Issuu on Google+

Western Port

Features inside MOTHER’S DAY 2012

PAGES 25–29 FOOD AND ENTERTAINMENT

PAGES 30–31 WESTERN PORT SCOREBOARD

PAGES 32–35

Local news for local people

Your weekly community newspaper covering the entire Western Port region For all your advertising and editorial needs, call us on 1300

FREE

AN INDEPENDENT VOICE FOR THE COMMUNITY 1 May – 7 May 2012

MPNEWS (1300 676 397) or email: team@mpnews.com.au www.mpnews.com.au

No secret over yarn bombers IN the end it was a soft landing for the Hastings knitters intent on a “yarn bombing” to brighten up their town. Despite threats from shire officers and derision from their local councillor, the knitters associated with Hastings Community House carried out their subversive “attack” on Wednesday 18 April. And the shire? It backed down. It ended what had been an embarassing stand-off by offering its support. The shire has also salvaged some face by dubbing the “bombing” a “tremendous success”, although it admitted to some “initial difficulties”. Finn Andersson, left, was among about 30 knitters participating in the yarn bombing outside Hastings Library. So keen was Ms Andersson that she brought along her needles, stitching up the yarn that had played out in the newspapers to a bemused public. Picture: Yanni See ‘Knitting bombers defy shire’, Page 3

Dock plan won’t delay port By Mike Hast A NEW container port at Webb Dock in Port Melbourne would not delay development of the Port of Hastings, MP Neale Burgess says. Mr Burgess said both projects “must happen” and were “part of the same plan for Victoria’s future”. He was commenting after the state government last week announced a new section of Port of Melbourne would be built at Webb Dock at a cost of about $1.2 billion. Premier Ted Baillieu said the project would create more than 2500 jobs and

change the landscape of the city. The Webb Dock project was foreshadowed last August by Ports Australia CEO David Anderson (‘Hastings port shock: expert’s call to develop Webb over Western Port’, The News, 2/8/11). Mr Anderson said Webb Dock should be given a higher priority than developing the Port of Hastings. The chief of the peak body of port and marine authorities in Australia told a ports conference in Tasmania that infrastructure for accessing Hastings was “pretty diabolical” and it would take 30 years to fully develop the port.

In late January, The News reported construction of the first stage of an expanded Port of Hastings would not start for four or five years. Yehudi Blacher, head of the new Port of Hastings Development Authority, said Hastings was well suited to become Victoria’s second container port within 10 to 13 years. Mr Blacher and other members of the authority, appointed on 1 January, were meeting for the first time. Before the lunch meeting, board members visited existing facilities with Ports Minister Denis Napthine and Mr Burgess. Mr Blacher said he was “absolutely

confident” the expansion could be finished on time and on budget, but could not say how much it would cost. “There is extensive planning work to be done.” Dr Napthine said Hastings port would serve the state for 50 to 100 years. “This is a nation-building project.” On Monday, Mr Burgess said the previous Labor government had left Victoria without a plan for coping with forecast import and export growth. “Redevelopment of Webb Dock and development of the Port of Hastings are both part of the same plan for Vic-

/HOOH\V Equipment and trailer hire Mini loader, bobcat and excavator hire Cherry picker and scissor lift hire Log spitter hire

For all your equipment hire needs 2069 Frankston Flinders Rd, Hastings

5979 8885

PRESENT THIS VOUCHER

$5

SENIORS SPECIAL

COFFEE, CAKE & SOUP

WE SELL BOXES

$10.00

26 Mornington-Tyabb Road, Tyabb

MONDAY TO WEDNESDAY

24 High Street, Hastings Ph 5909 8220

toria’s future,” he said. Last Tuesday, Dr Napthine said Webb Dock expansion would be funded by the Port of Melbourne and the private sector. The container port would compete for business against the two operators at Swanson Dock. It would improve handling capacity to up to $100 billion worth of trade a year. Opposition leader Daniel Andrews said the plans would cause major traffic chaos on the West Gate Freeway. The government’s plans for Webb Dock do not include rail links.

Short/Long Term Storage 24/7 Access Your Lock & Key Night Security 2I¿FH2Q6LWH

5977 3560 www.lockandstore.com.au sales@lockandstore.com.au

We custom design, build and install aluminium frame awnings with twinwall polycarbonate sheet roo¿ng, to give you a great outdoor living experience! Available in your choice of colour, our range includes: „ bullnose „ gable „ Àat „ curved „ window and door coverings.

For an obligation free measure and quote call 0418 868 863. www.optimoawnings.com.au

MAIN MEAL

Buy one main meal and receive a second meal for $5* From the selected menu (Valid Mon to Fri)

WESTERNPORT HOTEL 16 High Street, HASTINGS Phone 5979 1201 for bookings Not valid public holidays. *Conditions apply. Valid until 14th May 2012.

CNR HIGH & SALMON STREET, HASTINGS. PHONE 5979 1201


hunting around for Mother’s Day gifts?

Spend $30 at a specialty store or $150 at Coles or Target to receive your choice of a FREE Hand or Foot Cream or an animal print Cosmetic Bag!* Present your receipt on the same day of purchase to Okasions located near Target to collect your gift. Offer available from Saturday 5th to Sunday 13th May 2012. *Limit one gift per customer, per day. While stocks last.

Special offers for Mum! Present this ad at the following stores to receive the offers shown: Curves

McDonald’s

PNT Nails

Civic Video

Limit one per person, per day. Valid until 5th to 13th May 2012.

Free eyebrows wax must be used on the same day as spa pedicure service. Not transferable for cash.

50% OFF joining fee $1 movie or games rental, including new releases. Maximum 3 new releases per presentation of this card. Not valid with any other offer.

FREE baked muffin with the purchase of a standard McCafé coffee

Min’s Chinese Massage

Spend $30 or more and get a FREE neck or head massage worth $10 Exclusive offer for mum’s only.

Direct Chemist Outlet Take a further 15% OFF selected fragrance range Available at Centro Somerville store only.

Nandos

Buy a whole chicken, seriously large chips & 1.25 litre Coke for $19.95

Experience better shopping. 49 Eramosa Road West, Somerville. PAGE 2

Western Port News 1 May 2012

FREE eyebrow wax with every spa pedicure service

Zealz Handbags & Luggage 20% to 50% OFF marked price on handbags Selected colours and styles. While stocks last.


NEWS DESK

Night raid: Nyah Andersson, far left, was a willing helper at the “yarn bombing” by a group of Hastings knitters. Pictures: Yanni

No hitch for knitting ‘bombers’ By Keith Platt THE weeks leading up to it may have been surrounded by controversy, but the “yarn bombing” at Hastings passed without a hitch. More than a few stitches were put together in time for the “bombing” which had been effectively banned by Mornington Peninsula Shire’s cultural planner, Andrea Ebsworth. The knitters from the craft group run by Hastings Community Centre were upset last month when their ward councillor Reade Smith gave $300 to a Frankston-based group. They took Cr Smith’s plan to have the Knit-A-Holics teach them knitting as an insult.

The money has been returned to the councillor’s discretionary Cerberus Ward fund, but not before a war of words broke out on Cr Smith’s Facebook page. Ms Ebsworth told The News that she was “retracting my offer for them [the Hastings knitters] to bomb anything” and Cr Smith wrote that he had “discovered that members of the local craft movement are just as pathetic as marauding vandals! With adult role models like this, no wonder the kids are running amok!”. Undeterred, the Hastings knitters clickety-clacked their own way and on Wednesday 18 April made their “bombing” without help from the shire

or Cr Smith. In what could be seen as a carefully crafted protest, the yarn bombers used their creations to coverup such public property as trees, bollards and a signpost, all close to the Hastings Library in High St. Tantalising as it might have been, the team of 30 bombers – women, children and one man – ignored the statue of champion footballer John Coleman. Some vandalism occurred overnight, with remnants of the bombers’ work still being visible the following day. Community house manager Lisa Glover said she was “happy” with the yarn bombing. “The display endured minimal vandalism, which we took as a sign that

only

Tough jobs just got easy.

only

$

$

349 000

236e

38.2cc - 14” - 4.6kg

$000 669 38.2cc - 16” - 4.7kg

435e

only

only

$

$ $

440e Copyright © 2011 Husqvarna AB (publ). All rights reserved.

38.2cc - 16” - 4.7kg

$

000 769

RRP incl. GST. * While Stocks Last

240e only

240e TRIO

$299

399 000

only

000 449

*

day that “despite initial difficulties” the yarn bombing had been “a tremendous success”. He said Ms Ebsworth had assisted “a small group of dedicated knitters from Hastings Community House”. Ms Ebsworth had liaised with library staff and the shire’s infrastructure and maintenance staff “to ensure all would be aware of the unusual activity in the town”. Mr Carson described the yarn bombing as “explosions of colour and texture that intrigued library users and passersby the next day”. More pictures are on the Facebook page of the Mornington Peninsula News Group.

the community was happy about the efforts,” Ms Glover said. “We received numerous phone calls from community members saying they loved it. “I think we have established there is an abundance of crafty and creative people in Hastings who are willing to donate time and items for community events. Look out for more in the future.” Ms Glover was grateful for the support shown by the library. A picture of the yarn bombing is posted on the Mornington Peninsula Arts Blog, which is run by the shire. Geoff Carson, the shire’s manager of libraries, arts and culture, said on Mon-

40.9cc - 15” - 4.4kg

000 869

40.9cc - 16” - 4.4kg

445e

45.7cc - 16” - 5.1kg

TAMING THE WILDTM YOUR AUTHORISED HUSQVARNA SPECIALIST DEALER

HASTINGS MOWERS

2013 FRANKSTON FLINDERS RD, HASTINGS HUSQVARNA 236 CHAINSAW 38.2cc - 14” - 4.7kg X-Torq engine - delivers more power, lower fuel consumption and reduced exhaust emissions.

PH: 5979 1382

OPEN 7 DAYS

www.husqvarna.com.au Western Port News 1 May 2012

PAGE 3


NEWS DESK

Western Port

Proudly published by Mornington Peninsula News Group Pty. Ltd

PHONE: 1300 MPNEWS (1300 676 397) Published weekly. Circulation: 15,000

Editor: Keith Platt, 0439 394 707 Journalists: Mike Hast and Jo Winterbottom, 5979 8564 Photographer: Yanni, 0419 592 594 Advertising Sales: Val Bravo, 0407 396 824 Real Estate Account Manager: Jason Richardson, 0421 190 318 Production and graphic design: Stephanie Loverso, Tonianne Delaney Publisher: Cameron McCullough REGULAR CONTRIBUTORS: David Harrison, Barry Irving, Cliff Ellen, Frances Cameron, Peter McCullough, Stuart McCullough, Gary Turner, Peter Ellis, Casey Franklin, Fran Henke, Matt Vowell. ADDRESS: Mornington Peninsula News Group PO Box 588, Hastings 3915 Email: team@mpnews.com.au Web: www.mpnews.com.au DEADLINE FOR NEXT ISSUE: 1PM ON THURSDAY 3 MAY NEXT ISSUE PUBLICATION DATE: TUESDAY 8 MAY

Local news for local people We stand as the only locally owned and operated community newspaper on the Peninsula. We are dedicated to the belief that a strong community newspaper is essential to a strong community. We exist to serve residents, community groups and businesses and ask for their support in return.

To advertise in the Western Port News call Val Bravo on 0407 396 824 Western Port

Guide to eating ‘locally’ By Keith Platt PEOPLE may choose to be carnivores, herbivores or both. Now, according to a book highlighting eating delights on the Mornington Peninsula, they can also be locavores – someone who eats locally. The Field Guide to Victorian Produce promotes itself as “the first comprehensive guide to Victoria’s regional produce and the people that grow, make and sell it�. It’s made so locavores can easily identify and choose where to eat. The guide breaks the state into regions: the Mornington Peninsula, Daylesford and the Macedon Ranges; Melbourne; Gippsland and Phillip Island; Goldfields; Murray Region; Grampians; High Country; Great Ocean Rd; and the Yarra Valley/Dandenong Ranges. The peninsula section includes an interview with Stuart Bell of Ten Minutes By Tractor, the Main Ridge winery that sources grapes from several vineyards while also running a restaurant. Mr Bell emphasises the use of locally sourced products as ingredients for menu items. He says this is a “hot topic� for diners and sees life on the land as “heading into more organic and sustainable farming techniques with a focus on growing heirloom varieties�. Mr Bell’s “must have� experiences offered by the peninsula are tasting wines at cellar doors, going to Mornington’s Wednesday market or the one at Red Hill (the first Saturday of each month) and visiting Heronswood his-

toric house and garden at Dromana. Public relations consultant Mia Cochrane said the $40 guide “aims to inspire Victorians, interstate and international visitors to look locally and to think seasonally so that they can discover the wealth of produce that Victoria has to offer�. “It also aims to increase the capability of small independent producers and regional food organisations to reach their potential, growing and diversifying the local food economy.� The Field Guide to Victorian Produce lists details of 300 Victorian growers, producers and providers, which were researched and selected by an editorial team under the direction of Ewan McEoin who has run such festivals as the Victorian State of Design Festival in 2008-09.

PADUA COLLEGE

Catholic Co-educational Secondar y College

Padua College - Tyabb Campus The Padua College Board of Management is excited to announce that plans are underway for a Year 7-10 Campus at Tyabb for students who live in the Western Port region

Tyabb Hall: 1535 Frankston-Flinders Road Tyabb, Melway Ref: 148 J10 Please join us as the Principal, Mr Christopher Houlihan, and Panel present an update on the development RIWKLVVLJQLĂ€FDQWSKDVHLQWKHKLVWRU\RI Padua College.

Ĺ?ĆŠÄžĆŒĹś^ƾŜĚĂLJDÄ‚ĆŒĹŹÄžĆšĹ?Ć?Ä‚ ŽžžƾŜĹ?ƚLJDÄ‚ĆŒĹŹÄžĆš žĂŜĂĹ?ĞĚÄ?LJÇ€Ĺ˝ĹŻĆľĹśĆšÄžÄžĆŒĆ?

To assist with seating, bookings are essential. Please book through reception on t: 5976 0100 or email:

ĹŻĹŻĆ‰ĆŒĹ˝Ä?ĞĞĚĆ?Ä¨ĆŒĹ˝ĹľĆ?Ĺ?ƚĞĨĞĞĆ?Ä‚ĆŒÄžĆŒÄžĆšĆľĆŒĹśÄžÄš ƚŽƚŚĞÄ?ŽžžƾŜĹ?ƚLJÄ?LJÇ Ä‚Ç‡ŽĨĹ?ĆŒÄ‚ĹśĆšĆ? ƚŽĆ?Ä?ŚŽŽůĆ?Í•Ä‚Ç Ä‚ĆŒÄšĆ?ƚŽĆ?ƚƾĚĞŜƚĆ?ĂŜĚ ĨƾŜĚĹ?ĹśĹ?Ä¨Ĺ˝ĆŒĹŻĹ˝Ä?Ä‚ĹŻĆ‰ĆŒĹ˝ĹŠÄžÄ?ĆšĆ?͘

enquiry@padua.catholic.edu.au 7KH3DGXD&ROOHJH7\DEE&DPSXVLVVXEMHFWWRĂ€QDO approval by the Catholic Archdiocese and Catholic (GXFDWLRQ2IĂ€FH9LFWRULDQ5HJLVWUDWLRQDQG4XDOLĂ€FDWLRQV K %YXLSVMX] :65% ERHXLI1SVRMRKXSR4IRMRWYPE7LMVI $XWKRULW\ 954$ DQGWKH0RUQLQJWRQ3HQLQVXOD6KLUH 'SYRGMP TIVQMXW  &RXQFLO SHUPLWV 

&ƾŜĚĹ?ĹśĹ?ƚŽƚĂů͗ϭϾϴϯͲώϏϭώÍ´Ĺ˝Ç€ÄžĆŒΨϹϏϏ͕ϏϏϏ

Located at

6SWIFYH Rosebud Year 7-10 Campus =IEV'EQTYW Inglewood Cres,6SWIFYH Rosebud -RKPI[SSH'VIW

X t: 5982 9500 IRUYMV]$TEHYEGEXLSPMGIHYEY

Western Port News 1 May 2012

Ĺ?ĆŠÄžĆŒĹś ^ƾŜĚĂLJDÄ‚ĆŒĹŹÄžĆš Íť>Ĺ˝Ä?Ä‚ĹŻ&Ä‚ĆŒĹľWĆŒĹ˝ÄšĆľÄ?Ğ͝&ĆŒĆľĹ?ĆšΘsÄžĹ?ĞƚĂÄ?ĹŻÄžĆ? ÍťWůĂŜƚĆ?Íť&ĹŻĹ˝Ç ÄžĆŒĆ?ÍťĆŒĆšΘĆŒÄ‚ĹŒÍť&ĆľĆŒĹśĹ?ĆšĆľĆŒÄž ÍťEÄžÇ ΘhĆ?ĞĚdŽŽůĆ?ÍťĆŒĹ?Ä?ͲĂͲĆŒÄ‚Ä? Íť&ŽŽĚΘĆŒĹ?ĹśĹŹÍ˜Í˜Í˜ĂŜĚůŽƚĆ?ĹľĹ˝ĆŒÄžÍ˜ Z>Ĺ˝ĆľĹśĆšĆŒÇ‡DÄ‚ĆŒĹŹÄžĆšÍ˜

Tuesday 8 May, 2012 at 7.30 p.m

PAGE 4

z ^ Í› Z ,

Ç€ÄžĆŒÇ‡^ƾŜĚĂLJϴĂžͲϭƉž

You are invited to attend an information evening at the Tyabb Hall on

JEGIFSSOGSQ4EHYE'SPPIKI

&

d'  Z ' /E

d DK  Z &K / & d^

The guide will be reprinted and updated every year, and there are plans to launch a similar publication in each state. Mr McEoin published the Melbourne Design Guide and came up with the idea for a guide to eating out last year after running the OpenIDEO Challenge on the future of the Australian food sector for the 2011 Ideas Festival. “The challenge was meant to end with the best three or four projects being seed funded by the Queensland government. With the floods at that time wrecking havoc all over Queensland, this was just not possible from a budget point of view,� Mr McEoin said. “We were left in a position where we had brought together industry, talked the talk and now someone had to walk the walk. “I believe that content, information and strong visual communications can create change and movement in the marketplace. I was also surprised – amazed even – that there was so little accessible information about regional producers. “Most of them were terrible websites that make everyone pay to be listed or piecemeal gourmet tours on tourism websites. “As no one pays to be listed [in the guide] it is egalitarian and an ethical and socially conscious business, remaining independent and maintaining a reputation for supporting the people who produce our food.�

1SVRMRKXSR Mornington =IEV'EQTYW Year 7-10 Campus =IEV'EQTYW Year 11-12 Campus Oakbank Rd,1SVRMRKXSR Mornington 3EOFERO6H X t: 5976 0100

[[[TEHYEGEXLSPMGIHYEY

Ĺ?ĆŠÄžĆŒĹśZÄ‚Ĺ?ĹŻÇ Ä‚Ç‡Ä?Ä‚ĆŒĆ‰Ä‚ĆŒĹŹ &ĆŒÄ‚ĹśĹŹĆ?ƚŽŜͲ&ĹŻĹ?ĹśÄšÄžĆŒĆ?ZŽĂĚ͕Ĺ?ĆŠÄžĆŒĹś Melways Ref: 164 F7

EYh/Z/^͗ϏϰϏϾϰϭϳϰϲϯ


Trans-Tasman tastes seek cool acclaim

Workshop gig: The Perch Creek Family Jugband will be playing in Shoreham later this month.

