2010 Bunning vertical spreader, good condition, $83,500. 306-621-0956, 306-647-2649, Theodore, SK. 2001 DODGE 1 TON dually, 2WD, 5.9 Cummins, 5 spd. standard, 10’ deck, low kms., premium cond. 306-273-4301, Canora, SK.

2000 FREIGHTLINER FL80 with 24’ flatdeck, 300 HP diesel 9 spd., safetied, vg cond., no rust, $19,500. Call for details, 306-946-8522, Saskatoon, SK. 2005 IH 4300, 24’ van truck, Allison auto., 466 eng., 3000 lb. lift gate, premium California truck, no rust, 118,000 miles, only $24,500. 306-946-8522, Saskatoon, SK. CAN-AM TRUCK EXPORT LTD., Delisle, SK, 1-800-938-3323. 1992 Ford LN7000, 7.8 dsl., 6 spd., C&C will take 15-16’ box, new safety, $10,000; 2007 Freightliner Classic, 60 DT, 18 and 40’s, 24” sleeper, wet kit, new 22.5 tires, $45,000; 1995 KW T800, 475 Cat, 18 and 46’s, pintle hitch, $38,000; 1982 JD 644D wheel loader, 6800 hrs., nice machine, $32,000; 2002 KW T300, 3126 Cat, 6 spd., hyd. brakes, 26’ reefer van, $16,000; 2006 IHC 7600, DT 466, Allison auto, 76,000 miles, C&C, $40,000; Cat V110 forklift, propane, good cond., 11,000 lbs., $10,000; 2005 GMC W4500 diesel, auto, cube van w/power lift gate, hyd. brakes, $14,000; 1988 Fruehauf, spring susp., highboy curtain, $7,500; 1993 T600 KW N14, 13 and 40’s, W19 grain box, $28,000; Gravel boxes 13’, 14’, 15’, $2500-$4500; Two sander units, $2000-$3000; Single axle dolly converters, A Model $1800; 1998 Manac highboy trailer 53’, air ride, tandem, $9,000; Gensets available. Financing available, OAC. www.can-amtruck.com DL #910420. CHECK OUT OUR inventory of quality used highway tractors, view information at www.titantrucksales.com COMING SPRING 2014: The Industry’s strongest/ lightest alum. Super B trailer. Pre-Order today, get the best advantage! www.warnerindustries.ca DL #913604.

HONEY RANCH! Turnkey honey operation comes fully equipped with everything required for beekeeping and 2 residences. Sellers willing to train. Val Marie, SK. MLS® ID#481220. Real Estate Centre, w w w. f a r m re a l e s t a t e . c o m o r c a l l 1-866-345-3414.


THE WESTERN PRODUCER, THURSDAY, FEBRUARY 6, 2014

BUILD YOUR 2014 nucs with queen cells. Great economy, great results. Love, SK. 306-862-1384. cliffordqueens.com COMPUTER BUSINESS in large northern town of 7000 includes stationery and other AUSTRALIAN PACKAGE BEES, mite income generating business. Living quarfree. April delivery. Australian and US ters can be developed. On #11 Hwy in queens available. Morley at 306-534-2014, Craik, Bar and Grill, turnkey, housing 306-534-4462, Spy Hill, SK. available. Development Lands. 136 Acre, development lands in Elbow. Restaurant, store, and 2 houses. All can be bought as a group or individually. 76 Acres, in city of Melville, destined for resiSELLING LEAFCUTTER BEE incubation dential and/or commercial development. trays wood and poly units, 200 of ea, good 30 Acres, part of Craven, can be develcond. FOB in Shell Lake, SK. 306-477-1021 oped residentially, includes large 2 storey house. 68 Acres, east of Regina on #46 WILL DO STYROBLOCK cocoon harvesting; near Pilot Butte, with a home, secondary Wanted: plastic shelters. Call Maurice serviced site adjacent town land. 93 Wildeman 306-365-4395, 306-365-7802, Acres, north Saskatoon on #11 Highway. Lanigan, SK. Investment: Davidson, 2 heated shops excellent for trucking or heavy mechanics operation, on approx. 2 acres. Hanley, near #11 Hwy, former bake shop, gas bar, confectionary, has 3 work bays and living WANTED: SERVICE MANUAL and parts quarters. Lintlaw, 4 acres, school with manaul for 60 Series Volvo 810. Call: gym, good shape, many applications. On #39 Hwy. in small town, 7300 sq. ft. 306-839-4438, Pierceland, SK. building on 2 acres land, sale or lease. Seed cleaning and processing plant on CP rail line 40 miles north of Regina. Brian Tiefenbach, NAI Commercial Real Estate (Sask) Ltd. 306-536-3269, 306-525-3344.

CONTINUOUS METAL ROOFING, no exposed screws to leak or metal overlaps. Ideal for lower slope roofs, rinks, churches, pig barns, commercial, arch rib building and residential roofing; also available FARMERS NEED FINANCIAL HELP? Go to: www.bobstocks.ca or call 306-757-1997. in Snap Lock. 306-435-8008, Wapella, SK. 245- 1055 Park Street, Regina, SK.

STEEL BUILDING BARGAINS. Allocated discounts. We do deals, 30x40, 50x60, 100x100 and more. Total construction and blueprints available. Ph. 1-800-964-8335, www.gosteelbuildings.com Source #18X

F U T U R E S T E E L B U I L D I N G approx. 30’x30’x14’. No front or back walls. Cert. engineered drawings and manuals for SK. Complete assembly instructions. Stock #C8957465T. CSA A660-04. Cert. gauge AAAA steel. Delivered, never assembled, t o o b i g fo r o u r y a r d ! $ 9 0 0 0 fi r m . 306-352-3052, Regina, SK.

DEBTS, BILLS AND charge accounts too high? Need to resolve prior to spring? Call us to develop a professional mediation plan, resolution plan or restructuring plan. Call toll free 1-888-577-2020.

CUSTOM BALE HAULING have 2 trucks and t r a i l e r s , 3 4 b a l e s p e r t r a i l e r. C a l l 306-567-7100, Imperial, SK. 1997 TS14D TEREX scraper, CAH, Michelin tires at 60%, recent w/o on trans., in good working cond, exc. cosmetics. Call 780-983-0936, Westlock, AB. JIM’S TUB GRINDING, H-1100 Haybuster with 400 HP, serving Sask. 306-334-2232, LINKBELT LS 98 crawler crane, 50’ boom Cat power, long UC, c/w all rigging includBalcarres. ing yard 1/2 and yard 1/4 drag buckets, CUSTOM TUB GRINDING: operate a ready to go, $15,000 OBO. 204-669-9626, Haybuster H1100E- 425 HP machine. Winnipeg, MB. Phone Greg 306-947-7510, Saskatoon, SK. 1993 CASE 621B wheel loader, CAH, hyd. Q/A, 2.75 yd. Q/A bucket, 20.5-25 tires, excellent condition! $39,500. Jordan, BRUSH MULCHING. The fast, effective anytime 403-627-9300, Pincher Creek, AB. way to clear land. Four season service, D65E-6 KOMATSU DOZER, very clean competitive rates, 375 HP unit, also avail. and straight, cab, LED lights, multi-shank trackhoe w/thumb, multiple bucket at- ripper, angle dozer, hyd. tilt, new sprocktachments. Bury rock and brush piles and ets, guarded w/sweeps. 780-983-0936, fence line clearing. Bork Contracting, Westlock, AB. www.borysiukcontracting.ca Prince Albert, STEEL SERVICE TOOLBOX for 1/2 ton, 3/4 SK., 306-960-3804. 1 ton truck, 6 compartments, 79” wide, REGULATION DUGOUTS: 120x60x14’ or ’ long, good shape, $750 OBO. $2000; 160x60x14’ $2950; 180x60x14’ 8204-669-9626, Winnipeg, MB. $3450; 200x60x14’ $3950. Government grants available until 2018. 306-222-8054, 2006 CASE 621D wheel loader, 4498 hrs, Saskatoon, SK. CAH, ride control, 3rd valve, 20.5-25 tiresWBM hydraulic QA, c/w 2.75 cu. yd. MULCHING - TREES, BRUSH, stumps, 90%, and pallet forks, $89,900. Jordan caraganas, etc. 12 years of enviro friendly bucket mulching. Call today! 306-933-2950. Visit: anytime 403-627-9300, Pincher Creek, AB. www.maverickconstruction.ca KOMATSU D37P CRAWLER, 1993, 6-way blade, hydrostatic, cab, heat, winch, joyGRAVEL SCREENING. Will custom screen stick controls, runs great, $23,600. g r ave l at y o u r l o c at i o n . C a l l D ave 306-526-9382, Shaunavon, SK. 306-368-2595, Lake Lenore, SK. NEUFELD ENT. CORRAL CLEANING, RECLAMATION CONTRACTORS: Bigham payloader, Bobcat with rubber tracks and 3 and 4 leg mechanical trip 3 pt. hitch v e r t i c a l b e a t e r s p r e a d e r s . P h o n e Paratills in stock; parts for Bigham and Tye Paratills. Call Kellough’s: 1-888-500-2646. 306-220-5013, 306-467-5013, Hague, SK. CUSTOM SEEDING/ BALING/ SWATHING. CAT 60, 70, 80 and 463’s available. Also Also parting 567 baler; Some hay for sale. Allis Chalmers direct mount scrapers. Call 306-338-7114, Clair, SK. Call Alan: 306-463-8423, Marengo, SK. 2011 MIDLAND TRI-AXLE quarter frame end dump, w/vibrator and liner, 2 air lift axles, $45,000. 306-726-7938, Southey SK

2006 544J, 5100 hrs., rubber- 85%, choice NEED A LOAN? Own farmland? Bank says of bucket, or bucket w/grapple, 9 of out n o ? I f y e s t o a b o v e t h r e e , c a l l 10 condition, immaculate. 306-744-8113, 1-866-405-1228, Calgary, AB. Saltcoats, SK. FARM/CORPORATE PROJECTS. Call A.L. HARCO RHINO 12’, 3 PTH blade, dual Management Group for all your borrowing gauge wheels w/hyd., skid shoes, Q/A end and lease requirements. 306-790-2020, plates, $6000. 306-287-8487, Watson, SK. Regina, SK. ROAD GRADERS CONVERTED to pull WANT SHORT TERM FINANCING? Good behind large 4 WD tractors, 14’ and 16’ return. For more info. ph 306-221-2208. blade widths available. CWK Enterprises, 306-682-3367, 306-231-8358, Humboldt, SK., www.cwenterprises.ca

FARM CHEMICAL/ SEED COMPLAINTS We also specialize in: Crop insurance appeals; Chemical drift; Residual herbicide; EST MASSAGE and Laser Therapy busi- Custom operator issues; Equipment malness and building in busy oilpatch town in function. Qualified Agrologist on staff. Call Back-Track Investigations for assistance SE SK. For info: 306-457-8220, Stoughten. regarding compensation, 1-866-882-4779. RAMSAY PONY RIDES and Concession have for sale concession bus (blue), 1982 IHC propane bus, 5 spd. std., great concession bus or would make great camper. 2- 1983 supply buses, Detroit dsl., HUNDREDS OF DOLLS and teddy bears, Some porcelain collector plates, piggy Allison trans. 306-386-2490, Cochin, SK. banks, cookie jars, salt and pepper sets, HOME PLUS INCOME! Live in the Resort 300 Weston pocket books, lots of crochet Village of Manitou and live for next to books, size 30 crochet thread, enough nothing. The Canadian dream is to earn re- hooks to stock a small library, every subtirement income owning this small motel ject Disney tree ornaments, tea pots, fancy with principal residence. Contact Lorne tins. Phone 306-622-4300, Tompkins, SK. Purdy 306-222-5984, Remax Saskatoon or view online at: www.homebuyerconnect.ca TURNKEY LOG FURNITURE BUSINESS. 3000 sq. ft. heated shop w/all tools. 2 homes. On 6 fenced lots. Trailers for hauling logs. 24’ custom built trailer for moving furniture. No shortage of wood or work. Best steelhead fishing in the world. Lots of mountain life, mountains and rivers. Selling for health reasons. Hazelton, BC. 250-842-0005, 250-842-8996.

CLASSIFIED ADS 49

FARM ACCOUNTING/ UTILITIES Software. It’s totally new and better than ever. Farmtool - Farm Accounting Software; Farmtool Companion - Field, Service, Inventory records and more. WilTech Software Ltd. Burstall, SK. Ph/fax 306-679-2299, email: wiltech@sasktel.net www.wil-techsoftware.com

WANTED: GAS BARS/ CONVENIENCE Stores. Bill Nesteroff, Re/Max Saskatoon, 306-497-2668, billnesteroff@sasktel.net SMALL MANUFACTURING SHOP and residence. 40 yrs of operation with established product line. Owner retiring. Turnkey operation. 306-445-5562, Delmas, SK. CONCRETE COMPANY in central Alberta. Includes 2 trucks, trailer, and all tools too many to mention, asking $65,000. Growing clientele yearly. Gary 403-843-3546.

RTL018918BPH REBUILT 18 spd. trans., custom rebuilt by 30 year Gear Guy. Sold exchange, $4375. Call 780-672-6868, Camrose, AB. www.ontrackinc.net WISCONSIN MOTOR PARTS for VG4D: Crank shaft, heads, fly wheel, starter, manifold and carb, $1000 OBO. 204-669-9626, Winnipeg, MB.

GREAT PRICES ON new, used and remanufactured engines, parts and accessories for diesel pickups. Large inventory, engines can be shipped or installed. Give us a call or check: www.thickettenginerebuilding.ca Thickett Engine Rebuilding. 204-532-2187, Russell, MB.

TRTL018918 AUXILIARY SECTION/back box, new exchange “Special Deal”, $2050. Call On Track for details 780-672-6868, Camrose, AB. www.ontrackinc.net CAT 3208N ENGINE, 210 HP, good running take out, $4885, exchange. Call On Track at 780-672-6868, Camrose, AB. www.ontrackinc.net REBUILT DETROIT SERIES 50 engine, 315 HP, sold exchange, $18,885. Call On Track for details 780-672-6868, Camrose, AB. www.ontrackinc.net DEUTZ BF4L914 COMPLETE engine, 4 cylinder turbo, 90HP, $4000. 403-652-0757, High River, AB.

ENGINES: 353, 453, 471, 8.2L Detroit, 4BT Cummins, 6CT8.3, 3208 Cat and 3306 Cat. Call Western Diesel, 1-800-667-1164. 3406B, N14, SERIES 60, running engines and parts. Call Yellowhead Traders, 306-896-2882, Churchbridge, SK.

DX110, 13006 DEUTZ; 90 dsl. Massey, 318 Perkins; 2705 Massey, 354 Perkins; 2675 Massey, 354 Perkins; 2290 Case, 504; 3394 Case, 504; 1070 Case, 451; 1586 IHC, 436; 8430 JD complete OH. All above engines in good running condition. DIAMOND CANVAS SHELTERS, sizes ranging from 15’ wide to 120’ wide, any 1-877-564-8734, Roblin, MB. length. Call Bill 780-986-5548, Leduc, AB. www.starlinesales.com

w w w .go o do n.co m

WINTER CLEARANCE. Wheel loaders, trackhoes, skidsteers, backhoes, crawler dozers. Larry at 306-563-8765, Canora, SK. CHAMPION GRADER model 720, snow wing, in good operating cond, ready to go, $21,000. Call 306-563-8765, Canora, SK.

Fo r A llY o ur Fa rm , C o m m ercia l& Industria lN eeds

1-800-665-0470 S to ny Pla in O ffice 780-975-3748 A irdrie O ffice 403-470-4570 M B S a les 204-534-2468 S a sk. S a les 306-737-8788 V erm ilio n O ffice 780-581-5822 290 CUMMINS, 350 Detroit, 671 Detroit, Series 60 cores. 306-539-4642, Regina, SK

2010 LUXURY BY DESIGN, 4 to 8 people, living quarters, exc. cond., forced air heating, AC, 5 pull-outs, 2 washrooms, 2 showers, cooking area, 54’, $37,000. Can deliver. 204-526-0321, Cypress River, MB.

ATTACHMENTS: skidsteer, pallet forks, buckets, augers, hay spears. Conquest Equipment, 306-483-2500, Oxbow, SK. 2006 CAT 320 EXCAVATOR, QA, clean out bucket, 10,000 hrs., nice, $65,000. 204-871-0925, MacGregor, MB. 1997 CAT IT28G wheel loader, cab w/heat, hydraulic Q/A bucket and pallet forks, 3rd valve, new 17.5-25 tires! Very nice! $48,500. Call Jordan anytime 403-627-9300, Pincher Creek, AB. CAT D6D angle dozer, guarding, sweeps, tilt, winch, nice Cat. Call 780-983-0936, Pacesetter Equipment, Westlock, AB. SKIDSTEERS, BOBCAT S220 wheeled, Cat 297C track, for rent/sale. Call Conquest Equipment, 306-483-2500, Oxbow, SK. CLIFF’S USED CRAWLER PARTS. Some o l d e r C at s , I H a n d A l l i s C h a l m e r s . 780-755-2295, Edgerton, AB.

MEAT PROCESSING PLANT - Abattoir. 11,600 sq ft building (2007) located on 7.3 industrial acres in Vegreville, AB. Business is showing positive growth with excellent returns. Please do not approach business directly. Craig Stenersen, 780-233-9939, Realty Executives Devonshire (the park), FEITSMA SERVICES IS booking 2014 alfalRENTALS: loaders, dozers, craig@working4u.ca fa, cereal and corn silage acres. Serving all EQUIPMENT excavators, compactors, etc. Conquest of Sask. Jason 306-381-7689, Hague, SK. Equipment, 306-483-2500, Oxbow, SK. ABOVE AVERAGE WAGE opportunity to operate you own business. Be your own boss representing, Lifetime Cookware, kitchen products. Consider a rewarding and exciting commission based career with Life- LOWDERMILK TRANSPORT IS providing time (Since 1909). Complete training one call service for all Equipment/Hay will be provided. Serious persons only ap- hauling. Very experienced, multiple trucks ply please. Mail resume to: Brian Kakuk, serving AB., SK., and MAN. 780-872-0107, PO Box 2378, Drumheller, AB. T0J 0Y0. 306-252-1001, Kenaston, SK. Or e-mail to: bmkakuk@hotmail.com Contact Brian for additional information 403-820-2789. THRIVING APPLIANCE STORE FOR SALE in beautiful Kelowna, BC. Specializing in used appliances, parts and a full service department. Est. 1978, owner retiring. Call 250-765-3769 or 250-765-1511. KIR-ASH CONTRACTING LTD. Hauling equipment of all types, throughout HAULING COMPANY: 3 2013’s, 1 2006 farm AB., SK. Call us to book today, truck w/pumps to haul oil. Shop and living BC., 780-978-2945, Grande Prairie, AB. quarters all on same lot, c/w client base $900,000. Pat 306-460-6024, Conquest SK RANCH OIL CONTRACTING LTD. is in the grain hauling business. Truck and SuTURNKEY BUSINESS OPPORTUNITY! per B, looking for work in NW SK and NE New state of the art, 8-bay carwash for AB. Call 306-238-4800, Goodsoil, SK. sale in thriving Saskatchewan community. Located on 1.5 acres with great location on highway. Great customer base! Selling due to health concerns. Serious inquiries only please! Call 306-232-4767.

WESTFALIA VACUUM PUMP, (60 CFM), 45 free stalls with bedding mattresses, 800 gal. bulk tank, feeding augers, Badger piston manure pump. 306-933-2805, email sp.dyck@sasktel.net Warman, SK.

CONTERRA GRADER for skidsteers and tractors. Excellent for road maintenance, floating and levelling. 518S-SS, $2499. Conterra manufactures over 150 attachments. Call 1-877-947-2882, view online at www.conterraindustries.com 2001 JD 650H crawler, LGP, canopy, sweeps, air/heat, 6-way blade, winch. Call 306-921-9462, Melfort, SK.

2006 HITACHI ZX270, LC-3, hydraulic excavator, c/w hyd. thumb, multi function aux. hydraulics, WB quick attach, 2 buckets, catwalks, ROPS, Proheat, positive air shutdown, 6720 hrs., AC. 587-991-6605, Edmonton, AB. CAT D8K angle dozer, guarding, sweeps, ripper, vg running cond. 780-983-0936, Pacesetter Equipment, Westlock, AB. JD 750 crawler tractor, c/w 6-way dozer, heated cab and ripper. Call 780-983-0936, Pacesetter Equipment, Westlock, AB. SKIDSTEER ATTACHMENTS: rock buckets, dirt buckets, grapples and more top JETCO ENT. INC. Experienced equipment quality. Also have truck decks in stock. hauling. Alberta, Sask. and Manitoba. Call Quality Welding and Sales 306-731-3009 780-888-1122, Lougheed, AB. or 306-731-8195, Craven, SK. ROUND BALE PICKING and hauling, small 2008 HITACHI 350 hyd. excavator, hyd. or large loads. Travel anywhere. Also hay thumb. Pacesetter Equipment, Westlock, for sale. 306-382-0785, Vanscoy, SK. AB., 780-983-0936.

2005 CAT 950 G LOADER, 6100 hrs., new Michelin tires, quick attach, sweeper, forks, and snow blade, $125,000. Call 403-818-8615, Nobleford, AB. 2005 HITACHI 270, hyd. excavator, w/hyd. thumb. Pacesetter Equipment, Westlock, AB., 780-983-0936. WANTED: OLDER WHEEL loader, Case W9D, Clark Michigan 75, or others, running or not. 306-276-0167, Choiceland, SK 2006 HITACHI ZX270, LC-3, hydraulic excavator, c/w hyd. thumb, multi function aux. hydraulics, WB quick attach, 2 buckets, catwalks, ROPS, Proheat, positive air shutdown, 6720 hrs., AC. 587-991-6605, Edmonton, AB. 2008 VOLVO G970, 5200 hrs., ripper, 250 HP, $168,000. Will take older trade. Call 306-445-5602, North Battleford, SK. SAND DRYING PLANT. 7 cu. yd. insulated feed hopper; 5’ dia. x24’ drum dryer/ 4 to 12 million BTU burner on nat. gas; two 20”x32’ conveyors; one 5’x14’ - 2-1/2 deck screening plant; 45 TM drive-under outload bin; 240 TM dry bulk storage hopper bin; 55’ bucket elevator; switch gear and electrical panel with 10 switches; 1982 Drott 50E track excavator. All equipment operating and in good condition. 306-945-2270, Waldheim, SK. ROME PLOW AND KELLO DISC blades and bearings; 24” to 36” notched disc blades. 1-888-500-2646, Red Deer, AB. www.kelloughs.com CHAMPION 730 GRADER, c/w snow wing and V-plow, clean, orig. paint. Pacesetter Equipment, 780-983-0936, Westlock, AB. JD 772D 2005 AWD, 8700 hrs., $125,000; New ripper, Cat 140M, $12,000. Call 403-291-1010, Calgary, AB. EXCELLENT SELECTION Used skidsteers, track loaders, forklifts, zoom booms, mini excavators. Visit www.glenmor.cc for details, specs and prices. Glenmor, phone 306-764-2325, Prince Albert, SK. 2012 JD 444 wheel loader, 1000 hrs., quick attach bucket. Call 780-983-0936, Pacesetter Equipment, Westlock, AB. 1992 TAYLOR DD60 PT Padfoot packer, 60” drums, $12,500. Terry 204-746-4131, www.equipmentpeople.com Rosenort, MB. HYDRAULIC PULL SCRAPERS 10 to 25 yds., exc. cond.; Loader and scraper tires, custom conversions available. Looking for Cat cable scrapers. Quick Drain Sales Ltd., 306-231-7318, 306-682-4520 Muenster SK 2008 JOHN DEERE 770 GRADER, S/N DW770DX616885, w/snow wing, good cond. Highest or any tender not necessarily accepted. Written tenders received no later than 9:00 AM, March 18, 2014. 306-463-7043, fax 306-967-2424, RM of Chesterfield, Box 70, Eatonia, SK, S0L 0Y0.

USED DELAVAL MILKING equipment, 4 weigh jars, Duravac vacuum pump and compressor, all working. Asking $2,000. 306-547-5501, Preeceville, SK.

USED, REBUILT or NEW engines. Specializing in Cummins, have all makes, large inventory of parts, repowering is our specialty. 1-877-557-3797, Ponoka, AB.

FARM AND INDUSTRIAL ELECTRICAL motor sales, service and parts. Also sale of, and repairs to, all makes and sizes of pumps and phase converters, etc. Tisdale Motor Rewinding 1984 Ltd., 306873-2881, fax 306-873-4788, 1005A- 111 Ave., Tisdale, SK. www.tismtrrewind.com

1-866-974-7678 FREE QUOTE

IntegrityPostStructures.com

BUILDING SUPPLIES & CONTRACTING

FARM BUILDINGS “Today’s Quality Built For Tomorrow”

Hague, SK | (306) 225-2288

www.zaksbuilding.com

3UH(QJLQHHUHG/DPLQDWHG3RVWV


50 CLASSIFIED ADS

THE WESTERN PRODUCER, THURSDAY, FEBRUARY 6, 2014

WHEN

Quality COUNTS

• The HEAVIEST metal • The STRONGEST posts • SUPERIOR craftsmenship

EACH DOOR IS CUSTOM MEASURED, BUILT, DELIVERED AND

Choose Prairie Post Frame

PROFESSIONALLY INSTALLED. THE POWERHOUSE

EXPERIENCED POST FRAME BUILDERS REQUIRED

OF THE DOOR INDUSTRY

Northern Alberta Southern Alberta Saskatchewan Manitoba

1-855 (773-3648)

1-866-497-5338 1-855-532-4475 1-306-355-2718 1-855-542-5117

www.prairiepostframe.ca

$$$$$$$$$$$$$$$$$$$$$ $ $ $ $ $ $ 7 5 TR UC KLOAD S $ $ 29 G AUG E FULL H AR D 100,000 P S I $ $ H IG H TEN S ILE R OOFIN G & S ID IN G $ $ 16 C OLOUR S TO C H OOS E FR OM $ $ 2 $ B-G r. Colou red . . . . . . . . . . . . . . . 70¢ ft $ 2 $ M u lti Colou rM illen d s . . . . . 49¢ ft $ $ $ BEAT THE P RICE $ $ IN C R E A S E S $ $ AS K ABO UT O UR BLO W O UT $ $ CO LO RS AT $0.6 5 S Q . FT. $ $ CALL N O W $ $ $ $ F o u illa rd S teel $ $ S u p p lies L td . $ $ S t. La za re, M a n . $ $ 18 005 103303 $ $ $$$$$$$$$$$$$$$$$$$$

P RICED TO CLEAR!!!

SDL HO PPER C O NES

14’Hopper 8 leg H/Duty .................2,285 15’Hopper 8 leg S/Duty ..................$2,6 00 15’-10” Hopper 10 leg H/Duty .........$2,9 9 0 18’Hopper 12 leg M/Duty ...............$4 ,09 5 19’Hopper 12 leg M/Duty ...............$4 ,535 21’& 24’Hopper Cones...................$P.O .R. $

SDL STEEL BIN FLO O RS 10 gauge bottom ,8” or 12” Side Wall (1)O r (2)piece construction 12’- 28’sizes Tru ck ing Av a ila b le

TOP QUALITY MERIDIAN/ BEHLEN BINS. Book now for best prices. Example: all prices include skid, ladders to ground, manhole, set-up and delivery within set radius. Meridian Hopper combos: 3500 bu. $10,450. SPECIAL 5000 bu. $13,990. We manufacture superior quality hoppers and steel floors for all makes and sizes. Know what you are investing in. Call and find out why our product quality and price well exceeds the competition. We also stock replacement lids for all makes and models of bins. Leasing available. Hoffart Services Inc., 306-957-2033, Odessa, SK.

Download the free app today.

STEALTH BIN PRODUCTS- Goebel bins, Westeel bins, 14’ hoppers. Early booking specials. 587-280-0239, Vegreville, AB. www.stealthbins.ca

ATLAS BUILD IN G S YS TEM S & S ALES LTD . Yo rk to n , S K .

SD L H OP P E R CONE

FER TILIZER M OD ELS

306-324-4441

16’ Dia m eter - 45’ d eg. Bottom C one 16010M - 80 m etric to n n es 16012M - 93 m etric to n n es 16015M - 107 m etric to n n es 16017M - 121 m etric to n n es 16020M - 134 m etric to n n es 16025M - 162 m etric to n n es 16030M - 189 m etric to n n es

M ARG O ,SASK.

HOPPER B IN SA LE

GRAIN HAN D LIN G & STORAGE

G R AIN M OD ELS 16’ Dia m eter - 45’ d egree b ottom c one 16010G - 2408Bu 16020G - 4064Bu 16012G - 2822Bu 16025G - 4892Bu 16015G - 3236Bu 16030G - 5730Bu 16017G - 3650Bu

www.powerliftdoors.com POLE BARNS, WOODSTEEL packages, hog, chicken, and dairy barns, grain bins and hoppers. Construction and concrete crews available. Mel or Scott, MR Steel Construction, 306-978-0315, Hague, SK.

M ANY OP TIONS TO CHOOS E FR OM - CALL FOR P R ICING!

BEHLEN STEEL BUILDINGS, quonsets, convex and rigid frame straight walls, grain tanks, metal cladding, farm - commercial. Construction and concrete crews. Guaranteed workmanship. Call your Saskatoon and northwest Behlen Distributor, Janzen Steel Buildings, 306-242-7767, AFAB INDUSTRIES POST frame buildings. For the customer that prefers quality. Osler, SK. 1-888-816-AFAB (2322), Rocanville, SK.

s a les @ jtlin d u s tries .ca

w w w.jtlin d u s tries .ca N E IL BU RG, S AS K ATCH E W AN

N eilb u rg S K S tettler AB “ The Pea ce Co u n try” W in d tho rs tS K M a n ito b a

1-306 -8 23-48 8 8 1-78 0-8 72-49 43 1-78 0-8 72-49 43 1-306 -224-208 8 1-204-371-5400

JTL is n o w o ffe rin g c o rrug a te d b in s s e tup o n o ur a w a rd w in n in g “F o rc e ” ho p p e r, o ur “L e g a c y” 6 ’ hig h fla tflo o r o r o n yo ur c o n c re te p a d .

1-800-561-5625

w w w .s kyw a ygra in s ys tem s .c o m

L EA S IN GL E A V A IL A B

WINTER SPECIALS: 5000 bu. Superior bin combos, $11,200; 8000 bushel Superior combos, $17,500. Limited quantity avail. We make hopper bottoms and steel floors for all makes of bins. Try our U-Weld kits. Call 306-367-2408 or 3 0 6 - 3 6 7 - 4 3 0 6 , M i d d l e L a ke , S K . www.middlelakesteel.com BOOKING SPECIALS ON large diameter bin erection, concrete and damage repair. Call Quadra Development Corp. 1-800-249-2708, Rocanville, SK.

• 4” co rru ga tio n a n d 50 k s i yield s tren gth (6 5 k s i ten s ile) s teel a re s till u tilized . • 10 yea rw a rra n ty o n co rru ga ted b in s • Re pla c e yo u ro ld • Le g-s tyle b in s a n d flo o rs a n d a d d u p to re pla c e m e n t ho ppe rs w ith a n 1500 b u s he ls a e ra tio n s ys te m tha t c a pa c ity to u s e s the b a s e a n d yo u r e xis tin g b in s . le gs a s the ple n u m • No m o re fightin g to fo rc e the a irin to w ith yo u ro ld d o o rs . the ho ppe r. Ou rpa te n te d JTL • Ae ra tio n s ys te m d o o ris gu a ra n te e d c o m e s a s s ta n d a rd to m a ke yo u s m ile e qu ipm e n t fo ra ll e ve rytim e yo u “ Fo rc e ” b in s & u s e it! con es.

DARMANI - Building Better Bins D A R M A N I

2200 bu s . $7,95 0 - $3.55 p erbu . Buy 3 - $2 3,45 0 2700 bu s . $8 ,65 0 - $3.15 p erbu . Buy 3 - $2 5 ,5 5 0 4000 bu s . $11,300 - $2.78 p erbu . Buy 3 - $33,300 4800 bu s . $12 ,8 5 0 - $2.64 p erbu . Buy 3 - $37,95 0 6600 bu s . $18 ,900 - $2.80 p erbu . Buy 2 - $37,000 7660 bu . $2 0,700 - $2.65 p erbu . Buy 2 - $40,600 H op p er bin s c/ w ou ts id e la d d er, lid op en er, 4x4 s teel s k id , s et-u p w ithin 100 m iles a n d m a n hole p ort, d elivery extra . Ca ll f or S pe c ia l Pric ing on Roc ke ts & Fa ns .

Ros le r Con s tru c tion 2000 In c 306 -933-0033 w w w .ro slerco n stru ctio n .ca

F la t F lo o r Bin s up to 1,000,000 Bus he ls !

AGR I- TR AD E IN N OVATION AW AR D W IN N ER 20 12

• HUTCHIN SON Grain Pum ps/ Loop Chain Conveyors • Galvanized Bucket Elevators • Galvanized Drag Chain Conveyors • RailLoad-Out System s • Pulse Crop Handling Equipm ent • SUKUP Bins & Aeration

• GRAIN GUARD Bins & Aeration

TAK E AD VAN TAG E O F W IN TER B O O K IN G N O W !!!

THE “FORCE” LINE

O ffice: 306- 782 - 3300 Cell: 306- 62 1- 5304 Em a il: a tla sb in s@ ho tm a il.co m Fin d u s o n lin e: w w w .a tla sb u ild in gs.n et

INVITATION TO TENDER: Sealed tenders are invited by Saskatoon Co-op Agro Center for a bin construction crew for the 2014 bin building season. The contract involves construction and/or repair of approx. 130 new and/or existing galvanized grain bins in various locations around Saskatoon. Tender package and details available by calling Saskatoon Co-op Agro 306-933-3834 or in person at 1327 North Service Road, Hwy #16 West, Saskatoon, SK. Deadline for tenders is 12:00 noon, Friday February 14, 2014. Highest or any tender not necessarily accepted. SPECIAL WINTER PRICING! 10,400 bu. Twister hopper bins. See your nearest Flaman store or call 1-888-435-2626. WESTEEL, GOEBEL, grain and fertilizer bins. Grain Bin Direct, 306-373-4919.

THE LEGACY LINE The o n ly c lo s e d in ho ppe r/a e ra tio n b in o n the m a rke t.

DARMANI - Building Better Bins

DARMANI - Building Better Bins

WINTER SPECIALS 1-866-665-6677 WINTER SPECIALS Grain Bins Steel Floors Unload Systems Swing Air /Cross Air/Full Floor Temp Monitoring Aeration Fans ONE CALL CAN SAVE YOU $1,000’s BIG BINS and SKYLIFTS NOW AVAILABLE

A

Factory Sales Reps FLAT MOUNT

R

306-227-8171 306-831-5060 306-831-5854 306-831-5856 306-831-5857

4,000-40,000 bushel pkgs

CHIEF WESTLAND AND CARADON BIN extensions, sheets, stiffeners, etc. Now available. Call Bill, 780-986-5548, Leduc, AB. www.starlinesales.com FOR ALL YOUR grain storage, hopper cone and steel floor requirements contact: Kevin’s Custom Ag in Nipawin, SK. Toll free: 1-888-304-2837. NUMEROUS HOPPERS and some flat bottoms. Hoppers from 1500 bu.-5000 bu., most w/air, some w/fans, some fertilizer. Flat bottoms from 2500 bu.-6000 bu., some w/air and fans. Priced to sell. Phone Barry 306-946-7805, Young, SK. LIFETIME LID OPENERS. We are a stocking dealer for Boundary Trail Lifetime Lid Openers, 18” to 39”. Rosler Construction 2000 Inc., 306-933-0033, Saskatoon, SK.

Yo rk to n S K

HOP P ER B IN C OM B O S P EC IA L S 3-5000BU. M ERID IAN S IN G LE CO RRUG ATED HO P P ER BIN CO M BO S c/ w roofa n d w a ll la d d ers , top s a fety ca g es , a u to lid op en ers , 12 leg hop p ers , m a n w a ys , s lid e chu tes , trip le s k id s & erected .

$40,000.00 or $2.6 6 P e rBu 2-6 200BU. M ERID IAN D O UBLE CO RRUG ATED HO P P ER BIN CO M BO S c/ w roofa n d w a ll la d d ers , top s a fety ca g es , a u to lid op en ers , 12 leg hop p ers , m a n w a ys , s lid e chu tes , trip le s k id s & erected .

$33,000.00 or $2.6 6 P e rBu 2-7200BU. M ERID IAN D O UBLE CO RRUG ATED HO P P ER BIN CO M BO S c/ w roofa n d w a ll la d d ers , top s a fety ca g es , a u to lid op en ers , 14 leg hop p ers , m a n w a ys , s lid e chu tes , q u a d s k id s & erected .

$38,000.00 or $2.6 3P e rBu 2-9800BU. M ERID IAN S IN G LE CO RRUG ATED HO P P ER BIN CO M BO S c/ w roofa n d w a ll la d d ers , top s a fety ca g es , a u to lid op en ers , 10 5x5 V-LEG S hop p ers , m a n w a ys , s lid e chu tes , q u a d 5x5 s k id s & erected .

$51,000.00 or $2.6 0P e rBu 2-10,000BU. M ERID IAN D O UBLE CO RRUG ATED HO P P ER BIN CO M BO S c/ w roofa n d w a ll la d d ers , top s a fety ca g es , a u to lid op en ers , 18 leg hop p ers , m a n w a ys , s lid e chu tes , trip le s k id s & erected .

$52,000.00 or $2.6 0P e rBu **F REIG HT & L EAS ING AVAIL ABL E**

* * B OOK NOW F OR S P R ING B UIL D * *

ALSO AVAILABLE SM OOTH W ALL FERTILIZ ER & GRAIN BINS Ca ll for Pricin g

Servic ing SK & AB

FOR M ORE INFORM ATION: OFFICE: (3 06 )78 2-3 3 00 SCOTT’S CELL: (3 06 )6 21-53 04 TAISHA’S CELL: (3 06 )6 21-3 025 W W W .ATLASBUILDINGS.NET ATLASBINS@ HOTM AIL.COM

FROM

EXG 300 AKRON

THE

D

FACTORY DIRECT PRICING

HOPPER MOUNT CEMENT MOUNT

BROCK (BUTLER) GRAIN BIN PARTS and accessories available at Rosler Construction. 306-933-0033, Saskatoon, SK.

ATLAS BUILD IN G S YS TEM S & S ALES LTD

M A N

www.darmani.ca

I

MANUFACTURE---FINANCE---DELIVERY---SET UP B

B

Flat Bottom Grain Bins 19,106 BUSHEL PACKAGE Grain bin/Steel Floor/Air

DEFERRED LEASE PROGRAM

Hopper Bottom Grain Bins 4800 Bushel / 10400 Bushel

N

from $1.06/Bushel

From $2.16/Bushel

N

S

Set up and delivery available

NO PAYMENTS FOR UP TO 6 MONTHS

Set up and delivery available

S

I

DARMANI - Building Better Bins

Grain Bin/Hopper/Skid

DARMANI - Building Better Bins

I

DARMANI - Building Better Bins

GREAT CAPACITY, 300 TON/HOUR 1 BUSHEL CLEAN UP AT THE END OF THE BAG. FULLY WINDS UP GRAIN BAG Email: craigyeager@grainbagscanada.com or aaronyeager@grainbagscanada.com

Call Your Local Dealer

or Grain Bags Canada at 306-682-5888

www.grainbagscanada.com


THE WESTERN PRODUCER, THURSDAY, FEBRUARY 6, 2014

INVITATION TO TENDER: Sealed tenders 20’ AND 40’ SEA CONTAINERS, for sale are invited by the Saskatoon Co-op Agro in Calgary, AB. Phone 403-226-1722, Center for bin hauling for the 2014 season. 1-866-517-8335. www.magnatesteel.com The contract involves moving approx. 130 new galvanized grain bins from our yard to various customer yards around Saskatoon. Tender package and details available by calling Saskatoon Co-op Agro Center at 306-933-3834 or in person at 1327 North Service Road, Hwy #16 West, Saskatoon, SK. Deadline for tenders is 12:00 noon, Friday February 14, 2014. Highest or any tender not necessarily accepted. POLY HOPPER BINS, 100 bu., $900; 150 bu. $1250. 306-258-4422, Vonda, SK. Call for nearest dealer. www.buffervalley.com 20’ AND 40’ SHIPPING CONTAINERS, large SK. inventory. Ph. 1-800-843-3984, 306-781-2600.

Grain Bin Direct Factory To Farm Grain Storage

CONTAINERS FOR SALE OR RENT: All sizes available. Also, tilt deck services. Call 306-861-1102, Radville, SK.

Galvanized • Flat Floor • Hopper Bins Smooth Walls • Fertilizer • Grain • Feed Aeration • Rockets • Fans • Heaters Temp Cables Authorized Dealer

Saskatoon, SK

Phone: 306-373-4919 grainbindirect.com

CLASSIFIED ADS 51

NH3 RATE CONTROLLER, 3 section Raven/Greenstar section control, currently 60’, 36 run, can be changed, complete system to tractor rear plug-in. Priced to sell $6000 firm. 204-649-2276, 701-389-1042, Pierson, MB.

2010 4520 AutoSteer, 1100 hrs., 70’ booms, $223,000; 2008 Case 3520, 2000 HORNOI LEASING NEW and used 20’ and hrs., $167,000; 2006 Case 4510, Auto4 0 ’ s e a c a n s fo r s a l e o r r e n t . C a l l Steer, FlexAir 70’ booms, 7400 hrs., 306-757-2828, Regina, SK. $114,000; 2005 Case 4520 w/70’ flex air, 4000 hrs., $129,000; 2005 Case, 3000 hrs., $138,000; 2005 Case 4010 w/3020 G4 New leader bed, $93,000; 2004 Loral AirM a x 1 0 0 0 , 7 0 ’ b o o m s , i m m a c u l at e , $93,000; 2002 Case 4260 w/1100 gal. tank, 80’ booms, $96,000; 2004 AgChem Rogator, w/air bed, $66,000; 2003 SterKEHO/ GRAIN GUARD Aeration Sales ling spreader w/AgForce spinner spreader, and Service. R.J. Electric, Avonlea, SK. Call $75,000; 2002 Dempster w/spin spreader, 2300 hrs., $58,000; 1999 Loral, w/AirMax 306-868-2199 or cell: 306-868-7738. 5 bed, 5700 hrs, $51,000; 1999 AgChem, KEHO, STILL THE FINEST. Clews Storage 70’ booms, $64,000; 1997 AgChem, 70’ Management/ K. Ltd., 1-800-665-5346. booms, $38,000; 2008 Adams Semi tender, self contained, $39,500; 2011 Terra KEHO/ GRAIN GUARD/ OPI STORMAX. Gator 8204 twin bin, 1900 hrs., $223,000; For sales and service east central SK. and 25 ton Wilmar tender w/spread axles, MB., call Gerald Shymko, Calder, SK., $39,500; 1987 Ford w/22 ton Raymond 306-742-4445 or toll free 1-888-674-5346. tender w/vertical auger, $44,000; 8 ton Doyle vertical blender with scale, 40 HP, new auger, $18,500; 5 ton Tyler blender, 40 HP, $7500; 2000 Skidsteer Wrangler BUILD YOUR OWN conveyors, 6”, 7”, 8” loader, w/quick detach bucket, $18,500; and 10” end units available; Transfer con- 1993 Wrangler loader, $14,500; 10 proveyors and bag conveyors or will custom pane trucks in test date with 2800-3000 build. Call for prices. Master Industries gal. tanks, w/hose reels, pumps and meInc. www.masterindustries.ca Phone ters from $16,000 to $33,000. Northwest’s largest used selection of fertilizer equip1-866-567-3101, Loreburn, SK. ment. 406-466-5356, Choteau, MT. For BATCO CONVEYORS, new and used, more equipment and photos view website grain augers and SP kits. Delivery and www.fertilizerequipment.net leasing available. 1-866-746-2666.

BIN MOVING FLAT bottom and hoppers, up to 22’. binmovers@hotmail.com Call Tim 204-362-7103. Get organized now! BEAVER CONTAINER SYSTEMS, new Morden, MB. and used sea containers, all sizes. 306-220-1278, Saskatoon and Regina, SK. 20’ TO 53’ CONTAINERS. New, used and modified. Available Winnipeg, MB; Regina USED SEA/STEEL Storage Containers and Saskatoon, SK. www.g-airservices.ca for sale. 20’, 40’, 40’ HC, 48’ HC, etc. Guar306-933-0436. anteed wind, water and rodent proof. Ask about modifications and accessories for SHIPPING CONTAINERS FOR SALE. 20’- your container (ramps, electrical kits, new 53’, delivery/ rental/ storage available. For paint, etc.) Call Bond Industrial Direct, inventory and prices call: 306-262-2899, 306-373-2236, 306-221-9630, Saskatoon, Saskatoon, SK. www.thecontainerguy.ca SK. joe@bondind.com www.bondind.com JOHNSON NH3 WAGON, with 2- 1250 gal. tanks, 19L-16.1 tires, cert. July 2012, $21,000. 306-486-4826, Frobisher, SK.

M & K WELDING BINS & CONES

New 18-05 Meridian Hopper Bin (Approx. 5000 bu.)

Hopper Cone for 14 ft Westeel Rosco up to 2000 bu.

• Manhole • 7 legs • 37 degree slope • Single 8x4x188w skid base

• Ladders • Remote lid opener • Safety-fil Indicator • 12 leg hopper • 37 degree slope • Manhole • Double 6x4x.188w skid base

$2,750.00 Hopper Cone for 19 ft Westeel Rosco up to 3300 bu.

$10,575.00

Other sizes of new bins also available.

• Manhole • 10 legs • 37 degree slope • Single 10x4x188w skid base

REMOTE LID OPENERS For Most Sizes of Bin Starting at $129.00

$4,900.00

We make hopper cones for all makes & sizes of bins.

Prices do not include setup or freight. Prices subject to change. Quantities are Limited.

M & K WELDING 1-877-752-3004

Em a il: s a les @ m kw eld ing.ca | Melfort, Sask | w w w.m kw eld ing.ca

OSLER, SASK.

PH: (306) 242-7767 FAX: (306) 242-7895 CHECK US OUT AT www.janzensteelbuildings.com

FOR ALL YOUR 2014 GRAIN & FERTILIZER STORAGE NEEDS

LOOKING FOR A floater or tender? Call me first. 34 years experience. Loral parts, new and used. Call 403-650-7967, Calgary, AB. ARE YOU LOOKING for a pressurized, pump-assisted anhydrous ammonia fertilizer application system? I have several on hand, including some good-used systems. I am very familiar with NH3 application systems, as I have developed two of the pump-assisted systems for sale in Western Canada. I am one of Western Canada’s largest independent MaxQuip dealers and have new and some used traditional and Pump NH3 systems and used ammonia tanks as well. Contact Double HH Ag. Sales n Services at 780-777-8700 or email me at: doublehhag@shaw.ca Fort Sask., AB. FERTILIZER SPREADERS: 4- 8 ton. Large selection. 204-857-8403, Portage la Prairie, MB. www.zettlerfarmequipment.com 1995 TERRAGATOR 1844 floater, 60’ boom, micro-bin, second owner, vg cond., $37,000. Call 780-853-7205, Vermilion, AB NH3 NURSE WAGON, twin 1000, new M5 inspection, new paint and decals, vg cond., $14,000. 204-649-2276, 701-389-1042, Pierson, MB.

1995 AG CHEM 1844 dry floater, JD 8.1L w/TerraShift, 7290 hrs., front tires- 25%, rears- 45%. Air Spread and Dickey John controls. Ag Leader and Satloc GPS. Fert. and seed boxes. All working. $26,500. 250-417-9159 dlamb@intref.ca Cranbrook FOR ALL YOUR

FERTILIZER

EQUIPMENT NEEDS ADAMS SPREADER & TENDER CALL US FOR PARTS ON ALL

SPREADER/TENDER MAKES AND MODELS

1 800 667 8800

www.nuvisionfhs.com

FERTILIZER STORAGE TANKS- 8300 Imp. BANDIT 2035 LIQUID fert. wagon, 2000 gal. tanks available. Contact your nearest gal, 5 HP Honda pump, John Blue flow meFlaman store or call 1-888-435-2626 or ter, $12,000, 306-398-2923, Cut Knife, SK. visit www.flaman.com

“BOOK EARLY TO GUARANTEE BEST SELECTION” “Up TO 7 YEAR Lease Terms”

TORMASTER NH3 WAGON, with 2- 1750 2000 GALLON NH3 tanks on an offset axle, gal. tanks, 21.5L-16.1SL front, 900/60R32 Wadena steel trailer, rear fill, $21,500. rear, new safety, $50,000. 306-486-4826, 306-873-7349, Tisdale, SK. Frobisher, SK.

STANDARD FEATURES INCLUDE:

FARMERS CHOICE BEST HOPPER

UNSTIFFENED SIDEWALL PANELS WALL & ROOF LADDERS SAFETY RING & SAFETY FILL 18” RACK & PINION GATE MANWAY IN CONE

“ALL JSB CONES ARE SANDBLASTED PRIOR TO PAINTING” 3513 Bu. & 4135 Bu. 4920 Bu. & 5999 Bu. Hopper Bin Combo’s Hopper Bin Combo’s 16’ DIAMETER BIN

18’ DIAMETER BIN

H. Duty 8 leg cone c/w 18” port Painted cone inside & out DBL 4”x6” skid - Setup included Air Screen & 3hp/5hp Fan (Extra)

H. Duty 10 leg cone c/w 24” port Painted cone inside & out DBL 4”x6” skid - Setup included Air Screen & 5hp Fan (Extra)

9702 bu. Hopper Bin Combo’s

19.5’ DIAMETER BIN

22’ DIAMETER BIN

H. Duty 12 leg cone c/w 24” port Painted cone inside & out Double 4”x8” skid Setup included (Saskatoon Area) Air Screen & 7hp Fan (Extra)

H. Duty 14 leg cone c/w 24” port Painted cone inside & out Setup included (Saskatoon Area) Triple 4”x6” skid (Extra) Air Screen & 10hp Fan (Extra)

$19,455. + gst/delivery

$21,855. + gst/delivery

Authorized Dealer

READY TO SHIP!! CREWS AVAILABLE!!

Harvest International Swing Auger Winter Sale on Now! 1- H13x92 LEFT IN STOCK.

2011 DEMCO 10501, 3/4” PTO, scale, 520/85R38 duals, 640 display w/printer port, $40,000. 306-287-8487, Watson, SK. BRUNS 400 BU. gravity grain cart, like new condition, $4800 OBO. 306-755-2084, Tramping Lake, SK. BRENT AVALANCHE 1594 grain cart, TA, floater tires, auto. scale, tarp, mint cond., used 2 seasons. Call Ron 204-626-3283 or 1-855-272-5070, Sperling, MB.

Winter Sale on Meridian Augers c/w E-Kay Movers and many options to choose from

SORTEX-Z CLASS 1V color sorter, single module w/2 monochromatic cameras, very low hrs., in new cond., c/w IngersollRand rotary compressor, 10HP, w/cooler and dryer. Call 204-724-6673, Souris, MB. AUGERS: NEW and USED: Wheatheart, KIPP KELLY 300 gravity table, less motor, Westfield, Westeel, Sakundiak augers; Au- $3200. Call evenings, 306-795-3314, Ituger SP kits; Batco conveyors; Wheatheart na, SK. post pounders. Good prices, leasing WANTED: USED GJESDAL Five-in-One available. Call 1-866-746-2666. 50-100 bu./hr. grain cleaner in exc. cond. NEW 10x51 WHEATHEART auger, comes Ph. Bert 306-728-3732 eves., Melville, SK. with 38 HP motor and mover kit. Get more capacity! Call your nearest Flaman DUAL SCREEN ROTARY grain cleaners, great for pulse crops, best selection in Sales store or call 1-888-435-2626. Western Canada. Phone 306-259-4923 or BRANDT 10”x70’ SWING AUGER, w/spout 306-946-7923, Young, SK. and full bin sensor, $6500. 306-488-2103, CUSTOM COLOR SORTING chickpeas to 306-527-1389, Holdfast, SK. mustard. Cert organic and conventional. SAKUNDAIK 8x44’ AUGER with Hawes 306-741-3177, Swift Current, SK. mover in excellent shape, 25HP. First 2004 GJESDAL Five-In-One, M400X, exc. condition, extra screens, hopper extension, $9500 takes. 780-768-2294, Two Hills, AB. electric eye, $13,500. 306-773-9058, REMOTE CONTROL SWING AUGER Stewart Valley, SK. movers, trailer chute openers, endgate and hoist systems, wireless full bin alarms, MOBILE GRAIN CLEANING business for digital wireless tractorCam, the Simpler sale: 2 self-contained grain cleaners plus Sampler portable combine. All shipped di- clientele in West Central SK., c/w screens, rectly to you. Doing it right, keeping you in-feed, discharge augers, scale, bin sweep safe, by remote control. Phone Brehon mounted on Isuzu cab-over trucks. Quick Agrisystems at 306-933-2655 or visit us set up and total clean out. Will provide training. 306-463-5955, Kindersley, SK. at www.brehonag.com Saskatoon, SK. FOR SALE: SUPERIOR scalper aspirator; 3 USED AUGER SPECIAL. 2009 BH 8x51 Carter Day no.3 indents, w/shells, stands Wheatheart w/30 HP, Kohler, mover and and motors; Carter 412 grader w/shells clutch, $8500; 2012 R 8x41, Wheatheart, and stand; Forever 54” w/full set of slightly used w/29 EFI Kohler, mover, screens; Oliver 160 Gravity; 2 dust cyc l u t c h a n d l i g h t k i t , $ 1 0 , 9 0 0 . clones. Ph. 204-871-4666, MacGregor MB. 306-648-3321, Gravelbourg, SK. DUAL STAGE ROTARY SCREENERS and NEW SAKUNDIAK AUGERS in Stock: Kwik Kleen 5-7 tube. Portage la Prairie, Used: Brandt 10”x60’ S/A, $6500. In stock: www.zettlerfarmequipment.com or call New Convey-All TCSNH-1045 hydraulic 204-857-8403. drive, c/w mover kit, and 38 HP Kohler diesel, list $38,900. Leasing available. Call FORSBERG VACUUM GRAVITY table, D a l e at M a i n w ay F a r m E q u i p m e n t , model 250V w/Forsberg industrial fan 306-567-3285 or 306-567-7299. Davidson, model 23HA. Both refurbished and ready to work. Call 204-724-6673, Souris, MB. SK. View www.mainwayfarmequipment.ca WANTED: FORAGE SEED blender, blends up to 1 ton of seed. Leonard Friesen 204-685-2376, Austin, MB. • Po s itio n gra in a u ger o r co n veyo r in to b in rem o tely; N EW b y yo u rs elf. PRODUCT SUKUP GRAIN DRYERS: 1 or 3 phase, liq• Po w erfu l m a gn ets to a d here uid propane or nat. gas, canola screens. to gra in & co m b in e a u gers , Early order discount pricing now in effect. co n veyo rs , etc. For info call: 204-998-9915, Altamont, MB. • Ca m era is w a terpro o f & co lo r w ith a u d io . NEW SUPERB GRAIN DRYERS and Moridge S ee w eb s ite fo r m o re d eta ils o r Ca ll dryer parts in stock. Call Grant Service Ltd. 306-272-4195, Foam Lake, SK. Brow n le e s Truckin g In c. Un ity, S K

M AGNETIC CAM ERA PACKAGE

306-228-297 1 o r 1-87 7 -228-5 5 98

SELLING GRAIN LEGS, distributors, conveyors and truck scales. Also other elevaSAKUNDIAK GRAIN AUGERS available tors parts. 403-634-8540, Grassy Lake, AB. with self-propelled mover kits and bin sweeps. Contact Kevin’s Custom Ag in Nipawin, SK. Toll free 1-888-304-2837. KEEP YOUR GRAIN SAFE. Temperature NEW “R” SERIES Wheatheart Augers: and moisture cables from OPI systems. With engine, mover and electric clutch. Call the bin experts at Flaman Sales. R-8x41, cash price $12,250; R-8x51, cash 1-888-435-2626. $12,750; R-10x41, cash $13,240. Call 306-648-3321, Gravelbourg, SK.

w w w .fullb in s upe rs e n s o r.co m

Patent pending jack/hitch system. Only 42 lbs for easy handling. Hoppers are built to fit each size to eliminate leftover grain in hopper. The only hopper that will work with The Lump Buster for your fertilizer needs.

Most efficient way to load fertilizer. 6 rows of studs driven by the augers hydraulic pack eliminate fertilizer lumps to allow you to save time when loading your air seeder cart.

1.306.642.3460

www.thehopper.ca

3513 Bu. $10,430. + delivery 4920 Bu. $13,345. + delivery 4135 Bu. $11,325. + delivery 5999 Bu. $14,910. + delivery 7082 Bu. Hopper Bin Combo’s

2012 AKRON 10’ grain bagger, electric winch, lights, big auger keeps up to biggest grain carts. Made 15 bags. $20,000. 306-287-8487, Watson, SK. FLAMAN 710 10’ grain bagger, c/w conveyor truck unloader, exc. cond., $12,500 SAKUNDIAK 8X1200, 25 HP Kohler, revers- OBO. 780-787-8293, Vermilion, AB. ing gear box, $5750; Sakundiak 7x1600, 18 HP Briggs & Stratton, $4450; Sakundiak 8x1400, $2000; Sakundiak 8x1400, $4100. N E W 4 0 0 B U. G R AV I T Y WAG O N S , Call Brian 204-724-6197, Souris, MB. $7,100; 600 bu., $12,000. Large selection used gravity wagons, 250-750 bu. Used grain carts, 450-1050 bu. 1-866-938-8537. www.zettlerfarmequipment.com 2009 DEMCO 1050, red, 900 metrics, PTO, scale, $38,900. Call 306-473-2749 or 306-640-8181, Willow Bunch, SK.

REPLACEMENT FLIGHTING FOR augers, seed cleaning plants, grain cleaners, combine bubble-up augers.

Rosetown Flighting Supply 1-866-882-2243, Rosetown, SK www.flightingsupply.com

SUPERIOR STORAGE of liquid fertilizer

IF YOU PLAN ON LONG TERM STORAGE OF LIQUID FERTILIZER, DEMAND NOTHING BUT THE BEST!

· “Fertank” single tank capacity of 9900usg · Stainless steel tanks with capacities up to 77,000usg Your single supplier of liquid handling products

1-866-509-0715

www.liquidsystems.net

GRAINMAXX HIGH CAPACITY AUGERS 8 MODELS TO CHOOSE FROM

NEW SEE VIDEO ON WEBSITE

6000

SERIES TELESCOPIC

GRAIN VACS: REM 552, $3000; REM 2500 HD, $9500; Brandt 4000, $7000; Brandt 4500, $7500; Weigh wagon with digital scale, $3500. 1-866-938-8537. 2700 REM grain vac, 51 hours, shedded, exc. cond., $15,900 OBO. Grandview, MB, 204-546-2131, 204-572-5032. 2011 BRANDT 7500 HP grain vac hose arm, dust exhaust kit, approx. 145 hrs., nice condition, $22,000 OBO. 780-787-8293, Vermilion, AB. 2008 BRANDT 5000 vacuum, had since new, presently using and in good shape. Call Brewster Ag, 306-939-4402, (Cell) 306-731-7235, Earl Grey, SK. CONEYAIR GRAIN VACS, parts, accessories. Call Bill 780-986-5548, Leduc, AB. www.starlinesales.com

SWING AUGER

1 800 667 8800

www.grainmaxx.com

NH 855 ROUND baler, $2000 OBO; NH 848 round baler w/gathering wheels, $1200. MERIDIAN GRAIN AUGERS: SP kits and 306-395-2668, 306-681-7610, Chaplin, SK. clutches, Kohler, B&S engines, gas and 1982 MCKEE 1578 soft core round baler, diesel. Call Brian ‘ T h e A u g e r G u y ’ field ready, one owner, always shedded, 204-724-6197, Souris, MB. new floor belts and bearings all around, $2000. Call 403-318-8135, Delburne, AB. S A K U N D I A K A U G E R S I N S TO C K : swings, truck loading, Hawes Agro SP BALE SPEAR ATTACHMENTS for all movers. Contact Hoffart Services Inc. loaders and skidsteers, excellent pricing. Call now 1-866-443-7444. Odessa, SK, 306-957-2033.


52 CLASSIFIED ADS

BALE SPEARS, high quality imported from Italy, 27” and 49”, free shipping, excellent pricing. Call now toll free 1-866-443-7444, Stonewall, MB.

THE WESTERN PRODUCER, THURSDAY, FEBRUARY 6, 2014

1476 16’H esston M ow er Conditioner Clear out Price - $37,000 2856 5x6 H esston H ard Core B aler -$36,900 Financing Available

2010 JD 568 baler, Mega wide PU, hyd. lift, bale kicker, surface wrap, floatation tires, shedded, 5620 bales, $32,000. Denis 306-845-2496, 306-845-7709, Mervin, SK.

Please Callor Visit

N ick’s Service Ltd.

#2 South Plains R oad W . Em erald Park, Sk. S4L 1C6

306-781-1077

CASE/IH 8120 Combines: Two 2009’s to choose from, c/w headers, threshing hrs. from 1041 to 1232 hrs., field ready. Can d e l i v e r. C a l l f o r m o r e o p t i o n s . 204-743-2324, Cypress River, MB.

2001 TR99 Combine w/ $50,000 work order, 1757 sep. hrs...$69,800. Financing available. Trades welcome. 1-800-667-4515. www.combineworld.com

1998 MACDON 920, 14’ hay header, double drive, $8800. Phone 306-698-7787, Wolseley, SK.

2011 NH CR9090E, 482 threshing hrs, shedded, loaded, 0 hrs. on NH Triple Inspection. Call 780-210-3799, Myrnam, AB.

2007 NEW HOLLAND 1475 haybine, 16’, f i e l d r e a d y, v e r y g o o d c o n d i t i o n . 306-845-2406, Turtleford, SK.

2006 CR960, 1730 hrs, 76C 15’ PU header, 200 hrs. on bars and concaves, HID lights, AutoSteer ready, shedded, very good. Call 306-648-3511, 306-648-7695, 306-380-7769, Gravelbourg, SK. 2003 NH CR970 w/Swathmaster PU, 25’ header, $115,000 US. Call 503-939-9241, 503-320-6335, Hillsboro, OR, USA.

2012 JD 956 discbine, 14.6’ cut, rubber conditioner rollers, cut less than 1,000 acres, excellent condition, $32,000. Denis 306-845-2496, 306-845-7709, Mervin, SK. ONE USED RUBBER crimper, off of JD moco part #AE76305, fits various units. Isaac at 403-641-2162 ext. 102, Gem, AB.

2008 JD 4895, 25’ HoneyBee header, 600 header hrs., loaded w/Roto-Shears, pea auger, AutoSteer harnesses, big rubber, shedded, exc. cond., $85,000. Call 780-349-9505, Westlock, AB.

CASE/IH COMBINES and other makes and models. 5 years interest free on most units. Call the combine superstore. Trades welcome, delivery can be arranged. Call Gord 403-308-1135, Lethbridge, AB. WANTED: SET OF SPREADERS for Case 2188. Call Frank at 306-394-2131, 306-394-7000, Coderre, SK. 2013 CASE 9230, 150 hrs, lux. cab, 620 duals, 750 rears, HD lateral tilt, small tube rotor, hyd. hopper cover, high cap. folding unload auger, point spout, magna fine cut chopper, HID, air comp, AutoSteer and mapping. 306-287-8487, Watson, SK.

TWO 2010 CASE/IH 8120 w/634 sep. hrs, c/w 2016 Swathmaster, PU headers, exc. cond., always shedded, $218,000. Located in Kamsack, SK. can deliver. 204-526-0321

40’ MacDon FD70 w/ transport, dbl knife drive, new knife, new adapter canvas, overall 8.5/10 condition. Incl: choice of adapters JD STS, CNH, CAT... $56,800.00 w/ warranty. Trades welcome. 1-800-667-4515. www.combineworld.com

’09 CIH 2016 head w/ Swathmaster pick-up. Overall 85% cond’n. $19,800. Trades welcome. Financing available. 1-800-667-4515. www.combineworld.com

2009 HONEYBEE SP36’ header, fore/aft, PU reel, pea auger, newer knife and drapers, lifters, under 7000 acres. Call 403-599-3945, Milo, AB. ‘01 TR99 Combine New rear tires, new chopper blades on 4150 Redekop, hopper cover, lateral tilt, Yield & Moisture, sold w/ 971 & Rake up! $39,800. Trades welcome. Financing available. 1-800-667-4515. www.combineworld.com

WANTED: VERSATILE SP swather model 4700 or 4750, 25’, double knife drive. Call 204-635-2600, Stead, MB.

TRADE IN YOUR JD 615, NH 76C OR CIH 2016 for a brand new Macdon PW7 header w/ 16’ Swathmaster pickup. HHC & Reel speed. 1-800-667-4515. www.combineworld.com

2003 CX 840, 1950 engine hrs., 1500 threshing hrs, Rake-Up, vg shape, $95,000 OBO. 403-652-7980, High River, AB.

2011 MACDON M150 35’ D60D 160 eng./103 cutting hours, dual direction, booster spring kit, hyd. center link, dual knife drive, split reel, transport pkg, poly skids, hyd. freeform mounted roller, RotoShears, $135,000. 306-287-8487 Watson 2007 CASE/IH 2588, 1432 rotor hrs., 1750 eng. hrs., well maintained, always shedded, Swathmaster PU. 306-843-2999 or 306-843-2718, Wilkie, SK.

2005 PRAIRIE STAR 4940, MacDon 972 25’ Draper header, orig. owner, 1543 header hrs., 2114 eng. hrs. Very clean and well maintained, field ready, $68.000. Enchant, AB., 403-634-3593. www.stampseeds.com 2- 8120 CASE COMBINES, 1006 and Email: nathan@stampseeds.com 1256 sep. hrs., small tube rotor c/w 2016 Swathmaster PU, dual wheels on front, near mint cond., shedded, $190,000 ea. 306-695-8162, Indian Head, SK. TWIN HESSTON HYD. side delivery rakes, 2006 2388, 1014 rotor hrs, 2015 with #3831 and #3830, exc. cond., $7900 for Swathmaster PU, too many new parts and extras to list. Call 403-599-3945, Milo, AB. both OBO. 780-798-2280, Plamondon, AB.

Lexion 590R Salvage Combine World is now parting out a 2006 Cat Lexion 590R, less than 1000 threshing hours, tons of nice parts. www.combineworld.com 1-800-667-4515.

2006 580R, 1216 sep. hrs, big tires, Sunnybrook cyl., rotor bearings done, P514 PU, Y&M, cebis, very nice, $116,000 OBO. Call 403-312-5113, Viscount, SK.

2005 9660 STS, 2350 eng. hrs., 1750 threshing, duals, high cap. unload auger, 1500 Precision header w/Rake-Up pickup. Howard concaves, hopper cover, shedded, Greenlighted every year, JD AutoSteer ready, $130,000 OBO. 306-843-7070, 306-658-2122, Wilkie, SK. 2002 JD 9650 combine, 2300 sep hrs., long auger, dual spd. cylinder, fine cut chopper, good overall condition, many new parts, been a very reliable machine. $79,900 OBO. 403-901-3024, Standard, AB

’92 914 JD Header & Pick Up Call for details….$7,280. Trades welcome. Financing available. 1-800-667-4515. www.combineworld.com 2011 MACDON PW7 PU head, JD 60/70 hookup, under 1000 acres, like new, $19,500. 306-230-2736, Assiniboia, SK.

3- 2005 HONEYBEES, 36’ with transports, gauge wheels, 1 piece PU reels, pea augers, includes adapters for 2388 Case; JD 635F, HydraFlex, 35’ with pickup reel. TWO 480R CAT combines, 2002/2003, both in great shape. If interested phone 2005 JD 9660W, 2453 eng. hrs, 1798 sep 306-622-2069, Gull Lake, SK. for more info. 306-287-3955, Watson, SK. hrs, 80065R32/42085R26, inspected by 2009 MACDON D60, 35’, 60/70 JD hookmechanic yearly, field ready, hopper ext., up, transport, fore/aft, vg cond, $53,500. $110,000 US. 701-263-1467 Sherwood ND Call 306-230-2736, Assiniboia, SK. 2013 S680, 258 hrs, 650 duals, 750 rear, 29’ unload auger, 615 PU, loaded, never RECONDITIONED rigid and flex, most done pulse crops. 2012 45’ MacDon flex, makes and sizes; also header transports. used 1 season, double knife, pea auger. Ed Lorenz, 306-344-4811, Paradise Hill, SK. www.straightcutheaders.com Call 306-834-7610, Major, SK. 2006 JD 9760 STS, 1800/2300 hrs., 2010 MACDON FD70 40’ header, all opGreenlighted yearly, new injectors, con- tions, Case/IH adapter, shedded, like new, cave, feeder house, Y&M, vg cond., $65,000. 306-473-2749 or 306-640-8181 cell, Willow Bunch, SK. $145,000. 306-230-2736, Assiniboia, SK.

Move it! in print and online next day. Now your classified word ads will go online within one business day from when you book them to run in the Producer Classifieds. Our team of Classified Sales Associates has the product knowledge, marketing strategies and access to qualified buyers that is unmatched in the industry. Place your classified ad and experience our professional service first hand.

Monday to Friday, ads will be posted online within one business day. Real Time online will be placed a maximum of 11 days prior to first print insertion.

CLASSIFIEDS.PRODUCER.COM

‘13 40’ MD D65 Header hyd. tilt, dbl knife drive w/ JD adapter. $59,800. Trades welcome. Financing available. 1-800-667-4515. www.combineworld.com

2006 8010 AFX CASE w/2125 eng. hrs., 1487 sep. hrs. c/w 16’ PU, updated with new feeder chain, new slip clutch and new rear tires c/w 2- sets of concaves, $140,000. 306-831-7273, Rosetown, SK.

2012 CASE/IH WD1903, DH362 Honeybee header, JD AutoSteer, 2013 Freeform roller, Roto-Sheers; 409 hours, $130,000. 306-230-1920, Allan, SK.

2011 JD 9770STS Salvage Less than 600 total hours! Auto-steer ready cab, duals, and many other nice parts. www.combineworld.com 1-800-667-4515.

1-800-667-7770

2010 9770 STS JD, w/1615 PU header, 20.8x42 duals, large rear tires, $275,000. Call A.E. Chicoine Farm Equipment Ltd., 306-449-2255, Storthoaks, SK. 2009 JD 9770, duals, Contour-Master, shedded, 1290 hrs., $159,000. Call 204-822-3797, Morden, MB. 2010 JD 9770 STS, 774 sep. hrs., c/w 2012 JD 615P PU header w/only 100 hours on header, Contour-Master high torque variable spd. feeder house, high cap lift cyl., 22’ high cap unload auger, wide spread fine cut chopper, 800/70R38, small and large grain concave’s, always shedded, exc. cond., $235,000. Call Jordan anytime 403-627-9300, Pincher Creek, AB.

