THE BUZZ
by Wetherbee
RACE ONE
RETURN FIRE may have disappointed at Ayr last time, but he had been in terrific form before that and dropping back down in grade should aid his cause as he looks to make it three wins in his last four starts. Runner-up on his last two outings, Good Work is interesting on the step up to three miles, while Court At Slip must hold strong claims on the form of his penultimate win over C&D
WIN: RETURN FIRE DANGER: Good Work
RACE TWO
Formerly of the Gosden’s on the Flat, HIGHLAND FROLIC has shown enough in both starts over hurdles to suggest that he can get off the mark in what looks a winnable contest. Tying The Knot did it well at Hereford last time, though a penalty is bound to make life tougher Casi Crudo, who finished second over C&D on his penultimate outing, also merits shortlist inclusion.
WIN: HIGHLAND FROLIC DANGER: Tying The Knot
RACE THREE
BLUE SHARK continues to go from strength to strength and a 6lb rise for his most recent win at Fontwell may not be enough to stop him from completing the four-timer especially with the extra yardage expected to suit. Samatian has not been outside the first three on his last seven starts and is likely to be thereabouts once again, along with Economic Editor and Joie De Vivre.
WIN: BLUE SHARK DANGER: Samatian
RACE FOUR
IRON BRIDGE was left alone to score at Haydock on his latest start, due to his sole rival being pulled up, and the seven-yearold, already a winner over fences at Carlisle in October, remains capable of better in this sphere. A line can be put through No Risk Des Flos effort in the Castleford as it was the first time he tasted defeat at this venue and the performance appeared too bad to be true. Others to note include Prevaricate, who makes his stable debut for Venetia Williams, and Adrimel.
WIN: IRON BRIDGE
RACE FIVE
DANGER: No Risk Des Flos
ETALON has filled the runner-up spot on both his attempts over hurdles and this appears to be a decent opportunity for Dan Skelton’s gelding to gain a first career success. Big Ambitions stepped forward from his bumper debut at Chepstow when fourth here over Christmas and is of considerable interest now going hurdling for the first time. Miss Lamb, who placed in the mares ’ bumper at Aintree in 2021, and newcomer Ranging Bear appeal most of the remainder
WIN: ETALON
RACE SIX
DANGER: Big Ambitions
Swincombe Fleat posted a below par effort on good ground at Fontwell last month, but in first-time cheekpieces and under more suitable conditions, she could bounce back However, the vote goes to MIDNIGHT MARY, who would appear to be fairly treated from a mark of 107 on her fencing bow. Lincoln Lyn struck at Fakenham earlier this month and she’s considered, while Ring Pretender is worth monitoring in the betting market. Stanley Stanley isn’t ruled out either but she has a lengthy absence to overcome.
WIN: MIDNIGHT MARY
RACE SEVEN
DANGER: Swincombe Fleat
The Imposter’s winning run came to an end at Exeter earlier this month, but he ran well to fill the runner-up spot and Nigel Hawke’s charge remains firmly in calculations. My Strong Man displayed improved form at Catterick on his latest outing and he warrants respect fitted with first-time cheekpieces, but THE GOONER edges the vote A 280,000-euro purchase at last April’s Punchestown sales, the gelded son of Flemensfirth could be well treated from an opening mark of 100 and he looks to have been well placed.
WIN: THE GOONER
DANGER: The Imposter
PREMIER ENCLOSURE • Wetherby Millenium Stand • Level 1 – The Tack Room Coffee Shop • Level 2 – Marston Moor Bar • Level 3 – White Rose Bistro* • Level 4 – White Horse Mezzanine Bar • Millennium West Stand • Level 3 – 1891 Bar (Please check opening timings on the day) *The White Rose Bistro is popular and often sells out in advance. Please check availability on the day at the White Rose reception desk. PADDOCK ENCLOSURE • Wetherby Millenium Stand • Level 1 – New for 2022! The Tack Room Coffee Shop • Millennium West Stand • Level 1 – Henry Crossley Bar • Bramham Hall • Paddock Bar OUTSIDE CATERING MOBILES Additional catering units are positioned in outside areas of the Racecourse Enclosures. FRESH FRESH FRESH CAFE FRESH HOT ROLLS FRESH CAFE FRESH bistro FRESH FRESH FRESH CAFE FRESH PIES FRESH FRESH CAFE FRESH bistro FRESH CAFE FRESH PANINIS Paddock Bar William Hill Betting Shop Saddling-up Boxes Weighing Room Administration Offices Winners’ Enclosure Parade Ring Bramham Stand Millennium West Canterdown Owners &Trainers Entrance Bramham Hall Parenting Room
• Roast of the Day • Selection of Fresh Hot Dishes • Side Dishes • Daily Hot Specials • Blue Plate Salads • Selection of Freshly made Sandwiches • Snacks • Hand Baked Cakes • Coffee and Tea Infusions • Chilled Minerals and Juices • Selection of Carved Meats served in Speciality Breads with a variety of accompaniments and dressings • Selection of Tasty Hot Pies and Pastries served with accompaniments • Selection of Paninis served with Salad Garnish FRESH bistro FRESH CAFE FRESH HOT ROLLS FRESH PIES FRESH PANINIS Open to both Premier & Paddock Enclosure racegoers. The Tack Room Coffee Shop.... Level 1 Millennium Stand Serving Barista style coffees, speciality teas, hand-baked cakes & brownies and Panini’s This is an alcohol-free zone Course Enclosure Course Entrance &Turnstiles Horsewalk Wetherby Millennium Stand wn VIP Hospitality ‘B’Car Park Main Entrance &Turnstiles Annual Badge Holders (Reserved) ‘A’Car Park Annual Badge Holders ‘C’Car Park
A cloudy cold morning painted a typical winters day at our last meeting, with seven exciting races taking centre stage.