Music on which to build a community ENTERTAINMENT from a jug band and a music workshop are the first events being held by Shoreham Community Association with a grant from Mornington Peninsula Shire. The $2000 grant was made to help pay for “community building events”

in the coming year. Star of the show, The Perch Creek Family Jugband, plays original and traditional compositions, including bluegrass, old-time jazz and country blues. The band played at this year’s Port Fairy Folk Festival and leaves on a

tour of Britain after the Shoreham gig. The band also will be running a music workshop, with participants playing later that night. The Shoreham Community Gig is on Saturday 26 May with the Perch Creek Family Jugband performing in

the Shoreham CFA building, starting at 6.30pm. Tickets, $15 adults, $10 concession, $40 a family can be bought at the Shoreham post office or call Linda McLeish on 5989 8194. Visit www. shoreham.vic.au for more information.

WINEMAKERS from the Mornington Peninsula, Tasmania and New Zealand each make up 20 per cent of the entries made so far in this year’s International Cool Climate Wine Show. Wines from the Yarra Valley, Geelong, Gippsland, the Port Phillip region and small wine growing regions in South Australia and New South Wales make up the rest of the competitors at the 13th Red Hill Show, according to project manager Steve Robin. “With the past few vintages being excellent in terms of quality, competition for medals will be hot,” he said. Closing date for entries in the wine show has been extended to 2 May due to Easter and Anzac Day delaying the process. Judging will be held on 29 and 30 May at Mornington Racing Club. Mr Robin said cafe and restaurants were making a “delicious offer” for meals between 17 May and 1 June as part of the event: a two-course lunch featuring bountiful local produce with a glass of cool climate wine. For details www.visitmornington peninsula.org The public will be able to taste entries 6-8pm at the racing club on Wednesday 30 May for $20, which includes a tasting glass and wine. The awards presentation dinner is on Friday 1 June at the racing club. The $125 cost includes four courses, canapés and wine. Email sr@asnevents.net.au or visit www.coolclimate wineshow.org.au

SUNNY DAYS & COOL NIGHTS … AUTUMN IS HERE AUTUMN PLANT SPECIALS Convolvulus

Diosma

A MOUNTAIN OF FIREWOOD!

+ FREE pair of gloves

Dietes Westringia Smokie

Coprosma

BRIQUETTES 20kg Bag $15.90 4 Bags $50

PLUS MANY MORE IN STOCK 6” Pots $4.95ea

Come and enjoy a coffee and cake in our beautiful coffee shop

8” Pots $9.95ea Nandina

SPLIT REDGUM $280 per tonne $155 per ½ tonne $105 per 250kg $75 per 125kg $8.50 per 10kg bag Prices exclude delivery

Westringia

We also stock a huge range of ‡3DYHUV‡0XOFK‡&HPHQW ‡1XUVHU\SODQWV‡3RQGV‡6DQG ‡*LIWVKRS‡0LQLPL[‡6OHHSHUV ‡+DUGZDUHV‡3RWWLQJPL[DQGPRUH

YES, WE CAN DELIVER!

OPEN 6 DAYS A WEEK

Burdetts HOUSE & GARDEN SUPPLIES

COFFEE SHOP

W STOCK UP NOR FOR WINTE

615 McClelland Drive, Langwarrin Ph 9789 8266 Fax 9789 8810

www.burdetts.com.au

OPEN 7 DAYS A WEEK Western Port News 1 May 2012

PAGE 5


Neighbourhood Houses The Heart of our Community NEIGHBOURHOOD HOUSE WEEK~7th -11th MAY

COMMUNITY HOUSES r Talk to u o o e ur e s ON V S olunte y a l ers p s i d WESTERNPORT Displa IN THE Librayrsy in Kmart FOYER HASTINGS Find out what’s happening at your Community House SOMERVILLE COMMUNITY HOUSE INC. I ncorp ora tion

Reg No A00 40276V ABN 47 673 738 558

14 Edward Street, Somerville 3912 PO Box 579, Somerville 3912 PH: 59 77 8330 Email: somervi@bigpond.net. au Web: www.somervillecommunityhouse.com.au

Wallaroo Community Centre 6 Wallaroo Place Hastings Vic Ph: 59 707 000

peninsula@goodshepvic.org.au www.goodshepvic.org.au

PAGE 6

Western Port News 1 May 2012

Crib Point Community House inc 7 Park Road, Crib Point. Vic 3919 Reg No. A0005121C. ABN 13 567 174 223 Phone: 03 59839888 www.cpch.org.au

185 High Street Hastings Vic hastingsch@bigpond.com www.hastingsch.com


NEWS DESK

Baking tradition returns to Flinders TRADITIONAL breadmaking has been brought back to Flinders. David Allan and Margaret Carey are baking bread in the oven made in the 1930s for the Draper family. It took six months to restore the oven, which is now being used to bake “traditional sourdough loaves using only organic flour, water and Victorian pink lake salt”, Ms Carey said. “True sourdough bread is naturally leavened, which means that a local wild culture of organisms is used to slowly develop and rise the doughs over an eight-hour period. “The bread develops greater flavour and nutritional benefits such as the breaking down of gluten and natural sugars, great for gluten intolerant and low GI diets.” Ms Carey and Mr Allan hold degrees in winemaking and see a synergy between the processes of making wine and bread. “As there is a large crossover with the microbiology of the two processes, much of our wine knowledge is of great use managing the many variables of sourdough,” Ms Carey said. “We made the big decision to leave the winery [at Heathcote] and then volunteered at Redbeard Bakery under the guidance of John and Alan Reid and their great team of bakers. We learnt a lot in three months and fell in love with using a Scotch oven; there was no turning back.” The couple spent a year searching Victoria for a Scotch oven, finally finding one at Flinders. “We found many ovens, but most

All fired up: David Allan and Margaret Carey at their Flinders sourdough bakery. Picture: Yanni

were in poor condition. David knew of the oven in Flinders due to memories of visiting the bakery as a child; he also drove through Flinders daily while working at nearby Stonier Wines. “We visited the Flinders Bakery out

of interest and what we found was a hidden treasure, a great oven and matching vintage dough mixer in fabulous condition.” The couple spent “many long days and nights crouched inside the oven

fixing the floor and rebuilding the firebox”. Missing fire bars were replaced with new ones recast at an historic foundry in Castlemaine, which still had the original moulds. A twin-arm mixer from the 1940s is used to prepare dough being baked in the restored oven. The mixer has a slow and gentle action that replicates hand kneading. “Traditional hand-shaping and cutting techniques are used, reducing the

need to power excess machinery,” Ms Carey said. “Any energy used on site is replaced to the grid via renewable hydro-electricity, helping to achieve a sustainable community.” Flinders Sourdough, 50 Cook St, Flinders, opens 9am-4pm Friday to Sunday, and sells its bread at several markets, including Mornington Craft Market, Boneo, Mt Eliza, Tootgarook and Red Hill farmers markets.

BUY DIRECT AND SAVE UP TO

25% OFF

ŸȖNjĶNjs_ɴĶŸɠƼNjÞOsǣ ŸŘNJŸĶĶsNjDĶÞŘ_ǣ DĶŸOĨŸȖǼNJŸĶĶsNjDĶÞŘ_ǣÞŘ ˡ˦®ǣÌÞŸŘNŸĶŸȖNjǣ ǢȖŘǣONjssŘNJŸĶĶsNjDĶÞŘ_ǣ ǼŸƼNjŸǼsOǼɴŸȖNj¯ȖNjŘÞǼȖNjs Ř_ʪŸŸNjOŸɚsNjÞضǣ¯NjŸŎ ÌNjŎ¯ȖĶȕəNjɴǣ

ĶĶNJŸĶĶsNj DĶÞŘ_ǣNjs ĶŸOĶĶɴŎ_s ÞŘŸȖNjŸɠŘ ¯OǼŸNjɴ

Painted DǣǣɠŸŸ_ ƻĶŘǼǼÞŸŘ Shutters

NĶĶ¯ŸNjƼNjÞOsʵ DsǣǼƻNjÞOsÝŘ ōsĶEŸȖNjŘs

50 Hartnett Drive, Seaford Ph 1800ALLBLINDS Fax 97769170 ®NjssōsǣȖNjs˓džȖŸǼs˒ɠɠɠʳĠĶsÞ¶ÌEĶÞŘ_ǣʳOŸŎʳȖ

Western Port News 1 May 2012

PAGE 7


NEWS DESK

Liz Dart and the spirit of giving ANY conversation between Liz Dart and I was going to be a never-ending story. I figured we were around the same age with a year between her mum and my mum’s birthdates; our journeys were bound to be similar. Thus it turned out, in areas I didn’t expect. Liz Dart is a legend, as was her mum, Dame Phyllis Frost. My first question, when we eventually got around to business (delightfully interrupted by dogs) at her Pt Leo home was how had her mother’s incredible service to society, particularly in women’s prisons, shaped her life? “There must be a family gene that says there is nothing daughters cannot do. There were no high expectations, but we were never told we couldn’t do anything,” Liz said. For generations the women in my family have been strong, independent people, regarded as being ahead of their time and who always were involved with their communities. My aunts and my mother were high achievers who, especially in their younger days, were actually quite naughty although then it was called “high spirited”. How did her mother become involved with women’s prisons? Liz backtracked to say that her mother had originally trained as a physiotherapist and during the polio epidemic worked at Yooralla with children with polio. “Although Mum was well married by the time she had me, I was known as ‘Miss Turner’s baby’. “All physios were called ‘Miss’ someone,” I interrupted, currently editing a book of reminiscences from Victorian polio survivors. “Anyhow, some years later mum visited a friend, who wasn’t well off, but had a woman working for her. The friend explained that women prisoners as part of their rehabilitation could go out to work and be paid next to nothing,” Liz said. “Mum thought that was outrageous. She went back to university, studied criminology and became involved in the prison system. “She soon learned that women did not get a fair go in prison; there was much to be done.” Phyllis Frost took her three girls – Liz, Christine and Pauline – on prison

visits. (Turned out I knew Pauline from a previous life at Healesville.) “This was pre-drug culture; there are different people in prison today. The women then did a lot of knitting. We always had what we called ‘prison jumpers’,” Liz said. Meanwhile her dentist father Glenn, also heavily involved with his local community (through local government) was president of the Croydon Horticultural and Agricultural Society, had a great vegetable and flower garden, setting the scene for another side of Liz’s life – running the iconic Red Hill Show. “Mum and Dad complemented each other enormously,” she said. Liz confessed she wears her mother’s engagement ring whenever she faces a stressful situation. “She’s with me that way. I don’t

like unfairness or injustice [in government or anywhere] and still go into bat against it,” she said. The formidable Dame Phyllis Frost had ways for dealing with bureaucracy and almost always achieved what needed to be done. The Frost girls did the hard yards with their mother. Liz remembers in her early teens helping her scrub out a house where violence had occurred. During bushfires they could be found “pitching in” at the State Relief Centre, sorting clothing or distributing food. For many years sister Pauline was secretary of the Victorian Women’s Prison Council. The spirit of giving was innate. Like me, in the early 1960s Liz attended Royal Melbourne Institute of Technology – and played up. “We would sit in darkened rooms

wearing duffle coats reciting Kerouac,” she said with a laugh. While I went folk singing, with friends Liz opened a discotheque. It was a good era, where anything seemed possible. “It was before the drug culture spread; off-duty police worked as bouncers so we had a good relationship with police. But then it lost its innocence,” she said. Liz went into advertising and public relations as a junior account executive, then to Coates Patons as photography supervisor for knitting pattern books. “This meant going out on location in summer, shooting winter knitwear and boiling. But they brought in people like Mary Quant and Norma Tullo to update the look. People still wanted to knit the tried and true patterns but also allowed new designers in.” From Patons, she worked at the Royal Children’s Hospital in the pathology department for years as secretary to the noted histopathologist Dr Peter Campbell. After marriage in 1970, the family settled full-time at Pt Leo, which threw Liz Dart full pelt into community activity – as well as running a craft shop called Country Matters. With two small boys, preschool requirements were important. The Balnarring preschool was low on numbers so Liz discovered funding to transport children from the new development of Westpark to help both communities. Before long Westpark was populous enough to have its own preschool. Liz helped mothers get that established, also working with the Hastings Social Welfare & Advisory Association helping set up the Citizens’ Advice Bureau and the Community Youth Support Scheme in Hastings. On the council of St Paul’s School “Mininbah” and “Woodleigh” for some years, she accepted the job of school development officer in 1985. She was also involved with the South Eastern Peninsula Residents’ Association and presented a weekly program on conservation issues on Radio 3RPP, where under the alias of “Ma Supial” she gave environmentally friendly household hints! Change beckoned and in 1997 Liz went to work for Flinders MP Peter Reith. “I loved working there. It wasn’t about politics. You can achieve so much for people through the right connections,” Liz said. In 2001, however, after a trip overseas with her two boys, she became seriously ill and wasn’t expected to live. Ambulance officers taking her to

Did you know...

you can now view i our papers online at:

www.mpnews.com.au

PAGE 8

Western Port News 1 May 2012

Frankston had to detour to Beleura Hospital for help, afraid Liz wouldn’t make it. Family members were called in from overseas to say goodbye. “The diagnosis was uncertain, but I had the good luck to strike a doctor who immediately understood it wasn’t a heart attack and changed treatment. It was all meant to be,” she said. Liz spent seven weeks in intensive care and many months in rehab. “But I defied predictions. I strongly believe in forces out there beyond our knowing.” Her death was mistakenly announced at the school where she worked. “I can genuinely say that rumours of my death were greatly exaggerated,” she said, quoting Mark Twain. However, Liz lives with primary lymphedema in both legs and has struggled to find a suitable management program for herself and, of course being Liz, for others. Lymphedema is a failure of the lymphatic system, causing swelling. Primary means since birth, secondary can be acquired following cancer when lymph nodes have been removed. She discovered the Lymphoedema Association of Victoria and naturally became secretary. “No one has come up with any answers,” she said grimly. I say my piece about the similar situation for polio survivors. Her involvement at the Red Hill Show began after being asked to take over as craft steward in the early 1980s. She moved up the ranks to become president and secretary for more than 20 years. “I’ve resigned as secretary, but keep on with the International Cool Climate Wine Show, which is my baby. And the show jumping because I love it.” Joy comes through her sons and their partners, grandchildren, the garden and two ebullient canine companions. Um, what about the “no” word? Is that in her vocabulary? “I always thought I’d know when it was time. I am still being asked to become involved with things but I find myself getting cranky so maybe it’s time to examine whether I’m doing a good job any more,” she said quietly. “How long can you swim against the tide?” Liz points to her favourite painting by Red Hill artist Michael Leeworthy. It shows 11 fish swimming in one direction. One of a different colour is swimming in the opposite direction.


MT ELIZA’S $400,000 skate park is attracting skaters from around Melbourne, thanks to a YouTube video posted by Mornington Peninsula Shire. Skater Ricky Davidson, left, made the hike to Mt Eliza from his home in Beaconsfield after seeing the clip. Mt Eliza Ward councillor Leigh Eustace (pictured) hopped on a board for the first time in 35 years. The first major event will be a meeting of the Skate and BMX South Eastern League on Saturday 26 May. Picture: Keith Platt

Penguin fine follows feature on Facebook A CRIB Point man has been fined $800 for catching and keeping a penguin. The 21-year-old kept the protected little penguin (Eudyptula minor) at his father’s house for several days. The man pleaded guilty in the Frankston Magistrates’ Court to one charge of possessing wildlife that was taken unlawfully and one charge of disposing of protected wildlife. Both charges are under the Wildlife Act 1975. Officers from the Department of Sustainability and Environment believe the penguin was taken from Phillip Island, although the convicted man stated he found it crossing the South Gippsland Highway at Tooradin at around 3am when he was driving back from the island with friends.

He posted messages on Facebook about having the penguin. The incident occurred on 28 November 2011 and as well as being fined $800, the man was ordered to pay DSE’s costs of $160. “This fine sends a strong message to the community that it is not acceptable to interfere with protected wildlife such as penguins,� DSE senior wildlife officer Glenn Sharp said. “Taking a little penguin out of its natural habitat and trying to keep it in a suburban house puts the health of the bird at serious risk.� The largest colony of little penguins in Victoria is found at Phillip Island, 40 kilometres from Tooradin.



PALM LEAF BAR WITH STOOLS

$799

WAS

COOKING BOOK WITH SPOON WAS NOW

NOW

$599

$12.95

$9.95 BAMBOO BOATS

WATERHYCINTH DAY BED WITH CUSHION

SMALL

WAS

$1199

LARGE

$15 $20

NOW

$750

BAMBOO BENCH WAS $199 NOW

$150 TERRACOTTA STATUES

30% OFF

MUM PHOTO FRAME

$9.95

WORLDS BEST MUM PLAQUE

1800 765 529

WAS $10.95 NOW

$8.95

Unit 2, 36 Hartnett Dr, Seaford www.rollaway.com.au

ROLLER SHUTTERS UP TO

40% OFF

AWNINGS UP TO

30% OFF

RING HOLDER

MUM PHOTO HOLDERS

WAS $14.95 NOW

$9.95

WAS $6.95 NOW

$4.95

LOVE YOU MUM MUG

STATUES

WAS $9.95

30% OFF

NOW

$8.95

PALM LEAF 2X2M DAY BED

COMPACT MIRROR

$1999

WAS $5.95

WAS

NOW

$3.95

NOW

$1599 BOUTIQUE LADIES PURSE

PLANTATION SHUTTERS UP TO

30% OFF

WAS $12.95 NOW

$9.95 0251,1*7217<$%%52$'0251,1*721

5976 4641

1(;7725('52267(5 0&'21$/'6 Open Tuesday To Saturday 9am-5pm, Sunday 10am-4pm, Closed Monday Western Port News 1 May 2012

PAGE 9


NEWS DESK

Dolphin, seals snagged by fishing line SEALS and dolphins are being hooked on fishing gear carelessly dumped in Port Phillip. The latest victim, a two-year-old dolphin, prompted the Department of Sustainability and Environment to issue a warning to anglers, although tour boat operators and divers have for months being calling on authorities to help entangled seals. One of the seals was sighted at Rye pier just before Mornington Peninsula Shire proceeded with its Australia Day fireworks display. Crew on board the Sorrento-based Polperro tour boat spotted the dolphin on Friday 27 April. Efforts are now being made to locate and free the dolphin by the DSE, Zoos Victoria, dolphin tour operators, the Gold Coast’s Sea World and the Hastings-based Dolphin Research Institute. DSE senior wildlife officer Glenn Sharp said the agencies were doing their best to free the dolphin that appeared to be tangled in fishing line, rope and large shark fishing sinkers. “A rescue may be unachievable because we are dealing with a fast-moving, mid-sized, agile, sea-dwelling dolphin that can easily keep its distance from us,” Mr Sharp said. “We are privileged to share the water with marine mammals such as dolphins and an incident like this is a reminder of the detrimental impact humans can have on our wildlife.” Mr Sharp said DSE also had reports and confirmed sightings of six entangled seals in Port Phillip since December. “The amount of marine mammals

affected by discarded fishing line is unavoidable because seals take fish off the hooks,” he said. “However, discarding of fishing line appropriately will make a difference and help to minimise the detrimental impact on marine wildlife.” Mr Sharp said photographs and observations “suggest the fishing line and

rope entangling the dolphin may also be attached to a weight with hooks and the dolphin may have a hook in its body”. “We know Victorians love seeing marine mammals and we seek their cooperation to undertake recreational activities safely and clean up so that we can all enjoy these amazing animals

without jeopardising their lives.” To report an emergency – including stranding, entanglement, injury or death – involving a whale or a dolphin, call 1300 136 017. Information to help reduce the rates of marine entanglement by keeping waste out of the marine environment is at www.zoo.org.au/sealtheloop

Tied up: This young male seal with rope around his neck was first spotted at Chinamans Hat, off Rye, in January. Jessica Beckham, who photographed the seal, says the line had eaten into his flesh. “I’m out on the water [with the Polperro tour boat] most days and having to be confronted with this has been quite distressing, not only for me, but for guests on board. They were disgusted.”