’03 Swathmaster PU 14’ pickup w/ new belts, hyd. wind guard. $10,950. Trades welcome. Financing available. 1-800-667-4515. www.combineworld.com

NEED PICKUP HEADERS? 914 $3,500 & up; JD/Precision - $3,000 & up; 212/214/971 NH - $500 & up. Trades welcome. 1-800-667-4515. www.combineworld.com ‘12 40’ IH 2162/MD FD70 w/ transport, dbl knife drive, pea auger, hydraulic header tilt, sold w/ warranty.....$68,800. Financing available. 1-800-667-4515. www.combineworld.com

ROUND BAR CONCAVES for 50, 60 and JD 216 16’, $1950; JD 920 20’, poly skids, 70 series STS JD combines, $1500 OBO for recond. $6900; JD 924 24’ steel pts., poly skids, $4950; JD 925 25’, steel pts., poly the set. 306-552-4905, Eyebrow, SK. skids $4500’; 2001 JD 925 25’, poly pts., poly skids, full finger auger, recond., $13,950; 3 JD 930 30’, steel pts., poly skids, start at $3950; two 2003 JD 930 poly skids, full finger auger, recond. $15,900; 2003 JD 930 air reel, poly skids, full finger auger, recond., $20,900; 2004 to 2006 JD 630 Hydra Flex, poly skids, HD auger, start at $14,900; 2004 to 2011 JD 635 Hydra Flex, poly skids, mint, start at $14,900. www.reimerfarmequipment.com Reimer Farm Equip, Hwy. 12 North, Stein‘97 JD CTS Combine 2,117/2,861 bach MB. Gary Reimer at: 204-326-7000. hrs., Big Top, 2 spd cyl, long auger, hyd F/A, F/C chopper, chaff spreader, pickup 2009 MACDON D60 header, reel endincluded. $39,800. Trades welcome. guards, float optimizer, skid shoes, JD Financing available. 1-800-667-4515. adapter, w/2010 Mauer M38 header trailwww.combineworld.com er, $43,000. 403-818-2816, Oungre, SK. 1992 JD 9600, 3500 threshing hrs, dual CIH 820 FLEX, 20’, $1500; 1995 to 1999 range cylinder, new tires, hopper ext, 9610 CIH flex, 1020 25’, poly skids, nice start sieve updates, c/w 914 header, always $7900; 1996 to 2002 CIH 1020 flex, 30’, shedded, exc. cond., $45,000 OBO. 930 poly skids, nice start $10,900; 2010 CIH 30’ straight cut header c/w transport, flex 2020 30’, poly skids, recon. $18,900; $ 6 5 0 0 O B O . 4 0 3 - 3 4 5 - 3 7 7 0 o r 2007 to 2010 CIH 2020 flex, 35’, poly 403-634-2048, Coaldale, AB. skids, recond. Start $18,900. Gary Reimer: 2007 9760 STS 300 bu., 340 HP, chopper, 204-326-7000, Reimer Farm Equipment, topper, 1000 hrs., c/w 2010 FD70 36’ flex H w y. 1 2 N o r t h , S t e i n b a c h M B . draper, $200,000 OBO; 1998 9610, new: www.reimerfarmequipment.co separator, feeder house, chains, belts, tires. Hopper topper, fine chopper c/w JD 843 flex, 8 row, 30”, totally recondiMacDon 974 36’ flex draper, $70,000 OBO. tioned, mint, $14,500; JD 893 flex, 8 row, 30”, field ready, $19,500. Reimer Farm 406-895-2527, Plentywood, MT. Equipment, Hwy. 12 North, Steinbach, MB. 1990 JD 9600, 3000 sep. hrs., Sunnybrook reimerfarmequipment.com Gary Reimer bars and concave, 914 PU, shedded, 204-326-7000. $30,000. Call 306-524-4960, Semans, SK. 1993 NH 973 flex, PU reel, 30’, good work1998 CTS II, 3785 eng./ 2707 sep. hrs., ing order, $8900; 1998 NH 973 30’, Crary GreenStar Y&M monitor, new tires and air reel, poly skids, $12,900. Reimer Farm many new parts in the last 4 yrs., always Equipment, Hwy. 12 North, Steinbach MB. shedded. Must be seen to be appreciated. reimerfarmequipment.com Call Gary $40,000; 1994 9600, 4812 eng./ 3429 Reimer, 204-326-7000. sep. hrs., 1 season on new concave and rub bars, 3 yrs. on Firestone tires, always SP30 HONEYBEE DRAPER header, new shedded, $40,000. Both machine owner k n i fe , a l w ay s s h e d d e d , e x c . c o n d . , $28,000. Call 780-678-6054, Daysland, AB. operated. 403-575-5783, Veteran, AB.

JD STS Duals factory kit w/ 20.8R42 Firestone 23deg. Radials in 80%+ condition. Less than 600hrs use. Complete kit $16,900. Financing available. 1-800-667-4515. www.combineworld.com

FYFE P ARTS 1- 8 1- 8 1- 8 1- 8

00- 667- 98 71 • Regin a 00- 667- 3095 • S askatoon 00- 38 7- 2 768 • M an itob a 00- 2 2 2 - 65 94 • Ed m on ton

“ Fo rAllY o u rFa rm Pa rts”

w w w .f yf e p a rts .c om ALLISON TRANSMISSIONS Service, Sales and Parts. Exchange or custom rebuilds available. Competitive warranty. Spectrum Industrial Automatics Ltd., Blackfalds, AB. 1-877-321-7732. STEIGER TRACTOR PARTS for sale. Very affordable new and used parts available, made in Canada and USA. 1-800-982-1769 PUMPS, PRESSURE WASHERS, Honda/Koshin pumps, 1-1/2” to 4”, Landa pressure washers, steam washers, parts washers. M&M Equip. Ltd. Parts and Service, Regina, SK., 306-543-8377, fax 306-543-2111.


THE WESTERN PRODUCER, THURSDAY, FEBRUARY 6, 2014

CLASSIFIED ADS 53

gallantsales.com Large inventory of new and used potato equip. Dealer for Tristeel FARM EQUIPMENT: 1983 JD 7721 comMfg. wash line equip. Dealer for Logan bine w/JD 912 PU; 2000 MacDon Premier swather w/finger reel; Morris Magnum II Equipment. Call Dave 204-254-8126, MB. cultivator; JD discers; International 310 discers; Rite-Way harrow packer drawbar; Wheatheart 8� grain auger w/mover; 1982 GMC 6000 V8 3 ton truck w/Strong Box; 1965 IH 2 ton truck w/wooden box. Dinsmore, SK. For more info please call Cliff 306-846-2175 or e-mail: cab@sasktel.net

Call 1-888-920-1507

2004 NH SF110 high clearance sprayer w/Norac height control. Dinsmore, SK. 306-846-2175 or e-mail: cab@sasktel.net

Combine World 1-800-667-4515, www. combineworld.com; 20 minutes E. of Saskatoon, SK on Highway #16. Used Ag & Industrial equipment, new, used & rebuilt parts, & premium quality tires at unbeatable prices! 1 yr. warranty on all parts. Canada’s largest inventory of late model combines & swathers. Exceptional service.

GRATTON COULEE

Call 1-888-920-1507

AGRI PARTS LTD. IRMA, AB.

1-888-327-6767 www.gcparts.com USED PICKUP REELS - 36’ HB HCC $5,980, 36’ MD $6,980, 36’ HB UII $6,980. 42’ HB UII $7,800, 30’ MD $2,780. Trades welcome. Call 1-800-667-4515. www.combineworld.com

MEDICINE HAT TRACTOR Salvage Inc. Specializing in new, used, and rebuilt agricultural and construction parts. Buying ag and construction equipment for dismantling. Call today 1-877-527-7278, www.mhtractor.ca Medicine Hat, AB. TRIPLE B WRECKING, wrecking tractors, combines, cults., drills, swathers, mixmills. etc. We buy equipment. 306-246-4260, 306-441-0655, Richard, SK. G.S. TRACTOR SALVAGE, JD tractors only. 306-497-3535, Blaine Lake, SK.

Huge Inventory Of Used, New & Rebuilt Combine & Tractor Parts. Tested And Ready To Ship. We Purchase Late Model Equipment For Parts.

GOODS USED TRACTOR parts (always buying tractors) David or Curtis, Roblin, MB., 204-564-2528, 1-877-564-8734.

S EXS M ITH US ED FARM P ARTS LTD .

LOEFFELHOLZ TRACTOR AND COMBINE Salvage, Cudworth, SK., 306-256-7107. We sell new, used and remanufactured parts for most farm tractors and combines.

S EX S M ITH , ALTA. w w w .u sed fa rm pa rts.co m

Harvest Salvage Co. Ltd.

YOUR ONE STOP FOR NEW , USED & REBUILT AG PARTS.

1-866-729-9876

Em ail: fa rm pa rt@ telu spla n et.n et

www.harvestsalvage.ca New Used & Re-man parts

Dis m a n tlin g a ll m a jor m a ke s a n d m ode ls of tra ctors , com b in e s , s w a th e rs , b a le rs a n d fora ge h a rve s te rs .

Tractors Combines Swathers

Plu s M u ch M o re!

5150 Richmond Ave. East Brandon, MB

SMITH’S TRACTOR WRECKING. Huge inventory new and used tractor parts. 1-888-676-4847.

1-8 00-340-119 2 Bu yin g Fa rm Equ ipm en t Fo rD ism a n tlin g

AGRA PARTS PLUS, parting older tractors, tillage, seeding, haying, along w/other Ag equipment. 3 miles NW of Battle- NEW SALVAGE TRACTORS, Volvo 810, 650; IH 885; MF 165, S90; JD 7800; Ford ford, SK. off #16 Hwy. Ph: 306-445-6769. 7600, 3600, Super Major; County; Nuffield. COMB-TRAC SALVAGE. We sell new and www.britishtractorwreckers 306-228-3011 used parts for most makes of tractors, Unity, SK. combines, balers, mixmills and swathers. Phone 306-997-2209, 1-877-318-2221, DEUTZ TRACTOR SALVAGE: Used parts Borden, SK. www.comb-tracsalvage.com for Deutz and Agco. Uncle Abe’s Tractor, We buy machinery. 519-338-5769, fax 338-3963, Harriston ON

0IJ&R/WG

LQIR#ULWHZD\PIJFRP ZZZULWHZD\PIJFRP  

$/:$<6029,1*)25:$5'70 5LWH:D\ÂśVURFNSLFNHUVWDNHRQURFNV\RXZRXOGQÂśWWKLQNDERXW WDFNOLQJZLWKRWKHUURFNSLFNHUV Â&#x2021; Â&#x2021; Â&#x2021;

+\GUDXOLFGULYHWRDGMXVWUHHOEDWVSHHGWXUQRIIUHHOWR SLFNODUJHURFNVDQGUHYHUVHUHHOWRFOHDUMDPV +\GUDXOLFDQJOHGKLWFKÂ&#x2021;+DUGVXUIDFHWHHWK /RZDQJOHUDNHÂ&#x2021;(IÂżFLHQWDQGDIIRUGDEOH

5567

5RWDU\EDWZKHHO FX\GRSHQJUDWHEXFNHW ´GXPSKHLJKW ´SLFNLQJZLGWK 3LFNVURFNVXSWR´LQ GLDPHWHU[´ORQJ

5567

5RWDU\EDWZKHHO FX\GRSHQJUDWHEXFNHW ´GXPSKHLJKW ´SLFNLQJZLGWK 3LFNVURFNVXSWR´LQ GLDPHWHU[´ORQJ

FOUR 380X46 TIRES and rims, 95%, off a Rogator 1184, tires wont fit new sprayer, $8500. 403-652-0757, High River, AB. 1998 ROGATOR 854, 4103 hrs., 2 sets of tries, $12,000 spend on wheel motors last year, professionally serviced every year, Trimble AutoSteer, sectional boom control $75,000 OBO. Young, SK. 306-259-4990 or 306-946-6424. SPRA-COUPE, 3630 60â&#x20AC;&#x2122;, $24,000 OBO. Call: 780-753-6495, Provost, AB. 2010 CASE/IH 4420, 120â&#x20AC;&#x2122; booms, luxury cab, loaded, excellent condition, 900 hrs., offers. 306-252-2301, Kenaston, SK. 2010 CASE 4420, loaded, Aim command, Viper Pro, AutoBoom, AccuBoom, 120â&#x20AC;&#x2122;, 2 sets tires, active susp., shedded, $285,000. 403-647-7391, Foremost, AB. 2005 CIH 4410, 3300 hrs., 90â&#x20AC;&#x2122; booms, 380 skinnyâ&#x20AC;&#x2122;s, 650 floaters, Outback SPS mapping and AutoSteer, sec. boom control, 4600 Raven monitor, SS tank, $143,000 OBO. 306-281-2275, Prudâ&#x20AC;&#x2122;Homme, SK.

1993 FLEXI-COIL 65 100â&#x20AC;&#x2122; high profile wheeled, 800 gal. windscreens w/endcaps, chem tank, dual nozzles, foam markers, clean water tank, adj. axles, lug tires, 2 seasons on pump, 1 season on solonoids, $7500. 403-878-6985 cell, Richmound, SK. 2001 FLEXI-COIL 67, susp. boom, 90â&#x20AC;&#x2122;, 800 gal., dual nozzles, Norac II, boom height control, vg. 306-537-3400, Regina, SK. 2013 JOHN DEERE 4940, 120â&#x20AC;&#x2122;, 328 eng. SPRAY-AIR 120â&#x20AC;&#x2122; 3600, 1300 gallon tank, hrs., 380/105R50, JD Link, section congood condition, $20,000 CDN. Located just trol, $386,700. South Country Equipment, south of Coronach, SK. Contact Charlie at 306-354-2411, Mossbank, SK. 406-783-5510. cahillseeds@nemont.net 2011 CASE/IH 3230, 4 WD, SS tank, 2008 CASE SRX160 PT sprayer, 134â&#x20AC;&#x2122;, 100â&#x20AC;&#x2122; boom, shedded, 0 hrs, 2 sets tires, Norac AutoBoom, 2 sets nozzles, good loaded. 306-764-7760, Prince Albert, SK. shape, $29,500. C a l l o r t e x t 2006 JD 4920, 120â&#x20AC;&#x2122;, loaded, exc., hi-flow, 403-330-3698, Lethbridge, AB. eductor, Trac control, Raven powerglide, 2002 FLEXI-COIL 67XL suspended boom, ultra-glide, 5-ways, 380s, 15â&#x20AC;? spacing, 90â&#x20AC;&#x2122; booms, 1200 gal. tank, induction tank, $139,500. 204-242-4074, Manitou, MB. clean water tank, foam markers, triple nozzles, mint cond., $19,000. 306-487-2712 or 306-487-7966, Lampman, SK. 2- 24.5x32 RIMS, fit high clearance New Holland 1600 gallon PT sprayer. Call 306-463-4866, Kindersley, SK.

55â&#x20AC;&#x2122; MORRIS MAXIM, 10â&#x20AC;? spacing, blockage monitor, Atom-Jet openers, 7300 TBT tank, exc. cond. Phone: 306-291-9395, or 306-283-4747, Langham, SK. 2005 CIH ADX, 3430 TBT tank, 430 bu., 3 tanks, var. rate, semi hopper, good cond, $33,000 OBO. 204-324-3647, Altona, MB. 2008 SEEDMASTER 80â&#x20AC;&#x2122;, 12â&#x20AC;? spacing, w/double air shoot plus liquid kit, w/2011 Bourgault 6550, 4 tank metering, upgraded Zynx monitor, $215,000 OBO. Located near Regina, SK. Trent 306-540-5275 or Tyler 306-533-8834. 2010 65â&#x20AC;&#x2122; BOURGAULT 3310 paralink, 12â&#x20AC;? spacing, mid row shank banding, DS, rear hitch, $157,000. A.E. Chicoine Farm Equipment Ltd. 306-449-2255, Storthoaks, SK. 2001 MORRIS MAXIM II, 40â&#x20AC;&#x2122;, double shoot, 10â&#x20AC;? spacing, 7240 TBH tank, 3rd tank. 306-266-4362, Glentworth, SK. 2009 BOURGAULT 55â&#x20AC;&#x2122; Paralink drill, c/w MRBâ&#x20AC;&#x2122;s, excellent condition. 306-666-2153 or 306-662-7471, Fox Valley, SK. 40â&#x20AC;&#x2122; MORRIS MAXIM air drill, 10â&#x20AC;? spacings, 7240 TBH tank, double shoot, one season on Atom Jet boots, asking $32,000. 306-443-2437, Alida, SK. 1996 FLEXI-COIL 5000 with 2000 2320 tank, 39â&#x20AC;&#x2122;, 9â&#x20AC;? spacing, DS 3.5â&#x20AC;? steel packers, Atom Jet openers, $35,000 OBO. 306-575-8312, Wawota, SK. 2004 BOURGAULT 5710, 10â&#x20AC;? spacing, 1â&#x20AC;? Atom Jet liquid side band opener. VR sectional control w/JD rate controller, 450 lb. trips, c/w 2001 Flexi-Coil TBT 3450 air cart. Only used liquid since 2011, one owner drill, $90,000 OBO. 306-336-2684, or 306-331-8636, Lipton, SK.

DEGELMAN GROUND DRIVE rockpicker, 2007 FLEXI-COIL 67XL, mint condition $1500; also fork type rockpicker, $600. very low acres, autorate, AutoHeight, 306-488-2103, 306-527-1389 Holdfast, SK $28,500. 306-963-2722, Imperial, SK.

MORI-SEIKI SL 80F CNC lathe, 8.5â&#x20AC;? spindle bore, 25â&#x20AC;? air chuck, Fanuc controls, $59,000; Hitachi-Seiki CNC lathe, model 50G, 6.25â&#x20AC;? spindle bore, $31,000; Standard-Modern lathe, 20x120, $10,500; Kent 12x24 fully automatic surface grinder, $9000; Acer milling marching, $4000. Call 403-850-8876, Calgary, AB.

1994 BRANDT QUICK fold sprayer, foam marker, windcones and double nozzle bodies, $3500. 306-488-2103, 306-527-1389 Holdfast, SK. 2010 NEW HOLLAND 100â&#x20AC;&#x2122; S1070 suspended boom sprayer, c/w Raven AutoBoom, triple nozzle bodies, 4 sets of tips, 1350 Imp. gal, rinse tank, chem. inductor, 20â&#x20AC;? spacing, joystick and IntelliView monitor, exc. cond., wintered inside, $35,000 OBO. Call 306-642-5806, Assiniboia, SK. 2007 CASE SRX 160, JD rate controller, sectional control, AutoBoom, $35,000. Call 780-678-6054, Daysland, AB.

JD 4920, 2005, 1600 hrs, 120â&#x20AC;&#x2122; boom, 1200 gal. SS tank, Autotrac, swath control, Norac, 710/70R42 Michelin and 380/105R50 Firestone tires, $169,900. 519-949-2351, Hensall, ON. 2009 JD 4830, 2934 hrs, AutoSteer, AutoBoom shut-off, excellent cond, $145,000 OBO. 306-497-3322, Blaine Lake SK. 2009 JD 4830, 1000 gal., $199,000; 2009 CIH SRX160, 120â&#x20AC;&#x2122;, 1600 gallon, $39,900; 2010 CIH 3230, $219,000; 2000 RoGator 1254, 1200 gal., $89,900; Brandt 4000, 100â&#x20AC;&#x2122;, 1600 gal., $29,900; 2013 CIH 4430, loaded, $365,000; BG 1450, 100â&#x20AC;&#x2122;, 1200 gal., $5,900; 2004 RoGator 1064, 1000 gal., $117,500; BG 850, 112â&#x20AC;&#x2122;, $4,900. Call Hergott Farm Equipment 306-682-2592, Humboldt, SK. 1999 APACHE 790, 2600 hrs., all new tires, new solution pump, new hydraulic pump, EZ-Steer GPS, always shedded, excellent condition, $70,000. Call 306-642-5632 or 306-536-9811 cell, Assiniboia, SK.

SCHULTE AND FARM KING snowblowers, In stock at Flaman. Call today to book yours 1-888-435-2626. www.flaman.com 2012 JD 4940, 622/246 engine/spray hrs., SCHULTE 8â&#x20AC;&#x2122; FRONT mount rotary snow fully loaded. 2nd set of wheels and tires plow, hydraulic deflector, new cutting (710â&#x20AC;&#x2122;s) avail. 403-892-3303 Carmangay AB edge, $3,000. 306-963-2722, Imperial, SK. 2009 CIH 3185 high clearance, 90â&#x20AC;&#x2122;, 2 sets DEGELMAN 2-WAY BLADE off a PTA 280 of tires, AIM command, inspected, 1452 Steiger, good condition, $10,000 OBO. hrs., $148,000. 306-738-4603, Gray, SK. 780-872-8209, 306-823-4456, Neilburg SK 2001 APACHE 890 PLUS, 850 gal., 90â&#x20AC;&#x2122;, 2011 JOHN DEERE 4930, 1800 hrs., 120â&#x20AC;&#x2122;, USED 12â&#x20AC;&#x2122; LEON dozer blade/snowplow, 2 8 2 7 h o u r s , $ 6 4 , 0 0 0 O B O . P h o n e section control, GPS glove, 620/70R46 $4995. Call Roy 780-955-8042, Leduc, AB. 306-731-7197, Holdfast, SK. moat tires, $273,600. South Country PARTIAL LIST ONLY. Snowblowers and 2009 JOHN DEERE 4930 120â&#x20AC;&#x2122;, 1037 hrs., Equipment, 306-354-2411, Mossbank, SK. attachments: JD Spitfire snowmobile, 620/70R46 tires, SwathPro, SF1 AutoTrac, 2007 JD 4830, 1000 gal. SS tank, 100â&#x20AC;&#x2122;, 2 $999; NEW Cub Cadet 54â&#x20AC;? snowblowers, 20â&#x20AC;? nozzle, $269,500. South Country sets tires, GPS: 2600 SF1, auto-sect. shut$599; NEW 8â&#x20AC;&#x2122;, 2-stage, 3 PTH, PTO snow- Equipment, 306-842-4686, Weyburn, SK. off, exc. cond., 3200 hrs, 2nd owner, loadblower, $2999; 8â&#x20AC;&#x2122;, 3PH, PTO snowblower; ed, $152,000. 204-355-8305 Ste Anne, MB 2- walk behind snowblowers, Toro and Ai- 1996 WILLMAR 765SE, 600 gal. tank, 75â&#x20AC;&#x2122;, rens; NEW 5â&#x20AC;&#x2122; front drive 3PH snowblower; 60% tires, triple nozzle body, gauge Trackless 4WD diesel w/5â&#x20AC;&#x2122; blower; 6- Sic- wheels, Outback mapping, Rinex Autoard and Oshkosh trucks w/blowers; Holder Boom, vg cond., 2800 hrs, $44,000 OBO. TRIDEKON CROP SAVER, crop dividers. 4WD diesel w/5â&#x20AC;&#x2122; blower; snow blades for 306-429-2785, 306-424-7575 Glenavon SK Reduce trampling losses by 80% to 90%. trucks and loaders; snow buckets from 1 2006 ROGATOR 1274 C, 100â&#x20AC;&#x2122;, 3470 hrs., Call Great West Agro, 306-398-8000, Cut to 10 yard; snow buckets for skidsteers; c r o p d i v i d e r s , l o a d e d , $ 1 5 7 , 0 0 0 . Knife, SK. 10- fire engines, many types; parting out 306-641-7759 306-647-2459 Theodore, SK 18- graders. Attachments of all types, hundreds of items on 2 yards, over 50 acres. NEW 2013 MILLER CONDOR SPRAYER, Over 75 sets of pallet forks in stock; sever- 120â&#x20AC;&#x2122; booms, 1200 gal. SS tank, 4WD, Raal Crawler loaders; large stock of construc- ven GPS and boom levelers, loaded, new tion tires; over 25 forklifts, man lifts and sprayer at used price, $299,000. Call scissor lifts; 12- loaders from 1.5 to 9 208-267-1973, Bonners Ferry, Idaho. yard. Over 50 Gensets from 3.5 to 193 KW. 2004 JD 4710, 90â&#x20AC;&#x2122; poly tank, 1750 hrs., 12- sets of forks for loaders and dozers. Norac AutoHeight, 2 sets of tires, triple New replacement parts. Central Canadaâ&#x20AC;&#x2122;s nozzles. Call 306-782-7630, Jedburgh, SK. largest wreckers of construction equipment. Cambrian Equipment Sales Ltd. 2 0 1 0 J D 4 9 3 0 s p r a y e r, 8 9 6 h r s . , 204-667-2867, fax: 204-667-2932. $295,900. Nelson Motors & Equipment 9â&#x20AC;&#x2122; ERSKINE INDUSTRIAL universal front Ltd. For more details call 306-869-3000, mount blower, 540 RPM, good condition, Radville, SK. â&#x20AC;&#x2122;97 AG Shield P/T sprayer, 1,250 gallon $8500. 306-268-7400 or 306-268-7550, 2013 4430, 120â&#x20AC;&#x2122;, 164 hrs., 1200 gallon, tank, 100â&#x20AC;&#x2122; boom. $8,800. Trades welcome. Bengough, SK. Financing available. 1-800-667-4515. AIM, 710â&#x20AC;&#x2122;s and 320â&#x20AC;&#x2122;s, spray remote, 5 sensor AutoBoom, AccuBoom, wide fenders, www.combineworld.com 3â&#x20AC;? front fill, Pro 700, Tridekon crop dividBEHNKE DROP DECK semi style and ers. 306-287-8487, Watson, SK. pintle hitch sprayer trailers. Air ride, 2001 ROGATOR 854 High Clearance, t a n d e m a n d t r i d e m s . C o n t a c t S K : 3790 hrs., 100â&#x20AC;&#x2122;, 800 gal. SS tank, foam 306-398-8000; AB: 403-350-0336. markers, Raven Invisio Pro monitor, AutoSteer, AutoBoom Height w/gauge wheels and Sonar boom Height, 5 sec. AccuBoom control, 2 set wheels, always shedded, exc. cond., $86,000 OBO. Can deliver. Pictures avail. 306-497-3126, 306-497-7511, Blaine Lake, SK. lakeridgefarms@sasktel.net 2012 BOURGAULT 3320 PHD, 60â&#x20AC;&#x2122;, 10â&#x20AC;? 2009 CIH HIGH clearance sprayer, 90â&#x20AC;&#x2122; spacing, 4.5â&#x20AC;? V-Style packers, MRB-III, booms, 750 gal., Raven GPS, AccuBoom, 6550ST tank, X20 monitor, var. rate, 491 3PT SNOWBLOWERS: AGRO Trend, made AutoBoom, 2 sets tires, 990 hrs., always drill control, like new! $339,000. Jordan, anytime 403-627-9300, Pincher Creek, AB. in Ontario. All oil bath gearboxes, 48â&#x20AC;?, 72â&#x20AC;?, shedded $160,000. 306-230-1920 Allan SK 78â&#x20AC;?, 84â&#x20AC;?, 96â&#x20AC;?, 102â&#x20AC;?, 120â&#x20AC;?. In stock, limited 2011 BOURGAULT 65â&#x20AC;&#x2122; 3310, 10â&#x20AC;? spacing, quantities. Call Cam-Don Motors Ltd. SPRAYTEST REMOTE BOOM CONTROL MRB, 2â&#x20AC;? tips, 4.8â&#x20AC;? semi-pneumatic packers, 306-237-4212, Perdue, SK. Use wireless remote to turn on individual primary blockage, stored inside, mint boom sections for nozzle checks. cond., $150,000. Contact 306-662-3388, 2013 SCHULTE SDX117, 1000 PTO, hyd. Easy install with plug and play harness to Maple Creek, SK. rotation and hyd. deflector on discharge fit your sprayer. Order your SprayTest today. spout, rated up to 225 HP tractor, exc. 2007 72â&#x20AC;&#x2122; SEEDMASTER, 12â&#x20AC;? spacing, semishape, only 40 hours, shedded, $13,800. pneumatic tires on shank w/Bourgault 403-664-0329, Sedalia, AB. 6700 ST cart, dual wheels, conveyor, Ph: 306-859-1200 $230,000. A.E. Chicoine Farm Equip. Ltd. 306-449-2255, Storthoaks, SK. spraytest@sasktel.net YOUNGâ&#x20AC;&#x2122;S EQUIPMENT INC. For all your silage equipment needs call Kevin or Ron toll free 1-800-803-8346, Regina, SK. 2010 SCHUITEMAKER RAPIDE 240 silage wagon, always shedded, $125,000. Call 780-675-9276, Athabasca, AB. 2012 HAYBUSTER CMF-700 feed wagon, two screws, scale, $55,000. 780-675-9276, Athabasca, AB. NH FR9080 forage harvester, c/w 8 row corn head, 15â&#x20AC;&#x2122; pickup head, 900 hrs. 403-394-4401, Lethbridge, AB.

2013 BOURGAULT 3320 76â&#x20AC;&#x2122; XTC drill with 7950 cart. 4.5â&#x20AC;? V-style packer, double shoot air kit for mid row shanks, liquid kit for side band with 1â&#x20AC;? knife, full blockage seed and fert. ISO adapter, X30 monitor, 12â&#x20AC;? auger and bag lift. Call 306-746-7638 for info., Raymore, SK. 2011 SEED HAWK, 60-10, semi-pneumatic packers, c/w 2010 Bourgault 6700 tank, d o u b l e s h o o t , c o nveyo r, l ow a c r e s , $325,000. 204-522-5189, Waskada, MB.

NEW AD! 2009 Bourgault 3310 ParaLink, 40â&#x20AC;&#x2122;, new MRBâ&#x20AC;&#x2122;s, 2.5â&#x20AC;? openers, 10â&#x20AC;? spacing, shedded, field ready! $115,000. Text or call 403-901-9808, Strathmore, AB. 2006 K-HART DRILL and 2006 ADX 3430 tank (Flexi-Coil), 60â&#x20AC;&#x2122;, 10â&#x20AC;? spacing. New and rebuilt parts, some new tires for drill also included, $100,000 OBO. 306-463-9229 or 306-460-7426, Eatonia, SK. 2013 K-HART AIR Drill 66â&#x20AC;&#x2122;, 560 bu., SS w/4612 openers, 10â&#x20AC;? spacing, deluxe packers, 560 bu. Salford w/variable rate, ISO controller and scales. Selling because we a g o i n g t o K - H a r t w i t h M R B â&#x20AC;&#x2122; s . 306-378-7709 or 306-378-7759, Elrose, SK JD 610 35â&#x20AC;&#x2122;, 10â&#x20AC;? spacing, 550 lb. trip, Technotill seeding system, 777 JD 160 bu. tank, rear hitch for NH3 kit w/cooler. $30,000. 306-827-7611, 306-827-7740, Radisson, SK. 2001 JD 1920 drill, 41â&#x20AC;&#x2122;, 12â&#x20AC;? spacing, 4â&#x20AC;? steel packers, double shoot, new openers, 2001 JD 1900 270 air cart, new fertilizer meter box. Will take grain on trade. 306-831-7782, Harris, SK. 1999 FLEXI-COIL 2340 TBH cart w/3rd tank, variable rate, semi hopper, $24,000. 306-587-2764, 306-587-7729, Cabri, SK. 90â&#x20AC;&#x2122; SEEDMASTER TXB-M90, 12â&#x20AC;? spacing, DS, all run monitors, 2013 JD 1910 air cart, $369,000. Nelson Motors & Equipment Ltd. 306-868-2022, Avonlea, SK.

2002 FLEXI-COIL 3450 TBH, 10â&#x20AC;? auger w/air seeder hopper, very good condition, double shoot, mechanical drive, rear hitch, $37,000. Call 780-221-3980, Leduc, AB.

2013 SEEDMASTER 74-12TXB with JD WANTED: FLEXI-COIL 6000, 30â&#x20AC;&#x2122; tool bar, 1910 430 bu. tank, 8 run, double shoot, prefer 7.5â&#x20AC;? spacing, SS, in good working $338,900. South Country Equipment, 2 0 1 2 C I H S P X 3 3 3 0 s p r aye r, 1 0 0 â&#x20AC;&#x2122; , condition. 780-205-3322, Lloydminster, SK 306-354-2411, Mossbank, SK. $316,500. Nelson Motors & Equipment Ltd. Call for more details 306-452-3418, Redvers, SK. 2007 APACHE 1010, 1275 hrs., 103â&#x20AC;&#x2122;, Raven Envisio Pro monitor w/hyd. SmarTrax steering, Phoenix 200 receiver, Raven AccuBoom and Raven AutoBoom, sharp shooter nozzle control, five nozzle body, shedded, well maintained $162,500 OBO. Lumsden, SK. Call Jim 306-530-8433 or email: info@LLseeds.ca for photos

www.spraytest.com


54 CLASSIFIED ADS

1997 BOURGAULT 5710, 60’, 7” spacing, SS, speed lock adapters, 3/4” carbide knives, 3” steel packers w/mud scrapers, granular kit, 2004 5350 TBH tank, center tank metering, DS, 2 fans, rear tow hitch, $85,000. 306-264-3721, Mankota, SK. CONCORD AIR DRILL 4010 c/w 3000 tank, Dickey John NH3, Dutch sideband openers, one pass seeding, field ready. 306-873-5788, Tisdale, SK.

SEEDING SPECIALS

THE WESTERN PRODUCER, THURSDAY, FEBRUARY 6, 2014

MOON HEAVY HAUL pulling air drills/ air seeders, packer bars, Alberta and Sask. 30 years experience. Call Bob Davidson, Drumheller, AB. 403-823-0746. 2001 39’ FLEXI-COIL 5000, 12” spacing, 2340 TBT tank, var. seed rate, var. flow anhydrous. 306-747-3635, Shellbrook, SK. 34’ MORRIS MAXIM, 12” space, 7180 TBH, DS, Dutch side band openers, all pins and bushings have been changed, low acres. 306-454-2725, 306-861-9816, Ceylon, SK.

1-6 1’ M o rris Co n to u r Drill, 12” S p a cin g, 5.5’’ Pa ckers , 1 Y r. Old . . . . . . . . . . . . $145 ,000 1-45’ Flexi-Co il 5000 Air Drill, 10’’ S p a cin g, Ru b b er Pa cker. . . . . $25 ,000 1-M o rris 7300 Air Ta n k w /3rd T a n k. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $28,000 1-718 0 M o rris Air Ta n k , E xcellen t. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $18,000 1-M o rris 40’ Air Drill, w /7180 T o w Betw een T a n k. . . . . . . $28,000

2010 40’ Case Precision disk air drill w/ matching 3430 tank & liquid fertilizer kit. Field ready w/ warranty. Trades welcome, transportation CARROT RIVER IM PLEM ENTS INC. available. $138,800.00. 1-800-667-4515, Ca rrot Rive r, SK www.combineworld.com Ph : 3 06 -76 8 -2715 Fx: 3 06 -76 8 -2255 2010 P1050 NH 380 bu. air tank, TBH, SS, Em a il: crim p @ s a s kte l.n e t dual fans, bin level, velocity. Intelliview II 1998 MORRIS MAXIM air drill TBT 7180, monitor, hitch, hoses, shedded; 2002 29’, 7-1/2” spacings, steel packers, tank is Case/IH 32-12 Edge-on spring shanks double shoot. 306-395-2791, Chaplin, SK. w/Farmland boots, disc closers, shedded. 2010 JD 1830 61’ w/1910 350 bu., 4x22” Call 204-734-2526, Swan River, MB. steel press wheels, Dutch openers, 1910 8 2005 JD 1820 10” spacing, 4” steel packrun DS, 10” spacing, var. rate. mark, now ers, double shoot, w/Bourgault opener, $143,600. SCE 306-721-5050, Regina, SK. 1920 JD air cart, 430 bu. triple tank, con2000 BOURGAULT 5710, 47’, MRB’s, Raven veyor, TBH, very clean, $78,000. Call Auto-Rate controller for NH3, 5350 tank 780-841-1496, Fort Vermilion, AB. w/bag lift, $60,000. Glenbush, SK. 306-342-4251 or 306-342-7781. BG 2155H, $2500; BG 2195H, $7900; BG 54’ 5710 w/5350, $79,900; BG 5710 64’, ONE POWERFUL NETWORK $85,000; BG poly packers, $6500; CIH PH800 60’ w/3430 TBT, $179,000; BG SAME LOCAL ADVANTAGE. 4350, PDM auger, $27,500; BG 5710 64’ w/5440, $110,000; Morris Contour w/8370, 47’, $135,000; JD 45’ 1820 w/1910, $95,000. Call Hergott Farm Equipment 306-682-2592, Humboldt, SK. 1998 MORRIS MAXIM 34’, DS, 9” spacing, 3.5” steel packers, 7180 TBH 180 bu. w/3rd tank. 306-693-2068, Moose Jaw, SK WANTED: 5-1/2” RUBBER packers for Flexi-Coil 5000, 9” spacing. Will trade 4-1/2” steel. 403-793-1705, Brooks, AB. 2001 JD 1820 w/JD 1900 air cart. Dinsmore, SK. For more info. please call 306-846-2175 or e-mail: cab@sasktel.net 1997 SEED HAWK 32’, 10.5” spacing, onboard seed, liquid kit, excellent shape. Phone 306-675-4932, Kelliher, SK. 2011 BOURGAULT 3310 and 6550, 65’, 10” spacing, X20, MRBs, 3/4” openers, 4.5” V-packer and 5.4”, semi-pneumatic, manifold blockage monitors, dbl. walking castor wheel pkg., 4 tank meter, duals, deluxe 10” auger, dbl. shoot, bag lift, rear hitch, map l i n k V R , N H 3 i n t e r f a c e fo r R ave n , $310,000. 306-287-8487, Watson, SK. 60’ JD 1830, 10” spacing, 430 and 550 bu. tanks, 2008 - 2013, several units. Check website or call Nelson Motors & Equipment Ltd. 306-868-2022, Avonlea, SK. 1994 FLEXI-COIL 39’ air drill, 2320 tank, 1000 gal. liquid fert. caddy, 9” spacing, Atom Jet side band tips, steel packers, Pattison liquid kit and Graham seed treater, $30,000. 306-488-2103, 306-527-1389 Holdfast, SK. 2001 BOURGAULT 54’ 5710 Series II, 9.8” spacing w/newer 3.5” steel packers and MRB’s, NH3 tip, all new main frame tires, c/w 2002 L-5350 Bourgault tank, DS, tank always shedded, $130,000. 306-231-8229, Watson, SK. 2013 JD 1870 Conserva Pak, 57’, c/w full run blockage monitor and 430 JD TBT cart, seeded only 3000 acres, $225,000 OBO. Ph. 780-778-0796, Mayerthorpe, AB. 2008 SEEDMASTER TOOLBAR, 64’ on 12” spacing, c/w Flexi-Coil 3450 var. rate cart, brand new fert. knives, asking $150,000. 306-421-1086, 306-634-9330, Macoun SK 2013 JD 1830, 61’, w/2013 1910 550 bu. cart. Steel packers, auger, single shoot, $200,000. 306-463-7527 or 306-460-7222 Kindersley, SK. 2013 MORRIS CONTOUR II 71’, Demonstrator, 12” spacing, c/w 650 bu. TBT cart. Financing, leasing OAC available. Huge cash discounts. Cam-Don Motors Ltd., 306-237-4212, Perdue, SK. 3612 CONCORD AIR drill, 200 bu. tank, TBH, hyd. fan, single shoot, new Flexi-Coil openers, good working condition, $16,500 OBO. Call Terry 403-882-3349, Castor, AB. 2002 BOURGAULT 5710 drill w/mid-row banders, 54’, 9.8’’ spacing, 3’’ rubber packers, $50,000. 780-678-6054, Daysland, AB. FLEXI-COIL 5000 57’ with 2320 tank, new p a i r e d r ow o p e n e r s , d o u b l e s h o o t , $48,000. Ph. 403-819-1439, Luseland, SK. 1999 33’ FLEXI-COIL 5000, double shoot, 12” spacing, 3.5” steel packers, 1720 TBH cart, excellent condition, $40,000 OBO. 780-986-3356, Leduc, AB. 2008 JD 1830, 10” spacing, gen openers, Pattison liquid kit, 1910 cart w/duals, variable rate, stored inside, many options, $135,000. Can deliver. Call 306-445-5602, North Battleford, SK. THREE 2010 SEEDMASTERS, 70-12TXB, w/JD 1910 430 bu. TBH, $235,900 and up. South Country Equipment, 306-642-3366, Assiniboia or 306-354-2411, Mossbank, SK 70’ SEEDMASTER SXG550, 12” spacing, DS, sectional control, 550 bu., 2012 cart, $269,000. Nelson Motors & Equipment Ltd. 306-634-6422, Estevan, SK. 2010 SEEDMASTER 80-12TXB with JD 1910 430 bu. TBH, $288,400. Call South Country Equipment, 306-354-2411 in Mossbank, SK. WANTED TO BUY: air cart to pull behind Flexi-Coil 5000, must be in good condition. Call 204-476-6137, Neepawa, MB.

BOURGAULT PARA-LINK Air drills, large selection of good late model units. Other makes and models available.

WE WILL DELIVER. DEPENDABLE IS WHAT WE DO.

CALL GORD 403-308-1135 - Lethbridge, AB.

BOURGAULT 8810, 52’, 330 trip, 9” spacing, 3/4” carbide knives w/2.5” independent packers and 4 bar harrows and 5350 DS tank, w/wo MRBs. Cudworth, SK. Call Gary 306-256-3510, or cell 306-233-7348.

2005 54’ BOURGAULT 5710, 10” space, 2” dutch carbide, 4300 TBT tank, 1700 gal. Bandit liquid system dribble or side band, very good cond, $98,000. Text or call Adam 306-293-7676 (cell), Climax, SK. BOURGAULT AIR CART/ MISC. AIR FLEXI-COIL 1720 TBH seed cart, w/double SEEDERS: Bourgault 5350 air cart, double shoot and monitor. Joe at 403-641-2162, shoot, TBH, hyd., 3rd tank. Air seeders: 40’ ext. 100, Gem, AB. Dutch tool bar, single shoot with Barton openers; 32’ Concord 3212, double shoot with knives or sweeps. Call 306-243-4216, Outlook, SK. IHC 41’ 4700 cult., Degelman harrows, w/1966 1655 Valmar, $3500. BOURGAULT 8800 48’ w/front spreader, mounted harrows and poly packers, 4250 dual shoot 306-488-2103, 306-527-1389 Holdfast, SK air cart, asking $35,000. 306-742-5912, KELLO-BILT OFFSET discs. Check out our 306-742-4772, Churchbridge, SK. new spring arrivals and early pricing dis2009 JD 1830 40’ c/w 1910 350 bu. cart, counts. 2012, 16’ in excellent shape, and only 6500 acres, like new cond., 3.5’’ split parts for Kello and Rome dics. Brewster row Dutch openers, Pattison liquid kit, Ag, 306-939-4402, (Cell) 306-731-7235, Earl Grey, SK. $105,000. 204-574-6401, Brandon, MB. BOURGAULT 64’ 5710, MRB’s and 6350 Bourgault air cart w/in-cab controls. 306-277-4503, Gronlid, SK. 2012 Bourgault 3320QDA Stk# B21999A, single shoot, rear duals, liquid knife, liquid VR kit, Edge-on frnt knife holder, $198,000 Cash. 1-888-442-6084, www.farmworld.ca 50’ BOURGAULT 8810 cultivator, 10” spacing, air kit, liquid fertilizer kit, speed locks, 3” shank mounted valley packers, 24,000 a c r e s s e e d i n g o n l y, $ 4 0 , 0 0 0 . C a l l 306-335-2513, Lemberg, SK. AGROPLOW MODEL 19SAP2H, all options, including tow hitch or 3 PTH, used on 350 acres so like new. Pics available or google FLEXI-COIL 40’ harrow packer bar, heavy the model no., $38,000 OBO. Bruce at packers, $3500. 306-642-3225, Assiniboia, 780-405-8638, Fort Saskatchewan, AB. SK. or cell 306-640-7149. 2009 SUNFLOWER 1544, 45’ tandem 2013 BOURGAULT 7200, 84’ heavy har- disc, 24” blades, hyd. self-leveling, 4 gauge row, loaded, like new, $46,000. Millhouse w h e e l s , g a n g w r e n c h , $ 7 5 , 0 0 0 . 306-287-8487, Watson, SK. Farms Inc. 306-398-4079, Cut Knife, SK. 2010 DEGELMAN 82’ heavy harrow, Val- 60’ BOURGAULT CULTIVATOR, 10” space, mar, $48,500; Brandt 70’ heavy harrow, Summers harrows, no welding on frame, $24,900; 2011 BG 7200 72’ heavy harrow, NH3 ready, Atom Jet no freeze tips, $38,900. Call Hergott Farm Equipment $55,000; NH3 tank, twin 1450’s, $32,500. $80,000 for unit. 780-933-2585, Debolt AB 306-682-2592, Humboldt, SK. WANTED: 80’ or larger heavy harrows, 306-641-7759 or 306-647-2459, leave message. Theodore, SK. FLEXI-COIL SYSTEM 95 harrow packer drawbar, 80’, 5-bar tine harrows, P20 packers, $10,000. Rouleau, SK., phone 306-776-2394, 306-537-0615. FLEXI-COIL HARROW PACKER, 50’, with 2 0 5 5 V a l m a r, $ 4 0 0 0 O B O . C a l l : 780-753-6495, Provost, AB. 2010 BOURGAULT 7200 heavy harrow, 72’, 5/8” tines, 21.5-16.1 tire pkg., full hyd. adjust, $35,000. 306-287-8487, Watson, SK. 1998 RITE-WAY 70’ harrow packer bar, very good condition, low acres, $6500. 306-963-2722, Imperial, SK. DEGELMAN STRAWMASTER 7000 harrow drawbar, 50’, $21,000. Gene Zdunich 306-252-2790, 306-381-6363 Kenaston SK

65-10 SEEDMASTER with dual liquid and dry manifolds, active wing brace, Smart hitch, Agtron blockage monitor, JD 1900 air cart TBH dual shoot, asking $130,000. 306-742-5912, 306-742-4772, Churchbridge, SK. 1997 FLEXI-COIL 5000 w/1995 JD 787 air cart, 170 bu, 33’, 9” spacing, 3.5” steel packers recapped, single shoot, 550 lb. trips, markers, $30,000 OBO. Warner, AB. Call: 403-642-3762. 70’ FLEXI-COIL HARROWS w/sprayer system, 5 bar harrows, $3000. 306-488-2103, 36’ JD 730 double disc with 1900 TBT 306-527-1389, Holdfast, SK. cart, $30,000 or 1900 cart $24,500; JD 787 TBT cart, $12,500. Can deliver. Mac- 55’ LAURIER HARROW packer bar, P20 packers, $3500 OBO. Call 306-297-7624, Gregor, MB. 204-856-6119, 204-685-2896. Shaunavon, SK. 2001 SEED HAWK 357 Magnum, 40’, 12” spacing, 350 lb. 3rd tank, vg cond, some NEW AGRI-TECH 45’ land roller, $36,000. extra parts. Delivery may be possible. Ask- C a l l f o r d e t a i l s 4 0 3 - 3 3 0 - 7 9 8 2 o r 403-824-3737, Nobleford, AB. ing $65,000 204-785-0457 East Selkirk MB 70’ FLEXI-COIL 7500, DS dry c/w 3450 BRANDT 7000 HEAVY harrow, 70’, hydraulTBT tank, $55,000; 5300 Bourgault air cart ic tilt, mint condition. Call 306-277-4503, Gronlid, SK. TBH, $28,000. 306-247-4818, Scott, SK. BOOKING SPECIALS for all makes of harrow tines: mounted, std. drawbars and heavy harrows. Ex: 9/16x26” straight, (Degelman, Brandt, Bourgault, Flexi-Coil, RiteWay) 100 or more, $21.95 ea.; 3/8x15” bent, (Rite-Way, Morris, Herman) 100 or more, $8.60 ea. Special ends Feb. 14, 2014. March delivery. Fouillard Implement Ltd., St. Lazare, MB., 204-683-2221.

WIRELESS BLOCKAGE AND Flow Monitor. Using acoustic sensors, it’s the most accurate monitoring for your air seeder. Say goodbye to wire problems. Seed and fertilizer flow rates are sent wirelessly to an iPad in your cab. It’s simple, reliable and accurate. Call Zane at Intelligent Ag Solutions 306-202-7157, Saskatoon, SK. www.IntelligentAg.com 40’ FLEXI-COIL 400 cultivator, 9” spacing, knock-on shovels, c/w 1110 air cart, $7500 OBO. 306-297-7624, Shaunavon, SK FLEXI-COIL 420 CULT. 40’, c/w 1610 tank, mounted gang packers, Dutch openers, hyd markers. 306-749-2649, Birch Hills, SK

WINTER DISCOUNTS on new and used rollers, all sizes. Machinery Dave, Bow Island, AB., 403-545-6340, 403-580-6889. FLEXI-COIL 85 HEAVY harrows, 70’, excellent condition. 403-321-2105, Blackie, AB.

2011 JD 1790 32 row 15” planter, drawbar hitch, Esets w/corn, sunflower, soybean and canola plates, in-furrow fert. $130,000 1999 BOURGAULT 5710 Stk# B21677D, OBO. 306-452-7931, Redvers, SK. 54’, 9.8” spacing, 3” carbide tips, MRBs, u p d at e d w i d e p i vo t , $ 3 8 , 5 0 0 C a s h . HAYBUSTER ZERO TILL DRILLS: 107, 147, 1000, 1068, 3107 air drill. Looking for 1-888-442-6084 or www.farmworld.ca worn down 1000 drill discs. Call Rudy BOURGAULT 5250 AIR seeder, 3 Series II 403-627-5429, Pincher Creek, AB. meters, 491 monitor, hyd. calibration, cab meter controls, shedded, no fertilizer, WANTED: HOE DRILL, JD 930, 30’ to 60’ wide in good seeding condition. Call King $48,000. 306-398-2923, Cut Knife, SK. Ranch 250-827-3901, Montney, BC. 1999 FLEXI-COIL 2320, TBH, excellent condition, $14,900 OBO. 306-563-8482, FLEXI-COIL 1720 SEED cart, 18.4x26 rears, 16.5x16.1 fronts. 306-622-2069, 306-782-2586, Yorkton, SK Gull Lake, SK. area. 820 FLEXI-COIL 40’, 9” spacing, c/w 1720 TBH tank, dual front caster, 320 third tank, JD 750 SEPARATE placement no-till drill Broadcast kit and 4 bar harrows, very good c/w grass seed attachment. 100 acres on new discs. 780-842-7981, Wainwright, AB. condition. 306-749-2649, Birch Hills, SK. BOURGAULT 5350 air tank, dual fans, 3 tanks, Rice tires, 491 HP monitor, 2008 NH ST830 tillage tool, 50’, 12” spacing, 530 trip, w/Technotill seeding system, unit shedded, sold as unit. Contact Gregoire Seed Farms Ltd., 306-445-5516 or 306-441-7005, North Battleford, SK. 1995 BOURGAULT 3195 Stk# HR3113B; trailing mechanical drive, single fan, RTH, $13,300. Call 1-888-446-9572 or visit our website: www.farmworld.ca 2 0 1 1 B O U R G A U LT 3 3 1 0 P H D, S t k # PB2965, DS, MRB II’s, rear duals, couple walking casters, rear drop hitch, $355,000 cash. 1-888-462-3816, www.farmworld.ca

CASE/IH 3580 TBH tank, 2013, dual shoot, Deluxe auger c/w remote, 3 tank var. rate, Ultrasonic bin level sensors, air velocity meter, rear folding ladder, 3 c o a r s e r o l l e r s , 1 e x t r a fi n e r o l l e r, 800/65R32 front tires, 650/75R32 rear duals. Gord 403-308-1135, Lethbridge, AB. 5440 PLUS BOURGAULT tank, 3 tank metering, single shoot, high output fan, loadi n g a u g e r, 9 0 0 / 6 0 R 3 2 r e a r t i r e s , 540/65R24 fronts, 591 monitor. Leroy, SK. 306-287-7442. 2 4 0 VA L M A R G R A N U L A R ap p l i c at o r, $1700. Phone 306-395-2668 or 306-681-7610, Chaplin, SK.

48’ LEON RODWEEDER w/harrows, $850; Morris 35’ cultivator w/harrows, $1200. 306-395-2668, 306-681-7610, Chaplin, SK. 2011 BOURGAULT 9400 60’ deep tillage cultivator, heavy trips, rear hitch, $78,000. A.E. Chicoine Farm Equipment Ltd. 306-449-2255, Storthoaks, SK. FRIGGSTAD C5 47’ cultivator, mounted harrows, Beeline chem applicator, nice shape, $8500. 306-963-2722, Imperial, SK KELLO-BILT 8’ to 20’ offset discs w/24” to 36” notched blades; Kello-Bilt 24’ to 38’ tandem wing discs w/26” and 28” notched blades and oil bath bearings. Red Deer, AB. www.kelloughs.com 1-888-500-2646. 2012 SALFORD 570RTS, 41’, 7” spacing Coulters, HD rear mount harrow with roller basket, HD main frame tires, 600 lb. weight kit, single point depth control, new blades, $69,500 US. Financing available. 605-226-0695, Aberdeen, South Dakota RT-300 JOKER! 2011, 30’ wide, approx. 3500 acres, asking $69,500. Please Contact James 403-312-0776, Calgary, AB. KELLO-BILT DISC PARTS: Blades and bearings. Parts to fit most makes and models. 1-888-500-2646, Red Deer, AB. www.kelloughs.com LEMKEN RUBIN 8 meter 26’ disc, demo model, as new, $95,000. 204-574-6401, Brandon, MB.

2005 MXU 125 Case/IH, 5692 hrs, LX 156 loader, bucket and grapple, $62,000. COMPLETE SHANK ASSEMBLIES: JD 1610, 306-594-7224 or 306-595-2274, Pelly, SK. $135; JD 610, black, $180; JD 1600, $90; Morris 7-series, $135. 306-946-7923, CASE/IH STEIGER built, 4 WD/Quads; 306-946-4923, Young, SK. Plus other makes and models. Call the Tractor Man! Trades welcome. We deliver. Gord 403-308-1135, Lethbridge, AB. 1999 CASE 9390, 450 HP, 5800 hrs, S3 Outback AutoSteer, high cap. pump, 4 remotes, triples, excellent, $110,000 OBO. 306-243-4242, 306-652-6765 Macrorie, SK 1994 CASE 9280, 8200 hrs., new tires, excellent condition, one owner, $45,000. 306-946-3863, 306-946-7737 Watrous SK 1992 CASE 9270 4 WD, 12 spd. std. trans., 8334 hrs., bottom and bearings done at 5000 hrs., new hydraulic pump, valve set recently redone, c/w 16’ Degelman 6-way blade, $70,000 with blade, without $55,000. Call 306-594-7578, Norquay, SK. 1993 7140, MFD, 4 spd. reverse, w/710 loader and grapple, 4 new radial tires, 60% duals, new seat, runs good, $40,000 2011 FENDT 933, GPS, front and rear w/loader. 204-827-2629, 204-526-7139, weights, duals, eng brake, 710/42’s, 1130 Glenboro, MB. hrs., warranty till March, 2014. Fendt maintained, $210,000. 806-717-7337, 2010 CIH MAGNUM 335 FWA, 680 hrs., Hartley, Texas. drostland15@gmail.com l u x u r y c a b , 4 r e m o t e s , Au t o S t e e r equipped, powershift, 1000 PTO, dual 2010 FENDT 712, 900 hrs., 580/42 rear, 710/70R42 rears, dual 480/70R34 fronts, 540/26 front, 3 PTH, exc. shape, fast, quick attach 3 PTH, excellent condition, great on fuel, $95,000. Call 403-652-7980, $177,000. 780-618-5538, Grimshaw, AB. High River, AB. PUMA 170, MFWD, 770 loader, lux. 2007 CHALLENGER MT865B, 525 HP, Cat 2011 powershift, 540/1000 PTO, 710/70 C18, 3953 hrs, exc. cond., HD tracks 80%, cab, 38 rear, 28 front, fenders, 3 PTH, 4 PTO, big pump, 6 SCVs, RTK GPS and remotes,600/65 32 GPM, elec. joystick, eng. block more, $209,000. 780-206-1234, Barrhead. and trans. heater, HID lights, rear wheel weights, 102” bucket and q/c pallet forks. 306-287-8487, Watson, SK. DUETZ 9170 MFWD, 5900 hrs., good con- 1983 CASE 2294, 2WD, 10,300 hrs., c/w d i t i o n , g o o d r u b b e r, $ 2 4 , 0 0 0 . C a l l 10’ blade, good condition for it’s age, $14,000. Call 403-740-6316, Castor, AB. 780-305-3547, Neerlandia, AB. 1992 CASE/IH 7120 Magnum, 7147 hrs, original owner, 20.8x38 singles, 3 hyd., 18 spd. power shift, exc. cond. LIZARD CREEK REPAIR and Tractor. We 306-291-9395, 306-283-4747 Langham SK buy 90 and 94 Series Case, 2 WD, FWA tractors for parts and rebuilding. Also have CASE/IH: 7120 MFWD w/loader, 7500 r e b u i l t t r a c t o r s a n d p a r t s fo r s a l e . hrs., duals, $48,500; 7120 MFWD, 8500 306-784-7841, Herbert, SK. hrs., duals, new tires, 3 PTH, $49,000; 7130 MFWD, 5500 hrs., duals, $45,000. All WANTED: CASE/IH 2294 FWA. Also older in vg cond. 204-937-7411, Grandview, MB. Case and JD tractors in need of repair. 1981 4490, row crop model, 38” tires, 3 306-395-2668, 306-681-7610, Chaplin, SK. PTH and PTO, 3100 original hours, mint 2004 CASE STX500, Firestone triples, luxu- shape, open to offers. 204-827-2629, ry cab, 16 spd. powershift, 2300 hrs, 204-526-7139, Glenboro, MB. $175,000. 403-647-7391, Foremost, AB. 1986 CASE/IH 4894, 7100 hrs., asking WANTED IHC TRACTORS: 1206, 1026, $25,000. 306-287-4243 or 306-287-7573, 1456, 826, 4 WD’s 4166, 4100, 4156, Watson, SK. 4186. Must have 3 PTH and PTO, running 2013 550 QUAD, 435 hrs, loaded, PTO or not. Call 204-665-2461, Melita, MB. 36” tracks, clear caps, 113 GPM hyd., 6 CASE 2594, 3600 hrs., 24 spd., IHC 684 R e m , H I D, t o w c a b l e , Au t o S t e e r. c/w FEL, 3 PTH, 2400 hrs., 403-394-4401, 306-287-8487, Watson, SK. Lethbridge, AB. QUAD TRAC AND PTO, 2006 STX500 HD, 2003 CASE STX 450, PTO, 16 spd. power- very nice, 36” tacks, 2900 hrs, $209,000. shift, weights, GPS, 710-42’s, 3600 hrs., Located Yorkton. 306-948-7223, Biggar SK $158,000. 403-443-1207, Trochu, AB. 2002 STX 450 quad, power shift, PTO, 2010 CIH 435 Quad, PTO, $269,000; 2011 7500 hrs., $125,000. 306-831-8963, CIH 450, 800 duals, $263,000; 2009 CIH Rosetown, SK. 535 Quad, 36” tracks, $283,900; 2012 JD 9460R, PTO, $279,000; NH Boomer 3045 2002 STX 375, Firestone triples, powerw/FEL, $31,900; CIH Magnum 210, 3 PTH, shift, PTO, AutoSteer, shedded, 3100 hrs., $139,000; CIH Magnum 235, low hrs, $150,000. Rosetown, SK. 306-831-8808. $165,000; 2003 JD 9520, PS, $169,000; 1986 CIH 4494, $23,900; 2012 CIH 550Q, 2006 STX 530 Quadtrac, 3363 hrs., 30” PTO, $359,000; 2011 CIH Maxxum 125 tracks, Cummins DSX-15, 4 hyd. valves, w/FEL, $97,500; 2004 NH TJ500, PS, scraper and Ag hitch, deluxe cab, 16 spd. $175,000; 2009 CIH 535 Quad, 36” tracks, powershift, farmer owned. Delivered. $296,000. Call Hergott Farm Equipment $ 1 8 5 , 0 0 0 U S. F i n a n c i n g ava i l a b l e . 605-226-0695, Aberdeen, South Dakota 306-682-2592, Humboldt, SK.

CASE 2290’s, rebuilt trans., brand new dually tires, interiors totally redone, exc. BOOK YOUR RITEWAY landroller for spring shape, 5500/8000 hrs. Two to choose delivery. Be ready for seeding. Call Flaman from. Call 250-263-5992, Charlie Lake, BC. today- 1-888-435-2626. www.flaman.com 2012 500 QUAD, luxury suspended cab, 2010 JD DB60 PLANTER, 24/47 row, 1000 PTO, diff. locks, 30” tracks, twin Precision air force, E-sets, 20/20 monitor, pumps, 6 hyds., elec. mirrors, AutoSteer, row command, row cleaners, Keaton seed equipped w/Pro700, 495 hrs., exc. cond., firmers, liquid kit. Call 306-456-2749, $340,000. 780-618-5538, Grimshaw, AB. 306-861-2013, Oungre, SK. 2009 PUMA 210, w/LX770 FEL, 851 hrs, WANTED: 49 - 2” shank mount packers; no 3 PTH, 18 spd. powershift w/LHR, 4 Selling JD 737 air drill, 31’, SS, 7.5” spac- valves, dual PTO, 180 PTO HP, cab susp., ing w/787 TBH cart 160 bu., $16,500, just Trimble EZ-Steer, Michelin radials. Call 403-599-3945, Milo, AB. cart $10,000. 306-867-8477, Outlook, SK.

2011 CASE MG340, 1350 hrs., loaded, duals front/rear, exc. cond. Tractor will do almost anything you would like! $180,000 OBO. 403-652-7980, High River, AB.

2013 CASE STEIGER 500, 4WD, powershift, 800R38 duals, large hydraulic pump option, $322,900. Nelson Motors & Equipment Ltd. 306-868-2022, Avonlea, SK. 2013 CIH STEIGER 500, 686 hrs., PTO, powershift, lar ge hyd. pump, duals, $333,900. Nelson Motors & Equipment Ltd., 306-868-2022, Avonlea, SK.

NEW DEALER

the JOKER

High - Speed Versatile Tillage The Joker tillage system is versatile and able to handle any type of crop residue in wet, dry, rocky, or extremely saturated soils. No other tillage system gives you the speed, durability, moisture conservation and finishing capabilities that the Joker does. No matter what cropping conditions are dealt, you will never be outmatched with a Joker in your hand. Visit www.horschanderson.com/joker.html

HORSCH ANDERSON Distributed by:

Farming with Passion

Call Your Local Dealer

Email: craigyeager@grainbagscanada.com or Grain Bags Canada at 306-682-5888 or aaronyeager@grainbagscanada.com www.grainbagscanada.com


THE WESTERN PRODUCER, THURSDAY, FEBRUARY 6, 2014

CHALLENGER 55, 6500 hrs., 3 PTH, Trimble 750 AutoSteer w/Subscription, 4 hyds. vg cond. $65,000. 204-937-7411, Grandview, MB.

2013 JD 9560R 77 hrs., demo unit, 18/6, powershift, 800/70R38, 2630 Greenstar, JD Link, leather trim, 1000 PTO, $415,000. SCE, Mossbank, SK., 306-354-2411. 1998 JD 9400, 24 spd., newer 710x38s, 5303 hrs, $99,000. 306-948-7223, Biggar, SK. STEVE’S TRACTOR REBUILDER looking for JD tractors to rebuild, Series 20s, 30s, 40s or 50s, or for parts. Will pay top dollar. Now selling JD parts. 204-466-2927, 204-871-5170, Austin, MB. 8420T, 2005, 3325 hrs., 24” tracks, GPS ready, 4 remotes, powershift, vg cond. 780-954-2005, 780-283-2005,Westlock AB RETIRING: TWO 1982 JD 4640 tractors, vg condition, one with vg radial duals. 306-638-4550, 306-630-7609, Findlater SK 4440 JD, quad range, 3 PTH, 20.8x38 tires, very well maintained, $26,500 OBO. 403-823-1894, 403-772-2156, Drumheller. 1997 JD 9100 and 1990 JD 4555 tractors. Dinsmore, SK. For more info. call Cliff 306-846-2175 or email: cab@sasktel.net JD 7400, 7410, 4640 FWD’s; 1998 Ford 9782, low hrs. Loaders in stock. Will trade for JD tractors needing work. Austin, MB. 204-871-5170. TWO 2013 JD 9560R, 77 hrs. up, demo’s, 800/70R38, 2630 Greenstar, $415,000 up. South Country Equipment, 306-721-5050, Regina, SK., 306-354-2411, Mossbank, SK. 1981 JD 8440, 7500 hrs, 300 hrs. on new motor, PTO, no winter use, shedded. Call 306-297-8548, Simmie, SK. JD 7810 MFD, 3 PTH, 740 loader, 5600 hrs., mint. Call 780-990-8412, Cherhill, AB. FOR SALE BY TENDER: 1998 JD 7410 selflevelling loader, 10,500 hrs., 3 hyds., all new tires May 2012. Equipment sold as is. Highest or any tender not necessarily accepted. Tenders close February 11, 2014. Send tenders to: RM of Auvergne #76, Box 60, Ponteix, SK. S0N 1Z0. For more info ph John 306-625-7152 or Dale 306-625-7797. DIGITAL HOUR METER repair and programming on heavy equip. and farm tractors. 403-809-3903 Prospeedo Calgary, AB 2 0 0 8 J D 9 5 3 0 , 4 W D, 2368 hours, 800/70Rx38 Firestone duals, Greenstar ready, instructional seat, vg cond., warranty until 2015, $218,500. Kindersley, SK. 306-463-3023, 306-463-8774. 1994 JD 7700, 740 SL loader w/grapple, MFWD, 14,300 hrs., pps trans., $42,800. Nelson Motors & Equipment Ltd. For details contact 306-868-2022, Avonlea, SK. 1999 9400 JD, 4WD, powershift, PTO, 6791 hrs, Greenlight, wired for AutoSteer, excellent, shedded, $130,000. Indian Head, SK. 306-695-0441, 306-412-0091. LOOKING FOR: JD 30, 40, 50 Series tractor in good cond. with mechanical issues. Call 306-621-7170, Yorkton, SK. TRACTOR FOR SALE By Tender. The RM of Arlington #79 is accepting tenders for a: 2006 Buhler Model 2145 MFD tractor equipped with powershift, Buhler Model 3895 FEL, 540/1000 PTO and rear mount 3 PTH. Approx. 4800 hrs, PTO 145 HP, engine 195 HP. Very good condition. Tractor can be viewed at the municipal shop in Dollard. Sealed Tenders will be opened at 2 PM, February 26, 2014. Highest or any tender not necessarily accepted. Terms of sale: Where is, as is. Address sealed tenders to: Tender, RM of Arlington #79, Box 1115, Shaunavon, SK. S0N 2M0. 306-297-7854. 1976 4630, 6100 original hours, duals, all new rubber, immaculate. 306-744-8113, Saltcoats, SK. 1997 JD 7410, 740 NSL loader w/grapple, MFWD, 105 hrs., $58,000. Nelson Motors & Equipment Ltd. For details contact 306-868-2022, Avonlea, SK. 9630T JOHN DEERE, premium cab and lighting pkg., 530 HP, 3500 hrs., tracks at 8 0 % , g r e at s h ap e , a l w ay s s h e d d e d . $208,000. Ron 204-941-0045, Rosser, MB. 1985 JD 8650, quad range, 3 hyd., AM/FM, AC, diff. lock, rebuilt eng., tires85%, shedded, $33,900. 204-761-5145, Rivers, MB. 2002 JD 9120 powershift, 1000 PTO, 3 PTH, 900 metric duals, 6065 hrs, $119,000 www.reimerfarmequipment.com Reimer Farm Equipment, Hwy. 12 North, Steinbach MB. Gary Reimer at: 204-326-7000. 1976 JD 4430 quad range trans., 18.4x38 duals, good running order, $12,900. www.reimerfarmequipment.com Reimer Farm Equipment, Hwy. 12 North, Steinbach MB. Gary Reimer at: 204-326-7000. 1984 JD 8650, 8700 hrs., 4 hyds., 20.8x38 duals, $25,000 OBO. 306-575-8312, Wawota, SK. 2003 JD 7520, MFWD, 3 PTH, IVT trans., w/741 loader and grapple, 6025 hrs., $83,000. A.E. Chicoine Farm Equipment Ltd. 306-449-2255, Storthoaks, SK. 1981 JD 8440 4WD, 7457 hrs, power quad trans, 1000 PTO, 3 remotes, 18.4x38 duals 65%. Completely rebuilt motor, new injection pump and injectors, new clutch and brakes, shedded! $29,900. Jordan, anytime 403-627-9300, Pincher Creek, AB. JD 4640, 8965 hrs., quad shift, 20.8x38 duals, 8 front weights, excellent condition. 306-283-4747, 306-291-9395 Langham SK 2007 JD 7520, IVT trans., 741 loader, detachable grapple fork, FWD, 3 PTH, 4400 hrs, $85,000. 780-853-7205, Vermilion, AB 2009 JD 9770 STS, 1107 rotor hrs., 4 WD, Contour-Master, full load, $169,000 OBO. 306-552-4905, Brownlee, SK. 1976 JD 4430 quad, 3 hyds., 85% rubber, excellent. Call 306-744-8113, Yorkton, SK.

2006 JD 7520 Stk# HN3108A, 5801 hrs., 150 HP, 2 WD, 3 PTH, powershift trans., 3 hyd. outlets, air seats, $75,000. Call 1-888-446-9572 or www.farmworld.ca 1998 JOHN DEERE 9400 4 WD, 4370 hrs., 12 spd, weight pkg, 750x65x38 Treleborg dual tires, $109,000 OBO. 403-529-7134, Medicine Hat, AB. NEW JD 741 front end loader, frames for 20/30 Series, $13,900. Reimer Farm Equipment, Hwy. 12 North, Steinbach MB. Call: Gary Reimer at 204-326-7000. www.reimerfarmequipment.com

CLASSIFIED ADS 55

2012 T9.615, 535 HP, 800-38’s, PTO, high cap. hyd., HID lighting, 16 spd., auto guidance w/262 receiver, cold start pkg., cast front and back, 780-450 working hrs., not smoked in, new cond., full warranty until spring 2014, asking $280,000. Drinkwater, SK. 306-693-5054, drtt.thul@gmail.com

2012 JD 9560RT, 518 hrs, 5 SCV, 79 GPM pump, PTO, HID lites, front weights, AJ steering hitch, $415,000. Nelson Motors & Equipment, 306-868-2022, Avonlea, SK. 2000 JD 8100, FWA, 20.8x42 duals, 6000 2007 NH TV145, 4200 hrs., one owner, hrs., mint, $63,900. Phone 306-948-7223, well equipped: high lift FEL, hyd. couplers, PTO and 3 PTH tractor and cab end, bi-diBiggar, SK. rectional tires, grapple fork. New pins and 2012 JD 9460R 4WD powershift, 600 bushings in centre hinge. Well maintained hrs., 800/70R38’s, prem. cab, leather trim, and serviced. 306-457-2935 Stoughton, SK HID lights, 4 remotes, weight pkg, Cat V drawbar, $234,500 US. 320-848-2496 or 320-894-6560 www.ms-diversified.com Fairfax, MN. FORD 7700 w/FEL and Ford 7710. Both 2011 JD 9630T deluxe comfort package, with cabs, 3 PTH’s, good cond., $14,000 to 1248 hrs., 1000 PTO, 5 hyds., 18F/6R $24,000. Call 204-322-5614, Warren, MB. powershift, $361,900. South Country Equipment, 306-692-2371, Moose Jaw, SK JD 7130, MFWD w/740 Classic loader, bale spear, like new, 870 hrs., $92,500. Phone 306-726-7455, 403-308-4200. JD 850 COMPACT utility tractor, dsl, 3PTH, 2155 hrs., $4500; JD 2010, dsl., jobber, 3PTH, vg cond., 4755 org. hrs., org. paint, $4500. 204-522-5428, Deloraine, MB. 1995 JD 8970, 400 HP quad range, 8000 h o u r s , 3 8 ” r a d i a l s , $ 6 2 , 0 0 0 . C a l l 1993 Ford 9880 4WD Tractor 306-524-4960, Semans, SK. 400HP, 7,886 hrs., $48,800.00 w/ singles, 2012 JD 9410R, 1300 hrs., 18 spd., power- or $59,800 with duals + 8 new radial shift with efficiency manager, 710x70R42 tires. Sold w/ warranty. 1-800-667-4515, tires, PTO, warranty. 306-752-1948 or www.combineworld.com 306-921-6693, Melfort, SK. 1979 FORD FW60, Stock # C22221, 5405 JD 4450, 6844 hrs, MFWD, 3 PTH, power- hrs., 335 HP, 4 WD, new starter, 20 spd., shift, $39,000; JD 7800, 7900 hrs, MFWD, duals, $25,500. 1-888-442-6084, or 3 PTH, powershift, $57,000; JD 7700, www.farmworld.ca 7300 hrs, powerquad, MFWD, 3 PTH, 1998 FORD/NH 9682, 710 rubber, 12 $54,000; JD 7600, 6400 hrs, powershift, speed, low hours, excellent condition. MFWD, 3 PTH, $49,000; JD 7600, 7100 306-277-4503, Gronlid, SK. hrs, powerquad, MFWD, 3 PTH, $46,000; JD 7810, 6020 hrs, powershift, MFWD, 3 PTH, new big tires, $65,000; JD 4450, 8035 hrs, powershift, MFWD, 3 PTH, en- D145 VERSATILE WITH 12’ Degelman gine rebuilt, $39,000; JD 4050, 8450 hrs, blade, runs good, $6500 firm. Call: powershift, MFWD, 3 PTH, $29,500. 306-397-2599, Meota, SK. 306-231-3993, www.versluistrading.com Humboldt, SK. 1981 VERSATILE 835, 7100 hrs., asking 306-287-4243 or 306-287-7573, 1981 JD 8440, 20.8x34 duals, 1000 PTO, $20,000. triple hyds., 2300 hrs. showing, excellent, Watson, SK. $35,500. 306-473-2711, Willowbunch, SK. 2002 BUHLER VERSATILE 2270, 4 WD, 2007 7420 Stk# HN3300A, 6000 hrs, 135 GPS, 3100 hrs., vg cond., $78,000 OBO. HP, MFWD, 3 hyd. 3 PTH, dual PTO, c/w 306-445-5551, North Battleford, SK. 741 JD loader, bucket, grapple, $69,000. VERSATILE 2525, 525 HP, 2 track, air ride, 1-888-446-9572 or www.farmworld.ca 1400 hrs., $75,000. Call 204-822-3797, Morden, MB. 2013 MF 4610 FWA, rental return, 84 HP PTO, self-levelling loader, cab, AC, hyd. shuttle, joystick, 3PTH, 110 hrs. Warranty. 2.9% for 72 months OAC. Cam-Don Motors Ltd., 306-237-4212, Perdue, SK.

SUNFLOWER HARVEST SYSTEMS. Call for literature. 1-800-735-5848. Lucke Mfg., www.luckemanufacturing.com ESTATE SALE: 8-row Monosem corn planter c/w liquid fert. kit, $10,000; New ’00 LULL 644D34 TELEHANDLER, 6,000 lbs., Idea power unit w/4-row SP corn harvest- 34’ reach, w/ cab, well maintained, good er, $15,000; 2-row SP corn harvester, shape. $26,800. Trades welcome, financing available. 1-800-667-4515. $5000. Dennis 403-308-1400, Taber, AB. www.combineworld.com. NH 358 MIXMILL w/Forrester auger attachment, not rusted out, excellent shape. FORKLIFTS FOR RENT/SALE: JCB 940, 306-291-9395, 306-283-4747 Langham SK 8000 lbs; JCB 550-170 Telehandler. Ph. Conquest Equip., 306-483-2500, Oxbow SK

2012 T9.670, Stk# HN3227A, 450 hrs., 670 HP, 4 WD, diff. lock, 6 hyd. outlets, high cap. drawbar, lux cab, $345,000. 1-888-442-3816 or www.farmworld.ca 2011 NH T9050, 1215 hrs, 485 HP, 4 WD, powershift, IntelliVeiw II Plus, HID’s, full IntelliSteer Omnistar unlocked, $238,000. 1-888-442-6084 or www.farmworld.ca

SANCTUARY LANDSCAPE CONSULTATION Services. Shelterbelt design, yard/acreage tree planning, 35 years experience. Phone 306-695-2019, Indian Head, SK.

WANTED: 1026, 1456 or 826 IH; Also JD 6030, 3020 or 4020 tractors, any cond. 701-240-5737, Minot, North Dakota. WANTED: GRANULAR TANK for air seeder, can be any make. 306-795-2708, Hubbard, SK. WANTED: INT. DISC DRILL, 20’ to 24’, with grass and fertilizer attachment, in good shape. 780-645-2263, St. Paul, AB. WANTED: USED, BURNT, old or ugly tractors. Newer models too! Smith’s Tractor Wrecking, 1-888-676-4847.

2008 GRADALL/JLG TELEHANDLER 534D9 DSL, 4 WD, 9000 lbs., c/w heated cab, 45’ reach w/auxiliary hydraulic lines to articulating swing carriage c/w adjustable HD forks, full block heater, hydraulic tank 1800 hrs, $89,000. 403-580-0649, WANTED: MF #36 DISCERS, all sizes, heater, SPRUCE FOR SALE! Beautiful locally prompt pick-up. Phone 306-259-4923, Medicine Hat, AB. grown trees. Plan ahead and renew your 306-946-9669, 306-946-7923, Young, SK. OVER 20 FORKLIFTS in stock, many parted shelterbelt or landscape a new yardsite, WANTED: FLEXI-COIL or JD 50-60’ cult.; out. Over 75 sets of pallet forks from small get the year round protection you need. Also Ford 9030 4 WD tractor in good cond. to large. Cambrian Equipment Sales, We sell on farm near Didsbury, AB. or dephone 204-667-2867, fax 204-667-2932, liver anywhere in western Canada. Details 306-452-3955, Bellegarde, SK. phone 403-586-8733 or check out our Winnipeg, MB. WANTED: CASE/IH 1482 or 1682 PT comwebsite at www.didsburysprucefarms.com bine in good condition. Call 306-210-8901, Reward, SK. WANTED: 160 to 200 HP 2 WD tractor, in good condition. 306-210-8901, Unity, SK. WANTED: NH BALE WAGON 1037, 1033, 1036, 1032, JD 7810 tractor, MFWD, FEL, 3 PTH. 403-394-4401, Lethbridge, AB.

BISON WANTED - Canadian Prairie Bison is looking to contract grain finished bison for growing markets. Roger Provencher at 306-468-2316. roger@cdnbison.com

WANTED: 8”x51’ PTO auger in good cond., Sakundiak preferred. Call 306-531-6119, Balgonie, SK. WANTED: Older and newer tractors, in running condition or for parts. Goods Used Tractor Parts, 1-877-564-8734. WANTED: 70 to 100 HP 2 WD tractor with cab, in good condition. Ph: 306-210-8901, Unity, SK.

1-888-92 0-1507

MULCHING - TREES, BRUSH, Stumps. Call today 306-933-2950. Visit us at: www.maverickconstruction.ca GUARANTEED PRESSURE TREATED fence MF 2675, like new tires; MF 1505, $2500; posts, lumber slabs and rails. Call Lehner MF 255, 3 PTH; Versatile 800 Series II, Wo o d P r e s e r ve r s L t d . , a s k fo r R o n 306-763-4232, Prince Albert, SK. $8500. 403-394-4401, Lethbridge, AB. GRATTON COULEE AGRI PARTS LTD. Your #1 place to purchase late model combine and tractor parts. Used, new and rebuilt. www.gcparts.com Toll free 888-327-6767.

WE SPECIALIZE in manufacturing all kinds of buckets including large snow buckets to fit any loader. Call Reimco Industries, 403-312-4202, Linden, AB. DEGELMAN BLADE 12’, plus 1’ extensions, f i t s Ve r s a t i l e 8 3 5 , g o o d s h a p e . 306-378-2314, Elrose, SK. 8’ LEON 3 point hitch blade, $500 OBO. Call: 306-377-4726, Fiske, SK. CANADA’S EQUIPMENT LEASING EXPERTS STILL OVER 25 2 WD and 4 WD loaders and crawlers in stock. We have dismantled many units for parts. Large stock of new and used parts. 2 locations, over 60 years in business. Cambrian Equipment Sales, phone 204-667-2867, fax 204-667-2932, BLOCKED AND SPLIT seasoned Spruce firewood. Call V&R Sawing, 306-232-5488, Winnipeg, MB. Rosthern, SK.

F I R E W O O D : C u t a n d s p l i t , d e l i ve r y available. 306-862-7831, 306-862-3086, Nipawin, SK. BIRCH FIREWOOD, sold in bags of approx. 1/2 cord, split and seasoned, $200; 2006 CAT 924G wheel loader, 5500 hrs, 1 Pine also available in same quantity, $120. owner, used for farming and snow remov- 306-763-1943, Prince Albert, SK. al, good shape, always serviced at Toromont Cat, lots of attachments available, $89,000. 204-633-8888, 204-782-4114, Winnipeg, MB. KEET’S FISH FARM has Rainbow Trout EZEE-ON #125 FEL, high lift, 8’ bucket, fingerlings for spring stocking. Gill nets mounts and controls included, as new, available. 306-260-0288, Saskatoon, SK. www.keetsfishfarm.com $5000. 250-567-2607, Vanderhoof, BC.

ORGANIC BISON FOR lease or for sale w/calf crop share. Ph/fax 250-630-2524, or write to: Box 6214, Fort St. John, BC. V1J 4H7. WANTED TO PURCHASE cull bison bulls and cows for slaughter. Oak Ridge Meats 204-835-2365 204-476-0147 McCreary MB PREMIUM BREEDING STOCK, $1500 to $2000/head. Dr. Marshall Patterson, 306-475-2232, Moose Jaw, SK. ELK VALLEY RANCHES, buying all ages of feeder bison. Call Frank 780-846-2980, Kitscoty, AB. or elkvalley@xplornet.com NILSSON BROS. INC. buying finished bison on the rail at Lacombe, AB for Feb delivery and beyond. Fair, competitive and assured payment. Richard Bintner 306-873-3184. 12- MATURE PURE PLAINS bred bison cows, $1300 each. MFL Ranches, 403-747-2500, Alix, AB.

SOLIDLOCK AND TREE ISLAND game wire and all accessories for installation. Heights from 26” to 120”. Ideal for elk, deer, bison, sheep, swine, cattle, etc. Tom Jensen ph/fax 306-426-2305, Smeaton, SK.

BLOCKED SEASONED JACK Pine firewood and wood chips for sale. Lehner Wood Preservers Ltd., 306-763-4232, Prince Albert, SK. Will deliver. Self-unloading trailer. ‘09 NH TV6070 Tractor 105hp, new tires, loader w/ new bucket, 3,812 hrs., $59,800. Trades welcome Financing available. 1-800-667-4515. www.combineworld.com

PHIL’S IRRIGATION SALES: Reinke pivots, lateral and minigators, pump and used mainline travelers and pivots. 22 years experience. 306-858-7351, Lucky Lake, SK. www.philsirrigation.ca IRRIGATION EQUIPMENT or move water? 6”-10” pipe, 4 cyl. motor and pump on cart, $4500. 403-308-1400, Taber, AB.

ODESSA ROCKPICKER SALES: New Degelman equipment, land rollers, Strawmaster, rockpickers, rock rakes, dozer blades. Phone 306-957-4403, cell 306-536-5097, Odessa, SK.

WANTED: TWO SETS 4’ Flexi-Coil mounted packers, 12” spacing. 204-662-4432, or 204-264-0693, Sinclair, MB VERSATILE 875 TRACTOR w/duals, 700 hrs on major $19,000 engine overhaul. Recent new tires, return line for air drill, field ready $35,500. 780-307-8571 Westlock AB 2006 VERSATILE 435, 4700 hours, 800 rubber, $129,000 OBO. 306-563-8482, 306-782-2586, Winnipeg, MB. VERSATILE 936, 7200 hrs, 24.5x32 duals, standard shift. Phone 306-266-4362, Glentworth, SK.

2012 T9.560, Stk# PN2993A, 440 hrs., 500 HP, 4 WD, 16 spd trans, 6 hyd outlets, luxury cab, cold weather start, $347,500. 1-888-462-3816 or www.farmworld.ca 2013 T9.560, 280 hrs, 800 metric tire, deluxe cab, 6 hyds., tow cable, weights, $330,000; 2013 T9.390, 270 hrs, 480x50” row crop tires, PTO, 4 hyds., powershift, tow cable, cloth seat, $280,000; 2012 T7.185 MFWD loader grapple, 460 rear, 420 front 70% tread, weights, CVT trans, 3 h y d s . , 5 4 0 / 1 0 0 0 P TO , 1 2 2 0 h r s . , $100,000. 204-534-7651, Boissevain, MB.

BEV’S FISH & SEAFOOD LTD., buy di- BONE CHINA, Old Country Rose, 265 pcs., rect, fresh fish: Pickerel, Northern Pike, asking $2900 for whole set. Will sell indiWhitefish and Lake Trout. Seafood also vidual pieces. 204-728-9104, Brandon, MB. available. Phone toll free 1-877-434-7477, 10’ REM DOZER with hoses and hydraulic 306-763-8277, Prince Albert, SK. cylinders, off a JD 4440, $1000. Gerald 306-962-4505 or 306-460-8780, Eston, SK WANTED: I-BEAM, 6” preferred, any length, looking for a minimum of 80’. Call D5H CAT, CAB, winch, 6 way dozer; Steel 306-531-6119, Balgonie, SK. quonset, in crate, 52’x35’x18’; Ford 5000 dsl w/loader. 306-236-8023, Goodsoil, SK.

WANTED: MASSEY 698 tractor, running or not w/wo loader. Phone 780-635-2232, Glendon, AB.

WANTED: MASSEY 698 tractor, running or not w/wo loader. Phone 780-635-2232, Glendon, AB. WRECKING FOR PARTS: Massey 2675, very good engine, 18.4x38 tires, excellent sheet metal. 1-877-564-8734, Roblin, MB.

’09 NH T7040 180HP FWA tractor 3PTH & PTO w/ FEL & grapple, 2,600 hrs. Excellent condition w/ warranty! $104,800. Trades welcome. 1-800-667-4515. Financing available. www.combineworld.com

FACTORY BUILT DEARBORN FEL for 30-40 HP tractors c/w front mounted hydraulic pump off 1950’s Ford, $1500. 780-778-1270, Blue Ridge, AB.

NORTHFORK- INDUSTRY LEADER for over 15 years, is looking for finished Bison, grain or grass fed. “If you have them, we want them.” Make your final call with Northfork for pricing! Guaranteed prompt payment! 514-643-4447, Winnipeg, MB. QUALITY BISON for sale, grass fed calves, GENERATORS: 20 KW to 2000 KW, low yearlings, 2 year olds and exposed cows. hour diesel and natural gas/ propane units 250-489-4786 leave msg., Fort Steele, BC. Abraham Generator Sales Co. Phone: 701-797-4766 or 701-371-9526, Coopers- SASKATCHEWAN BISON ASSOCIATION Industry sponsored meetings of staketown, ND. www.abrahamindustrial.com holders and producers to provide current NEW AND USED generators, all sizes from information on industry trends and bison 5 kw to 3000 kw, gas, LPG or diesel. Phone production. The Saskatchewan Bison Assofor availability and prices. Many used in ciation gratefully acknowledges the supstock. 204-643-5441, Fraserwood, MB. port of the Saskatchewan Ministry of Agriculture, February 21, 2014, Travelodge, 2007 MQ 25 kW trailer mount diesel gen- Melfort, SK. February 28, 2014, Western erator, excellent, $9,500. 306-642-3225, Development Museum, North Battleford, or 306-640-7149, Assiniboia, SK. SK. March 21, 2014, Days Inn, Swift Current, SK. Meeting Schedules for All LocaDIESEL GENSET SALES AND SERVICE, tions: 10:00AM - Industry and Market Up12 to 300 KW, lots of units in stock, used date; 12:00PM - Complimentary Lunch; and new, Perkins, John Deere, Deutz. We 1:00PM - Production Seminars; 3:30PM also build custom gensets. We currently SBA AGM (North Battleford only). Register have special pricing on new John Deere at SBA office: 306-585-6304 or CBA office: units. Call for pricing 204-792-7471. 306-522-4766. SBA Premium Stock Show & Sale, February 28, 2014 Kramer Auctions Ltd., Big Bid Barn, 6:00PM: Supper, social, premium stock show awards, fun auction, $20 adults, children 10 and WANTED: GOOD USED Trimble 750 GPS under free. March 1, 2014, Kramer Auca n d E Z - S t e e r c o m p l e t e . C a l l tions Ltd., Big Bid Barn, 11:00AM: Premium Stock Sale. Quality breeding stock 306-962-6677, Eston, SK. from across Western Canada. Commercial TRIMBLE EZ-BOOM SECTIONAL control, bison sale to follow. To enter or for more works only with Trimble 500 display, information contact: Kramer Auction Ltd. $1000 OBO. 306-424-7312, Candiac, SK. at 306-445-5000 or SBA office at: 306-585-6304. TRMBLE 500, EZ-STEER, EZ-Boom, $5,000 complete. 306-731-7197, Holdfast, SK. WANTED: 50 to 100 2013 Bison calves. Call 780-777-2326, Athabasca, AB. YOUR PICK: 2011 bred heifers. One to 150 head. Contact Bruce 403-651-7972, Youngstown, AB. SASKOTA NATURAL is looking for finWWW.NOUTILITYBILLS.COM - Indoor ished bison and cull cows. COD, paying coal, grain, multi-fuel, gas, oil, pellet and market prices. “Producers working with propane fired boilers, fireplaces, furnaces Producers.” 306-231-9110, Quill Lake, SK. and stoves. Outdoor EPA and conventional wood boilers, coal / multi-fuel boilers. HERD DISPERSAL, 40 exposed cows, 30 Chimney, heat exchangers, parts, piping, two and three year old heifers, 35 calves, 3 bulls. Call 250-785-4674 , Fort St John, BC pumps, etc. Athabasca, AB, 780-628-4835. 1999 CUMMINS LTA10-G1 Standby gen plant, 280 hrs, 250 KW, single and/or 3 phase, 120/240 volt, c/w 1000 amp, 3 phase robonic transfer switch, very nice shape! $16,000. Call Jordan anytime 403-627-9300, Pincher Creek, AB.


56 CLASSIFIED ADS

THE WESTERN PRODUCER, THURSDAY, FEBRUARY 6, 2014

OLE FARMS 9TH Annual Family Day Sale: 170 top Red and Black Angus 2 yr. old bulls, 180 commercial Black Angus bred heifers. Monday, February 17, 2014, 1:00 PM at the farm. Athabasca, AB. Phone: 780-675-4664. www.olefarms.com

LABATTE SIMMENTALS 34th Annual Bull and Open Heifer Sale, Friday, February 28, 1:00 PM, Johnstone Auction Mart, Moose Jaw, SK. Guest consignor Meadow Acres Farms. Offering: 80 red and black purebred Simmental bulls and 30 red and black purebred open heifers. For catalogue or DVD: labatte.simm@sasktel.net Call Barry LaBatte 306-815-7900 or Blair Fornwald 306-487-7662. View catalogue on-line at labattesimmentals.com

MADER RANCHES, Pearson Simmentals and Diamond T Cattle Co. 25th Annual Bull Power Sale, Friday, Feb. 14, 2014, On the Farm. 1 PM Sale Time. 90 Polled, Red and Black Simmental, Salers, and Angus bulls. Also 10 Simmental heifers. Easy calving bulls for heifers, high performance bulls for cows, 85 lb. average birthweight, gaining almost 4 lbs per day. Free wintering until April 1st, delivery assistance, 2/3 down option. You can watch and bid online at: www.liveauctions.tv Free catalogue or view at: www.maderranches.com Ryley 403-337-4014, Carstairs, AB.

STEWART CATTLE CO. & Guests Bull Sale: 40 Black Angus bulls; 8 Simm. cross Angus bulls; 11 Purebred Angus heifers. February 27, 2014, 1:30PM, Neepawa AgPlex, Neepawa, MB. Contact: Brent Stewart 204-773-2356(h) or 204-773-6392(c). Or Email: stewartcows@wificountry.ca Visit our website: www.stewartcattle.com

19TH ANNUAL Cattleman’s Connection Bull Sale, March 7, 2014, 1 PM Heartland Livestock, Brandon, MB. Selling 100 yearling Black Angus bulls. For catalogue or more info. call Brookmore Angus, Jack Hart, 204-476-2607 or 204-476-6696, email brookmoreangus@gmail.com Guest consignor, HBH Farms manager, Barb Airey 204-566-2134 or 204-761-1851, email rbairey@hotmail.com Sales Management Doug Henderson 403-350-8541 or 15 PERFORMANCE AND calving ease Black 403-782-3888. PALMER CHAROLAIS/ NIELSON LAND Angus bulls selling in the Kuntz Farm Bull and Cattle Co. Black and Red Angus Bull Sale, March 8, 2014, Balgonie, SK. Contact and Heifer Sale, March 3, 2:00 PM at the Laird Edwards at 306-567-7456 or Jack Palmer Farm, Bladworth, SK. Offering: 45 Davidson at 306-726-4307, Craik, SK. Black and Red Angus yearling bulls and 9 Black and Red PB Angus yearling heifers. 43 2 yr. old and yearling Charolais bulls, most polled, some Red factor. Top quality cattle with great pedigrees that will work. Contact Larry Nielson at 306-734-5145 or ROB & LORNA STORY Velon Herback at 306-567-7033 or By NETHERHILL, SK Livestock 306-536-4261. View catalogue and videos online at www.bylivestock.com BURNETT ANGUS 30th Annual Bull and Female Sale, Saturday, April 5 at 1:00 PM, SOUTH VIEW RANCH has Red and Black Heartland Livestock, Swift Current, Sask. Angus coming 2 yr. old bulls. Shane at: 50 yearling and two year old bulls, low 306-869-8074, 306-454-2688, Ceylon, SK. birthweight stacked pedigrees bred to use on heifers, Final Answer, Chinook, In Fo- RED ANGUS BULLS, two year olds, secus, OCC Missing Link, Glanworth Wai- men tested, guaranteed breeders, delivery SELLING group, Fahren. New this year Leptin test- available. 306-287-3900, 306-287-8006, Registered Black Angus ed. Select group of first calf heifers and Englefeld, SK. skinnerfarmsangus.com open replacement heifers. Ask about our by Private Treaty off the Farm Bull Finance Program. Catalogues and info: Offering a Great Selection Bryce 306-773-7065, Wyatt 306-750-7822 of Two Year Old (Virgin) & Yearling Bulls wburnett@xplornet.ca Featured AI Sires: 100 TOP CUT black heifers AI’d June 29 SAV 707 Rito 9969, SAV Brand Name 9115, and pasture bred to 6 Mile & Co.’s NorthSAV Providence 6922, Mohen Dynamite 1356, ern Lite for 60 days after. 80 Black and Red BJ’S Fort Walsh 823 Angus cross heifers bred to Breed Creek heifer bulls, sons of HF Hat Trick and Six Delivered Free 1st 150 Miles Mile’s Trademark. Bulls turned out July 1. • All bulls semen tested and delivered Full health program, ultrasound preg • Bulls are available for viewing anytime checked. Kevin 306-295-3371 Eastend, SK. DEER RANGE RED Angus 2 Year Old Bull Home Phone - (306) 463-3225 YOU ARE INVITED to Carlrams 5th Annual Sale, Monday March 10, 2014 at Heartland Lorna’s Cell - (306) 460-8520 Bull Sale, Friday, Feb. 7th 5 miles North of Livestock, Swift Current, SK. 50 bulls, Cut Knife, SK. Come for dinner. Sales start many suitable for heifers. We only raise 2 Rob’s Cell - (306) 460-7620 at 2:00 PM. 14 Super Angus Bulls, from year old bulls, selected for feet, perforwww.dolittleangus.com RNR Flicek. Bred right and fed right. Call mance and maternal strengths. Visit: Directions from Kindersley, SK Rick or Ruby 306-823-3933, or Larry www.DeerRange.ca Phone 306-773-7964, 10 miles East on Hwy #7 and 1.5 miles North 306-823-3957. Bid or watch on dlms.ca 306-773-9872, email: tkolson@sasktel.net Catalogues online at: buyagro.com 17 REGISTERED RED Angus open heifers, 2nd ANNUAL BAR Heart Angus and J excellent brood cow prospects. Call Little Heart Red Angus Bull and Female Sale, de Ranch, 306-845-2406, Turtleford, SK. Tuesday, February 18, 2014 at 1:00 PM at BRED HEIFERS: Bred to easy calving Angus Bluffton, AB. Celebrating 60 years in the bulls. Start calving April 1st. 306-287-3900 Angus industry. Offering: 44 lots, 38 year- or 306-287-8006, Englefeld, SK. ling bulls and 6 yearling heifers. Contacts: Ron and Georgina Smith 403-391-7839, 2 YEAR OLD RED ANGUS BULLS. Easy Chris and Kim Sailer 403-785-6801, Rob calving, high performance and structurally Holowaychuk, OBI 780-916-2628. View sound. Semen tested and guaranteed. Dewww.cattlemanagement.ca for catalogue. livery available and can keep until spring. RANCH READY BULL SALE on March 20, BRED HEIFERS, purebred Black Angus, Prices $3500 and up. Bulls are ranch raised 1:00 PM at Heartland, Swift Current, SK. calving April/May, papers available. Call and come from a working cowherd. Call 23 tanky 2 yr. old Angus bulls from Bar CR Everblack Angus, Ernest Gibson, Vermilion, Rock Creek Ranching, Jordan Newhouse 306-276-2025, White Fox, SK. Angus and 30 Hereford bulls from Braun AB., 780-853-2422. Ranch. Catalogue at www.braunranch.com 2 YEAR OLD and yearling Red Angus Bulls, BLACK ANGUS BULLS, yearling and 2 Contact Linda Froehlich 306-221-4088, calving ease, semen tested. Little de year olds. Semen tested and ready to go Ranch, 306-845-2406, Turtleford, SK. caledonian@sasktel.net by mid-April. Mike Chase, Waveny Angus Farm 780-853-3384 or 780-853-2275 at Vermilion, AB.

BRED HEIFERS: Bred to easy calving Angus bulls. Start calving April 1st. 306-287-3900 PALMER CHAROLAIS/ NIELSON LAND or 306-287-8006, Englefeld, SK. and Cattle Co. Black and Red Angus Bull and Heifer Sale, March 3, 2:00 PM at the Palmer Farm, Bladworth, SK. Offering: 45 Black and Red Angus yearling bulls and 9 Black and Red PB Angus yearling heifers. 43 2 yr. old and yearling Charolais bulls, most polled, some Red factor. Top quality cattle with great pedigrees that will work. Contact Larry Nielson at 306-734-5145 or Velon Herback at 306-567-7033 or By Livestock 306-536-4261. View catalogue and videos online at www.bylivestock.com NORDAL LIMOUSIN AND ANGUS Bull 33rd ANNUAL EARLY Sunset Ranch Bull Sale, Thursday February 20, 2014. Saska- and Female Sale on Friday, February 28, toon Livestock Sales, Saskatoon, SK. Sell- 2014 at 1:30 PM at the farm near Edam, ing: 50 Red and Black Angus 2 yr.old bulls. SK. “Only the good ones sell.” Offering: 62 Rob Garner, Simpson, SK. 306-946-7946. lots, 23 Angus yearling bulls, 14 SimmenCatalogue at: nordallimousin.com tal yearling bulls, 11 Angus yearling heifGLENNIE BROS. 18 reg. bred heifers, sell ers, 14 Simm. yearling heifers. Contacts: at Heartland, Swift Current, Feb. 13. AI’d Jim and Peggy Grant 306-441-3590, Rob to Krugerrand 410H and Cedar Ridge to Holowaychuk, OBI 780-916-2628. View start calving March 15. Cattle located in www.cattlemanagement.ca for catalogue. Online bidding with DLMS. Carnduff, SK. Call Wes at: 403-862-7578.

JOHNSTON/FERTILE VALLEY Black Angus Bull Sale, Friday, April 11 at 1:00 PM, C.S.T. at Saskatoon Livestock Sales. 90 thick, easy fleshing bulls, sired by the leading AI sires in the industry including: Special Focus, Excitement, Imprint, Consensus, Hoover Dam, EXAR 263C, SAV Mustang, Impression, SAV Brand Name and Stiz Upward. Many of these bulls are suitable for heifers. All bulls are semen tested with complete performance and carcass information available. Deferred payment program with 60% sale day, 40% interest free, due Dec. 01, 2014. Dennis and David Johnston, 306-856-4726, or T Bar C Cattle Co. 306-933-4200. Call for a catalogue or view on our website at: www.johnstonfertilevalley.com ISLA BANK ANGUS CONSIGNING TO Ward’s Red Angus and Guests Bull Sale, Sat. March 1, 2:00 PM, Saskatoon Livestock Sales. Selling 50 pasture two year olds, super long yearlings and top cut yearlings. As well as 50 open commercial heifers. Wintering and volume discounts available. For a catalogue or info. contact Iain 306-280-4840 or T Bar C Cattle Co 306-220-5006. View the Catalogue online at www.buyagro.com PL #116061.

TWO PUREBRED BLACK Angus cows, (no BLACK AND RED ANGUS bulls on moderate papers), $1400 each; 3 year old registered growing ration, performance information avail. Adrian or Brian Edwards, Valleyhills cow, $1500. 306-852-8720, Tisdale, SK. Angus, Glaslyn, SK., 306-342-4407. BLACK ANGUS BULLS, two year olds, semen tested, guaranteed breeders, delivery SELLING: BLACK ANGUS bulls. Wayside available. 306-287-3900, 306-287-8006, Angus, Henry and Bernie Jungwirth, PUREBRED BLACK ANGUS long yearling 306-256-3607, Cudworth, SK. Englefeld, SK. skinnerfarmsangus.com bulls, replacement heifers, AI service. Meadow Ridge Enterprises, 306-373-9140 8th Annual or 306-270-6628, Saskatoon, SK.

100% “Forage-Developed” BULL SALE

February 13th

2:00 pm Stettler Auction Mart Stettler, AB

Starhuixin. Robot bull. 2008. Panoramio, Changning, Shanghai. 4 Dec 2012. <www.panoramio.com>

Canada’s Largest Offering of 100% “ForageDeveloped” 2 Yr. Old Bulls Angus & Red Angus

ENGINEERED TO BREED COWS & BUILT TO LAST

 Developed exclusively on grass and hay  Predictable grass-based maternal Angus genetics  2 Yr. Old bulls born in 1st & 2nd calving cycle  Will continue to grow & gain weight breeding  More years service on your bull investment  Environmentally sorted to be the right kind of bulls for most commercial cattle operations  64 years & 3 generations of supplying purebred bulls  550 Forage-Developed bulls sold to satisfied customers to-date across Canada indicate versatility, virility, and value! Request or view catalog at: www.chapmancattle.com Silas Chapman (403) 741-2099 | Shane Castle, Castlerock Marketing (306) 741-7485 Auctioneer: Don Raffan (250) 558-6789

90 YEARLING AND 2 year old Red Angus bulls. Guaranteed semen tested and delivered in spring. Bob Jensen 306-967-2770, Leader, SK. 2 YR. OLD RED ANGUS cross Fleckvieh baldy power bulls and light birthweight Red Angus bulls. Perfect for your heifers! Harv Verishine 306-283-4666 Langham SK. DOUBLE BAR D FARMS BEST OF BOTH Worlds Annual Bull and Female Sale, Saturday, February 15 at the farm, 1:00 PM, Grenfell, SK. Offering 200 head of Simmental and Red Angus bulls and females. Ken 306-697-7204, 306-697-2474, Brian 306-451-7205. View catalogue at www.doublebardfarms.com WARD’S RED ANGUS AND GUESTS Bull Sale Sat. March 1, 2:00 PM, Saskatoon Livestock Sales. Selling 50 pasture two year olds, super long yearlings and top cut yearlings. As well as 50 open commercial heifers. Wintering and volume discounts available. For a catalogue or info. contact Clarke 306-931-3824 or T Bar C Cattle Co 306-220-5006. View the Catalogue online at www.buyagro.com PL #116061.

NORDAL LIMOUSIN AND ANGUS Bull Sale, Thursday February 20, 2014. Saskatoon Livestock Sales, Saskatoon, SK. Selling: 50 Red and Black Angus 2 yr.old bulls. Rob Garner, Simpson, SK. 306-946-7946. Catalogue at: nordallimousin.com REGISTERED 2 YEAR OLD BULL. Used sparingly last summer. Sound, quality bull. B-elle Red Angus, 306-845-2557, Turtleford, SK. Email: evandglen@littleloon.ca RARE OFFERING. PACKAGE of 2 bred heifers and 3 open yearling heifers out of our “Lassie” cow family. No other cow has influenced our herd as much as Red KBJ Lassie 836F (daughter of KBJ Round Lassie 18T) $12,999. B-elle Red Angus, 306-845-2557, Turtleford, SK. Email: evandglen@littleloon.ca OVER 20 YEARS of raising and selling sound quality Registered yearling bulls. Natural and AI sires. Calving ease, solid feet, thick hair coats. Vet inspected, semen tested, guaranteed breeders. B-elle Red Angus. Glen and Evelyn Bloom, 306-845-2557, Turtleford, SK. Email: evandglen@littleloon.ca

CHAROLAIS BULLS for sale, yearlings SASKATOON GELBVIEH BULL And Feand 2 year olds. Wintering available. male Sale: March 22, 2014, Saskatoon, 780-582-2254, Forestburg, AB. S K . To r e q u e s t a c a t a l o g u e c a l l 306-865-2929, www.gelbviehworld.com BECK McCOY BULL SALE, Sat., Feb. 22, 2014 at 1 PM, Optimum Genetics, Regina, SK. 100 CHAROLAIS, HEREFORD and G E L B V I E H B U L L S o n o f fe r. Wa d e 306-436-4564 or Chad 306-436-2086. Catalogue online at www.mccoycattle.com

RAWES RANCHES LTD. 31st Annual Performance Tested Charolais Bull Sale, Tuesday, Feb. 18, 2014, 1:00 PM at the ranch, Strome, AB. On offer: 132 two year olds. Calving ease, performance, longevity. All built into one superior package! Bull videos and catalogue online at: www.rawesranches.com Call Philip at 780-376-2241 for more info. YEARLING AND 2 year old Charolais bulls. Creedence Charolais Ranch, Ervin Zayak, 780-741-3868, 780-853-0708, Derwent AB

RANCH READY BULL SALE on March 20, 1:00 PM, Heartland, Swift Current, SK. 30 soggy, stout, Hereford bulls from Braun Ranch and 23 Elite 2 yr. old Angus bulls from Bar CR Angus. Catalogue online at www.braunranch.com Contact Craig Braun JTA DIAMOND CHAROLAIS BULL SALE at 306-297-2132. week, Monday, March 24th, 1:00 PM on BECK McCOY BULL SALE, Sat., Feb. 22, the farm, to Saturday, March 29th. 23 two 2014 at 1 PM, Optimum Genetics, Regina, year olds; 15 yearlings, reds and whites. SK. 100 CHAROLAIS, HEREFORD and For info call Jerome and Cindy Tremblay, G E L B V I E H B U L L S o n o f fe r. Wa d e Courval, SK., 306-394-4406. 306-436-4564 or Chad 306-436-2086. Catalogue online at www.mccoycattle.com

PALMER CHAROLAIS/ NIELSON LAND and Cattle Co. Black and Red Angus Bull and Heifer Sale, March 3, 2:00 PM at the Palmer Farm, Bladworth, SK. Offering: 43 Two year old and yearling Charolais bulls, most polled, some Red factor; 45 Black and Red Angus yearling bulls; 9 Black and Red PB Angus yearling heifers. Top quality cattle with great pedigrees that will work. Contact Velon Herback at 306-567-7033 or Larry Nielson at 306-734-5145 or By Livestock 306-536-4261. View the catalogue and videos online: www.bylivestock.com HEJ CHAROLAIS BULL SALE, Friday Feb. 28, 1 PM, Innisfail Auction Mart. Offering 60 ranch ready Charolais yearling bulls, red, white, black and tan. Wintering, delivery, sight unseen purchase program available. All bulls vet inspected, semen tested. For catalogues or info. contact the Rasmussens at 403-227-2824 or T Bar C Cattle Co. 306-220-5006. View catalogue online at www.buyagro.com PL #116061. REG. CHAROLAIS BULLS, 2 year olds and yearlings, polled and horned, some red, quiet, hand fed. 40 plus bulls available at the ranch. Call Wilf, Cougar Hill Ranch, 306-728-2800, 306-730-8722, Melville, SK

SQUARE D BULLS for sale: over 60 to choose from, spring and fall yearlings and two year-olds, performance and semen tested, halter broke and quiet, kept until June 1. Delivered. 306-538-4556, Langbank, SK. View videos and pictures at: www.square-dpolledherefords.com YOU ARE INVITED to Carlrams 5th Annual Bull Sale, Friday, Feb. 7th 5 miles North of Cut Knife, SK. Come for dinner. Sales start at 2 PM. 35 Hereford bulls from Carl and Cal Ramsay and Robin and Randy Flicek. Big thick bulls, lots of hair, not over fed and guaranteed. Carl 306-398-7879, R a n dy o r R o b i n 3 0 6 - 8 2 3 - 3 9 1 2 , C a l 306-398-7343. Sale on dlms.ca Catalogues online at: buyagro.com

OPEN HOLSTEIN HEIFERS for sale. Also some short breds available. Please call John at 403-382-1963, Fort Macleod, AB. FRESH AND SPRINGING heifers for sale. Cows and quota needed. We buy all classes of slaughter cattle-beef and dairy. R&F Livestock Inc. Bryce Fisher, Warman, SK. Phone 306-239-2298, cell 306-221-2620.

40 OLDER COWS bred Angus/Shorthorn; 30 2nd/3rd calvers bred Dexter; 25 heifers QUALITY 2 YEAR old and yearling bulls for bred Dexter; Dexter bull and heifer calves. sale. Also open and bred females. Merv 403-845-5763, Rocky Mountain House, AB. Springer, Leslie, SK. 306-272-0144 PUREBRED DEXTER HERD: Selling herd of approx. 20 Dexter cows and heifers. Exposed to Reg. Polled bull, due to calf early spring. Ages range from 1-9 yrs. old. Asking $775 OBO for bred horned; $875 OBO for Polled; 3 year old Reg. polled bull $1800 OBO; 2 non Reg. 2 yr. old polled bulls $1400/ea. OBO. Would consider package deal. 306-287-3181, Watson, SK.

GENUINE GENETICS GALLOWAY Internet Bull Sale, March 6 - 10th, 2014. Contact Russell at 403-749-2780. Visit website: www.bigdealgalloways.com

KENRAY RANCH OPEN HOUSE, Feb. 22 on offer 35 yearling and 5 two year old Red Angus bulls. Sheldon 306-452-7545, Redvers, SK. www.kenrayranch.com MAPLE RIDGE ACRES has yearling purebred Red Angus bulls for sale. AI sires Sakic and Honky Tonk. Les Saunders, DAVIDSON GELBVIEH/ LONESOME DOVE RANCH 25th Anniversary Bull Sale 306-997-4507, Borden, SK. Saturday March 1, 2014 at Our Bull Yards (heated facility), Ponteix, SK. Dinner at 11:00 AM, Sale at 1:00 PM. Selling 85+ CREEK’S EDGE LAND and Cattle Purebred stout, semen and performance tested, Charolais Bulls for sale off farm. Our larg- easy fleshing purebred bulls both Red and est selection yet. 20 two year olds and 40 Black. View the bull sale video at our webyearlings. Thick, hairy, good feet, and sites or for online bidding access, register quiet. Call Stephen 306-279-2033, cell 2 days prior to the sale at www.DLMS.ca 306-279-7709, Yellow Creek, SK. Website Presale viewing all day Friday, Feb. 28th. www.creeksedgecharolais.ca to learn Call us anytime for catalogue or further info Davidson Gelbvieh Vernon and Eileen more about our program. Davidson 306-625-3755, 306-625-7863, 12 REGISTERED CHAROLAIS open heif- 306-625-7864 www.davidsongelbvieh.com ers, sired by a son of JDJ Smokster and by or email davidsongelbvieh@sasktel.net CSS Sir Breadmaker 2W. Call Pruden Lonesome Dove Ranch Ross and Tara Davidson and Family, phone 306-625-3513, Charolais 306-383-2961, Quill Lake, SK. 306-625-7045, 306-625-7345. Website: BECK McCOY BULL SALE, Sat., Feb. 22, www.davidsonlonesomedoveranch.com 2014 at 1 PM, Optimum Genetics, Regina, lonesomedoveranch@sasktel.net SK. 100 CHAROLAIS, HEREFORD and G E L B V I E H B U L L S o n o f fe r. Wa d e TWIN BRIDGE FARMS 3rd Gelbvieh 306-436-4564 or Chad 306-436-2086. Bull and Female Sale, Monday, March Catalogue online at www.mccoycattle.com 17, 2014, 1 PM at the Silver Sage Commu12 REGISTERED WHITE CHAROLAIS nity Corral, Brooks, AB. Selling 40 yearling heifers bred to easy calving Kaboom Son Gelbvieh Bulls and a select group of open Purebred heifers. Red and black genetics for sale. Call 306-492-4634, Dundurn, SK. on offer. Guest Consignors Carlson Cattle REGISTERED POLLED YEARLING bulls, Company and Keriness Cattle Co. For info. performance and semen tested. Guaran- contact: Ron and Carol Birch and family teed breeders. Will keep until May. 403-792-2123 or 403-485-5518 or Don $2200-2500. Charrow Charolais, Marshall, Savage Auctions 403-948-3520. Catalogue SK. 306-387-8011 or 780-872-1966. online at: www.donsavageauctions.com

NORDAL LIMOUSIN AND ANGUS Bull Sale, Thursday February 20, 2014. Saskatoon Livestock Sales, Saskatoon, SK. Selling: 30 Polled Black and Red 2 yr. old Limousin Bulls also 50 Red and Black Angus. Rob Garner, Simpson, SK. 306-946-7946. Catalogue at: nordallimousin.com GOOD SELECTION OF stout red and black bulls w/good dispositions and calving ease. Also good bred heifers. Qually-T Limousin, Rose Valley, SK., 306-322-4755 or 306-322-7554. POLLED RED AND black thick hairy Limous i n b u l l s fo r s a l e . Pay n e L i ve s t o c k 306-825-4056, Lloydminster, SK.

BIG ISLAND LOWLINES Premier Breeder. Selling custom designed packages. Name your price and we will put a package together for you. Fullblood/percentage Lowline, embryos, semen. Black/Red carrier. Darrell 780-486-7553, Edmonton, AB. DISPERSAL: 30 FB Lowline cows, due April 1st, selling w/o papers; Also 13 2013 open Lowline heifers. Circle S Stock Farms, Canwood, SK. 306-468-2820 or 306-468-7720.

CANADIAN MAINE-ANJOU ASSOCIATION. Power, performance and profit. For info on Maine-Anjou genetics. Call 403-291-7077, Calgary, AB., or www.maine-anjou.ca THE BEST SELECTION Of The Real MaineAnjou Bulls, FB sired. Easy calving. Longtime breeder, Gary Graham, Marsden, SK. Ph. 306-823-3432, grahamgs@sasktel.net Visit us at: www.manitoumaineanjou.ca

POLLED SALER BULLS and 20 polled Saler heifers for sale. Harbrad Saler Farms, 306-459-7612, Ogema, SK. POLLED POLLED POLLED- Salers bulls for sale. Call Spruce Grove Salers, Yorkton, SK, 306-782-9554 or 306-621-1060.


THE WESTERN PRODUCER, THURSDAY, FEBRUARY 6, 2014

REG. PB RED or Black Salers bulls, bred heifers and replacement heifers. Elderberry Farm Salers, 306-747-3302 Parkside, SK

5th ANNUAL BATTLE RIVER SHORTHORN BULL & FEMALE SALE, Saturday, March 8th, 2014, Ponoka, AB. Selling a top selection of 2 year old and yearling Shorthorn bulls and a select group of open yearling heifers. For info. contact Ken Hehr 403-783-4350, Kirk Seaborn 403-729-2267 or Don Savage Auctions 403-948-3520. Catalogue www.donsavageauctions.com SHORTHORNS FOR ALL the right reasons. Check out why and who at website www.saskshorthorns.com Secretary 306-577-4664, Carlyle, SK.

12 BRED COMMERCIAL cows, due to calf early spring, bred Black Angus; 306-222-7709, Saskatoon, SK. 12 SELECTED COWS and bred heifers. Club Calf bred females, AI to Leading Club Calf bulls like: Choppin Wood, Ohio Senator, I67, Bodacious and Monoploy Money. Start calving April 1st, $1800. each. Call 780-808-4064, Dewberry, AB. REG. FULLBLOOD BULLS, yearlings and a few 2 year olds. 110-115 lb. birthweight, no creep feed, no silage. Delivery can be arranged. 204-720-3103, Wawanesa, MB. PHESANTDALE CATTLE CO. 10th Annual Bull and Female Sale, Thursday Feb. 27th, 1:00PM at the farm, Balcarres, SK. Offering: 60 head of polled yearling and long yearling Simmental bulls: 10 open Purebred heifers and 12 Simm. cross replacement heifers. For catalogue, DVD or more info. call Lee 306-335-7553 or Lionel 306-335-2828. View catalogue online at: www.bohrson.com

DOUBLE BAR D FARMS BEST OF BOTH Worlds Annual Bull and Female Sale, Saturday, February 15 at the farm, 1:00 PM, Grenfell, SK. Offering 200 head of Simmental and Red Angus bulls and feBENDER SHORTHORNS and Star P Farms males. Ken 306-697-7204, 306-697-2474, will be selling 40 Shorthorn bulls, 2 yr. Brian 306-451-7205. View catalogue at olds and yearlings, also replacement heif- www.doublebardfarms.com ers, Tuesday, March 18, 2014, 1:00PM, at the East Central Bull Power Sale at York- SIMMENTAL BULLS: Red, Black and Full ton, SK., Exhibition Grounds. Internet bid- Blood. 60 bulls for sale by private treaty. ding DLMS: www.dlms.ca Call Ryan Fully guaranteed. A down payment will 306-748-2876 or 306-728-8613, Neudorf, hold your bull for spring delivery. Also 15 SK. Rayleen 306-682-3692, Humboldt, SK. selling in the Southwest Showcase Bull Sale, March 31st. Call Dean, EDN Simmenwebsite: www.bendershorthorns.com tals, 306-662-3941, Maple Creek, SK. SELLING GLENFORD Just Right 4W grand champion at Agribition 2010. Bender Shorthorns 306-748-2876, Neudorf, SK. SOUTH DEVON AND South Devon/ Angus cross bulls. Black and red yearlings and 2 yr olds, $2000-$2800 each. 403-566-2467, ROBB FARMS, HOEGL FARMS Bull Sale, Duchess, AB. dmrranching@gmail.com Thursday, February 20, 2014, 1:00 PM MST, Lloydminster Exhibition Grounds. On offer: 73 red, black, and fullblood quality Simmental bulls. Bulls semen tested, fully SPECKLE PARK AND Polled Hereford yearguaranteed and delivered. For catalogue or ling and two year old bulls, low BW, high more info. call Jay 780-205-0816 or Murry performance, semen tested, delivered. 306-825-5253. Catalogue can be viewed at Johner Stock Farm, David: 306-893-2714, www.buyagro.com or Justin: 306-893-2667, Maidstone, SK. YEARLING BULLS FOR SALE: Reds, Traditionals and Simmental/Red Angus cross. McVicar Stock Farms, Colonsay, SK. 306-255-2799 or 306-255-7551. YEARLING PUREBRED REGISTERED bull 4 month old purebred bull calf. Call 1ST ANNUAL YOUNG GUNS and Guests and Simmental Bull Sale, Feb. 12, 1:00 PM, 306-225-4546, Hague, SK. Wainwright, AB, Equine Centre. Offering 60 Full Fleckvieh and Purebred yearling and 2 year old Simmental bulls. For catalogue or for more info call Winston ALBERTA TEXAS LONGHORN Association F o r d 7 8 0 - 8 4 2 - 9 6 2 3 , G r e g A r n e s o n 780-387-4874, Leduc, AB. For more info. 7 8 0 - 7 5 5 - 2 4 6 8 , M a r k T r a b y s h www.albertatexaslonghorn.com 780-208-2375 or T Bar C Cattle Co. 306-220-5006. View the catalogue online at www.buyagro.com PUREBRED WAGYU AND F1 cattle, bull DIAMOND M RANCH Annual Bull and Fe- prospects. Call 587-877-2649, Red Deer, male Sale, Feb. 9th, 1:30 PM, Estevan, SK. AB. E-mail: aherron@ualberta.ca at the ranch. Offering 50 two year old Simmental, Simmental/Angus Red and Black bulls and 20 Red and Black Commercial open heifers. Call: Jordan 306-421-1915 or 306-634-2971. View catalogue at: www.cattleinmotion.com

SUNNY VALLEY SIMMENTALS 24th Annual Bull and Female Sale, Wed. March 5, 2014, 1:00 PM, Saskatoon Livestock Sales. Offering 45 red, black and fullblood beef bulls and 10 replacement heifers. Wayne 306-544-2651, Tyler 306-544-7633, Hanley, SK. www.sunnyvalleysimmentals.com BONCHUK FARMS ANNUAL Bull Sale ,on February 16th at 1:00PM, Heartland Livestock in Virden, MB. On offer: 70 Reds, Blacks and Fullblood yearling and 2 year old Simmental bulls. For more information call Dave at 204-773-0467. View the catalogue online: www.bonchukfarms.com ERIXON SIMMENTALS BULL and Female Sale, February 26 at Saskatoon Livestock Sales. Dave: 306-270-2893, Clavet, SK. Catalogue at: www.erixonsimmentals.com BROOK’S SIMMENTALS 2014 Polled Policy Private Treaty Bull Sale: Yearling polled full blood bulls, first come first served. Semen tested, fully guaranteed. Delivery available. Catalogue available on-line: brookssimmental.wix.com/polledfullblood Call Konrad 306-845-9434 (cell) or 306-845-2834 (home), Turtleford, SK.

CLASSIFIED ADS 57

NAERIC DRAFT HORSE CLASSIC SALE, approx. 30 yearlings. At the Royal Manitoba Winter Fair, April 5, 2014, Brandon, MB. www.naeric.org 502-245-0425. HORSE AND TACK Sale, Heartland Livestock, Prince Albert, SK. Friday, February 28th. Tack at 5:30PM, horses to follow. Please book tack and horses in advance with Brennin at 306-981-2430. Special pre-sort sheep, lamb and goat sale, 85 BLACK ANGUS cross Simmental heif- February. 28th, 10:30AM. ers, bred to small birthweight Black Angus bulls. All one herdm home raised, herd health program. Calving start date March 20th, for 42 days and bulls polled. TWO REGISTERED BELGIAN herdsires for 780-645-0022, Vilna, AB. sale. Proven pasture breeders. Ph Robert COMPLETE DISPERSAL of 25 Lowline An- 204-821-5011, Birtle, MB. gus cross cows bred Red Angus. Very efficient and hardy cattle. Bull out March 20th. $800-$1100 your pick. Call 306-322-7789, Spalding, SK. MAMMOTH DONKEYS, $500 each. Yearling Jacks and Jennys. Call 204-434-6132, 26 RED ANGUS/SIMMENTAL bred heifers, Steinbach, MB. preg. checked, start calving March 10, bred to Red Angus bull, $1400/ea. Call QUALITY MAMMOTH DONKEYS for sale. 306-752-3862, Melfort, SK. View: www.bigearsdonkeyranch.ca or call 204-535-2141, 204-825-0113, Baldur, MB. BRED COWS BRED Black or Red Angus and Charolais. Pick from 300. Start calving March/April. Cochin, SK., phone 306-386-2213 or 306-386-2490. PLEASURE DRIVING MARE 14.3 HH, RED SIMMENTAL CROSS HEIFERS, sorrel w/star, asking $4000 OBO, or part Bodybuilder bloodlines, bred to 6 Mile trade. 306-643-2117, Rocanville, SK. bulls. Exposed June 1 to August 1st. Home WWW.ELLIOTTCUTTINGHORSES.COM raised. Fir Mountain, SK., phone Kai 35 plus years of training, showing, sales, 306-266-4505 or Kim 306-266-4848. clinics, lessons. Clifford and Sandra Elliott, 100 BRED HEIFERS, bred Red Angus bulls Paynton, SK. Phone 306-895-2107. June 1: 60 Black Angus/Simmental cross; WILL BREAK HORSES to drive. Call or text 40 Charolais/Red Angus, preg checked, 306-814-0014, Preeceville, SK. $1500/ea. Call Gerald at 306-867-7558 or Terry at 306-867-7533, Outlook, SK. BALE SLEIGH FOR feeding round bales with a team, 12V winch, all steel, very well SUPER BRED HEIFERS made. 1 cutter with pole for a team, all painted, seats min. 4 adults. For more info. 200 red angus heifers. Bu lls o u t Ju n e call 306-845-2690, Turtleford, SK. 1 5th pu lle d Au g 1 5th. Bre d re d a n gu s   TRIM BOSS: The Power Hoof Trimmer. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $1,750.00 Take the work out of hoof trimming. Trim 200 black angus heifers. Bu lls o u t Ju n e wall, sole and flare on saddle horses, 1 5th pu lle d Au g 1 5th. Bre d Bla ck a n gu s drafts and minis. Call 780-898-3752, Buck Creek, AB. www.trimboss.ca . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $1,750.00 60 solid yellow heifers. Bu lls o u t Ju n e CERT. EQUINE MASSAGE THERAPIST 1 s t pu lle d Au g 1 0th. Bre d re d  a n gu s offering massage for injury, behavioral . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . $1,800.00 problems and better performance. Call Anna 306-466-2068, Shellbrook, SK. All he ife rs in the fa ll Alve rin P o u r O n , S co u r Gu a rd a n d M U -S E  RAMSAY PONY RIDES have for sale wellbroke kids ponies and saddle horses. All   H e ife rs will we igh 1 050 to 1 200 lb s broke horses sold with a written guaranExcellent condition totalherd health  tee. Also new and used saddles and tack. For pictures go to 306-386-2490, Cochin, SK. w w w. pri m rosel i vestock. com   Ca ll S teve a t 40 3 -3 8 1-3 70 0 o r m o b ile a t 40 3 -3 8 2 -9 9 9 8 WANTED: 100 YEAR old Bear Trap bucking BLACK ANGUS, 2nd time calvers, bred saddle. Call 403-986-3280, or write Box back to Black, calving March and April. Call 6274, Innisfail, AB. T4G 1S9. 204-745-7917, St. Claude, MB. THE VERY FINEST sleighs in Canada await 2 0 0 YO U N G A N G U S b r e d c o w s . your selection. Click on website: www.aloemingauctions.com 306-773-1049, Swift Current, SK.

CATTLE FOR LEASE or for SALE w/calf crop share. Ph/fax 250-630-2524, or write: Box 6214, Fort St John, BC. V1J 4H7 40 HOMEGROWN ANGUS/Char/Gelbvieh cross cows, bred to Angus/Char/Gelbvieh bulls, mostly Angus. You pick 40 from 65, $1250/ea; Or $1400/heifers, $1300/cows. WANTED: HEAVY FARM wagons, boxes preferred and heavy farm bobsleighs. Also 306-692-1296, Moose Jaw, SK. interested in any lighter rigs. Must be top COMPLETE HERD DISPERSAL: 220 bred quality- stored inside. Call Steve at cows and 30 fancy bred heifers. Char/Red 780-466-4418, Edmonton, AB. Angus influence closed herd, hardy and THE LIVERY STABLE, for harness sales and moderate sized. Bred to easy calving Char repairs. Call 306-283-4580, 306-262-4580, and Red Angus bulls, start calving 3rd Hwy #16 Borden Bridge, SK. week of April. Full vaccination program, Ivomeced and preg checked. Approx 85 red mix, 80 tan mix, 35 white and 20 black or gray. Truckloads preferred. Call: 306-728-3488, Melville, SK. or email: SADDLE & HARNESS MAKING SCHOOL Phone: 780-576-2756, Newbrook, AB. zlranch@yourlink.ca www.rodssaddlemakingschool.com COZY CAPS! Ear protection for newborn calves! Ph. 306-577-4664, Carlyle, SK. gerrybettywyatt@gmail.com CULL COWS for slaughter. For BLACK ANGUS/SIMMENTAL cows, bred WANTED: call Kelly at Drake Meat ProcesBlack Angus, due April 1, vaccinated and bookings sors, 306-363-2117, ext. 111, Drake, SK. ivomeced. 306-567-0622, Davidson, SK. SHEEP AND GOAT SALE, Sat., Feb. 15, 1:00 PM, Johnstone Auction Mart, Moose 56TH ANNUAL MEDICINE HAT BULL Jaw. Accepting all classes of sheep and Show and Sale. Show- Tuesday, March goats. Sheep ID tags and pre-booking 18, 5:00 PM, Sale- Wednesday, March 19, mandatory. www.johnstoneauction.ca 1:00 PM. 133 Hereford polled/horned and 306-693-4715, Moose Jaw SK. PL#914447 Angus Red/Black bulls on offer. For more info call 403-834-2632. Bid online at DLMS or view pictures online at www.medicinehatbullsale.com 12 NORTH COUNTRY Cheviot ewe lambs 80 SIMMENTAL and Simmental Red Angus and 5 Suffolk ewe lambs. To lamb mid cross, start calving March 1, bred Simm. or April. 306-648-3568, Gravelbourg, SK. Red Angus. Will keep until February 15. C A N A D I A N C O - O P E R AT I V E W O O L Call 306-762-4723, Odessa, SK. Growers, buying wool. For nearest wool 500 QUALITY ANGUS cross ranch heifers collection depot or livestock supplies catato mature cows w/calves. Pick up starting logue, 1-800-567-3693, www.wool.ca April 1st as they calve on ranch SE of SUNGOLD SPECIALTY MEATS. We want Strathmore, AB. On full health program. your lambs. Have you got finished (fat) Bulls also available. Call 403-308-4200. lambs or feeder lambs for sale? Call BRED COWS/HEIFERS, Simmental Angus Dwayne at: 403-894-4388 or Cathy at: cross. Bred to calve from March 10 to May 1-800-363-6602 for terms and pricing. 10, preg checked, vaccinations up to date. www.sungoldmeats.com 35 HD first calvers. Stan 204-855-2810 or Cameron 204-855-2069, Oak Lake, MB. 50 ANGUS CROSS cows, bred Angus, calve April and May, $1400/ea. 306-845-2624, Spruce Lake, SK. GOOD BRED SIMMENTAL cross cows for sale. Call 306-984-4606, Leoville, SK.

160 BLACK ANGUS bred heifers, 40 second calvers, full vaccinations, $1500/ea. for ASHWORTH FARM AND RANCH 11th all. 204-385-3646, Austin, MB. Annual Bull Sale, Monday, March 3rd, 1 PM 20 BRED COWS for sale, start calving end at the farm. 8 miles south of Oungre, SK. o f M a r c h . C a l l 3 0 6 - 2 9 1 - 9 3 9 5 o r Hwy. #35, 2-1/2 miles east. Offering 65 306-283-4747, Langham, SK. Red and Black Simmental bulls. For catalogue or more info call Kelly Ashworth MERCER MEADOWS EXPERIENCED 306-456-2749, 306-861-2013 or Bouchard grazing has space available for 1000+ Livestock 403-946-4999. View catalogue yearlings or 500 cow/calf pairs. Call early for particulars and company contract. online at: www.bouchardlivestock.com Ranch at Whitewood, SK., 306-735-2645. 2 YEAR OLD and yearling Red and Black Simmental bulls, moderate birthweights, BRED HEIFERS, black and BWF, and Red good temperaments. All bulls sold by pri- Angus cross heifers, bred Black Angus, due vat e t r e at y. B i l l o r V i r g i n i a Pe t e r s Apr. 1st calving. 306-493-2969, Delisle, SK 306-237-9506, Perdue, SK. SELLING GOOD REPLACEMENT quality SIMMENTAL BULLS: BLACK and Black heifers, Fleckvieh and Red Angus cross, Simm. Angus, registered and guaranteed. also PB Simmentals, 800+ lbs., quiet. Also 3 0 6 - 6 6 2 - 5 0 0 6 , G o l d e n P r a i r i e , S K . 5 yr. old PB Red Angus bull. Curtis Mattson 306-944-4220, Meacham, SK. www.hertersimmentals.com

IF YOU HAVE sheep that need shorn, call Rod or Bryce at 403-579-2520 or 403-863-8937, Byemoor, AB. Will travel. SHEEP DEVELOPMENT BOARD offers extension, marketing services and a full line of sheep and goat supplies. 306-933-5200, Saskatoon, SK.

NORTHFORK- INDUSTRY LEADER for over 15 years, is looking for Elk. “If you have them, we want them.” Make your final call with Northfork for pricing! Guaranteed prompt payment! 514-643-4447, Winnipeg, MB.

WINTER WATERING: FREEZE proof, motion eye, 24”/36” drain back bowl. Call toll free 1-888-731-8882, Lumsden, SK. Or visit: www.kellnsolar.com BALE PICKER, 2 prong, single bale mover, quick and easy, electric over hyd., $2495. Also livestock scales and hopper feeders. 306-445-2111, North Battleford, SK. www.eliasscales.com ALBERTA ELK RANCHERS Production Sale. Live Video Auction- Online bidding available Feb. 14, 2014, 7 PM Nisku Inn, Nisku, AB. Watch www.gwacountry.com for updates and online catalogue or call Gateway Auction Services 1-866-304-4664 ATTENTION ELK PRODUCERS: If you have elk to supply to market give AWAPCO a call today. No marketing fees. Non-members welcome. info@wapitiriver.com or phone 780-980-7589.

MORAND INDUSTRIES Builders of Quality Livestock Equipment, Made with Your Safety in Mind!

1-800-582-4037 www.morandindustries.com HERD DISPERSAL: 26 purebred Alpines. 15 are bred, 1 buck. All CAE and CL free. Great milkers. Would like to sell as one pkg.; Also have PB Nubian bred does and Nubian bucks. 306-365-3211 Humboldt SK GOAT AND SHEEP Sale, Saturday, February 15th, 1:00 PM, Johnstone Auction Mart, Moose Jaw, SK. Accepting all classes of sheep and goats. Sheep ID tags and prebooking mandatory. Call 306-693-4715, www.johnstoneauction.ca PL #914447.

WANTED: 425 LEON manure spreader, must be in good shape. Call 306-386-2490, Cochin, SK. LIVESTOCK EQUIPMENT: Feed alley panels, super size bale feeders, steel frame calf shelters, freestanding panels. Planning something big? Ask about leasing. 306-485-8559, 306-483-2199, Oxbow, SK. ARROW FARMQUIP LIVESTOCK handling solutions: Portable windbreaks. Custom built panels and gates. 1-866-354-7655, www.shadowranch.ca Mossbank, SK. HI-HOG CATTLE SQUEEZE. All steel construction, very good condition. Call 780-208-3344, Innisfree, AB. NH 358 MIXMILL c/w bale feeder, always shedded, low usage, sold livestock, $6800 OBO. Call 403-823-1894, 403-772-2156, Drumheller, AB. HIGHLINE 8000 BALE processor, right hand discharge, big tires, $9500. Call 780-916-2333, Spruce Grove, AB.

YOUNG’S EQ U IPM EN T IN C. FOR ALL YOUR LIVES TOC K FEED IN G , S P R EAD IN G , C H OP P IN G AN D H AN D LIN G N EED S . W E C AR R Y JIFFY, FAR M AID , H AYBUS TER & N D E.

Ca ll K evin o r Ro n

1-8 00-8 03 -8 3 46 w w w .yo u n gs eq u ip m en t.co m

STEEL VIEW MFG: 30’ portable wind breaks, HD self-standing panels, silage/ hay bunks, feeder panels. Quality portable p a n e l s at a f fo r d a b l e p r i c e s . S h a n e 306-493-2300, Delisle, SK. DURATECH, HD-8, JD engine, 239 hrs., new battery, new tires, pulled by a 1/2 ton, trees, pallets, bales, $22,500 (over $80,000 new). 306-526-9382, Regina, SK.

FOR SALE: ROLLER mill, 5 HP electric motor. Phone 306-845-2665, Turtleford, SK. PAYSEN LIVESTOCK EQUIPMENT INC. We manufacture an extensive line of cattle handling and feeding equipment including squeeze chutes, adj. width alleys, crowding tubs, calf tip tables, maternity pens, gates and panels, bale feeders, Bison equipment, Texas gates, steel water troughs, rodeo equipment and garbage incinerators. Distributors for El-Toro electric branders and twine cutters. Our squeeze chutes and headgates are now avail. with a neck extender. Ph. 306-796-4508, email: ple@sasktel.net Web: www.paysen.com 2001 JIFFY 920 bale shredder, electric lifton shield, excellent condition, $8750. 306-473-2711, Willowbunch, SK. FREESTANDING WINDBREAK PANELS, up to 30’ (2-3/8” oilfield pipe); Square bale feeders, any size; Can build other things. Elkhorn, MB. 204-851-6423, leave msg. FROSTFREE NOSEPUMPS: Energy free solution to livestock watering. No power required to heat or pump. Prevents contamination. Grants avail. 1-866-843-6744. www.frostfreenosepumps.com ACORN MANURE PUMP system, minus piston and ram. Call Jim 306-382-2351, Saskatoon, SK. TRAILER TYPE PTO drive hydraulic post pounder, $1750. Phone 306-395-2668 or 306-681-7610, Chaplin, SK. NH 358 MIXMILL w/Forrester auger attachment, not rusted out, excellent shape. 306-291-9395, 306-283-4747 Langham SK FREESTANDING PANELS: 30’ windbreak panels; 6-bar 24’ and 30’ panels; 10’, 20’ and 30’ feed troughs; Bale shredder bunks; Silage bunks; Feeder panels; HD bale feeders; All metal 16’ and 24’ calf shelters. Will custom build. 306-424-2094, Kendal, SK. 2007 HIGHLINE 8000 bale processor, big tires, PTO update, $9500. Take bred heifers on trade. 306-883-2935, Spiritwood SK HARSH 375H SILAGE WAGON, always shedded, rubber and wagon in vg cond. 403-575-0712, 403-577-2243, Consort, AB JIFFY BALE SHREDDER, good condition, $5000. 780-305-3547, Neerlandia, AB. FOR SALE: SLIDE IN 40 bushel hopper fe e d e r fo r p e l l e t s o r g r a i n . P h o n e 403-627-2601, Pincher Creek, AB. Sta tion a ry Cra te

G o v. G ra n ts Ava il.

3 000 lb

ALS O P OR TABLE M OD ELS Pla tfo rm s to fita lley a s w ell.

FEED HOPPER SCALE AQUA THERM A pasture proven trough. Winter water problems? Solved! No electricity required. 3 sizes - 100, 200 and 525 ga l l o n . Ke l l n S o l a r, L u m s d e n , S K . 1-888-731-8882, www.kellnsolar.com 1998 JOHN DEERE 6850 forage harvester, 2287 cutter head hrs., c/w 645A PU header, lots of recent work, $75,000 OBO. Phone 403-994-4041, Three Hills, AB. GREG’S WELDING: Free standing corral panels, windbreak panels, calf shelters, belting troughs, etc. Many different styles to choose from. Call for pricing, delivery available. 306-768-8555, Carrot River, SK. USED JIFFY SLIDE-IN round bale handler, in good condition. Phone 403-627-2601, Pincher Creek, AB.

BUYING WILD BOAR pigs/swine for 20 PORTABLE PANELS 30’ freestanding 3years, all sizes. 1-877-226-1395. Highest bar windbreak frames, 5-bar, 4-bar panels WESTERN HORSE SALES UNLIMITED, $$$. www.canadianheritagemeats.com w/wo double hinge gates and more. On May 2nd and 3rd, Saskatoon, SK. Entry farm welding. Oxbow, SK., 306-485-8559, d e a d l i n e M a r c h 1 s t . F o r m o r e i n fo 306-483-2199. w w w. we s t e r n h o r s e s a l e s . c o m o r c a l l 306-436-4515. BERKSHIRE BOARS AND Gilts; Also Tam- WANTED: NH 358 mixer mill with power sworth. Delivery avail at cost. Troy Collin- bale feeder, in good working order. Phone HORSE SALE, JOHNSTONE Auction Mart, gridge, 204-828-3317, St. Claude, MB. 403-318-8135, Delburne, AB. Moose Jaw, SK, Thurs., Feb. 6, 2014. Tack sells: 2:00 PM, Horses sell: 4:00 PM. All BUYING: PIGS/SWINE, raised outside, all 14’ SUDENGA 3 compartment feed box, classes of horses accepted. 306-693-4715. sizes. Highest $$$. 1-877-226-1395. w/top unloading auger, very good for filling tall bins. 204-871-4365, Oakville, MB. www.canadianheritagemeats.com www.johnstoneauction.ca PL #914447.

Also Truck, Trailer & ATV Mts, ATV

Sa le 5% Off

3000 lb.

Folding Auger

ATV HO P P ER FEED ERS 50/60/100 pa ilca p.

with o rwitho u tsca le

Sa le 5% Off

Hyd /12 V G ea rDrive Fo ld in g Au ger

35-45-85 Bu . A TV, 3 p t hitch, Tru ck , Tra ilerS k id s teer, etc. Va riety ofLives tock S ca les , Cra tes , etc. W ill As s is t W ith S h ippin g

ELIAS S CALE 306- 445 - 2 111

North Ba ttleford , S a s k. W ebsite:w w w.elia s s ca les .com


58 CLASSIFIED ADS

THE WESTERN PRODUCER, THURSDAY, FEBRUARY 6, 2014

FREE STANDING CORRAL panels and WANTED CERTIFIED ORGANIC grass fed windbreak frame for cattle, horse, bison slaughter beef. Peter Lundgard, Nature’s and sheep. Large variety of length, height Way Farm, 780-338-2934, Grimshaw, AB. and bar spacings. Sample price: 21’x6 bar, 5’HLW, $199; 21’x5 bar, 5’H, very sturdy, $239; 24’x5 bar, 5’H, med. duty, $239; 21’x7 bar, 6’H bison, $299; 30’ windbreak frames $399 less boards; New mount to post continuous corral panels, 24’x5 bar, $169. Haysaver horse feeders, feed troughs, bunk feeder panels and RB feeders. Call Jack Taylor 1-866-500-2276. www.affordablebarns.com 2003 REM BALEMAX 3600R bale shredder, used very little, done 800-900 bales, not used last 4 years, sold cattle, $6500 OBO. 306-358-4620, 306-753-7682, Denzil, SK.