RACV HasƟngs Everything you need to meet your insurance, motoring and touring needs is now available from the RACV Shop located within Travelscene Westernport at 11 High Street, HasƟngs.

Home Insurance

Q

Motor Insurance

Q

New Quotes and Renewal Payments Taken Don’t call Jason. Call Andrew, Lisa and Di!

PAGE 10

Western Port News 1 May 2012

Q

Don’t wait on hold. Call us!

Q

InternaƟonal Driving Permits

Q

Maps and Travel Accessories

As your closest RACV Shop we will be here to assist you by providing highly personalised service. Please come in and see us, or if you would prefer contact us on 5979 8152.


Lost years: Two views of HMAS Otama: left, anchored off the Crib Point jetty last week and, right, soon after being towed from Western Australia after being purchased by the Western Port Oberon Association in 2002. Pictures: Keith Platt (left) and Andrew Mackinnon of aquamanships.com

Decade up for rusty submarine By Mike Hast PORTS Minister Denis Napthine has handballed his professed interest in the submarine HMAS Otama to the Port of Hastings Development Authority. Dr Napthine last August promised to help the Western Port Oberon Association bring its 2000-tonne Oberon class submarine ashore at Hastings. The blow comes on the 10th anniversary of the arrival of Otama, which lies rusting at anchor off the Crib Point jetty. Last year, Dr Napthine told WPOA officials Max Bryant, Alf Tallon and

Howard Bull he would go in to bat for them. â&#x20AC;&#x153;Iâ&#x20AC;&#x2122;ll work out if there are substantial impediments [to bringing the sub ashore at Hastings] and if we canâ&#x20AC;&#x2122;t do it here, weâ&#x20AC;&#x2122;ll look at Stony Point or Crib Point,â&#x20AC;? Dr Napthine said during a meeting in High St, Hastings, attended by The News. â&#x20AC;&#x153;If the problems arenâ&#x20AC;&#x2122;t genuine, weâ&#x20AC;&#x2122;ll get it fixed; letâ&#x20AC;&#x2122;s find a site,â&#x20AC;? he said. Hastings MP Neale Burgess told Dr Napthine the Department of Sustainability and Environment had knocked back bringing ashore the 90-metre

long Otama between Hastings Yacht Club and Western Port Marina, claiming there was insufficient room for car parking. Mr Bryant told the minister DSE had initially supported the plan, but had changed its mind. Dr Napthine said he supported WPOAâ&#x20AC;&#x2122;s plan for a naval memorial park with Otama and an adjacent interpretative centre as the hub. Now Dr Napthine has sent a letter to the Oberon association stating it was â&#x20AC;&#x153;appropriate that the [Port of Hastings Development] authority considers your request for the use of the landâ&#x20AC;?.

On the weekend, Mr Bryant told The News the unwanted anniversary of the submarine had cost the association and the Western Port community $49 million in lost revenue. â&#x20AC;&#x153;A study done for Mornington Peninsula Shire by economic consultants MacroPlan Australia said the submarine and its interpretative centre would have generated $4.9 million a year,â&#x20AC;? Mr Bryant said. After considering sites in Hastings near the yacht club, at Crib Point and Stony Point, the association has proposed bringing Otama next to the outside wall of the marina.

Mr Bryant said the outer hull of the sub was rusting but it was just cosmetic. â&#x20AC;&#x153;The interior is as good as the day it arrived from Western Australia in May 2002.â&#x20AC;? The association was strong and had gained new members after distributing pamphlets at the recent Tyabb Air Show, he said. â&#x20AC;&#x153;We had members from Italy and Germany come to our centre in Crib Point recently. There is strong interest in Otama from around the world.â&#x20AC;? He said WPOA had more than 700 members.

HURRY NOW. RELAX LATER. BOOK NOW AND RECEIVE UP TO $300

CASH BACK

^

CARNIVAL SPIRITâ&#x201E;˘ SAILING FROM SYDNEY & MELBOURNE FROM OCTOBER 2012 13 DAYS NEW ZEALAND EX MELB

COMPLIMENTS OF THE CAPTAIN â&#x20AC;&#x201C; WHATâ&#x20AC;&#x2122;S INCLUDED: â&#x153;&#x201C; 2QERDUGPDLQPHDOVDQGVQDFNV

Melbourne, Fiordland Pk, Pt. Chalmers, Christchurch, Wellington, Napier, Tauranga, Auckland, Melbourne 2013 DEPARTURES

â&#x153;&#x201C; EDUV ORXQJHVZLWKOLYHHQWHUWDLQPHQW â&#x153;&#x201C; 6SDFLRXV FRQWHPSRUDU\DFFRPPRGDWLRQ

16 FEB, 1 MAR

â&#x153;&#x201C; $ZDUGZLQQLQJ\RXWKSURJUDPVIRUNLGVDJHG\HDUV

Interior

Ocean View

Balcony

Onboard Credit Per Cabin

Quad From

$1344

$1489

$1704

$150pp

Twin From

$1799

$2169

$2599

$150pp PRICES ARE PER PERSON

â&#x153;&#x201C; &KLOGIUHH6HUHQLW\70DUHD â&#x153;&#x201C; Carnival WaterWorksÂ&#x152;²VSODVKSDUN7ZLVWHU:DWHUVOLGH

DQG*UHHQ7KXQGHU

PLUS MUCH MORE!

Travelscene Westernport 11 High Street Hastings VIC 3915 03 5979 1589

)DUHVDUHFUXLVHRQO\SSLQ$8'EDVHGRQWZLQRUTXDGVKDUHDVVSHFLĂ&#x20AC;HGLQOHDGFDWHJRULHVLQFOXVLYHRIDOOWD[HVDQGFKDUJHV ZKLFKDUHVXEMHFWWRFKDQJH )DUHVDUHVXEMHFWWRFKDQJHDWDQ\WLPHZLWKRXWQRWLFH6XEMHFWWROLPLWHGDYDLODELOLW\&RQGLWLRQVDSSO\$LUIDUHVKRWHOVDQGWUDQVIHUVDGGLWLRQDO XQOHVVRWKHUZLVHVWDWHG9DOLGIRUQHZERRNLQJVRQO\QRWFRPELQDEOHZLWKDQ\RWKHURIIHU$OLPLWHGQXPEHURIFDELQVKDYHEHHQVHWDVLGHDWWKHVHVSHFLDOIDUHVRQFHVROGIDUHVPD\UHYHUWWRDKLJKHUIDUHRUWKHIXOOIDUH2QERDUGFUHGLWDSSOLHVWRXSWRSDVVHQJHUVDJHG\HDUVDQGRYHULQORZHU EHUWKVRQO\2QERDUGFUHGLWLVGHWHUPLQHGE\WKHERQXVSDFNDJHVHOHFWHGLVQRQUHIXQGDEOHDQGQRQUHGHHPDEOHIRUFDVK6HOHFWVDLOLQJVRIIHUVPD\EHXVHGLQFRQMXQFWLRQZLWKD&UXLVH6DOHRIIHUAFDVKEDFNLVEDVHGRQVDLOLQJVRIGD\VRUPRUHDQGLVDZDUGHGDVDQRQERDUGFUHGLWRI SS PD[SHUFDELQ &DVKEDFNPD\DSSO\WRRWKHUFUXLVHV DPRXQWZLOOYDU\E\LWLQHUDU\OHQJWK 8QXVHGRQERDUGFUHGLWPD\EHUHGHHPHGDWWKHHQGRIWKHFUXLVH&UHGLWPD\RQO\EHXVHGIRURQERDUGJRRGVDQGVHUYLFHV7REHUHDGLQFRQMXQFWLRQZLWKWKH&DUQLYDO&UXLVH/LQHV7HUPVDQG &RQGLWLRQVDYDLODEOHDWZZZFDUQLYDOFRPDXWHUPVZKLFKSDVVHQJHUVZLOOEHERXQGE\Â&#x2039;&DUQLYDO&UXLVH/LQHV$OOULJKWVUHVHUYHG6KLSŇ&#x2039;V5HJLVWU\3DQDPD&DUQLYDOSOFWUDGLQJDV&DUQLYDO&UXLVH/LQHV$%17$3URPRWLRQFRGH2%:

Western Port News 1 May 2012

PAGE 11


NEWS DESK

Mother’s Day Lunch BOOK NOW 9789 2888

9789 8388

9789 8833

9789 4000

9785 9662

FREE PARKING OPEN 7 DAYS 197 Karingal Drive Karingal Ph: 9789 1192

PAGE 12

Western Port News 1 May 2012

Family effort: Three generations of the Christie family are involved in the building of barbecues used in public reserves and parks throughout Australia. Pictured at the Dromana headquarters of D A Christie Pty Ltd are, from left, Alex Christie, with father David, mother Adele and grandmother Merle.

Dromana’s barbies are for the masses

By Keith Platt DAVID Christie fired up a couple of barbecues before Christmas, and they were still running hot in January. But unlike most blokes who light up and forget, he didn’t run out of gas or cop a roasting from his wife or kids. Taking barbecues to the limits of their use is Christie’s business. In fact, D A Christie Pty Ltd is a family business started 47 years ago by his father (also David, known as Sandy) that supplies most of the free barbecues found on foreshores and public land throughout Australia. Many of the barbecues made in the family’s Dromana factory are located in isolated areas, so dependability, durability and hygiene are essential. The two barbecues fired up before Christmas were advances on the current models of gas and electric units. The barbecues originally developed and sold by Christies were coin-operated, but damage by vandals trying to retrieve “gold” coins persuaded public authorities that it was far cheaper to make them available without charge. The genesis of Christie’s entry into the barbecue market came when David Christie senior, an electrical engineer working from his Dromana home, was asked to design a coin operation for a barbecue on the foreshore. Impetus for sealed barbecues came from total fire ban days and Christies “really hit the market” in 1974 after approaching municipal councils and national parks managers. The first of their barbecues were installed at Mentone and Parkdale. The business now has three generations of Christies on its staff, with David Christie as managing director, his wife Adele sales manager and son Alex customer relations coordinator. Merle Christie, David’s mother, is company secretary and on the board of directors. The brick and stone barbecues have now made way for ones made of extruded aluminium with compressed fibre cement panels, topped with stainless-steel benches and cooking areas. The company has “dabbled” in domestic barbecues but returned to its niche “because we can’t compete with Asia and China”, David Christie says. The company has sold more than 40,000 barbecues, with about 80 per cent going to the Australian market. “It’s not a very big market, with about 2500 being sold here a year,” Christie says. “And they have a 10-year service life.” He says there are a few cheaper brands marketed in Australia but they offer little follow-up support. Christies has seen steady growth, and now has a staff of 23.

There are five reps on the road, knocking on doors, bidding for tenders and “making relationships”. Christie says his company has “set the de facto standard” for outdoor, free barbecues, making them too high for youngsters to touch the hot plate and a six second safety delay on the operating button. Pre-heating at a temperature recommended by microbiologists ensures hygiene on hot plates that attract birds and animals when no one is around. “Pre-heating at over 100 degrees centigrade for more than four minutes kills most organisms that could hurt people. The best way to clean it is to pre-heat and then pour on a glass of cold water.” “Others tend to follow our lead, so part of the challenge is to keep ahead with our development.” This extends to making packaging easily transportable and barbecues that can be quickly assembled. Christie’s barbecues are exported to New Zealand, Singapore, United Arab Emirates and most of Europe. The global financial crisis put a stop to most exports in 2008, but by the beginning of this year inquiries were “picking up”. “Public money dried up overseas, Australia doesn’t realise how lucky we were,” Christie says. Two barbecues were being shipped to Zurich in Switzerland where authorities were trying to stop the use of small, portable barbecues heated by disposable charcoal. One barbecue installed in a park in Hamburg, Germany, had saved 600 kilograms of ash being dumped as well as improving air quality. “Overseas visitors are amazed when they see that our councils provide free barbecues. “We see ourselves as a market leader in these types of outdoor barbecues while for other manufacturers these are just a sideline.” Christie barbecues utilise some parts made overseas, mainly because they are not available in Australia, but the metal fabrication is done in Dandenong. And the need to test a barbecue’s stamina and reliability? “They get one year’s use in a month. The ones we’re doing now have been going three months and they’re still chugging along. “It’s accelerated testing. The real world testing is done on the Dromana foreshore. Just about everything has been tested – there’s nothing like being in the public domain.” And just to show that Dromana is the spiritual home of the Christie barbecues, one coin-operated unit remains. Still heating on command, still doing it job. Reprinted courtesy BusinessTimes www.businesstimes.net.au


Western Port

realestate 1 May 2012

Incredible rural paradise > page 3


real estate directory Western Port

The people to call for your real estate needs... Tallon

Alf Tallon

Sid Ferguson

Mobile:0417 711 958

Mobile:0418 321 963

Tallon First National 35 High Street, HASTINGS 5979 3000

EMAIL: info@tallon.com.au

Satchwells 1/97 High Street, HASTINGS 5979 1888

EMAIL: realestate@satchwells.com.au

Ty Luff

Rob Pryzler

Mobile:0408 368 892

Mobile:0408 808 698

Stockdale & Leggo 3/1065 Fâ&#x20AC;&#x2122;ston-Flinders Road,

Stockdale & Leggo 1/109 High Street, HASTINGS 5979 2288

Phil Stone

Mobile: 0412 226 758 L. Cooper Real Estate 1067 Fâ&#x20AC;&#x2122;ston-Flinders Road, SOMERVILLE 5977 7766 EMAIL: sales@lcooper.com.au

Lee Swift Mobile: 0434 871 536 Baywest Real Estate 87 High Street, HASTINGS 5979 4412

EMAIL: ty@stockdaleleggo.com.au

Mobile:0409 410 456 MC Real Estate 4/82 High Street, HASTINGS 5979 8833

EMAIL: sales@mcrealestate.com.au

Jordan Hendrix Mobile: 0415 346 866 Zentori Real Estate 1549 F/Flinders Road TYABB, 5977 3747

SOMERVILLE 5977 8877

EMAIL: rpryzler@stockdaleleggo.com.au

Michael Curry

EMAIL: lswift@baywestrealestate.com.au

EMAIL: jhendrix@zentori.com.au

       

Ben Tallon

Gary Barnes

Mobile:0419 339 489

Mobile: 0412 347 233 Baywest Real Estate 1/1085 Fâ&#x20AC;&#x2122;ston-Flinders Rd SOMERVILLE 5977 9660

Ben Tallon Real Estate 1/34 High Street, HASTINGS 5979 8003

EMAIL: realestate@btre.com.au

EMAIL: somerville@baywestrealestate.com.au

Elizabeth Wall

Milton Brown

Mobile: 0417 528 042

Mobile: 0418 326 044

Ray White Real Estate 69 High Street, HASTINGS 5979 3555

LJ Hooker Somerville Shop 15/17 Eramosa Road West, Somerville 5978 0044

EMAIL: hastings.vic@raywhite.com Page 2

EMAIL: somerville@ljh.com.au

> WESTERN PORT realestate 1 May 2012

Wilma Green

Mobile: 0407 833 996 Century 21 Homeport 2100 Fâ&#x20AC;&#x2122;stonâ&#x20AC;&#x201C;Flinders Rd, HASTINGS 5979 3555

EMAIL: wilmagreen@century21.com.au

Kevin Wright Mobile: 0417 564 454 Kevin Wright Real Estate 72 Main Street, Mornington PHONE: 5977 2255 Email: kevin@kevinwrightcommercial.com.au

Gabriele Frenkel Mobile: 0413 773 075 Peninsula Property Investment Centre 2/80 Baxter-Tooradin Road BAXTER 5971 3999 & 630 Nepean Highway, CARRUM 9773 2999

EMAIL: gabriele@realty1.net.au

Tony Latessa

Mobile: 0412 525 151 Latessa Business Sales 50 Playne Street Frankston 9781 1588

Email: latessabusinesssales@bigpond.com


FEATURE PROPERTY

<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<<

Paradise awaits WITH a stunning array of quality and glamour, this divine property showcases all the essential features of the perfect rural lifestyle. Breathtaking views encompass both Western Port Bay and the entire western side of Phillip Island from this superb 2.5-hectare (five-acre) allotment (approx). Set at the top of a meandering driveway, the incredible home features blackbutt timber pillars and hand-laid stone walls to the formal entry, all set under glass cathedral ceilings. The main living area soaks up the bay vistas and sliding doors take you to the sunny timber deck with a feature gas pebble fire, ducted reverse cycle air-conditioning and polished bamboo timber floors. The kitchen is a true statement of brilliance with its amazing onyx marble benchtops, a full set of appliances incorporating a custom-fitted refrigerator, wine fridge and steam oven. Entertaining will be an absolute breeze as you play host to all of your friends and family around the designer, 18-metre solar- and gas-heated lap pool and cook up a storm under the cabana with a full kitchen. Retire for the evening to the amazing master suite with a stunning ensuite bathroom, magnificently highlighted by imported Italian stone tiles and its own kitchenette. Each of the other three bedrooms have their own storage space with Shoji screen internal doors, all sharing a well-appointed stone tiled family bathroom with floor heating and direct access to the pool area. The journey outdoors reveals a four-bay storage shed with a dry store and stable, separate studio, full dressage arena and four well-equipped paddocks. The property is set among native landscaped gardens. Whether you are a horse enthusiast, love wine tours, surfing weekends or just have the means for a fantastic getaway, you must inspect this incredible property.

Address: 3850 Frankston-Flinders Road, SHOREHAM Price: $2.775 million Agency: Adam Harlem Real Estate, PO Box 106, Rosebud, 5982 2850 Agent: Adam Harlem, 0432 911 700

Amery Homes The builder with the lot

To advertise in the real estate liftout of Western Port News, contact Jason Richardson on 0421 190 318 or jason@mpnews.com.au NOW PUBLISHED WEEKLY

House & Land Package - Live Near The Bay Lot 16 John Coleman Close, Hastings $428,850 â&#x20AC;&#x201C; Mel Ref. 154 H7

pic not indicative of view from home

DFour bedroom home, ensuite & bathroom DDouble garage and eaves DTwo living areas & rumpus room DStainless steel appliances + dishwasher D6 star energy rating DFencing and full driveway DAll connections DLetterbox, clothesline, towel rails, toilet roll holder and lots more

Call Ellen or Chris on 5977 8194

> WESTERN PORT realestate 1 May 2012

Page 3


MARKET PLACE

>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>>

Retire in style

Big family living

SET in the Peninsula Parklands lifestyle village, this near-new, two-bedroom property would make for an ideal retirement home. The home is near the new community centre and all facilities and has been well maintained. The interior has a nice lounge with gas heating and air-conditioner and the kitchen has a wall oven, gas cooktop and the adjoining meals area has a tinted bay window. Both bedrooms have built-in robes and ceiling fans. A single carport at the side has a roller door and is tandem length to store a caravan. New owners can take the option of a 30-year lease.

CATERING for all the needs of a large family, this splendid double-storey brick home is in a quiet court setting with room to move. Polished pine floorboards feature throughout the kitchen, living areas and walkways. The kitchen has a nice sunny aspect and features a stainless-steel dishwasher and wall oven. From the adjoining dining area you can access the undercover patio. The big lounge has a wood heater and air-conditioner. Upstairs are the four bedrooms, all with built-in robes, and the main bedroom has an ensuite. At street level is a double garage with internal access to the home. It is large enough for a workshop area.

Address: 9 Palm Drive, HASTINGS Price: $189,000 Agency: Tallon First National Real Estate, 35 High Street, Hastings, 5979 3000 Agent: Nigel Evans, 0439 540 055

Address: 8 Colchester Court, SOMERVILLE Price: $475,000 Agency: L Cooper Real Estate, 1067 Frankston-Flinders Road, Somerville, 5977 7766 Agent: Hugh Gamble, 0401 319 811

Page 4

> WESTERN PORT realestate 1 May 2012


Satchwells

Local Agents with Local Knowledge For Over 50 Years BITTERN

HASTINGS

CRIB POINT

Asking $395,000

Asking $240,000

Asking $460,000 - $480,000

Asking $255,000

LI NE ST W IN G

R BY ED U 20 CE ,0 D 00

HASTINGS

ER UND ER OFF

MUSTLD BE SO Inspect by Appointment

Inspect by Appointment

19 Rosemary Drive - Inspect Sat 12-12.30pm

Inspect by Appointment

DONâ&#x20AC;&#x2122;T MISS THIS ONE

DEVELOPMENT SITE BITTERN

A UNIQUE 2 FOR 1 PACKAGE

CHARMING AND AFFORDABLE

Properties established within a short stroll to the foreshore, Marina and town FHQWUHDUHJHWWLQJKDUGHUWRĂ&#x20AC;QG3RVLWLRQHGRQDODUJHDOORWPHQWDSSUR[ m2 this home offers 3 bedrooms - master with air-conditioning, separate lounge, good sized meals area and quality carpets and tiles throughout.

'RQ0F.HQ]LH+DVWLQJV2IĂ&#x20AC;FH

A rare opportunity S.T.C.A to develop land on approximately 783 sqm has become available in Bittern. Being part of a total land size of 1300 sqm approx which includes a period home, the property can be purchased separately or as a total package. P.O.A.

/LVD5REHUWV+DVWLQJV2IĂ&#x20AC;FH

Only 6 years young and close to public transport and High Street shopping is this unique family home equipped with a fully self-contained unit - all on a spacious, low-maintenance corner allotment.This well-appointed home is large enough for a growing family, comprising formal and informal living options.

This quaint cottage is an ideal starter for someone looking to get in the market. Only a stones throw to local shops and public transport at your doorstep this home offers 2 bedrooms with all the bells and whistles as well as a fresh coat of paint throughout. Built in robes have been installed in both bedrooms.

/LVD5REHUWV+DVWLQJV2IĂ&#x20AC;FH

/LVD5REHUWV+DVWLQJV2IĂ&#x20AC;FH

HASTINGS

HASTINGS

BITTERN

Asking $375,000

Asking $395,000 - $425,000

Asking $345,000+

Asking $254,000

4 Goris Close - Inspect Sat 2.00-2.30pm

62 Reid Parade - Inspect Sat 3.00-3.30pm

2 Dylan Drive - Inspect Sat 1.30- 2.00pm

A SURPRISE PACKAGE

A SPECIAL PLACE TO CALL HOME

INVEST OR LIVE IN

LI NE ST W IN G

R BY ED TO $3 UC SE 0,0 ED LL 00

BITTERN

,QDGHOLJKWIXOVWUHHWWKDWKDVQRWKUXWUDIĂ&#x20AC;FWKLVORYHO\KRPHRQDSSUR[ 800sqms is a delight inside and out.This property has 3 bedrooms all with robes the master with ceiling fan and ensuite.The 2 split systems provide heating and cooling. A spacious living area adjoins the lovely large kitchen.

Sit back relax and just enjoy the character and charm this property has to offer. Set on 700sqm plus allotment on the seaside location of Hastings this period style home features 2 living areas including an elegant formal lounge, an adjoining kitchen dining area with kleenmaid appliances.

HASTINGS Asking $542,000+

An opportunity to create your dream home on approx 1000sqm in the heart of Crib Point. With infrastructure in place including large shedding, double carport and concrete driveway. Surrounded by quality homes, close to schools, medical centre and transport.

HASTINGS

BITTERN

HASTINGS

Asking $429,000

Asking $1,150,000

Asking $345,000+

/LVD5REHUWV+DVWLQJV2IĂ&#x20AC;FH

/LVD5REHUWV+DVWLQJV2IĂ&#x20AC;FH

'RQ0F.HQ]LH+DVWLQJV2IĂ&#x20AC;FH

M B RED U Y U ST $2 C BE 0,0 ED SO 00 LD

R BY ED $3 UC 0, ED 00 0

READY, SET, BUILD

This 3BR Villa still under warranty is close to transport & Marina. Features good quality carpet, s/steel appliances, ens to main bedroom, BIRs, ducted heating, fans throughout and r/c dble lock up garage. Landscaped, maintenance free gardens and tank water connected to the house.

R BY ED TO $1 UC SE 0,0 ED LL 00

/LVD5REHUWV+DVWLQJV2IĂ&#x20AC;FH

417 Stony Point Rd - Agent-on-site Wed 12.30-1.00pm

4/2 Skinner Street - Inspect Sat 12.30-1.00pm

Inspect by Appointment

Inspect by Appointment

Inspect by Appointment

THE VIEWS ARE A PRICELESS BONUS

WHEN QUALITY MATTERS

$77,&67</()$0,/<+20(21$&5(6

SUPER CENTRAL LOCATION

You enter this 4 BR property through a pleasant well maintained front garden. Access is also via Salmon St & through the private common area grounds.The property has a r/c gate & single garage. A colour video pedestrian gate door phone with remote opening & a security alarm system is provided for peace of mind.

Situated in a prime location, close to the bay and the heart of Hastings.This 3 year young home in display home condition and still under warranty offers everything. Comprising 3 bedrooms, main with ensuite and good sized walk in wardrobe.

'RQ0F.HQ]LH+DVWLQJV2IĂ&#x20AC;FH 'RQ0F.HQ]LH+DVWLQJV2IĂ&#x20AC;FH

Individually designed with recycled beams, clinker bricks, soaring timber lined ceilings all incorporated into this prestigious property. The home has 4 bedrooms, 3 bathrooms, lounge, family room, renovated kitchen with stone benchtops all overlooking solar heated I.G pool & modgrass tennis court.

Undoubtedly prime position in this much sought after pocket of central Hastings, this property will appeal to a retiring executive couple or investor seeking a low maintenance home. With quality and style this 2/3 bedroom KRPHXSVWDLUVRIĂ&#x20AC;FHRUVWXGLRLVDQRSWLRQ

/LVD5REHUWV+DVWLQJV2IĂ&#x20AC;FH

'RQ0F.HQ]LH+DVWLQJV2IĂ&#x20AC;FH

CRIB POINT

BITTERN

CRIB POINT

Asking $240,000

Asking $285,000-$305,000

Asking $452,000

Asking $350,000+

LI NE ST W IN G

LI NE ST W IN G

HASTINGS

ER UND ER OFF Inspect by Appointment

288-290 Stony Point Road - Inspect Fri 12.30-2.00pm

9 Goris Close - Inspect Sat 2.30-3.00pm

BUDGET BUYING 2 BEDROOM UNIT

AFFORDABLE NEW LIVING

IDEAL LOCATION, IDEAL SIZE & IDEAL LIVING

35 Orotava Street - Inspect Sat 11.00-11.30am

ONE FOR 1ST HOME BUYERS/RETIREES

In a great location within easy walking distance to High Street Shopping and opposite parkland. O.K it needs a coat of paint and some new carpet, but a smart investor always buys property that you can add value to. Comprising 2 bedrooms, kitchen, lounge, separate laundry, single lock up garage and small backyard.

Itâ&#x20AC;&#x2122;s all about getting your foot in the door when it comes to Real Estate!!!!! By purchasing 1 of these quality built Units of the plan youâ&#x20AC;&#x2122;re on your way in becoming DKRPHRZQHUZKHWKHULWVIRU\RXUĂ&#x20AC;UVWKRPHRUĂ&#x20AC;UVW,QYHVWPHQWSURSHUW\ Completed and ready to purchase today are these 6 Star energy rated units.

Desirably located in a quiet court setting in Bittern.This three bedroom SOXVRIĂ&#x20AC;FHIDPLO\KRPHZLWKHQVXLWHWRPDVWHULVVLWXDWHGRQDSSUR[ 800sqm of land and is within walking distance to Primary School, public transport and the recently completed Bittern Shopping Centre.

Nestled at the end of a quiet court in Crib Point this well thought out 3 bedroom home offers ducted heating & cooling, recently renovated kitchen & bathroom, RSHQSODQOLYLQJQHZĂ RRULQJWKURXJKRXWSOXVQHZFXUWDLQVDQGGUDSHV7LQWHG windows gives you extra security.

CRIB POINT

HASTINGS

HASTINGS

BITTERN

Asking $165,000

Asking $310,000+

Neg Over $620,000

Asking $340,000

Inspect by Appointment

Inspect by Appointment

195 Hendersons Road - Inspect Sat 1.00-1.30pm

Inspect by Appointment

WHEN PRICE MATTERS

AS NEW UNIT CLOSE TO TOWN & MARINA

AN AFFORDABLE DREAM

A TOUCH OF CHARACTER

/LVD5REHUWV+DVWLQJV2IĂ&#x20AC;FH

'RQ0F.HQ]LH+DVWLQJV2IĂ&#x20AC;FH 'RQ0F.HQ]LH+DVWLQJV2IĂ&#x20AC;FH

BE MU SO ST LD

/LVD5REHUWV+DVWLQJV2IĂ&#x20AC;FH

SOLD What great block to purchase and sit on whilst saving for your dream home, blocks like this are going to become the only option available with no further plan for Development in or around the surrounding area of Crib Point at the present time.

/LVD5REHUWV+DVWLQJV2IĂ&#x20AC;FH

This 4 year young unit is situated within minutes walking distance to the main street of Hastings and Marina. Offering 2 spacious bedrooms with built in robes, seperate lounge, open plan living, dining & kitchen with quality appliances including dishwasher. Gas ducted heating has been installed for your comfort.

'RQ0F.HQ]LH+DVWLQJV2IĂ&#x20AC;FH

HASTINGS BALNARRING FLINDERS

A wonderful feeling of warmth and tranquillity envelopes you as you enter this beautifully appointed, environmental home with its use of natural materials, solar electricity and north facing living.Owner built this mud brick home on over an acre gives you the luxury of all services being provided.

/LVD5REHUWV+DVWLQJV2IĂ&#x20AC;FH

www.satchwells.com.au 1/97 High Street 14 Balnarring Village Cnr Cook and Wood Streets

Built in the early 1900â&#x20AC;&#x2122;s with Period elegance, this beautifully restored home offers HYHU\WKLQJ7KHKRPHKDVEHHQUHVWXPSHGUHZLUHGDQGQHZURRIĂ&#x20AC;WWHG)HDWXUHV LQVLGH/HDGOLJKWZLQGRZVIRUPDODQGLQIRUPDOOLYLQJRSHQĂ&#x20AC;UHSODFHVSOXV coonara, 3 bedrooms, open plan kitchen featuring quality tiling, s/s smeg appliances.

'RQ0F.HQ]LH+DVWLQJV2IĂ&#x20AC;FH

03 5979 1888 03 5983 5509 03 5989 0744

> WESTERN PORT realestate 1 May 2012

Page 5


Bay West Real Estate (VIC) Pty. Ltd. 87 High Street, Hastings Victoria 3915 Ph: 03 5979 4412 Fax: 03 5979 3097 Email: enquiries@baywestrealestate.com.au Web: www.baywestrealestate.com.au

COVERING THE WESTERN PORT REGION

If you want the best...Talk To The Best...Talk To BAYWEST!

Hastings, Somerville, Tyabb, Crib Point & Bittern HASTINGS

$735,000 Negotiable

Our single goal at Baywest is to realise the best return for the investor in the most professional manner.

Low fee, High service. Rental properties wanted! HASTINGS

$335,000 - $350,000

Call Sue Now!! PRELOHRIĂ&#x20AC;FH sfrankcombe@baywestrealestate.com.au

&5,%32,17



FAMILY HAVEN IN LEAFY SURROUNDS ALL ON HALF ACRE BLOCK Â&#x2021;)RXUEHGURRPKRPHPDLQZLWK)(6 :,5%,5¡VWRRWKHUV Â&#x2021;.LWFKHQZLWKVWDLQOHVVVWHHODSSOLDQFHV Â&#x2021;'LQLQJDUHDORXQJHZLWK&RRQDUD*'+ DLUFRQGLWLRQLQJ Â&#x2021;5XPSXVURRPODUJHIDPLO\URRPZLWKEDURYHUORRNLQJSRRO Â&#x2021;$WUHDULVDODUJHLQVXODWHGZRUNVKRSZLWKYHKLFOH FDUSRUWSKDVHSRZHUWKURXJKRXW/WZDWHUWDQN

HASTINGS

$375,000 plus

:LQJDOD&RXUW,QVSHFW6DWSP PERFECT FOR A FAMILY! Â&#x2021;5HQRYDWHGWKUHHEHGURRPKRPHZLWKEXLOWLQUREHV Â&#x2021;4XLHWFRXUWORFDWLRQ Â&#x2021;1HZFDUSHWVEDWKURRPNLWFKHQZLWKVVWHHODSSOLDQFHV Â&#x2021;/RXQJHZLWKJDVZDOOKHDWHU UHYHUVHF\FOHDLUFRQGLWLRQLQJ Â&#x2021;:LWKLQZDONLQJGLVWDQFHWRWKH+LJK6WUHHWVFKRROVDQG train station

HASTINGS

$350,000 plus

YOUR PRIVATE PARCEL!

TICKS ALL THE BOXES

Â&#x2021;VTXDUHPHWUH DSSUR[ EORFN Â&#x2021;6LWXDWHGRQDTXLHWQRWKURXJKURDG Â&#x2021;$OOVHUYLFHVDYDLODEOH Â&#x2021;&RPSHWHWLYHO\SULFHGZLOOQRWODVW

Â&#x2021;6SDFLRXVEHGURRPKRPH Â&#x2021;0DVWHUEHGURRPZLWKFXVWRPHQVXLWHDQG:,5 Â&#x2021;)RUPDODQGLQIRUPDOOLYLQJDUHDVSOXVDGLQLQJDUHD Â&#x2021;/LJKWDQGEULJKWKRPHZLWKTXDOLW\Ă&#x20AC;QLVKHVWKURXJKRXW Â&#x2021;'RXEOHJDUDJHZLWKUHDUDQGLQWHUQDODFFHVV Â&#x2021;6LWXDWHGDWWKHHQGRIDTXLHWFRXUW

THINKING OF SELLING? Talk to Sean or Lee about our low-cost Ă DWIHHWRGD\

:DUUHQ&UHVFHQW,QVSHFW6DWSP BEYOND THE FENCE â&#x20AC;&#x201C; A BREATH OF FRESH AIR Â&#x2021;EHGURRPKRPHPDLQZLWKKLV KHUV%,5DQGHQVXLWH Â&#x2021;.LWFKHQZLWKJDVVWRYH GLVKZDVKHU Â&#x2021;,QIRUPDO IRUPDOORXQJHDQGGLQLQJDUHDV Â&#x2021;6HSDUDWHVWXG\ Â&#x2021;/DUJHODXQGU\ZLWKFXSERDUGVSDFH DFFHVVWRUHDU\DUG Â&#x2021;'RXEOHFDUSRUW VLQJOHJDUDJHZRUNVKRS

A lifestyle village for the over 50s 249 High Street Hastings, Victoria 3915 www.peninsula parklands.com.au

$180,000

$145,000

LEE SWIFT 0434 871 536 lswift@baywestrealestate.com.au

SEAN CRIMMINS 0411 734 814 scrimmins@baywestrealestate.com.au

Need to sell your house prior to buying at Peninsula Parklands? Ask us how we can make it very simple and easy

Â&#x201E;Sealing

of our roads is almost complete Â&#x201E;Limited number of homes available

- Sell Your Existing Home + Buy at Parklands = Reap the Financial Rewards email us at info@penpark.com.au

$145,000

5979 2700

A.H. Brad Wilcox 0419 583 634

$210,000

SECURE LONG TERM TENURE SUBJECT TO FINAL APPROVAL zLow maintenance z24 hour security access zA carefree lifestyle zFreedom to travel zEconomical zFull-time on site managers zSocial club zCommunity centre Page 6

> WESTERN PORT realestate 1 May 2012


Tallon HASTINGS

Exquisite Two Bedroom Unit

:HSXW\RXĂ&#x20AC;UVW

BITTERN

HASTINGS

Secluded Homestead

Build Your Dream

CRIB POINT

Sandstone Lodge

Close to the shopping precinct, this immaculate unit will delight with a large lounge/dining area overlooking the kitchen that has solid timber cupboards, upright gas FRRNHU  SDQWU\ WLPEHU Ă RRULQJ DQG TXDOLW\ FDUSHWV throughout. Large main bathroom has shower & bath, there is a separate laundry & 2 bedrooms have BIRâ&#x20AC;&#x2122;s. Private courtyard with gate access, beautifully landscaped with extensive colour.

Imagine your own homestead tucked away behind high Land for sale in the leafy suburb of Old Tyabb. Front block fences with bullnose timber decked verandahs. The of 502m2 with all services. sweeping path & treed surrounds add to the country feel. The home comprises of 4 bedrooms main with full ensuite, 2 living areas with high vaulted ceilings, split system airconditioning, gas column heater & coonara for year round comfort. A good size country style kitchen with gas up right cooker and plenty of bench space.

Ideal for the larger family the home has 2 living areas, main living with Coonara wood heater adjacent to the meals and a modern kitchen with s/steel appliances. The main bathroom, laundry and 2 bedrooms are on the lower level. A timber staircase leads to the 2nd living and main bedroom with FES & BIRâ&#x20AC;&#x2122;s + 4th bedroom or study. Outside is a large garage shed with power, concrete slab, water tanks, pergola and verandahs to keep the harsh sun out.

For Sale:

For Sale:

For Sale:

$345,000

$412,000

For Sale:

BITTERN

BITTERN

HASTINGS

$220,000

$495,000

CRIB POINT

LI NE ST W IN G

Country Style Living

A Quiet Retreat

Make An Offer - Vendor Says Sell

Picture Perfect

As new 3BR home set on a corner block with double JDWHG VLGH DFFHVV ,QVLGH WKHUH DUH VKLQ\ WLOHG Ă RRUV  good quality carpets, the main bedroom has a WIR & FES with double shower. BIRâ&#x20AC;&#x2122;s to other bedrooms. A modern kitchen has s/steel inc. gas cook top, under bench oven & d/w. The lounge at the rear of the home overlooks the timber decked outdoor area & garden. Main bathroom & laundry, double garage and ducted heating.