REEL AUG G IE TM R FEED M IXERS

A M ixerW a go n w ith In n o va tive R eel a n d Au gerDesign fo ryo u rTo ta l M ixed R a tio n Available at:

N ic k ’s S e rvic e Em era ld P a rk, S K 306- 78 1- 1077

DOUBLE FACED LIGHT up SIGN, 10’Wx6’H with aluminum case and 35’ pole. Offers. 306-446-1398, North Battleford, SK.

PRO-CERT ORGANIC OPTION - 2014. For information on organic farming: prospects, transition, barriers, benefits, certification, and marketing contact one of our agrologists. wallace.hamm@pro-cert.org call 306-382-1299, www.pro-cert.org

PROPERTY WITH TIMBER: Approx. 220 and approx. 100 acres with woodlot opportunity. Small field, year round creek, on paved school bus route, surrounded by mountain lakes for hunting and fishing. Old farm house also available. 1.5 hrs to Kelowna. View: johnidegroot.com listing #10072769 and #10072770. Phone toll free 1-888-299-0592.

COSTA RICA PACIFIC coast beach property, zoned commercial hotel, permits in place to rebuild w/liquor license. For sale/trade. Approx. value, $650,000. Phone: 306-267-4552. GLASLYN POWER & EQUIPMENT Inc: This 10,000 sq. ft. shop can be sold as a turnkey operation, or as an empty building and property at a reduced price. This property and building could be used as a fabrication shop. Part of the inventory is a large lathe plus a milling machine and most in the building stock and office equipment, delivery truck and trailer, Belarus tractor and front end loader. This is a must to see. Lloyd Ledinski, Re/Max of the Battlefords, call: 306-446-8800, or 306-441-0512. MLS® 485161

ACTIVE, SPORTS MINDED Gentleman would like to meet an attractive lady between 30 and 45, NS, who would like to travel this winter and maybe long term. Send photo and phone number. Reply to: Box 2010, c/o The Western Producer, Saskatoon, SK. S7K 2C4 CLASSY, PRETTY, SLIM, WF, 69 wishes to meet gent. 62-74. Attributes: Generous, compassionate, financially secure. My interests: Travel, fishing, animals. Am sin- WARMAN HOMES CUSTOM built commercere, loyal, honest, compassionate. Have 2 cial buildings, to your plan or ours. Call horses, 10 cows. Permanent w/right part- 1-866-933-9595 or www.warmanhomes.ca ner. Horse whisperer would be nice. South or Central AB. Serious replies only w/picture and phone # to: Box 2009, c/o The Western Producer, Saskatoon, SK S7K 2C4 LAC DES ISLES- 5 acre treed lake lot, FEMALE 70, would like to meet male 69-75 $295,000. 2 acre lot, $125,000 near boat for friendship, SE SK. Prefer genuine, launch. Adjacent to Meadow Lake Prov. open-minded guy. eleano.nt@gmail.com Park area. $10,000 down, remainder due Jan 1. 306-373-4808, loiselh@msn.com CEDAR LOG HOMES AND CABINS, sidings, paneling, decking. Fir and Hemlock SINGLE? WINTER IS the perfect time to flooring, timbers, special orders. Rouck fall in love and hibernate with someone! Bros., Lumby, BC. www.rouckbros.com Meet the Matchmaker! In-person inter- 1-800-960-3388. views February 25th to 27th in Regina and Saskatoon. 19 years successful matchmaking. Call to book your appointment: Camelot Introductions, 204-888-1529 HOUSE IN BURSTALL SK. One bedroom main floor, 2 bdrms. up, central air, vinyl www.camelotintroductions.com siding, single garage, big lot. Will sell or PSYCHIC READING by Jessica. Helps in trade for land, equipment or cattle. Call all problems! Immediate results within 12 403-647-7440 or cam@cjbventures.com hrs. Call for free reading, 305-456-9714. HOUSE WAS BUILT during 1920’s, w/additions in 1970’s. Natural gas. Basement is studded and insulated just need some drywall work. House comes w/some furniture as well as stove, fridge, W/D, dish washer, GOPHERS BE GONE! We go for gophers newer flooring and carpets, large bedroom in AB and SK. 3 mature hunters willing to w/lots of closet space, big bathroom, travel and control your gopher problems large kitchen. Nice little house, located at for free. Contact: Peter 780-622-7968, 105 Kerry St., Limerick, SK. Asking Email: 378Blackwood@telus.net $28,500 OBO. Call 306-640-8882.

BEST COOKING PULSES accepting samples of organic and conventional green/yellow peas for 2013/2014 crop year. Matt 306-586-7111, Rowatt, SK LOOKING FOR CERT. organic feed oats and feed barley. Call Bryce at Pristine Prairie Organics 204-522-0842, Pipestone, MB.

)PVYPNPUHS-VVK :JPLUJL*VYW IHZLKPU:HZRH[VVUPZHJ[P]LS` I\`PUN6YNHUPJ-SH_MVY[OL JYVW`LHY

-VYTVYLPUMVYTH[PVU WSLHZLJVU[HJ[:HUK`H[!

     W\YJOHZPUN'IPVYPNPUHSJVT

GOLDEN RETRIEVER PUPS, ready to go. Phone Ed 306-272-3848, leave message if not in. Foam Lake, SK. GERMAN SHEPHERD FEMALES looking for good farm homes, first shots, born Dec. 18th, $300. 306-228-3523, Unity, SK.

306-370-3870 or info@laserconstruction.ca www.laserconstruction.ca

Custom RTM Homes

MARVIN HOMES, BUILDING RTM’S since 1976: 1320 sq.ft., 3 bdrm, $75,000 and a 1520 sq.ft, 3 bdrm., $90,000. Call Marvin Homes 204-326-1493 or 204-355-8484, Steinbach, MB. www.marvinhomes.ca

SILVER RIDGE: 69 acres unique lakefront property perfect for the outdoor enthusiast w/an abundance of wildlife and good MASTER STONE MASONRY. Custom fishing. Louise Blair, Royal LePage Portage fireplaces and stone masonry. Specialize in Realty, 204-857-1822, Woodside, MB. fieldstone and restorations. Willing to travel for work in rural areas. WETT Cert. Inspections. Ph 306-280-1845, Saskatoon, SK. Email: adam_kent@live.com

WARMAN HOMES. LOTS for sale in Langham, SK. or Warman Legends or Southwww.warmanhomes.ca to view or 2- MALE PYRENEES pups, 6 months old, lands. call 1-866-933-9595. $150 each. 306-447-4640, Lake Alma, SK. HOUSE FOR SALE, near Hague. To be TRUE BLUE HEELERS pups off good moved. 985 sq. ft., asking $25,000 OBO. proven working Blue Heeler parents, ready Needs to go. 519-983-2484, Osler, SK. now, $300 w/first shots and dewormed. References avail. Delivery can be arranged. WARMAN HOMES RTM homes ready to 306-492-2447, 306-290-3339, Clavet, SK. go! Mt. Robson, 1443 sq. ft. was Sale price $155,943. Call NON REGISTERED AUSTRALIAN Shepherd $161,715. puppies, 8 weeks, red, black, merle, $250. 1-866-933-9595, www.warmanhomes.ca Call 306-441-2550, North Battleford, SK.

KUVASZ/PYRENEES PUPS, farm raised, born Sept./Oct., 7 males and 5 females. WANTED: BUYING ORGANIC GRAINS. Call 403-502-9470, Medicine Hat, AB. FOB farm or delivered, Loreburn, SK. Call COYOTE OR WOLF problems on your F.W. Cobs Company ph. 1-888-531-4888. farm? Sarplaninac puppies. Strong guardDIVERSIFY WITH QUINOA. Organic con- ing qualities, good work ethics, amazing tracts available. Competitive returns, ex- livestock guardians, exc. personal protecpert resources, guaranteed market. North- tion dogs. Ph 204-638-8854, Dauphin, MB. ern Quinoa, 306-933-9525, Saskatoon, SK. PB AUSTRALIAN SHEPHERD PUPS from working parents, tails docked, ready to go, $300. 780-853-2783, Vermilion, AB. 2- BORDER COLLIE PUPS, 3 months old, from parents working with sheep and cows, $200/ea. 306-854-4713, Elbow, SK.

L IM ITED K A M UT CO N TRA CTS AV A IL A B L E N O W CAL L 1 -30 6-869-2926 w w w .p hso rg a n ics.co m

LASER CONSTRUCTION

RM HAZEL DELL, SK: 160 acres, SE-10-37-09-W2, bush/grassland. Ideal for hunting with cabin. Ph 306-634-5032.

0MPU[LYLZ[LKWSLHZLZLUKHUSI ZHTWSL[V[OLMVSSV^PUNHKKYLZZ!

7SLHZLZ[H[L[OL=HYPL[` 8\HU[P[`MVY:HSL

Visit our homes on site! You order it, we’ll build it.

MESA, ARIZONA- Greenfield Village 55+ RV Resort. For sale oak park model trailer, fully furnished, totally landscaped 40x50’ TO BE MOVED: 1440 sq. ft. bungalow, lot. More info. and website call Howard at very well built, open floor plan, 10’ walls, 306-374-0259, Saskatoon, SK. oak kitchen, make excellent cabin or home. 306-281-8398, Saskatoon, SK. TO BE MOVED: 1963 bungalow with 2 car attached garage, 1300 sq. ft., main floor fully renovated, 2/3 hardwood floor. Selling with stove, fridge, furnace, water treatment system, hot water heater and sewage pump, asking $80,000. Call 306-338-7114, Clair, SK. LAKE HAVASU CITY, AZ. REAL ESTATE! Inexpensive warm winter homes. Dave Chambers, 928-846-1443, Re/Max Prestige Properties, findlakehavasuhomes.com

GOT GRAIN FOR SALE? All organic wheats, durum, feed oats, brown flax and spelt. Call Growers International today 306-652-4529, Saskatoon, SK.

([[U!:HUK`1VSPJVL\Y )PVYPNPUHS-VVK :JPLUJL*VYW 4LS]PSSL:[YLL[ :HZRH[VVU:HZRH[JOL^HU :19

SPECTACULAR RIVERFRONT PropertyKamloops. 124 fenced acres, extensive frontage along the North Thompson river only 7 minutes to shopping and schools in Westsyde. 85 acres of irrigated, fertile land, 25 acres of irrigated pasture. TO BE MOVED: house north of Big River, crop level, white sand beach, treed SK. 2 bdrm, bathroom, laundry, porch and Mostly along the river. Mobile home, hay shed d e c k , $ 8 5 0 0 . S u i t a b l e f o r c a b i n . and corrals. Fenced and cross fenced. Call 306-380-2616, teresnetja@yahoo.ca Julieanne, Best-West Realty- Kamloops, BC. 250-571-0355. ja-brown@shaw.ca WARMAN HOMES RTM homes ready to go! Mt. Blanchard, 1296 sq. ft. was $191,285. Sale price $175,000. Call 1-866-933-9595, www.warmanhomes.ca FARM FOR SALE OR RENT: Bindloss, AB., all in 2-22-W4th. Family farm for 100 WARMAN HOMES RTM homes ready to years. Owner retiring. Located on oiled go! Mt. Vanier, 1680 sq. ft. was $222,083. Hwy. 555 and 15 kms west of Hwy. 41. 19 Sale price $215,363. Call 1-866-933-9595 quarters, approx. 3000 acres deeded in 1 or go to www.warmanhomes.ca block. 3 quarters are native grass and yard. Balance is farmland seeded to tame grass. 2 residences. Central air and heating. 2 garages. Excellent purebred and seed grain operation. 2 large calving WANTED: OLDER MOBILE HOME 12’, 14’, barns. Steel corrals. 3 excellent water or 16’ wide, to be moved, suitable for lake wells. Great hunting and fishing area. Adc o t t a g e . 3 0 6 - 6 2 7 - 3 3 1 2 l e ave m s g . , jacent to large government community 306-648-7516, Swift Current, SK. pasture. 50,000 bu. grain storage. 40x78 heated workshop. 520 acres water rights MEDALLION HOMES 1-800-249-3969 from Red Deer River. 30 acres flood irrigaImmediate delivery: New 16’ and 20’ tion. 3 stock dams. Mineral surface leases. modular homes; Also used 14’ and 16’ Call 403-528-5425, 403-548-1299. homes. Now available: Lake homes. PASTURE FOR SALE, 4 quarters deeded, 3 Medallion Homes, 306-764-2121, Prince leased, Section 16-83-2-W6, NW-, NE- and Albert, SK. SE-17-83-02-W6. Some logging, round-up corrals, hunting, quading, $375,000. CANADIAN BUILT BY Moduline. 20x76’ Te- 780-596-0000, Peace Country, AB. mora, $99,900; 16x76’ Oasis, $79,900; 16x60’ Tuscan, $69,900. Show homes 298 ACRES CULT. farmland 2.5 miles east available for viewing in Yorkton, SK. Call of Tofield, AB. on 626. Good #2 soil, no Stan, 306-496-7538 or 1-888-699-9280. bush, no stones, very flat, annual surface lease revenue $3200. MLS MH0026833 www.affordablehomesales.ca S o u t h l a n d R e a l t y, c a l l L e n R e m p e l 306-741-6358, Medicine Hat, AB. 159 ACRES FARMLAND, 4 miles east of Tofield, AB, along Hwy. 14, good #2 soil, READY TO MOVE HOMES NW15-50-18-W4, 145 acres cultivated. 780-662-2061 or 780-999-6399. Completely customized to your ideas. LOG HOMES, builders of quality handcrafted log and timber frame homes. Call Jeff at 306-493-2448, Saskatoon, SK. www.backcountryloghomes.ca

PROPERTY WITH TIMBER: Approx. 220 and approx. 100 acres with woodlot opportunity. Small field, year round creek, on paved school bus route, surrounded by mountain lakes for hunting and fishing. Old farm house also available. 1.5 hrs to Kelowna. View: johnidegroot.com listing #10072769 and #10072770. Phone toll free 1-888-299-0592.

J& H READ Y-TO -M O V E H O M ES!

SPECIAL PRICING T H E B E L L E VU E

• 1380 sq.ft. • m ain floor laundry • 2 1/ 2 bathroom s • triple pane w indow s • optionaljetted bathtub

W e Ca n Cu stom Bu ild To You r N eeds!

Platinum Service Award TURNKEY LOG FURNITURE BUSINESS. 3000 sq. ft. heated shop w/all tools. 2 homes. On 6 fenced lots. Trailers for hauling logs. 24’ custom built trailer for moving furniture. No shortage of wood or work. Best steelhead fishing in the world. Lots of mountain life, mountains and rivers. Selling for health reasons. Hazelton, BC. 250-842-0005, 250-842-8996.

As k us a b o ut B UIL DER TR EN D BUILDER TREND GIVES YOU A BETTER HOM E BUILDING EX PERIENCE

TO LL FR EE:

J&H H OM ES ... W ES TER N C AN AD A’S M OS T TR US TED R TM H OM E BUILD ER S IN C E 1969

1-877-6 6 5-6 6 6 0

Ca llUs To d a y O rV isitw w w .jhho m es.co m

3 OR 5 QUARTER PRIME GRAINLAND for sale in RM of Excelsior Lake, No. 166. Was owned by a hog farm and hog manure has been applied to the land for many years. Can be purchased in smaller parcels. For land details: www.JustinYin.com or call agent Justin Yin 306-230-1588 info@justinyin.com MLS #484247, Sutton Group Norland Realty Saskatoon, SK. “PIVOT IRRIGATION”: APPROX. 218 acres of grain land. Phone 306-773-7379, John or Joel Cave, Edge Realty Ltd., Swift Current, SK. www.farmsask.com FOR RENT: FOUR 1/4 sections crop land, 524 workable acres. Call 1-855-768-5263, or email: support@rentthisland.com RM OF REFORD: 327 acres, 80 verified to have gravel, possibly more; 188 acres cult. w/60 planted to wheat, remaining cult. acres seeded to tame grass, balance is partly fenced native pasture. 2300 sq. ft. bungalow built 1985. MLS®470122. Call Wally Lorenz, Re/Max of the Battlefords, 306-446-8800, North Battleford, SK. www.remaxbattlefords.com

LAND FOR SALE: RM OF HARRIS, NE 11-32-11-W3, NW 11-32-11-W3. For more info., contact Heather Love at Busse Law Professional Corp. before February 15, 2014. 306-948-3346, Biggar, SK. Email busselaw.ofc@sasktel.net RM OF LOREBURN, SK, taking offers until AGRICULTURAL LAND FOR SALE, 2880 Feb. 28th on Section 21-26-5-W3. Total acres on Hwy. #23, beautiful mountain assesement 307,100. Approx. 635 cult. view, lots of water (3 artesian wells and acres. Phone: 306-867-3716. large creek). Private sale, brokers wel- FA R M L A N D : R M # 2 1 7 , L i p t o n , S K . come. Call Don 403-558-2345, Brant, AB. NW-34-23-13-W2; SW-34-23-13-W2, 308 suzannedepaoli@yahoo.com acres, 260 cultivated (2013). If interested 1/4 SECTION TITLED land, sheltered yard email: 19flanders@gmail.com w/mobile, shop, good corral set up, water FARMLAND FOR SALE: RM of Lajord. well, natural gas, electricity, two dugouts, NE-27-13-18-2 ext 0, NW-27-13-18-2 ext $25,000 of timber, 1539 acres leased graz- 0. January, 2014 possession. Canola stubing land w/$3000. oil revenue. Asking ble, no storage, well farmed, $700,000 $439,000. 780-568-4192 Grand Prairie, AB OBO. Contact 306-536-6611, Regina, SK. 3800 + 14,000 ACRES: Cattle, bison and elk operations, fenced and cross fenced, RM 184: Approx. 160 acres farm land. Wabumun Lake, west of Edmonton, AB. Phone 306-773-7379. John or Joel Cave, Edge Realty Ltd., www.farmsask.com 780-915-1735, roperrealtyltd@aol.com ALBERTA LAND FOR SALE: #2055- Up FARM/RANCH/RECREATION, buying or for bids until March 7, 2014 at 2 PM. selling. Call Tom Neufeld 306-260-7838, Prime Irrigation Land in the heart of Pota- Coldwell Banker ResCom Realty. to Country. 398.44 acres of land with 367.81 acres BRID Water Rights. 17,000 Tim H a m m o n d R ea lty bu. steel grain bins, quonset, 1150 sq. ft. home. Call for a bidding package. K evin Ja r r ett #1975- Rainer: 160 acres irrigated with Selling Farm s & R anches for older pivot, large shop, surface revenue, over 10 years throughout mature yard, lots of trees, currently used Saskatchew an, w ith over as a ranch with seed grass, great soil for row crop, corn, hay or canola, older 1500 30 current listings. sq. ft. home. ID#100116- Taber: ApTo view listing brochures please prox. 320 acres irrigated crop farm with visit: w w w .tim ham m ond.ca extensive set of buildings, feedlot (older), two homes, surface revenue. Cell306.441.4152 ID#100120- Tilley: Approx. 290 acres Cell306.537.8086 irrigated farm land with surface revenue, Fax 306.477.1268 Share sale, SW of Tilley. ID#1100188Em ailkevinjarrett@sasktel.net Bassano: Starter farm, ideal for row crop or alfalfa/Timothy hay. 92.8 acres of land with 53 acres of EID water rights. More FOR SALE BY TENDER: Located RM Excel land available, adjacent parcels have 208 #71. NE-32-8-26-W2, NW-32-8-26-W2. acres of irrigated land. ID#1710- Chin: Prospective purchasers must rely on their Modern 350 sow farrow to finish opera- own research of the property to determine tion, isolated from other hog operations. acreage, condition, improvements, and asNew hog finishing barn, new feed mill, sessment. Highest or any tender not necpermit to expand to 500 sows. 1762 sq. ft. essarily accepted. Please submit certified home and shop. Livestock included, loose cheque for 5% of bid with tender, payable housing sows, electronic feed system. to Lewans & Ford In Trust, Barristers & SoReal Estate Centre 1-866-345-3414 licitors, Box 759, Assiniboia, SK. S0H 0B0 and clearly mark envelope “Schneikart www.farmrealestate.com Land Tender”. Tenders will close February 5 QUARTERS OF FARMLAND, fenced, 21, 2014 at 2:00 PM. South of Sunset House, AB. Contact FOR SALE OR RENT in RM of Milton #292, 780-524-2578. NE-24-30-28-W3rd, oil revenue $5700; SE-13-30-29-W3rd, chemfallow. RM of Antelope Park #322, SE-7-31-27-W3rd, 120 acres seeded grass, 40 acres native grass; NE-7-31-27-W3rd; NW-8-31-27-W3rd, 10,000 bushel bin included. Offers with or without oil revenue. Highest or any bid not 14 Qu a rters in the Ou tlo o k, S K a rea . necessarily accepted. Mail bids before Feb. Ap p ro x 10 Qu a rters in the E lb o w , S K . 18, 2014 to: Box 67, Marengo, SK. S0L a rea . M o s tly p ivo tirriga tio n . In clu d es 2K0. Phone: 306-460-7898. irriga tio n eq u ip m en ta n d gra in s to ra ge. RM OF 442 Manitou Lake SE-03-46-26-W3 farmland, canola last crop, 145 cultivated P h . H a rry S h e ppa rd a t306-5 30-8035 S utto n G ro up - R e s ults R e a lty, R e gin a , S K. acres. 306-821-7541, Neilburg, SK. h a rry@ s h e ppa rd re a lty.ca FOR SALE OR RENT in RM of Milton 292, w w w .s h e ppa rd re a lty.ca SE-21-30-28-W3, NW-27-30-28-W3. 290 acres cultivated. Gas revenue $4300/year. NW-7-22-26-W4, 30 minutes east of Submit written tenders to PO Box 277, Calgary, AB. 53 acres, located beside hard- Medicine Hat, AB. T1A 7G1. Closing date top, near light industrial, in County of Feb. 15, 2014. Highest or any tender not Wheatland, asking $550,000. Great terms. necessarily accepted. Info. 403-580-1053. Wes 403-936-5572. Prime investment plot beside Agrium Industries. Sale pending. CENTRAL ALBERTA FARMS, acreages, businesses (all sizes). Information avail. RM #217 DYSART, NW33-23-15-W2 and on request! Central Agencies Camrose Ltd. SW33-23-15-W2, 50 minutes from Regina, 4870-51 St., Camrose, AB. 780-672-4491. 4 miles off main hwy, 5 miles from town, 4 FARMLAND FOR SALE in Cypress County. miles from groomed trail. Perfect for Two quarters of cultivated farmland and hunting, quadding and sledding! 320 option for long term lease of adjacent 80 acres consisting of 200+ cultivated acres acres. Includes grain bins and surface w/ older 2 bdrm, fixer upper house, lease on NE quarter, except 11 acre home- w/electrical (vacant for 12 yrs), attached stead subdivision on NE quarter. NE/SE garage, new windows, tinned roof, barn 30-11-07-W4. Call 780-460-0313 for info. and corrals. Purchase as a pkg. or call for Submit written bids to: 206, 51 Inglewood sub-division pkgs. Renter avail. for cultivated acres if needed for 2014. Willing to Drive, St Albert, AB. T8N 4E7. finance. Call 306-726-7761 for more info. Taking offers until March 15th by email: busygs@sasktel.net

IR R IGATE D L AND F OR R E NT

(306)652-5322 2505 Ave. C. N orth, Saskatoon

5 QUARTERS PRIME GRAINLAND for sale in RM of Ponass Lake, No. 367. Highly assessed value with F, G soil classification. For land details visit: www.JustinYin.com or call agent Justin Yin at: 306-230-1588, info@justinyin.com Sutton Group Norland Realty, Saskatoon, SK.

LARGE GRAIN AND cattle property, Exclusive listing; Also a beautiful recreational quarter, borders Clearwater River, West of Red Deer, AB.; Other cattle properties and summer grazing available. Ph. Don Jarrett, Realty Executives Leading, 780-991-1180, Spruce Grove, AB.

TIM HAMMOND REALTY Johnston Farm located by Grenfell, RM #155. 1829 acres cultivated and 635 acres hay as per SAMA. Great livestock operation, corral system, 34x60 barn, excellent water supply. Yard includes 1356 sq. ft. home (1945), 4 beds, 2 baths, asking $3,495,000. MLS#478193. Call G u y S h e p h e rd , 306-434-8857, http://Johnston.FarmsofCanada.com


THE WESTERN PRODUCER, THURSDAY, FEBRUARY 6, 2014

RM of LOREBURN #254: NW35-26-4-W3 2013 assess 76,600; SW6-27-4-W3, 2013 assess 79,900; SE6-27-4-W3, 2013 assess 84,100. All adjacent to Hwy. #44 truck route (Skudesnes Road) SE6 has yardsite w/natural gas. Water line and power available. For more info. contact Ken 250-837-4572 or email kjb01@sasktel.net Taking written offers until Feb. 28th, 2014. Ken and Jan Brown, 1757 Piotrowski Rd, Revelstoke BC V0E 2S1. FARM CHEMICAL/ SEED COMPLAINTS We also specialize in: Crop insurance appeals; Chemical drift; Residual herbicide; Custom operator issues; Equipment malfunction. Qualified Agrologist on staff. Call Back-Track Investigations for assistance regarding compensation, 1-866-882-4779.

RM OF BIGGAR #347, Taking offers until Feb. 20th, 2014. SW-12-36-17-W3rd; 155 cultivated acres. Assessment 101,100. Call Bob 306-658-2042.

IR R IGATE D L AND F OR R E NT 14 Qu a rters in the Ou tlo o k, S K a rea . Ap p ro x 10 Qu a rters in the E lb o w , S K . a rea . M o s tly p ivo tirriga tio n . In clu d es irriga tio n eq u ip m en ta n d gra in s to ra ge.

CLASSIFIED ADS 59

FOR SALE BY TENDER: Located in RM of Waverly #44. NE-7-5-6-W3; SE-7-5-6-W3; SW-7-5-6-W3; NE-6-5-6-W3; SE-6-5-6-W3 Land has 5 dugouts and access to creeks. Prospective purchasers must rely on their own research of the property to determine acreage, condition, improvements, and assessment. Highest or any tender not necessarily accepted. Please submit certified cheque for 5% of bid with tender, payable to Lewans & Ford in Trust, and clearly mark envelope “McCrea Land Tender”. Tenders will close Feb. 7, 2014, 2:00 PM.

FOR CASH RENT by tender in RM Mountain View #318 and RM Winslow #319. P h . H a rry S h e ppa rd a t306-5 30-8035 N E - 1 4 - 3 3 - 1 9 - W 3 ; S W- 3 6 - 3 3 - 1 9 - W 3 ; S utto n G ro up - R e s ults R e a lty, R e gin a , S K. SW-07-33-17-W3; NW-26-32-18-W3; h a rry@ s h e ppa rd re a lty.ca SE-26-32-18-W3. Written offers to Skelton w w w .s h e ppa rd re a lty.ca Turner Mescall Law Office, 314 Main WANTED: GRAIN LAND TO RENT, 25 Street, Box 1120, Rosetown, SK. S0L 2V0. mile radius of Rouleau, SK. Call Fax: 306-882-3969 by 5:00 PM Feb. 17, CASH RENT: RM of Wallace #243, NE 306-776-2600 or kraussacres@sasktel.net and NW-17-27-03-W2, 260 cult. acres, to- 2014. Highest or any tender not necessarital 2014 assess 219,100, 2013 crop- cano- ly accepted. Enquiries call 306-882-4244. la. 306-946-3400, 306-917-7070, Rhein SK L AND F OR S AL E BY TE ND E R SMILEY, SK. RM PRAIRIEDALE #321, RM OF BI G QUI L L N O. 308   farm/ranch/recreation, 152 acres for sale, S E-26-31-18-W 2 close to town on pavement, lots of water, In clu d es 143 cu ltiva ted a cres . oil leases, house and buildings, $250,000. Farm antiques available. 403-986-3280. S W -26-31-18-W 2 In clu d es 146 cu ltiva ted a cres . MINERAL RIGHTS. We will purchase and S E-33-31-18-W 2 or lease your mineral rights. In clu d es 155 cu ltiva ted a cres . 1-877-269-9990. cndfree@telusplanet.net  

W -1/2 o f N W (LS D 12&13) 34-31-18-W 2

In clu d in g 70 cu ltiva ted a cres .

RM OF PRAIRIE ROS E N O. 309 S E-26-32-19-W 2 Ha yla n d

M INERAL RIG HT S NO T INC LUDED.

In teres ted pa rties s ho u ld s u b m it ten d ers ON OR BEFORE FEBRUARY 28 , 2014 Ad d res s ed to : K o ha ly, Ela s h & L u d w ig L a w Firm L L P 1312 - 4th S treet, Es teva n , S K S 4A 0X 2 306 -6 34-36 31 F o r in fo rm a tio n co n ta ctBren d a Reiter a t 78 0-9 9 8 -78 57 Or Neil W a lla ce a t011-31-229 -506 -9 39 All ten d ers s ho u ld b e in w ritin g a n d s ho u ld b e a cco m p a n ied b y a d ep o s ito f10% o f the ten d ered a m o u n tp a ya b le to K o ha ly, E la s h & L u d w ig L a w F irm L L P. in tru s t.  Highestor a ny tend er notnec essa rily a c c ep ted . 

RM LEASK #464, Ranch Property, 4499 acres all connected except one quarter. Approx. 3164 acres cult. tame hay pasture mix. 3 and 4 wire fences with treated posts. 36x51 straight wall shop, with att. 20x36 ranch hand quarters, heated with in-floor nat. gas. Power, sewer, well and lots of in pasture water. Ample bush shelter. Property is mainly stone free. MLS® 468365. For viewing call Lloyd Ledinski, Re/Max of the Battlefords, 306-446-8800, 306-441-0512, North Battleford, SK. GRAINLAND SW24-03-09-W2nd in RM of Estevan. Seven miles west of Estevan, off Hwy. #39, $200,000. 306-634-7949.

RM OF MERVIN 499, quarter of land SE-04-54-21-W3, 155 acres broke. Asking $175,000. 6 miles East of St. Walburg, SK. and 5 miles West of Brightsand Lake. Call Joe Helperl 306-862-6880, 306-862-5127. THREE QUARTERS Jedburgh SK, grid road, 2 fenced, 1 in grass, corrals, shed, good well. Offers. 306-627-3445, Blumenhof, SK

FOR SALE IN RM PRAIRIE ROSE: 150 cultivated acres, NW-31-33-18-W2, near RM 126: Approx 640 acres pasture, full set BHP Potash mine. Assessment at $50,200. of buildings. John or Joel Cave. Edge Real- Easy access off Hwy 6. Make an offer. Call ty Ltd. 306-773-7379, www.farmsask.com 306-287-3785, Watson, SK.

Re s id e n tia l Bu ild in g f or S a le a n d Re m ova l Loc a te d a t N W 21-34-3 W 3M Ap p rox. 7 k m S ou th of Cla ve t Vin ta g e 1920 2½ s torey “ Ea ton ” -s tyle fa rm hou s e. H ou s e con ta in s 4 bd rm , 1 ba th, a p p rox. 1,300 s q u a re feet p er level. For s a le “ a s is ” a n d m u s tbe reloca ted by p u rcha s er. View in g : S a tu rd a y, Febru a ry 8, 2014 from Noon – 4:00 p .m . Dea d lin e for s ig n ed a n d com p leted p a ck a g es w ith d ep os it: 2 p m CS T Febru a ry 28, 2014. To o b ta in a n o ffer pa cka ge plea se con ta ct: Pu rcha s in g S ervices , U n ivers ity of S a s k a tchew a n . 306-966-6704 or p u rcha s in g .s ervices @ u s a s k .ca

S AL E OF F ARM BY TEN DER The follow ing la nd w ill be offered for sa le by tender u nder the direction ofJoel A . H esje, Q .C ., Ba rrister a nd S olicitor:

W

⁄ 2 29-4 2-16 W 2 (RM of Plea s a nt da le N o. 398)

1

N E 29-4 2-16 W 2 (RM of Plea s a ntda le N o. 398) S E 29-4 2-16 W 2 (RM of Plea s a ntda le No. 398) Crow n Lea s e 1.The lands contain aggregate deposits.The vendor m akes no representation as to the quantity or quality ofsuch deposits.Purchaser shallbe responsible for m aking their ow n assessm ent ofthe deposits. 2.A llbids m ust be in w riting and subm itted by registered m ailor delivered personally in a sealed envelope at the address below by 5:00 p.m .on Friday, February 21, 2014. 3.Each bid shallbe accom panied by a certified cheque or solicitor’s trust cheque in the am ount of10% ofthe bid.Ifthe bid is not successful, the deposit w illbe returned to the bidder. 4.W ithin 15 days ofthe opening ofbids, the successfulbidder shallprovide either: (a) the balance ofthe purchase price; or (b) paym ent ofthe sum equalto the difference betw een the balance ofthe purchase price and any m ortgage financing, together w ith an unconditional and unequivocalletter ofcom m itm ent from a recognized financialinstitution to the m ortgagee to finance the successfulbidder’s purchase ofthe land for the price stated in the bid, w ith the m ortgage financing to be advanced w ithin 30 days ofthe opening ofbids. 5.Ifthe successfulbidder does not com plete the purchase on the term s and w ithin the tim e specified, the deposit w illbe forfeited. 6.The land shallbe sold subject only to such taxes as accrue due after D ecem ber 31, 2013. 7.The land m ay be sold as separate parcels. Ifbidding on m ore than one parcel, the bid should specify the am ount bid for each parceland w hether the bid is conditionalupon being successfulon allparcels included in the bid. 8.The highest or any bid m ay not necessarily be accepted. 9.Further inform ation including the fulllegaldescription ofthe land m ay be obtained from : M cKercher L L P 374 -3rd Avenu e S ou th S a ska toon, S K. S 7K 1M 5 A ttention: Joel A . H esje, Q .C . Telephone: (306)653-2000 Fa csim ile: (306)653-2669

FARMLAND FOR SALE BY TENDER. Approx. 157.90 acres located in RM Huron #223, SW-07-22-01-W3, Ext. 0. Bids must include: Full legal name, mailing address and phone number; Purchase price for above land with signature and date; Cert. cheque, money order or bank draft payable to McKercher LLP for 10% of total bidthe Deposit. Send bid in sealed envelope with Deposit addressed to: McKercher LLP, Barristers and Solicitors, 500- 2220 12th Ave., Regina, SK., S4P 0M8. Attn: Ryan O. Malley. All bids must be received no later than 5:00 PM, Friday, February 14, 2014. Highest or any bid not necessarily accepted. If bidder does not complete the sale within 30 days of notification by signing an unconditional Agreement for Sale the Deposit will be forfeited. Seller will deliver clear title to the lands to the successful bidder subject only to existing registrations respecting utility and similar easements. Vendor has entered into a wind power development lease, term 60 years, expiring May 19, 2071, with a right of renewal of 25 years. No development so far. Deposits of unsuccessful bidders will be returned. For info contact: Mr. Ryan Malley 306-565-6500, fax: 306-565-6565, r.malley@mckercher.ca FOR SALE BY TENDER: RM Of Benson #35, NW and NE-21-05-08-W2. All offers to be submitted in writing on or before Monday, March 3, 2014. Highest or any offer not necessarily accepted. Minerals not included. Please forward all bids and enquiries to: McGeough Zepick Law Office, 1222-5th Street, Estevan, SK, S4A 0Z6. 306-634-8822, mzlaw@sasktel.net LAND FOR SALE or RENT in the RM of Emerald #277. Serviced, treed yardsite. N-1/2-NE-30-29-13-W2. Contact Bev Shewchuk at 306-576-2017, Wishart, SK.

TIM HAMMOND REALTY. For Sale by Tender RM 217 Lipton. 6 quarters with 809 cultivated. 2 well treed yard sites, one on t h e S W- 2 1 - 2 3 - 1 3 - W 2 , o n e o n t h e NW-22-23-13-W2, both with power, phone and a total of 4150 bu. grain storage. Total farmland Assessment 487,100 (avg. 79,933/quarter). Tender deadline is 5:00 PM, February 12, 2014. MLS #485201. Call Alex Morrow, 306-434-8780, http://Rumancik.TimHammond.ca 16 QUARTERS GRAINLAND FOR RENT/ Sale, RM of Livingston #331. Can be rented or purchased in smaller parcels. Contact Justin Yin at 306-230-1588, Sutton Group Norland Realty, Saskatoon, SK: Email: info@JustinYin.com For land details visit: www.JustinYin.com WANTED: LAND TO rent and/or buy in the surrounding areas of Moose Jaw, Marquis, Chamberlain and Craik. Ph 306-631-8454.

:$17(' SASKATCHEWAN FARMLAND

7HG&DZNZHOO³Anin Expert the Field

³

S W -34-31-18-W 2

in clu d es a S teel Qu o n s et, 7 W es teel Ro s co Bin s w ith w o o d flo o r, 2 W es teel Ro s co Bin s o n ho p p ers , 1 p a in ted /w eld ed S teel Ho p p er Bin , S m a ll Rigid F ra m e S ho p , electrica l s ervice a n d 130 cu ltiva ted a cres .

SASK. LAND FOR SALE. Rush Lake: Approx. 309.73 acres irrigated land. Valley pivots, natural gas pumping unit, 3 phase power. Located 11 miles east of Swift Current and 5 miles south of Hwy #1 right along Highfield Reservoir. ID#1100191. Regina: 798 acres of very productive farm land. 100 acres summer fallow, 270 acres tame hay, 148 acres tame pasture, 280 acres native pasture. Energy efficient home and outstanding water quality. 66 kms south of Regina, 5 kms off the #6 Hwy. ID#485737. Dinsmore: 8 quarters of prime Sask. land in the RM of Milden. ID#1100169. Maple Creek: 25 acres on a hill beside the highway on the way to the Cypress Hills Interprovincial Park. Bare land perfect for new construction, 2 wells, power and telephone in place, good water. MLS®. ID#479810. Estevan: Crop farm close to town. Large home, second yard, hip roof barn, shop, quonset, prime land, approx. 3178 acres, or ganic status. ID#2064. Real Estate Centre, www.farmrealestate .com or call 1-866-345-3414. RM ROCANVILLE #151: 6 quarters, 856 cultivated acres, SE-19-16-32-W1st, SW-20-16-32-W1st, NE-13-16-33-W1st, NW-13-16-33-W1st, SE-23-16-33-W1st, SW-24-16-33-W1st. Total assessment 486,700. Jason 403-820-0566, Rocanville. LAND AUCTION, WEYBURN, SK. Monday March 17th, 10:30 AM at the Weyburn Travelodge. Seven quarters: All of section 23-9-12-W2nd, South 1/2 of 20-8-12-W2nd and NE-12-8-13-W2nd. This land, composed of Brooking and Amulet clay loam soil, is productive farmland of J and K soil class. The topography is gently sloping and stone quantities are slight. South 1/2 of 20 is located 10 miles East of Weyburn on Hwy 13 and 1/2 mile South. The full section 23 is located 13 miles East of Weyburn and 5-1/2 miles north. NE-12 is 9 miles East of Weyburn and 2 miles South. These parcels have potential for rural residential sub-division and connection to city water supply. Contact Kevin 306-842-1516, Lackey Auctioneers, PL#914582. Detailed info. available at: www.Century21.ca/HomeTown ONLINE LAND AUCTION: NW-35-9-11-W2 quarter in RM of Griffin. Information at paslawskiauctions.ca or 306-722-3752 Griffin/ Fillmore, SK. PL #914816.

A solid understanding of Saskatchewan agricultural business built from years of farming and Ag. Industry involvement. Strong work ethic and exceptional customer service. Database of qualified buyers-both investors and local buyers.

Ted Cawkwell Agriculture Specialist BLUE CHIP REALTY

1-306-327-5148 www.tedcawkwell.com

FARM LAN D FO R REN T RM 331 -N W -23-34-31-W 1 •S W -30-34-30-W 1 •S E-26-35-30-W 1 •S E-22-35-30-W 1 •S W -22-35-30-W 1 •S W -19-35-31-W 1 •S E-19-35-31-W 1 •N W -19-35-31-W 1 •S W -18-35-31-W 1 •S W -16-35-31-W 1 •N W -36-34-32-W 1 •S W -11-35-31-W 1 •N W -2-35-31-W 1 •N E-2-35-31-W 1 •S E-35-34-31-W 1 •N E-26-34-31-W 1 •S W -26-34-31-W 1 •S E-26-34-31-W 1 RM 96 – N E-19-10-11-W 2 •N W -19-10-11-W 2 •S E-19-10-11-W 2 •S W -19-10-11-W 2 •N E-32-10-11-W 2 •S E-32-10-11-W 2 •S W -33-10-11-W 2 •S W -26-10-12-W 2 -C a ll N o rm a n a t3 06 -5 70-195 1 RM 213 – N W -19-23-3-W 2 •N E-19-23-3-W 2 •S E-19-23-3-W 2 • N W -18-23-3-W 2 •S W -18-23-3-W 2 •N W -25-23-4-W 2 •N E-25-23-4-W 2 • S E-25-23-4-W 2 RM 275 – S W -24-28-9-W 2 RM 184 – N E-5-20-4-W 2 RM 335 – N E-35-34-9-W 2 • S E-30-34-8-W 2 • N W -32-34-8-W 2 RM 69 -N W -36-9-21-W 2 •N E-36-9-21-W 2 -C a ll N o rm a n a t3 06 -5 70-195 1 RM 185 – S E-29-19-9-W 2 •N W -28-19-9-W 2 RM 70 – N E-31-08-22-W 2 •N W -31-08-22-W 2 •S W -31-08-22-W 2 C a ll N o rm a n a t3 06 -5 70-195 1 RM 246 – N E-3-26-11-W 2 •N E-23-26-11-W 2 •N W -1-26-10-W 2 •S E-12-26-10-W 2 •S W -12-26-10-W 2

n orm a n l@ m a x crop.ca | 3 06-201-785 8 | 800-610-6128

FARM LAN D FO R S ALE BY TEN D ER: NE 34-26-05 W 2 Exten s ion 1 RM ofO rk n ey No. 244 150 Cu ltiva ted Acres To ta l 8.5 M iles fro m Y o rkto n id ea la crea ge site. C ond itions ofOffer: 1. T en d ers w ill b e a ccep ted u n til 12:00 No o n o n M o n d a y, M a rch 3, 2014. An y o ffer n o treceived b y Ro s o w s ky L a w Office b y this tim e w ill n o tb e p res en ted to the s eller. 2. Bid d ers s ho u ld rely u p o n their p ers o n a l in s p ectio n a n d a s s es s m en t o fthe a cres fo r ea ch p a rcel a s the b a s is fo r their ten d er. 3. Bu yer to p a y 2014 p ro p erty ta xes . 4. Highes to r a n y o ffer n o tn eces s a rily a ccep ted . Accep ta n ce o fa n y ten d er s ha ll b e a tthe s o le d is cretio n o fthe s eller. 5. T en d ers w ill b e fo r ca s h s a le o n ly, a ll ten d ers m u s tb e a cco m p a n ied b y a d ep o s itcheq u e fo r 5% o fthe to ta l ten d er p rice, this w ill fo rm p a rto fa n o n -refu n d a b le d ep o s ito n a n y a ccep ted o ffer. In the even ttha tthe d ep o s itcheq u e b ein g d is ho n o u red then a n y a ccep ted o ffer w ill b eco m e n u ll a n d vo id . 6. GS T is a p p lica b le a n d is the res p o n s ib ility o fthe b u yer. Bu yers regis tered fo r GS T p u rp o s es w ill b e exem p tfro m GS T . 7. All o ffers received a re to b e lefto p en u n til 5:00 PM F rid a y, M a rch 7, 2014. 8. All o ffers received w ill b e a d d res s ed a n d res p o n d ed to (i.e. a ccep ted , rejected , o r co u n tered ). All d ep o s it cheq u es o n u n a ccep ted o ffers / ten d ers w ill b e retu rn ed to the b u yer. 9. L a n d is s o ld o n a n “ a s is ” b a s is , a n d the b u yer a ccep ts a ll res p o n s ib ility fo r the co n d itio n o fthe la n d , a n d w a ives a n y cla im a ga in s tthe s eller rela tin g to the co n d itio n o fthe la n d . 10. All o ffers /in q u ires to b e s u b m itted in w ritin g to : L a n d Ten d er - Ro s o w s k y L a w , Bo x 400 K a m s a ck, S K S 0A 1S 0. F a x # 306-542-4009.

SP E CIAL IZIN G IN F AR M L AN D M a ny fa rm p rop erties For S a le a cros s S K Visit

w w w.s hep p a rd rea lty.ca

to view all ou rcu rren tlistin gs. S u tton G rou p - R esu lts R ealty R egin a, S K .

THIN KIN G O F S ELLIN G? Ha rry Sh eppa rd 306-530-8035 (cell) 306-352-1866 (Office) em ail h a rry@ sh eppa rdrea lty.ca

FARM FOR SALE: Avonlea, SK. 640 acres in one block, 488 acres of cultivated land, 152 acres of pasture w/dugout. 7 grain bins, 3 steel, 2 with hopper bottoms, 4 plywood; 24x40 shop/garage; 32x60 cattle shed; older 2 bdrm, 1-1/2 bath house w/newer shingles, well water system, large yard overlooking scenic valley. Located 2 miles north and 2 miles east of Avonlea, SK., RM of Elmthorpe: Section 36, Twp 12, Range 23-W2, known as Jake Jaschinsky farm. Close to Dunnett Dame Provincial Park and Long Creek Golf Course. Offer to include all land and buildings, bids accepted. Include name, address and phone number. Possession date April 16th, 2014. For info contact L.S. Schikowsky, Lethbridge AB. 403-327-5631.

RM 342, COLONSAY, SK. 1100 acres. Located only a few miles N of Hwy 16 E. N W- a n d S W- 1 9 - 3 5 - 2 7 - W 2 , S e c t i o n 17-35-27-W2, NW-5-35-27-W2. $1900 per acre. All within close proximity. Section 17 presently fenced and seeded to hay. Well and power in yardsite, 8900 bu. storage. All land details available on request. Call RM 45: APPROX. 4160 acre ranch. 2 yard Joanne at 306-255-7602. sites. Full set of buildings. 306-773-7379, DWEIN TRASK REALTY INC. RM of Rudy John or Joel Cave, Edge Realty Ltd., Swift #284, all of Sec-36-30-06-W3, West of Current, SK. www.farmsask.com Hanley, SK. Approx. 590 acres cult., C.I. RM 49: APPROX. 640 acres irrigation and soil, Class L and M, FMV 255,000. Level dry land with buildings. 306-773-7379, and stone-free with renter available, John Cave, Edge Realty Ltd, Swift Current, $785,900. Call Dwein today 306-221-1035. SK. www.farmsask.com WANTED: 200 - 300 head cow/calf ranch R M O F F I L L M O R E # 9 6 . 6 4 0 a c r e s : in SK or BC. Can start with partial purchase SW-9-10-12-W2nd, NE-9-10-12-W2nd, and work with someone wanting to retire. NE-16-10-12-W2nd, SW-23-10-12-W2nd. No agents please. Box 2005, c/o The Western Producer, Saskatoon, SK S7K 2C4 306-722-3525, 306-891-8757 Weyburn SK

Lan d Fo r Sale RM o fRo sthern ,4 m ilesE o fW a ld heim 1. SW -18-4 2-04 -W 3 a ssessed $99,800.00 2. SE-18-4 2-04 -W 3 a ssessed $114,700.00,w ith 5 fla tbottom m eta l bin s (tota l+/-8,500 bu ),m eta lq u on set38’x70’,pow er. Fo r m o re in fo rm a tio n p ho n e: Arlen e K la ssen 3 06 -24 9-125 9 Sen d w ritten o ffersp er p a rcel to : K la ssen La n d c/o D D yn n a La w O ffice 100-10th StE , Prin ce Albert,SK S6V 0H 7 By Feb .24 ,2014 . H ighestor a ny offer notnecessa rily a ccepted.

S AL E OF F ARM BY TEN DER The follow ing la nd, together w ith hou se, ba rn, Q u onset a nd gra in bins w ill be offered for sa le by tender u nder the direction ofJoel A . H esje, Q .C ., Ba rrister a nd S olicitor:

N W 1⁄ 4 2-4 2-15 W 2 (RM of Ba r rierV a lley N o. 397) S ec 3-4 2-15 W 2 (RM of Ba rrierV a lley N o. 397) W 1⁄ 2 10-4 2-15 W 2 (RM of Ba r rierV a lley N o. 397) N W 9-4 2-15 W 2 (RM of Ba rrierV a lley N o. 397) N E 24 -4 1-15 W 2 (RM of Ba rrierV a lley N o. 397) 1.A llbids m ust be in w riting and subm itted by registered m ailor delivered personally in a sealed envelope at the address below by 5:00 p.m .on Friday, February 21, 2014. 2.Each bid shallbe accom panied by a certified cheque or solicitor’s trust cheque in the am ount of10% ofthe bid.Ifthe bid is not successful, the deposit w illbe returned to the bidder. 3.W ithin 15 days ofthe opening ofbids, the successfulbidder shallprovide either: (a) the balance ofthe purchase price; or (b) paym ent ofthe sum equalto the difference betw een the balance ofthe purchase price and any m ortgage financing, together w ith an unconditional and unequivocalletter ofcom m itm ent from a recognized financialinstitution to the m ortgagee to finance the successfulbidder’s purchase ofthe land for the price stated in the bid, w ith the m ortgage financing to be advanced w ithin 30 days ofthe opening ofbids. 4.Ifthe successfulbidder does not com plete the purchase on the term s and w ithin the tim e specified, the deposit w illbe forfeited. 5.The land shallbe sold subject only to such taxes as accrue due after D ecem ber 31, 2013. 6.The land m ay be sold as separate parcels.Ifbidding on m ore than one parcel, the bid should specify the am ount bid for each parceland w hether the bid is conditionalupon being successfulon allparcels included in the bid. 7.The highest or any bid m ay not necessarily be accepted. 8.Further inform ation including the fulllegaldescription ofthe land and description ofthe buildings and im provem ents on the land m ay be obtained from : M cKercher L L P 374 -3rd Avenu e S ou th S a ska toon, S K. S 7K 1M 5 A ttention: Joel A . H esje, Q .C . Telephone: (306)653-2000 Fa csim ile: (306)653-2669


60 CLASSIFIED ADS

THE WESTERN PRODUCER, THURSDAY, FEBRUARY 6, 2014

RM SPIRITWOOD #496 and RM Meeting Lake #466. This amazing 2988 acre ranch does have approx. 802 acres of cult. tame pasture. The balance is natural and bush pasture, mainly fenced with 4 wires, 2 sets of corrals, power, well. Good supply of pasture water. The RM road runs through the centre of the property with pasture on each side and very easy to move cattle. Also an amazing big game hunting area. For info on this EXCL Listing 188, call Lloyd Ledinski. I am in need of grain land in most of my trading areas. Re/Max of the Battlefords, 306-446-8800 or 306-441-0512, North Battleford, SK.

F AR M L AND F OR R E NT # o f QTR S

RM

2 7 20 16 12 10 14 9 13

96 99 184 213 214 224 284 394 520

LAND FOR RENT: RM 99 Caledonia E-1/2-32-11-19-W2, soil Class B, $85/acre Submit bids by February 15, 2014 by fax: 306-775-2045. Inquiries to Don at HCI Ventures Ltd., 306-775-2049. Regina, SK.

Plea se go to our w eb site to view a d d itiona l sm a ller p a rc els of la nd for rent (1 to 3 Qua rters).

FARM LAND W ANTED

F o r m o re in fo rm a tio n p lea s e vis it

w w w .s h e ppa rd re a lty.ca Co n ta ct: H a rry S h e ppa rd S utto n G ro up - R e s ults R e a lty R e gin a , S K E-M a il: s a s kla n d 4re n t@ gm a il.co m Pho n e: 306-352-1866 F a x: 306-352-1816 LAND FOR SALE, RM of Kingsley #124: Written tenders only will be received for SE-26-13-05-W2, 160 cultivated acres (2013 crop was flax); NE-26-13-05-W2, 140 cultivated acres (2013 crop was flax); NW-26-13-05-W2, 126 cultivated acres (2013 crop was oats). Quarter sections will not be sold separately. Submit written tenders to: Randy and Mary Lou Seier, Box 783, Kipling, SK. S0G 2S0. Deadline for tenders February 20th, 2014. Highest or any tender not necessarily accepted. FOR CASH RENT or Sale by tender in RM Rudy #284: SW-31-29-07-W3, Pivot irrigation, approx. 134 acres under pivot, requires maintenance/repair prior to use; NW-30-29-07-W3, approx. 100 cultivated acres; SW-30-29-07-W3, approx 100 cultivated acres. Written offers can be sent to: Skelton Turner Mescall Law Office, 314 Main Street, Box 1120, Rosetown, SK. S0L 2V0. Fax: 306-882-3969 by 5:00 PM February 24, 2014. Highest or any tender not necessarily accepted. Inquiries call 306-882-4244. FOR SALE OR RENT: RM of Milton #292, NW-17-30-27-W3rd; NE-17-30-27-W3rd; SE-17-30-27-W3rd; SW-19-30-27-W3rd, oil revenue $8600; SE-19-30-27-W3rd; NW-30-30-27-W3rd; NE-30-30-27-W3rd; SW-31-30-27-W3rd, oil revenue $2800; NW-24-30-28-W3rd, oil revenue $12,800; NE-23-30-28-W3rd, oil revenue $2600, chemfallow; SE-35-29-27-W3 chemfallow and 60 acres of alfalfa. Offers with or without oil revenue. Highest or any bid not necessarily accepted. Mail bids before Feb. 18, 2014 to: Box 63, Marengo, SK. S0L 2K0. Phone: 306-460-7601. RM 241 CALDER, CATTLE OPERATION by owner. Nine quarters deeded in grass and hay. Full cattle facilities, calving barn, shelters, Morand handling system, etc. Will handle 200 plus cows. 3 bdrm. 1-1/2 storey house, exc. water, $1,100,000. Near Wroxton SK. 306-786-2121, 306-621-8551

N O FEES N O CO M M IS S IO N S

PURCHASING: SINGLE TO LARGE BLOCKS OF LAND. PREM IUM PRICES PAID W ITH QUICK PAYM ENT. FARM AND PASTURE LAND AVAILABLE TO RENT M a n y Referen ces Ava ila b le

SUM M ARY OF SOLD PROPERTIES

Cen tra l...........................19 1 1⁄4’s S o u th...............................75 1⁄4’s S o u th Ea s t.......................40 1⁄4’s S o u th W es t......................6 5 1⁄4’s N o rth..................................6 1⁄4’s N o rth W es t.......................12 1⁄4’s Ea s t..................................51 1⁄4’s

RENT BACK AVAILABLE

Ca ll DOUG

WANTED: LAND TO RENT in RM 261 Chesterfield or neighboring areas. Contact Francis Family Farms, Ryan 403-391-1728, Bill 306-463-9103 or Chris 403-597-0366, Mantario, SK. E-mail: ryan.francisfamilyfarms@outlook.com

3 06 -9 55-226 6 Em a il: s a s kfa rm s @ s h a w .ca

L AN E R EALT Y A f tersuccessf ully prom otin g Sa ska tchew a n f a rm a n d ra n ch propertiesf orover30 yea rsa cross Ca n a d a a n d oversea s, w e ha ve m a n y q ua lif ied b uyers lookin g to reloca te a n d im m ig ra te to Sa ska tchew a n . To inc lud e your propert y f or W int er Show ing s

CA LL US TO DA Y!

L A N E R E A LT Y

Saskatchewan’s Farm & Ranch Specialists™ 18 5 REGISTERED SALES IN 2013

P HO N E: 306 -56 9-3380

W ITH O VE R 30 YE A R S IN TH E BUSIN E SS To view fu ll colorfea tu re s heets fora ll ofou rCURRENT LIS TING S a n d virtu a l tou rs ofs elected p rop erties , vis itou rw ebs ite a t:

www.lanerealty.com

LAND FOR SALE: RM of Eye Hill No. 382, Three quarter sections: NW-30-38-28-W3; SW-30-38-28-W3; SE-05-39-28-W3. Call 306-547-2926 for all inquiries.

200 ACRES OF PASTURE FOR RENT in RM of Ponass Lake No. 367, Quill Lake, SK. Contact Justin Yin 306-230-1588. For land details visit www.JustinYin.com or email: info@justinyin.com Sutton Group Norland RM OF KINDERSLEY: All of Section Realty Saskatoon, SK. 26-30-23-W3rd, total assessment 232,900. Oil revenue approx. $8400 annually, Brad Edgerton 306-463-7357, Edge Realty Ltd. LOCATED NORTH OF TREHERNE, MB. on Assiniboine River, 300 acres cultivated land w/8 tower pivot and buried pipe to LAND FOR SALE: RM of Good Lake #274: river. Christianson Soils Ltd. 204-239-6086 1120 acres, 30 mins. North of Yorkton, SK., $1125/acre, all within close prox- MIXED FARM FOR SALE- retiring, The Pas, MB. Clean, well maintained, all in one imity. Call 306-783-3914 or 306-621-7973 piece, no rocks. 1470 deeded acres, 900 RM WAVERLY #44 and RM Mankota #45, cultivated; 2640 acres long term Crown near McCord, SK. NE-06-04-06-W3rd; rental, 500 cult. acres. 2 houses- 5 bdrm. NE-07-04-06-W3rd; SE-18-04-06-W3rd; house, wheelchair accessible and 1 bdrm. NW-01-04-07-W3rd; SE-03-04-07-W3rd; house. Heated shop, machine shed, hay SW-02-04-07-W3rd; NE-02-04-07-W3rd. shed, pole barn, Hi-Hog chute system, Total assessed value 190,995. Sold as a 40,000+ bu. grain storage, large 30,000 package. Please submit tenders: N. Wiens, sq. ft. insulated tinned barn, machinery Box 45, Halbrite, SK. S0C 1H0. Ph./email and cattle available. Call 204-623-5029. 306-458-2689, nj.wiens@sasktel.net Highest or any tender not necessarily accepted. Tender close February 28, 2014.

16 ,000 a cre s h igh q ua lity gra in la n d Lus e la n d Are a $

3 4,03 5,000 C a ll Jim o r S h e rry to d a y

3 06 -46 3 -6 6 6 7

o r e m a il fo r m o re in fo rm a tio n

re m a xkin de rs le y@ s a s kte l.n e t ®G

ro up W e s tR e a lty Kin d e rs le y, S K

w w w .kin d e rs le yre a le s ta te .co m

L OOK IN G F OR L AN D w /Aggrega te Potentia l In Sa ska tchew a n

Ca ll PO TZU S LTD. Phone: 306-782-74 23 Fa x: 306-786-6909 Em a il: info@ potzu s.com

3 q u a rters fa rm la n d s in RM 317 fors a le

$39 4,0 0 0

5 q u a rters fa rm la n d s in RM 250 fors a le

$69 0 ,0 0 0

P lea s e ca ll 306- 5 01- 9368 or em a il:ka thleen.y@rem yy.com RM 139: 6720 acre ranch, good set of buildings. Call 306-773-7379, John Cave, Edge Realty Ltd. www.farmsask.com 3 QUARTERS in the RM of Parkdale. 370 acres cultivated, includes 900 sq. ft. home, 14,000 bu. grain storage and 2 small shops. Mike Janostin Realty Executives at: 306-481-5574 or www.mikejanostin.com Email mikejanostin@realtyexecutives.com CROPLAND FOR RENT, RM of Dundurn No. 314, approximately 1840 acres, well maintained, fields close together. Hay and pasture acres also available for rent. Call Lisa for more information 306-261-6260, Saskatoon, SK. FOR RENT: 8 QUARTERS- RM of Kingsley 124. One quarter pasture, approx. 1100 cultivated acres ready for seeding. Contact 306-735-7250, Whitewood, SK. FOR RENT FARMLAND, approx. 100 cult. acres, SW-33-17-17-W2. Located near RM of Edenwold, SK. Info call: 480-998-1924.

FARM PROPERTY FOR Sale By Tender: Sealed tenders in writing for purchase of the property described below will be received by McCulloch Mooney Johnston LLP as follows: Property for sale (owned by Brian Oleson and Joanne Gudmundson): NE-7-10-21-WPM (approx. 136 cult. acres); NW-7-10-21-WPM (approx. 111 cult. acres); SE-7-10-21-WPM (approx. 130 cult. acres); SW-7-10-21-WPM (approx. 156 cult. acres). Conditions of Tender: 1) Interested parties must rely on their own inspection and knowledge of the property. Any specific questions pertaining to the property should be directed to Brian Oleson at 204-996-9899. 2) Tenders must be delivered to McCulloch Mooney Johnston LLP by 2:30PM, February 25, 2014. Please mark on front of envelope “Oleson/Gudmundson Tender”. 3) Tenders must be accompanied by a $10,000 deposit cheque payable to McCulloch Mooney Johnston LLP. Deposit cheques accompanying unacceptable bids will be returned. 4) The highest or any tender will not necessarily be accepted. Terms and Conditions of Sale: 1) The bidder(s) whose tender is accepted will be required to complete an Agreement covering the terms and conditions of the sale. 2) Possession date will be March 15, 2014. 3) The successful bidder(s) will be responsible for all realty taxes following January 1, 2014 (the adjustment date). 4) In addition to the deposit, the balance of the accepted tender must be paid on or before the date of closing or evidence provided that the purchase funds will be available under conditions acceptable to the Vendor. If the balance of the purchase price is not paid by the possession date or under such acceptable conditions, the deposit paid shall be forfeited as liquidated damages and not as a penalty. McCulloch Mooney Johnston LLP, PO Box 450, 175 Broadway Street, Treherne, MB. R0G 2V0. 204-723-2777, Attn: Bob McCulloch FOR SALE BY OWNER: 11,500 acre mixed farm and ranch. Located 50 miles from Ste. Rose du Lac, 7000 acres cleared, 8960 acres fenced, 3000 acres cropland, 4000 acres hay and pasture. 65,000 bu. grain storage. Two modern homes, 1 shop, 1 cattle shelter, 28 pen feedlot, 3 wells, 40 dugouts. Dyck Enterprises Ltd. Contact: Gordon, 204-656-5000, Waterhen, MB.

SA SKA TCHEW A N FA RM LA N D FO R SA LE RURA L M UN IC IPA LITY:R.M . of Perdue N o. 346 Legal Description SW 33-35-10 W 3 SW 34-35-10 W 3

A cres

Cultivated A cres

A ssessm ent

161 152

159 149

43,600 30,200

FARM LAN D FO R S ALE BY TEN D ER: Pa rcel 1: NE 23-32-29 W PM Pa rcel 2: NE 25-33-29 W PM Pa rcel 3: NW 25-33-29 W PM Pa rcel 4: S W 36-33-29 W PM 603 Cu ltiva ted Acres To ta l All lan d in RM ofS w an River#193 C ond itions ofOffer: 1. T en d ers w ill b e a ccep ted o n ly fo r the en tire p a cka ge o fa ll 4 p a rcels . 2. Bu yer to reim b u rs e s eller fo r 2013 fa ll w o rk a n d in p u ts . 3. Bu yer to p a y 2014 p ro p erty ta xes . 4. T en d ers w ill b e a ccep ted u n til 12:00 No o n o n M o n d a y, M a rch 3, 2014. An y o ffer n o treceived b y Ro s o w s ky L a w o ffice b y this tim e w ill n o tb e p res en ted to the s eller. 5. Bid d ers s ho u ld rely u p o n their p ers o n a l in s p ectio n a n d a s s es s m en t o fthe a cres fo r ea ch p a rcel a s the b a s is fo r their ten d er. 6. Highes to r a n y o ffer n o tn eces s a rily a ccep ted . Accep ta n ce o fa n y ten d er s ha ll b e a tthe s o le d is cretio n o fthe s eller. 7. T en d ers w ill b e fo r ca s h s a le o n ly, a ll ten d ers m u s tb e a cco m p a n ied b y a d ep o s itcheq u e fo r 5% o fthe to ta l ten d er p rice, this w ill fo rm p a rto fa n o n -refu n d a b le d ep o s ito n a n y a ccep ted o ffer. In the even ttha tthe d ep o s itcheq u e b ein g d is ho n o u red then a n y a ccep ted o ffer w ill b eco m e n u ll a n d vo id . 8. GS T is a p p lica b le a n d is the res p o n s ib ility o fthe b u yer. Bu yers regis tered fo r GS T p u rp o s es w ill b e exem p tfro m GS T . 9. All o ffers received a re to b e lefto p en u n til 5:00 PM F rid a y, M a rch 7, 2014. 10. All o ffers received w ill b e a d d res s ed a n d res p o n d ed to (i.e. a ccep ted , rejected , o r co u n tered ). All d ep o s it cheq u es o n u n a ccep ted o ffers / ten d ers w ill b e retu rn ed to the b u yer. 11. L a n d is s o ld o n a n “ a s is ” b a s is , a n d the b u yer a ccep ts a ll res p o n s ib ility fo r the co n d itio n o fthe la n d , a n d w a ives a n y cla im a ga in s tthe s eller rela tin g to the co n d itio n o fthe la n d . 12. All o ffers /in q u ires to b e s u b m itted in w ritin g to : L a n d Ten d er - Ro s o w s k y L a w , Bo x 400 K a m s a ck, S K S 0A 1S 0. F a x # 306-542-4009.

306-5 84 -364 0 in fo @ m a xcro p.ca

CALL

PU RCH ASIN G FARM LAN D REN TERS W AN TED w w w .m a xcro p.ca

1. O ffers m ustexclude G ST or any other levies w hich m ay be payable by the purchaser. 2. A certified cheque for 10% ofthe offer m ustaccom pany the O ffer to Purchase (cheques w illbe returned to those w hose offers w ere unsuccessful). 3. A n accepted offer to purchase is subjectto the previous ow ner’s Right ofFirstRefusal,as provided by law . 4. The Corporation is responsible for property taxes to Decem ber 31,2013. 5. The highest,or any,offer to purchase m ay notnecessarily be accepted. 6. O ffers to purchase m ustbe subm itted by February 21,2014,in a sealed envelope. 7. Purchasers m ustrely on their ow n research and inspection ofthe property,w hen preparing an offer. 8. A CS is notresponsible for any errors or om issions in this advertisem ent. 9. O ffers to purchase parts ofthe advertised properties w illbe considered. 10. O ffers to lease the property w illbe considered.Details on this option can be obtained from the contactbelow .H ow ever,offers to purchase w illbe given preference to offers to lease. 11. O ffers should clearly state land description and totaloffer. DirectInquiries and O ffers To: Bob Shoem aker, C redit A dvisor A g riculturalC redit C orp oration ofSaskatchew an (A C S) 3830 Thatcher A venue, Saskatoon, SK S7K 2H 6 Phone:(306) 933-6143 Fax:(306) 933-7330

24.9 ACRES of virgin grassland, ideal for development. 8 minutes north of Dundurn, SK. along Hwy. 11. Call Ed 306-249-1971. 20 ACRE YARD next to 40 hunting Crownland quarters. House, barn with hayloft. Good water. 204-858-2555, Hartney, MB.

2005 YUKON XL Denali, 7 passenger, fully loaded. Please call John at 403-382-1963 Fort Macleod, AB.

2005 MONACO CAYMAN 34PDD, 35’, 5.9 Cummins, 300 HP, 21,500 miles, auto, satellite, air over hyd. brakes, 5.5 KW Onan dsl. gen.- 148 hrs, exc. cond., 2 slides, $85,000. More photos on our website www.can-amtruck.com Can-Am Truck Export Ltd 1-800-938-3323. DL #910420.

2014 TUSCANY 36MQ Class A dsl. pusher 37’.9” long, 360 HP ISB, Cummins turbo dsl. eng., 4 slide-outs, king bed, fireplace, lar ge over-size shower. Stk# 8418. $192,000 CND. Call 1-866-346-3148 or shop online 24/7 at: allandale.com WANTED: TOWABLE RV vehicle, SUV or car. 780-663-2201, Ryley, AB.

2008 DUTCH STAR 4304 Class A diesel pusher, 43’ long, 4 slides, beautiful cabinetry, rear bath and bedroom, washer and dryer, island king bed, mint! Stk# 4416 $188,500. Call 1-866-346-3148 or shop AVAILABLE FOR THE 2014 Season: 12-1/2 online 24/7 at: allandale.com quarters of tame pasture and one quarter farmland for rent near Melville, SK. All quarters are adjoining, individually fenced with good barbed wire and have deep dugouts. Approx 400 - 450 cow/calf capacity. Working corrals and a solar water system are also available. Call 306-728-3488 or email: zlranch@yourlink.ca LOOKING TO RENT pasture for 100 cow/calf pairs, for 2014 grazing season, in South Central Sask area. Ph 306-642-4022 LOOKING FOR PASTURE in Southern Alberta or Southern Sask. Long term or short term. Will pay top dollar for right location. 403-362-0672. PASTURE FOR RENT: For 300 cow/calf pairs or 500 yearlings. 4-wire fence, not grazed for 5 years. Lots of grass, water, good corrals, supervised daily. North of Biggar, SK. Nathan Bugler, 306-937-7445. PASTURE FOR 60 Pair or 100 yearlings. Crossfenced, good water, checked daily. 306-256-7087, Cudworth, SK.

2014 TUSCANY 44MT, Class A diesel pusher, 44’.11” long, 450 HP ISL Cummins turbo diesel engine, 3 slide-outs, full high gloss porcelain throughout. Stk #8214. $294,000. Call 1-866-346-3148 or shop online 24/7 at: allandale.com

WANTED: PASTURE TO RENT in south east Sask. or south west Manitoba. Phone 306-452-7605, Wauchope, SK. MULCHING - TREES, BRUSH, Stumps. Call today 306-933-2950. Visit us at: www.maverickconstruction.ca PASTURE WANTED for at least 300 head, 2014 PALAZZO 33.2 Class A diesel pusher anywhere in Alberta. Phone 780-933-2585. 34’.8” long, 300 HP Cummins ISB dsl. eng., 2 slide-outs, dream booth dinette, sideaisle bathroom with oversized shower Stk# 7962, $154,900. 1-866-346-3148 or WANTED TO PURCHASE FARMLAND shop online 24/7 at: allandale.com with lots of oil wells and battery sites on property. 780-499-2367, Edmonton, AB. WANTED: 1) IRRIGATED or dry land Outlook/ Hanley area. 2). Land in RM of 2003 HARLEY DAVIDSON Ultra Classic AnHoodoo. 3). Bushland. 4) Natural pasture. niversary, mint, has reverse gear, asking Bill Nesteroff 306-497-2668 Re/Max Sas- $12,500. 306-247-4808, Unity, SK. katoon, email: billnesteroff@sasktel.net

CO N DITIO N S: Q u ick Clo su re – N o Co m m issio n

13.58 ACRES, NE/NW-27-28-13-W2, RM 277. 50’x100’ straight wall steel machine shed, overhead dr. House and extra buildings fully wired. Totally surrounded by DU land, $135,000. 306-675-6032, Kelliher, SK

1196 SQ. FT. 3 bdrm. house on 10 acres, 1.6 kms east of Lintlaw, SK. Nat. gas heat, newer shingles, energy efficient furnace, 3/4 finished basement, vinyl siding and large deck, c/w fridge, stove, microwave, W&D. Asking $175,000. 306-327-7433. RM 137. APPROX. 40 acres w/2 houses, quonset, adjoins City of Swift Current on Hwy #4 South. 306-773-7379, John or Joel Cave, Edge Realty Ltd., Swift Current, SK. www.farmsask.com 8.9 ACRES, 1-1/2 storey home handyman special, foundation good, stone veranda, 45x50’ shop w/20x14’ door, well treed, well graveled, no high water issues, Craigmyle, AB. area. 2 miles off #9 Hwy, good neighbours, beautiful setting in the rolling Handhills, 10 minutes to Hanna, 40 from Drumheller. For photos and more info 403-358-8933, nelsontruckandtractor.com APPROX. 12 ACRES on LaSalle River and #3 Hwy. near Sanford, MB. Town water and sewer available. Ideal for large house and large garden. $185,000. Call 204-736-4465 or leave message. VARIOUS SIZES AVAILABLE, West of Saskatoon, SK. Call 306-384-4512, leave a message.