Set on a beautiful treed block of 847m2. This home has sprawling verandahs, three edrooms, main bedroom overlooks garden and has FES with spa bath. The open plan lounge/dining has exposed beams, gas heating & A/C also with garden outlook. The modern kitchen with servery, s/steel upright gas cooker, dishwasher, pantry & stained glass window adds to the country feel. The home has been tastefully decorated with as new carpets.

As new unit set on a block of 4. Two bedrooms, main with WIR & dual access bathroom, lounge, modern kitchen with s/steel appliances & separate meals area with sliding doors leading to paved courtyard. Tiled and carpeted throughout. S/system, air con, single garage with internal entry and remote door. If youâ&#x20AC;&#x2122;re looking for an investment rental look no further, or perhaps a starting point to get into the market. Walking distance to schools shops + navy base.

For Sale:

For Sale:

For Sale:

For Sale:

Pick your own builder and design your dream home on a block of 609m2. Situated on a corner block in a quiet location framed by trees with views overlooking the Hastings Football Oval. Itâ&#x20AC;&#x2122;s an ideal position for family safety. This is your chance to live in the â&#x20AC;&#x2DC;Toorakâ&#x20AC;&#x2122; end of Hastings, the Old Tyabb area.

$269,500

CRIB POINT

HASTINGS

Hop, Skip & Jump This well maintained unit is a must see. Two bedrooms, main with dual access bathroom, separate laundry, large lounge with high vaulted ceilings & meals area. The modern kitchen has under bench oven & gas cook top, a third room could be used as a study or bedroom. The home comes with gas heating & air-conditioning and single garage. Leased until November 2012, walking distance to shopping precinct, doctors surgery & foreshore.

For Sale:

If you are looking for the peaceful life this home is it! Set in the tranquil surrounds of Red Hill this architect designed double story home overlooks a 1/3 acre of land. Walk through the large monastery doors where the light Ă&#x20AC;OOHG ORXQJH DZDLWV ZKLFK OHDGV WKURXJK WR WKH NLWFKHQ and dining area. The home features 4 bedrooms - main with walk in robe and full ensuite, a separate study, high SLWFKHGFHLOLQJVSROLVKHGĂ RRUERDUGVWKURXJKRXW

DOMINIC TALLON Phone: 0408 528 857

$358,000

HASTINGS

Mud Brick Masterpiece

$770,000

Look No More

Builders/investors 3-4 unit site (S.T.C.A). Build 3 with rental income from house or build four if the house is removed. Set on a 1439m2 approx block of land all services available. Be quick to secure your next project.

For Sale:

$295,000

RED HILL

For Sale:

$410,000

Below Replacement Cost

Operating out of near-new premises, this Indian restaurant has 15 years remaining on its lease. A set of bifold doors open onto a patio area, with an outlook across parklands to the foreshore, which creates extra dining space during the warmer months. The restaurant has seating for 150 with scope to increase to 200, which is in line with the current liquor licence. Opening hours are Tues. - Sun for lunch and dinner. For Sale: $280,000

NIGEL EVANS Phone: 0439 540 055

35 High Street, Hastings

$385,000

$279,000

HASTINGS

HASTINGS

Palm Drive

Make An Offer - Vendor Says Sell

Beautifully maintained, retirement unit with twobedrooms, both with BIRâ&#x20AC;&#x2122;s & ceiling fans. A large lounge with gas heating, split system air-conditioning & ceiling fan. A good size modern kitchen with wall oven & gas cook top overlooks the meals area with picture window. The main bathroom has a large shower & the laundry leads to the long carport with roller door. Option for a 30 year lease.

For Sale:

Pick your own builder and design your dream home on the largest block in the estate. Situated at the end of the court in a quiet location framed by trees and close to recreational facilities. Itâ&#x20AC;&#x2122;s an ideal position for family safety. This is your chance to live in the â&#x20AC;&#x2DC;Toorakâ&#x20AC;&#x2122; end of Hastings, the Old Tyabb area.

For Sale:

$189,000

$295,000

TYABB

BALNARRING BEACH

Industrial 3 Zoned Factory + Yard

General Store - Only Business in Town

:LWKSOHQW\RISDVVLQJWUDIĂ&#x20AC;FWKLVPXOWLSXUSRVHVLWH suits mechanics, engineering, fabrication and storage. Â&#x201E;Industrial 3 Zone Â&#x201E;757m2 approx land Â&#x201E;295m2 approx factory Â&#x201E;6m roof height Â&#x201E;4.4m roller door height Â&#x201E;3 phase power Â&#x201E;Heavy duty frame Â&#x201E;colourbond exterior Â&#x201E;Small side & rear yard with fencing Â&#x201E;toilet Â&#x201E;,QWHUQDORIĂ&#x20AC;FH For Sale: $320,000 For Lease: $1550.00pcm + GST + OGS

tallon.com.au

A lifestyle change awaits you with the only shop in Balnarring Beach. Busy all year round, you can choose your own hours. Well known for its Ă&#x20AC;VK¡Q¡FKLSVWKHVWRUHDOVRDZLGHYDULHW\RIPL[HGOLQHV JHQHUDOVXSSOLHVIRUFDPSHUVDQGEDLWIRUĂ&#x20AC;VKLQJ7DNLQJ $7.5-8k pw with growth potential and directly behind, joined to the shop, is a 4-5 BR home, ideal as for managers residence.. Full list of inclusions available.

For Sale:

$269,000 W.I.W.O

5979 3000

> WESTERN PORT realestate 1 May 2012

Page 7


Z E N TOR I Property Made Easy

10 KATHLEEN CRESCENT, TYABB

$430,000 - $465,000 11 PARAMOUNT CRESCENT, MOUNT MARTHA

Turn Your Dream Home Into A Reality

Picturesque Gardens with Bay Views

zFour bedrooms with the WOW factor

zTranquil 1/3 acre allotment

zMaster bedroom with large ensuite and WIR

zStunning water views

zKitchen w/ stone benchtops, wine rack &

zFour bedroom plus study home

servery window zDecked undercover area for entertaining in both style and luxury zDouble remote control garage with internal access

zMaster with ensuite, walk in robe and corner spa zLarge decked veranda zEvap cooling, gas ducted heating zUnder house storage

Inspect: By Appointment

Inspect: By Appointment Agent: Jordan Hendrix

Mobile 0415 346 866

5/24 LUCERNE AVENUE, MORNINGTON

$860,000 - $940,000

FROM $480,000

Only 1 left - Be Quick!

Agent: Jenny Bastin

3/247 DROMANA PARADE, SAFETY BEACH

Mobile 0432 685 961

$420 PER WEEK

Stunning roof top balcony & BRAND NEW

16 ELLE WAY, TYABB

$410,000 - $450,000

Don’t buy anything until you have seen this!

zBeachside townhouse with three bedrooms

zPolished timber floors

zFour bedrooms plus study, Porter Davis home

zMaster with ensuite plus WIR

zDownstairs master bedroom with ensuite and WIR.

zMaster bedroom with ‘his n hers’ WIR & FES with dual vanities

zKitchen with stone bench tops and s/ steel appliances

zMultiple living areas

zMultiple living areas with open floor plan

zDouble remote controlled garage

zChef ’’s kitchen with stainless steel appliances and stone bench

zDecked alfresco area

zLarge rear deck

zHeating and cooling

zRear gate access for caravans, trailers etc.

Agent: Jenny Bastin

Mobile 0432 685 961

9 BUCKLEY STREET, SAFETY BEACH

$595,000 NEG.

Sparkling new interior & fabulous position

Agent: Jordan Hendrix 29 LANTONS WAY, HASTINGS

Mobile 0415 346 866 Agent: Jordan Hendrix $420,000 - $460,000

Three bedroom + study family home

29 BUCKLEY STREET, SAFETY BEACH

zMaster with WIR & FES boasting dual vanities

z790sqm (approx.) allotment

zState of the art kitchen with stone bench tops &

zSub-divisional potential (STCA)

zDouble remote controlled garage with internal access

zThree generous-sized bedrooms

zSet behind the waterfront homes of Martha Cove marina

zTwo large living areas plus formal dining

zTwo living areas

z Large rear deck for outdoor entertainment

zDecked alfresco outdoor living area

zSituated close to the

Mobile 0403 908 134 Agent: Jenny Bastin

$550,000 NEG.

Ideal weekender & sub-divisional site

zFully renovated three bedroom home

Agent: Dean Toy

Mobile 0415 346 866

zLarge allotment of 842sqm(approx.)

s/steel appliances

zSub-divisional potential (STCA)

Marina, no body-corp. fees

Mobile 0432 685 961 Agent: Dean Toy

Mobile 0403 908 134

1549 Frankston Flinders Road, Tyabb

Phone: (03) 5977 3747

La Marina Plaza, 171 Marine Drive, Safety Beach

www.zentori.com.au

Page 8

> WESTERN PORT realestate 1 May 2012


REAL ESTATE SOMERVILLE

$285,000

Tyabb

Auction: Friday 18th May @1.00pm on site

IN 2. SPE 00 C -2 T .3 SA 0p T m

Somerville

Est 1989

6/1160 Frankston-Flinders Road Position Position Position Ć&#x201D;4uality built 3 bedroom, low maintenance unit Ć&#x201D; Only minutes walk to local shopping, transport, schools Ć&#x201D; Large lounge/dining area, ďŹ&#x201A;oating ďŹ&#x201A;oor boards Ć&#x201D; Modern kitchen with s/steel appliances plus dishwasher Ć&#x201D; Security shutters on all windows,

$325,000

SigniďŹ cant Tyabb Landmark Ć&#x201D; Original Tyabb landmark formerly known as Potts General Store Ć&#x201D; Built Circa 1915 Ć&#x201D; Offered for sale for only the second time in 97 years Ć&#x201D; Plethora of opportunities for the investor/owner, occupier or developer.

Ć&#x201D; Blue ribbon site consists of 3 dwellings on 1 title Ć&#x201D; Potential land bank with income Ć&#x201D; A rare & versatile offering unlike any other in Tyabb Ć&#x201D; SigniďŹ cant investment in the Western Port Region with the Port of Hastings redevelopment and Peninsula Link Bypass. Ć&#x201D; Zoning: Business 1 â&#x20AC;&#x201C; Land Area: 560m2 approx

Somerville

Somerville

$325,000

From $290,000 - $380,000

IN 12 SP .0 EC 012 T S .3 AT 0p m

Tyabb

1527 Frankston - Flinders Road

1-3 / 3 Seaton Court Brand New Units - Only 3 On The Block

More Bang For Your Buck

Classy and Stylish

Ć&#x201D;Lovely 3 bedroom B.V home surrounded by parklands Ć&#x201D;Large formal lounge room with vaulted ceiling Ć&#x201D;Modern kitchen & family room with ducted heating Ć&#x201D;Paved pergola area Ć&#x201D;Single carport and double garage.

Ć&#x201D;Beautifully presented 2 bedroom unit Ć&#x201D;Comprising large formal lounge room with gas wall furnace Ć&#x201D; R/cycle air-conditioning Ć&#x201D;Modern kitchen with s/steel appliances inc. dishwasher Ć&#x201D;Outdoor entertaining area Ć&#x201D;Single lock-up garage with remote.

Ć&#x201D; 2 x three bedroom units, FES to main bedroom Ć&#x201D;7LOHGZHWDUHDVVVWHHODSSOLDQFHVWRNLWFKHQ Ć&#x201D; Open plan living areas, 9ft ceilings Ć&#x201D; Double garage with remote, landscaped gardens Ć&#x201D; Minutes walk to local shops & transport Ć&#x201D; Buy off the plan and save on stamp duty

Somerville

Somerville

$475,000

$480,000

$750,000 - $795,000

IN 12 SP .0 EC 012 T S .3 AT 0p m

IN 1. SPE 00 C -1 T .3 SA 0p T m

Somerville

8 Colchester Court Simple Yet Stylish

Light, Space and Comfort

34 Seaview Road Seaview Gums

Ć&#x201D; Four bedrooms, ensuite to main Ć&#x201D; Lounge room with wood heater and ducted heating Ć&#x201D;Modern kitchen & family area Ć&#x201D; TerriďŹ c outdoor entertaining area, lovely gardens Ć&#x201D; Room for boat, trailer or caravan Ć&#x201D; Double garage with workshop

Ć&#x201D; Located in one of the ďŹ nest parts of Somerville Ć&#x201D;&RQVLVWVRIWKUHHbedrooms, main with FES Ć&#x201D; Lounge with open ďŹ re place, family room with gas heating Ć&#x201D;Evaporative cooling throughout Ć&#x201D;Timber kitchen with dishwasher Ć&#x201D;Outdoor entertaining area, very private setting

Ć&#x201D; Outstanding solid brick 30sq approx. residence Ć&#x201D; Picturesque 2 acres approx well-treed block Ć&#x201D;Includes 4 bedrooms, FES, formal lounge/dining area with A/C Ć&#x201D; Modern tiled kitchen/family area with coonara heating Ć&#x201D; Plus 2 bedroom semi self-contained in-law accomadation Ć&#x201D; Tennis court, triple carport, large sheds plus car parking.

Pearcedale

Somerville

French Island

$790,000 - $820,000

$1.4 million

IN 11 SP .0 EC 0- T 11 S .3 AT 0a m

$830,000 - $850,000

795 Robinsons Road â&#x20AC;&#x2DC;Norwoodâ&#x20AC;&#x2122;

Character and Charm

â&#x20AC;&#x2DC;Picnic Pointâ&#x20AC;&#x2122;

Ć&#x201D; Beautiful 8-acre property with charming colonial style homestead Ć&#x201D; Large open plan lounge and dining areas Ć&#x201D;Blackwood timber kitchen and meals area Ć&#x201D; Three bedrooms, FES to main Ć&#x201D; Verandah overlooks two ornamental dams Ć&#x201D; Lots of sheds for storage and separate bungalow

Ć&#x201D;Hidden sanctuary located 1.25 acres approx Ć&#x201D;Huge 4 bedroom family home with wrap around verandah. Ć&#x201D;Featuring timber kitchen/family area with polished floor boards, Ć&#x201D;Ducted heating, lounge/dining area with open fire place Ć&#x201D;+uge rumpus room Ć&#x201D;Entertaining area overlooking flood lit mod grass tennis court Ć&#x201D;Huge 12m x 8m shed.

Ć&#x201D; 50 acre (approx.) allotment with incredible Western Port Bay views Ć&#x201D; Short drive to Crib Point ferry Ć&#x201D; Build your dream getaway (STCA) with access to your own beach Ć&#x201D; All measurements in above image are approximates. For all enquiries contact Phil Stone

1067 Frankston-Flinders Road, Somerville 5977 7766

PHIL STONE 0412 226 758 HUGH GAMBLE 0401 319 811

> WESTERN PORT realestate 1 May 2012

Page 9


AU

CT IO

N

17 SUNSET CRESCENT, MOUNT ELIZA

LUXURY HOME WITH POOL & PUTTING GREEN The ultimate secluded family sanctuary, this palatial 40sq (approx.) residence offers a taste of American colonial grandeur among forest-like gardens complete with a sparkling in-ground pool and a golf putting green and bunker. Set on 2/3 acre (approx.) behind remote-controlled gates, the luxury 4 bedroom home is your familyâ&#x20AC;&#x2122;s long-awaited reward where they can spread out in three huge living areas, while entertaining takes place by the ORXQJHURRPÂżUHLQDPRRGÂżOOHGIRUPDOGLQLQJURRPDW the family room bar or a fabulous all-weather alfresco entertaining area with mounted radiant heaters and bistro blinds that enclose the whole area for those endless all season dinner parties. But it is the master suite that is designed to truly pamper featuring a lovely window seat, walk in robe and a deluxe ensuite complete with a sunken jacuzzi beside a stunning water feature that sends water cascading down the wall, a double shower and granitetopped twin vanity. Upstairs, the children reign supreme ZLWKWKUHHEHGURRPVĂ&#x20AC;RZLQJIURPDODUJHVWXG\DUHDRQWKH landing, a family bathroom with a spa bath and vast games room including a kitchenette area, wiring for surround sound and a balcony with stairs leading down to the pool. Rich with character and elegance, the home also includes a gourmet kitchen with granite bench tops, a twin-drawer dishwasher and walk-in pantry, ducted heating, evaporative cooling, a secure dog run, a double remotecontrolled garage and remote front gates. AUCTION: TERMS: PRICE GUIDE: INSPECT: CONTACT:

9708 8667 Page 10

> WESTERN PORT realestate 1 May 2012

Saturday 12th May at 1pm 10% deposit, balance 120 days $1.05M-$1.15M Saturday 1-1.30pm James Crowder 0407 813 377 Deb Ketting-Olivier 0403 554 955

Shop 7 / 20-22 Ranelagh Drive MOUNT ELIZA www.communityrealestate.com.au


SMARTER. BOLDER. FASTER PHONE: 03 5979 3555 2100 Frankston-Flinders Road. HASTINGS. VIC. 3915

HOME PORT

CENTURY21HASTINGS.COM.AU

Situated in a quiet court 4 location, boasting 4 bedrooms 2 all with B.I.R.’s, master with ensuite & spacious lounge with 2 separate meals area. Adjoining laminated kitchen with overhead cupboards, plus, brand new stove and dishwasher. Outside boasts covered outdoor deck area, brand new rear fence & double carport with small garden shed. Contact Exclusive Agent. PRICE: $310,000 - $330,000 VIEW: Saturday 11.00-11.30am AGENT: Wilma Green 0407 833 996 OFFICE: 2100 Frankston-Flinders Road, Hastings, 5979 3555

SOMERVILLE 11 Westminster Court You will fall in love with this 2 well-presented home, with a 1 touch of French provincial flair. Large informal living and meals 2 area with near new carpet, plus a spacious kitchen with Caesar stone bench tops. Both bedrooms are very spacious, master with W.I.R. This home has been tastefully renovated and is in excellent condition. Contact Exclusive Agent.

HASTINGS 10 Sunset Rise VENDOR SAYS SELL!! MAKE AN OFFER!!!

4 VIEW: By Appointment 2 AGENT: Carefully designed for the growing family, this Kerry-Lee Marshall 0408 363 686 4 executive residence is only five years old. OFFICE: Boasting four large bedrooms, master with 2100 Frankston-Flinders Road, W.I.R. & ensuite, plush quality carpets, three Hastings 5979 3555 living areas plus quality fixtures and fittings. Also featuring ducted heating, double garage with rear roller door access, block size approx. 800sqm and too many more features to mention. Still under builders warranty! Contact Exclusive Agent. $410,000 NEGOTIABLE

$329,900 By Appointment Wilma Green 0407 833 996 2100 Frankston-Flinders Road, Hastings, 5979 3555

BITTERN 15 Skinner Street

Quality four bedroom open plan 7 main residence with soaring 3 pine lined cathedral ceilings! Double garage under roof plus 4 additional double garage to rear and verandah on three sides! There is a second three bedroom home under the same roof to rear with connecting verandah. Set on almost 3/4 acre, with planning permit issued for three lot subdivision. Contact Exclusive Agent.