THE WESTERN PRODUCER | WWW.PRODUCER.COM | FEBRUARY 6, 2014

1.888.986.2946 2001 LODE KING FLATDECK

2013 FELLING OTM DECK Deck, Drop Deck, Air Ride suspension, Tridem axle, Steel rims, Wood floor, Winches: 25 3-Bar, Width: 102in, Length: 53ft. Edmonton, AB. Stock #D1043251U

$

$

10,500

2001 LODE KING FLATDECK Deck, Flatdeck, Air Ride suspension, Tandem axle, Steel rims, Alum w/ Nailing Strips floor, Width: 102in, Length: 53ft. Winnipeg, MB. Stock # 4N608125U

12,900

$

37,900

2004 WILSON DWH-500 PACE SETTER Grain, Hopper, Air Ride suspension, Tandem axle, Aluminum rims, 22 king pin, Hoppers: 2 , Width: 96in, Length: 41ft. Prince Albert, SK. Stock #4A238158U

$

2008 GREAT DANE DECK Deck, Flatdeck, Air Ride suspension, Tandem axle, Aluminum rims, Alum w/ 4 Nailing Strips floor, 18 king pin, Winches: 18 Sliding 3-Bar, Width: 102in, Length: 48ft. Winnipeg, MB. Stock #8H709450U

$

19,900

2008 EAST DECK Deck, Drop Deck, Air Ride suspension, Tandem axle, Aluminum rims, 24 king pin, Length: 48ft. Calgary, AB. Stock #V683580

33,900

$

28,900

2009 INTERNATIONAL 9200I 6X4 Tandem Axle Grain Truck, Cummins ISM engine, Eaton Fuller Auto Shift transmission (10 speed), ABS brakes, 412000 km, 12000 lbs front axle capacity, 40000 lbs rear axle capacity, 3-Way rear lockup, A/C, Getting a White Cncade 20 foot grain box. Prince Albert, SK. Stock #V492718

$

Deck, Flatdeck, Air Ride suspension, Tandem axle, Steel rims, Wood floor, Width: 102in, Length: 48ft. Winnipeg, MB. Stock #1A034828U

2009 INTERNATIONAL 8600 4X2 Tandem Axle Grain Truck, Cummins ISM engine (320 HP), Eaton Fuller Ultra Shift transmission (10 speed), Air brakes, 804000 km, 12000 lbs front axle capacity, 40000 lbs rear axle capacity, Diff Lock rear lockup, A/C. Brandon, MB. Stock #V291181

$

79,900

2008 KENWORTH T300 Tandem Axle Grain Truck, Paccar PX8 engine (330 HP), Eaton Fuller transmission (10 speed), Air brakes, 14000 lbs front axle capacity, 46000 lbs rear axle capacity, 3-Way rear lockup, A/C. Winnipeg, MB. Stock #5149-08A

77,900

$

85,000

2009 INTERNATIONAL PROSTAR

2008 KENWORTH T300 Tandem Axle Grain Truck, Cummins engine (300 HP), Allison (Auto) transmission (5 speed), Air brakes, 397890 km, 14000 lbs front axle capacity, 40000 lbs rear axle capacity, Diff Lock rear lockup, A/C, Getting a matching color 20 foot grain box. Saskatoon, SK. Stock #5699-08A

$

Tandem Axle Grain Truck, Cummins ISX engine, Eaton Fuller D/O transmission (13 speed), Air brakes, 825000 km, 12000 lbs front axle capacity, 40000 lbs rear axle capacity, 4-Way rear lockup, A/C, power tailgate, New 20 foot Silage Box. Regina, SK. Stock #V492713

$

77,500

2009 INTERNATIONAL 8600 4X2 Tandem Axle Grain Truck, Cummins ISM engine, Eaton Fuller Ultra Shift transmission (10 speed), Air brakes, 849000 km, 12000 lbs front axle capacity, 40000 lbs rear axle capacity, A/C, new Cancade grain box. Calgary, AB. Stock #V291145

75,000

$

82,500

2009 FREIGHTLINER CASCADIA Tandem Axle Grain Truck, Detroit Diesel engine (475 HP), Eaton Fuller D/O transmission (13 speed), Air brakes, 838000 km, 12000 lbs front axle capacity, 40000 lbs rear axle capacity, 4-Way rear lockup, A/C. Brandon, MB. Stock #7038-09A

$

82,500

2005 INTERNATIONAL 7600 6X4 Tandem Axle Grain Truck, Cummins ISM engine (310 HP), Eaton Fuller transmission (10 speed), Air brakes, 370000 km, 12000 lbs front axle capacity, 40000 lbs rear axle capacity, Diff Lock rear lockup, A/C, getting new grain box. Regina, SK. Stock #0047-05A

$

69,900

2009 FREIGHTLINER CASCADIA Tandem Axle Grain Truck, Cummins ISX engine (450 HP), Eaton Fuller D/O transmission (13 speed), Air brakes, 1147000 km, 12000 lbs front axle capacity, 40000 lbs rear axle capacity, Diff Lock rear lockup, A/C. Brandon, MB. Stock #8216-07A

$

69,900

61


62

FEBRUARY 6, 2014 | WWW.PRODUCER.COM | THE WESTERN PRODUCER

‘13 BOURGAULT Capstan Nject NH3 MRB, 66’ 3320 & 3” Openers, Dual Castors, ‘12 6550 TBH Variable Rate,

OUR INNOVATION

Deluxe Auger, Bag Lift, Dual Fans, 650 Duals.

350,000

$ ELIMINATE OVERLAPS t SAVE ON INPUT COSTS t GET BETTER YIELDS

YOUR PROFIT

‘12 SEED HAWK 65’ 30.5 Duals on Cart, 6510 & 600 TBT Double Shoot.

267,400

$

‘06 SEED HAWK 10” spacing, w/397 55’ 5510 OnBoard tank, DJ Auto Rate NH3

137,800

$

‘10 BOURGAULT 65’ Front Dual Castors, 3” 3310 & FC 4350 TBT Openers, Flexi-Coil 4350 Variable Rate, 10” Auger, Dual Fans.

189,500

$

TRACTORS ‘12 NH T9.450 .........$235,000 ‘11 CIH 600 Quad .......... SOLD ‘09 NH 9060 ............$235,000 ‘05 CIH STX450 .......$167,400

‘06 SEED HAWK 53’ Dual Fan, Auger, Double 5310 & 397 ONBOARD Shoot. TANK

SOLD

143,800

$

‘10 SEED HAWK 7212 Dual Castors, 30.5L32 & 600 SCT Rear, Seed Hawk 600 Tow Between, Sectional Control, Double Shoot Dry, Dual Fan, Bag Lift, Duals.

272,000

$

Capstan Nject NH3,

‘06 SEED HAWK 6010 2 OnBoard NH3 Tanks, & ‘10 6550 TBH Dual Castors, Variable

‘11 BOURGAULT 65’ Capstan Nject NH3 MRB, 3310 & ‘12 6550 TBH 3” Openers, Dual Castors,

Variable Rate, Deluxe Auger, Bag Lift, Dual Fans, 650 Duals.

305,000

$

‘10 BOURGAULT 65’ Dickey John NH3 MRB, 3310 & ‘12 6550 TBH 3” Openers, Dual Castors, Variable Rate, Deluxe Auger, Bag Lift, Dual Fans, 650 Duals.

285,000

$

‘01 SEED HAWK 60’ Variable Rate, Raven NH3 6010 & BOURGAULT Kit. 5350 TBH

Rate, Deluxe Auger, Bag Lift, Dual Fans, 650 Duals.

177,000

$

93,700

$

‘07 CIH 430 Quad ....$225,000 ’85 Steiger KR1225 ...$31,500

COMBINES ’12 JD S680, JD Pickup Loaded ......................... SOLD ‘11 CIH 9120, Swathmaster PU ...........................$280,600 ‘12 NH CR7090, Only 233 Sep.Hrs ...................$220,500 ’11 CIH 8120, Swathmaster PU ...........................$260,300 ’11 CIH 7088’s, Swathmaster PU ..................From $198,000 CIH 8010’s, c/w Swathmaster PU ...................From $99,300 ‘10 CIH 9120, SwathMaster Pickup ....................$261,700 ’99 MF 8780, Swathmaster PU .............................$64,500

www.mokerthompson.com

Prince Albert: 306-763-6454 | Melfort: 306-752-2273

HUGE IN–HOUSE

e l Sa

NEW LOCATION Across from Emerald Park

FEBRUARY 8th – 23rd

ExtendSehdow

Hours of

-6pm Mon. 9am -6pm Tues. 9am -6pm Wed. 9am -9pm Thurs. 9am pm Fri. 9am-6 pm Sat. 9am-6 m -5p Sun. 12pm

775-1006 | Hwy#1 East, North Service Road |

www.reginamarine.com


THE WESTERN PRODUCER | WWW.PRODUCER.COM | FEBRUARY 6, 2014

2012 JD 9560RT

$

5 scv, 79 gpm pump, PTO, HID lites, front weights, AJ steering hitch, balance of JD link and powergard, 518 hrs.

415,000

2013 CIH STEIGER 500

$

PTO, power shift, large hyd. pump, duals, 686 hrs.

333,900 1997 JD 7410

740 NSL loader w/ grapple, MFWD, 105 hrs.

$

58,000 1994 JD 7700 740 SL loader w/ grapple, MFWD, pps trans., 14,300 hrs.

$

42,800 2013 CASE STEIGER 500 4WD

$

Powershift, 800r38 duals, large hydraulic pump option

322,900

4 WD TRACTORS 2008 JD 9630, 800/70R38 duals, 3570 hrs ......................... $248,000 2013 Case IH 500, powershift, duals, 620 hrs..................... $322,900 2013 Case IH 500, powershift, duals, PTO, 450 hrs ............ $333,900 2008 JD 9330, powershift, 1600 hrs ................................... $215,600 1999 JD 9400, 24 spd, duals, 5237 hrs ............................... $112,000 1997 JD 9400, duals,12 spd std, 6200 hrs .......................... $105,000 1998 JD 9300, duals, 24 spd, 4000 hrs ............................... $108,000 1994 JD 8570, 12 spd, duals, 5550 hrs ................................. $59,900

(AV) (RE) (RE) (OX) (RE) (RA) (AV) (RA)

TRACK TRACTORS 2012 JD 9560RT, pto, fully loaded, AJ hitch, 518 hrs.......... $415,000 2011 JD 9630T, 378 hrs ....................................................... $369,000 2010 JD 9530T, 36” tracks, 1279 hrs .................................. $310,000 2009 JD 9630T, 2014 hrs ..................................................... $314,000 1998 Challenger 75E, 7951 hrs.............................................. $74,500

(AV) (AV) (ES) (ES) (ES)

2 WD - MFWD TRACTORS 2011 NH T5070, cab, mfwd, loader, 880 hrs.......................... $61,500 2010 CIH Puma 165 cab,mfwd, loader, 2303 hrs ................ $105,400 2008 CIH Puma 210 1500 hrs ............................................. $109,000 2006 CIH MXM140, cab, mfwd, loader, 2750 hrs .................. $69,300 2002 CIH MX120, mfwd, loader, 7000 hrs ............................. $52,700 2002 NH TV140 cab, mfwd,loader, 5133 hrs ......................... $56,900 1997 JD 7410, cab, mfwd, loader, 7275 hrs .......................... $58,000 1995 JD 7400, cab, mfwd, loader, 9160 hrs .......................... $53,500

(RE) (ES) (AV) (AV) (RE) (RE) (ES) (RA)

COMBINES 2008-2010 JD 9870STS, 8 units, recent trades ..................................................... CALL OR CHECK WEBSITE 2008-2010 JD 9770STS, 8 units, recent trades ..................................................... CALL OR CHECK WEBSITE 2004-2007 JD 9760STS, 3 units, various hrs & options ................................................... CALL OR CHECK WEBSITE 2002 JD 9750STS, 20.8x38 duals, 3500 hrs .......................... $97,500 2001 JD 9750STS, 800/65R32, 2411 hrs ............................. $102,000 2003 JD 9650STS, 800/32 tires, 1780 hrs ........................... $112,900 2001 JD 9650W, walkers, dlx hdr controls, hopper ext, 3028 hrs .............................................................................. $79,000 1995 JD CTS, chopper, dlx controls, hopper ext, 3558 hrs ... $40,000 2009 CIH 7120, cm, pickup, 484 hrs .................................... $290,000 1998 JD 9610, duals, pickup, 3327 hrs ................................. $63,500 1994 JD 9600, chopper, pickup, 3786 hrs ............................. $50,000

(AV) (AV) (ES) (AV) (AV) (ES) (RA) (RE)

COMBINE PLATFORMS Macdon PW-7 Pickup Headers ................................$19,000-$26,000 2004-2009 JD 635, flex, 8 units, some with air reels ......................................................................$27,000-$44,000 (AV) 2010 JD 640D, 40’ drapers, 3 units ....................................... $66,500 (AV) 2009-2010 JD 635D, 35’ drapers, 3 units.............................. $59,000 (AV) 2005-2008 JD 936D, 36’ draper, 5 units ..................$33,000-$41,000 (ES-RE) 1997 JD 930F, flex platform ................................................... $15,500 (AV) 1997 JD 930F, flex platform, Kehoe air reel ............................ $7,500 (RA) 1994 JD 930F, flex platform ................................................... $10,000 (RA) 1994-1997 JD 930R 30’ rigid, bat & pickup reels available....................................................................... $6,500 & up 1999 Honey Bee SP30, 30’ draper, crop auger, CIH adapter................................................................................ $27,000 (RA) 1999 Honey Bee SP36, 36’ draper, crop auger, transp ......... $29,500 (RE) 2000 Honey Bee SP36, 36’ Gleaner adapter.......................... $28,000 (RA) 2000 Honey Bee SP36, 36’ draper, trans, crop auger ........... $28,000 (AV) 2010 MacDon D60, 45’, transport.......................................... $64,000 (RE) 1996 MacDon 960, 36’ , CIH adapter ..................................... $14,900 (RE) 1991-1998 MacDon 960, 36’, JD adapter ................$12,500-$18,500 (RE,ES) 1996 MacDon 960, 36’, pur,JD adapter ................................. $23,000 (ES) 1998 MacDon 962, 36’, pur,JD adapter ................................. $28,000 (RA) MacDon 960 30’, pickup reel................................................. $14,000 (RA) 2006 MacDon 974, 36’, JD adapter ....................................... $41,900 (AV) 2004 MacDon 974, 30’ flex draper, Case adapter ................. $45,000 (RA)

GRAIN HANDLING EQUIPMENT 2008 Brent 1194 Grain Cart, tandems, scale, tarp................ $49,500 1999 Bourgault 1100 Grain Cart ............................................ $32,000 2013 Brandt 13x40 pto Load Out Auger, mover, never used .................................................................................... $17,600 2007 Brandt 13x90HP Grain Auger ....................................... $18,900 2005 Brandt 13x90XL Grain Auger ........................................ $13,900

(AV) (AV) (AV) (AV) (ES)

2004 Farm King 13x85 Grain Auger ........................................ $9,500 2009 Farm King 13x70 Grain Auger ...................................... $13,000 Farm King 10x70 Grain Auger ................................................. $7,900 2008 Westfield MKP130-111 Grain Auger............................. $16,500 Sakundiak HD10x1800 Mech Swing Auger ............................ $6,500 Several Smaller Load Out Aaugers with movers . WEBSITE OR CALL

(ES) (ES) (ES) (OX) (RA) FRANK TUCHSCHERER 306-869-7889

SPRAYERS 2012 CIH SPX 3330, 100’ ..................................................... $316,500 2005 JD 4720, 2330 hrs ....................................................... $170,000 2008 JD 4830, fully equipped, 1620 hrs .............................. $221,000 2009 JD 4830, 100’ boom, 1450 hrs .................................... $264,000 2010 JD 4930, 896 hrs ......................................................... $295,900 2007 JD 4930 Raven, auto boom, 2001 hrs ........................ $222,900 2002 Spray Air 3400, suspended boom ................................ $18,000 1996 Spray Coupe 3630 80’, 2500 hrs .................................. $32,000 2009 Spray Coupe 7660, 1500 hrs....................................... $144,400

(RE) (RA) (RE) (RA) (RA) (OX) (ES) (ES) (RE)

RICK ARNESON 306-536-7111

MISCELLANEOUS EQUIPMENT 2008 Schulte FLX15 Flex Arm ................................................. $7,500 Degelman 10’ 5700 Dozer, JD 7730 mtg ................................. $8,950 New Valmar 3255 Applicator................................................. $12,500

(RA) (OX) (AV)

JARET NELSON 306-868-7700

HAYING EQUIPMENT 1992-1994 JD 535 Round Balers (2) ...........................$7,500-$9,500 1998-2000 JD 566 Round Balers (5) .......................$11,000-$14,000 2001-2005 JD 567 Round Balers (4) .......................$17,000-$24,000 2007-2009 JD 568 Round Balers (3) .......................$28,500-$34,500 New Holland 1033 HayLiner Stacker....................................... $6,000 2003 New Holland BR780 Round Baler ................................. $12,500 2006 New Holland BR780 Round Baler ................................. $16,900 2005 Vermeer 605 Round Baler............................................. $26,200 1988 Vermeer 605 Round Baler............................................... $4,700 2001 Hesston 1275 16’ Mower Conditioner .......................... $13,200 2002 JD 946 3 pt hitch Mower Conditioner .......................... $18,500 2008 Kuhn KC4000 Disk bine ................................................ $14,900

JEFF ENGLE 306-577-7815

(RA) (RA) (ES) (RA) (RA) (OX) (RE) (OX)

CURTIS KILBACK 306-452-7700

SP WINDROWERS 2012 JD A400, 36’ header, 225 hrs ...................................... $138,000 2012 Westward M155, 35’ header, 280 hrs ......................... $149,900 2011 JD D450, 40’ header, 780 hrs...................................... $161,000 2009 JD 4995, 36’ header, 979 hrs ...................................... $106,000 2009 JD 4895, 36’ Honey Bee header, swath roller, 730 hrs .............................................................................. $115,000 2008 JD 4895, 36’ Honey Bee header, 1311 hrs.................. $100,900 2006 JD 4895, 30’ Honey Bee, 1680 hrs ................................ $84,500 2004 JD 4895, 36’ Honey Bee, 1700 hrs ................................ $76,500 1998 MF 220, 30’ header, 1928 hrs ....................................... $35,000 2009 MF 9430, 30’ header, 1820 hrs ..................................... $81,500 2011 NH H8040, 36’ header 431 hrs .................................... $112,900 2010 MacdDon M100, 30’ header, 352 hrs .......................... $109,800 2002 MacDon 9352, 18’ hay header, 2800 hrs ...................... $59,900 2001 Hesston 8250S, 16’ hay header, 30’ draper header 2500 hrs .............................................................................. $48,000 Several other units .................................................. CHECK WEBSITE

(RE) (RE) (AV) (RE) (AV) (ES) (OX) (RE) (ES) (RA) (RE) (RE) (OX) (RE)

BOB KOSIOR 306-483-8557

ALF TIDE 306-421-9397

CALVIN BILL 306-421-3607

SEEDING EQUIPMENT 90’ SeedMaster TXB-M90 12” spg, double shoot, all run monitors, 550 bus JD 1910 air cart 2013 ........................ $369,000 70’ SeedMaster SXG550, 12” spacing, double shoot, sectional control, 550 bus cart 2012 ............................................... $269,000 60’ JD 1830, 10” spg, 430 & 550 bus tanks, 2008-2013, several units check ............................................ CHECK WEBSITE OR CALL 60’ JD 1820, 2003, 430 bus 1910 cart ................................... $76,900 60’ JD 1820, 10” spg, d/s, arm, stl pkrs, no tank ................. $69,000 60’ JD 1820, 10” spg, ss, arm,rubber pkrs, no tank, 2006 ... $62,000 56’ JD 1870, 2008, 270 bus TBT tank .................................. $136,900 40’ JD 1870, 2011, 430 bus tank ......................................... $165,000 56’ JD 1870, 2012, 430 bus tank ......................................... $221,000 40’ JD 737, 230 bus 787 tank ................................................ $35,000 65’ Bourgault 3310, 10” spg, MRBs, no tank ...................... $203,000 40’ Bourgault FH36-42, 3195 tank ........................................ $22,000 50’ Bourgault 5710, L6350 tank ............................................ $83,250 40’ Bourgault 8800, 3225 tank .............................................. $25,900 Flexi-Coil 3450, 10” spg, TBT tank ........................................ $32,000 45’ Flexi-Coil 5000, 2320 tank ............................................... $55,000 57’ Flexi-Coil 5000, 3450 TBT tank ....................................... $49,000 34’ Flexi-Coil 5000 ............................................................ COMING IN

(AV) (ES) (AV) (AV) (RA) (AV) (RE) (AV) (ES) (RA) (ES) (OX) (RE) (RE) (RA) (RA) (RA) (RE)

DARCY YERGENS ESTEVAN 306-421-9624

RANDY KOSIOR 306-483-8595

MARLYN STEVENS SALES MANAGER 306-868-7755

GOOD DEALS...AND A GOOD DEAL MORE! SERVING SOUTHERN SASKATCHEWAN SINCE 1959

Avonlea, SK — (306) 868-2022 • Radville, SK — (306) 869-3000 Oxbow, SK — (306) 483-5115 • Estevan, SK — (306) 634-6422 Redvers, SK — (306) 452-3418

63


64

FEBRUARY 6, 2014 | WWW.PRODUCER.COM | THE WESTERN PRODUCER

THE ALL-NEW 2013 SUBARU XV CROSSTREK

THE ALL-NEW 2013 WRX & STI

INDULGE IN PURE, UNMITIGATED PERFORMANCE

THE GAME CHANGING COMPACT CROSSOVER! LOW FINANCE RATES FROM .5% OR $2,000 CASH PURCHASE DISCOUNT

LOW FINANCE RATES MSRP FROM FROM .5% OR $4,000 $

24,495*

MSRP FROM $

2013 OUTBACK THE MORE YOU GET OUT, THE BETTER IT GETS!

LOW FINANCE RATES FROM .5% OR $2,500 CASH PURCHASE DISCOUNT

MSRP FROM

28,495

$

*

24,495*

CASH PURCHASE DISCOUNT (WRX), $2,500 (STOI

2013 LEGACY

CONSUMER REPORTS TOP PERFORMING MID SIZE CAR

2013 TRIBECA

SPORTY, PERFORMANCE & LUXURY ALL IN ONE PACKAGE!

LOW FINANCE RATES FROM .5% OR $4,500

LOW FINANCE RATES FROM .5% OR $6,500

CASH PURCHASE DISCOUNT

CASH PURCHASE DISCOUNT

MSRP FROM

23,495

$

*

MSRP FROM

38,495*

$

MANY MORE UNITS IN STOCK... OPEN 24 HOURS AT WWW.SUBARUOFSASKATOON.CA ELITE AUTOMOTIVE GROUP INC. O/A

Open 24 Hours @

www.subaruofsaskatoon.com

SUBARU OF SASKATOON 471 CIRCLE PLACE • 306-665-6898 OR 1-877-373-2662

Open 24 Hours @

www.bramerauto.com

BRAMER AUTOMOTIVE GROUP CORNER OF SARGENT & KING EDWARD • CALL 204-474-1011 • TOLL FREE 1-877-474-1011

READY TO MOVE HOMES

CUSTOM BUILD TO OUR PLAN OR YOUR PLAN Delivering homes ON TIME to happy customers in Sask., Alta., and Man. for over 25 years

JOB 1206 1217 1259 1275 1306 1310 1329 1350 1371 1355 1369 1364 1372 1367 1382 1379 1396 1395 1394 1380

MT. BLANCHARD

,  , Q -Q

 Q -SALE PRICE

Book Now For Delivery Of Your Home in

2014

175,000

$

FOR MORE HOMES AVAILABLE NOW SEE OUR WEBSITE OR CALL FOR DETAILS

HOUSE NAME MT CHAPMAN MT BLANCHARD MT ROBSON MT VANIER MT MICHENER MT FOSTER MT COLUMBIA MT RAE MT FOSTER MT DOUGLAS MT RAE MT ASSINIBOINE MT DOUGLAS MT WHITMORE MT DALHOUSIE MT AVERILL MT AVERILL MT KALLEIGH MT BRETT MT HAYDEN

SQ. FT. 1712 1296 1443 1680 1644 2144 1341 1319 1702 1254 1319 1393 1267 1710 1650 1129 1129 1395 1619 1470

PRICE $189,991 $191,285 $161,715 $222,083 $200,425 $376,264 $152,174 $151,000 $229,528 $142,000 $139,367 $164,432 $140,314 $217,087 $207,516 $125,198 $134,609 $212,911 $208,223 $187,303

WWW.WARMANHOMES.CA

Toll-Free 1-866-933-9595

SASKATCHEWAN

NEW HOME WARRANTY

SALE PRICE $183,143 $175,000 $155,943 $215,363


THE WESTERN PRODUCER | WWW.PRODUCER.COM | FEBRUARY 6, 2014

 Choose New Holland T9 Series 4WD tractors, and not only do you get powerful new engines with EcoBlue™ technology to meet stringent Tier 4A emissions standards, you also get the award-winning Sidewinder™ II armrest, the largest cab in the industry and high-performance choices like optional MegaFlow™ hydraulics.You get the power you need with the comfort you want. BEST-IN-CLASS POWER AND PERFORMANCE INDUSTRY-LEADING HYDRAULIC FLOW AND PERFORMANCE BALANCED CHASSIS DELIVERS MORE POWER TO THE WHEELS INDUSTRY-FIRST COMFORT RIDE™ CAB SUSPENSION OPTION INBOARD PLANETARY DRIVE AXLES FOR ADJUSTABLE WHEEL SETTINGS 2 WIDE FRAME MODELS FOR BROAD ACRE WORK 4 STANDARD FRAME MODELS ARE ROW-CROP READY

YOU’LL BE HARD PRESSED TO FIND 670 HORSES THIS WELL TRAINED S/A Payment

$

7,718 + GST

S/A Payment

$

7,662 + GST

S/A Payment

$

©2012 CNH America LC. New Holland is a registered trademark of CNH America LLC.

17,479 + GST

S/A Payment

$

3,783 + GST

S/A Payment

$

4,665 + GST

2012 NEW HOLLAND T7.170

2013 NEW HOLLAND LM5020

2013 NEW HOLLAND T9.505

2013 NEW HOLLAND L220

2013 HONEY BEE SP36

AutoCommand CVT, suspended front axle, 125 HP, 30 mph road speed, 20.8R38 tires, electronic joystick loader ready, PTO engage on rear fender, suspended cab

85 HP, 71” total width, 3750 lb lift cap. to full height, 5500 lb max cap., 1750 lift cap. at full reach, 19’ max lift height, aux hyd. on boom, air cond., bucket and pallet forks incl in price

Powershift, 800’s, diff lock, 57 gpm pump, HID lights, full Omnistar Intellisteer, demo use 187 hrs

12 spd mech controls, enclosed cab and heater, suspension seat, high flow package, 78” low profile bucket w/bolt on cutting edge

16’ cross auger, hyd header tilt, F/A, CR or CaseIH adapter, transport, UII reel

$

347,500

$

75,000

2012 NEW HOLLAND T9.560

2006 JOHN DEERE 7520

440 HRS, 500 16 SPEED PS TRANSMISSION, 6 HYDRAULIC OUTLETS, LUXURY CAB, ELECTRIC MIRRORS, COLD WEATHER START

5801 HRS, 150 3 POINT HITCH, POWER SHIFT TRANSMISSION, 3 HYDRAULIC OUTLETS, AIR SEAT

$

25,500

$

17,600

1979 FORD FW60

2005 FLEXI-COIL SF115

5405 HRS, 335 NEW STARTER, 5405 HRS, HEAT, AIR, 4 REM, 20 SPD, DUALS

120’ WHEEL BOOM, SINGLE NOZZLE BODIES, END BOOM NOZZLES, AUTOFOLD, RINSE TANK, 1250 GAL

$

6,000

$

36,000

TRACTORS

SEEDING & TILLAGE

2012 NEW HOLLAND T9.670

2008 BOURGAULT 6450

450 HRS, 670 DIFF LOCK, 6 HYD OUTLETS, HIGH CAP DRAW BAR, LUX CAB, MEGA FLOW HYD, MONITOR $ DISPLAY..........................................

3 TANK METERING, STD AUGER WITH LISFELD HOPPER, NH3 LINE, CTM, SINGLE $ FAN, 900 SINGLES ................................

2011 NEW HOLLAND T9050

TRAILING, SINGLE FAN, CTM $ & CRA, RICE TIRES, R.T.H ......................

345,000

1215 HRS, 485 POWERSHIFT / 800 FIRESTONE TIRES, INTELLIVIEW PLUS II WITH OMNISTAR $ UNLOCKED, HID LIGHTING...............

238,000

2011 NEW HOLLAND T9050

FLEXI-COIL 5000

238,000

6000 HRS, 135 3 HYD, POWER GUARD, 3 PT HITCH, DUAL PTO, CAST REAR WHEELS, C/W 741 JD $ LOADER, BUCKET & GRAPPLE ...............

69,000

1996 NEW HOLLAND 9882

5900 HRS, 425 TIRES 710/70R38 INNER & DUALS, PERFORMANCE MONITOR, $ 12 SPD TRANS ................................

103,000

2 TANK, 300 BU, 23.1X26 REAR RICE LUG, 16.5X16.1 LUG FRONT, 6 RUN, IN CAB RATE ADJUST, $33,000 CASH

$

13,300

$

54,000

W/HYD TINE ADJUSTMENT, $ 16.5X16.1 CART TIRES..........................

1999 BRANDT QF2000

195,000 10,000

96,900

1995 BOURGAULT 3195

2003 MORRIS MAXIM II

2012 MORRIS 8370

TRAILING, MECH DRIVE, SINGLE FAN, REAR TOW HITCH

49’, 10 SPACING, LIQUID KIT, 4 STEEL PACKERS, SINGLE SHOOT, C/W 7300 MORRIS TANK

VR TBH TANK, TOPCON EAGLE MONITOR, 3RD TANK, SINGLE 17 FAN, TOW BEHIND, FIELD HITCH

$

24,500 19,500

1995 FLEXI-COIL 5000

39,000

C/W FL SC380 TANK, MIDROW, SINGLE SHOOT, 3 RUB PACK, NH3, $ VARIABLE RATE .....................................

56,000

MISCELLANEOUS

1500 GAL, 90’ BOOM, WINDSCREENS, SINGLE NOZZLE BODIES, WIND CONES, $ FOAM MARKER .....................................

$

55,000

57’, 12 SPACING WITH MID ROW SHANKS, 4 OPENERS/PACKERS, DICKIE JOHN NH3, $ LEAD 3450 TANK ..................................

SPRAYERS 1200 GAL POLY, 100’ TRUSS BOOM, 1 INLINE FILTERS, FENCE ROW NOZZLES, $ FOAM MARKER ...............................

2001 JOHN DEERE 1900

32’ AIR KIT W/ 2130 $ TANK S/N 5030 .....................................

2007 JOHN DEERE 7420

2010 MILLER CONDOR G75

FLEXI-COIL S82

BOURGAULT 8800 2001 FLEXI-COIL S85

5,900

2005 JOHN DEERE TRAIL BUCK 650

2008 HLA 3000 96 HYD ANGLING SNOW BLADE, $ WITH FLIP UP END PLATES..........................

www.farmworld.ca

3,500

CALL!

2005 SUZUKI KINGQUAD 700

SCHULTE BX-62 3PTH SNOWBLOWERS

4100 HRS, GREEN, WINCH, WINDSHIELD, NEW RUBBER @ 3300 KMS

CALL FARM WORLD AT 306-682-9920 ABOUT OUR SPECIAL PRICING!

Paul .................. 306-231-8031 Tyler.................. 306-231-6929 Perry ................. 306-231-3772

25,000

1998 BOURGAULT 5710

1996 BOURGAULT 5710

DOUBLE SHOOT AIR KIT, REAR TOW HITCH, 9.8 SPACING, TANK HAS DUAL FAN, 591 MONITOR, $95,000 IS CASH

54’, SERIES 20 MRBS, RAVEN NH3 KIT, 3/4 CHROME TIPS, 3 RUBBER PACKERS

$

125,500

198,000

$

2010 BOURGAULT 3310 PHD

2012 BOURGAULT 3320QDA

55’, 12 SPACING, DBL WALK CAST, DUAL REAR TIRES, LIQUID KIT, SINGLE SHOOT AIR KIT

SINGLE SHOOT, REAR DUALS, LIQUID KNIFE, LIQUID VR KIT, EDGE ON FRONT KNIFE HOLDER

$

38,500

1999 BOURGAULT 5710 54’, 9.8 SPACING, 3 CARBIDE TIPS, MRBS, UPDATED WIDE PIVOT, $38,500 IS CASH, 330 TRIPS

$

50,000

355,000

$

2011 BOURGAULT 3310 PHD DOUBLE SHOOT, MRB IIS, REAR DUALS, DOUBLE WALKING CASTERS, REAR DROP HITCH

$

56,000

1998 MORRIS MAXIM

2004 MORRIS MAXIM II

60’ DRILL, CARBIDE TIPS, REAR TOW HITCH, SS AIR KIT, COMES WITH MORRIS 6300 TBH CART, $50,000 CASH

60’, 10 SPACING, ATOM JET OPENERS 4, PACKERS, LIQUID KIT, DRILL ONLY

Hwy. #3, Kinistino Hwy. #5, Humboldt Hwy. #2 South, PA 306-864-3667 306-682-9920 306-922-2525 Bill .................... 306-921-7544 David H ............. 306-921-7896 Jim ................... 306-864-8003 Kelly.................. 306-961-4742

$

4,950

FOR MORE PHOTOS AND DETAILED DESCRIPTIONS OF ALL OUR USED EQUIPMENT VISIT

$

95,000

94,000

2005 BOURGAULT 6350

1215 HRS, 485 PWR SHIFT, INTELLIVIEW II PLUS, HID LIGHTS, FULL INTELLISTEER, $ OMNISTAR UNLOCKED ....................

$

Brent................. 306-232-7810 Aaron ................ 306-960-7429

Sprayer Dept., Kinistino David J. ............ 306-864-7603

Check out our website at www.farmworld.ca

65


66

FEBRUARY 6, 2014 | WWW.PRODUCER.COM | THE WESTERN PRODUCER

O R T S A

2006 KENWORTH T800

780-567-4202 Visit our Website: www.astro-sales.com

SALES LTD. CAR & TRUCK

3($&(

Std. , M11 350 Cummins dsl engine, 13 spd, 240â&#x20AC;? WB, c/w 1500PK Palfinger Folding Picker, 20,000lb winch. Stock# L-6718

ONLY 50,000 KM

OVER 400 UNITS TO

CHOOSE FROM &28175< Âś6 CARSâ&#x20AC;˘TRUCKSâ&#x20AC;˘RVSâ&#x20AC;˘TRAILERS LARGEST USED DEALER! 2002 ASPEN TRAILER

Step Deck Tandem Axle Trailer Stock #L-6605

2004 FREIGHTLINER FL60 Diesel Hp Mercedes diesel engine, FL60 Stock# L-6727

2012 JOHN DEERE

Single Drop Tridem Lowboy Stock # L-6604

44 Km Wheel Loader 1800 Hrs.

2008 INTERNATIONAL MXT

2001 JOHN DEERE 330LC

2008 TIFFIN ALLEGRO

W/ Amco Veba Picker & Deck Stock #L-6688

Motorhome 40â&#x20AC;&#x2122; 4 Slides only 20,000 Miles

2008 GENIE

2008 KOUNTRY STAR 3912

DRUM 2002 EENER SCR

330 HP engine and sits on a Freightliner chassis, 41â&#x20AC;&#x2122; Motorhome, Triple slides, Corian countertops, Tile Floors. Very clean unit. Stock#L-6636A

2006 FREIGHTLINER COLUMBIA

2004 ALFA SEE YA GOLD

Diesel, 2 Door, Standard Stock# L-6802

2 Slides. 42,000 miles 400 HP Engine.

2006 GENIE GT-2666

1998 SAMSUNG SL180 LOADER

Truss boom, low hrs

2008 INTERNATIONAL FLAT DECK TRUCK Stock# L-982

Diesel Pusher 4 Slides only 20,000 Miles

Gravel Crusher Stock# L-5197A

2003 GULF STREAM ATRIUM 8410

GTH844 Telehandler

c/w 36â&#x20AC;? Digging Bucket & 72â&#x20AC;? Churchblade Stock #L-5838

Very clean unit only 80,000 Km Stock #L-6889

Crewcab, 4x4, 209,609km, Silver with Leather $23,900 Stock #C-2740

2007 GMC C5500

â&#x20AC;˘HEAVY EQUIPMENT

2008 REITNOUER

2006 DODGE LARAMIE 3500 Diesel,

4X4

2002 INTERNATIONAL 4300 lift Moore crane 7.6L Diesel engine Stock #L-6943

ONLY KM 00 39,0

:$51(5,1'8675,(6 Trucks & Trailers â&#x20AC;&#x201D; New & Used Visit our website: www.warnerindustries.ca â&#x20AC;&#x201D; Sales, Parts & Service NEW & USED

Trucks & Trailers

COMING SPRING 2014 The Industryâ&#x20AC;&#x2122;s Strongest and Lightest Aluminum Super B Trailer. Pre-order, and get the best advantage in the industry today! BALANCE OF FACTORY WARRANTY

2014 DOEPKER TRIDEMS SEVERAL IN STOCK! CALL FOR MORE DETAILS

2005 INTERNATIONAL 9400 GRAIN $

75,990

2010 KENWORTH T800 $

77,500

:$51(5,1'8675,(6 Moose Jaw, SK: Jct. Hwy #2 & North Service Road Contact Greg Krahn â&#x20AC;&#x201D; 306-693-7253

Regina, SK: 330 â&#x20AC;&#x201C; 4th Avenue East For New Truck Sales Call 306-359-1930 â&#x20AC;˘ For Used Truck Sales Call Chris Beaton 306-359-1930 For New Trailer Sales Contact Danny Tataryn â&#x20AC;&#x201D; 306-541-8564

2012 FREIGHTLINER CORONADO $

97,500

DL #913604

Swift Current, SK: #1 Hwy. West, 2525 South Service Road West Contact John Shaver â&#x20AC;&#x201D; 306-773-3030


THE WESTERN PRODUCER | WWW.PRODUCER.COM | FEBRUARY 6, 2014

67

Quality Pre-Owned Equipment

SOUTH COUNTRY EQUIPMENT LTD.

GET READY FOR NEXT SEASON! 2011 JD 9630T

#00914260

Deluxe Comfort Package, 1248 hrs., PTO 1000, 5 hyds., 18F/6R powershift. (MJ)

361,900

$

2013 JD 9560R

#00007709

77 hrs., demo unit, 18/6 powershift, 800/70R38, 2630 Greenstar, JD Link, leather trim, PTO 1000 rpm. (M)

SEEDING

415,000

$

2009 JD 4930

TRACTORS (2) 13 JD 9560R, 77 hrs up, demoed, 800/70R38, 2630 Greenstar.............................................. $415,000 up (M,R) 12 JD 9560RT, 730 hrs, JD Link, deluxe Command View, 18/6 powershift ...........................................$405,300 (M) 12 JD 9560R, 27 hrs, 560 hp, 23 hrs, demo unit................................................................................. $391,500 (MJ) 13 JD 9510R, 510 hp, 800/70R38, JD Link, 18/6 powershift, 2630 Greenstar .................................... $387,900 (MJ) (2) 11 JD 9630T, 901 hrs up, 36” track belt, deluxe comfort pkg ............................................$357,900 up (MJ,RM) 12 JD 9510R, 1453 hrs 510 hp, 800/70R38, 6 hyds, JD Link ................................................................$327,300 (M) 10 JD 9630, 1252 hrs, 530 hp, 18F/6R, diff lock, 800/70R38 ................................................................$306,700 (A) 10 Cat Challenge MT875C track, 1844 hrs, 6 hyds, deluxe cab ............................................................$298,900 (W) 11 JD 9430, 1174 hrs, diff lock, 710/70R42, 2600 Greenstar, SF1 ITC receiver.....................................$285,200 (R) 08 JD 9530T, 1826 hrs, deluxe comfort pkg, HID lights, SF1 AutoTrac ...............................................$266,100 (RM) 07 JD 9530T, 2255 hrs,18F/6R, deluxe comfort pkg, 5 hyds .................................................................$260,200 (S) 10 JD 9430,1200 hrs, diff lock, 710/70R42, 24/6 man shift ..................................................................$255,500 (R) 06 JD 9620, 2880 hrs, 500 hp, diff lock, 800/70R38, Greenstar AutoTrac .............................................$221,500 (A) 09 NH T9060, 2090 hrs, diff lock, 800/70R38 duals ..............................................................................$217,000 (R) 05 JD 9620, 3443 hrs, diff lock, 20.8R42, deluxe comfort pkg ..............................................................$212,900 (S) 08 Cat Challenger MT865B track, 510 hp, pto 1000, deluxe cab ..........................................................$223,000 (W) 12 JD 7200R, 1270 hrs, 200 hp, 710/70R38, MFWD, JD Link ...............................................................$180,300 (M) 10 JD 7930, 690 hrs, 20.8 R42, MFWD, 3 hyd outlets, Command View .................................................$179,000 (R) 11 JD 7251R, 215 hp, MFWD, 750 hrs, 710/70R42 ...............................................................................$177,250 (M) (3) JD 7330, MFWD, 1120 hrs up, w/JD H380 loader .......................................................................$140,600 up (M) 06 JD 9520, 9111 hrs, 4 hyd, 710/70R42, w/2011 Degelman 7200 16’ blade......................................$137,300 (M) 11 JD 7230, 3130 hrs, MFWD, 480/80R42, w/JD741 loader ..................................................................$115,400 (R) 98 JD 9200, 5230 hrs, 18.4-42 triples, diff lock ....................................................................................$109,000 (S) 11 JD 7230, 2059 hrs, MFWD, 520/85R38, deluxe lighting ....................................................................$106,900 (R) 04 JD 7920, 6000 hrs, MFWD, 520/85R42, w/JD746 loader ...............................................................$105,700 (RM) 98 JD 9100, 3940 hrs, 24 spd powersync, diff lock, 20.8R-38 .............................................................$99,600 (RM) 06 JD 7320, 2290 hrs, MFWD, 480/80R38, w/563 SL loader ...................................................................$92,800 (R) 95 JD 8970, 5766 hrs, diff lock, 650-65Rx42, 5 scvs ..............................................................................$86,500 (A) 03 NH TM190, 3391 hrs, w/Q980 loader ..................................................................................................$71,900 (R) 11 JD 6115D, 968 hrs, MFWD, 18.4-38, w/673 SL loader ........................................................................$71,500 (R) 96 JD8870, 6547 hrs, 20.8R42, 4th remote, ........................................................................................ $69,900 (MM) 95 JD 8570, 5776 hrs, 12 spd, diff lock, 20.8R-42...................................................................................$64,900 (S) 08 JD 6603, 810 hrs, MFWD, 18.4X38, w/542NSL loader ....................................................................... $61,000 (M) 03 JD 6420, 4440 hrs, 18.4-38, w/JD 620 loader, bucket ....................................................................... $52,900 (M)

0006685B

120', 1037 hrs., 620/70R46 tires, SwathPro Act, SF1 AutoTrac, 20" nozzle. (W)

13 SeedMaster 74-12TXB w/JD 1910 -430 bu tank, 8 run double shoot .............................................$338,900 (M) 10 SeedMaster 80-12TXB w/JD 1910-430 bu TBH...............................................................................$288,400 (M) (3) 10 SeedMaster 70-12TXB, w/JD 1910 430 TBH ..................................................................... $235,900 up (A,M) 09 SeedMaster 70-12TXB, w/JD 1910-430 TBH ....................................................................................$240,000 (A) 07 SeedMaster 80-12TXB w/JD 1910 430 bu Tank, 1800 Greenstar w/SF1.........................................$208,500 (W) 06 SeedMaster 6612 TXB drill w/ JD 1910 430 TBH..............................................................................$197,700 (A) 10 JD 1830 61’, w/ JD 1910 350 bu cart ...............................................................................................$143,600 (R) 09 JD 1830, 61’, 10” spac, w/JD 1910 350 bu TBH ...............................................................................$119,900 (R) 06 JD 1820, 53’ 10” spac, w/04 JD 1910-270 tank, w/2013 Pattison fert wagon. ..................................$98,800 (S) 05 Conservapak 5112, 56’, 12” spac w/4400 tank ................................................................................. $66,100 (M) 00 Flexi-Coil 5000, 57’, 10” spac, w/3450 drill ........................................................................................$65,700 (A) 97 Bourg 5710, 64’ 12” spac, w/2011 Ezee on 300 bu cart, double shoot, 3 tank ..................................$52,400 (S) 07 NH SD550, 60’, 10” spac, single shoot, Concord style pack wheels/tires ..........................................$43,900 (A) 03 CIH ADX3360, 360 bu cart, 3 tank, var rate, 8 run double shoot ..................................................... $37,900 (MM) 01 Mor Maxim 40’, 10” w/7240 TBT cart, 240 bu 3rd tank......................................................................$36,800 (A) 00 Ezee-On 7550, 43’, 10” spac, w/2175TBH cart .................................................................................. $30,600 (M) 97 Concord 4012, 40’, 12” spac, w/ 3000 tank, double shoot ................................................................ $27,300 (W)

COMBINES

269,500

$

2011 JD 4930

0013550A

1800 hrs., 120', section control, GPS glove, 620/70R46m float tires. (M)

273,600

$

2010 JD 1830 - 61' w/ 1910 350 bu.

0735306A

4x22" steel press wheels, double shoot, Dutch openers, 1910 - 8 run double shoot, 10" spacing, var. seed/fert. rate. mark. (R)

NOW

$

143,600

(2) 12 JD S680, 181 hrs up, ProDrive trans w/Harvest Smart, 520/85R42, premium ................ $395,200 up (R,RM) 13 JD S670,403 hrs, JD link, ProDrive trans w/ Harvest Smart, premium............................................$355,500 (M) 12 JD S670, 524 hrs, 520/85R42, JD link, 2630 Greenstar ................................................................. $330,600 (MJ) 11 JD 9870STS, 715 hrs, 520.85R42, Greenstar 2600 display, SF1, premier cab ..................................$298,500 (R) (2) CIH 8230, 400 hrs, 620/70R42, w/09 2016 CIH PU, 16’ Swathmaster pu .........................................$319,200 (A) 11 JD 9870STS, 997 hrs, premier cab, 520/85R42, ProDrive w/Harvest Smart....................................$273,500 (W) (4) 10 JD 9870 STS, 648 hrs up , premier .................................................................................. $272,000 up (R,RM) (4) 11 JD 9770STS, 740 hrs up, premier, ProCrive ..................................................................... $256,900 up (A,MJ) (2) 09 JD 9870STS, 708 hrs up, premier cab ................................................................................... $254,900 up (R) 10 JD 9870STS, 830 hrs, premier cab, 900/60R32, high cap feeding................................................$251,900 (MM) (2) 08 JD 9870STS, 780 hrs up, 520/85R42 duals, hi cap feeding ............................................ $233,900 up (MM,R) (2)10 JD 9770STS, 700 hrs up, 20.8R-38, hopper cover ............................................................... $233,900 up (R,S) 09 CIH 8120, 761 hrs, 900/32, w/2010 2016-16 PU .............................................................................$233,000 (W) 09 JD 9770STS, 1072 hrs, 20.8R-38, premium cab ............................................................................ $226,100 (MJ) 08 NH CR9070, 1306 hrs, w/Rakeup 76C PU .........................................................................................$205,800 (S) (5) 08 JD 9770STS, 1025 hrs up, prem cab ............................................................................. $191,200 up (M,MM) (4) 07 JD 9760STS, 11133 hrs up, Greenstar, 520/85R42, premier cab .................................... $175,000 up (MM,R) 10 NH CR9060, 609 hrs, 800x32, Nav II w/GPS guidance ......................................................................$191,000 (A) 06 JD 9760STS,1745 hrs, 600/65R28, Greenstar 2600, HID lights ....................................................... $167,900 (M) 08 CIH 2588, 1227 hrs, w/2015 PU, 30.5L32, Rotary AFX ext wear ......................................................$163,700 (M) (2) 05 JD 9760STS, 1904 hrs up, 22’ auger ................................................................................. $137,600 up (A,W) 04 JD 9660STS, 1701 hrs, 800/65R32, 300 bu grain tank ext, Greenstar ...........................................$129,900 (RM) 04 CIH 2388, 1266 hrs, w/2016 14’ PU Platform ...................................................................................$119,300 (S) (2) 03 JD 9750STS, 2606 hrs up, Michels, deluxe header control ............................................... $109,600 up (S,W) 02 JD 9650,1922 hrs, dial spd, auto header height, 30.5L-32 ..............................................................$106,500 (M) (3) 01 JD 9650 STS, 1770 hrs up, 800/65R32, dial spd, auto header height................................. $93,900 up (S,W) 00 JD 9750STS, 2189 hrs, fine cut chop, hopper ext, 30.5-32............................................................. $89,600 (MM) 99 JD 9610, 2888 hrs, dial a spd, 30.5x32, dial matic .......................................................................... $63,400 (MJ) (2) 98 JD CTSII, 2336 hrs up, 30.5x32...........................................................................................$52,000 up (A,MJ) 98 JD 9510, 4008 hrs, dial spd, 30.5L-32, hop topper .............................................................................$44,800 (S) (4) 97 JD CTS, 2343 hrs up, dial spd, chopper ..........................................................................$43,500 up (M,MJ,S) (2) 97 JD 9500, 3100 hrs up, dial spd ................................................................................................$37,700 up (M) 97 JD 9600, 3218 hrs, wide chop, dial spd, f/a, 30.5x32 .........................................................................$37,900 (S) 90 JD 9500, 2254 hrs, dial matic, 24.5x32, 17’ auger ............................................................................$33,500 (W) (2) 96 JD CTS, 2715 hrs up, auto header height, dial spd, 30.5Lx32 ............................................$27,900 up (A,MJ) 86 CIH 1660, 3060 hrs, 23.1-26, w/ 13’ PU plat................................................................................... $18,900 (MM)

SPRAYERS

Assiniboia, SK (A) 306-642-3366 Montmartre, SK (MM) 306-424-2212 Moose Jaw, SK (MJ) 306-692-2371 Mossbank, SK (M) 306-354-2411 Raymore, SK (RM) 306-746-2110 Emerald Park/ Regina, SK (R) 306-721-5050 Southey, SK (S) 306-726-2155 Weyburn, SK (W) 306-842-4686 Don’t forget to visit

www.southcountry.ca

13 JD 4940,120’, 328 eng hrs, 380/105R50, JD Link, section control ..................................................$386,700 (M) 12 JD 4940, 1150 eng hrs, 120’, section control, JD Link .....................................................................$332,400 (A) (2) 11 JD 4930,120’, 620/70R46 float tires, 20” nozzle space..................................................... $273,600 up (M,R) 09 JD 4930, 120’, 1037 hrs, 380/105, Swathpro ..................................................................................$269,500 (W) (4) 10 JD 4930, 1136 eng hrs up 120’, 20” nozzle, 380/105R50......................................... $246,500 up (A,MJ,R,W) (3) 08 JD 4930, 1744 eng hrs up, 120’, 20” nozzle ....................................................................$253,000 up (A,R,S) (2) 09 JD 4730, 1500 hrs, 100’, 20” spac, 520/85R38 .................................................................. $217,900 up (RM) 08 JD 4830, 100’, 20” spac, 600/65R38, sec control, Starfire 3000 receiver .......................................$211,600 (M) 08 CIH Patriot 4420, 120’ ,2090 hrs, AccuGuide Contr, Trimble FM1000 ...............................................$214,900 (S) (2) 06 JD 4920, 2009 eng hrs up, 120’, 380/105R50 .................................................................... $210,000 up (R,S) 05 JD 4920, 1858 eng hrs, 380/105R50, AutoTrac................................................................................$191,500 (M) 03 JD 4710,90’, 800 gal, 520x85R38, boom controller .........................................................................$129,300 (M) 02 JD 4710 90’, 3570 hrs, 800 gal poly tank, 20.8R38 float tire, radar .................................................$120,200 (R) 05 RoGator 1074, 3806 hrs, 90’, 1000 gal SS tank, 380/90R46, Raven control .....................................$111,500 (R) 00 JD 4700 80’, 3234 eng hrs, 750 gal, Outback steer, Norac Height................................................$104,900 (MM)

Don’t forget to visit www.southcountry.ca


68

FEBRUARY 6, 2014 | WWW.PRODUCER.COM | THE WESTERN PRODUCER

GREENLIGHT TRUCK & AUTO 2011 FORD F250 XLT LONG BOX 4X4

DED A O L 6.7L IESEL D

PST PAID, 72KM

$35,995

2012 DODGE RAM 3500 LARAMIE MEGA CAB

2013 GMC SIERRA 3500 SLT

2012 DODGE RAM 3500 LARAMIE

5 AND 6 PASSENGER MEGA CAB DIESEL SUNROOF 3 TOSE LEATHER NAV DVD BACK UP CAMERA 40KM O CHOO FR M

E 6.6L FULLY LOADED DIESEL WHITLE LEATHER SUNROOF 40KM & R B SILVE AVAILA O S L A

$51,995

$52,995

STARTIN NG FROM

2011 GMC SIERRA 2500 SLT

SUNROOF CK 6.7L 4X4 DIESEL 78KM NAV AND DVD BLAU ONLYM Y T A BE 60K

2012 DODGE RAM 1500 LARAMIE LONG HORN

6.6L LEATHER DIESEL DVD AND SUNROOF

2010 FORD F150 KING RANCH

FULLY LOADED 4X4 .5.4L PST PD WITH NAVIGATION

5.7L HEMI 4X4 PST PD 95KM

WOW

$48,995

$51,995

STARTIN NG AT

$36,995

ALSO HAVE 2013 SIN NGLE AXLE

BLACK BEAUTY

2011 FORD F250 XLT

LONG BOX DIESEL LOADED 72KM

6.7L 4X4 167KM LOADED

$35,995

$29,995

WAS $38,995

NOW

6.7L PST PD 178KM LEATHER SUNROOF

$29,995

$29,995

HUGE INDOOR SHOW ROOM

6.6L 4X4 15KM LEATHER DVD SUNROOF NAVIGATION HEATED COOLED SEATS

2011 DODGE RAM 2500 SLT

FULLY LOADED 4X4 5.3L PST PD LEATHER SUNROOF

$24,995

DED LOAA LLY DU

2008 FORD F250 LARIAT

2008 DODGE RAM 3500 LARAMIE DUALLY

2009 CHEV AVALANCHE LTZ

ONLY 58KM

2013 CHEV SILVERADO 3500 LTZ

FULLY LOADED LEATHER DIESEL 6.4L 4X4 185KM PST PD

MUST! SEE

WAS S $30,99 95

NOW

$27,995

www.GreenlightAuto.ca

Call FINANCE HOTLINE 306-934-1455 2715 FAITHFULL AVE., SASKATOON, SK.

Titan Truck Sales Box 299 MacGregor, MB R0H 0R0

204-685-2222 2007 WESTERN STAR 4900SA

515 hp Detroit, 13 sp, 12/40, 22.5” alloy wheels, 358 gears, 232 WB, 892,837 km.

39,000

$ 2005 IH 9900I

2005 PETERBILT 379

475 Cat C15, 13 sp, 12/40, 3:55 gears, 244” WB, 70” bunk, 22.5” alloy wheels, 2,013,769 km.

30,000

$

2010 PETERBILT 388

500 HP Cummins ISX, 18 sp, 12/40, 22.5” alloy wheels, 244” WB, 3:73 gears, 4-way diff. locks, 72” midrise bunk, 1,428,989 km.

29,000

$

550 HP Cummins ISX, 18 sp, 12 front super 40 rear, 3-way diff. locks, 410 gears, 22.5” alloy wheels, 244” WB, 63” midrise bunk, 779,362 km.

65,000

$

2006 PETERBILT 379X

475 HP Cat C15, 18 sp, 3:55 gears, 12/40, 22.5” alloy wheels, 275” WB, 70” bunk, 1,657,883 km.

65,000

$

2010 PETERBILT 388

550 HP Cummins ISX, 18 sp, 12 front super 40 rear, 3-way diff. locks, 410 gears, 22.5” alloy wheels, 244” WB, 63” midrise bunk, 739,252 km.

65,000

$

2005 IH 9900I

www.titantrucksales.com 2003 PETERBILT 379L

475 HP Cat C15, 13 sp, 14.6 front super 40 rear, 370 gears, 22.5” alloy wheels, 260” WB, air trac suspension, engine warranty till July 2015, 1,647,845 km.

19,000

$

2007 PETERBILT 379 LEGACY

475 HP Cat C15, 18 sp, 3:55 gears, 12/40, 22.5” alloy wheels, 244” WB, 70” bunk, 1,373,064 km.

45,000

70,000

$

2005 PETERBILT 387

475 HP Cat C15, 13 sp, 12/40, 22.5” alloy wheels, 236” WB, 2,035,713 km.

$

2006 PETERBILT 379L

550 HP Cat C15, 18sp, 12/40, 22.5” alloy wheels, 3:36 gears, 3x4 locks, 70” bunk, 1,193,240 km.

15,000

49,000

$

2009 PETERBILT 388

475 HP Cummins ISX, 13 sp, 12/40, 22.5” alloy wheels, 244” WB, 3:73 gears, 72” midrise bunk, 1,409,137 km.

DL#311430

450 HP Cummins ISX, 18 sp, 12/40, 22.5” alloy wheels, 3-way diff. locks, 3:55 gears, 244” WB, 63” midrise bunk, 1,145,366 km.

49,000

$

$ 2007 IH 9400I

455 HP ISX Cummins, 13 sp, 12/40, 22.5” alloy wheels, 4:11 gears, 222” WB, 72” mid-rise bunk, 1,210,399 km.

22,000

$


THE WESTERN PRODUCER, THURSDAY, FEBRUARY 6, 2014

CLASSIFIED ADS 69

1972 HARLEY DAVIDSON FLH 1200cc, FDN., REG., CERT., CDC Austenson, CDC CERT. #1 CDC Verona and Strongfield new tires and battery last year, hard bags, Cowboy, CDC Copeland, AC Ranger. Ph. Durum. Call Shawn Fraser 306-741-0475, all original, 3000 miles on rebuilt motor. Ardell Seeds, Vanscoy, SK, 306-668-4415. Pambrun, SK. Email: foc@sasktel.net 306-435-2847 after 6pm, Moosomin, SK. FOUNDATION, REGISTERED, CERTIFIED, AC Transcend Durum. Ace Crop Care Ltd., 306-831-8963, Rosetown, SK. V e ry high yie ld ing 2R b a rle y CERT. STRONGFIELD, AAC Current, PARTING OUT Polaris snowmobiles, 1985 w i th p lu m p ke r ne ls. CDC Verona durum. Order early for max to 2005. Edfield Motors Ltd., phone: discounts. Visa/MC. www.llseeds.ca 306-272-3832, Foam Lake, SK. Ca ll yo u rlo ca l S e e d G ro w e rRe ta ile r: 306-530-8433, Lumsden, SK. CLOSE-OUT SALE: 2012 Arctic Cat M1100 A L BER TA FDN., CERT. AC STRONGFIELD durum. turbo, 500 miles, $11,995. CDN; 2013 AC Sean Miller, Avonlea, SK., 306-868-7822. XF1100 turbo, high country, 650 miles, K IN G ’S S EED FA R M L TD . $11,995. CDN; 2011 AC M800 1400, $8995 Three H ills,AB.............403-443-0005 CDN; 2007 AC M1000 Snopro, 900 miles, S A S K ATC H EW A N mint! 2012 Ski-Doo Summit 800, $8995 WWW.TRAWINSEEDS.CA Cert. AC MorCDN. Call Swenson RV, 1-800-735-5846, L ES & W EN D Y TR O W EL L S EED FA R M gan, Souris, Triactor, milling oats; CDC Minot, ND www.swensonrv.com Saltcoats,SK ...................306-744-2684 Baler forage oats 306-752-4060 Melfort SK PARTS FOR VINTAGE snowmobiles, 1990 1-877-791-1045 CERTIFIED SOURIS AND Triactor. Northand older. Call Don at 780-755-2258, land Seeds Inc. 306-324-4315, Margo, SK. w w w .fp gen etics .ca Wainwright, AB. doncole@telus.net CERTIFIED AC MORGAN and CDC SO-1 1970 SNOWCRUISER MODEL 2000, Oats: High germination and low disease. stored inside, original seat, wide track, Call Wilfing Farms Ltd. 306-236-6811 or taking offers. 306-298-4536, Orkney, SK. 306-236-7797, Meadow Lake, SK. E-mail: 2009 ARCTIC CAT Z1 Turbo, mint cond., rjwilfing@sasktel.net Malt Barley/Feed Grains/Pulses 3000 miles. Call Mark at 306-370-1337, C D C B OY E R , CERT., early maturity, best price/best delivery/best payment Saskatoon, SK. straight cut, 99% germ., 98% vigor. Stoll’s Seed Barn 306-493-2534, Delisle, SK.

A C ® N ew da le

Licen s ed & bon d ed 1- 800- 2 58- 7434 ro ger@ seed - ex.co m CERTIFIED CDC MEREDITH, CDC CopeFULLY FURNISHED PARK model trailer in land and AC Metcalf. Northland Seeds Inc. Apache junction, AZ. Available March and 306-324-4315, Margo, SK. April, $1200/mo. Call Glen 306-795-2806. CERT. COPELAND, 99% germ., 0% smut, 100% pure to variety; Cert. Meredith, 97% germ., 0% smut, 100% pure to variety. Call Sandercock Seed Farms, 306-334-2958, Balcarres, SK.

A C ®Su m m it H igh yie ld ing m illing o a t w ith the b e st m u lti-ge ne cro w n ru st re sista nce . Ca ll yo u rlo ca l S e e d G ro w e rRe ta ile r: FED O R U K S EED S Kam sack,SK .................306-542-4235

1-877-791-1045 w w w .fp gen etics .ca

CERT. #1 AC Metcalfe, CDC Meredith, CDC PolarStar. Wiens Seed Farm, call CERTIFIED AND REG. Souris, Leggett. Frederick Seeds, 306-287-3977, Watson, Brennan 306-377-2002, Herschel, SK. SK. H I G H Q UA L I T Y C E RT I F I E D B a r l ey Seed: CDC Copeland, Newdale and CDC WWW.TRAWINSEEDS.CA Certified CDC Meredith. High germination with low dis- Meadow yellow peas. Call 306-752-4060, ease levels. Call Wilfing Farms Ltd. Melfort, SK. 306-236-7797 or 306-236-6811. Meadow CERTIFIED CDC ORRIN. Berscheid Bros. Lake, SK. E-mail: rjwilfing@sasktel.net Seeds, 306-368-2602, Lake Lenore, SK. CERTIFIED #1 TRIACTOR. Hetland Seeds at Naicam, SK. Call: 306-874-5694. www.hetlandseeds.com H igh yie ld ing w hite m illing o a t w ith e a rly m a tu rity a nd e xce lle nt m illing yie ld . V e ry high yie ld ing w hite m illing o a t Ca ll yo u rlo ca l S e e d G ro w e rRe ta ile r: w ith cro w n ru st re sista nce . FED O R U K S EED S Ca ll yo u r lo ca l S e e d G ro w e r Re ta ile r: Kam sack,SK.....................306-542-4235 S O R G A R D S EED S 1-877-791-1045 C hu rchbridge, SK .....306-896-2236 w w w .fp gen etics .ca

C D C D a ncer

A C ® L eggett

1-877-791-1045 w w w .fp gen etics .ca

CERTIFIED CDC AUSTENSON high yielding fe e d . E n n i s S e e d s , G l e n av o n , S K . , 306-429-2793.

WOOD-MIZER PORTABLE SAWMILLS, eight models, options and accessories. 1-877-866-0667. www.woodmizer.ca SAWMILLS from only $4897 - Make Money and Save Money with your own bandmill. Cut lumber any dimension. In stock, ready to ship. Free info. and DVD: www.NorwoodSawmills.com/168 or call 1-800-566-6899 ext. 168.

ELIAS SCALES MFG., several different ways to weigh bales and livestock; Platform scales for industrial use as well, nonelectric, no balances or cables (no weigh like it). Shipping arranged. 306-445-2111, North Battleford, SK. www.eliasscales.com

CERT. AC METCALFE and CDC Meredith CERTIFIED SEABISCUIT. Greenshields barley, excellent germ. and disease. Seeds, Semans, SK., 306-524-2155, 306-524-4339. 306-741-0475, Pambrun, SK. FDN, REG. AND CERTIFIED #1 CDC Orrin, CERTIFIED #1 AC Newdale (2R), Legacy Leggett. Fenton Seed Farm Ltd., Tisdale, (6R). Call Fenton Seed Farm Ltd., Tisdale, SK. 306-873-5438. SK. 306-873-5438. FDN., REG., CERT. AC Morgan. Terre CERTIFIED METCALFE and Meredith. Call B o n n e S e e d F a r m 3 0 6 - 9 2 1 - 8 5 9 4 , Greenshields Seeds Ltd., 306-524-2155, 306-752-4810, Melfort, SK. 306-524-4339, Semans, SK. FOUNDATION, CERTIFIED Leggett, Souris. CERT. #1 COPELAND BARLEY. Discounts Ardell Seeds, Vanscoy, SK, 306-668-4415. available on large or early orders. Blaine CERTIFIED AND REG. Metcalfe, Copeland, Lake, SK. 306-290-7816, 306-497-2800. Newdale, Meredith barley. Frederick WWW.TRAWINSEEDS.CA Cert. CDC Seeds, 306-287-3977, Watson, SK. Meredith, CDC Copeland, AC Metcalfe, SORGARD SEEDS, Leggett, Souris, 306-752-4060, Melfort, SK. CDC Baler feed oats. Call 306-896-2236, CERTIFIED AC MEREDITH, AC Metcalfe, E-mail: s e e d s @ s o rg a rd s e e d s . c o m CDC Copeland malt barley. Conlon, Churchbridge, SK. Sundre feed barley. Order early for max discounts. Visa/MC. www.llseeds.ca 306-530-8433, Lumsden, SK. CERTIFIED #1 CELEBRATION and CDC Copeland. Call: Hetland Seeds at Naicam, SK. 306-874-5694. www.hetlandseeds.com Ea rly m a tu ring sp ring tritica le REG., CERT. CDC MEREDITH, AC Metcalfe, o ffe ring high yie ld s,e xce lle nt 9 9 % g e r m . Te r r e B o n n e S e e d F a r m lo d ging re sista nce a nd im p ro ve d 306-921-8594, 306-752-4810, Melfort, SK. H a gb e rg fa lling nu m b e r. WWW.TRAWINSEEDS.CA Certified CDC Ca ll yo u r lo ca l S e e d G ro w e r Re ta ile r: Austenson highest yielding feed barley. 306-752-4060, Melfort, SK. S O R G A R D S EED S SORGARD SEEDS, Feed Barleys: CowC hurchbridge,SK..........306-896-2236 boy and Conlon. 306-896-2236, Churchbridge, SK. seeds@sorgardseeds.com 1-877-791-1045

A C U ltim a

w w w .fp gen etics .ca

CORN SEED, $25/ACRE, open pollinated varieties, lower N required, early 22502350 CHU’s, 7-9’ tall, high yield and nutrition, for silage, grazing and grain. Delivery available. 204-723-2831, Austin, MB. CERT. CONVENTIONAL AND ROUNDUP ready grazing corn. Early maturing, leafier for increased grazing yield. For ruminant livestock including cattle, sheep, bison and wildlife food plots. CanaMaize Seed Inc., 1-877-262-4046, www.canamaize.com

CERTIFIED #1 AC STRONGFIELD. Wiens Seed Farm, call Brennan at 306-377-2002, Herschel, SK. FOUNDATION, REGISTERED, CERTIFIED Transcend Durum. Call Craswell Seeds, Strasbourg, SK., 306-725-3236. C E R T. C D C V E RO N A D u r u m . P h o n e 306-296-2104, 306-296-7434, Frontier, SK CERTIFIED, REGISTERED, FOUNDATION AC Strongfield and AC Raymore (solid stem) Call 403-867-2338, Foremost, AB. FOUNDATION, REGISTERED and/or Certified: CDC Copeland; AC Metcalfe, CDC Meredith, CDC Kindersley, Legacy. Berscheid Bros Seeds, Lake Lenore, SK. 306-368-2602.

CERT. CDC VERONA, 99% germ., 0% Fusarium Graminearum. Wholesale pricing until Feb. 12/2014. www.jagfarms.com email jagizen@sasktel.net Call/text Jason 306-628-8127, Prelate, SK.

CDC UTMOST VB Midge HRS wheat. Early, high yield, 0% Fusarium Gram. 306-843-2934, Wilkie, SK. www.herle.ca CERTIFIED #1 AC Vesper VB, AC Shaw VB. Wiens Seed Farm 306-377-2002, Herschel, SK. FDN, REG. AND CERTIFIED #1 Vesper VB, Goodeve VB, CDC Utmost VB. Fenton Seed Farm Ltd., Tisdale, SK. 306-873-5438. CERTIFIED SHAW-AC DOMAIN MTW, AC Unity-Waskada MTW, AC Andrew high yielding wheat. Order early for max discounts. Visa/MC. www.llseeds.ca 306-530-8433, Lumsden, SK. AC ANDREW SOFT white wheat. Most popular variety, 0% Fusarium Gram. 306-843-2934, Wilkie, SK. www.herle.ca CERTIFIED #1 UNITY, Waskada, Lillian. S h ew c h u k S e e d s , B l a i n e L a ke , S K . 306-290-7816, or 306-497-2800. FOUNDATION, REGISTERED, CERTIFIED, AC Muchmore, AC Shaw VB. Ace Crop Care Ltd., 306-831-8963, Rosetown, SK. CERTIFIED AC LILLIAN, sawfly resistant. Call 403-867-2338, Foremost, AB.

CERTIFIED #1 AC Carberry, AC Sadash, CDC Utmost VB, AC Vesper VB and AC, Shaw VB. Call: Hetland Seeds at Naicam, SK. 306-874-5694. www.hetlandseeds.com AC ANDREW CERTIFIED #1, 98% germination. Excellent quality! Nakonechny Seeds, Ruthilda, SK., Call 306-932-4409. FOUNDATION AND/OR CERTIFIED CDC Utmost VB and Lillian Wheat. Call Craswell Seeds, Strasbourg, SK., 306-725-3236. CERTIFIED AC SHAW VB, midge resistant; Certified AC Carberry. Ennis Seeds, 306-429-2793, Glenavon, SK. CERTIFIED VESPER/ WASCADA midge resistant, Stettler, Carberry. Greenshields Seeds Ltd., Semans, SK., 306-524-2155, 306-524-4339. CERTIFIED SHAW, 98% germ. Hansen Seeds, Yellow Grass, SK., 306-465-2525 or 306-861-5679. Email jsh2@sasktel.net CERTIFIED PASTEUR, 94% germination, 0% Graminearum. Bailey Brothers Seeds 306-935-4702, Milden, SK.