Development site or an 3 affordable home on 700sqmt 1 (approx.) allotment! The home 2 boasts a recent renovated kitchen, spacious lounge area, 3 generous sized bedrooms, all with B.I.R.’s. Outside has a decked outdoor area, side verandah under roof line and a large double garage with power and concrete. Contact Exclusive Agent.

PRICE: EXPRESS SALE VIEW: By Appointment AGENT: Chris Watt 0417 588 321 OFFICE: 2100 Frankston-Flinders Road, Hastings, 5979 3555

PRICE: $329,000 VIEW: By Appointment AGENT: Wilma Green 0407 833 996 OFFICE: 2100 Frankston-Flinders Road, Hastings, 5979 3555

BITTERN 59 Myers Road

HASTINGS 34 Burke Street

CRIB POINT 57 Hamilton Street

PRICE: VIEW: AGENT: OFFICE:

Positioned on a 1050m2 approx. 4 allotment, this four bedroom 2 family home features spacious formal and informal living zones, 6 solid timber kitchen and secure double lock-up garage, plus master bedroom with a W.I.R. and ensuite. Also boasts ducted heating, solid Jarrah flooring, freshly painted with quality carpets and window furnishings. Contact Exclusive Agent.

Worst house in the best street 3 - Bring your tools! 3 bedroom 1 period style home, boasting 2 original features throughout including hardwood flooring, picture rails, cornices - in need of some TLC but make no mistake, a real gem of a property for the astute investor. Located only a short walk to the Marina and town centre. Contact Exclusive Agent.

PRICE: EXPRESS SALE VIEW: Saturday 11.00-11.30am AGENT: Kerry Lee Marshall 0408 363 686 OFFICE: 2100 Frankston-Flinders Road, Hastings, 5979 3555

PRICE: VIEW: AGENT: OFFICE:

EXPRESS SALE By Appointment Kerry Lee Marshall 0408 363 686 2100 Frankston-Flinders Road, Hastings, 5979 3555

HASTINGS 16 Douglas Street

> WESTERN PORT realestate 1 May 2012

Page 11


’ n e p p a h t i e k a m e w ‘ t nt ec e sp tm In oin p ap by

en Op

m 0p 1.3 t1 Sa

t Sa en Op

pm .00 -2 0 3 1.

Mornington 13 Playfields Grove

Mornington 15 Allchin Avenue

Mount Martha

Family home and pool

Large and luxurious family home

Position Plus

Stunning renovated four bedroom brick home Q Large open plan lounge and rumpus room Q Undercover pergola area Q 816m2 with landscaped gardens

Ideal family home or investment Q 3 bedroom home on 710sqm block Q Two separate living areas QPlenty of room to play and entertain

Three living areas Q Al fresco dining area overlooking the pool Q Double garage with drive through access QLarge, centrally located kitchen Q

$520,000 - $545,000

t Sa en Op

4

2

2

m 0p 3.3 3-

55 Harrap Road

Q

4

$570,000 +

t Sa en p O

2

en Op

Mornington

Cute As A Button

Family entertainer with lake views

Gorgeous two bedroom beachside unit Q Roomy lounge, neat kitchen & bathroom Q Secure & private paved outdoor area Q Single garage, walk to Main Street

$380,000 - $420,000

2

1

1

t as gf lin l se

4

2

2

2

m 0p 2.3 1 2t1 Sa

Four large bedrooms, main with WIR & FES Q Large formal lounge overlooking gardens Q Solar heating & central gas system Q Wonderful vistas Q

Fantastic size home + swimming pool Q Caesar stone and vinyl wrap kitchen Q 4 bedrooms plus study Q Evaporative cooling and ducted heating

$770,000 - $799,000

3

Mornington 53 Parkside Crescent Parkside elegance

11 Reflections Way

Q

en Op

$460,000 - $480,000

pm .30 12 12

Mornington 3/17 Lucerne Avenue Q

3

Q

2

am .30 11 0 t1 Sa

$590,000 - $640,000

en Op

4

3

4

m 0p 2.3 t2 Sa

t it a , un oad y a pl ys R ns dis ad ow he O’Gr D t it um Vis 4/91 arr 1 C

Mount Martha Blue Water Drive 4 house & land packages left

Carrum Downs

save on stamp duty + design your plan Q creek and rural views Q 3 & 4 bedroom designs available

Q

from $484,000

FROM $330,000

85 O’Gradys Road

Buy off the plan and save on stamp duty

Q

photos for illustrative purposes only

Close to transport

QClose

to Eastlink and shopping centres QDevelopment is a superb option for first home buyers and investors photos for illustrative purposes only

Shop 37a Bentons Square Shopping Centre, Mornington

Page 12

Darrren

Layne

Jade

> WESTERN PORT realestate 1 May 2012

Sarah

42 / 746 Nepean Highway

Perfect for first home buyer or investors Low maintenance gardens Q 1 year old - maximum depreciation Q Get in before June 30 Q

03 5976 1188

Kathy

Mount Martha

www.bwbre.com.au

$460,000 - $480,000

4

2

2


TROTTER SHOES

e h t l l a g Wishin c i t s a t n a f mums a y a D s ’ r e Moth TRADING HOURS: Monday-Friday 9am-5.30pm. Saturday 9am-2pm – Sunday 10am-2pm

41 High Street, Hastings Ph: 5979 1352 Western Port News 1 May 2012

PAGE 25


heritage Tavern & Restaurant Set in a 1930 house the

Mother ’s Day

Heritage Tavern is a great place to visit. 6QXJJOHLQE\WKHÀUHSODFHV or take some rays on the deck. Offering local beers, local wines and local ciders.

Our staff will spoil your mum with white table linen, a complimentary glass of local wine, open fire comfort and old fashioned style service. Enjoy a glass of wine and stay for the Live Music which starts on the deck at 3pm. Head Chef has designed a beautiful menu for the day as his mum will be attending too. Children’s menu at $10 will also be on offer. Bookings (with deposits) essential phone 5983 2597

3059 FRANKSTON-FLINDERS ROAD, BALNARRING (OPPOSITE THE BALNARRING SHOPPING COMPLEX)

PHONE: (03) 5983 2597

e: theheritage1@bigpond.com

www.heritage 3059.com.au

Jewellers

Celebrating

OVER 30 YEARS in jewellery manufacture

Because she’s special y a D s ’ Give her a gift that lasts forever. Mother ay

hav a unique range of beautiful jewellery. 13th M We have Jewellery for all occasions WE WILL BEAT ANY PRICE

'ULYHWKURXJKWR&UDIWYLOODJH‡7UDGLQJKRXUV7KXUVGD\WR6XQGD\DPSP

TYABB CRAFT VILLAGE PAGE 26

Western Port News 1 May 2012

14 Mornington-Tyabb Road, Tyabb 3913 Phone 5977 3711


Everyone deserves a pampering EVERY busy mum dreams of being pampered. Local mother of two small children Carley Bravo recently visited Synergy Wellness Spa in Somerville and was treated to a special pamper package of a facial plus body and foot massage. â&#x20AC;&#x153;It was wonderful; you feel relaxed and rejuvenated. Itâ&#x20AC;&#x2122;s so important to have some â&#x20AC;&#x2DC;me timeâ&#x20AC;&#x2122;,â&#x20AC;? Carly said. â&#x20AC;&#x153;At Synergy Wellness Spa the staff were very friendly and I was impressed by their knowledge of skin care and beauty techniques.â&#x20AC;? Products used during face, body and feet package: Avocado cleansing cream to

cleanse the face. Avocado oil for facial massage. Hydrating facial mask applied to hydrate and nourish the skin. Everyday moisturising cream applied to continue hydration of the skin. Foot massage with a massage oil blend of lemon, rosemary and peppermint. Hot stone back, neck and shoulder massage with sweet almond massage oil. Products available for purchase for home use are: avocado cleansing cream $32 and everyday moisturing cream $35. Winter warmer packages now available: Free use of sauna and spa

lounge with all $98 body packages. No 1: Avocado and lime sugar body scrub, rose clay moisturising body wrap, leg and back massage. No 2: Orange sugar body scrub, gold clay body wrap, full back, neck, shoulder and scalp massage. No 3: Cellulite body wrap with a nourishing winter express facial. The warm bamboo body masssage is a new massage technique that will warm and gently manipulate your muscles into total relaxation. Picture: Sean Morrow

Special gifts for special mums 2J(CZĹ&#x2013;5JQR5CNOQP5V*CUVKPIU

5;0'4);9'..0'5552# $49.95

5;0'4);52# 6#56'6'56'4

SECOND IN LOCATION ON MORNINGT SOON!

Â&#x2021;0LQL+\GUDWLRQ)DFLDO Â&#x2021;%DFN1HFN 6KRXOGHU0DVVDJH Â&#x2021;+DQG )RRW7UHDWPHQW Not available as a gift voucher. New client only.

Become a Salon One member and SAVE every time you visit! As a Salon One member youâ&#x20AC;&#x2122;ll never again pay full price for our salon treatments & services. Enquire now and phone one of our friendly staff regarding this great offer.

52#2#%-#)'5

Body & Back Indulgenc e: Full body brushing, revitalising all natural Australian clay applied to your entire back whilst we mas sage your feet, clay removal by soothing hot towels followed by a destressing hot stone back massage. Price: $98 Face/Body/Feet: Luxurious & destressing back, neck & sho ulder massage followed with a hydrating facial which includes a cleanse, facial massage & K\GUDWLQJPDVNÂżQLVKLQJZLWKD OX[XULRXVIRRWPDVVDJHPrice : $98 Top to Bottom Package: Full body scrub with Australian body clay over entire body left on during a nou rishing facial treatment followed by a hot stone back massage. Price: $125 Body & Soul Recharger: Start with a soothing, out of this world Spa Bath or Sauna followed by a sou l nourishing hour long relaxation massage, complete your stay with a rene wing facial. Price: $280 Anti-aging Facial Packag es: Price: $98

LATEST HI-TECH AMERICAN GELS UltraWhite uses the very latest American gels. We believe they are the most technologically advanced and safest in the industry. Just one 30 minute session with UltraWhite gel can whiten your teeth by up to 8 shades. When booking your treatment please tell us who referred you and you will receive a $50 discount.

5;0'4);9'..0'5552#64#+0+0)%'064' 6KRS6WDWLRQ6WUHHW6RPHUYLOOHÂ&#x2021;3KRQH www.synergyspa.websyte.com.au Western Port News 1 May 2012

PAGE 27


thursdays

y a l p e e x r f o b e k u j e e ol fr free po

s y a d i r f K DJ P

e v i l t h g i n y a d r u sat m p 9 m o r f sic live mu

HOTEL

ay MMother’s D Westernport

Treat mum on

at the

Hotel

‡)5((JODVVRIFKDPSDJQH IRUODGLHVRQDUULYDO ‡1HZZLQWHUPHQXQRZRQ ‡/LYHELVWURVRORLVW ‡7ZRVLWWLQJVRIIWKHPHQX DPDUULYDODQGSPDUULYDO Bookings essential 5979 1201

Oyster Bay Selected Varietals or Sparklings

Carlton Draught or Victoria Bitter 10x375ml

750ml

BOTTLESHOP

SPECIALS Available until 14/5/2012

Jim Beam White Label 700ml

great food... good times... unbeatable value! CNR HIGH & SALMON STREET, HASTINGS. PHONE 5979 1201 PAGE 28

Western Port News 1 May 2012


Susan Anderson Owner

Shop1,10 Russell street Balnarring Phone: 03 59313114 email: balnarring@lillianmac.com.au Web: www.lillianmac.com.au

The most important ad you will see. What you all have been waiting for...

Motherâ&#x20AC;&#x2122;s Day Vouchers

BUY ONE GET ONE

Buy for your mother, your friend, or just buy for YOURSELF. Save yourself hundreds of dollars on your treatments. Limited number available. $50 minimum $1000 maximum.

On sale Mon 7th May to Sat 12th May only

E E FR r e h c u o V 0 5 $ a t e g d n a r Buy a $50 Vouche E E FR r e h c u o V 0 0 1 $ t e g d n a r e h Buy $100 Vouc

r FREE

e h c u o V 0 0 2 $ t e g d n a r e h c u Buy $200 Vo er FREE h c u o V 0 0 5 $ t e g d n a r e h c u o V Buy $500

E E FR r e h c u o V 0 0 0 1 $ t e g d n a r Buy $1000 Vouche nnot be used on any Strict 6 month expiry date. Ca

specials or to buy products.

Western Port News 1 May 2012

PAGE 29


F

D

& ENTERTAINMENT

ʔʦLȫɏ

Riddle:

Confucius says: The best way to slow a runaway horse, is to bet on it.

What can run but never walks, has a mouth but never talks, has a head but never weeps, has a bed but never sleeps? Answer page 31.

Nobody expects a ferret in their bedroom By Stuart McCullough ‘LOST! One ferret. Answers to the name of Tony.’ While neighbourhood light poles are littered with pamphlets advertising everything from garage sales to school fetes to lost cats and dogs, ferrets rarely get a look in. Perhaps people feel you can only really say so much on a light pole. In fact, it’s true to say that most people have a carport rather than a garage, but you never hear of a carport sale. Such a declaration would, no doubt, spook the horses. In the same way, it’s fine to plaster a photo of some unfortunate feline or doggy far and wide in a plea for its prompt return, you seldom if ever see anyone begging to be notified as to the whereabouts of their missing pet hairy-backed tarantula or short-nosed crocodile. The same is true of ferrets. It was just after 3am last Wednesday when, if not all hell, then at least threequarters of it broke loose downstairs. The silent, early hours of the morning were sliced open by two piercing screams from our neighbours. This, I must say, is highly unusual; they’re simply not the kind of people to make a ruckus. This screaming was followed by an avalanche of footsteps, closing doors and what sounded like hand-to-hand combat. This prompted some discussion as to whether we should go down and offer assistance, in case they were trying to fend off an intruder. But the sound rising through the floorboards suggested that such assistance was not necessary. The following day, Kate received an email from our downstairs neighbours politely asking if we were missing a ferret.

PAGE 30

They had been sleeping when they heard a scratching sound in their bedroom and, out of curiosity, switched on the light. The illumination revealed a somewhat surprised ferret which, in turn, inspired the squealing and scrambling that followed. Nobody expects a ferret in the bedroom, especially if you don’t own one. After managing to evict the interloper from their apartment, our neighbours were startled to find the furry intruder returning through the cat-flap, setting off a second wave of commotion. In response to the question ‘have you – perchance – misplaced a ferret?’ I was able to answer with almost complete certainty that this was not the case. In fact, so far as we could ascer-

Western Port News 1 May 2012

tain, no one in our block of apartments was a secret ferret fancier. After tossing the interloper out, it took up residence in the courtyard, eyeing off tenants as they went to start their cars later that morning. To know the creature was still lurking somewhere in the backyard was somewhat unnerving. For all I knew, it was now in the mood for revenge and could easily launch an attack from a hiding place under the stairs at any moment. It’s never pleasant to lose a pet. Many years ago, my brother Lachlan had a pet mouse named Manceton. He was allowed to keep it in his bedroom, in an old budgerigar cage. But like Papillon, Manceton was not about to al-

low himself to be imprisoned for very long. There began a series of escapes, the likes of which would put most ferrets to shame. Generally, these prison breaks ended after a short time in which my brother would tear through the house in search of his escaped pet. In one way, you have to admire its determination. How it managed to get away, much less smuggle a pair of wire cutters into its cage in the first place, quite rightly boggles the mind. However, the day inevitably came when Manceton escaped and could not be found. We had our suspicions, of course. For while Manceton no longer occupied his cage, his odour continued to occupy my brother’s room.

Over time, the mouse scent carried with it the whiff of decay and it seemed likely that poor Manceton – desperate to escape – had got stuck somewhere in the room and had perished. Years later, a mouse skeleton was discovered in the curtain railing. Alas poor Manceton. All you craved was freedom. While all those in the surrounding apartments declared they knew nothing of the ferret, one reported hearing someone from the next block over calling out for ‘Tony’ at about 5am. To their credit, our neighbours rang local vets in the hope this might reveal the owner of a ferret named Tony. Whether describing the resulting reunion as a miracle is not only going overboard but recklessly disregarding the lifejackets in the process probably doesn’t matter. A grateful owner collected a disoriented ferret to return it to its home. Our neighbours, I suspect, are likely to add some kind of keypad to the cat flap as a means of upping the security level. There’s nothing worse than losing a beloved pet. More than that, it’s quite a big deal to find something so precious to somebody else, especially at three o’clock in the morning. That’s a mighty responsibility. In a sense, it doesn’t matter what you love – cat, dog or blue-tongued lizard. Having a pet reveals something about all of us. It’s well proven that having a pet increases your general health and wellbeing. I’m not a bit surprised. Especially when the pet in question is a ferret named Tony. www.stuartmccullough.com


FOOD & ENTERTAINMENT

Performance NEW Zealand-born Keith Urban picked up his first guitar aged six and won his first talent quest at eight. He was influenced by Glen Campbell, Dire Straits, Fleetwood Mac and Don Williams. Urban (pictured) became a Tamworth busker before winning his first Star Maker Quest in 1990 and a Golden Guitar in 1991 for best new talent. The winning song was I Never Work on a Sunday. He went on to win eight Golden Guitars. Now one of the world’s top-selling country music artists, he is enjoying time at the top of both the music charts and television ratings. Urban’s Greatest Hits album is at No 1 on iTunes, while Channel 9’s The Voice, on which Urban appears as a coach, is at No 1. Greatest Hits took the No 1 position on the iTunes chart following the second episode of The Voice, and has kept UK boy band One Direction at No 2 after their recent chart dominance. Greatest Hits is one of four Urban albums in the iTunes album chart alongside Be Here, Get Closer and Defying Gravity. He has sold more than 15 million albums. Urban’s current No 1 follows his recent third consecutive US No 1 song

You Gonna Fly from the Get Closer album. The No 1 US hit follows previous Get Closer chart toppers Without You and Long Hot Summer and gives him a 14 No 1 hits in the US. www.keithurban.net www.theinsoundfromwayout.com www.thevoice.com.au *** CAT Stevens spent his childhood in a flat above his parents’ restaurant in London’s West End. Cat Stevens, real name Steve Georgiou, had his first hit single I Love My Dog at age 19 before he contracted tuberculosis in 1968 and retired from music. After two years he re-emerged and

released the album Tea for the Tillerman in 1971, which gave him international stardom, the album making it to No 2 on the Australian charts and staying in the top 40 album charts for a staggering 96 weeks. The follow-up Teaser and the Firecat (1971) went straight to No 1 in Australia, staying there for 69 weeks. The 1972 album Catch Bull at Four also hit No 1 on the Aussie charts and remained for 34 weeks. Other albums to follow included Foreigner, Buddha and the Chocolate Box, Greatest Hits, Numbers, Izitso and Back to Earth. In 1979, he became a Muslim, took the name Yusuf Islam and retired from music. In 2006, he returned to pop music with his first album of new pop songs in 28 years, Another Cup, under the name Yusuf. Island Records released his most recent album Roadsinger in 2009. Former Hollies singer Terry Sylvester, Rick Nelson’s son Gunnar Nelson and Holly Williams (daughter of Hank Williams Jr) were featured on backing vocals on Roadsinger. This month, Melbourne will see the $5 million production of Moonshadow, the first musical by Yusuf. He has

been working in Melbourne with the cast for the past few months. “The musical has been my baby for a while and it’s about to be born here in Melbourne. I’m really excited. It’s looking fantastic,” he said. Yusuf first indicated the musical was on the way when he made comment during his 2010 Australian tour. He has written new songs for Moonshadow, but most are his classics. The story is centred around family and is about someone who has a dream of another world. Five principal cast members are Gareth Keegan (Jersey Boys, Rocky Horror Show, Bobby Darin Musical), Gemma-Ashley Kaplan (Neighbours, Damn Yankees), Jolvon James (Shane Warne: The Musical, Mama Mia, Homicide, Blue Heelers, Water Rats), Blake Bowden (West Side Story, Boy From Oz, Home and Away) and Robert Grubb (Phar Lap, Gallipoli, McLeod’s Daughters, The Flying Doctors, All Saints, Phantom of the Opera, We Will Rock You). Moonshadow opens at the Princess Theatre on 31 May. Tickets 1300 111 011 or online www.ticketmaster.com.au www.moonshadowthemusical.com.

is still there claiming he did his best for his clients. Will the government compensate the losers? Probably, to ensure that people are calmed by the magic word “superannuation”. True, I am no financial adviser, but with billions invested in superannuation funds it stands to reason there are termites in the woodwork. Be certain. *** I’M so glad the young ones have a new skate park at Mt Eliza. Now there’s a call for a footpath to the park, maybe a clean concrete footpath. And after that we could perhaps call for freshwater drinking fountains along the way, never forgetting coin-operated first aid kits. Mt Eliza, the unforbidden city on the peninsula. Do not disturb. *** BIG splash in The Age: “Victoria in danger of losing its triple A credit rating.” This caused me some concern until I suddenly realised I hadn’t a clue what it meant, not dissimilar (or similar?) to my feelings/knowledge of the surplus/deficit talk. Further, I remembered that they all got it wrong just three years ago. Then I remembered Melbourne was built on a deficit. I turned to the sports section. *** TEDDY Baillieu (“I will increase

transparency and disclosure to break Labor’s culture of secrecy and deals”) has his Independent Broad-based Anti-corruption Commission running. Well done Mr Premier. Nobody knows what investigations into “serious” corrupt conduct means, of course, but it looks good anyway. Secret hearings no doubt. Are we fools? *** HAVE just received a copy of Flinders Community News from handsome Greg Hunt MP, which I shall treasure. Nice; colourful. Eight pages of good deeds featuring handsome Greg some two dozen times. Go Greggy. I often wonder if he will lose his good looks as he gets older. It works in reverse for some, you know. I was pretty ordinary as a nipper and into my 50s, but now I’m reasonably presentable. *** ONE of life’s problems is when you are put in a situation where a galah rules the roost, like where one behaves in a manner above their station in life despite their job description. I recall during my National Service I was on a ship where they had a “Splice the Mainbrace” (free grog) day, but Monsieur Galah barred everyone. Only on our ship. A very unhappy crew. The word was they staged a small mutiny

in Japan after I left; it was hushed up. You come across them in the public service, too; heads are too big for their small brains. They promote authoritarianism, arbitrary punishment and inherent unfairness. They particularly survive in places like the Department of Human Services, Centrelink and the AFL. *** ASIO is responsible for security checks of refugees. Going on my experience, God help the refugees. Has ASIO got a file on me? Probably. Way back in the 1950s they had a file on Ginger Meggs, so the rumour goes. I had a cousin who worked for them, likely as a clerk but from his demeanour it was like James Bond without the females. They worked out of a building that nobody mentioned except everybody at Victoria Barracks. Or was it another rumour? Still, whichever way you look at it they’re more efficient than the Commonwealth Police. ASIO is now investigating environment activists apparently. That should keep them at bay for a time. *** SHADOW treasurer Joe Hockey is sprouting a welfare system closer to our Asian neighbours. Where will the savings go, Joe? To the 1% or to your

By Gary Turner au www.yusufislam.com *** THE Bootleg Beatles, formed from the West End cast of the Broadway musical Beatlemania, perform at Frankston Arts Centre on Friday 11 May. They have been dubbed the world’s premier Beatles tribute band. Tickets 9784 1060. www.abstractentertainment.net *** SOME of Australia’s best known guitarists will pay homage to Jimi Hendrix in the one-off show Experience Jimi Hendrix at the Forum Theatre on Saturday 23 June. Bob Spencer (Skyhooks), Jimi Hocking (Screaming Jets), Phil Manning (Chain), Stuart Fraser (Noiseworks), Dave Leslie (Baby Animals), Steve Edmonds (Jimmy Barnes Band) and many others will appear. Tickets 136 100. www.empiretouring. com.au

A Grain of Salt DO you ever get the feeling we’re being conned? Yes, it’s common to talk with people who have grudges; against Centrelink, politicians, immigrants, you name them. Closer examination results in their facts being arrived at by instinct, gossip and bias rather than knowledge and reason. Look back to the era when John Cain was our premier. There were no poker machines, no football betting, no GST. So how did governments manage in the light of the huge increases in income today, and yet there is a never-ending cry of cuts in services due to reaching their fantasy surplus? Who are these people who spend a lifetime thinking of ways to cut our income and increase theirs? No difference in federal politics. The Coalition and Labor both have razor gangs sifting through ways to cut our entitlements while they are munching on caviar and biscuits. *** WHERE exactly have you invested your money? If you don’t know, you should. Trio Capital in Wollongong lost $180 million; something about offshore investments and, presto, hundreds of people lose retirement nest eggs. The fund manager copped two and a half years in jail, a typical sentence for crooks in suits. The adviser

Joke!!! A man goes to his doctor and says “Doc, I can’t stop singing the Green Green Grass of Home.” The doctor says “That sounds like Tom Jones Syndrome.” The patient asks “Is it common?” To which the doctor replies “It’s not unusual.”

RIddle Solution

ANSWER:

By Cliff Ellen increased salary to buy more pasta? You want savings, Joe? How about capital gains tax, negative gearing, family trusts and other sweeteners for the rich? The list is long, Joe. He’s a time bomb this bloke. *** WHETHER or not the Speaker of the House of Reps is guilty or innocent only time will tell, but in the meantime he certainly has an appropriate surname... Come on buddies? Prayer rooms for Muslims at all AFL grounds? How about prayer rooms for Magpie fans; BYO mat? Farewell and well done to former Greens leader Bob Brown. I didn’t voted for him but he had some fine ideas. “Grief can take care of itself, but to get the full value of a joy, you must have somebody to divide it with.” – Mark Twain Peace until Cup Day. cliffie9@bigpond.com

The most ridiculous and strange, fresh for you...

A river

Sudoku Solution

Western Port News 1 May 2012

PAGE 31


WESTERN PORT

scoreboard

Proudly sponsored by Telstra Store Hastings

Sorras’ dominance over Blues Words Toe Punt, Pictures Andrew Hurst SORRENTO remains the king of the MPNFL Nepean Division mountain after smashing Hastings by 38 points on Saturday in the grand final rematch. Both were undefeated coming into the game, the Sharks beating Dromana and Somerville, and the Blues with wins over Rosebud and Crib Point. It was neck and neck in the first hour, with just one point separating the sides at the major interval. The run of Sorrento was always going to be a concern for the Blues late in the game, as the Sharks were coming off a 14-day break. Having played its round two game against Dromana on Easter Saturday, Sorrento had an extra week’s break. This gave the likes of Trevor Mattison (hand), Leigh Treeby (hamstring) and skipper Benny McCormack (hamstring) the opportunity to recover for this all-important game. The Blues went into the match without the suspended Mick Haddad and Steven Hull, both getting two weeks after the Rosebud game. Sorrento has the ability to turn a game on its head within minutes. On Saturday at Thomas Barclay Reserve in Hastings, that explosion took place in the third quarter. With five goals each at half-time, the Sharks came out in the third and booted eight goals to two. At three-quarter time, the game was effectively over as the Sharks had a 41-point break. The visitors may have lost a gun ‘ranga’ (red head) in Josh Stephenson, but they have been fortunate to replace him with another with a similar complexion and hair colour in Dalton Sanderson. Sanderson booted five goals and was one of the key differences between the sides. Treeby also was super with three goals and the defence, led by Guy Stringer and Chris Bagot, kept the Blues’ forwards under control. Hastings coach Glenn Michie and Grant Masterson each kicked three goals, but they didn’t have massive influences on the game. Sorrento tall Jon Croad is arguably the most improved player in the competition in the past 12 months and his contribution as a pinch-hitter in the ruck and in defence was significant. Adam Jago continues to get better for the Blues and by season’s end, he’s going to be a dominant performer. Mark Deveraux has also proved to be a good recruit and Colin McVeigh continues to be a star of the competition. The Blues have some ground to make up. It’s only round three, but a six-goal loss on home turf against the side that beat you in the 2011 grand final is cause for concern. A best-on-ground display from Crib Point coach Dave Lawson saw his side defeat Frankston Bombers at Greg Beck Oval. Lawson, who used to be one of the best forwardmidfielders in the game, booted seven goals was the Magpies won by seven points. Since taking the coaching job with the Pies a few seasons back, Lawson has played predominantly as a midfielder, spending less time in attack. On Saturday, his ventures into the scoring zone proved to be the key difference. After the game, the Bombers were ruing opportunities wasted in the second quarter. Kicking with the wind, the Bombers managed 6.8 while the Pies were able to convert three of six opportunities. At half-time, the margin was 11 points in favour of the home side. The Pies kicked clear in the third, thanks largely to Lawson, who booted three goals in 10 minutes, while Waide Symes finished with three majors. Sam Austin played one of his best games in years for the black and white, and Matt Jackson continues to prove he is one of the recruits of the season. While Lawson and Symes booted 10 of the 16 goals, the Pies had another six goal kickers. The Bombers were always going to come charging in the final term, but for the second time in three matches, Cribby was able to hold

PAGE 32

Western Port News 1 May 2012

its nerve, dig deep, show enormous resolve and strong character, and get the points. Teenager Michael Maorino with three goals was the best of the Bombers, while Shaun Wilkey and James Degenhardt were again among the best. Bombers coach Tony Blackford said he was getting sick and tired of the roller coaster ride his side was taking him on. “When our backs are to the wall, we tend to come out fighting, but we just can’t seem to find consistency,” Blackford said. “Take nothing away from Crib Point though, they came to play, they were up and about and excited, and went home with the result. “Plugger [Lawson] was awesome. He was at his vintage best playing as a forward. We played three blokes on him and couldn’t stop him.” Conversely, problems continue with the form of recruit Brad Wakeling, who again had zero impact as a forward. “He’s struggling, no doubt about that,” Blackford said. “We put him [Wakeling] back at one point and sent Shaun Brand forward and that worked for us. It’s something we might need to look at.” In better news for the Bombers, recruits Leigh Bidey and Dean Wagner were among the best in the reserves. Blackford said Wagner was “exceptional”. Rosebud had to overcome a slow start to defeat Tyabb in a highly entertaining game. The Buds trailed by 27 points at quarter time and by nine points at half-time, before kicking seven goals to two in the second half to win by 31 points. It was a dominant display by the Buds in the second hour, Ryan Spooner, Greg Bentley and Rhys Bancroft all getting on top through the middle of the ground. While the Buds have some outstanding upper echelon talent in the team, it’s unheralded players such as Mitch Wells and Jamie Clarke who continue to get the job done. Along with the likes of Jack Jarman, Reece Woods and Cody Mulcair, it is the improvement and development of these players over the past couple of years that has seen Rosebud enjoy a good start to the season. There was no Daniel Giarusso for Rosebud on Saturday, which made the win even more impressive. The Yabbies were totally outgunned in the second half. Scott Pickersgill continued to rebound off half back and Jake Anderson worked hard, but there weren’t many other stand out performers for the home side. One positive was the performance of Josh Morhun, who played his first game of the season. Former Rosebud player Robbie Beswick may have regretted his decision to leave the Buds for the Yabbies in the off-season. He had little influence on the match. Tyabb coach Brad Coller said he was disappointed with his side’s second half. “The teams completely changed their output in the second half,” Coller said. “I thought Rosebud was down in the first half and we were up and about. In the second half, it was the opposite. “We should have been five goals up at half-time but gave away three goals through mistakes. The opposition was good enough to make us pay. “Rosebud was great in the second half and we were average.” Coller refused to lay blame for losses on the half a dozen injuries to key players. Tyabb is missing through injury Tavis Brown, Stuart Bell, Kade Anderson, Rowan McGrath, Josh Milburn and Ash Souter. They lost Tim McGrath on Saturday with rib damage. “All pre-season we worked on our structures and I guess when you have so many injuries to key position players, the structures are compromised,” Coller said. “However, I’m not sure the injuries have an influence on our mental toughness and that lacked a bit on Saturday.” Dromana proved that it had taken the next step


Proudly sponsored by Telstra Store Hastings

WESTERN PORT scoreboard

in its development this season, easily accounting for Red Hill at Red Hill showgrounds. In what many predicted would be a danger game for the Tigers, they came out firing in the first quarter, gave themselves a 32-point buffer and won by 36 points. While the scoreline suggested Dromana was only able to extend its quarter time lead by four points at the end, the Hillmen were never really in the contest on the scoreboard. The Tigers’ ability to share the work is where the improvement has come in the past two seasons. Dromana had nine goal kickers on Saturday, Steven Gaertner and Ryan Hawkins the chief contributors with three goals each, while Anthony Bruin has become the third string to the bow, booting a couple. Finding a genuine full-back in Jay Neratzoglou has been a significant difference for the Tigers and the form of Paul Minchington and Toby Banks has been exceptional. David Teasdale and Jarryd Douglas

managed to boot three goals each for Red Hill. The week off last week gave the Tigers the opportunity to have a look at the Hillmen, which gave them the chance to lay eyes on David Maplestone. He booted two goals but was kept under wraps. Luke Adams was again the Hillmen’s best, and Joe Krieger and Ben McGuinness were again among the better players. Dromana has two wins from three matches, its only loss coming against Sorrento on Easter Saturday. After squaring the win-loss ledger against Devon Meadows last week, the Hillmen are now behind at 1-2. Dromana coach Gavin Artico said after the match it was “always nice to come away from Red Hill with a win”. “The weather never seems to be great when we go to Red Hill and it does make it tough, hard footy,” he said. “I was very pleased with our start. To have nine goals kicked against you in the first game of the year against Sorrento, and then bounce back with

nine against Pearcedale and six against Red Hill was pleasing. “The key for us is to develop an even spread of contributors and I think we are getting close to that. “Our depth is very good, there are some name players in the reserves and the young ones coming up are holding their own and contributing to the team. “We are a lot less predictable and harder to match-up on if we have blokes popping up and doing their bit every week.” Pearcedale won its first game of the season, coming from behind to knock over Somerville. At the beginning of the season, you could have put your house on the well recruited Eagles beating the Panthers. However, as we all know, four weeks is a long time in footy. The Eagles were impressive against Sorrento, going down by less than two kicks, and went down in a thriller against Frankston Bombers last week. However, after a handful of players failed to attend an early-morning recovery session after the Frankston

loss, coach Leigh Stewart was left with little choice but to discipline the players. Coupled with a handful of injuries, the Eagles went into Saturday’s game against the Panthers without Justin Allsop, Ben Crowe (injured), Josh Collie, Caleb Cox, Chris King, Aaron Murray (injured), Paul McDonald (injured) and Sam Adams. The Eagles’ best performer this season, teenager Luke Rowe, was on Stingrays duties. Somerville was ripe for the picking and Pearcedale did exactly that. Coming from behind in the final term, Pearcedale won by 18 points. Daniel Murray booted six for the Panthers and Damien McCormack was one of the best players with three goals. Travis Sauer, Pat Cadd and Tony Lester were also instrumental in the victory. Emilio Bitters played his best game for the season for the Eagles, while Jonno Edwards and Leigh Stewart also battled hard for four quarters. Rye’s dominant start to the season

continued on Saturday when the team smashed newcomer Devon Meadows by 80 points. Justin Van Unen made it 30 goals in three matches with another bag of eight, while Andrew Dean made it 10 goals in three matches with four goals. The Demons went into the game without their coach and the league’s best player in Ben Holmes, out for six weeks with a knee injury. However, the form of Darren Booth and Rhett Sutton has been outstanding in the early parts of the season and this continued. They were superb through the middle and working together at stoppages. Sam Smith is the best tagger in the business and was very good, while Billy Kerr and Jai Lloyd were up and about. After half-time when the Demons trailed by two points, they went on to kick 18.9 to 5.5. Andy Oldmeadow and Lachy Burke with two goals were the best of the Panthers.

Did you know... you can now view our papers online at: www.mpnews.com.au Western Port News 1 May 2012

PAGE 33


Proudly sponsored by Telstra Store Hastings

WESTERN PORT scoreboard

FRANKSTON VFL DOLPHINS Results Nepean Seniors

ROUND 8 Sunday 13th May Vs Werribee Tigers Dev League: 11am Seniors: 2pm PLAYED AT HOME Come watch the Dolphins at Frankston Park

ROUND 9 Sunday 20th May Vs Casey Scorpions Dev League: 11am Seniors: Bye PLAYED AT CASEY FIELDS

Win a signed Michael Hussey ball! Raffle tickets $2 each or 3 for $5 Tickets are on sale at the Commonwealth Bank in Hastings. Funds raised will go towards sending Matt Foy to the UK to play cricket. Win a piece of sporting history, while supporting a great cause! Raffle drawn on 15 May, 2012.