A C ®Tr a nscend Be st fo r yie ld ,d ise a se a nd e nd -u se . Ca ll yo u rlo ca l S e e d G ro w e rRe ta ile r: S M ITH S EED S Lim erick,SK .................306-263-4944

1-877-791-1045 w w w .fp gen etics .ca

H I G H Q UA L I T Y C E RT I F I E D W h e a t Seed: CWRS, CPSR and CWSW. Harvest, CDC Utmost VB, AC Shaw VB, Alvena, AC Enchant VB, AC Crystal, AC Foremost and AC Sadash. Call Wilfing Farms Ltd. 306-236-7797 or 306-236-6811, Meadow Lake, SK. E-mail: rjwilfing@sasktel.net

CERT. CDC IMPOWER CL large green; New CDC Scarlet reds. High germ. Fast Seed Farm, 306-463-3626, Kindersley, SK. CERTIFIED CDC DAZIL., CDC Impower, Ace Crop Care Ltd., 306-831-8963, Rosetown, SK.

M&M SEEDS LTD. has Certified No. 1 CDC Treasure and Meadow. Cash and volume discounts. 306-258-2219 St.Denis, SK CERT. CDC MEADOW. Order early for max discounts. Visa/MC www.llseeds.ca 306-530-8433, Lumsden, SK. AC EARLYSTAR NEW YELLOW PEA. High germination. Contact 306-843-2934, Wilkie, SK. www.herle.ca FOUNDATION, REGISTERED and/or Cert. CDC Meadow and CDC Saffron peas. Ph. Berscheid Bros Seeds, Lake Lenore, SK. 306-368-2602. FDN, REG, CERT, CDC Hornet, CDC Patrick (green), CDC Limerick (green). Ace Crop Care Ltd. 306-831-8963, Rosetown, SK. CERTIFIED #1 TREASURE. Call: Hetland Seeds at Naicam, SK. 306-874-5694. www.hetlandseeds.com

AC UNITY VB, certified, 99% germ., 96% vigor, 0% Graminearum fusarium. Stoll’s TOP QUALITY CERTIFIED alfalfa and grass Seed Barn 306-493-2534, Delisle, SK. seed. Call Gary or Janice Waterhouse FOUNDATION, REGISTERED and/or Certi- 306-874-5684, Naicam, SK. fied: AC Vesper VB, AC Unity VB; CDC UtSORGARD SEEDS: CDC Meadow yellow most VB, Berscheid Bros Seeds, Lake Lepeas. 306-896-2236, Churchbridge, SK. nore, SK. 306-368-2602. Email: seeds@sorgardseeds.com CERT. AC MEADOW peas, 97% germ., 93% vigor, good quality. Call Sandercock Seed V e ry high yie ld ing, CERTIFIED FOREMOST CONVENTIONAL, Farms, 306-334-2958, Balcarres, SK. se m i-d w a rfCW RS ,sho rt stro ng stra w . Rugby Round-up Ready, Canterra canola NEW CERTIFIED CDC Saffron, high germ. va r i e t i e s . G r e e n s h i e l d s S e e d s L t d . , and vigor. Volume discounts. Fast Seed Ca ll yo u r lo ca l S e e d G ro w e r Re ta ile r: 306-524-2155, 306-524-4339, Semans, SK Farm, 306-463-3626, Kindersley, SK. HYBRID AND OPEN-POLLINATED Canola NEW! CDC SAFFRON, Foundation, RegisS A S K ATC H EW A N varieties at great prices. Cert. #1 Synergy tered, Certified. High yield. Good stander. FED O R U K S EED S (Polish). Call Fenton Seeds, Tisdale, SK. Now booking! Nakonechny Seeds, RuKam sack,SK....................306-542-4235 306-873-5438. thilda, SK., 306-932-4409. S M ITH S EED S Lim erick,SK.....................306-263-4944 H I G H Q UA L I T Y C E RT I F I E D Ye l l ow Peas: CDC Meadow, CDC Treasure, CDC A L BER TA and Abarth. High Germination with K IN G ’S S EED FA R M L TD . SORGARD SEEDS, Prairie Sapphire Saffron Three H ills,AB................403-443-0005 Churchbridge, SK. Phone 306-896-2236, low disease levels. Call Wilfing Farms Ltd. 306-236-7797 or 306-236-6811, Meadow Email: seeds@sorgardseeds.com Lake, SK. Email: rjwilfing@sasktel.net 1-877-791-1045 BUYING BROWN FLAX farm pickup. Call REG., CERT. CDC MEADOW, CDC Treasure. w w w .fp gen etics .ca 1-877-752-4115, Naber Specialty Grains Ardell Seeds, Vanscoy, SK, 306-668-4415. Ltd. Email: nsgl@sasktel.net REGISTERED AND CERTIFIED #1 CDC CERT. AND REG. CDC Sorrel reconsti- Meadow. Fenton Seed Farm Ltd., Tisdale, CERTIFIED SADASH WHEAT for sale. tuted. Available in Moose Jaw and Swift SK. 306-873-5438. P h o n e A n t e l o p e C r e e k E n t . L t d . , Current, SK. Good germ. and vigor. Visa, 306-395-2652, Chaplin, SK. M/C accepted. Call Simpson Seeds Inc. CERTIFIED MEADOW. Call Greenshields Seeds Ltd., 306-524-2155, 306-524-4339, M&M SEEDS LTD. has Certified No. 1 AC 306-693-9402 or toll free 1-877-252-9431. Semans, SK. Goodeve VB, CDC Utmost VB and AC Shaw FDN, REG. AND Certified #1 Reconstituted V B . C a s h a n d v o l u m e d i s c o u n t s . CDC Sorrel, Fdn and Reg. AAC Bravo. Call 306-258-2219, St. Denis, SK. Fenton Seeds, Tisdale, SK. 306-873-5438.

A C ® M u chm or e

C D C U tm ostV B H ighe st yie ld ing CD C CW RS w he a t w ith m id ge to le ra nce & stro ng stra w . Ca ll yo u rlo ca l S e e d G ro w e rRe ta ile r: S A S K ATC H EW A N S O R G A R D S EED S C hurchbridge,SK......306-896-2236 L ES & W EN D Y TR O W EL L S EED FA R M Saltcoats,SK.................306-744-2684 FED O R U K S EED S Kam sack,SK.................306-542-4235 S M ITH S EED S Lim erick,SK..................306-263-4944 A L BER TA K IN G ’S S EED FA R M L TD . Three H ills,AB.............403-443-0005

1-877-791-1045 w w w .fp gen etics .ca

CARDALE HRSW, CERTIFIED #1, 99% germ., 99% vigour, 0% gram./fus. Stoll’s Seed Barn Ltd. 306-493-2534, Delisle, SK. CERTIFIED AND REGISTERED Utmost VB, Harvest, Andrew, Conquer VB. Frederick Seeds, 306-287-3977, Watson, SK.

FOUNDATION, REGISTERED and/or Certified CDC Sorrel reconstituted flax. Berscheid Bros Seeds, Lake Lenore, SK. CDC BASTIA, Certified. Excellent quality! 306-368-2602. Limited supply! Nakonechny Seeds, RuRECON., REG. AND CERT. CDC Sorrel, CDC thilda, SK., 306-932-4409. B e t h u n e . Te r r e B o n n e S e e d F a r m 306-921-8594, 306-752-4810, Melfort, SK. WWW.TRAWINSEEDS.CA Cert. Recon CDC Bethune, CDC Sorrel flax. 306-752-4060, Melfort, SK. CDC SORREL, Registered, Certified, reconstituted. Large seed. Good lodging resistance. Now booking! Nakonechny Seeds, Ruthilda, SK., 306-932-4409. CERTIFIED PRAIRIE GRANDE flax. Ph. Greenshields Seeds Ltd., 306-524-2155, 306-524-4339, Semans, SK. CERT. PRAIRIE SAPPHIRE and Reconstituted CDC Bethune flax, CDC Sorrel. Pambrun, SK., 306-741-0475. foc@sasktel.net CDC SORREL FLAXSEED. Cert. and reg. Germination, vigour, thousand seed weight and disease all tested. LaForge BUYING CANARY SEED, farm pickup. Farms, 306-773-0924, Swift Current, SK. Call 1-877-752-4115, Naber Specialty Grains Ltd. Email: nsgl@sasktel.net CDC BASTIA (NEW), CDC Togo, Itchless varieties. Phone 306-843-2934, Wilkie, SK. www.herle.ca CDC ORION kabuli chickpea, registered. CERTIFIED CANTATE, highest yielding variety. Hansen Seeds, Yellow Grass, SK., Sean Miller, Avonlea, SK., 306-868-7822. 306-465-2525, 306-861-5679. CERTIFIED, REGISTERED AND FDN CDC Togo. Northland Seeds Inc. 306-324-4315, CERTIFIED CDC DAZIL, CDC Maxim, CDC Margo, SK. Impower, CDC Greenland lentils. Pambrun SK., 306-741-0475, foc@sasktel.net

AC CONQUER VB (new) midge tolerant CPS. High yields, 0% Fusarium Gram. Wilkie, SK. 306-843-2934, www.herle.ca LARGE QUANTITY OF Certified Harvest wheat, wholesale pricing, selling in truck load lots only; Also, Certified Newdale 2row malt barley. Phone 204-683-2316, CERT. #1 CDC Impala (Red) CL lentil. Call C E RT I F I E D ANDANTE YELLOW. Call Inland Seed Corp., Binscarth, MB. Fenton Seed Farm Ltd., Tisdale, SK. Greenshields Seeds Ltd., 306-524-2155, CERTIFIED UNITY WASKADA and Carberry 306-873-5438. 306-524-4339, Semans, SK. wheat, exc. germ. and disease. Pambrun, MUSTARD SEED: We carry a full line of SK., 306-741-0475. Email foc@sasktel.net high quality cert. mustard seed. Bare, treated, large or small bags. Can arrange CERT. VESPER VB, Pasteur GP wheat. delivery anywhere. Great pricing!! (Looking P re c i s i o n A g S e r v i c e s , Griffin WANTED for low grade mustard). Call Ackerman Ag 306-457-2220, Carlyle 306-453-2255, Services 306-638-2282, Chamberlain, SK. Carnduff 306-482-4343. REG., CERT. AC Shaw VB, AC Vesper VB, C D C O s l e r. Te r r e B o n n e S e e d F a r m 306-921-8594, 306-752-4810, Melfort, SK. NOW BUYING BROWN

GrainEx International Ltd.

WWW.TRAWINSEEDS.CA Cert HRS. CDC Utmost VB, Carberry, Shaw VB, Harvest. 306-752-4060, Melfort, SK. SORGARD SEEDS, WHEAT: Carberry, Glenn, AC Vesper, CDC Utmost, Cardale, CPS Conquer and Pasteur. Churchbridge, SK. Phone 306-896-2236, E-mail: seeds@sorgardseeds.com AC VESPER VB. FDN., Reg., Cert. #1. High yield. Excellent quality! Nakonechny Seeds, Ruthilda, SK., 306-932-4409. AC CARBERRY REGISTERED certified #1, 96% germination. Superior agronomy package. Ready for pickup! Nakonechny Seeds, Ruthilda, SK., Call 306-932-4409. WWW.TRAWINSEEDS.CA Cert. SWW Sadash, GP Pasteur and CPS Crystal, Enchant VB. 306-752-4060, Melfort, SK. REGISTERED CDC GO Hard Red Spring wheat. 306-296-2104 or 306-296-7434, Frontier, SK. FDN., REG., CERT. CDC Utmost VB, AC Shaw VB, AC Vesper VB, AC Carberry, Cardale, Conquer VB (CPS red). Ardell Seeds, Vanscoy, SK, 306-668-4415.

LENTILS, CANARY AND CHICK PEAS.

Schluter & Maack & YELLOW MUSTARD All grades of Green Peas

Call GrainEx International Ltd. Laird & Richlea Lentils for current pricing at Yellow Peas 306-885-2288, Sedley SK. Visit us on our website at: www.grainex.net GRAIN LTD. Buyer of all varieties CERTIFIED CDC DAZIL, CDC Imax, CDC BESCO mustard. Call for competitive pricing. Impower. Hansen Seeds, Yellow Grass, of Call 204-736-3570, Brunkild, MB. SK., 306-465-2525, 306-861-5679. FOUNDATION, REGISTERED, CERTIFIED CDC Redcliff and CDC Maxim CL. Craswell Seeds, Strasbourg, SK., 306-725-3236. CERTIFIED #1 CDC Impower, CDC BORAGE WANTED. Dandilee Spice Corp. Greenland. Wiens Seed Farm, Brennan, is buying Borage seed for prompt delivery. Very attractive prices. Also offering 2014 306-377-2002, Herschel, SK. Production Contracts with early season CERT. CDC MAXIM CL, CDC Impower movement and Act of God clause. Contact CL Clearfield lentils. Order early for max Jack Valleau, Ridgedale, SK. 306-277-4208 d i s c o u n t s . V i s a / M C w w w. l l s e e d s . c a or Dandilee Spice Corp. 306-585-9080. 306-530-8433, Lumsden, SK. PARTNER WITH NORTHERN QUINOA. CERTIFIED IMPOWER, INVINCIBLE, New Competitive returns, 20 years agronomic CDC Scarlet Lentils, high germ, low dis- experience, guaranteed markets. Convenease. Phone Antelope Creek Ent. Ltd., tional and organic contracts available. 306-933-9525, Saskatoon, SK. 306-395-2652, Chaplin, SK.

1-306-771-4987


70 CLASSIFIED ADS

X-59 (He m p -N u t) he m p : - excellen tfibre q u a lity - n ew ben chm a rk forhem p p rod u ction - n ew g en etic ba s e d eliverin g a com p a ctlow -s ha tterin g hea d - top yield in g g ra in cu ltiva r - im p roved s tra ig htcu t ha rves ta bilty - excellen tecon om ic retu rn s

Ta b oa r f a b a b e a n : - low ta n n in cu ltiva r - excellen tN-fixer - m od era te s eed s ize forea s y s eed in g - s p otm a rk etcom m od ity con tra ct - a n im a l feed , hu m a n con s u m p tion , p rotein a n d  s ta rch m a rk ets

S k ylin e n a vy b e a n s : - ea rly m a tu rin g , low hea tu n it req u irem en t - a d a p ted to S E S K a n d W M a n itoba - g ood s ta n d a bility a n d p od clea ra n ce - $0.60/ lb s eed cos t-u n trea ted

Te rra m a x 306 6 99-736 8 Q u â&#x20AC;&#x2122;Appelle S K

THE WESTERN PRODUCER, THURSDAY, FEBRUARY 6, 2014

M illiga n B iofu e ls W AN TS YOU R CAN OL A

W e a re b uyin g a ll gra de s of ca n ola . #1, 2, a n d 3 a s w e ll a s h e a te d, gre e n , s p rin g th re s h e d. Top p rice s , fre igh t op tion s , de live ry con tra cts , p rom p t p a ym e n t. Bon de d a n d in s ure d.

LARGE ROUND BALES, Alfalfa/grass, 40$/each. Call 306-245-3756, Tyvan, SK. LARGE SQUARE BALES, alfalfa Brome crested wheat. Call 306-630-3078, Moose Jaw, SK.

LET U S M A N A G E Y O U R C A N O LA

WHY NOT KEEP MARKETING SIMPLE? You are selling feed grains. We are buying feed grains. Fast payment, with prompt pickup, true price discovery. Call Gerald Snip, Jim Beusekom, Allen Pirness, David Lea, or Vera Buziak at Market Place Commodities Ltd., Lethbridge, AB. Email: info@marketplacecommodities.com or phone: 1-866-512-1711.

BUYING YELLOW AND GREEN PEAS, all grades, farm pickup. Naber Specialty Grains Ltd., 1-877-752-4115, Melfort, SK. email: nsgl@sasktel.net

BUYING W INTER TRITICALE & 4010 SILAGE PEAS

FIRST CUT ALFALFA: 241-1600lb. JD net wrapped, $56/bale; 250-1500lb JD net wrapped, mixed grass feed, $42/bale. All bales feed tested. 306-364-4700 Leroy, SK SMALL SQUARE WHEAT straw bales for sale. Call 306-237-4406, Perdue, SK.

1-866-388-6284

w w w .m illiga n biofu e ls .c om

GREEN PEA SEED, new variety, 99% germ. Phone Antelope Creek Ent. Ltd., 306-395-2652, Chaplin, SK.

YELLOW PEAS, COMMON cleaned, high germ., prices reasonable. 306-562-8866, Canora, SK.

WANTED HEATED CANOLA. No broker involved. Sell direct to crushing plant. Also limited amount of #1 canola. Cash on delivery or pickup. 306-228-7306 or 306-228-1502, Unity, SK.

Green and/or heated Canola/Flax, Wheat, Barley, Oats, Peas, etc. BOW VALLEY TRADING LTD.

CLEANED HIGH BULK greenfeed OATS, 16,000 bu., 98% germ., $5/bu. if paid by Feb. 15. 780-872-3611, Lloydminster, SK. LACKAWANNA PRODUCTS CORP. Buyers and sellers of all types of feed grain MILLING OATS, good weight, good germi- and grain by-products. Call 306-862-2723, nation, no wild oats. Call 306-867-7716, Nipawin, SK. Outlook, SK. WANTED: FEED/ OFF-GRADE Pulses and tough, heated green oilseeds and also cereals. Prairie Wide Grain, Saskatoon, SK., 306-230-8101, 306-716-2297. TOP QUALITY ALFALFA, variety of grasses and custom blends, farmer to farmer. Gary Waterhouse 306-874-5684, Naicam, SK.

1-877-641-2798

ORGANIC SAINFOIN SEED, called â&#x20AC;&#x153;Healthy Hayâ&#x20AC;? in Europe (sainfoin.eu). An ancient, non-bloating, nutritious, low input, perennial forage loved by all animals. Better flavored meat and dairy. Call 306-739-2900, Wawota, SK. jhusband@primegrains.com or primegrains.com/prime-sainfoin.htm

TOP PRICES PAID FOR FEED BARLEY, WHEAT, OATS, RYE, TRITICALE, PEAS, LENTILS, HEATED OIL SEEDS

Saskatoon

WE BUY DAMAGED GRAIN

CERISE RED PROSO COMMON MILLET. Book early to avoid disappointment. 93%+ germ., 0% Fusarium Graminearum, makes great cattle feed, swath grazed, silage, dry and silage bales, drought tolerant, very high in protein and energy. Delivered in 50 lb. bags at nearest points in SK. and AB. Call Reynald at Millet King Seed of Canada Inc., St. Claude, MB., 204-526-2719 or 204-379-2987, leave msg. Cell and text 204-794-8550, all calls returned. Over 2000 satisfied producers and our 11th year in business. www.milletkingseeds.com or email: reynald@milletking.com

M USGRAVE ENTERPRISES Ph : 204.8 3 5.2527 Fa x: 204.8 3 5.2712

PEARMAN GRAIN LTD.

OFFERS ON A large volume of heavy oats and feed barley for sale. Call 306-874-7590, Naicam, SK.

GOOD SUPPLY OF most Alfalfas, Clovers and Grasses. Will blend hay and pasture blends to suit your needs. Call: Hetland Seeds at Naicam, SK. 306-874-5694. www.hetlandseeds.com

1-8 8 8 -3 28 -9 19 1

Priced at your b in.

Â&#x2039;-SL_PISLJVU[YHJ[PUNVW[PVUZ H]HPSHISLHZ^LSS

CLEANED COMMON DURUM seed, 97% g e r m i n at i o n a n d 0 % s p r i n g w h e at . 306-296-2104, Frontier, SK.

C a ll for your on fa rm b id .

Le th b ridge , AB.

Â&#x2039;([[YHJ[P]LVPSWYLTP\TZHUKMYLL ZLLKKLSP]LY`HUKVUMHYTWPJR\W

  JLSS    VMĂ&#x201E;JL JYVWZ'IPVYPNPUHSJVT

2500 ROUND WHEAT/ STRAW BALES, net wrapped for sale. Ph: 780-878-4655, Ferintosh, AB. 15,000 SQUARE ALFALFA and alfalfa/grass mix bales, 3x4x8, no rain, feed test done. Phone 306-648-7540, Gravelbourg, SK. LARGE SQUARE DURUM/STRAW bales, 3x4, $16/each. Delivery available. Call 306-631-8854, Moose Jaw, SK.

Â&#x2039;.YLH[WYVĂ&#x201E;[WV[LU[PHSIHZLKVU CANARYSEED, COMMON CLEANED. Wiens `PLSKZWYPJLZHUKSV^PUW\[JVZ[Z Seed Farm, call Brennan, 306-377-2002, Herschel, SK.

-VYTVYLPUMVYTH[PVU WSLHZLJVU[HJ[*HYS3`UU7(N VM)PVYPNPUHSH[!

Bu yers o f co n ven tio n a l a n d o rga n ic gra d es o f len tils , pea s , m u s ta rd , w hea t, b a rley, o a ts , rye, ca n o la , fla x, etc.

S OARIN G TO N EW HEIGHTS

370 LARGE ALFALFA bales for sale, 2011 crop. Call 306-436-4526. Milestone, SK.

TOLL FREE

RED LENTIL SEED, 2 varieties, high germ. and vigor, 0% disease. Call Byron Blackwell, 306-846-7222, Dinsmore, SK.

)PVYPNPUHS-VVK :JPLUJL*VYW IHZLKPU:HZRH[VVUHYLSVVRPUN [VJVU[YHJ[)VYHNLHJYLZMVY[OL \WJVTPUNNYV^PUNZLHZVU

EAGLE COM M ODITIES

WANTED: ALFALFA HAY. Call Brenton SHUR-LOK TRUCK TARPS and replacement Mundt, 403-664-9734, Oyen, AB. tarps for all makes of trucks. Alan, 1200 ALFALFA/BROME ROUND bales, 306-723-4967, 306-726-7808, Cupar, SK. 1600 lb. hard core, excellent quality. Call: 306-648-7656, Gravelbourg, SK.

HEATED CANOLA WANTED â&#x20AC;˘ GREEN â&#x20AC;˘ HEATED â&#x20AC;˘ SPRING THRASHED

LIGHT/TOUGH FEEDGRAINS â&#x20AC;˘ OATS â&#x20AC;˘ BARLEY

â&#x20AC;˘ WHEAT â&#x20AC;˘ PEAS

DAMAGED FLAX/PEAS â&#x20AC;˘ HEATED

â&#x20AC;˘ DISEASED

GREEN CANOLA â&#x20AC;˘ FROZEN â&#x20AC;˘ HAILED â&#x20AC;&#x153;ON FARM PICKUPâ&#x20AC;?

WESTCAN FEED & GRAIN

1-877-250-5252 XPELLER PRESSING. Offgrade oilseeds WANTED: FEED GRAIN, barley, wheat, needed! Lethbridge crusher looking for off- peas, green or damaged canola. Phone grade canola, flax, camelina and canola or Gary 306-823-4493, Neilburg, SK. flax screenings. Prompt payment. Phone: Darcy at: 403-894-4394, Lethbridge, AB. or email: xpellerpressing@gmail.com FLAX SEED, 98% germination. Hansen NUVISION COMMODITIES is currently Seeds, Yellow Grass, SK., 306-465-2525 or purchasing feed barley, wheat, peas and milling oats. 204-758-3401, St. Jean, MB. 306-861-5679. Email jsh2@sasktel.net

480 ALFALFA GRASS round bales and 80 alfalfa round bales. Asking $70/ton. 306-478-2625. Located at Mankota, SK. RM #369, FIRST cut alfalfa, no rain, 1500 lb. bales, net wrapped, 123 RFV. Call: 306-682-1704, Humboldt, SK.

306-374-1968

NOW B UYIN G O ATS!

AL L GRAD ES Com petitive Ra tes P ro m pt P a ym en t

SweetGrass CONTRACTING

COMBINE DUAL KITS IN STOCK, JD 94009600/10/CTS/CTSII kit w/o tires starts from $9,850; JD STS dual kit w/ new 20.8x38 tires, $15,046; CIH 1680-2588 kit w/ new 20.838 tires, $13,900. Trade in your singles for duals. Financing available. 1-800-667-4515. www.combineworld.com

LIQUID HUMIC ACID. Add Humika or PlantXL to existing fertility program to protect your liquid phosphorus (ie. Alpine/10-34-0) or nitrogen fertilizer investment from tie-up and allow your fertilizer to work more efficiently. Promote the growth of larger healthier root systems. Improve your soils health. Increase your crops yield. Ph. 519-749-5488, Bright, ON. Email: mosburgerfarms@hotmail.com

103 -3240 Id ylw yld Dr. N . S a s k a to o n

3 06 -9 3 3 -1115 TIRE & W HEEL

N EW STATE OF THE ART FACILITY

â&#x20AC;˘ PAS S EN GER, L IGHT TRUCK , S EM I, AGRICUL TURE, CON S TRUCTION â&#x20AC;˘ M ECHAN ICAL & AL IGN M EN T FOR CAR, BUS RV , TRUCK & TRAIL ER â&#x20AC;˘ TIRES /W HEEL S & CUS TOM DUAL & TRIPL E K ITS â&#x20AC;˘ TIRE V UL CAN IZIN G â&#x20AC;˘ 24 HOUR M OBIL E TRUCK S FOR ON S ITE W ORK

4 03 - 3 04 - 1 4 9 6

CHECK OUT OUR inventory of quality used highway tractors, view information at www.titantrucksales.com SCRAPER AND LOADER TIRES available. All sizes. Quick Drain Sales, Muenster, SK. Ph: 306-682-4520, 306-231-7318. GOOD USED TRUCK TIRES: 700/8.25/ 900/1000/1100x20s; 11R22.5/11R24.5; 9R17.5, matched sets available. Pricing from $90. K&L Equipment and Auto. Phone Ladimer at: 306-795-7779, Ituna, SK., or Chris at: 306-537-2027, Regina, SK. WANTED: USED 18.4x38, or 20.8x38 rears, prefer at least 75% tread. Call 306-531-6119, Balgonie, SK.

4 03 - 54 6 - 006 0

BUYING GOOD QUALITY hay, picked up or delivered, large or small quantities, CAN AD A p r o m p t p ay m e n t ! 3 0 6 - 2 4 5 - 3 3 1 0 o r LESS FUSARIUM MORE BOTTOM LINE. 701-340-3607, Tyvan, SK. Farmer directed varieties. Wheat suitable for ethanol production, livestock feed. Western Feed Grain Development Co-op Ltd., 1-877-250-1552, www.wfgd.ca WANTED LARGE YELLOW peas and Triticale. Call Norbert at Saskcan Parent 204-737-3002, St. Joseph, MB.

*5$,1 %8<,1*)(('*5$,1

:HDUHDIXOOVHUYLFHIHHG JUDLQLQJUHGLHQW VXSSOLHULQFOXGLQJPHUFKDQGLVLQJ GLVWULEXWLRQ DGPLQLVWUDWLRQ

BUYING WILD FURS, coyote, fox, coon, beaver, etc. in the whole or finished. Fur license or treaty number required. DL#5971. Call 306-889-2070 or cell 306-852-8802, madtrapper@hotmail.ca Mistatim, SK.

&*&OLFHQVHGDQGERQGHG www.jglgrain.com 877-907-1517 e:info@jglgrain.com 720 Duchess St - Saskatoon, SK 306-374-1517 L O O K I N G F O R A L L t y p e s o f fe e d grains, paying top dollar. Booking new crop. Prompt movement. 1-855-752-0116. www.cactuscommodity.com PASKAL CATTLE FEEDLOT Company in Lethbridge area, looking for feed barley. Call Roxanne at 1-800-710-8803.

SOLID CORE ROUND alfalfa, alfalfa grass, green feed, grass and straw. Delivered. Call 306-237-4582, Perdue, SK. 2013 ALFALFA, conventional and organic, 1500 lb. bales, net wrapped, hard core, JD baler. 306-370-8897, Tessier, SK.

POLY TANKS: 15 to 10,000 gallons; Bladder tanks from 220 to 88,000 gal; Water and liquid fertilizer; Fuel tanks, single and double wall; Truck and storage, gas or dsl. Wilke Sales, 306-586-5711, Regina, SK.

M AGNUM TANKS â&#x20AC;˘ U P TO 1 000 GAL L O N Financing â&#x20AC;˘ ISO 9001 :2008 available. Appro ved Inqu ire â&#x20AC;˘ SINGL E W AL L SQ U AR E TANK at ou r â&#x20AC;˘ TR ANSP O R T CANAD A AP P R O V ED dealers. Available at Magnum Fabricating & our dealers

w w w .m a g n u m fa brica tin g .com

M AGN UM F ABR ICATIN G LTD . M a ple Creek, SK P h: 306-662-2198

BULK FUEL TANK Clearance Sale at Saskatoon Co-op Agro Center. Single wall and double wall bulk fuel storage tanks, brand new but older models, some have slight cosmetic damage. From 500-7500 gal. in stock and ready to go. Pumps and accessories available. Call 306-933-3834 or 306-385-3434 for details and prices.

TARPCO, SHUR-LOK, MICHELâ&#x20AC;&#x2122;S sales, service, installations, repairs. Canadian company. We carry aeration socks. We now carry electric chute openers for grain trailer hoppers. 1-866-663-0000.

Portion oftours m a y b e Ta x Ded uc tib le.

Se le ct Holida ys

1- 800- 661- 432 6 w w w .selectho lid a ys.co m

PTO AUGER WATER PUMPS, 6000 gal. per minute. Simple, tough, NO Prime. Handles mud, ice, plants, other debris. Call Jan 204-868-5334, Newdale, MB. 6â&#x20AC;? FAIRBANKS MORSE water pump w/4 cylinder Ford Industrial engine on trailer, approx. 1/2 mile lay flat 4â&#x20AC;? Cam Lock connector hoses. 780-663-2201, Ryley, AB.

NEW TO CANADA, Ecosmarte/Advanced pure water. Guarantee 99% pure, no salts, chemicals, or chlorine. Good for residential, farm and town systems, hot tubs and swimming pools. Phone 306-867-9461, Outlook, SK. Dealer inquiries.

D AV E K O EH N

L IN D EN ,AL BER TA

Ja pa n ~ M ay 2014 Irela n d & S co tla n d ~ June 2014 Uk ra in e ~ June 2014 Yu k o n /N W T ~ July 2014 Icela n d /Green la n d ~ July 2014 M id -w es t US A ~ O ctober 2014 Au s tra lia /N ew Zea la n d ~ Jan 2015 K en ya /Ta n za n ia ~ Jan 2015

ONE SET GOODYEAR radial 20.8x38 duals off JD 7800 Series tractor, tires 60%-70%, $5000. 306-267-4471, Coronach, SK.

Linden, AB

P AUL M O W ER

GOT FROZEN PIPES? We can help. www.arcticblaster.com Call 403-638-3934, Sundre, AB.

RURAL & CULTURAL TOURS

LARGE ROUND ALFALFA brome mixed hay. Call 306-764-6372, Prince Albert, SK.

WANTED: ALFALFA/GRASS, large round bales and feed barley. We are interested in all quantities of hay and feed grain delivered to the ranch. Call 306-734-9001, Brownlee, SK. CUSTOM BALE HAULING with 2 trucks and t r a i l e r s , 3 4 b a l e s p e r t r a i l e r. C a l l 306-567-7100, Imperial, SK.

REDUCED TO CLEAR: Over 1500 new and used tires. About 300 for farm applications, balance industrial construction type, many sizes up to very very large. Cambrian Equipment Sales. Phone 204-667-2867, fax 204-667-2932, Winnipeg, MB.

REMOTE PIPE CRUSHER with 6â&#x20AC;? ram, 5 HP 230V, remote hyd. system; 3 HP 230V 14â&#x20AC;? HD cut-off saw. 780-663-2201, Ryley, AB.

SECOND CUT ALFALFA round bales, no rain, heavy hard core bales. Feed tests avail., $90/bale. 306-270-2893, Clavet, SK

WA N T E D : A L FA L FA / G R A S S lar ge round bales. We are interested in all qualities of hay delivered to the ranch. Call 306-638-3051, Bethune, SK. ALFALFA AND ALFALFA/grass, large sq., tested, all certified organic. Glenboro, MB. 204-827-2629, 204-526-7139.

E I G H T 7 1 0 - 7 0 x 3 8 T R AC TO R T I R E S, available in April, $600 ea. 780-763-2487 or 780-853-7010, Mannville, AB.

CLAMP ON DUALS 20.8 x 38 Titans in very good condâ&#x20AC;&#x2122;n, adapts to 30.5x32 inside rims, w/ adapters & hardware. $5,250. Trades welcome. Financing available. 1-800-667-4515. www.combineworld.com

NEW 20.8-38 12 PLY $765; 16.9-30 12 ply, $495; 18.4-38 12 ply, $789; 24.5- 32 14 ply, $1,495; 14.9-24 12 ply, $486; 16.9-28 12 ply, $558. Factory direct. More sizes available, new and used. 1-800-667-4515, www.combineworld.com

WAT E R T R E AT M E N T for the whole house to commercial units, hot tubs and pools. Over 50 years experience. No salt, chemicals or chlorine. 99% pure, 100% satisfaction or your money back. Also offering WWQ ionizers and portable ultra-sonic flow meters. Contact Bob 403-620-4038, Prairies Water, High River, AB.

KORNUM WELL DRILLING, farm, cottage and acreage wells, test holes, well rehabilitation, witching. PVC/SS construction, expert workmanship and fair pricing. 50% government grant now available. Indian Head, SK., 306-541-7210 or 306-695-2061 STAUBER DRILLING INC. Water well drilling and servicing, Geotechnical, Environmental, Geothermal. Professional service since 1959. Call the experts at 1-800-919-9211 info@stauberdrilling.com

SALE BY TENDER PLAINS LIVESTOCK INC. Plains Livestock Inc. (â&#x20AC;&#x153;Plainsâ&#x20AC;?) operated a 10,000 head capacity custom cattle feedlot located approximately 70 kms east of Tisdale, SK. The facilities include four (4) quarter (1/4) sections of land, feedlot pens, indoor and outdoor shipping and handling facilities, feed storage and processing equipment, a residence, an office, various other storage buildings, agricultural equipment, trucks, related tools and supplies. Deloitte Restructuring Inc., in its capacity as Receiver of Plains invites tenders for the purchase of the Receiverâ&#x20AC;&#x2122;s right, title and interest, if any, in the assets of Plains on an en bloc basis. All tenders must be sealed and marked â&#x20AC;&#x153;TENDER â&#x20AC;&#x201C; PLAINS LIVESTOCK INC.â&#x20AC;? and be delivered or mailed, postage prepaid, to Deloitte Restructuring Inc. at Suite 400 PCS Tower, 122 â&#x20AC;&#x201C; 1st Avenue South, Saskatoon, SK S7K 7E5 no later than 5:00 pm Saskatchewan time on Friday, February 28, 2014. Every tender submitted shall be in the form of the tender prescribed in the Sales and Information Package. The highest or any tender will not necessary be accepted. To obtain a copy of the Sales and Information Package and/or to arrange an appointment to view the assets, please contact Jasmin Calyniuk at (306) 343-4475 or by fax at (306) 343-4240.


THE WESTERN PRODUCER, THURSDAY, FEBRUARY 6, 2014

U-DRIVE TRACTOR TRAILER Training, 25 years experience. Day, 1 and 2 week upgrading programs for Class 1A, 3A and air brakes. One on one driving instructions. 306-786-6600, Yorkton, SK.

SWINE HERDSPERSON, full-time permanent position at Sunderland Hog Farms Partnership. Duties: Supervise breeding programs; Perform farm duties; Formulate feeding program; Recognize and treat certain hog’s health problems; Supervise farm operations; Develop work schedules and establish procedures; Maintain quality control and production records; Maintain hog performance records; Train workers. Benefits: clothing for inside work at our barns and boots. Requirements: Grade 12. 3 yrs. experience or post secondary certificate. Extended work hours as needed, evening/early mornings or weekends. $14.68 to $17/hr, 40 hrs/week. Send resume to Sunderland Hog Farm Partnership c/o Dale Sunderland, Box 160, Paradise Valley, AB., T0B 3R0. Fax 780-745-2888, e-mail: dale.sunderland@hotmail.com

BE A U of S student here! Small class sizes, less tuition, more personalized attention from Profs! On-campus residence. Start your university education for: Ag, Vet Med, Education, Nursing, Social Work, Engineering, Commerce, Pharmacy, Kinesiology and more! Fitness centre, rink. Over $40,000 in SPC scholarships available plus eligible U of S scholarships! Muenster, SK. E-mail: lholowaty@stpeters.sk.ca or FULL TIME POSITION available on large grain farm. Duties include: Operating and www.stpeterscollege.ca maintaining newer JD and NH equipment. Class 5 license required, Class 1 an asset. Well equipped heated shop to work in. Home cooked meals available. Must be SEASONAL FULL-TIME Riding position willing to work in a team environment. available on Connor Creek PGR. Must have Non-smoker. Competitive wages dependriding, roping and cattle health exp. Pref- ing on experience. Kincaid, SK. Phone erence given to applicant who will use 306-642-7880 or fax 306-264-3664. Email: available accommodations. Wages nego- laneview@hotmail.com tiable. Call 780-674-1759, 780-674-4121, Barrhead, AB. FULL-TIME FARM LABOURER HELP. Applicants should have previous farm exCERTIFIED ORGANIC MIXED FARM in perience and mechanical ability. Duties the north Okanagan, with beef, sheep, and incl. operation of machinery, including dairy, hay, irrigation looking for experi- tractors, truck driving and other farm enced farm help. Duties in all areas of the equipment, as well as general farm laborer farm. $40,000 per year. Housing available. duties. $12-$18/hr. depending on experiMeat allowance. Apply with references to: e n c e . C o n t a c t W a d e F e l a n d a t valefarms@telus.net Fax 250-547-6080, 701-263-1300, Antler, North Dakota. call 250-547-2382, Lumby, BC. GRAIN AND CATTLE FARM requires addiFULL-TIME PERMANENT farm/ranch tional employees, experience w/operating position in Cypress Hills, SK. Cattle experi- 2 and 4 WD tractors, tandem trucks, balence and Class 1 beneficial; machinery and ers, high clearance sprayers, grain carts, basic mechanical experience a must. grain baggers and retrievers, TMR feed Stable job record, reliability, work history, trucks, bale shredders, fence pounders and resume and references required. Housing general farm equipment maintenance. available. Possible land or cattle partner- Class 1A license and mechanical experiship. 306-295-4050, Eastend, SK. ence are assets. Hourly wages $18-$25/hr. on experience. Excellent acLOOKING FOR FARM help? Looking for depending are avail. Starting April 15. farm work? Agemploy.com can help with commodations References Fax resume to: both. We are the top Ag Employ site for 780-826-7370,required. Email: rsbeef@yahoo.ca or farm employment. Serving Western Cana- call Roger 780-812-4471, Bonnyville, AB. da, MB, SK, AB, BC. Phone 403-732-4295 or e-mail: agemploy@gmail.com PERSON REQUIRED TO work with farm management on an irrigation farm located LESANN LAND AND CATTLE COMPANY in the east Saskatoon, SK. area. Operating looking for a full-time employee on mixed knowledge of seeding and harvesting grain and cattle farm. Duties include oper- equipment mandatory, 1A an asset, fullating and maintaining all cattle and grain time year round employment available. machinery, haying, calving, and grain re- Reply to timmermanj@yahoo.com lated duties. Cattle experience a must, valid driver’s licence needed and Class 1 an asset. Wage between $18 to $25 an hour. based on skills and experience. Call Joel at 204-623-4357, The Pas, MB or email us at: lesannjp@gmail.com References required. CUSTOM HARVEST HELP wanted for 2014 USA harvest. Combine and truck drivers needed as well as grain cart operators. Must have clean driving record. Full room and board provided plus wages. Fill out application www.carlsonharvesting.com Goodridge, MN. WANTED: DELAGE FARMS LTD., a large modern grain farm north of Indian Head, SK. requires 1A Truck Drivers and Equipment Operators for modern, well maintained machinery. Duties may include seeding, spraying, swathing, combining, trucking (Super B, tridem axle trailers) and general farm duties. Farm experience preferred. Competitive wages base on experience. Send resume to: Marc Delage, email: marc@delagefarms.ca Fax: 306-695-2608 Call: 306-695-3959. FULL-TIME OR SEASONAL POSITIONS on cow/calf and grain farm. Class 5 license required. Class 1A an asset. Modern JD equip. Duties include: operating and servicing equipment, working with cattle, field work and other general farm duties. Housing available. Call 306-648-8081, fax: 306-264-5179, Kincaid, SK. hts4@live.com FULL-TIME AND SEASONAL help needed in operating a large modern grain farm. Preference given to experience as a Mechanic’s helper and Class 1 driver’s license an asset. Wages based on experience, range $12-20/hr. but not limited to. Housing available. Galvin Farms Ltd., Virden, MB., 204-748-8332, john@galvinfarms.com WANTED: FARM LABOURERS able to run farm equipment on cattle/grain farm. F u l l - t i m e wo r k ava i l a b l e . C a l l M i ke 306-469-7741, Big River, SK. HELP NEEDED TO calve 130 cows, starting March 1st, room and board available. 403-652-7253, High River, AB. FULL TIME AND seasonal positions on a seed farm in Melfort, SK. Must be able to run large modern equipment and work independently. Willing to train the right person. Mechanical experience and/or 1A license a definite asset! Very competitive wages and benefits. Flexible hours in summer and winter. Great snowmobiling trails and fishing! Fax resume to: 306-752-9676 or email: abeuker@sasktel.net FOUR PART-TIME SEASONAL farm labourers wanted for farm near Carnduff, SK. Experience in the operation of planting and harvesting equipment and Class 1A preferred, $18/hr. Call Paul 701-263-7013. BEEKEEPER’S HELPERS (5), for the 2014 season May to Oct, $12-$15/hr depending on experience. Contact Ron Althouse, 306-278-2747, Porcupine Plain, SK. FARM HELP WANTED: Two positions available for general farm work, Alsask, SK. Class 1 license needed, training possible. Wages negotiable depending on experience. Call 403-664-9878 or send your resume to: heathermundt@gmail.com

FARM MANAGER/ LABOURER for our 4000 acre contemporary grain farm with current equipment. We are looking for a self-motivated experienced person to run our farm. Experienced in all farm activities including seeding, spraying, harvesting, etc., as required. Mechanical aptitude and welding skills considered assets. Applicant should have good communication skills and be able to manage one or more employees. Valid driver’s license is required. Nine hour days, except variations dictated by season, and weather, or job timeliness. Weekends off except when the farm work dictates otherwise. Position can be full-time or seasonal, negotiable. Wages $20-$30/hr. We would consider, for the right employee, help in getting started farming or a co-farming arrangement. Contact Stan or Donna Yaskiw, Birtle, MB., 204-796-1400 or 204-842-5252.

CLASSIFIED ADS 71

MARDELL FARMS LTD., a large, modern grain farm operation, located at Snowden, Hoey, Aberdeen and Colonsay, SK, is currently seeking Seasonal Farm Labourers/Equipment Operators for the 2014 cropping season. Duties may include: O p eration and maintenance of equipment; Regular maintenance of farm yards, buildings, etc; Construction of farm buildings; General day to day tasks for operations of the farm and farm camp; Other duties as they arise. Requirements: Excellent communication skills; Extensive farm experience with modern machinery; Mechanically inclined; Energetic; Self-motivated; Work independently and/or in a team atmosphere; Willing to work long hours when necessary; Valid driver’s license mandatory w/clean driver’s abstract; Class 1A an asset. Employment Details: Room and board avail.; Salary $3200-$5000/mo. based on experience; Work commences April 1 - October 31, 2014. Seeding and/or harvest only positions also available. Email detailed resumes to Mardel Farms Ltd at: mardellfarmsltd@sasktel.net

FULL-TIME PERMANENT FOREMAN position on 10,000 acre grain farm in Lampman, SK. Must be willing to work long hrs. during seeding, spraying and harvesting seasons. Successful applicant should have: Class 1A license with clean abstract; Farm management education including basic Agronomy and Farm Apprenticeship training; Experience operating modern JD equipment w/ability to program and operate John Deere’s AMS technology. Other duties include: Hiring, training and managing farm employees; Maintenance of all farm equipment; All crop spraying operations and coordinating swathing and harvest operations, $3600/month. Phone Ole Michaelsen at 306-487-7816 or fax: 306-487-2770, Michaelsen Farms Ltd., Box 291, Lampman, SK., S0P 1N0.

EMPLOYMENT OPPORTUNITY near Mossbank, SK. for reliable self-motivated person interested in large grain farm operation. Applicant should be experienced in mechanics, operating large farm machinery and able to take on farm tasks indeHELP WANTED FOR 1800 acre grain farm, pendently. Class 1A an asset. Great wages April 15 to Oct. 31. $12-$18/hr, depending available. Phone Mike 306-354-7822 or on experience. 306-335-2777, Abernethy. email: nagelm44@hotmail.com AARTS ACRES, 2500 sow barn near Solsgirth, MB is seeking experienced Breeding WE ARE LOOKING for a Ranch Foreman. and Farrowing Technicians. The successful Our operation consists of purebred beef applicant must possess necessary skills, an cow/calf, bull backgrounding feedlot for aptitude for the care and handling of ani- our annual bull sale. We do a tremendous mals, good communication skills and amount of work with rotational grazing ability to work as part of a highly produc- and electric fence as well as perimeter tive team. Fax resume to: 204-842-3273. wire fencing. The ability to find and treat or call 204-842-3231 for application form. animals is very important. We are not looking for someone who just wants to FULL-TIME HELP for a large grain farm in ride, this is a modern working ranch that SE Sask. Looking for an honest, reliable uses horses, but also uses quads, trucks person w/experience in operating and and your ability to walk. You would be reserving farm equipment, mechanically in- sponsible for supervising several other clined and 1A license would be an asset. ranch employees, delegating work and enCompetitive wages based on experience. suring the work is completed. We do farm Housing available, excellent opportunity and crop about 1000 acres for feed but for a young active family. School and most of our land is pasture. We bale hay shopping 15 min. away. Please provide 2 and straw. A Class 1 would be very useful, references. Fax resume to: 306-449-2578, but not necessary as long as you are willor email to: triplebfarms@starband.net ing to obtain it. We truck our own cattle Ph evenings 306-449-2412, Storthoaks, SK and haul our own feed. Mechanical ability would prove to be an asset. We have modFARM MANAGERS/ SUPERVISORS with ern housing in the yard for the right candipost secondary diploma or university date. We live close to Lloydminster so equivalent (NOC Code 8251). Three full- work or school is 15 minutes away. Wages time permanent positions on larger grain paid according to experience and ability. farm, Terrador Farms Inc., near Oxbow, SK Company Health Care Plan offered. Duties include: planting, fertilizing, spray- Scheduled days off with the exception of ing and harvesting crops as well operating, busy seasons. Please email your resume, maintaining all farm machinery, supervis- references and driving abstract to the foling and training farm employees. Wages lowing: info@hill70quantock.com or fax $3600/mos. Fax resumes: 306-483-2776. to: 780-875-8332 or you can call us: Hill Mail: Box 368, Oxbow, SK. S0C 2B0. 70 Quantock Ranch Ltd., Lloydminster, AB. Email: terrador.farms@sasktel.net Call 780-875-8794 ask for Bill or Sherry. Gerry at 306-483-7829 for more info. LOOKING TO HIRE RANCH MANAGER/ Assistant Manager. We are a family run Black Angus purebred/ commercial ranch. Looking for a person or couple wanting to be hands on operator/s with all aspects of the day to day ranch operations. Position available ASAP, wages negotiable depending on experience. Housing available on site, but in a separate yard. Email resume to: 66@66ranchltd.com or fax to: 403-378-4320, Duchess, AB. A MIDDLE AGED couple running a 200 head cow herd NE of Edmonton are looking for a young person or couple to assist with the responsibilities of operating a successful cow/calf operation. An excellent opportunity to develop your own herd and experience a way of life. To schedule a p e r s o n a l i n t e r v i e w, p l e a s e p h o n e 780-656-5665, Newbrook, AB.

FARM RANCH POSITION AVAILABLE for general farm and ranch work. Resume and work experience helpful. State wages expected. Housing could be available. Non GENERAL FARM LABOURER for our smoker preferred. Mail resumes to: PO Box 4000 acre contemporary grain farm 382, Cochrane, AB. T4C 1A6. w/current equipment. We are looking for a self-motivated experienced Farm Labour- MACHINERY OPERATOR NEEDED for our er. Experience in all farm activities includ- farm, full or part-time. Must have some ing driving trucks, tractors and using farm operator and basic mechanical skills. equipment an asset. Other duties would Wages dependant upon level of experibe: machinery and building maintenance, ence. Phone 306-642-5806, Assiniboia, SK. yard and farm work. Must be able to work with limited supervision. Would be willing CHERHILL RANCH IS currently hiring a to train. Valid drivers license is required. pasture rider for Apr. 15th to Nov. 1st Position can be full-time or seasonal, ne- grazing season. Pasture Riders are regotiable. 8 hours a day unless dictated by quired to check, treat and move cattle on the season or weather. Some weekend horseback, repair, maintenance fence and work is required. Wages $17-$21/hr. de- water. Call: 780-983-4088, Cherhill, AB. pending on experience and ability. Contact S t a n o r D o n n a Ya s k i w, B i r t l e , M B . SHEWCHUK FARMS is looking for experienced help on mixed grain and cattle farm, 204-796-1400, 204-842-5252. Class 1A and farm experience is an asset, SEASONAL FARM LABORER required. Must wages based on experience. Call Shawn at have some farm exp. w/mechanical weld- 306-287-7880 or farm at: 306-287-3763, ing ability or Class 1A license. Preference Watson, SK. given to applicants experienced in both. May 1 to Oct. 31. $15-$25/hr. 101008187 LOWE RANCHES LOOKING for someone to SK Ltd., Corey Fehr, Call: 306-338-7561 or aid in the care and maintenance of livef a x : 3 0 6 - 3 3 8 - 3 7 3 3 , W a d e n a , S K , stock. Responsible for feeding, cutting hay, calving, etc . $12.50/hr. Email: cfehr9860@hotmail.com lowe.tyson@gmail.com Must have some HELP REQUIRED FOR calving cows, start- training or experience, Nanton, AB. ing March 1st. Hutterites welcome. LARGE MIXED FARM near Chauvin, AB. 306-753-2667, 306-753-7244, Macklin, SK w/newer equipment, looking for full-time farm workers. Must have proof of valid driver’s license. Housing is available. Email resume: schopferfarms@gmail.com or call FAMILY RUN GRAIN farm in Lipton, SK 780-842-8330 for more info. area, is hiring for a full-time position. Wanted, an experienced individual with 1A ESTABLISHED AG RETAIL centre located license and farming background. Must be in Mossleigh, AB. seeking full-time agriculable to work with large, modern equip- tural equipment operator; also, seasonal ment. Housing available. Wage based on equipment operators and truck drivers. experience. Start date: April 2014. Call Email: cneustaeter@pandh.ca or call Cornelius at: 403-534-3961. 306-675-5703 or email tltlutz@sasktel.net

SMITH SEEDS IN Limerick, SK has one full time permanent position for a Grain Crop Foreman to oversee the operation of the seed plant and workers, liaise with clients, arrange work and operating schedules, establish procedures, record keeping and general farm duties. Wages $15.50 per hour. Forward cover letter and resume to Ron at: smith.seeds@sasktel.net or fax to 306-263-4922. SEASONAL OR FULL-TIME Farm Labourer/Equip. Operators required by Cocajen Farms Ltd. A large family run grain farm near Prince Albert, SK. Duties include: operation and maintenance of farm equipment and vehicles, and building and yard maintenance as required. Must be able to work independently and have at least 1 yr. experience operating large farm equipment. Must have basic computer skills, valid driver’s license and ability to work extended hours during busy time. Wages $15-18/hr. depending on experience. Seasonal work commences May 1st to Nov. 1st, 2014. Apply with resume: Cocajen Farms Ltd., 43 Kernaghan Cres., Prince Albert, SK., S6X 1C8, ph/fax 306-929-2990 kellymacpherson@hotmail.com

WANTED FULL-TIME FARM worker for large semi-remote NE BC ranch. Must be able to work flexible hours under various weather and environmental conditions. Strong mechanical aptitude is required for operating equipment, repair and maintenance. Wages are $15.50/hr. and housing is available. For more information, or to apply, email: cfl@pris.ca Fort St. John, BC. RANCH HAND for large cow/calf operations in south AB. and east central SK. Duties: calving, feeding, haying, etc. Relevant experience required. Wages as per experience. Start Feb. 1st. Ph. 403-308-4200. EL-NELL FARMS LTD. requires 4 full-time Dairy Farm Workers, near Weyburn, SK. Duties: feed and tend livestock, milk cows, operate skidsteer to clean barn, detect disease and health problems in livestock, clean stables, barns, barnyards and pens, feed calves, mix feed in a batch mixer. Salary: $15/hr. depending on experience. Benefits: disability, life, dental and health after working 3 months. Experience: dairy farm knowledge and experience preferred, not required. To apply fax/email resume: 306-842-6090, hopper@yourlink.ca Attn Pamela.

FULL-TIME FARM LABOURER needed for grain farm in SE SK. Duties include: machinery operation and other farm duties, Class 1A preferred. Housing available. $18-$20/hr. dependant on experience. 306-452-7743, Redvers, SK. FARM LABOURER FULL-TIME permanent position available at DR Land & Cattle Ltd. near Esther, AB, mixed farm, remote rural. Duties include but not limited to: cattle help, herd health, calving, seeding, harvesting, spraying, haying, and general farm operation and maintenance. Experience operating machinery and High School diploma are assets. Wages $16 hourly, 40 hrs/wk. Onsite accommodation available. Email, mail or fax resume to hestrankmans@xplornet.com Box 430, Esther, AB, T0J 1H0, fax 403-552-2132. LARGE MIXED FARM in Alberta’s peace country looking for: Manager/Operator/ Joint Venture Partner. Farm is combination of agriculture land and cattle operation. Unique opportunity for the right individual. Flexible on structure, anything from salaried Manager to Joint Venture Partner, in crop and/or cattle operation. Do you have your own equipment or cattle, but can’t afford land? We can help. Interested parties please send resume to: Unit 720, 903-8th Ave SW, Calgary, AB. T2P 0P7. Or e-mail: dkaye@postellenergy.com

FULL TIME POSITION available on cattle operation. Duties include: Check and maintain cattle and grass; Help process, feed and look after cattle in a small feedlot; Help with haying operations. Class 5 license required. Non-smoker. Competitive wages depending on experience. Home cooked meals available. Kincaid, SK. Phone 306-642-7880 or fax 306-264-3664. Email: laneview@hotmail.com FAMILY RUN LARGE cow/calf operation located in SW SK. is looking for ranch help. Experience with cows and horses an asset. Wages negotiable w/experience. Housing provided. Info. ph. 306-623-4208, Sceptre, SK., or email bmcmahon09@gmail.com HELP WANTED ON MIXED FARM: Some cattle experience an asset. New shop for anyone mechanically inclined. Driver’s licence a must, 1A an asset. Must be willing to do manual labour and operate and maintain equipment. Paynton, SK. Send resume to: buggfarms@hotmail.com Ph/fax 306-895-4601.

120,000 print and 65,000 online Western Producer readers know us for our great content... but when it comes to classifieds you know us for our great service. in print and online next day! When it’s time to sell, turn to The Western Producer’s team of Classified Sales Associates. Our product knowledge, marketing strategies and access to qualified buyers is unmatched in this industry. Place your classified word ad with us and view it online within the next business day. Call NOW and talk to the experts at...

CALL US AT: 1-800-667-7770 | CLASSIFIEDS.PRODUCER.COM Monday to Friday, ads will be posted online within one business day. Real Time online will be placed a maximum of 11 days prior to first print insertion.


72 CLASSIFIED ADS

GRAIN FARM SUPERVISOR required on Hartman Farms, Elrose SK. Send resume with 3 references to: Box 568, Elrose, SK, S0L 0Z0. Email sales@khartindustries.com Full-time experienced. Co-ordinating workers, grain operations, production records, work schedules. 75% duties: planting, harvesting, spraying and equip. maintenance. 25% at K- Hart Industries in winter. Duties: basic welding, fabrication and assembly. Work hours: 8 hrs/day, 40 hrs/week, Cdn $22-$24/hr. See www.khartindustries.com PERMANENT FULL-TIME HELP required to start as soon as possible by a family owned grain and cow/calf farm by Milden, SK. Requires helping and working with others at all aspects of the operation. Avg. 40+hrs/wk. Starting $15/hr., accommodations avail., vehicle supplied for work. Located 1/2 mile from Milden with school bus to the door. Willing to train. Please contact Gordon Head 306-831-8296. HELPER WANTED ON mixed farm. Steady job for right person. Room and board avail. 403-631-2373, 403-994-0581, Olds, AB.

THE WESTERN PRODUCER, THURSDAY, FEBRUARY 6, 2014

PATROL OPERATOR REQUIRED. Applications are presently being accepted for a seasonal, full-time, Patrol Operator for the Rural Municipality of Glenside No. 377. Grader experience preferred but may consider applicant with heavy equipment experience. Mechanical skills are preferred. Initiative, ability to organize duties and time management skills are required. Class 1A driverâ&#x20AC;&#x2122;s license with air endorsement is an asset. The position offers pension, health and dental benefits and disability coverage. Please forward resumes including references, experience, driverâ&#x20AC;&#x2122;s license PIC# and salary expected by March 6, 2014 to rm377@sasktel.net or mail to: RM of Glenside No. 377, Box 1084, Biggar, SK. S0K 0M0. We thank all applicants for their interest. Only persons selected for interviews will be contacted. EXPERIENCED RANCH HELP needed for Pigeon Lake area, 1 hour SW of Edmonton. 300 cow/calf pairs, 2000 yearlings. Housing incl. 780-621-0981, Westerose, AB.

GRATTON COUL EE AGRIPARTS L TD. Is a pro gre s s ive , e xpa n d in g a gric u ltu ra l s a lva ge pa rts c o m pa n y s pe c ia lizin g in la te m o d e l tra c to r a n d c o m b in e pa rts a n d lo c a te d a tIrm a , Alb e rta . W e a re looking for

M E CH ANICAL AS S E M BL E R S

(4 va ca n cies ) Perm a n en t, fu ll tim e p o s itio n s -44 hrs p er w eek. S a la ry $19.25 to $20.00/hr. Va lid d rivers licen s e. Previo u s exp erien ce a n a s s et. To a pply fo r a po s itio n w ith u s , plea s e e-m a il res u m e to : m a rc@ gcpa rts .co m o r s en d fa x to 78 0-754-2333 Atten tio n : Alvin W a n n echk o

ALL CANADIAN GRAIN, INC. Lafleche, SK. is seeking a full-time equipment operator in South West Sask. Duties include organizing and performing maintenance tasks, hauling inventory, and all tasks relevant to seeding, spraying, and harvest operations. The successful candidate will be a self-motivated team player capable of working independently. A valid driverâ&#x20AC;&#x2122;s license is required, a Class 1A license is an asset. Training will be provided along with medical benefits and holiday time. Starting S C O O P L A K E O U T F I T T E R S i s h i r i n g wage $20/hr. Email resume and referenc- Sheep/Elk Guides for our season. We operate in NE BC in Region 751/52. Applies to: shawn@allcanadiangrain.com cant must be comfortable in a remote loRM OF ARLINGTON #79. Applications cation (100 air miles from town) for 3 are now being accepted for a Grader/ months. Must have guiding experience for Equipment Operator. This is a seasonal sheep and elk. Horse experience an asset. position with possibility of full-time. Start- Successful applicant should have experiing date to be discussed at interview. The ence with international clients, outdoor ideal candidate must have experience in cooking skills and wilderness living. Good the operation and maintenance of: grad- communication skills and working as a ers, tractors, mowers, rockpickers; be will- team essential. Wages are based on expeing to carry out other duties that the coun- rience and meet current industry stancil may assign; have a valid driverâ&#x20AC;&#x2122;s license dards. Due to our remote location room and a pickup truck; be able to work with and board is supplied. Please email reminimal supervision; be able to work well sume to info@scooplake.com Watson with others; have a valid Power Mobile Lake, YT. Equipment Certificate or be willing to ob- PRIME MOVER/MULCHER Operators tain same. The municipality offers a com- Ace Vegetation is hiring Mulcher, Hydropetitive wage and benefits package. Sub- Ax and Posi-Track operators. Class 1 lim i t w r i t t e n a p p l i c a t i o n s s t a t i n g cense an asset. For details 780-955-8980. experience, wages expected, including Send resume to: ACE at 2001 - 8th St., work related references by 5:00 PM, Feb. Nisku, AB., T9E 7Z1, fax: 780-955-9426 or 20, 2014 to: RM of Arlington No. 79, Box email: acemail@acevegetation.com 1115, Shaunavon, SK. S0N 2M0, Fax: 306-297-2144, email: rm79@sasktel.net RM OF CHESTERFIELD is hiring Seasonal Note: We thank all applicants for their in- Grader and Buggy Operators, April to Nov. terest, however, only those selected for an State wage expected. Fax: 306-967-2424 or reply to: Box 70, Eatonia, SK, S0L 0Y0. interview will be contacted.

3 FORKLIFT OPERATORS needed for night shift. Full time, year round employment. Hours: From 2:00PM to 10:30PM, $16.00$20.00 to start depending on experience, plus benefits (after probationary period). Work experience as forklift operator is an asset but not required. Apply with resume to: Igloo Building Supplies Group Ltd., 21421-111 Ave, NW, Edmonton, AB, T5S 1Y1. Fax to: 780-447-3247, or e-mail to: HR.Resource@igloo.ca

GC JENSEN ACRES INC. seeking multiple general farm workers to assist with seeding and harvest operations near Milden, SK. Duties include: operating machinery, maintenance, yard work. Minimum hours 8 AM- 5 PM, Monday to Friday, Apr. to Oct. Starting $15/hr+, includes accommodation. Must be able to work well and communicate with others. Farm experience an asset. Box 10, Milden, SK. S0L 2L0. Call 306-935-4523, fax resume: 306-935-2201.

APIARY WORKERS: 3 positions available, applicants should have a minimum of one yr. experience in commercial beekeeping. Duties include general work related to the management of honey bee colonies, such as: feeding, applying medication, requeening, splitting, starting nucs, harvesting and processing of honey. Full-time seasonal April to Sept., $11.35/hr. Apply to: Hilbert Honey Co. Ltd., Humboldt, SK., phone 306-682-3717, fax 306-682-3096.

PARTS PERSO N REQ UIRED

RM OF ROSEDALE No. 283 is accepting applications for a full-time Seasonal Grader Operator with duties to commence the spring of 2014. The position has the potential to become a year-round position. Primary duties will be the operation and general maintenance of the grader. General duties will also be assigned by the Foreman when needed. Having a Class 1A license and mechanical skills would also be an asset. Please forward resume to the undersigned stating experience, salary expected, include a current driverâ&#x20AC;&#x2122;s abstract, and three references. The position will remain open until a suitable candidate is found. RM of Rosedale No. 283, Box 1 5 0 , H a n l e y, S K . S 0 G 2 E 0 , f a x : 306-544-2252, email: rm283@sasktel.net The RM wishes to thank all who applied, however, only those individuals with interviews will be contacted. BEEKEEPERS WANTED for 2014 season. 2 positions available, experience necessary, $11.35/hr. Fax 306-937-2095 or email Stuart, Stuhoney@yahoo.com Battleford. FULL-TIME BOOKKEEPER. Bookkeeping duties including accounts payable and receivables, payroll and general journal monthly entries. Experience with Microsoft Office and familiar with Sage 50 Accounting. Experience in agriculture an asset. Salary depending on qualifications and experience. Accommodations provided. Fax resume to: 250-459-2624, Attn Larry, email: admin@gangranch.infosathse.com Gang Ranch, BC. 10 PERMANENT FULL-TIME POSITIONS available at County Fresh Farms Greenhouses in Cypress County, AB. Job includes daily picking and pruning of vegetable plants. Work is in a greenhouse environment with some lifting required. $10.03/hr. for 40-50 hrs./wk., may vary according to crop cycles, no experience required, must have transportation. Email: countyfreshfarms@hotmail.com MECHANIC ALLY INCLINED PERSON needed for farm near Grunthal, MB. Full line of JD and NH; welding/electrical an asset; must be able to operate machinery and have some knowledge of cattle. Year round work, housing possible, references required. Phone: 204-380-2223, or email: rehobothfarms12@gmail.com BUSY ROOFING COMPANY requires labourers for work in Edmonton, AB. and area. Free room and board. Hutterites welcome. Call Ron 780-220-5437, Jordan 780-934-2932.

W ellEsta blished M u ltilin e Agricu ltu ra lDea lership in Ea st Cen tra lAlberta IsLo o kin g Fo rAn Ho n est,Aggressive & Am bitio u s

PARTS PERSO N . Agricu ltu ra lBa ckgro u n d a n d Co m pu terExperien ce W o u ld Be An Asset. Fu ll-Tim e Po sitio n , $15 to $20 per ho u r.Ben efits,(a fter6 m o n th perio d ).

Plea se Fo rw a rd Resu m es to M a rc a t G ra tto n Co u lee Agri Pa rts Ltd ., B o x 4 1,Irm a ,AB T0B 2H 0 o r S en d Fa x to 780-75 4 -2333. FULL-TIME SALES POSITION: ACE is looking for individuals interested in selling and managing vegetation control projects for our clients across western Canada. Assets include: strong interpersonal skills, sense of humour and ability to communicate. Service is key to this position. Email your resume to: acemail@acevegetation.com or fax: 780-955-9426, Nisku, AB. 6 PERMANENT FULL-TIME Positions available at Rolling Acres Greenhouses in Medicine Hat, AB. Job includes daily picking and pruning of vegetable plants. Work is in a greenhouse environment with some lifting required. $10.03/hr., 40-50 hrs. per week, may vary according to crop cycles. No experience required. Must have transportation. acramer@canopycanada.net 3 TRUSS ASSEMBLY Supervisors needed. Full time, year round work, $17.00-$20.00 per hour depending on experience. Minimum 3 years experience as a supervisor in truss assembly or wood manufacturing. Apply by mail/in person at: Penn Truss Manufacturing Inc. Box 418 Saltcoats, SK, S0A 3R0. By fax to: 1-888-432-1891 or by email to: charles@penntruss.com

&RPH-RLQRXU7HDP &URS3URGXFWLRQ6HUYLFHV &DQDGDLVDGLYLVLRQRI$JULXP ZZZ$JULXPFRP DQGRQHRI WKHODUJHVWIDUPPDUNHWUHWDLOHUV LQ1RUWK$PHULFD :HDUHFXUUHQWO\UHFUXLWLQJIRUDQ $JUHWDLOPDQDJHU5HJLRQDODFFRXQW PDQDJHUDQG0DQDJHURIDJURQRPLF VHUYLFHVWRMRLQRXUWHDPDWRXU6ZLIW &XUUHQW6.ORFDWLRQ7KHVXFFHVVIXO FDQGLGDWHPXVWKDYHH[SHULHQFH LQPDQDJHPHQWVNLOOVFXVWRPHU UHODWLRQVDQGDVWURQJNQRZOHGJHRI WKHDJULFXOWXUHLQGXVWU\ ,QWHUHVWHGDSSOLFDQWVVKRXOGDSSO\ ZLWKWKHLUUHVXPHRQOLQHDW ZZZFSVDJXFRPFDUHHUV RUID[WR  

HEAVY DUTY MECHANIC, experienced in hydraulics, diesel engines, prime movers, tracked vehicles, as well as spray equipment. This is an opportunity for field and shop work. Please send resume by email to: acemail@acevegetation.com or by fax: 780-955-9426 or send by mail to: ACE, 2001- 8 St. Nisku, AB. T9E 7Z1.

4 DELIVERY DRIVERS Needed: Full time year round employment, $18.00-$21.00 to start, depending on experience and drivers license, plus benefits (after probationary period). Delivers and handles merchandise in Alberta. Previous driving experience an asset but not required. Must have Class 3 or Class 5 license w/Air Brake (Q) endorsement and a clean driverâ&#x20AC;&#x2122;s abstract. Apply with resume to: Igloo Building Supplies Group: 21421-111 Ave, NW, Edmonton, AB., T5S 1Y1. Fax: 780-447-3247 or HEAVY DUTY MECHANIC/APPRENTICE email to: HR.Resource@igloo.ca required for preventative maintenance, repair and service of heavy equipment fleet. OWNER/ LEASE OPERATOR required to Experience with Cat, JD, and Hitachi. Ap- haul livestock in western Canada, mostly propriate credentials and/or certifications. AB. work. Experience required. Nanton, AB. Valid drivers license. Both camp and shop 403-862-4345, lkvtrans@gmail.com locations. Service truck and accommodations provided. Wage negotiable. Send RWB RANCH IS LOOKING for full-time work references and resume to: Bryden Class 1 Drivers and Lease Operators to Construction, Box 100, Arborfield, SK. S0E haul livestock and hogs to and from SK, 0A0. Email: brydenconstruct@xplornet.ca MB, AB, BC and USA. Year-round work. Experience required, paying top wages, new Fax: 306-769-8844. equipment, benefits and safety bonuses. NELSON MOTORS & EQUIPMENT LTD. 403-625-4658, Claresholm, AB. 2 full-time Heavy Equipment Ag Mechanics CAL GAS IS seeking full-time or seasonal required. Duties: repair, overhaul, trouble- drivers for propane delivery and a picker shoot and maintain JD heavy duty agricul- operator in the oilfield, Kerrobert, SK. tural equipment; Use testing equipment to area. Prefer 1A license, will consider Class diagnose malfunctions and determine ex- 3A. All oilfield tickets, H2S, First Aid, Dantent of repair required; Test repaired gerous Good etc. are also required. We ofequipment to ensure compliance with JD fer competitive wages and comprehensive specifications. Salary: $27-$29/hr. Educa- health plan. Send resume to: Gerald Heimtion: Completion of Secondary School; Ex- becker at: gheimbecker@calgasinc.com perience: Minimum 4 years of experience. fax 306-834-5501, phone 306-834-7793. Qualified candidates would be assigned to one of the branches listed: Estevan, Red- LONG HAUL SEMI Drivers and Owner Opvers, Oxbow, Avonlea, Radville. To apply erators required to haul RVs and general send resume by email, fax or mail to: P.O. freight. Drivers paid 40¢/running mile and Box 300, Avonlea, SK. S0H 0C0. Contact pick/drop/border. Owner Operators paid Ken at fax: 306-868-4840 or by email to: 85% of gross revenue. Benefits, company service@nelsonmotors.com fuel cards and subsidized insurance. Must have valid passport and ability to cross border. Call Jeremy at 1-800-867-6233, Saskatoon, SK. www.roadexservices.com SASKATOON HOTSHOT TRANSPORTER is hiring power units w/wo stepdecks 3/4 and 1 tons, for RV and freight hauling throughout Canada and the U.S. Year round work, lots of miles and home time, fuel subsidies, benefits, excellent earnings. 306-653-8675, Saskatoon, SK. Website www.saskatoonhotshot.com ASSISTANT PARTS MANAGER wanted for multi-store New Holland dealer. Journeyman preferred, but experience will also be considered. Benefits, RRSP package, moving allowance, and signing bonus. $22 t o $ 2 8 p e r h o u r. E m a i l r e s u m e t o parts.triag@telus.net Wainwright, AB. 2 ROOF AND EWP Floor Designers needed. Full time, year round employment, $25-32 to start depending on experience, plus benefits. Minimum 2 years experience in designing floors or roofs with excellent understanding of building materials and the truss industry. Experience with Keymark and Mitek design software. Diploma from recognized architectural, civil or construction engineering program. Apply with resume to: Igloo Building Supplies Group, 21421-111 Ave, NW, Edmonton, AB, T5S 1Y1 or fax to: 780-447-3247 or e-mail: HR.Resource@igloo.ca

LIPSETT CARTAGE LTD. is now looking to hire owner operators. This well established Canadian flatdeck company strives to make owner operators successful in this competitive business. Owner Operators will be pulling well maintained company equipment. Pay is buy percentage with a quarterly bonus program. We are a family oriented company that knows the importance of home time, by staying Canada only we can make this happen. $1000 signing bonus after 3 mos. employment. Phone 306-525-5227 or 1-888-547-7388, Regina, SK. to arrange an interview today.

BRANCH SALES MANAGER(S) Western Tractor Company, the John Deere dealer in Southern Alberta, is searching for two Branch Sales Managers to lead our sales organization in the Taber and Medicine Hat regions. Western Tractor Company Inc. (WTC) has been providing premiere New and Used agricultural equipment since the 1930â&#x20AC;&#x2122;s. WTCâ&#x20AC;&#x2122;s basic values of integrity, positive attitude, and most importantly, their customer focus, are what make WTC a dominant equipment dealer in Southern Alberta. Ideal candidates have a proven track record of success in a sales organization with a minimum 5 years operations leadership and sales management experience. They possess a degree/diploma, ideally within the agriculture and business disciplines. The Branch Sales Managers will be responsible for the achievement of WTCâ&#x20AC;&#x2122;s plan objectives and fulfilling and key accountability benchmarks. Paramount to the role will be providing leadership in evaluating, managing and developing a high performance sales team; development and deployment of the overall location business plan; optimizing a profitable and sustainable growth strategy for the entire enterprise in partnership with our aftermarket and agronomic departments; achieving market share growth; and maximizing the satisfaction of customers. For more information on Western Tractor visit their website at www.westerntractor.ca. To further explore this exciting opportunity, please contactâ&#x20AC;Ś

Lloydminster, AB Requires 5 Service Rig Derrick Hands @ $29.50/hr â&#x20AC;&#x201C; 40 hrs/wk and 12 Service Rig Floor Hands @ $27.00/hr â&#x20AC;&#x201C; 40 hrs/wk, for work in the Lloydminster area.

Please fax resume to 780-871-6908 or email: royalwel@telus.net

Brenda Schnurer, Researcher Phone: (403) 351-2429 Email: bschnurer@aplin.com


NEWS

THE WESTERN PRODUCER | WWW.PRODUCER.COM | FEBRUARY 6, 2014

73

SHEEP | BARN HOUSING

Hog barn proves handy solution for sheep flock Producer hopes raising sheep indoors will reduce disease and increase productivity BY MARY MACARTHUR CAMROSE BUREAU

This old feeder hog barn near Tees, Alta., is owned and operated by Nathanael Polson and is now home to 1,200 ewes. The lambs never leave the barn, but the ewes go outside once the lambs are weaned. The ewes are on self feed inside the old hog barn. Only two lambs are kept on each ewe. If a ewe has more than two lambs they’re taken off the ewe and raised in a nursery barn. | MARY MACARTHUR PHOTOS

TEES, Alta.— It still looks like a hog finisher barn on the outside, but inside there are now sheep instead of pigs. Nathanael Polson says he has eliminated predator and weather problems by moving his sheep into the barn north of Tees. “This barn was just perfect. Lambs seem to find ways to die outside. I’ve eliminated that with this facility,” said Polson, who also runs a cow-calf and feedlot operation and grain farm about a 20 minute drive southwest of the barn at Clive. “Weather seems to be 80 percent of the battles with livestock.” Polson previously raised a 500 head flock but had little room to expand. Years of high grain prices and low hog prices had been hard on the pig industry, forcing many producers out of the business. The barn that Polson bought had housed hogs for only four years. “The pig industry at the time was in pretty rough shape,” said Polson, who took possession of the barn in the fall of 2012. It has been just what Polson needed in his quest to expand to his present 1,200 head and to his eventual goal of 2,000 head. Few renovations were required to switch the 156 by 220 foot barn from hogs to sheep. He added an overhead door to bring in feed, dragged the concrete slats from the two main feeder barn areas and knocked out some pony walls. Removing the portable concrete slats increased the ceilings from 10 to 12 feet high in the two main feeding areas. The three nursery rooms are virtually unchanged. Weaned lambs are moved into the nursery rooms, where they are raised on plastic slotted floors and eat from pig creep feeders. One pig nursery room has been made into a sheep nursery. Polson said raising the lambs inside rather than outside on a bed of straw earns him a premium for clean wool from his processor, Sungold. The mainly Rideau sheep with some Ile de France and Charollais genetics were chosen for their ability to produce multiple lambs and breed out of season. The nursery room, where he keeps the bottle lambs, held 100 to 150 lambs last year. An automatic nursing machine gives the lambs access to warm milk on demand. “As long as they get colostrum, there is no issue,” Polson said of the lambs’ ability to thrive in the nursery. He eventually intends to streamline his genetics to have most of the ewes produce at least a 250 percent lamb crop instead of the normal 150 percent. “It is really the gravy in the business. You can’t make it viable with one and a half lambs.” Just like other farming businesses,

profit comes with being larger and more efficient and meeting increasingly stringent environmental requirements. His operation doesn’t make sense with 1,000 ewes, he added, but it works with 2,000 ewes, which he is trying to get to as quickly as possible. “To be truly efficient, you can’t do it by being lean thinking,” he said. “You can’t cut corners and use more five gallon pails.” For Polson, becoming larger means spending money on proper equipment, land and buildings. He said his banker has been of considerable assistance as he expands. The bank stood by him during the BSE crisis and was willing to lend him money based on his personality and a belief in the lamb business. There are few large-scale sheep producers, which means Polson’s financial numbers will be the numbers on which future sheep operations are based. “They were willing to step up and take a risk on me,” said Polson of his local ATB branch. He is operating a closed herd, which he hopes will reduce disease problems.

With sheep, it’s all about nutrition. If you cut corners on feed or mineral, it’s the only time they’ll get sick. I have a closed flock so all issues are nutrition. NATHANAEL POLSON SHEEP BREEDER

“With sheep, it’s all about nutrition,” he said. “If you cut corners on feed or mineral, it’s the only time they’ll get sick. I have a closed flock so all issues are nutrition.” The ewes lamb in groups of 500. They and their young are moved into individual lambing jugs for one to two days until they are mothered and the lambs receive colostrum. A group of 500 ewes began lambing in mid-January, a second group will start in mid-March and the final group will start in June. Polson hopes that another group can eventually lamb in November, ideally after he is finished harvest. A radio frequency identification tag is placed on each lamb and marked with paint to prevent mix-ups and provide good flock production records. A self-propelled feed wagon dumps feed at the edge of the pens twice a day. The young lambs also have access to creep feed. A shearing gang shears the ewes two to three weeks before lambing, which seems to eliminate moisture concerns in the barn. The temperature inside the facility stays at a constant 5 to 8 C without extra heat.


74

FEBRUARY 6, 2014 | WWW.PRODUCER.COM | THE WESTERN PRODUCER

NEWS

An apprehensive farm dog learned the lesson well after a previous porcupine encounter. This time it keeps a safe distance out of reach of the porcupineâ&#x20AC;&#x2122;s tail. The porcupine was foraging in a hawthorn bush near the Watkins farmyard east of Aylesbury, Sask. | MICKEY WATKINS PHOTO

Wildlife and the Great Outdoors The Prairies remain full of active animals through the winter

FAR LEFT: The last strip of sunlight strikes a snowy owl perched on grain bins south of Blackie, Alta., where it waits for a mouse or vole to move in the field below. | MIKE STURK PHOTO

LEFT: A great grey owl sizes up intruders into its territory. This great grey was studying the snow below, waiting to dive for prey from its perch in an aspen tree, near Millarville, Alta. | WENDY DUDLEY PHOTO

BELOW: A mule deer stands by a fence looking at the herd across the road before jumping the fence and joining them. | MIKE STURK PHOTO


NEWS

THE WESTERN PRODUCER | WWW.PRODUCER.COM | FEBRUARY 6, 2014

75

BANFF PORK SEMINAR | HOUSING

Normal production possible with group housing Transition period | With proper management, productivity will rebound after initial culling to meet new space requirements BY DAN YATES SASKATOON NEWSROOM

BANFF, Alta. — Switching to group housing shouldn’t affect hog producers’ long-term productivity, says a researcher with the Prairie Swine Centre. Increased sow movement, depopulation and culling may affect producers at first, and production costs and management requirements can increase, Jennifer Brown told the recent Banff Pork Seminar. However, she is confident producers can see a return to normal production levels through proper management. “We expect that following transition there will be a return to normal production levels as management adjusts to this and barns repopulate,” Brown said. “And in the longer term, productivity is going to depend largely on management and the system that’s been implemented.” Retailers are demanding the elimination of confinement from their supply chains, and a new Canadian code of practice for pigs is coming this spring. However, it remains unclear when producers will have to decide whether to build new barns or renovate or expand existing ones. A draft of the Canadian pig code released last year required gilts and sows to be housed in groups by 2024, although that timeline is expected to change in the final version. The draft code also said barn rebuilds and new projects must adopt group housing by July 1, 2014. Its release drew widespread opposition from producers, receiving thousands of submissions during a public comment period. “While the process and the timing of this change may remain uncertain, I believe the change is definitely coming,” said Brown. She said the current trend in the United States is to expand barns to meet the space requirements for

Researchers at the Prairie Swine Centre are evaluating feeding systems and housing floor plans for hog barns. | group housing. However, older barns may have to be rebuilt, depending on their layout, condition and electrical and ventilation systems. A U.S. project recommended that facilities older than 21 years be rebuilt. The European Union has minimum requirements are 18 sq. foot per gilt and 24 sq. for sows. The recommendations in Canada’s draft pig code were smaller: 15 to 18 sq. feet for gilts and 19 to 24 for sows on a partially slatted floor. Brown said too little space is not an option. “We know that 16 sq. feet per adult sow is insufficient and 24 sq. feet is

definitely adequate,” said Brown. “We haven’t done a lot of research looking at allowances in between that.” Producers will also have to choose between competitive feeding systems, such as floor feeding and shoulder stalls and ones that allow for individual feeding, such as electronic sow feeding and free access stall systems. Brown urged caution with competitive systems because they require extra management and higher feed costs. Researchers at the Prairie Swine Centre and the University of Manitoba have developed an application

to outline conversion options for producers. It considers facility dimensions, infrastructure and pig numbers and provides floor plans, feeding system options and a cost estimate. The first phase of the project ran simulations on two hog barns: one in Saskatchewan and the other in Manitoba. Brown said the Saskatchewan simulation allowed 22 sq. feet per animal for the 2,500 sows housed in the facility. Only the free access feeding system required a reduction in herd size. The dynamic electronic sow feeding system came with a conversion

FILE PHOTO

price tag of $2.5 million, but at $839.70 per sow it was competitive with the other options, accommodating 2,932 animals. “A lot of stall systems are getting to the end of their useful life and so a lot of producers will be looking to do something with their barns in the next 10 years or so. If you consider the cost of replacing stalls, then you’re not looking at a big difference between implementing a group housing system versus replacing your stall system,” said Brown. “That should help defray some of the expenses to producers if they’re actually going to have to make an investment anyway.”

BANFF PORK SEMINAR | HOG HANDLING INNOVATION

Invention makes hogs, workers happy Reduces repetitive stress | Cradle holds piglets for easier processing BY DAN YATES SASKATOON NEWSROOM

Helmut Janz knows from firsthand experience the physical toll that handling livestock can take. The 20-year veteran of the hog industry has twice had surgery for carpal tunnel syndrome. Yet it was the pains and strains experienced by others that Janz was looking to mitigate when he dreamed up a new device for handling piglets. Janz originally built his “piglet processing arm” for employees in the Maple Leaf barn he manages near Zhoda, Man., so that they wouldn’t have to hold the animals. He hoped this would reduce the long-term damage that stress can cause.

“People (in) that process, they get sore wrists. They have to go for surgery or they have to stop processing: one of the two,” said Janz. “We want to make sure that they can continue doing their job long term.” The simple device attaches to a processing cart. Individual piglets are strapped into a foam cradle attached to the arm of the device, which holds them in place. A universal joint allows the device to swivel, giving users simpler access to the animal’s head and tail. The invention reduces the physical stress that barn workers experience when handling the small animals during a variety of activities from castrations to drenching. For his efforts, Janz was awarded

the F.X. Aherne Prize for Innovative Pork Production at the Banff Pork Seminar last week. “I wish I would’ve figured it out years ago,” he said. The device was first used a year ago, and Maple Leaf has now asked Janz to make more of them to be used in the company’s other barns. He said some workers are initially skeptical of the device, which he said can take a week or two to get used to and cause an initial dip in productivity. “If I would tell you to write with your left hand tomorrow, it would take you a while to get used to it,” he said. “It’s just the change that’s the hardest part. Once people have accepted the change, then they don’t want to go back because it is easier.”

Maple Leaf manager Helmut Janz won an award for his piglet processing arm that reduces stress on barn workers. | MERISTEM PHOTO


76

FEBRUARY 6, 2014 | WWW.PRODUCER.COM | THE WESTERN PRODUCER

NEWS

STANDING TALL

LIVESTOCK | GENETICS

Genomics coming to a cow near you Cattle breeding | Better technology will allow industry to test animals with greater accuracy BY KAREN BRIERE REGINA BUREAU

SASKATOON — The beef industry will eventually use genomics, says an extension specialist, even though the first version of the science gave way to what she called the “trough of disillusionment.” Alison Van Eenennaam, a researcher with the University of California, Davis, said genomics was oversold in the beginning. “When genomics first came out, I think the researchers and producers both thought it was going to be a silver bullet and we would have a (single) test for marbling or whatever the trait is, and it’s more complicated than that,” she said after a presentation at the Saskatchewan Beef Industry Conference. “At first we thought one marker might do it, and now we realize it’s probably more like 50,000 markers.” Genomics has been more successful in the dairy and hog industries, but Van Eenennaam said she expects adoption in the beef industry within the next decade. Darren Bevans, general manager of Deseret Ranches of Alberta Ltd., knows all about the trough of disillusionment. He told the conference that the biggest wake-up call was realizing genomic tests didn’t apply across breeds. The Alberta ranch is part of the large Ag Reserves Inc. company, which includes ranches in several states and a feedlot in Kansas. The cow herd totals more than 50,000, and the Alberta operation has 6,800 cows of Angus, Gelbvieh and Hereford genetics. “Five years ago I really believed that genomics was going to be the magic bullet,” Bevans said. “That we’d be able to take that calf that was born in one of our herds,

BUILDING YOUR GETAWAY HAS NEVER BEEN EASIER!

anywhere in North America, pull a hair sample and within a couple weeks of getting that sample back we’d know the potential for weaning weight, yearling weight, birth weight, fertility, udder suspension, frame score, marbling, tenderness, on and on. Honestly, that hasn’t come true at this point.” He said the ranch’s managers took a step back to figure out where genomics could actually work. They use basic parentage tests at the multiplier herd level and can produce solid expected progeny differences from those tests. “We backed it back to the elite herd level, where we’re measuring actual genetic relationships,” he said. “So we’re using the 50,000 (marker) test on those cattle, or an intermediate test of between 20,000 and 30,000, to determine actual genetic relationship of the progeny to the grandsires and to siblings.” This enables managers to increase the accuracy of EPDs and better predict the future. Bevans said it works pretty well for the company’s crossbred cattle, and it hopes the data it has collected will eventually help develop a marker panel for its own animals. He said a simple test of 100 or 200 markers could be cost effective at $10 to $15 and could help the company get back on the path on which it started. “What we’re developing is really patterned after the hog model,” Bevans said. “We start with the genetics and do intense selection, leverage the investment in those genetics on our cow-calf ranches, carry that through, right through the feed yard, until the day the cattle die.” The company wants to eventually offer packers a large volume of cattle each week that will bring a significant premium because of the traits they carry.

24’X48’ CABIN PACKAGE STARTING AT

$61,800 20’X24’ CABIN PACKAGE STARTING AT

$26,900

12’X24’ CABIN PACKAGE STARTING AT

$17,400

A new calf struggles to get up at the Crystal Springs Ranch in northwestern British Columbia Jan. 28. |

MARIE

WEITZEL PHOTO

ENTREPRENEURS | NEXT GENERATION

Young farmers stay close to family Rural lifestyle | Sask. Young Ag-Entrepreneurs see influx of new members BY WILLIAM DEKAY SASKATOON NEWSROOM

Lifestyle continues to be why most new producers choose to farm. When participants at the Jan. 29-30 Saskatchewan Young Ag-Entrepreneurs Conference were asked why they farm, some mentioned the freedom involved in being an entrepreneur while others talked being their own boss, a love of nature and the ability to be on the land and raise animals. Still others saw farming as a challenge that requires optimism and resilience. For Eric Rustad, a first-year farmer, it was all about choosing a quality way of life that was best for his young family. “I got to go with family. I was doing other things before I had my first son and decided farming was better for family,” said Rustad, 26, who farms near Rose Valley, Sask. Several years of employment off the farm helped convince Rustad to work on his family’s farm as well as rent his own land. His first year’s crop of canola and barley is in the bin. “Lifestyle pretty much has got to be the reason for farming because when you put in that many hours in any other job, you’d probably do a little better (financially), but there’s no other job where you can take your kids on the tractor,” he said. “Pretty much all jobs, you leave for the morning and you come back in the evening.” He said he realized soon after his

son was born that a city life was no place for his young family compared to staying on the farm. “You might work a 12-hour shift with farming, but there’s a good chance that your wife or your dad or kid is with you,” he said. Saskatchewan Young Ag-Entrepreneurs defines a young person as anyone from 18 to 40 years. Membership ranges from university students in agricultural related studies to sole proprietors to a host of partnerships, such as people working with their uncles, parents and grandparents. “It’s very diverse that way,” said chair Rodney Voldeng, who farms near Naicam, Sask. As one of the organization’s original members, Voldeng said he has watched the provincial chapter grow from 10 members in 2006 to more than 100 today. “The original motive was to really push networking for young farmers, for young farmers to really talk with other young farmers to find out their experiences, how they were dealing with things on their own farms,” he said. Voldeng said he saw many more new faces at this year’s conference. Most of them were grain, pulses and oil seed growers as well as a few cattle producers. “Grain farming has been successful for the past five to six years, and it has seen a resurgence of young people returning to the farm as compared to some of the other agriculture industries,” he said.

“The cattle industry, like the hog industry, went through a major downturn. There was no profit to be made and major losses. Young people were not coming back to the farm just to lose money.” Lynnell Olson of Archerwill, Sask., who is in her second year with the organization, said she joined to meet and network with other young people who work in the agricultural industry. “I think if you ask more people, you get different answers. Asking your family or agronomist is all good, but it’s also nice to hear other people’s problems to see if they’re getting the same or if you’re getting the right advice,” said the 24-year-old agronomist. “This is a nice group that reinforces to me that everything (farming) will be fine. We will keep passing on passion in the farming industry.” Olson works with her family growing cereals, pulses and oilseeds. She and her two younger siblings bought a separate home quarter last year, not far from the home where Olson now lives. Like Rustad, choosing farming as a career is also a way to maintain family ties. “It’s a group effort. I couldn’t farm by myself. I would rather farm with my family,” she said. “We feel that working together is stronger than working independently. Yes, I will have stuff that will be in my name, but I still work with my family members and that’s important to us.”


THE WESTERN PRODUCER | WWW.PRODUCER.COM | FEBRUARY 6, 2014

SUBSCRIBE. SUBSCRIPTION/RENEWAL ORDER FORM

Name

Account #

I would like to give a GIFT SUBSCRIPTION to:

Address Name

City/Town Phone (

Postal Code )

Address

Year of Birth

Email

City/Town

Province

Postal Code

Phone (

One Year:

One Year:

Two Years:

I’m an active farmer/rancher

I’m interested in agriculture

)

Two Years:

Name

I would like to pay by (check one):

Cheque enclosed

Visa MONTH

CARD NUMBER

Mastercard

Address

YEAR

EXPIRY DATE

City/Town

Province

Postal Code

Phone (

One Year:

Signature

)

Two Years:

Date

Subscription Prices

One Year

BC, AB, SK & ON residents (GST 5% inc.) MB residents (GST 5% & PST 8% inc.) NS residents (HST 15% inc.)

$87.07 $93.70 $95.36

Two Years $161.95 $174.29 $177.38

United States US/year $179.66 All other countries CDN/year $358.19

Per copy retail add taxes

$4.25

MY BILLING INFORMATION: Name

Account #

I would like to pay by (check one):

Cheque enclosed

MONTH

Address City/Town Phone (

Visa

CARD NUMBER

Postal Code )

Year of Birth

Signature

Mastercard YEAR

EXPIRY DATE

Date

Email

Mail to: The Western Producer, Box 2500, Saskatoon, SK S7K 2C4 or Call 1-800-667-6929

When The Western Producer celebrates a birthday, we GIVE the gifts. Farmers have been reading our newspaper for 90 years. And their children have been part of 4-H Canada for the last century. To commemorate these two milestones and support the continuing work of 4-H Canada, we are partnering with John Deere to give away a John Deere XUV825i Crossover Utility Vehicle to one lucky winner. Head to www.producer.com/contest for full rules, regulations and an entry form. Contest closes June 2014. Good luck!

Gator™ awarded may not be exactly as illustrated. Approximate value $14,000.

• growing with you

77


78

FEBRUARY 6, 2014 | WWW.PRODUCER.COM | THE WESTERN PRODUCER

NEWS

ALBERTA HORSE BREEDERS CONFERENCE | FEED MANAGEMENT

Make horses work for food to avoid boredom Exercise good for digestion | Specialist advises using a grazing muzzle to extend eating time and prevent wood chewing BY BARBARA DUCKWORTH CALGARY BUREAU

RED DEER — Horses left to their own devices spend most of their time eating. About 70 percent of a 24 hour period is spent either foraging or eating, said equine specialist Lori Warren of the University of Florida. Unlike other livestock, they will also eat at night. “These meals might last a few minutes, or depending on forage, it might last many hours of non-stop eating before they move on to another activity,” Warren told the Alberta Horse Breeders Conference held in Red Deer Jan. 10-12. Many horses are raised in confinement, and although they receive a well balanced diet, they also spend less time eating it, which gives them

time to do other things that may not always be healthy. “How we manage horses, what we feed them has really changed how they interact with their diet,” said Warren. Horses on pasture might travel three to five kilometres a day, which gives them exercise and keeps their bowels moving. They are also likely to be among other horses, which provides stimulation. “For our convenience, a lot of horses are meal fed, two times a day,” she said. Confined horses require special care. Their feed might meet their physical requirements, but it does not address their psychological needs. Warren said it is not always practical to turn horses out to pasture, but their owners need to find a way to

LORI WARREN EQUINE SPECIALIST

prolong the time the animals eat. Owners can slow down a horse’s eating time by using grazing muzzles or feeders that make them work for their feed. Wood chewing and cribbing may result if the horse has no food and nothing to do. Warren also advises matching the hay to the horse. Growing horses or hard working

horses may need grain for extra energy. Thin horses or those with bad teeth may need concentrates. High level performance or growing horses as well as lactating mares and thin horses may need grass alfalfa mixes or alfalfa hay. Mid maturity hay with lots of leaves should meet the requirements for average performance horses and pregnant mares. Ponies, miniature horses and idle ones may receive a grass hay or coarser hay, which slows them down when they eat. This type of hay also has a lower nutrient quality. The type of feed also affects digestion and behaviour. Concentrates may be nutritionally balanced, but they take less time to eat compared to long stemmed hay, which requires considerable chewing. Research has shown a horse chews

3,000 times for every kilogram of hay eaten but much less when eating grain. Long chewing produces more saliva to aid digestion and buffer the stomach. Horses can produce 30 to 60 litres of saliva per day, which is recycled as water in their bodies. Modern feeding practices can cause ulcers because the stomach passes the food through too quickly. Colic and laminitis are also possible when there is lots of time between meals. Horses also want variety. They prefer short, vegetative grasses and grazing in areas where there is a mixture of plant species. However, they cannot tolerate drastic changes in diet. Mixtures can be introduced gradually to horses that are meal fed so that they can pick through it.

Horses on the Crystal Springs Ranch in northeastern British Columbia huddle together to stay warm. Horses on pasture spend most of their time eating, says an expert. |

MARIE WEITZEL PHOTO

ALBERTA HORSE BREEDERS CONFERENCE | LIVESTOCK HEALTH

Producers urged to watch for pigeon fever, West Nile Virus BY BARBARA DUCKWORTH CALGARY BUREAU

RED DEER — Horse owners must watch for flare-ups of pigeon fever and West Nile Virus this summer. Dr. Kelsey Brandon, a veterinarian from Claresholm, Alta., who first diagnosed pigeon fever when it arrived in southern Alberta last August, said the first case was thought to be an accident in which a horse had been kicked. The owner reported the horse was severely lame and had a sudden swelling in its chest. “I thought I was going out to a trauma case,” she told the Alberta Horse Breeders Conference held in Red Deer Jan. 10-12. She said horse owners should con-

tact a veterinarian if disease is suspected and let the practitioner lance any abscesses because some go deep into the body. “It is best to seek some advice.” There is no vaccine. The last case of pigeon fever was seen Jan. 10. It appeared in 20 horses and two miniature donkeys. The disease causes painful swelling in the chest and may turn into an abscess that must mature before it can be lanced and drained. It may also appear internally and affect the lungs, spleen and liver or infect the legs’ lymphatic system. Pigeon fever is caused by corynebacterium pseudotuberculosis, a soil borne bacterium, and is spread by biting insects such as horse, house or stable flies. It may incubate for sev-

eral weeks before swelling occurs, but then quickly spreads. It can also affect cattle and sheep. Cattle can pick it up from sheep and horses but not the other way around. People are not affected. Antibiotics are not recommended because then abscesses take longer to mature and draining is delayed. The drugs also have difficulty entering the infection. Antibiotics may be recommended for internal abscesses and lymphangitis. Internal infections may require a six to eight week course of antibiotics and regular monitoring. Infected horses should be handled with biosecurity measures, such as handling sick animals last and using separate equipment. If possible, isolate infected horses, wash hands and

use disposable gloves. When applying fly treatments, remember to spray under the belly because flies seem to bite there. Producers are also being warned to stay alert for West Nile Virus, which may reappear this year after a hiatus, said Dr. Larry Friske, a veterinarian with the animal health company Zoetis. “It is one of these diseases that never goes away. It is an endemic disease,” he said. The mosquito culex tarsalis, which thrives in hot weather, bites infected birds and then transfers the virus to horses and humans. West Nile has not been a serious problem for some years, so most birds have not been exposed. The first case appeared in New York

in 1999, and the virus spread across the continent in 2002. The worst year was 2003, when Alberta had 170 confirmed cases in horses, Saskatchewan had 162 cases and Manitoba reported 47 cases. There were nearly 400 cases across the country that year. It was followed by years of low incidences, but the virus reappeared in Saskatchewan and Alberta in 2012 and 2013. The incidence seems related to environmental conditions. Effective vaccines are available. Friske said horses should be vaccinated for West Nile as well as forms of sleeping sickness and other horse diseases. West Nile requires two shots for immunity. Pregnant mares can receive a shot six weeks before foaling.


NEWS

THE WESTERN PRODUCER | WWW.PRODUCER.COM | FEBRUARY 6, 2014

79

SWINE | MANAGEMENT

Piglet growth isn’t optimized, says researcher Milk yields | Ongoing research into mammary development could help hog producers see improved performance BY DAN YATES SASKATOON NEWSROOM

Milk yields from modern pigs are up from previous generations, but that doesn’t mean piglets are necessarily better fed. Today’s sows are responsible for feeding larger litters of piglets, which means the amount of milk ingested per piglet has decreased. “We have nice hyper prolific sows, but we now have to work on increasing sow milk yield so that all these little piglets can have optimal growth, which is absolutely not the case at the present time,” Chantal Farmer, a swine researcher with Agriculture Canada, told the Banff Pork Seminar last month.

PORK | PROCESSING

Tyson fears PED will reduce pork supply by two to four percent (Reuters) — Tyson Foods Inc., the largest U.S. meat processor, said it expects pork supplies to drop two to four percent this fiscal year, raising wholesale prices, as a deadly pig virus spreads through the U.S. hog belt. Heavier hogs will offset some of the loss in headcount, Jim Lochner, Tyson’s chief operating officer, said during a conference call after the company’s quarterly earnings release. Porcine epidemic diarrhea virus, a highly contagious and potentially fatal pig virus, has contributed to higher hog prices, which are beginning to eat into pork processors’ profits in that country. Average prices for live sows surged 28 percent in the last year, according to figures released by the United States Department of Agriculture. “I do want to emphasize information does come out fairly regularly ... and we’re just staying on top of it region to region, producer to producer,” Lochner said, referring to the spread of the disease. Industry analysts estimate up to four million may have died from the virus, but there are no official figures for pig fatalities from the disease. The U.S. hog herd stood at 65.9 million head as of December 2013, U.S. Department of Agriculture data showed. PED was first discovered in April 2013 in the United States, the world’s the largest pork exporter, and has spread to 23 states and Canada. Transmitted orally and through pig feces, the disease causes diarrhea, vomiting and severe dehydration in the animals, but does not affect humans. Older pigs have a chance of survival, but the virus kills 80 to 100 percent of piglets that are infected. Tyson also said it was monitoring the number of sows affected by the virus.

Farmer said researchers have overlooked mammary development. Officials have noted a correlation between the size of mammary glands and milk yields. Milk is the primary energy source of piglets, and improving milk production will mean better piglet growth. Farmer said it seems obvious, but precise methods haven’t been developed to specifically manage replacement gilts for the development of that trait. Hormones and nutrition play a role, which make up part of Farmer’s

research efforts. She cautioned producers against restricting feed in animals older than 90 days because it affects mammary gland development. The hormone prolactin can boost milk yields, but it isn’t readily available for commercial use, which has Farmer looking for alternative supplements. She has studied feeding flax to pregnant and lactating sows and has discovered that lignans, the phytoestrogen found in flax, may increase mammary development in offspring

at puberty. Farmer is also examining other ways to increase estrogen in prepubertal period, as well as guidelines for body condition. “Body condition must be looked at closely,” she said about an ongoing project studying back fat and mammary development. The only other work done on the topic examined animals with back fat measurements of 25 to 36 millimetres, which doesn’t reflect commercial production. “Nobody has a sow with 36 mm of

EVERY CROP NEEDS A SUPERHERO. Someone who fights for higher yields, giving crops the nutrients they need when they’re needed most. Someone who trusts field-proven technologies to more effectively feed crops, save time and boost the bottom line. Be a superhero. Ask your retailer for Wolf Trax Innovative Nutrients.

Better nutrition. Better crops. Better farming.

wolftrax.com

1-855-237-9653

©2014 Wolf Trax® is a registered trademark of Wolf Trax, Inc. Not all products are registered in all areas. Contact infomaster@wolftrax.com for more information. 22716 WP

back fat ... but that’s all I can tell you. That’s all the information available,” she said. “It tells you an overly fat sow will have poor mammary development and will have less milk yield in the next lactation.” Farmer’s research will look at animals with less back fat, with 25 mm being on the high end. Results of that work will be coming in the next year and a half, she said. “Then producers will be able to feed animals to achieve that thickness,” she said.


80

NEWS

FEBRUARY 6, 2014 | WWW.PRODUCER.COM | THE WESTERN PRODUCER

LIVESTOCK | PORK MARKETING

China urbanization has pork exporters drooling Meat consumption increasing | The country will account for almost 20 percent of the world’s pork imports by 2022 Pork Seminar were told. Pork is already the most consumed protein in China. “This is the marketplace that collectively we can all grow,” Maple Leaf’s Troy Warren said. China is already a major customer for Canadian pork, but producers and processors require easier access to the country, said Warren. Lengthy inspection periods inhibit the sale of fresh product from Canada, he added. “Today, we serve a tremendous amount of frozen pork, but the real

BY DAN YATES SASKATOON NEWSROOM

BANFF, Alta. — China’s urban population outnumbers its rural residents for the first time in its history. It’s one of the reasons why pork processors put the country ahead of some traditionally larger export markets. In addition to its population, which has exceeded one billion, China’s increasingly urban residents are wealthier than their rural counterparts, attendees at the recent Banff

value added for all of us in this countr y is in the fresh pork markets around the world,” said Warren. Smithfield Foods, the largest pork producer and processor in the United States, was acquired last year by a Chinese processor, Shuanghui International. Economist Steve Meyer of Paragon Economics called the purchase a positive development that shouldn’t affect opportunities for Canadian exports. “It’ll probably increase the rate of growth and exports to China, but I

don’t see that it’s going to take market share from anyone,” said Meyer. “I think that it’s going to be a net increase for all imports going into China. I don’t think Canada is put at any big disadvantage by this deal.” Meyer presented U.S. Department of Agriculture projections that show China will account for almost 20 percent of the world’s pork imports by 2022. It is expected to account for more than half of worldwide imports, along with imports from Japan, Hong Kong and South Korea. “We’ve had this focus for China,

Industries Ltd. SELECT MAXIMIZER Incorporates added width to the fabric to accommodate heaped loads.

The “Original” Side Rolling Tarpaulin System with precise fit.

SIDE ROLLING TARP SYSTEMS

!

o Moving

Stop! N 1 Man, 1

GERS

U HOPPER A

Q All components are easily removed in minutes. Q Breakdown of tarp components fit inside of grain tank. Q 12v, DC motor is operated using a rocker switch, is a standard feature on all systems. Q Lightweight. Q Q Q Q Q Q Q

Painted steel or aluminum. Manual control or wireless remote. 8” diameter or 10”diameter. Available for 1, 2, or 3 hopper systems. Ideal for filling airseeders in spring and bins in fall. 5.9 cu. in. hydraulic motor with flow control valve. Attaches directly to chutes on trailer.



ON IN YOUR NOT THE HANDS GROUND!

U.V. & SCRATCH RESISTANT LEXAN MARGARD SHEET FOR YEARS OF DEPENDABLE SERVICE.

39” Extend

er Kits Ava

ilable

CROP CATC

China, China for many years and there’s no question that it’s important, but we have to look at Asia as a whole,” said Meyer. China, the United States, Japan and Russia are the largest markets for Canadian pork, but regulators and new competitors have presented challenges in every market. Country-of-origin labelling has hampered business in the U.S., exports to Japan have fallen and issues with the feed additive ractopamine have restricted access to Russia and China. “We’ve had a lot of trade issues. We still have a lot of trade issues,” said Warren. “As a country that exports 50 percent of its pork, we can’t afford to have trade issues.” Canada has long been a net exporter of pork, but calls for market protection and advancement come at the same time as a major shift in the domestic market, in which Canada has become a net importer of pork from the U.S. Warren said Canadian products still line grocery store aisles, but meat that goes on sale is likely from the U.S. “We have conditioned consumers to buy pork really, really cheap and wait for features,” said Warren. “And way more of the volume is shifting to features.… As much as I’d like to stop the American pork coming in here, I can’t supply a Loblaws feature when they sell something at $2.99 a pound.” The Canadian government is pursuing free trade agreements with the Trans Pacific Partnership and South Korea, while some Canadian packing plants have been able to remove ractopamine from their meat, including Quebec-based Olymel. “Today we have an OK relationship with China, I would say,” said Warren. “It’s a huge opportunity market for us … but trade terms aren’t totally known. Sometimes they allow Paylean (ractopamine) in. Sometimes they don’t. Today they’re back in the ‘don’t’ phase. When they need pork, they seem to turn a blind eye to this issue.” Warren said China and Russia have used ractopamine restrictions as non-tariff barriers to restrict trade, but the industry needs to be on the same page on the topic. “As an industry, we need to decide what we’re going to do with this ingredient,” he said.

Q SAVE UP TO 1/4 Bushel or more per acre on canola alone. Q Never, clean your feeder house again!

HER

Patent Pend in

g

Phone (306) 366-2184 | Fax (306) 366-2145 Email sales@michels.ca | www.michels.ca P.O. Box 119 St. Gregor, SK., Canada S0K 3X0

“I think the kids will enjoy the garden this year”


NEWS

THE WESTERN PRODUCER | WWW.PRODUCER.COM | FEBRUARY 6, 2014

81

SPECIAL CROPS | CONTRACTS

Interest growing in buckwheat as farmers explore options Looking for alternatives | Low-input crop drawing greater interest among Manitoba farmers as canola prices drop BY ROBERT ARNASON BRANDON BUREAU

Mike Durand, a special crops buyer in Manitoba, knows what to expect when canola prices fall. He says his phone will ring more frequently with inquiries from farmers who are looking to grow something other than canola. This winter, many of those growers have called to talk about buckwheat. “I’ve had some farmers tell me, ‘I’m thinking of cancelling my canola seed but I don’t know what to switch

to,’ ” said Durand, sales and purchasing manager at Nestibo Agra, a sunflower and special crops processor in Deloraine. “I’ve had quite a few more calls on buckwheat this year.” Buckwheat acres in Manitoba exceeded 10,000 acres in 2012, which boosted industry optimism after several years of being mired in the 4,000 to 5,000 acre range. However, the 2012 drought stifled buckwheat yields, with many fields producing less than 20 bushel per acre. The poor yields discouraged

casual growers, and buckwheat acres fell back to typical levels last year. However, prices of $10 to $11 per bu. have piqued growers’ interest, said Durand’s brother, Marc, who farms in Notre Dame des Lourdes, Man. “It’s a low input crop and the market is holding out compared to some of the other commodities,” said Marc, who grows buckwheat every year. “Demand is still there, supply is awfully low, also.” Another Manitoba buckwheat processor said he is also receiving more

producer inquiries this winter, including calls from potential growers in Saskatchewan. Mike Durand said buckwheat is profitable at yields of 20 to 25 bu. per acre. Although his phone continues to ring, he said he has contracted sufficient buckwheat acres for this year. “I have my regular growers and they are quite good at growing buckwheat. They’ll grow everything I need for this coming year,” he said. “Basically, I open with a contract one day and it’s filled the same day.”

Canola, wheat and other large acreage crops remain tied up in the grain transportation system this winter, which Mike Durand said might endear farmers to a special crop like buckwheat, which is typically shipped by container. “I think we’re going to see more special crops, on the whole, because of that.” Marc said it’s great that farmers are considering buckwheat again, but canola growers might go with another option this spring. “Soybeans is still the Cinderella crop right now.”

BUCKWHEAT | SNACK FOOD

Farmer targets gluten-free market BY ROBERT ARNASON BRANDON BUREAU

With a market size estimated at more than $35 billion annually, the North American snack food industry attracts thousands of new players and products every year. Keith Murphy of Oak Bluff, Man., has no intention of pushing aside Frito-Lay, but he hopes to capture a tiny fraction of the massive market with a roasted buckwheat snack called Buckshots. Murphy, who runs Stone Milled Sp e c i a l t y G ra i n s o n h i s f a r m, launched Buckshots a couple of years ago. The gluten-free snack comes in four flavours: natural, sweet and spicy, smokey barbecue and dill pickle. Growth has been steady; specialty food stores in Winnipeg, rural Manitoba, British Columbia and San Francisco now sell Buckshots. Murphy also sells product directly to consumers on a website called foodiepages.ca and plans to break into the Toronto market.

Other fungicides help protect yield potential. This increases it.

YELLOWSTONE | WILDLIFE

Park rejects ‘biobullets’ (Reuters) — Managers at Yellowstone National Park in the U.S. have rejected a plan to use air rifles to shoot the country’s last herd of purebred bison with so-called biobullets containing a vaccine against brucellosis. Roughly half of Yellowstone’s 4,600 bison are estimated to have been exposed to brucellosis, a bacterial infection that can sometimes cause cattle and bison to miscarry. Worries that infected bison may endanger cattle in states such as Montana and Wyoming that border Yellowstone had prompted the powerful ranching lobby to endorse biobullets — absorbable projectiles packed with vaccine. They would cut disease rates among bison by as much as 35 percent over 30 years.

There are a lot of decisions to make when it comes to getting the most out of your crop. But there’s only one fungicide that goes above and beyond controlling disease in canola by helping increase yield potential. We’re talking, of course, about Headline® fungicide. Not only does it help control yield-robbing diseases like blackleg, it also delivers the unique, proven benefits* that we call AgCelence®. The evidence? Greener, larger leaves and stronger stems that ultimately result in higher yield potential**. To find out how Headline can take your canola to new heights, visit agsolutions.ca/headline or contact AgSolutions® Customer Care at 1-877-371-BASF (2273). *AgCelence benefits refer to products that contain the active ingredient pyraclostrobin. **All comparisons are to untreated, unless otherwise stated.

Always read and follow label directions. AgSolutions, and HEADLINE are registered trade-marks of BASF Corporation; AgCelence is a registered trade-mark of BASF SE, all used with permission by BASF Canada Inc. HEADLINE should be used in a preventative disease control program. © 2013 BASF Canada Inc.


82

FEBRUARY 6, 2014 | WWW.PRODUCER.COM | THE WESTERN PRODUCER

PRODUCTION

SPRAYERS STUCK IN THE 50S Technology has made sprayers faster and more efficient, but efficacy hasn’t improved much in the past few decades. | Page 84

PR ODUC TI O N E D I TO R: M IC HAEL RAINE | P h : 306- 665- 3592 F: 306-934-2401 | E-MAIL: M IC H AEL.RAIN E@PRODUC ER.C OM

AGRONOMY | RESISTANT WEED

Burn, bale or smash to fight resistance 57 percent weed reduction | With herbicide resistant weeds on the rise, interest in mechanical weed seed removal grows BY MICHAEL RAINE SASKATOON NEWSROOM

EDMONTON, Alta. — Herbicide resistant weeds were an issue for Australian farmers long before they became a serious problem for Canadian growers. Michael Walsh, a professor and researcher with the University of Western Australia, has just completed more than 10 years of research into the value of mechanical weed seed removal in combination with herbicide control. Resistant weeds such as rye grass and wild oats are significant problems for the Australian industry. Chemicals such as glyphosate are not as effective as they once were. “Growers created this issue. The economics of farming in the 1990s and early 2000s meant that they were inclined to cut rates on their herbicides and overuse the least expensive (ones). The products did a pretty good job of managing the (weeds) at lower rates, but they also created ideal (natural) selection of the weeds,” he said. “Combines got larger and more efficient and chaff and straw spreading got better. For weeds, that is compounding the problem of the farmers’ weed selection. Now they are seeding those weeds back into their fields, making spot control impossible.” Ninety-eight percent of weeds in Western Australia are now herbicide resistant, often to multiple active ingredients. The problem caused producers to turn away from vulnerable crops such as pulses and grow hardier canola, wheat and barley. “That resulted in fewer rotational choices and more dependence on the herbicides that we are already having resistance issues with,” Walsh told a Farmtech session in Edmonton last week. Farmers began removing weed seeds from the back ends of their combines about 30 years ago, when the first Redekop chaff wagons were exported to the country. They were reducing or eliminating tillage in favour of continuous cropping and water conservation. “Chaff wagons worked for smaller farms and where they had livestock to use the chaff in a ration,” he said. “The chaff piles could be grazed by stock or gathered up and fed in a feeder yard.” The system uses a cross auger to collect chaff off the combine’s top sieve, and a blower puts 85 percent of the weed seeds into a cart. However, the practice has declined as broad acre producers shed their livestock herds in favour of specialization and increasing farm sizes

Growers created this issue. The economics of farming in the 1990s and early 2000s meant that they were inclined to cut rates on their herbicides and overuse the least expensive (ones). MICHAEL WALSH UNIVERSITY OF WESTERN AUSTRALIA

MICHAEL RAINE PHOTO

made hauling the feather-light chaff inefficient. “Farmers saw the benefits of weed seed removal, but they had to adapt after the carts,” Walsh said. Instead, they either collected the weed seeds with the chaff and burned the piles or used concentrators on their straw and chaff output to create tight windrows that were then burned. Seventy percent of Western Australia’s 25 million farmed acres now use fire to deal with weed seeds. A farmer in Western Australia improved on the blower design in the 1990s by adding a conveyor to carry the material back to the wagon, along with 25 percent of the straw. Walsh said this results in a denser pack of chaff and more complete and rapid burning of the piles. About 200 farms in the region still use some form of wagon system. “The Shields family farms about (30,000 acres) at Wongon Hills, Western Australia, and they went one better with a large square baler design behind the combine,” he said. The system draws about 80 horsepower in hydraulic flow back to run the baler, which bales the straw and chaff from the back of the combine. The machine’s $190,000 price tag makes it an expensive option. The Shields sell their bales to a feed company that turns the crop byproduct into pellets, which are fed to sheep as they move by ship to the Middle East. The system captures 95 percent of the weed seeds that come through the combine. “You need a market for the (straw) to make that alternative work,” said Walsh. Most producers choose to con-

The Harrington seed destructor was invented by Australian grain producer Ray Harrington in the mid-1990s. He used a cage mill that trailed behind his combine, smashing weed seeds and then sending them through a straw chopper. The University of Western Australia improved on the design and Agriculture Canada will test the $260,000 machine this spring on the Prairies. | UNIVERSITY OF WESTERN AUSTRALIA PHOTO dense the straw and chaff in a windrow and burn the result, despite the fire risks and the labour intensive process. “The Messina family pioneered that process and these days it takes them about a month to burn their (30,000 acres) of windrows,” he said. Ray Harrington, who sold his livestock in the mid-1990s and moved into grain production, wanted to avoid the already serious issue of herbicide resistance that other grain producers in his region were experiencing. Harrington drove a cage mill with a set of belts from a 200 horsepower motor. The unit trailed behind his combine, smashing weed seeds in the chaff and then passing the material through a straw chopper

and spreader. He handed the project over to the University of Western Australia to further develop and commercialize. Further improvements were made using farmer grain check-off money matched by government research funding. The machine is now available for sale, but the $260,000 price tag is probably why only four units have been sold. One of the machines went to Agriculture Canada for testing on the Prairies. It will be delivered in April. The current incarnation of the cage mill is hydraulically driven and features a paired set of counter rotating pins in two cages, each with three rows of interlocking bars countering

one another. “It is very effective, over 90 percent,” Walsh said. “Ninety-nine percent on wild oats.” Whether farmers use the Harrington system or capture and burn their chaff and straw, Walsh said the results are the same: a 57 percent reduction in weed seeds. “Might not seem like enough, but it works out,” he said. Mechanical removal reduced weed populations to less than one per sq. metre over 10 years of trials when combined with herbicide strategies. It was significantly better than results from herbicides alone , which allows five to 10 weeds to survive, he said. “Together, it deals with the problem of resistance selection pretty well.”


PRODUCTION

THE WESTERN PRODUCER | WWW.PRODUCER.COM | FEBRUARY 6, 2014

83

AGRONOMY | INPUTS

Focus on big things, don’t sweat small stuff: agronomist SASKATOON NEWSROOM

E D M O N T O N — Fa r m e r s a re advised to invest in the big stuff first and then selectively target the tiny. An agronomist with Crop Production Services in Calgary says they can sometimes focus too much time and money dealing with their fields’ smallest problems. Norm Flore told the recent FarmTech show in Edmonton that producers should examine all their field inputs carefully, especially as margins decline. The ratio between invested dollars and yield need to be a top priority, he added. “Ask yourself, are you doing all of the things that will get you the most bang for your buck?” he said. “There are no certainties with farm inputs. Not all of your investments pay off equally from year to year.” Flore said macronutrients and fungicides are the top earners for producers. He cited decades of regional research showing that adequate nitrogen to grow a crop is one of the single largest limiting factors that farmers can control. “Have you obtained the best genetics you can? If you have, then what have you done to protect them?” said Flore. Seed treatments have been shown to increase plant stands and improve the uniform development of most crops, which Flore said is an investment that will show up in yields later on. He said it’s also important to make sure that seeding equipment plants crops evenly and at the right depth. Stabilized nitrogen products could be a good investment for producers who are applying large amounts of nitrogen in a single pass. However, they deliver less of a benefit for those who band in an initial pass in the fall or place urea safely away from their seed. “If you have a need that those products can meet, then they really deliver,” he said. Flore said if producers can identify a seed safety issue or “if you feel you are losing N between application and plant use, then you can quantify that loss and decide if the investment is worth it.” He said prairie producers might benefit from those products in 10 to 20 percent of their acres. “Under the right circumstances, there is an 80 percent chance of this bet paying off,” he said. “It’s like recommending snow tires for every car in the world. In many places, it will do nothing but cost money. In Canada it is a good investment. Target your field investments.” He said broadcasting nitrogen is becoming more popular for prairie farmers who have large acreages to cover in a short season. “But banding will keep losses to a minimum. You have to decide what will work best on your farm.” Phosphorus also pays off, but most producers who applied sufficient amounts to replace what their crops have been removing could get by with cutting the nutrient for a year or two. Rates as low as 10 to 15 pounds per acre will still give plants enough nutrients to encourage rapid growth and a slightly shorter time to maturity.

Beyond that, he said, there will be no advantage in the year of application unless the soil is deficient. “You will need to make that investment at some point in the future, and it will be a larger one if you fail to put it in now, but there is a choice,” he said. Unless the field’s history isn’t known or it has just come out of a forage rotation, a 60 bushel wheat or 50 bu. canola crop will remove 35 lb. of phosphorus, which means growers who cut rates would have to put that back within a season or two. Flore said phosphate enhancers such as penicillium bilaii will help make additional phosphate available, but will it be enough of a benefit

NORM FLORE AGRONOMIST

in any given season? He said the product would not likely produce a good return on investment in most cases. He said his research at Vulcan, Alta., last year and research at the Indian Head Agricultural Research Foundation at Indian Head, Sask., showed little or no response to apply-

ing micronutrients to fertilizer prills. He said producers need to identify a shortage of a micronutrient before committing an entire farm or field to the product. Farmers should start by conducting strip trials in their own fields, he added. Seed and fertilizer applied micronutrients can be expensive in some cases, relative to applying the nutrient in bulk quantities. For example, zinc in some seed and fertilizer applied products costs about $25 per pound and the amount that is being applied to the seed or fertilizer might add up to a few grams per acre. He said copper and other micronutrients tend not to be in short sup-

ply in prairie fields, so producers should do some testing. “For these, they are 80 percent effective if you have a problem and five if you don’t,” he said. Foliar applied products could be effective if the field is deficient, he said, but when it comes to nitrogen, crops still tend to largely use foliar applications once the fertilizer has reached the ground. “Leaves can’t take in enough N to make a big difference. A growing canola plant uses up to seven lb. of N per day. Only the roots can do that,” he said. Mid-season applications can be helpful but require moisture to carry them to the roots in a timely manner.

YOUR CROPS. YOUR CHOICE. MANA Canada Herbicides

Same active as

Arrow®

Select® and Centurion®

(Clethodim)

Ladder® (Clodinafop-propargyl)

Bison® (Tralkoxydim) NE W !

BY MICHAEL RAINE

Bengal® WB (Fenoxaprop-p-ethyl)

Phantom™ (Imazethapyr)

Horizon® Liquid Achieve® Puma® Super Pursuit®

Priority®

PrePass™

(Florasulam)

(when mixed with glyphosate)

Rush 24™

OcTTain™ XL

(Fluroxypyr & 2,4-D Ester)

TopLine™ (Florasulam & MCPA Ester)

Badge®II (Bromoxynil & MCPA Ester)

Bromotril

®II

(Bromoxynil)

Thrasher®II (Bromoxynil & 2,4-D Ester)

MANA Canada Insecticides

Silencer

®

(Lambda-cyhalothrin)

Pyrinex® (Chlorpyrifos)

Alias® (Imidacloprid)

MANA Canada Fungicides

Bumper

®

(Propiconazole)

Blanket AP™ (Azoxystrobin & Propiconazole)

Overall™ (Iprodione)

Frontline™ Buctril® M Pardner®

Because Choice Matters. At MANA Canada we believe that growers and retailers deserve choice in crop protection products. Our growing portfolio of strategic active ingredients is used in over 20 MANA Canada branded herbicides, fungicides and insecticides manufactured to the highest standards. For the best return on investment, choose the MANA Canada advantage.

Thumper®

Same active as Matador® Lorsban® Admire® and Stress Shield®

Same active as Tilt® Quilt® Rovral®

manainc.ca

® Alias, Arrow, Badge, Bengal, Bison, Bromotril, Bumper, Ladder, Priority, Pyrinex, Silencer and Thrasher are registered trademarks and ™ Blanket AP, Overall, Phantom, Rush 24 and TopLine are trademarks of Makhteshim Agan of North America, Inc. All others are trademarks of their respective companies. Always read and follow label directions. 13037.01.14


84

PRODUCTION

FEBRUARY 6, 2014 | WWW.PRODUCER.COM | THE WESTERN PRODUCER

MACHINERY | APPLICATION TRENDS

Sprayers have gotten faster, but are they better? Application equipment | Sprayers are bigger, more accurate and expensive but still stuck in the 1950s BY MICHAEL RAINE SASKATOON NEWSROOM

EDMONTON — Farmers should expect more from their sprayers. Tom Wolf of Agrimetrix told farmers attending the FarmTech show in Edmonton last week that the sprayers on the market today still depend largely on technology from the 1950s. “We are still squeezing a pressurized liquid through an elliptical orifice. We have added a lot of creature comforts to the equipment and can go faster, but mostly that is what we

have done,” he said. “You are spending $400,000 for not a lot more than you had before. You just go faster and longer.” Wolf said the biggest changes were made in the 1990s when air induction and pulse systems that turn individual nozzles on and off were added or refined. Air induction nozzles reduce spray pressure at the tip and create coarse and very coarse spray. This improves leaf coverage while reducing the number of droplets in the 200 micron range. “That technology shifted the major-

ity to the 200 to 600 micron range from 200 to 300,” Wolf said. “We balance these interests with pressure and are limited by machine speed and the size of the pump.… Machinery guidance has reduced overlap and improved efficiency, but that hasn’t changed the application process.” The technology that is found in Capstan Ag Systems’ equipment and as an option on Case IH sprayers decouple boom pressure and spray volume by rapidly turning nozzles off and on to control application. It is one of the

trends that Wolf feels North American agriculture will see more of in the future. Improved application research and recommendations from pesticide manufacturers is another trend that Wolf is watching. Some of the latest herbicides that blend 2,4-D or dicamba with glyphosate/glufosinate come with more complete nozzle and pressure recommendations than most products. “Big droplets are best for many products like glyphosate, but some products want smaller droplets and

Make these guys your first pick this season ® Enforcer M MCPA + fluroxypyr + bromoxynil

® Enforcer D 2,4-D + fluroxypyr + bromoxynil

Add Enforcer® to your cereal team and end the dirty play from cleavers, kochia and wild buckwheat. Enforcer delivers all-in-one heavyweight control of these hard-to-kill broadleaf weeds. Available in two tough formulations, Enforcer features three active ingredients to fight this trio of annoying weeds. SPECIAL TRIAL OFFER

Try Enforcer on us this season and save 50% on your first 80 acres. Register at nufarm.ca for this special trial offer.

Talk to your local retailer about engaging the Enforcer on your cereal team.

Innovative solutions. Business made easy. 1.800.868.5444 Nufarm.ca Always read label before using. Enforcer® is a registered trademark of Nufarm Agriculture Inc. 35632-01-0114

CropLife (Canada) needs to tell us how to best use their products.” Wolf said little independent research is being done on how to improve product efficacy, but he expects chemical companies to begin providing more detailed instructions for producers. He said boom width is another area where North American farmers will see change. “Europe offers machines up to 56 metres. Most of ours are 30 and up to 40,” he said. The largest machines have mostly moved away from nozzle shrouds, but they help prevent negative pressure vortices that are created when equipment speeds increase. Negative pressure zones behind the spray pattern draw out the finest droplets, taking them off target and creating opportunities for drift. “Large booms can’t handle the weight or the challenge of the (shroud size) in folding,” he said. Boom materials are also changing. Agco has worked with universities to develop tough bio-composites, while German sprayer component builder Altek, which manufactures Lechler sprayer nozzles, has developed a 120 foot boom made of aluminum, steel, fibreglass and carbon fibre that weighs 850 pounds. As well, a Brazilian sprayer company has a mostly carbon fibre version. “They will get lighter and wider,” Wolf said. “That might let you slow down to improve efficacy.” He said farmers and custom applicators will also demand stainless steel, despite plastic plumbing’s attractive price and ease of repair. Plastic can absorb chemicals and release them at inopportune times, which could damage crops. Wolf said more farmers should also be investing in improved automatic boom height control, which allows growers to lower their boom height without the risk of striking the crop or ground. “We’ve gotten too high and we lose the advantages of some of the great nozzles that are out there,” he said. “For fungicides, the twin fans lose their advantage when you get too far from the crop.” He said more twin fan nozzles will be used in the future as more fungicides are required to improve yields. “European farmers have a lot choices. Not all great, but many good ideas, too,” he said. Many of Europe’s 40 high clearance sprayer manufacturers share common technologies and provide locally built choices in specific markets, but some offer different boom and spray system options from those found in North America. Wolf said some of that technology will make its way into the market. Faster loading is one of the ways that sprayers will become more efficient. Wolf said most nozzle companies are small and don’t have extensive research and development budgets for working on new technology. He said machines will get better, more comfortable and faster, but “someone needs to think more about the basic technology and deliver some improvements (in efficacy) for the farmer.”


PRODUCTION

THE WESTERN PRODUCER | WWW.PRODUCER.COM | FEBRUARY 6, 2014

85

NITROGEN | APPLICATION CHALLENGES

Flexibility with nitrogen applications improves odds Narrow application window | Nitrogen must be available early in the growing season BY REBECA KUROPATWA FREELANCE WRITER

Producers who show flexibility with nitrogen management and take conditions into account can better manage risks, but it’s not always easy to adapt established practices, said Doon Pauly, an Alberta Agriculture research scientist in Lethbridge. He said producers might want to hedge their bets and try to adjust their nitrogen applications in season if possible. That could mean applying no additional nitrogen if weather conditions are marginal or trying to capitalize on a prospective good crop. “… if weather conditions are looking like they have the potential to produce a very good crop, you may want to be a little bit more aggressive on your fertilization and take advantage of that.” he said. Significant nitrogen loss, such as what occurred in southern Alberta last year, may also prompt a second application. “Five to six weeks after seeding, we get a tremendous amount of rainfall in a very short period of time, ending up with saturated conditions,” said Pauly. Anaerobic conditions, which are

Farmers should be prepared to adapt their nitrogen applications to suit conditions and crop stage. | ideal for denitrification and loss, may result if this occurred before the crop had gone through a rapid uptake. “Let’s say you put down 100 pounds of N and it had been converted to nitrate by that time,” said Pauly. “Maybe the crop had taken up 30 to 40 lb. of N at that stage and you end up with those warm soils with lots of nitrate that are saturated for a few days. You could easily lose another 30 to 40 lb. of N in denitrification in a short period of time. That loss is huge.”

On the other hand, producers in drier regions would not want to be overly aggressive with their fertilization. If they receive good rainfall after seeding through to May and early June, they may consider these good conditions, see they are a looking a little short and try to correct it. “The real challenge is realizing when that crop takes it up, and for a lot of our annual crops that are fairly short seasoned, that nitrogen has to be available in the root zone fairly early in the growing season, so the

FILE PHOTO

window of application is quite narrow,” said Pauly. “A cereal crop will take up about 70 to 75 percent of its total nitrogen uptake in a growing season. It will take that up by about the time it’s accumulated about 25 percent of its bio mass. By the time it hits the tillering stage, when it’s just starting to go through a rapid growth phase, the nitrogen has to be available in the root zone.” The challenge in trying to correct in season is that farmers need to put

nitrogen down at the surface, relying on rainfall to move it into the root zone. “There is research out of the University of Manitoba that tends to indicate foliar feeding really doesn’t happen,” said Pauly. “Also, very little of what is applied to the leaves of our cereal crops actually gets into the plant through the leaves. It has to get into the root zone and be picked up by the roots. So, if you have an event that caused losses or if you’ve had improved moisture conditions that you tried to correct, then, what do you do if it stays dry? That material is left on the surface and, depending on what you’re using, you might get some volatile losses there or it may be trapped in the trash immobilized at the surface. It’s a big risk.” The nitrogen may still not be exactly where the plant needs it, even if it is moved into the soil a little bit and immobilization does not become a factor. Narrow application windows and needing to receive the correct amount of rainfall after the application are other challenges. “As far as the split applications of N in western Saskatchewan, it’s really had mixed results,” said Pauly. “But where it has been successful, it’s usually been where rainfall has been above normal.” It’s vital to make the fertilizer available to the plant, whether that means fertigating it or running a liquid across with a hydrant sprayer and triple banding it.

EQUIPMENT | TRUCKS

Ram diesel tows less than Hemi but wins on fuel economy GETTING AROUND

CHARLES RENNY

A

ll I wanted for Christmas was a new Ram diesel. It didn’t matter if it was under the tree, in the garage or even outside in the snow. After all, a Ram is a bit big to fit in Santa’s bag of presents. I was a bit disappointed when it didn’t turn up Christmas morning, but I thought I might have to wait for Orthodox Christmas because it was in January and Ram promised the truck would be out in the first quarter of 2014. Again, it wasn’t under the tree, not in the garage and not even in the driveway covered with snow. That is when I found the fine print that told me production was set for late in the first quarter, which means early second quarter for delivery. My request for the Ram diesel came after taking it for a test drive in the fall. At the time, Ram executives had said the best part of putting a diesel in the Ram is that customers won’t need to buy the top line truck to get the diesel package. Mind you, the trim level that they choose will have a

direct bearing on the cost of the diesel package. About the only Ram 1500s to not get a diesel will be the sport models, which I can understand, and the regular cab short box Tradesman. Ram has not made any announcements about pricing, but looking at other companies’ price strategies, expect a range of $2,500 to $5,500 for the diesel option, depending on trim and other options chosen. It sounds like a lot of cash to lay down, but keep two things in mind: it is the only diesel available in a 1500 series truck and payback time for the average diesel work truck is roughly four years. The Ram isn’t significantly different inside or in body shape, so it is no wonder that the V M Motori engine is going under the North American microscope. Motori has been building diesel engines for 65 years and has supplied diesels to the old Chrysler Corp. since 1992, and not just in North America. Motori diesels are now found in Chrysler Corp. North American vehicles such as the Grand Cherokee. This new diesel 3.0 litre V6 is 18 kilograms more than the Hemi and gets better fuel economy than the Pentastar V6. Power output is rated at 240 horsepower and 420 pound feet of torque. That is on the unloaded side of things. As we all know, put a gas engine to hard work and it uses considerably more fuel. Ram estimates

Ram 1500s come with a diesel 240 horsepower engine that provides 420 pound feet of torque. | show a significant improvement in loaded fuel economy when compared to any of the gasoline engines used in trucks, including Ford’s Ecoboost V6. One comment from a Ram representative was, “take that, Ford,” so they are pretty confident about what this motor can do. It doesn’t hurt that the new diesel is being hooked to the new eight speed automatic. The Hemi puts out 410 pound feet of torque and this transmission will be used for that engine as well, so there are no concerns about it being able to stand up to the abuse that trucks get in the course of their work days. If this new power train has a poten-

tial weak spot, it is that current estimates for towing capacity will be rated at 9,200 lb. Some competitors manage a tow rating of 10,000 lb., and while the difference is small, it seems larger psychologically. Probably the best way to think of this diesel power train is that it complements both the V Pentastar and the Hemi. It may not tow as much as the Hemi, but it will pull more than the V6 Pentastar gas engine. Fuel economy will be better than the Hemi, loaded or empty, and it most likely will be better than the V6 Pentastar empty and certainly better under a full load. For those who were concerned that they would not be able to order a

CHRYSLER PHOTO

Cummins diesel in the Heavy Duty Rams, the new engine in the 1500 Ram does not affect the ability to order a Cummins in the heavy duty line-up. The heavy duty trucks are a separate line with their own engines. Another project you may have heard about is that a new 5.0 litre Cummins diesel will be used in the new Nissan Titan. I haven’t driven that truck or even been in one yet. Meanwhile, the Ram exists. I have driven one, am impressed by the total package and can only say, “it’s about time.” Charles Renny is an automotive columnist and a member of the Automobile Journalists Association of Canada.


86

NEWS

FEBRUARY 6, 2014 | WWW.PRODUCER.COM | THE WESTERN PRODUCER

FARM POLICY | U.S. FARM BILL

U.S. House passes farm bill; Senate expected soon Approval follows months of negotiations | Bill ends direct subsidies to farmers but adds permanent livestock disaster aid WASHINGTON, D.C. (Reuters) — The U.S. House of Representatives passed a comprehensive farm bill last week that cuts payments for food stamps by about one percent and ends a direct subsidy to farmers, while expanding governmentbacked crop insurance programs. After months of negotiations and criticism from both sides of the political spectrum, the measure passed easily, by 251 votes to 166, with 162 Republicans joining 89 Democrats in favour. The last farm bill, which passed in 2008, expired in

September after being extended for one year while negotiators ironed out differences between measures approved in the House and Senate. A vote in the Democratic-run Senate was expected this week and the bill was expected to pass. White House spokesperson Jay Carney said president Barack Obama would sign the legislation. The wide-ranging legislation affects 16 million jobs in the country’s agricultural sector and can have an impact on the business landscape for major agricultural companies.

“This bill eliminates unnecessary subsidies, creates a more effective farm safety net and strengthens our commitment to conservation of land and water,” said Senate agriculture committee chair Debbie Stabenow . The agriculture committees say the bill will save $23 billion over 10 years, compared with current funding, which is less than many conservative Republicans had hoped for. The Congressional Budget Office, using a different measurement, has estimated savings of $16.6 billion over a decade.

“All Americans stand to benefit in some way from this farm bill,” House speaker John Boehner said after the vote. “This is an improvement over current law, and there are no earmarks.” About $8 billion in savings over 10 years comes from cuts to the Supplemental Nutrition Assistance Program, commonly known as food stamps. That was well below the $40 billion cut advocated by the Republican-led House, which would have been the largest reduction in a generation, but it was still double the

Advertorial

amount originally supported by Senate Democrats. The legislation ends direct payment subsidies, which for years have been doled out to farmers and landowners to the tune of $5 billion a year, regardless of whether there is a need for support and whether they actually grew crops. Instead, agriculture insurance programs would be expanded to help producers manage risk. The bill would also establish permanent disaster assistance for livestock producers.

HONG KONG | POULTRY DISEASE

The ultimate team to supercharge your yields

Asia struggles to control bird flu viruses

You can never have too much of a good thing, and in the case of Novozymes MultiAction® TagTeam® and Optimize® you can have two good things working for you at the same time. These two products together are the ultimate team to supercharge your soybean crop for maximum yields, especially in new ground. With Optimize applied on-seed you get the advantage of the LCO Promoter Technology®, which enhances your soybeans’ nutritional capabilities meaning you will get earlier and increased nodule development for better nitrogen fixation and an enhanced root system for improved nutrient and water uptake. Add TagTeam, the world’s only phosphate and nitrogen inoculant, to the equation and you have the makings for extremely healthy plants and a full, rich soybean crop that will deliver incredible yield.

HONG KONG (Reuters) — Hong Kong began culling 20,000 chickens and suspended imports of fresh poultry from mainland China for 21 days Jan. 28 after the discovery of the H7N9 bird flu virus in a batch of live chickens from the southern province of Guangdong. The government order took effect two days before celebrations began for Chinese New Year, when poultry sellers generally anticipate a boom. Officials were also concerned that the holiday period, when millions of Chinese travel to visit family, often carrying live birds, could encourage the spread of the flu. Another type of bird flu, H5N8 is causing problems in South Korea, which said Jan. 27 it would expand a poultry cull. The country’s agriculture ministry said the H5N8 strain of bird flu had been detected on six poultry farms and that there had been 13 cases in migratory birds since the first outbreak earlier this month. No human infection has been reported, while the ministry is looking into four additional reports from poultry farms and more than 50 other suspected cases in migratory birds, it said. The recent outbreak of bird flu in China has cost poultry farmers $3.3 billion, and the government will implement new policies to support the industry, the Shanghai Securities News reported Jan. 30. The outbreak has affected more than 40 million farmers and triggered a fall in chicken and egg prices, the newspaper said.

The advantage of using both of these products is the formulations start to work almost immediately. Seed-applied inoculants like Optimize tend to form nodules closer to where the seed is located (closer to the primary root), while in-furrow applied granular inoculants such as TagTeam form nodules on the secondary or lateral roots, ultimately allowing for wider distribution of nodules along the whole root system. Land that has been through some rough times or has not had soybeans for a few years requires special attention when it comes to inoculation. The goal is to supercharge the soil with a heavy load of rhizobia to ensure

the best possible nodulation and soybean performance. Land with no history or many years between soybean crops and land that has been flooded or had longer periods of drought, is not conducive to rhizobia survival. It is in these soils that farmers will benefit most from the application of both Optimize and TagTeam.

Optimize® with LCO Promoter Technology® Combining LCO Promoter Technology with the bradyrhizobia bacteria in Optimize helps to shortcut the natural process by enhancing your soybean’s nutritional capabilities, helping nodulation to get off to a faster start. The roots of the soybean plant send out signals to the nitrogen-fixing bacteria in the soil, and the bradyrhizobia bacteria communicate back that they are safe to absorb. Once the plant receives this confirmation, natural growth processes such as root and shoot development are stimulated, and gateways are opened to allow bradyrhizobia bacteria to infect the root, resulting in the formation of nitrogenfixing nodules. Barriers to this natural process include temperature, moisture stress and high levels of nitrogen in the soil. With Optimize, the communication between the soybean root and nitrogen-fixing bacteria happens sooner, resulting in earlier nodulation and faster root development regardless of growing conditions.

Get more with MultiAction® TagTeam® MultiAction TagTeam contains a naturally occurring soil fungus, Penicillium bilaii (P. bilaii), which enhances phosphate use efficiency, and a high performing, nitrogenfixing bacteria. The synergy of the two microorganisms provides balanced nutrition for better use of soil and fertilizer phosphate, maximum nitrogen fixation and higher yields. One of the benefits of P. bilaii is the development of more root hairs. Each root hair is a potential infection point for rhizobia. More infection points mean more nodules, more nodules mean more fixed nitrogen, and more fixed nitrogen equals higher yields. To learn how you can maximize your yields with TagTeam and Optimize call 1-888-744-5662.

Dual inoculation for even bigger yields

BIG HAIRY DEAL?