Sorrento 3.3, 5.4, 13.8, 18.8 (116) Hastings 2.1, 5.3, 7.3, 12.6 (78) Goals, Sorrento: D. Sanderson 5, L. Treeby 3, B. Kenyon 2, B. Schwarze 2, J. Croad 1, L. Poholke 1, J. Falck 1, N. Warner 1, G. Johnson 1, T. Head 1. Hastings: G. Michie 3, G. Masterson 3, C. McVeigh 2, B. Arnold 1, P. Mawson 1, M. Devereaux 1, B. King 1. Best, Sorrento: G. Stringer, L. Treeby, D. Sanderson, J. Croad, G. Johnson, C. Bagot. Hastings: C. McVeigh, M. Devereaux, A. Hurst, A. Jago, L. Hewitt, P. Mawson Crib Point 3.2, 6.5, 12.8, 16.11 (107) Frankston Bombers 1.2, 7.10, 9.13, 14.16 (100) Goals, Crib Point: D. Lawson 7, W. Symes 3, D. Warry, L. Herrington, J. Flack, D. Cook, D. Kairies, D. Annable. Frankston Bombers: P. Whelan 3, M. Maiorino 3, N. Lonie 2, S. Brand 2, N. Martin, J. Foster, B. Wakeling, B. O’Carroll Best, Crib Point: D. Lawson, S. Austin, W. Symes, M. Jackson, J. Cook, J. Cook. Frankston Bombers: M. Maiorino, S. Wilkey, J. Degenhardt, B. Drake, J. Foster, H. Moore. Rosebud 1.1, 5.4, 8.7, 12.17 (89) Tyabb 5.4, 6.7, 6.10, 8.10 (58) Goals, Rosebud: J. Clarke 3, B. Schultz 3, B. Davidge 2, R. Spooner 2, N. Boswell 1, G. Bentley 1. Tyabb: J. Anderson 2, A. Waterstone 2, R. Beswick 1, S. Pickersgill 1, J. Alexander 1, M. Dimkos 1. Best, Rosebud: R. Spooner, J. Clarke, M. Wells, G. Bentley, R. Bancroft, N. Boswell. Tyabb: S. Pickersgill, J. Anderson, C. Doria, M. Grazules, N. Waterstone, J. Morhun. Dromana 6.0, 9.2, 14.4, 16.6 (102) Red Hill 0.4, 5.4, 7.6, 11.8 (74) Goals, Dromana: S. Gaertner 3, R. Hawkins 3, A. Bruhn 2, J. Hutchinson 2, T. Banks 2, P. Minchington 1, J. Savage 1, R. Slocombe 1, B. Dennis 1. Red Hill: D. Teasdale 3, J. Douglas 3, D. Mapleston 2, B. Maguinness 1, J. Mold 1, L. Adams 1. Best, Dromana: S. Joyce, J. Neratzoglou, P. Minchington, T. Banks, B. Dennis, J. Hutchinson. Red Hill: L. Adams, J. Krieger, B. Maguinness, D. Teasdale, D. McNamara, J. Douglas. Pearcedale 4.2, 7.6, 9.7, 15.9 (99) Somerville 2.4, 3.8, 9.15, 10.21 (81) Goals, Pearcedale: D. Murray 6, D. McCormack 3, T. Smith 2, M. Blackburn 2, N. Wilcox 1, B. Cadd 1. Somerville: L. Forsyth 3, R. Hogenbirk 2, G. Boyd 2, L. Stewart 1, R. Palmer 1, T. Farrelly 1. Best, Pearcedale: D. Murray, T. Sauer, D. McCormack, P. Cadd, L. Murray, T. Lester. Somerville: J. Edwards, E. Bitters, L. Stewart, B. Sedgwick, B. McDonald, R. Palmer. Rye 2.5, 11.9, 13.13, 20.14 (134) Devon Meadows 3.1, 3.1, 5.3, 8.6 (54) Goals, Rye: J. Van Unen 8, A. Dean 4, L. Morse 2, D. Booth

2, J. Noseda 1, C. Ambrose 1, S. Cain 1, R. Sutton 1. Devon Meadows: L. Burke 2, T. Cotton 2, B. Hayes 1, B. Wapshott 1, D. Velardo 1, A. Adams 1. Best, Rye: D. Booth, R. Sutton, S. Smith, B. Kerr, J. Lloyd, J. Van Unen. Devon Meadows: A. Oldmeadow, L. Burke, B. Wapshott, D. Watson, B. Hayes, L. Aghan

Reserves Frankston Bombers 5.0, 9.2, 10.4, 17.10 (112) Crib Point 1.1, 2.1, 3.2, 3.2 (20) Goals, Frankston Bombers: J. Kiss 5, R. Lia 4, S. Foster 2, D. Bence 2, C. Smith 1, M. Webber 1, N. Phillips 1, Z. Longham 1. Crib Point: J. Condick 1, P. Smith 1, J. Wisken 1. Best, Frankston Bombers: J. Kiss, J. Page, M. Webber, D. Wagner, L. Bidey, R. Lia. Crib Point: T. Cook, J. PembertonBuchanan, M. Collins, D. Beech, C. Harris, Z. Dekleuver. Rosebud 5.7, 7.8, 10.11, 11.13 (79) Tyabb 0.2, 0.2, 0.3, 4.5 (29) Goals, Rosebud: J. Tuff 3, C. Fulton 2, L. Armstrong 2, C. Duncanson 1, T. Berridge 1, G. Thomson 1, P. Jones 1. Tyabb: D. Sherlock 2, B. Caldwell 1, A. Whalley 1. Best, Rosebud: D. Hutton, G. Glaum, T. Barrand, D. Marsden, L. Mew, J. Raphael. Tyabb: B. Caldwell, H. Cook, J. Carter, D. Sherlock, A. Whalley, N. Bradley. Dromana 3.6, 4.12, 7.17, 8.22 (70) Red Hill 1.2, 2.4, 2.5, 5.8 (38) Goals, Dromana: B. Hyde 2, K. Voelkl 2, W. Spencer 1, A. Burns 1, B. Allen 1, V. Beca 1. Red Hill: A. Mock 3, B. Martin 1, B. Ritchie 1. Best, Dromana: K. Voelkl, J. Terry, J. Hunter, D. Maestrale, B. Hyde, M. Heggen. Red Hill: R. Blake, A. Holmes, A. Embling, T. Pratt, A. Mock, M. Shaw. Sorrento 3.5, 5.8, 6.11, 6.11 (47) Hastings 0.2, 1.3, 2.5, 4.8 (32) Goals, Sorrento: J. Wells 2, J. Peart 2, L. O’Connor 1, C. Beetham 1. Hastings: J. Ward 2, T. Glass 1, B. Ross 1. Best, Sorrento: C. Beetham, F. O’Connor, T. England, L. Schuldt, M. Littlejohn, M. Senior. Hastings: L. Brouwer, J. Ward, J. Standfield, J. Leyonhjelm, T. Holmes, T. Green. Somerville 5.4, 7.6, 12.9, 15.11 (101) Pearcedale 0.0, 2.0, 3.1, 4.1 (25) Goals, Somerville: C. Cox 3, J. Allsopp 2, D. Droscher 2, T. Beckett 2, S. Adams 2, J. Collie 1, C. King 1, R. Muir 1, J. Boyes 1. Pearcedale: J. Garrett 1, R. Shaw 1, M. Kennedy 1. Best, Somerville: C. Cox, J. Wilson, S. Adams, M. Page, B. Guy, W. Lewis. Pearcedale: T. Mitchell, M. Kennedy, J. Davis, A. Eldridge, J. Garrett, S. Thomas. Devon Meadows 5.4, 7.6, 8.6, 11.7 (73) Rye 2.2, 4.2, 8.4, 9.7 (61) Goals, Devon Meadows: M. Walters 3, S. Kirkwood 2, D. Jarman 2, R. Bean 1, M. Duggan 1, J. Castello 1, L. Jansen 1. Rye: M. Pudney 4, M. Johnson 1, A. Holloway 1, S. Thomas 1, A. Marconi 1, G. Anderson 1. Best, Devon Meadows: S. Kirkwood, J. Castello, L. Jansen, R. Attwood, A. Churchill, S. Piper. Rye: M. Cain, M. Johnson, T. Cullen, M. Pudney, A. Holloway.

SELL YOUR CARAVAN HERE! Turn your

into

„No storage fee „No sale, no fee „Turn your unused caravan into cash! Longbeach Automobiles, 228 Marine Parade, Hastings PAGE 34

Western Port News 1 May 2012

1300ALL 856 312 HOURS

LMCT 7986


Proudly sponsored by Telstra Store Hastings

WESTERN PORT scoreboard

Dogs itching to take on Pies

MPNFL up for country games

Round 6 previews

THE MPNFL’s Nepean and Casey-Cardinia divisions go head to head as part of the Country Championships weekend on 26-27 May. The league will compete against Goulburn Football League at Shepparton on 26 May for the number one title in country football. Last season, the MPNFL beat Ovens and Murray to become No 2 in Victorian country football. This is the last season the MPNFL will have a combined side. Next season, the league’s Peninsula, Nepean and Casey-Cardinia divisions will enter separately. Former Pakenham premiership coach “Jock” Holland will coach the MPNFL team, while Hastings coach Glenn Michie and Dromana coach Gavin Artico will take the reins of the Nepean team. Narre Warren premiership coach Matt Shinner will coach Casey-Cardinia. Artico said putting together a squad for the Nepean team wasn’t easy. “We are looking at getting as much intel as we can from our experience and getting around and seeing a couple of games,” he said. “Our plan is to select a squad of 30 to 40 and then add to it. We will also get players back from the MPNFL squad who don’t make the final list. “So I would expect that we won’t have a final squad until the week of the match against CaseyCardinia.” Artico said that he and Michie would select a squad that epitomised Nepean Division football. “Skillful, fast, quick ball movement and competitive – that’s what Nepean footy is,” he said. “We know the other league has blokes with bigger, stronger and more mature bodies, but we want to represent our division the way we play footy, not to match them in any one department.” Artico said only players who wanted to represent the division would be selected. “If guys get invited to the squad but don’t want to play, we won’t pick them. Toe Punt

Friday 4 May Western Bulldogs v Collingwood, Etihad Stadium, 7.50pm Despite losing its first three games, the Bulldogs have grabbed two wins in a row. Confidence is building and the team will be dying to test its skills against a premiership favourite. For the Bulldogs, midfielder Ryan Griffen had an outstanding game in Canberra collecting 37 disposals. The Magpies will go into the game on a high after a classic Anzac Day victory. Dane Swan silenced his critics by gaining 42 touches, kicking three goals and winning the medal for best on ground. Collingwood by 33 points. Saturday 5 May Essendon v Brisbane, Etihad Stadium, 1.40pm After a close Anzac Day loss, the Bombers will be keen to get back to the form that saw them win their first four matches. Even though Essendon lost by just a point, skills wise they looked a mile off the pace with Brent Stanton being tagged out of the game. In the absence of Michael Hurley, Stewart Crameri wasn’t able to make an impact, which made the Bombers rely on small forwards such as Davey to kick goals. The Lions’ match on the weekend was played in near-monsoon conditions as they struggled to even kick straight. Essendon by 40 points. Geelong v Melbourne, Simonds Stadium, 1.45pm The Demons travel to Geelong still searching for their first win, but this

venue hasn’t been a happy hunting ground with their last win coming in 2005. The Cats didn’t let the wet hinder their performance when they flogged Brisbane by 38 points. Tom Hawkins was pivotal, kicking six goals where the big men were always going to struggle. In the Dees last match they had every opportunity to get a win, but a scoreless last term was a killer. Melbourne is no chance against the reigning premiers. Geelong by 77 points. Gold Coast v Fremantle, Metricon Stadium, 4.40pm This week the Dockers will make the longest flight in the AFL fixture when they face the winless Suns. The Gold Coast looked lost on the weekend without champion skipper Gary Ablett. Like recent weeks they’ve been able to stay in the contest for the first half but usually slip away. Debutant Kyal Horsley played an outstanding first match in Ablett’s absence, gaining 19 possessions including four clearances. The Dockers let themselves down with their inaccurate ball use and left their run too late against Carlton. Fremantle by 46 points. St Kilda v Hawthorn, MCG, 7.40pm We are five rounds in and never has Hawthorn needed a win as bad as it does now. The Saints cemented a spot in the eight after holding off

Melbourne. Clever small forward Stephen Milne kicked his 500th goal. The Hawks have gone from premiership favourites to failing to run out matches. In the three losses this year they have been flogged in the last quarter. Lance Franklin also needs to lift. Hawthorn can’t afford to lose this game and will lift. Hawthorn by 28 points. Sydney v Adelaide, SCG, 7.40pm Sydney Swans are a genuine premiership contender after going to Launceston with a slim chance of winning and pulling off their most inspirational victory since the Geelong win last year. Adam Goodes was terrific in his record-breaking game; he kicked three goals and earned 21 touches. The Crows stamped their authority against cross-town rivals Port Adelaide. This is a good matchup but the Swans look too good to lose at home. Sydney by 19 points. Sunday 6 May Carlton v GWS Giants, Etihad Stadium, 1.10pm This is a massive mismatch on paper and in reality as the Giants play their first game in Victoria. The Blues bounced back in style by gaining an important win on the road against Fremantle. Kade Simpson, aka “Mr Consistent”, was everywhere, picking up 35 disposals and kicking a goal. The Giants go into the game after a gallant loss in the Prime Minister’s Cup. They are improving every week and their young players are slowly adapting to the speed and physicality of big time football. Forward Jeremy Cameron is becoming

a great target inside 50; he kicked five goals, which gives him a total of nine for the season. Carlton by 112 points. Port Adelaide v Richmond, AAMI Stadium, 3.15pm It has been a month since the Power won a match and the pressure is mounting to avoid another horror season. The team definitely looks a lot better than last year with recruits Brad Ebert, Chad Wingard, John McCarthy, Brent Renouf and Darren Pfeiffer. The Tigers also have just one victory, but have played a higher calibre of opponent and been competitive in some of those games. Overall the Tigers look in much better form and should get their second win. Richmond by 17 points. West Coast v North Melbourne, Patersons Stadium, 4pm To finish off round six the Kangaroos head West to try and become the first team to beat the Eagles this year. West Coast fought out a tough match against Richmond to win by 10 points. Second-year player Andrew Gaff has come a long way to be a key ball winner in the middle. The same can be said of forward Jack Darling who kicked four strong goals. The Kangaroos bounced back with a convincing win over Gold Coast. Big men Hamish McIntosh and Drew Petrie were best on ground, taking 11 marks between them. The bottom line is the Eagles are nearly invincible at home. West Coast by 67 points. Twitter: FootballTragic9 Total tips: 36

WE W E SPE SPECIALISE ECIA AL IN VEHICLE REPAIRS We will provide a competitive estimate. We will repair your vehicle to a high standard with a lifetime warranty. (*conditions apply) We can help you with large or small repairs INTRODUCING OUR NEW

FLOATS, TRUCKS & TRAILERS DIVISION ‡ New Custom Floats ‡ All Repairs & Servicing ‡ Obligation Free Quotes! ‡ Small or Large Repairs ‡ Professional Tradesmen! ‡ Workmanship Guaranteed! ‡ Manufactured to your specification! ‡ New Windows Front & Side ‡ New Roofs ‡ Rust Repairs ‡ Chassis Work ‡ Rust Repairs

‡Paint Work ‡ Lights & Rewiring ‡ Floor Replacement or Repairs ‡ New Checkerplate & Rubber Flooring

2/8 Simcock St, Somerville Vic 3912 2 T 03 59 77 66 77 email transmend @bigpond.com

Western Port News 1 May 2012

PAGE 35


s r a C Used Finance from...

! y a d $5 a Log on to

w wpholden.com.au

3 YEAR/175,000KM WARRANTY ON ALL VEHICLES* | 100 POINT $5

$7

PER DAY#

PER DAY#

$7

$7

$8

$8

PER DAY#

PER DAY#

PER DAY#

PER DAY#

DUAL FUEL

1997

MITSUBISHI LANCER GLi GLi Auto, 2 Speaker Stereo, Power Steering, Remote Boot/Hatch Release. OOM283

MECHANICAL M ECHANICAL CERTIFICATION C C O TEST S

DUAL FUEL

2002

2005

2002

2003 2

2004

Automatic, Air Cond, CD Player, Power Steering, Engine Immobiliser. ULT990

3 Door Automatic, Air Conditioning, Airbag Driver, Power Steering, Cd Player. XGO073

ABS, Air Conditioning, CD Player, Central Locking, Power doors/mirrors. RYH400

16” alloys, ABS, Air Cond, Airbags, CD stacker, Cruise, Leather, S/roof. THQ218

Auto, ABS, Dual Airbags, Cruise Control, CD Player, Power Steering. UYH246

FORD FALCON BA XT

VOLKSWAGEN GOLF

TOYOTA ECHO

COMMODORE VZ WAGON

NISSAN X-TRAIL T30 II TI-L N

DRIVE $11,990 DRIVE AWAY $9,990DRIVE AWAY $11,990 AWAY $5,990DRIVE AWAY $9,990 DRIVE AWAY $9,990 DRIVE AWAY

$8

$9

$9

$9

$11

$11

PER DAY#

PER DAY#

PER DAY#

PER DAY#

PER DAY#

PER DAY#

2003

2005 2

Auto, 16” Alloys, CD Player, Power Steering, Cruise, Drivers Airbag. SCC274

5 Speed Manual, Air Cond, CD Player, Front Fog Lamps, Central Locking. TLF729

FALCON BA XLS SUPER CAB

KIA PREGIO CT2 VAN K

2008

2006

2008

2008

3 Door Automatic, Power Steering, Abs, Brake Assist , Air Conditioning. WXM214

4 speed Automatic, 6 cylinder, 2 door 3 seat, Body Colour - Bumpers. VSO355

4 Speed Auto, 15” Alloys, Stability Control, Tinted Windows, Audio MP3. WOX056

2 Litre Turbo Diesel, Auto, 55,000 Kms, Loaded With Extra Features. WRI984

FORD FALCON UTE BF

TOYOTA YARIS

HOLDEN ASTRA AH 60TH ANN.

EPICA CDX-I SEDAN

DRIVE DRIVE DRIVE $12,990 DRIVE $15,990 DRIVE AWAY $13,990 AWAY $14,990 AWAY AWAY $16,990 AWAY $11,990 DRIVE AWAY

$13

$15

PER DAY#

PER DAY#

2008

2011 2

Automatic, Sports Wagon, Cruise Control, Alloy Wheels. YLC437

O 6600K’s, 6 airbags, Genuine Toyota ONLY leather, Alloys, Darkest legal tint. YXY324

VE COMMODORE OMEGA

TTOYOTA COROLLA ASCENT

$16

$16

$18

PER DAY#

PER DAY#

PER DAY#

$20 PER DAY#

2007

2010

2007

2008

Automatic, 19” Alloys, Airbags, Cruise, Leather Seats, Sports Suspension. WEY674

Automatic, Cruise, Airbags, ABS, Air Cond, Roof Rails, Power Steering. XVC723

Auto, 18” Alloys, 8 Speakers, EBD, Electric Sunrrof, Subwoofer. WAV701

16” alloys, ABS, Dual airbags, CD stacker, Cruise, Roll bar, Sidesteps, Towing. WVQ598

CALAIS VE V NTERNATIONAL

MAZDA CX-7 ER LUXURY

HOLDEN CAPTIVA 5

NISSAN NAVARA ST-X

DRIVE DRIVE $21,990DRIVE AWAY $22,990AWAY $27,990 DRIVE AWAY $34,990AWAY $26,990DRIVE $19,990 DRIVE AWAY AWAY

$13 PER DAY

$11

#

PER DAY#

21,990

$

Manual 1.8 litre, 4-cylinder 16 valve DOHC ECOTEC petrol engine Electronic Stability Control (ESC) ABS and EBD Traction Control 16” Alloy Wheels Trip Computer

DRIVE AWAY

A

N C A P

Rated ★★★★★

1.6 L, 4-cylinder petrol engine Bluetooth® Phone & Audio Electronic Stability Control (ESC) ABS and EBD Traction Control 15” Alloy Wheels USB input with iPod® connectivity

DRIVE , 16 990AWAY

$

A

N C A P

Rated ★★★★★

2041 Frankston-Flinders Rd, Hastings ingss

Phone: (03) 5979 4433 Antony Walker 0422 310 834

PAGE 36

Ryan Kissick 0418 522 908

Western Port News 1 May 2012

WESTERNPORT HOLDEN

info@westernportholden.com.au www.wpholden.com.au LMCT10002

^WE WILL BEAT ANY GENUINE HOLDEN DEALERSHIP OFFER. ASK INSTORE E FOR DETAILS. *TERMS AND CONDITIONS APPLY. ASK INSTORE FOR FUTHER DETAILS. TAILS. *SOME PICTURES FOR ILLUSTRATION PURPOSES ONLY # Finance to approved purchasers based on corporate hire purchase (for business purposes only) over 60 months at 10.95% with 20% deposit, no balloon payment.

“ W H E R E T H E C U S T O M E R A LW AY S W I N S ”

Des Kissick


May 1st 2012