AG EXPO

AND For more information on how to increase your yields, visit useTagTeam.ca and useOptimize.ca Novozymes is the world leader in bioinnovation. Together with customers across a broad array of industries we create tomorrow’s industrial biosolutions, improving our customers’ business and the use of our planet’s resources. Read more at www.novozymes.com. ® TagTeam, MultiAction, Optimize and LCO Promoter Technology are registered trademarks of Novozymes A/S. All rights reserved. 13030 09.13

Presented by Farm Credit Canada

© 2013 Novozymes 2013-12614-01

What’s the

North American Seed Fair Presented by Fortis Alberta

Feb. 26, 27 & 28 9 to 5 pm daily Lethbridge, Alberta

www.exhibitionpark.ca Tel. 403 – 328 – 4491


NEWS

THE WESTERN PRODUCER | WWW.PRODUCER.COM | FEBRUARY 6, 2014

87

MANITOBA MP | CONSERVATIVE APPOINTED

Manitoba farmer promises to highlight ag issues in Ottawa BY BARRY WILSON OTTAWA BUREAU

Twenty years after he first tried and failed to win a Manitoba House of Commons seat, former farmer and farm leader Larry Maguire finally made it to Ottawa last week. He was sworn in as the new MP for Brandon-Souris, quickly asked a government-friendly question in his first question period and was assigned a seat on the influential public safety and national security committee. “That is a very important committee to me, coming from a riding on the border,” Maguire said. However, he said agricultural

issues remain key in his southwestern Manitoba riding, and he will work on those issues in Ottawa. A priority will be supporting legislation to implement the CanadaEuropean Union trade agreement when it comes before Parliament. “The trade deal with Europe is very important for western Manitoba,” he said. Beef and pork industries are a billion dollar part of the economy. “Trade opportunities are key.” Maguire said he will also strongly support the government’s omnibus agricultural bill, C-18, which is expected to be called for debate this winter. Among its key provisions is strength-

LARRY MAGUIRE BRANDON-SOURIS MP

ening protection for seed variety developers. Agriculture minister Gerry Ritz said it is designed to attract more private sector investment into agricultural research and variety development.

Maguire said Manitoba growers need improved varieties of wheat, oats and sunflowers. “New varieties are what have kept farmers in business over the years,” he said. “I know that personally.” Maguire, 64, farmed for decades in southwestern Manitoba, served as president of the Western Canadian Wheat Growers Association for four years in the 1980s and while an opponent of the Canadian Wheat Board marketing monopoly, was elected to the CWB advisory committee for two terms over seven years in the 1980s and 1990s. He was a founding member of Keystone Agricultural Producers.

His first run at federal politics came in 1993 during the election that saw the governing Progressive Conservatives reduced to just two seats: one in Quebec and one in New Brunswick. Maguire was trying to hold a seat that was considered a safe PC bastion. Six years later, he was elected to the provincial legislature and served as an MLA for 13 years and four terms before resigning last year to make another try for a federal seat. He held the traditionally Conservative seat in a late 2013 byelection but by fewer than 400 votes. “We will work hard to strengthen our position there (before the scheduled October 2015 election),” he said.

KAP | REBIRTH

Manitoba farm group grows

Questions about the weather?

BY ED WHITE WINNIPEG BUREAU

Amidst the continual slumping of the farmer population and the proliferation of new agricultural commodity groups, Keystone Agricultural Producers has experienced a startling rejuvenation. The organization is also trying to revamp itself from the inside so it can better fit the new farming reality. “It’s certainly nice to see at this 30-year milestone for the organization to see such renewal and people coming back,” KAP president Doug Chorney said about the 727 members added in 2014, which take overall membership above 4,000 again. Those 727 represent a 22 percent membership increase, which was the result of a campaign to sign up new members and get lapsed members back into the fold. It’s good news for the organization’s budget because members pay dues through a checkoff, and more members equals more budget. “Our budget was significantly less aggressive,” said Chorney, noting KAP expected to have only 3,700 members this year. “It was a much more successful effort than we thought we would be able to achieve.” KAP is celebrating its 30th anniversary this year, and delegates attending its annual meeting Jan. 30 debated a number of organizational issues. They pondered whether more commodity group seats should be placed around the KAP executive table because of the growing importance of new commodity organizations. “Hopefully, the Manitoba wheat and barley growers association will look at joining as a commodity group as well,” said KAP vice-president Rob Brunel. Delegates also discussed districts amalgamation but KAP executive favoured keeping the grassroots network widespread like it is now. “Our districts and our broad representations are really what makes this an effective organization,” said Brunel. “Those are core values.” Keeping the momentum is the new objective. “Year over year growth is going to be a priority,” said Chorney.

All the weather tools you’ll need

Ask

X OVER

1,100 REPORTING STATIONS

More stations, more data, more forecast tools for farmers Weatherfarm gives you the tools to stay constantly informed about the weather on your farm – and in your region. WeatherFarm is supplied by a growing dedicated network of more than 1,100 professionally maintained monitoring stations, most owned by farmers, with current conditions updated throughout the day. WeatherFarm gives you a full set of accurate weather-monitoring tools that show you detailed forecasts, current conditions and historical comparisons. Detailed local weather maps can show accumulated rain, maximum temperature and minimum temperature for a specific day, week or month. WeatherFarm’s exclusive Analyze Weather function allows you to view a growing set of data points over a wider area to see where the most rain fell, where it’s the hottest and more. WeatherFarm is dedicated to the Canadian farming community. Our focus is on growing and improving our weather services based on the feedback we get from our network of farmers who own stations... and from you.

For more information on WeatherFarm or purchasing a weather station please call:

1-855-999-8858 THE FARMER’S FORECAST TOOLBOX

info@weatherfarm.ca

weatherfarm.com

An extensive, live-updating network that gives you current and 7 day forecasted weather data for your farm or surrounding area X ANALYZE

FEATURE

WEATHER

Analyze weather feature allows you to compare temperature, wind speed, precipitation, humidity, pressure and dew point from nearby stations or across a region X RADAR

& SATELLITE

View current radar & satellite images showing precipitation, rain accumulation and more X HISTORICAL

DATA

Available to the public for five days, and for weather station owners, up to one year X MAPS

Available by province across Western Canada, showing recent and historical data on maximum temperature, minimum temperature and rainfall X PHOTO

COMMUNITY

Submit your weather photos to be included in our Photo of the Week feature. Visit our website for details.


88

FEBRUARY 6, 2014 | WWW.PRODUCER.COM | THE WESTERN PRODUCER

LIVESTOCK

PED VACCINE TO BE AVAILABLE An emergency measure will allow Canadian producers to access porcine epidemic diarrhea vaccine now that the virus has been found in Ontario and is likely to spread. | Page 90

L IV EST O C K E D I TO R : B A R B G LEN | P h : 403- 942- 2214 F: 403-942-2405 | E-MAIL: BARB.GLEN @PRODUC ER.C OM | TWITTER: @BA R B GLE N

BRINGING THE HERD HOME

Ed Russell from River Ranch near Riske Creek, about 50 kilometres west of Williams Lake, B.C., trails the cows home from the range. What appears to be fog is actually steam rising from the cows. | RACQUEL RUSSEL PHOTO

FEED | MYCOTOXINS

MARKETING | PROTECTION

Ergot consequences are drastic; meticulous testing necessary Testing is important | Ergot is among the major threats that can cause widespread damage BY KAREN BRIERE REGINA BUREAU

SASKATOON — Chris Clark will never forget the day he rolled a cow over and its two hind feet stayed behind. “The legs had actually completely separated,” said the Western College of Veterinary Medicine professor. “It is a particularly unpleasant thing to have to deal with.” He and colleagues were investigating a complaint from a producer that many of his cows were lame. It was a cold January and some cows were so lame they had to be trucked to the yard from the pasture where they were being fed hay and screenings. Clark said when he arrived the animals seemed quite content. They were eating, drinking and ruminating but would not stand up. “As we started to look at more, almost every animal lost a foot or was in the process of losing a foot,” he said. Sixty animals were euthanized because they lost their legs, and more losses followed. “It almost makes you gag when you see how bad the legs are,” he said. Clark said ergot poisoning was the only possible explanation, even though the feed was long gone. Ergot poisoning in humans typically presents in the brain. The mycotoxin is a chemical relative of LSD, and cases have been documented for 1,000 years that

could be explained by ergot poisoning, particularly in rye. “It’s a pretty wicked acid trip, by all accounts,” he told the Saskatchewan Beef Industry Conference. However, ergot poisoning in cattle shuts down the blood vessels to peripheral areas such as the feet and tail and acts like a tourniquet. He said extremities will hurt and go numb when the condition occurs in warm weather, but there is a chance of recovery. However, limbs will freeze solid and die when it occurs in cold weather of –40 C. C l a rk e s a i d t h e p ro d u c e r h e worked with had obtained screenings from a local elevator, but the employee who inspected the screenings for ergot before they were sold was away for three weeks and the feed was not examined. There is zero tolerance for ergot in grain for human consumption, which means contaminated grain automatically becomes cattle feed. The legal limit is .3 percent in a 500 gram sample. “That might be a big generous,” Clark said. “Generally you probably want to look at getting your ergot levels under .1 percent.” He said counting the ergots in a sample isn’t good enough because the amount of toxin within the ergot is the problem. Ergot has become a bigger concern in the past few years, likely because of wet, cool springs.

CHRIS CLARK WESTERN COLLEGE OF VETERINARY MEDICINE

The disease begins with a spore in the ground, which must be frozen. It germinates in spring and produces a pollen-like substance that infects open pollination plants such as rye and triticale. However, it can also get into weeds and other crops such as wheat and oats. Clark encouraged producers to be careful when feeding grain, particularly elevator screenings. Testing feed for ergot at the veterinary college costs $63. The feed can be diluted, but Clark said seed cleaning does not eliminate the ergot. Dicoumarol is another mycotoxin that cattle producers should worry about. Sweet clover naturally contains a compound called coumarol. When the clover is cut for hay or silage and becomes mouldy, the mould can act on the compound and create dicoumarol. Dicoumarol is a powerful anticoagulant that stops blood clotting. Cattle that eat dicoumarol risk

bleeding problems, Clark said. “If a cow is mildly affected, her newborn calf is going to be severely affected,” he said. The trauma of passing through the birth canal could cause bleeding. Cows will also be at risk they have any type of laceration from giving birth. Bruising can also result in uncontrolled bleeding. Clark said producers should consider their feed source if they see large swellings from pooling blood, animals that are reluctant to move and bruising around joints. Affected cattle will have pale eyes and mouths because the blood is draining from their circulation systems. Clark said suspected cases should be referred to veterinarians, who can test clotting ability. “If you’ve got high value stock and you want to do something to save them, treating with vitamin K is very effective,” he said. “Vitamin K provides the raw materials for the cow to make its own clotting factors.” However, avoiding the poisoning in the first place is easiest. Clark said mould is a problem in sweet clover. “If you see mould, get rid of the stuff that’s mouldy,” he said. “Don’t just expect cows to sort through (the feed).” Producers who believe their feed might be contaminated should dilute it at least three to one, he added.

Sask. producers seek payment guarantee BY KAREN BRIERE REGINA BUREAU

SASKATOON — Saskatchewan cattle producers have voted to establish a fund that will insure payment in the event a livestock dealer doesn’t pay them. However, just how the fund will work is still to be determined. The provincial government has amended legislation to allow for the fund but is looking to industry for direction. A Saskatchewan Cattlemen’s Association working group tasked with examining the issue recommended mandatory participation with optout provisions. The levy would likely be 25 cents, at least initially. However, those voting at last week’s SCA annual general meeting decided they preferred a voluntary fund. The SCA board wants mandatory participation, and the Saskatchewan Stock Growers Association also wants a fund, but with a refundable levy. Doug Gillespie, who chaired the working group, said the levy could not be refundable under Saskatchewan’s legislation. He said the program would have to be mandatory to start with to build it up to the $5 million the committee believes is necessary. Marketing 1.2 million head per year at 25 cents per head would generate $300,000 per year. Alberta has had a program since the 1960s, which has paid five claims worth a total of $1.64 million, according to a discussion paper circulated at the SCA meeting. The fund has built to the point that the levy is only five cents per head. Several producers in southeastern Saskatchewan lost more than $1 million about 10 years ago when an auction mart failed to pay them.


LIVESTOCK

THE WESTERN PRODUCER | WWW.PRODUCER.COM | FEBRUARY 6, 2014

89

ARTIFICIAL INSEMINATION | FIXED TIME BENEFITS

Earlier calving, heavier weaned calves reaped from timed AI Reduce cow handling, labour costs | Artificial insemination allows producer to shorten breeding season and improve pregnancy rates BY KAREN BRIERE REGINA BUREAU

SASKATOON — The hassle factor has kept many commercial cattle producers from using estrus synchronization and fixed-time artificial insemination. However, Cliff Lamb, an animal science professor at the University of Florida, says they should reconsider. Time, sire selection, facilities and labour are all complicating factors that can be overcome and lead to a shorter calving season, heavier weaned calves, better genetics and more money.

“The great thing about fixed time artificial insemination systems is that we can plan three months in advance when we’re going to handle the cattle,” he told the recent Saskatchewan Beef Industry Conference. “That takes the time out of it.” The ability to plan allows a producer to put all the people, supplies and facilities in place and get the job done. Lamb said overcoming post partum anestrus, which is the period of time between when a cow gives birth until it cycles again, is the main reason why producers should consider AI.

Progesterone will stimulate the cow to cycle. Cows that cycle earlier can be bred earlier and subsequently calve earlier. Studies have shown that heifers that calve in the first 21 days of the season last longer in the herd. They are more productive and wean heavier calves. Fixed time AI also reduces the need for heat detection. Lamb said the producers he works with have eliminated it. One of his goals when implementing AI systems is to handle the animals a maximum of three times. He advises using the seven-day Co-

Synch + CIDR system. A gonadotropin-releasing hormone (GnRH) is injected on Day 1 and a controlled internal drug release (CIDR) containing progestin is inserted. The CIDR is removed seven days later and an injection of prostoglandin is administered. The timed AI takes place about 60 hours later, along with another injection of GnRH. Lamb said the pregnancy rate is the critical number to assess. If 100 cows are synchronized and 50 are pregnant, then the rate is 50 percent. He said producers who choose to use heat detection would have to

detect 90 percent of their cows in heat to get the same pregnancy rate. Lamb has reduced the University of Florida’s 800-cow herd’s breeding season to 70 days from 123 two years ago. Calves are arriving earlier and pregnancy rates are higher, he said. “This past year, we increased the average value per calf $124 just by shifting the calving dates.” Weaned calves are averaging an extra 37 pounds. “By treating a cow with timed AI, 18 months from now each cow will bring you back an extra 17 kilograms of calf,” he said.

ARTIFICIAL INSEMINATION | STUDY

PROTECT THE

Cost, benefit study shows AI pays off

FLAG

BY KAREN BRIERE REGINA BUREAU

SASKATOON — At least one Saskatchewan study shows that cattle producers who use fixed time artificial insemination in their herds can see greater economic returns. Travis Peardon, a regional livestock specialist and producer near Outlook, Sask., said a 2012 study involving three herds of heifers found the procedure cost producers more, but they made it back in bigger weaned calves. “The AI calves were definitely smaller but it didn’t take them long to catch up to their natural service counterparts in the herd,” Peardon told the recent Saskatchewan Beef Industry Conference. Half of the heifers in each herd were bred naturally and half were artificially inseminated. The study aimed for conception rate of 50 percent, but all three herds averaged 67 percent. The weaning weight advantage over the naturally sired calves was 16, 27 and 174 pounds on the three farms. “That isn’t a typo,” Peardon said. The genetics worked amazingly well at the one operation, he added. Peardon calculated that the extra weight, at a price of $1.55 per lb. at the time, earned extra value for the producers of $24.80, $41.85 and $269.70. It cost them $18 more to use the AI program, including a technician, when compared to a $4,000 bull, he said. The advantage ranged from $7 to $250 when those costs were calculated. Peardon said the economic advantage isn’t the only reason for cattle producers to use AI. The increased performance of heifers retained in the herd is a big factor. Using highly accurate EPD sires means the heifers can be rebred sooner and will calve easier, he added. The calving period is also more concentrated. Challenges include handling facilities, time and convincing older generations to try the procedure.

WITH BUMPER OR BLANKET

Choose your best defense Over 50 percent of the yield in cereal crops is determined by the health of the flag and upper leaves. Early or late, MANA Canada has the fungicide protection you need. Protect the flag with Bumper®, containing propiconazole, or Blanket AP™, containing azoxystrobin and propiconazole. Support choice – ask for Bumper or Blanket AP by name.

Bumper

Fungicide

®

Propiconazole

418 EC

SAME ACTIVE AS TILT®

SAME ACTIVES AS QUILT®

manainc.ca ®Bumper is a registered trademark and ™Blanket AP is a trademark of Makhteshim Agan of North America, Inc. All others are registered trademarks of their respective companies. Always read and follow label directions. 13046.12.13


90

FEBRUARY 6, 2014 | WWW.PRODUCER.COM | THE WESTERN PRODUCER

LIVESTOCK

PED VACCINE | EMERGENCY ACCESS

PED vaccine could reduce impact of illness Produced from gene sequence | The vaccine doesnâ&#x20AC;&#x2122;t require growth of the virus so thousands of doses can be produced at once BY BARB GLEN LETHBRIDGE BUREAU

Canadian hog producers will have access to a vaccine against the deadly porcine epidemic diarrhea virus through permits issued to veterinarians. Agriculture minister Gerry Ritz and the Canadian Food Inspection Agency announced emergency access to the new vaccine Jan. 30. Developed in the United States by Harrisvaccines, the iPED+ vaccine

has been available only since August in the United States, also only through veterinarian prescription. Canadaâ&#x20AC;&#x2122;s first cases of PED were found Jan. 22, and the virus had infected five Ontario hog operations as of Feb. 1. The virus kills most young piglets, with lower mortality rates in older animals. Joel Harris, head of sales and marketing for Harrisvaccines, said tests show the vaccine prompts sows to develop antibodies against PED. It

,-* *!!+, 7KHIXWXUHRI\RXUEXVLQHVVGHVHUYHVDSURIHVVLRQDO Î&#x2013;V\RXUDGYLVRUD3URIHVVLRQDO$JURORJLVW 3$J " %\6DVNDWFKHZDQODZRQO\D3$JFDQSUDFWLFHDJURORJ\

-LP%HVVHO$7

$JUL7UHQG$JURORJ\ &DQROD&RXQFLORI&DQDGD

-LPDWWHQGHGWKH&ROOHJHRI$JULFXOWXUHDQG %LRUHVRXUFHVDVDPDWXUHVWXGHQWZKLFKIDQQHG WKHČľDPHVIRUDJULFXOWXUDOSURGXFWLRQ-LP VSHQWWKHQH[W\HDUVDVDSURGXFWLRQH[SHUW ZLWKWKHFDQRODLQGXVWU\IRFXVLQJRQQHZDQG LQQRYDWLYHLGHDVWKDWFRPELQHEHVWPDQDJHPHQW SUDFWLFHZLWKDGYDQFHGWHFKQRORJLHV$VDUHVXOW RIKLVRXWVWDQGLQJZRUNZLWKWKH&DQROD&RXQFLO RI&DQDGD-LPUHFHQWO\UHFHLYHGWKH4XHHQ (OL]DEHWK'LDPRQG-XELOHH0HGDODVUHFRJQLWLRQIRUKLVFRQWULEXWLRQWR DJULFXOWXUH Č&#x160;Î&#x2013;DPNHHQO\LQWHUHVWHGLQSDUWLFLSDWLQJLQWKHÎ&#x2013;QVWLWXWHČ&#x2021;VJURZWKSODQ RIDWWUDFWLQJWKHQH[WJHQHUDWLRQRISURIHVVLRQDOVDQGVXSSRUWLQJWKHLU FDUHHUGHYHORSPHQWLQSURČ´WDEOHDQGVXVWDLQDEOHIRRGSURGXFWLRQČ&#x2039;

&KDG%RKDFKHZVNL3$J

$\OVKDP$JUR

&KDGČ´UVWHQUROOHGLQHQJLQHHULQJEXWDIWHUWZR \HDUVKHVZLWFKHGWRWKH&ROOHJHRI$JULFXOWXUH DQG%LRUHVRXUFHVZKHUHKHJUDGXDWHGZLWKD PDMRULQDJURQRP\Î&#x2013;WZDVDGHFLVLRQKHKDV QHYHUUHJUHWWHG Č&#x160;%HLQJSDUWRIWKHÎ&#x2013;QVWLWXWHČ&#x2021;V1RUWKHDVW%UDQFKKDV SURYLGHGJUHDWQHWZRUNLQJZLWKRWKHUDJURORJLVWV DQGJLYHQPHFRQČ´GHQFHLQEHLQJDOHDGHULQWKH LQGXVWU\Č&#x2039; &KDGEHOLHYHVWKHUHFRJQLWLRQRIWKHSURIHVVLRQLVJURZLQJDPRQJ IDUPHUVDQGWKHLQGXVWU\Č&#x160;)DUPHUVZDQWWKHEHVWDGYLFHDQGNQRZLW FRPHVIURPDJURORJLVWV(PSOR\HUVDUHUDSLGO\Č´JXULQJRXWWKDWKDYLQJ DJURORJLVWVRQVWDÎ?UHJLVWHUHGZLWKWKHÎ&#x2013;QVWLWXWHLVMXVWSODLQJRRG EXVLQHVVVHQVHČ&#x2039;

ZZZVLDVNFDČ´QGDPHPEHU 6FLHQFHEDVHGSURIHVVLRQDOVLQDJULFXOWXUHELRUHVRXUFHVIRRG WKHHQYLURQPHQW

6XSSRUWHGE\

ZZZSURGXFHUFRP

is designed for intramuscular injection in sows one to two weeks before farrowing. â&#x20AC;&#x153;Weâ&#x20AC;&#x2122;re able to produce virus neutralizing antibodies in pigs that weâ&#x20AC;&#x2122;ve injected the vaccine into, so weâ&#x20AC;&#x2122;re getting similar antibody titers (concentrations) that you would see in pigs and in gilts that have been exposed to the virus naturally,â&#x20AC;? said Harris. The vaccine has been used primarily on pigs in PED outbreak situations and on previously exposed animals. Harris said the unique vaccine technology does not require growth of the virus, but instead is based upon a sequence of genes from the PED virus that generate an antibody response. â&#x20AC;&#x153;We know that the vaccine isnâ&#x20AC;&#x2122;t going to cause the disease because thereâ&#x20AC;&#x2122;s no way it can revert back to virulence.â&#x20AC;? He said the process allows his company to produce â&#x20AC;&#x153;tens of thousandsâ&#x20AC;?

of doses in a single run, so supply is not expected to be an issue. As a new vaccine, Harris said the length of protection it provides is not yet known. Dr. Egan Brockhoff of Prairie Swine Health Services in Red Deer told producers last week that vaccination will not prevent PED infection but could reduce its impact or the chances that it will become endemic. Brockhoff said itâ&#x20AC;&#x2122;s also possible that the vaccine could hinder early identification of PED, and he warned producers to be aware of that. Biosecurity remains the primary weapon against prevention, he added. Harris said his father, Hank Harris, a veterinarian and prominent swine researcher, considered possibilities for a PED vaccine about two years ago, when the virus was a problem in Asia but had not yet moved to the U.S. PED is a coronavirus similar to the one that caused severe acute respiratory syndrome (SARS) in people in

EGAN BROCKHOFF PRAIRIE SWINE HEALTH SERVICES

2004. A North Carolina-based company, Alphavax, developed a SARS treatment, and Harrisvaccines used some it that technology to develop the PED vaccine. â&#x20AC;&#x153;It gave us kind of a head start,â&#x20AC;? said Joel Harris. â&#x20AC;&#x153;It was a fairly quick turn around as far as vaccine development goes.â&#x20AC;? Alphavac licensed its technology exclusively to Harrisvaccines for veterinary applications. The latter company is based in Ames, Iowa.

FEED STUDY | EXPECTED PROGENY DIFFERENCES

Hereford study to help producers get biggest beef for the buck Feed efficiency | Residual feed intake information will be good marketing tool BY BARBARA DUCKWORTH CALGARY BUREAU

OLDS, Alta. â&#x20AC;&#x201D; Finding cattle that eat less and gain more could soon be easier than searching for that needle in a haystack. The Canadian Hereford Association is sponsoring a three-year residual feed intake trial on 900 bulls. The project is expected to be completed in 2015 and the results will be used to develop statistics for expected progeny differences ratings. The research team includes the association, Olds College, Cattleland Feed Yards at Strathmore, Alta., Alberta Agriculture and the University of Alberta. However, producers will still have to collect weights and performance data because animals are always evolving. â&#x20AC;&#x153;After the initial investment of measuring RFI, you could probably scale it back a little bit after testing your present generation, but you will never get away from testing for RFI,â&#x20AC;? said John Crowley of the U of Aâ&#x20AC;&#x2122;s Livestock Gentec. Feed efficiency is a heritable trait, but breeders have not selected cattle for their ability to put on the pounds over the last 40 years. â&#x20AC;&#x153;With long-term selection for feedto-gain ratio, we end up with animals that grow faster and eat more,â&#x20AC;? said lead researcher John Basarab of Alberta Agriculture. â&#x20AC;&#x153;We donâ&#x20AC;&#x2122;t end up with an animal that is any more efficient. We just end up with bigger cows, and they eat more,â&#x20AC;? he said at a producer day held at Olds College Jan. 23.

Feedlots are paid by the pound, but the costs to fatten those cattle are also critical. Knowing which cattle are the most efficient could be more profitable, said William Torres, research manager at Cattleland Feedyards. â&#x20AC;&#x153;It is hard to make money, especially when you donâ&#x20AC;&#x2122;t know what it is costing you to raise these animals,â&#x20AC;? he said. Torres calculates that feeding more efficient animals could save five cents per head per day, which means a 5,000 head feedlot would save $37,000 in feed costs because the steers ate less to reach market weight. He sees residual feed intake information as a good marketing tool that producers need to adopt. â&#x20AC;&#x153;Calves with good RFI produce less methane, have lower heart rates and spend less time eating,â&#x20AC;? he said. For example, performance data during a 77-day growing trial from Texas A & M University showed two steers coming in at 538 and 535 lb., respectively. The more efficient steer at 535 lb. gained the same as the other but ate 485 lb. less feed to get to market weight. Feedlots want to find those efficient animals, but no one knows if buyers are willing to pay more for calves from feed efficient bulls. Basarab said the Hereford research project is looking for bulls that grow fast and eat less. The bulls are fed using the Growsafe system, in which every bite of feed is measured along with other data, such as how often each one visited the feed bunk.

The first tests in 2012-13 involved 320 bulls. The average animal was rated as zero on a scale, while an efficient animal was assigned a negative value and inefficient animals received a plus number. They were fed 18 lb. of dry matter per day and gained about three lb. per day. The range in gain was 2.5 to 3.5 lb. per day. The test found that 107 were rated at zero, meaning they are average,107 were considered inefficient and the rest were deemed efficient. Researchers are also looking for the genes that indicate which animals are more efficient. Crowley said finding the part of the genetic code that is responsible for that trait will make it possible to predict what future progeny might do. Purebred breeders will see the more immediate benefits from this research, but Crowley said the next step is to genetically assess crossbreds for valued traits. â&#x20AC;&#x153;The big challenge at the moment is to get genomics working at a crossbred level for the commercial guys,â&#x20AC;? he said. Another project at Agriculture Canadaâ&#x20AC;&#x2122;s research centre in Lacombe, Alta., is testing replacement heifers for feed efficiency. That ability seems to continue throughout their lives. Those cows would be cheaper to keep, but real herd improvement comes from the sires. â&#x20AC;&#x153;The heifer is probably not where I would start,â&#x20AC;? Basarab said. â&#x20AC;&#x153;There is so much genetic improvement that comes from the bull side.â&#x20AC;?


LIVESTOCK

THE WESTERN PRODUCER | WWW.PRODUCER.COM | FEBRUARY 6, 2014

91

AVIAN FLU | PREVENTION

Wild bird surveillance key to early H5N1 avian flu detection ANIMAL HEALTH

JAMIE ROTHENBURGER, DVM

The Canada Interagency Wild Bird Survey tested 8,800 birds over five years with no positive H5N1 cases

T

ragedy struck in early January when the first North American victim of the deadly H5N1 avian influenza died in an Edmonton hospital. The individual travelled to Beijing in December and had recently returned home to Alberta. Investigations are ongoing into how the person contracted the virus and may shed light on how to minimize the risks to future travellers. The emergence of H5N1 avian flu in Asia is a major public health concern. Since 1997, 648 human cases have been reported and of these, 384 were fatal. The lethality of this virus in people is what sets it apart from typical flu viruses. Cases have been reported in 15 countries, with the majority occurring in China, Vietnam, Cambodia, Indonesia and Egypt. Most human cases have been attributed to contact with infected domestic poultry, usually in live markets, and tend to occur in young adults and children.

H5N1 does not readily transfer between people, unlike seasonal flu, which is highly contagious. Perhaps the greatest risk to people will occur if the virus gains the ability to be transmitted between people. H5N1 is considered to be a highly pathogenic influenza virus, meaning it causes high mortality in domestic birds. Therefore, in addition to the risk to people, outbreaks of this virus have resulted in affected countries killing hundreds of millions of domestic birds. This response has failed to limit the spread, and the associated economic and social impacts have been astronomical. Ducks and other wild waterfowl are the natural hosts of avian influenza viruses, where they circulate in lowpathogenic forms. These birds carry and shed the virus without causing disease, but it can mutate and cause high rates of mortality if it gets into domestic poultry. The transportation of infected people and domestic birds around the world is likely how H5N1 will be introduced, although wild birds are another possible route into North America. It’s why the Canadian Co-operative Wildlife Health Centre co-ordinates the Canada Interagency Wild Bird Survey, which tests birds for all avian influenza viruses. The survey gathers information on which strains of influenza are circulating in wild bird populations. More than 1,000 birds were tested last year, and two were positive for the run-of-the-mill North American strain of avian influenza. The survey has tested 8,800 birds over the past five years, and none were infected

Bin looking for higher yields? With Novozymes BioAg products like TagTeam®, JumpStart®, Optimize® and Cell-Tech®, we can help you increase your yield and get a better return on your investment!

Sign up with Novozymes and be entered to WIN THIS BIN! GRAND PRIZE Meridian® 4120 bushel GrainMax GM4000 grain bin equipped with AirMax vertical aeration system, HD skid base and more (SRP $22,600) 2nd Prize - $5,000 of Novozymes products 3rd Prize - $3,000 of Novozymes products

Contest is i open to commercially i ll active i farmers f in Western Canada (namely the provinces of Manitoba, Saskatchewan, Alberta and the Peace River region of British Columbia). Full contest details at WinThisBin.ca. Novozymes is the world leader in bioinnovation. Together with customers across a broad array of industries we create tomorrow’s industrial biosolutions, improving our customers’ business and the use of our planet’s resources. Read more at www.novozymes.com. ® TagTeam, JumpStart, Optimize and Cell-Tech are registered trademarks of Novozymes A/S. All rights reserved. Meridian Trademarks used with permission. Printed in Canada. 13048 11.13

© 2013 Novozymes 2013-17050-01

Visit WinThisBin.ca

Ducks and other wild waterfowl are hosts of avian influenza viruses and pose a risk to domestic birds. | JAMIE ROTHENBURGER PHOTO with the H5N1 strain. “Vigilance is needed because if a highly pathogenic virus were to arrive in North America by any means, it could cause disease or mortality in poultry, people or wildlife. Early detection requires surveillance in all three groups,” said Dr. Ted Leighton, the centre’s national director. The survey began following the outbreak of high pathogenic avian influenza (H7N3) in British Columbia’s Fraser Valley in 2004. It was

eradicated after 17 million birds were culled and more than $300 million in economic losses were incurred. Other strains of avian influenza continue to crop up in Asia and represent an ongoing threat to public and animal health. “These viruses are highly flexible and they change rapidly. There is constant movement between wild bird populations and domestic birds,” said Leighton. Biosecurity remains essential to

prevent future outbreaks of highly pathogenic avian influenza and potential establishment of H5N1 in North America. The human risk of contracting H5N1 remains low, but the tragic loss of a Canadian to this virus serves as a reminder that diseases elsewhere in the world are only a plane ride away. Dr. Jamie Rothenburger is a veterinary pathology resident at the Western College of Veterinary Medicine, University of Saskatchewan.


92

FEBRUARY 6, 2014 | WWW.PRODUCER.COM | THE WESTERN PRODUCER

AGFINANCE

CDN. BOND RATE:

CDN. DOLLAR:

1.570%

$0.8994

2.20%

0.960

2.00%

0.940

1.80%

0.920

1.60%

0.900

1.40% 12/27 1/6

1/13 1/20 1/27

2/3

Bank of Canada 5-yr rate

0.880 12/27 1/6

1/13 1/20 1/27

2/3

Feb. 3

A G F IN ANC E E D I TO R : D ’ A RC E M C M ILLAN | P h : 306- 665- 3519 F: 306-934-2401 | E-MAIL: DARC E.M C M ILLAN @PRODUC ER.C OM | TWITTE R: @ D AR CE MCMILLAN

AG STOCKS JAN. 27 - 31 The U.S. Federal Reserve further trimmed its stimulus, causing investors to pull money from currencies and stocks in emerging markets. For the week, the TSX composite fell 0.17 percent, the Dow fell 1.1 percent, the S&P 500 dipped 0.4 percent and the Nasdaq slipped 0.6 percent. Cdn. exchanges in $Cdn. U.S. exchanges in $U.S.

GRAIN TRADERS NAME

EXCH

ADM NY Alliance Grain TSX Bunge Ltd. NY ConAgra Foods NY W.I.T. OTC

CLOSE LAST WK 39.57 17.67 77.64 32.75 16.00

41.01 18.68 81.30 33.42 16.00

PRAIRIE PORTFOLIO NAME

EXCH

Assiniboia FLP OTC Ceapro Inc. TSXV Cervus Equip. TSX Input Capital TSX Ridley Canada TSX Rocky Mtn D’ship TSX

CLOSE LAST WK 2.346 0.115 23.97 2.21 15.79 13.19

2.346 0.12 23.94 2.53 14.85 13.38

FOOD PROCESSORS NAME

EXCH

Hormel Foods Maple Leaf Premium Brands Tyson Foods

NY TSX TSX NY

CLOSE LAST WK 45.14 15.75 22.53 34.77

45.85 16.33 22.53 35.04

FARM EQUIPMENT MFG. NAME

EXCH

Ag Growth Int’l TSX AGCO Corp. NY Buhler Ind. TSX Caterpillar Inc. NY CNH Ind. N.V. NY Deere and Co. NY Vicwest Fund TSX

CLOSE LAST WK 45.67 53.08 6.98 86.17 11.14 85.55 10.92

45.71 55.41 7.11 91.44 11.79 89.35 11.60

FARM INPUT SUPPLIERS NAME

EXCH

Agrium TSX BASF OTC Bayer Ag OTC Dow Chemical NY Dupont NY BioSyent Inc. TSXV Monsanto NY Mosaic NY PotashCorp TSX Syngenta ADR

103.13 107.22 136.84 43.07 64.02 4.40 113.11 48.54 37.49 77.31

TRANSPORTATION NAME

EXCH

CN Rail CPR

TSX TSX

CLOSE LAST WK 57.93 156.88

Rail companies optimistic Record revenues at CP, CN | Cold winter weather hampered car movement and efficiency in 2013 BY BRIAN CROSS SASKATOON NEWSROOM

CLOSE LAST WK 98.78 105.83 134.92 43.41 59.97 4.11 107.94 45.38 35.19 74.47

TRANSPORTATION | RAIL PROFITS

58.58 163.94

List courtesy of Ian Morrison, financial adviser with the Calgary office of Raymond James Ltd., member of the Canadian Investor Protection Fund. The listed equity prices included were obtained from Thomson Reuters and the OTC prices included were obtained from PI Securities Ltd., Assiniboia Farmland LP. The data listed in this list has been obtained from sources believed to be reliable, but accuracy cannot be guaranteed. Within the last 12 months, Raymond James Ltd. has undertaken an underwriting liability or has provided advice for a fee with respect to the securities of Alliance Grain. For more information, Morrison can be reached at 403-221-0396 or 1-877-264-0333.

Canada’s major rail companies generated record-breaking revenues in 2013 in spite of a downturn in business caused by cold weather in December. Last week, Canadian Pacific Railway reported year-end 2013 revenues of $6.1 billion, up eight percent from 2012 and a company record. Adjusted net income was $1.1 billion, up 48 percent over 2012. Canadian National Railway also reported record full-year revenues of nearly $10.6 billion. Net income was reported at $2.61 billion, down from $2.68 billion in 2012. Grain movement played prominently in the railways’ revenue figures. At CP, freight revenue from grain movement increased to $1.3 billion in 2013, up 11 percent from the previous year.

The railway moved 438,000 carloads of grain in 2013, an increase of five percent over 2012. At CN, revenue from grain was $1.6 billion. Despite record revenues, railway operations were affected by cold winter weather that hampered car movement and overall railway efficiency for most of December, said CN president Claude Mongeau. “If you have a few periods of few days with -30 C … you lose capacity. You have to shorten trains so you need more assets and you obviously build up a backlog,” Mongeau said in a Jan. 30 conference call. “What we’re seeing this year is just extended periods with no reprieve.…. “You have to go back to 1879 to have a month of December in Winnipeg that was this cold. In Saskatoon, there were 18 days (in December) that were less than -30 C.” CN’s chief operating officer Jim Vena said extremely cold conditions

that persisted into January will continue to have a negative impact on traffic volumes. CN increased resources to compensate for the weather and tweaked yard procedures to improve winter efficiency. Nonetheless, “we know we will not be able to move all of the business that (the company had hoped) … to move in the first quarter,” Vena said. At CP, chief operating officer Hunter Harrison said the railway company will be playing catch up in the coming months to make up for business backlogs incurred in December and January. “Clearly we had impact from weather conditions here in Canada…,” Harrison said. “I know if this first quarter continues like it is … we’re going to have some catch up to do in the next three quarters.” Both railways said they will continue to make strategic investments in sid-

ings aimed at optimizing train lengths and reducing train stops and starts. Both railways acknowledged that grain traffic in December and January was down from earlier projections. But in the future, demand for rail service from grain shippers should be strong and consistent, with fewer demand peaks and more predictable volumes. “When I look at the outlook for grain, I think that we’re going to move grain more consistently,” said CP’s chief marketing officer Jane O’Hagan. “I think it’s going to be one of the crop years where we don’t have the peakiness that we’ve had in the past. “We’ll probably have some large carryover and with an average crop (in 2014), we’re going to see strong movement throughout the year.” Added CN’s Mongeau: “We have a huge crop and things are looking good for the balance of the year and probably well into 2015.”

ENTREPRENEURS | FINANCING

Prairie Paper Ventures uses crowd funding to raise capital for new paper plant BY ROBERT ARNASON BRANDON BUREAU

Crowd funding arrived at just the right moment for Jeff Golfman, a Winnipeg entrepreneur who wants to revolutionize the North American paper industry. Golfman is using the relatively new practice of selling small amounts of equity to many investors, usually

through the internet, to try to raise $5 million for his company, which manufactures paper from wheat straw. Golfman is one of three partners in Prairie Paper Ventures, formerly Prairie Pulp & Paper, along with former Manitoba finance minister Clayton Manness and actor Woody Harrelson. In co-operation with the Toronto investment banking firm Optimize Capital Markets, Golfman discov-

ered that crowd funding is a great fit for his business. “Overall, we have been able to raise more capital, quicker, and while maintaining more ownership of our company,” Golfman said in an email. “We have had much success in a short period of time with Optimize, which is very different than our experience with the traditional routes of fundraising.” Following years of experimentation

and testing, Golfman and his partners have developed a process for turning wheat straw into high quality paper. Golfman and Manness have long promoted the idea of building North America’s first commercial scale straw paper plant, possibly in Manitoba, at an estimated cost of $500 million to $1 billion. However, before that happens, Golfman said they need $5 million in

capital to expand the business. Prairie Paper now manufactures its paper at a mill in northern India and buys wheat straw from farms within 100 kilometre of the plant. During a January presentation to potential crowd funders in Toronto, Harrelson said the company uses 80 percent wheat straw and 20 percent CONTINUED ON NEXT PAGE

»


AGFINANCE

THE WESTERN PRODUCER | WWW.PRODUCER.COM | FEBRUARY 6, 2014

93

» CONTINUED FROM PREVIOUS PAGE

Actor Woody Harrelson is one of three partners in Prairie Paper Ventures, a company that manufactures paper from wheat straw. | REUTERS PHOTO

tree fibre certified by the Forest Stewardship Council (FSC). “It’s always been a big concern of mine that paper comes from the forest,” said Harrelson, an environmental advocate and supporter of hemp, in a recorded video presentation. “Now, it’s back to the farm.” The Staples chain agreed in 2012 to become the exclusive distributor of the wheat straw paper, which is branded Step Forward Paper. Prairie Paper has also signed an exclusive deal with Unisource to distribute its paper, and Golfman said a long list of clients, including Hollywood studios and a Canadian telecommunications company, are now using Step Forward Paper. He said sales are growing because North Americans prefer environmentally friendly products, provided price and quality are comparable to conventional options. “Every day that goes by we keep on getting more orders coming our way,” he said.

“Research has shown if people have an eco-product and a regular product and everything else is equal… nine times out of 10 people will take the eco-option.” Golfman estimated that Prairie Paper sold $1 million worth of paper last year. If it can raise $5 million through crowd funding, Golfman and his partners will use the capital to expand their operations and hire staff, including customer service representatives and supply chain managers. “Through this five million raise, we believe we can build our revenues up to $25 million over the next few years.” Matthew McGrath, president of Optimize Capital Markets, said participants in the $5 million Initial Crowdfunding Offering would receive equity in Prairie Paper. “It’s a 20 percent equity offering in the company,” he said. Prairie Paper has also applied for

patents on its technology. “Our patents (recently) went from pending status to patent allowable status,” Golfman said. “Which means our patents are moments away from being officially approved.” He said the company is focused on increasing demand for wheat straw paper, which means they won’t make a decision on a dedicated North American mill for several years. Following his presentation in Toronto, an audience member asked why Prairie Paper wants and needs a plant in North America. Golfman said it’s expensive to ship paper from India, and a highly automated plant in Canada could compete with low cost overseas labour. “We can actually be a lot cheaper if it’s local. We’re paying $200 a tonne to ship it over back into the North America market,” he said. “And the straw is actually more plentiful here.”

RESTRUCTURING | CASH FLOW

Consider working capital needed before restructuring debt PERSPECTIVES ON MANAGEMENT

TERRY BETKER

N

o grain movement means no cash flow for a lot of farmers. Declining prices compound the problem. It doesn’t take long for insufficient cash flow to become a management challenge. The situation is difficult now but will become worse as we approach spring with operating loans at their limits. Farmers may be wondering what they should do. There are options. Visiting your lender sooner rather than later is a good first step. Maintaining regular communication with lenders when facing financial challenges is critical. Selling assets is an option, as is contributing personal money to the business. Another option, but not for everyone, is to have an individual or company invest money in the farm, which is referred to as equity capital. Restructuring debt is a more common option. It moves some or all of a business’s current debt (to be repaid in the next 12 months) to long-term debt. Typical types of current debt are an operating loan, accounts payable, commodity advances and the principal on long-term debt that is to be paid within the year. Restructuring doesn’t increase a business’s overall debt, but it does increase its commitment to making related principal and interest payments. The benefit is that inventory sales then become cash flow for operations instead of everything going to pay current debt obligations. If the original operating loan limit was left intact, those funds are also available to finance operations.

The farm should have the proven ability to be able to make the additional principal and interest payments. This may not be an issue for some farmers but could be quite a different story for others. Lower crop prices are currently problematic for many farmers. Today’s costs of production mean projected commodity prices and long-term average yields do not provide the profit margins needed to support additional debt repayment. A farm’s repayment history can compound these problems because getting the restructuring in place may not be possible if it is weak. Lenders usually demand additional security in the form of equity in assets when they perceive more risk.

Unencumbered assets are the best source of additional equity, but be cautious about mortgaging clear title land. The recent increase in land prices provides equity that could be used to secure new term debt associated with restructuring. Farmers first need to determine how much working capital they need to finance operations this year. Examining past cash flow will provide a good indication as to what is required. They can then arrange the restructuring accordingly, terming out enough of the current debt to end up with the desired working capital. Producers should also test their farm’s earned ability to make the additional principal and interest payment. First, they should determine their

average net earnings (before depreciation and term interest) for the past three to five years. Divide this number by the annual principal and interest commitments before the restructuring. This is the existing debt servicing ratio. Now, take the same net earnings but divide it by the annual principal and interest commitment, including the new restructuring commitments. This is the revised debt servicing ratio. Compare the two. Try to keep the new ratio to 1.5 or better, which is $1.50 for every $1 of principal and interest. Allowing the debt servicing ratio fall to $1.25 or lower as a result of restructuring can be problematic over the life of a loan. Restructuring debt is a common practice and may be a good option.

However, whether farmers choose to restructure or consider other options to help them get back on solid financial ground, there are pros and cons. It’s important to consider each option carefully and seek professional advice from lenders and independent farm management advisers who can help make the best decisions for each specific circumstance. I recommend that farmers think carefully about debt restructuring. If they are going to take this step, make sure not to just apply a Band-Aid in the short term. Consider the longerterm implications. Terry Betker is a farm management consultant based in Winnipeg, Manitoba. He can be reached at 204.782.8200 or terry. betker@backswath.com.

Support the Wheat & Barley Check-Off

Are you looking for…

to bring new varieties and marketing opportunities to your farm and maintain your unique, competitive edge in the global marketplace. This voluntary check-off of $0.48/tonne of wheat and $0.56/tonne of barley will be shown as a Deduction of Levy on your Cash Purchase Ticket upon grain delivery at a Canadian Grain Commission-licensed company.

wheat barleycheckoff.com

These funds will be delivered to three important groups that work together to provide variety research, market development and technical expertise to support your farm’s future. Visit their websites to learn more:

westerngrains.com

cigi.ca

cmbtc.com


94

MARKETS

FEBRUARY 6, 2014 | WWW.PRODUCER.COM | THE WESTERN PRODUCER

CATTLE & SHEEP

GRAINS Slaughter Cattle ($/cwt)

Steers 600-700 lb. (average $/cwt)

Grade A

Alberta

Live Jan. 24-30

Previous Jan. 17-23

Year ago

Rail Jan. 24-30

Previous Jan. 17-23

140.00 124.87-157.13 n/a n/a

137.00-148.50 124.51-150.12 n/a n/a

116.24 121.73 n/a n/a

236.75-238.50 238.00-250.00 n/a n/a

233.50-238.00 228.00-242.00 n/a n/a

n/a 136.71-150.45 n/a n/a

148.50 132.70-147.97 n/a n/a

n/a 122.07 n/a n/a

n/a 237.00-249.00 n/a n/a

233.50-238.00 227.00-241.00 n/a n/a

$185

Steers Alta. Ont. Sask. Man. Heifers Alta. Ont. Sask. Man.

$180

*Live f.o.b. feedlot, rail f.o.b. plant.

$190 $180 $170 $160

n/a n/a $150 12/27 1/6

1/13 1/20 1/27

3/3

Saskatchewan $190

$175

n/a n/a

$170 12/27 1/6

Feeder Cattle ($/cwt)

n/a 1/13 1/20 1/27

3/3

Manitoba $185 $180 $175 $170

n/a n/a

$165 12/27 1/6

Canfax

n/a 1/13 1/20 1/27

3/3

Heifers 500-600 lb. (average $/cwt) Alberta $200.0

Steers 900-1000 800-900 700-800 600-700 500-600 400-500 Heifers 800-900 700-800 600-700 500-600 400-500 300-400

Man.

Alta.

B.C.

144-153 145-169 160-184 176-196 187-207 191-222

140-158 147-166 160-183 173-196 180-213 190-223

148-162 154-170 165-180 175-196 187-208 195-220

134-158 142-169 155-174 160-196 180-208 190-223

133-153 141-165 152-171 165-184 171-193 168-191

130-154 142-165 150-173 158-183 168-190 155-190

140-159 149-167 158-176 164-186 170-195 175-195

130-149 140-164 162-181 160-192 170-195 170-195 Canfax

$185.0 $170.0 $155.0

Average Carcass Weight n/a n/a

$140 12/27 1/6

1/13 1/20 1/27

3/3

Jan. 25/14 848 792 666 812

Canfax

Steers Heifers Cows Bulls

Saskatchewan $175 $170 $165 $160

n/a n/a $155 12/27 1/6

n/a 1/13 1/20 1/27

3/3

$180 $175 $170 n/a n/a $160 12/27 1/6

YTD 14 848 790 668 878

YTD 13 884 821 676 934

U.S. Cash cattle ($US/cwt)

Manitoba

$165

Jan. 26/13 884 816 687 861

n/a 1/13 1/20 1/27

3/3

Slaughter cattle (35-65% choice) National Kansas Nebraska Nebraska (dressed)

Heifers 145.16 144.98 145.00 n/a

Feeders No. 1 (800-900 lb) Steers South Dakota 155-173 Billings 154.25-165.50 Dodge City 159-164

Trend steady/+1 +2/+4 steady/weak USDA

Basis Cattle / Beef Trade

Cash Futures Alta-Neb Sask-Neb Ont-Neb-

n/a n/a n/a

-19.10 n/a -11.53

Canadian Beef Production million lb. YTD % change Fed 123.2 +9 Non-fed 28.9 -6 Total beef 152.1 +6

Exports % from 2013 37,508 (1) +4.8 7,461 (1) +42.5 183,207 (3) -1.6 257,902 (3) +1.3 Imports % from 2013 n/a (2) n/a 55,634 (2) +8.4 10,578 (4) -25.6 12,810 (4) -33.2

Sltr. cattle to U.S. (head) Feeder C&C to U.S. (head) Total beef to U.S. (tonnes) Total beef, all nations (tonnes) Sltr. cattle from U.S. (head) Feeder C&C from U.S. (head) Total beef from U.S. (tonnes) Total beef, all nations (tonnes)

(1) to Jan. 18/14 (2) to Nov. 30/13 (3) to Nov. 30/13 (4) to Jan. 25/14

Canfax

To Jan. 25

Fed. inspections only Canada U.S. To date 2014 191,790 2,295,285 To date 2013 176,721 2,381,217 % Change 14/13 +8.5 -3.6

Agriculture Canada

Close Jan. 31 Live Cattle Feb 141.68 Apr 140.43 Jun 131.50 Aug 129.83 Oct 133.28 Feeder Cattle Mar 169.43 Apr 169.68 May 170.08 Aug 171.35 Sep 170.15

Close Trend Jan. 24 143.40 140.10 132.13 130.15 132.93

-1.72 +0.33 -0.63 -0.32 +0.35

127.10 132.18 127.75 128.68 133.00

168.88 169.48 170.20 171.33 170.70

+0.55 +0.20 -0.12 +0.02 -0.55

149.20 152.13 154.70 160.08 161.40

Est. Beef Wholesale ($/cwt) This wk Last wk Yr. ago 227-229 226-228 215 Canfax

Sheep ($/lb.) & Goats ($/head) Jan. 24 Base rail (index 100) 2.78 Range 0.13-0.17 Feeder lambs 1.30-1.40 Sheep (live) 0.35

Previous 2.78 0.02-0.18 1.30-1.40 0.35

Jan. 27 1.80-2.37 1.80-1.90 1.45-1.88 1.70-1.81 1.65-1.75 1.30-1.70 0.80-0.97 0.85-1.00 60-100

New lambs 65-80 lb 80-95 lb > 95 lb > 110 lb Feeder lambs Sheep Rams Kids

Index 100 Hog Price Trends ($/ckg) Alberta $180 $170 $160 $150 $140 12/27 1/6

1/13 1/20 1/27

3/3

Feb 23-Mar 08 Mar 09-Mar 22 Mar 23-Apr 05 Apr 06-Apr 19 Apr 20-May 03 May 04-May 17 May 18-May 31 Jun 01-Jun 14 Jun 15-Jun 28 Jun 29-Jul 12

Ontario Stockyards Inc.

1.35-1.40 1.45 1.25-1.35 0.25-0.40

Wool lambs >80 lb Wool lambs <80 lb Hair lambs Fed sheep

$180

Sltr. hogs to/fm U.S. (head) Total pork to/fm U.S. (tonnes) Total pork, all nations (tonnes)

$170 $160 $150 $140 12/27 1/6

(1) to Jan. 18/14 1/13 1/20 1/27

(2) to Nov. 30/13

To Jan. 25 Canada 1,528,512 1,555,907 -1.8

To date 2014 To date 2013 % change 14/13

Fed. inspections only U.S. 8,566,581 8,570,127 0.0 Agriculture Canada

163.00 162.62

Man. Que.

162.00 165.98 *incl. wt. premiums

$160 $155 $150 1/13 1/20 1/27

3/3

Feb Apr May Jun

Close Jan. 31 86.23 94.80 102.70 104.83

Close Jan. 24 86.38 94.03 100.55 102.35

% from 2013 -19.3 +13.9 -1.3

Import n/a 28,524 (3) 29,058 (3)

(3) to Jan. 25/14

Trend -0.15 +0.77 +2.15 +2.48

Year ago 87.65 88.75 96.60 97.50

% from 2013 n/a +92.2 +86.6 Agriculture Canada

Jul Aug Oct Dec

EXCHANGE RATE: FEB. 3 $1 Cdn. = $0.8994 U.S.. $1 U.S. = $1.1119 Cdn.

Durum (March) $255 $250 $245 $235 12/27 1/6

1/13 1/20 1/27

2/3

Milling Wheat (March) $190 $185

$170 12/27 1/6

1/13 1/20 1/27

2/3

Close Jan. 31 103.40 101.00 85.98 80.38

Trend +2.60 +2.70 +1.60 +0.73

Year ago 97.73 97.15 87.43 83.78

Feb. 3 19.50-22.00 13.75-15.00 16.50-19.00 16.00-18.00 12.00-15.00 18.25-20.00 14.50-18.00 9.30-11.00 8.30-8.50 4.85-6.25 4.85-5.35 11.00-12.50 5.00-5.50 34.00-35.75 33.00-34.75 27.30-28.75 19.00-21.00 19.00-20.00 14.00-18.00 9.00-14.00 9.00-18.00

Avg. Jan. 27 20.38 20.50 14.71 14.88 18.10 18.10 16.75 16.63 13.60 13.50 19.46 19.46 16.25 16.25 9.76 9.76 8.46 8.46 5.40 5.40 5.28 5.28 11.75 11.75 5.15 5.15 35.17 35.17 34.31 34.31 28.27 28.27 20.00 19.68 19.67 19.17 14.00 14.00 9.00 9.00 12.00 12.00

Cash Prices

Canola (cash - March)

Jan. 29 Jan. 22 Year Ago No. 3 Oats Saskatoon ($/tonne) 133.51 149.43 191.87 Snflwr NuSun Enderlin ND (¢/lb) 19.10 19.15 22.70

$395 $390 $385 $380 $375 12/26 1/3

U.S. Grain Cash Prices ($US/bu.) 1/10 1/17 1/24 1/31

$-35 $-40 $-45 $-50 $-55 12/26 1/3

1/10 1/17 1/24 1/31

Feed Wheat (Lethbridge) $180 $170 $160 $150 $140 12/26 1/3

1/10 1/17 1/24 1/31

$460 $440 $420 $400 $380 12/26 1/3

1/10 1/17 1/24 1/31

Barley (cash - March) $165 $160

Basis: $30

$150 $145 12/26 1/3

1/10 1/17 1/24 1/31

Canola and barley are basis par region. Feed wheat basis Lethbridge. Basis is best bid.

Corn (March) $440 $435 $430 $425 $420 12/27 1/6

1/13 1/20 1/27

2/3

$1340 $1320 $1300 $1280 1/13 1/20 1/27

2/3

Oats (March) $450 $420 $390

Grain Futures Feb. 3 Jan. 27 Trend Wpg ICE Canola ($/tonne) Mar 426.40 428.80 -2.40 May 436.60 438.60 -2.00 Jul 445.30 447.40 -2.10 Nov 460.80 462.80 -2.00 Wpg ICE Milling Wheat ($/tonne) Mar 177.00 180.00 -3.00 May 181.00 186.00 -5.00 Jul 184.00 189.00 -5.00 Wpg ICE Durum Wheat ($/tonne) Mar 245.00 245.00 0.00 May 249.00 249.00 0.00 Wpg ICE Barley ($/tonne) Mar 126.50 126.50 0.00 May 128.50 128.50 0.00 Chicago Wheat ($US/bu.) Mar 5.6375 5.6350 +0.0025 May 5.6575 5.6975 -0.0400 Jul 5.6875 5.7525 -0.0650 Dec 5.8975 5.9650 -0.0675 Chicago Oats ($US/bu.) Mar 4.1475 4.0075 +0.1400 May 3.6825 3.5800 +0.1025 Dec 2.9575 2.9100 +0.0475 Chicago Soybeans ($US/bu.) Mar 12.9275 12.8775 +0.0500 May 12.7825 12.7100 +0.0725 Jul 12.6225 12.5650 +0.0575 Nov 11.0850 11.0150 +0.0700 Chicago Soy Oil (¢US/lb.) Mar 37.45 37.06 +0.39 May 37.76 37.41 +0.35 Jul 38.09 37.77 +0.32 Chicago Soy Meal ($US/short ton) Mar 434.0 430.9 +3.1 May 417.1 414.0 +3.1 Jul 406.5 404.0 +2.5 Chicago Corn ($US/bu.) Mar 4.3575 4.3175 +0.0400 May 4.4175 4.3800 +0.0375 Jul 4.4675 4.4400 +0.0275 Dec 4.5300 4.5250 +0.0050 Minneapolis Wheat ($US/bu.) Mar 6.1075 6.0650 +0.0425 May 6.0475 6.0975 -0.0500 Jul 6.1150 6.1900 -0.0750 Dec 6.3275 6.4125 -0.0850 Kansas City Wheat ($US/bu.) Mar 6.2425 6.2250 +0.0175 May 6.1775 6.2025 -0.0250 Dec 6.3225 6.3825 -0.0600

Year ago 633.10 621.60 611.30 565.50 291.00 294.00 296.00 312.40 316.40 241.50 242.50 7.6300 7.7075 7.7600 8.0225 3.5975 3.6525 3.6675 14.8875 14.8025 14.7050 13.4400 53.11 53.54 53.84 434.3 431.4 425.8 7.3425 7.3625 7.2750 5.9375 8.4700 8.5975 8.6950 8.7625 8.1700 8.2875 8.6450

Canadian Exports & Crush

$360 1/13 1/20 1/27

2/3

Minneapolis Nearby Futures ($US/100bu.) Spring Wheat (March) $660.0 $645.0 $630.0 $615.0 $600 12/27 1/6

Jan. 31 6.14 5.54 6.90 4.56 3.12

USDA

No. 1 DNS (14%) Montana elevator No. 1 DNS (13%) Montana elevator No. 1 Durum (13%) Montana elevator No. 1 Malt Barley Montana elevator No. 2 Feed Barley Montana elevator

Canola (basis - March)

$330 12/27 1/6

Close Jan. 24 100.80 98.30 84.38 79.65

Laird lentils, No. 1 (¢/lb) Laird lentils, Xtra 3 (¢/lb) Richlea lentils, No. 1 (¢/lb) Eston lentils, No. 1 (¢/lb) Eston lentils, Xtra 3 (¢/lb) Sm. Red lentils, No. 2 (¢/lb) Sm. Red lentils, Xtra 3 (¢/lb) Peas, green No. 1 ($/bu) Peas, green 10% bleach ($/bu) Peas, med. yellow No. 1 ($/bu) Peas, sm. yellow No. 2 ($/bu) Maple peas ($/bu) Feed peas ($/bu) Mustard, yellow, No. 1 (¢/lb) Mustard, brown, No. 1 (¢/lb) Mustard, Oriental, No. 1 (¢/lb) Canaryseed (¢/lb) Desi chickpeas (¢/lb) Kabuli, 8mm, No. 1 (¢/lb) Kabuli, 7mm, No. 1 (¢/lb) B-90 ckpeas, No. 1 (¢/lb)

Cash Prices

$1260 12/27 1/6

Chicago Hogs Lean ($US/cwt)

$165

2/3

Soybeans (March)

Index 100 hogs $/ckg

3/3

Manitoba

$145 12/27 1/6

Export 38,275 (1) 334,049 (2) 1,085,989 (2)

1/13 1/20 1/27

Chicago Nearby Futures ($US/100 bu.)

Hogs / Pork Trade

Saskatchewan

$120 12/27 1/6

$155

Hog Slaughter

Alta. Sask.

$130

Flax (elevator bid- S’toon) 1.70-2.25 1.60-2.01 1.60-1.70 1.60-1.70 1.45-1.60 1.30-1.70 0.82-0.94 0.85-1.00 60-100

Feb. 3

Fixed contract $/ckg Maple Leaf Thunder Sig 3 Creek Pork Jan. 31 Jan. 31 178.00-179.53 177.07-178.72 180.56-181.58 174.95-175.68 178.00-180.37 178.20-178.65 181.39-183.94 181.28-182.89 187.01-196.83 192.24-197.48 200.41-203.99 200.67-203.97 202.96-208.08 199.10-204.20 204.50-206.03 205.69-207.81 207.05-209.61 208.74-209.36 206.06-209.13 201.09-204.46

$140

SunGold Meats

HOGS (Hams Marketing)

$150

$175

Year ago

Sask. Sheep Dev. Bd.

Due to wide reporting and collection methods, it is misleading to compare hog prices between provinces.

$160

$180

Chicago Futures ($US/cwt)

Montreal

Steers 145.11 144.96 145.83 231.55

Source: STAT Publishing, which solicits bids from Maviga N.A., Legumex Walker, CGF Brokerage, Parrish & Heimbecker, Simpson Seeds and Alliance Grain Traders. Prices paid for dressed product at plant.

Barley (March)

$240

Cattle Slaughter

Sask.

Pulse and Special Crops

ICE Futures Canada

1/13 1/20 1/27

2/3

To (1,000 MT) Jan. 26 Wheat n/a Durum n/a Oats n/a Barley n/a Flax n/a Canola n/a Peas n/a Lentils n/a (1,000 MT) Jan. 29 Canola crush 144.8

To Jan. 19 137.83 173.82 16.58 11.32 2.89 103.16 22.3 12.07 Jan. 22 130.1

Total Last to date year n/a 6668.6 n/a 2332.9 n/a 636.9 n/a 793.5 n/a 155.0 n/a 4033.5 n/a 885.4 n/a n/a to date Last year 3364.0 3576.1


WEATHER

DINE & DASH |

THE WESTERN PRODUCER | WWW.PRODUCER.COM | FEBRUARY 6, 2014

A bald eagle takes off from a field east of High River, Alta., after feeding on an animal carcass. | MIKE STURK PHOTO

PUBLISHER: SHAUN JESSOME EDITOR: JOANNE PAULSON MANAGING EDITOR: MICHAEL RAINE Box 2500, 2310 Millar Ave. Saskatoon, Sask. S7K 2C4. Tel: (306) 665-3500

ADVERTISING

TEMP. MAP

TEMPERATURE FORECAST

Churchill - 19 / - 28

Normal

Edmonton - 2 / - 11 Saskatoon Calgary - 6 / - 16 2 / - 11 Regina Winnipeg - 4 / - 15 - 6 / - 16

Below normal

ADVERTISING RATES Classified liner ads: $5.85 per printed line (3 line minimum) Classified display ads: $6.70 per agate line ROP display: $9.50 per agate line

Feb. 6 - 12 (in mm)

Above normal

Prince George 7.9

Vancouver 32.6

Churchill 4.3 Edmonton 4.2 Saskatoon Calgary 2.3 1.5 Regina 3.0

Much below normal

1-800-667-7770 1-800-667-7776 (306) 665-3515 (306) 653-8750

HOURS: Mon.& Fri. 8:30 a.m. – 4:30 p.m. Tues., Wed., Thurs. 8:30 a.m. – 8 p.m. e-mail: advertising@producer.com Advertising director: KELLY BERG Classified sales mgr: SHAUNA BRAND

PRECIPITATION FORECAST

Much above normal

Feb. 6 - 12 (in °C)

Vancouver 8/2

PRECIP. MAP

The Western Producer reserves the right to revise, edit, classify or reject any advertisement submitted to it for publication. Classified word ads are nonrefundable.

CANADIAN HERITAGE ACKNOWLEDGEMENT Winnipeg 3.2

We acknowledge the financial support of the Government of Canada through the Canada Periodical Fund of the Department of Canadian Heritage. Return undeliverable Canadian addresses to Subscriptions, Box 2500, Saskatoon, Sask. S7K 2C4

The numbers on the above maps are average temperature and precipitation figures for the forecast week, based on historical data from 1971-2000. Maps provided by WeatherTec Services: www.weathertec.mb.ca n/a = not available; tr = trace; 1 inch = 25.4 millimetres (mm)

Assiniboia Broadview Eastend Estevan Kindersley Maple Creek Meadow Lake Melfort Nipawin North Battleford Prince Albert Regina Rockglen Saskatoon Swift Current Val Marie Yorkton Wynyard

-6.4 -9.4 -1.8 -8.7 -9.0 4.2 -9.9 -12.0 -11.1 -8.7 -10.9 -10.4 -6.7 -11.3 -5.1 -5.5 -10.8 -8.9

-28.0 -32.3 -24.2 -29.5 -26.2 -22.5 -35.9 -34.9 -34.3 -31.0 -34.2 -31.3 -26.6 -31.1 -26.8 -26.3 -30.9 -32.8

Precipitation last week since Nov. 1 mm mm %

0.0 0.0 1.9 0.0 1.9 1.1 0.4 0.2 0.4 0.0 2.4 0.0 0.2 0.0 0.2 1.7 0.0 0.6

28.9 53.8 33.5 63.4 63.5 44.4 58.7 61.7 86.6 72.0 109.5 44.3 38.3 59.8 33.4 54.8 47.6 59.3

65 85 58 108 162 85 105 117 151 146 196 90 81 127 73 126 75 106

News stories and photos to be submitted by Friday or sooner each week. The Western Producer Online Features all current classified ads and other information. Ads posted online daily. See www.producer.com or contact webmaster@producer.com Letters to the Editor/contact a columnist Mail, fax or e-mail letters to joanne.paulson@producer.com or newsroom@producer.com. Include your full name, address and phone number for verification purposes. To contact a columnist, write the letter in care of this newspaper. We’ll forward it to the columnist. Coming Events/ Stock Sales/ Mailbox Please mail details, including a phone number or call (306) 665-3544. Or fax to (306) 934-2401 or email events@ producer.com If you’d like to buy a photo or order a copy of a news story that appeared in the paper, call our librarian at (306) 665-9606. Printed with inks containing canola oil

MANITOBA Temperature last week High Low

Brooks Calgary Cold Lake Coronation Edmonton Grande Prairie High Level Lethbridge Lloydminster Medicine Hat Milk River Peace River Pincher Creek Red Deer Stavely Vegreville

Newsroom toll-free: 1-800-667-6978 Fax: (306) 934-2401 News editor: TERRY FRIES e-mail: newsroom@producer.com

Member, Canadian Farm Press Association

ALBERTA Temperature last week High Low

$4.25 plus taxes

EDITORIAL

Publications Mail Agreement No. 40069240

LAST WEEK’S WEATHER SUMMARY ENDING SUNDAY, FEB. 2 SASKATCHEWAN

Subscriptions: 1-800-667-6929 In Saskatoon: (306) 665-3522 Fax: (306) 244-9445 Subs. supervisor: GWEN THOMPSON e-mail: subscriptions@producer.com

SUBSCRIPTION RATES Within Canada: One year: $82.92 + applicable taxes Two years: $154.24 + applicable taxes Sask., Alta., Ontario & B.C. add 5% GST. Manitoba add 5% GST & 8% PST. Nova Scotia add 15% HST. United States $179.66 US/year All other countries $358.19 Cdn/year

President, Glacier Media Agricultural Information Group: BOB WILLCOX Contact: bwillcox@farmmedia.com Phone: (204) 944-5751

Classified ads: Display ads: In Saskatoon: Fax:

SUBSCRIPTIONS

Per copy retail

The Western Producer is published at Saskatoon, Sask., by Western Producer Publications, owned by Glacier Media, Inc. Printed in Canada.

Prince George 1 /-8

95

-0.5 6.3 -7.9 -3.3 0.2 1.9 -8.9 5.6 -7.1 0.8 5.5 -6.1 1.0 2.4 6.2 -3.3

-24.2 -19.2 -29.6 -27.1 -26.7 -24.5 -32.2 -27.1 -26.7 -23.1 -26.6 -24.5 -24.2 -26.1 -17.2 -27.8

Precipitation last week since Nov. 1 mm mm %

1.3 3.9 3.3 0.5 2.5 3.6 0.0 2.1 0.0 3.1 4.4 2.6 5.4 6.9 2.3 0.0

43.8 108.0 115.5 43.3 118.4 206.1 42.9 33.1 59.6 52.9 44.5 116.6 74.3 149.5 68.9 55.0

121 293 207 105 213 265 59 73 114 123 82 164 93 304 131 112

Temperature last week High Low

Brandon Dauphin Gimli Melita Morden Portage la Prairie Swan River Winnipeg

-10.5 -8.3 -11.4 -9.9 -8.0 -8.9 -10.6 -11.0

Precipitation last week since Nov. 1 mm mm %

-31.0 -32.8 -31.4 -30.6 -29.6 -29.5 -31.8 -32.3

0.6 0.0 0.6 0.2 0.0 0.0 0.2 0.2

85.5 49.2 51.5 43.5 44.8 45.2 52.4 42.6

134 77 77 67 61 61 74 60

-23.9 -20.1 -16.7 -18.9 -27.2

8.0 3.3 4.5 7.0 2.5

108.7 226.5 89.5 97.9 172.2

82 280 104 84 107

BRITISH COLUMBIA Cranbrook Fort St. John Kamloops Kelowna Prince George

-1.8 -0.1 1.7 2.9 -1.7

All data provided by Agriculture and Agri-Food Canada’s National Agroclimate Information Service: www.agr.gc.ca/drought. Data has undergone only preliminary quality checking. Maps provided by WeatherTec Services Inc.: www.weathertec.mb.ca

Move it! in print and online next day.

Now your classified word ads will go online within one business day from when you book them to run in the Producer Classifieds. Our team of Classified Sales Associates has the product knowledge, marketing strategies and access to qualified buyers that is unmatched in the industry. Place your classified ad and experience our professional service first hand.

Monday to Friday, ads will be posted online within one business day. Real Time online will be placed a maximum of 11 days prior to first print insertion.

CLASSIFIEDS.PRODUCER.COM | 1-800-667-7770


96

FEBRUARY 6, 2014 | WWW.PRODUCER.COM | THE WESTERN PRODUCER

At the end of the day, your farm is a business. And making that business profitable depends on getting the most out of your land. That’s why all of our Case IH equipment, like the new Ecolo-Tiger® 875 Disk Ripper, is agronomically designed to help you maximize your returns. The Ecolo-Tiger 875 is engineered to size tough harvest residues, fracture root-limiting compaction and leave fields level. With better rooting and seedbed environments, plant stands can utilize more nutrients, water and sunlight. All of which provide a better environment for your profit potential. The world of farming is changing. Will you be ready? Learn more at caseih.com.

BE READY.

©2014 CNH America LLC. All rights reserved. Case IH is a registered trademark of CNH America LLC. www.caseih.com

ECOLO-TIGER 875 Tiger Point

201402061  
Read more
Read more
Similar to
Popular now
Just for you