The day kicked off with a win for Olly Murphy and Sean Bowen, where the removal of the tongue strap seemed to have the desired effect. Market favourite Ballybeg Boss could only manage second and was beaten nine-lengths by Olly Murphy’s eight-year-old.
Favourite backers got their revenge in the second, as the Skelton’s delivered a fine margin winner in testing conditions. The pair pulled some way clear after long time leader Choosethenews gave way and for most of the run in it was impossible to call the winner. The rail perhaps just gave Harry the upper hand against Sean Quinlan and Galudon, there was no doubting it was an enthralling finish
The late withdrawal of Amoola Gold left us with just the five runners. Richmond Lake took up the running heading into the straight and was pressed by Destined To Shine and Pay The Piper. It was Destined To Shine’s first run after quite a lengthy absence and he looked to get tired coming down to the last few fences. Richmond Lake seized the opportunity and extended away readily to win for Brian Hughes and Donald McCain.
Nathan Moscrop gave Piaff Bubbles an ice-cold ride from the back of the field and was happy to let proceedings play out in front of him. Heritier De Sivola had led for most of the race and looked like he may have the race in the bag for Philip Kirby. That was until eventual winner Piaff Bubbles began to motor through the ground and Nathan Moscrop always looked confident enough on the Rebecca Menzies trained seven-year-old. He came home an eventual two-length winner.
Our second big prize-pot of the day went the way of the well backed Iroko for the training partnership of Oliver Greenall and Josh Guerriero. When one is well backed in the green and gold they tend to rarely disappoint and Iroko was no different under Kevin Brogan. He went clear impressively and there will be more to come from this very promising looking five-year-old.
The penultimate race of the day was our second over three miles but this time for chasers. It produced another fantastic spectacle as Sean Bowen battled it out with Brian Hughes to just prevail by a neck. Brian Hughes looked to be home and dry on East Street after he repelled the initial challenge from Mackelduff and then the second from Cash To Ash. Sean however wouldn’t lie down and galvanised Mackelduff to run down East Street in the Shadows of the post, in what was one of the rides of the season!
Sean Bowen completed quite the day when riding Chosen Hero for Archie Watson in the last. Better known for his flat exploits, Archie has been accredited to train a useful hurdler or two and could potentially have another on his hands if they choose to take that route. Chosen Hero did take a keen hold in the early stages of the race but once Sean Bowen settled him down he travelled smoothly into contention. Coming to the two-furlong marker Sean gave him a shake of the reigns and kicked clear to win by three lengths.
It rounded off what was a fantastic day of racing.
LAST TIME OUT | Saturday 14th January
IROKO
RICHMOND LAKE
MACKELDUFF FISTON DE BECON
CHOSEN HERO
HITCHING JACKING
PIAFF BUBBLES
Race 1 12.25 1m 4f 14y
1 Infinitive (GB) 9-10
2 Ring Fenced (GB) 9-8
3 Lady Loulou (IRE) 9-7
4 Addosh (GB) 9-6
5 Thefastnthecurious (GB) 9-4
6 Ready To Shine (IRE) 9-4
7 Haven Lady (IRE) 9-2
8 Jubilee Girl (GB) 9-2
Race 2 1.00 1m 13y
1 Racing Country (IRE) 9-11
2 Soames Forsyte (GB) 9-11
3 Chief’s Will (IRE) 9-10
4 Love Your Work (IRE) 9-9
5 Anif (IRE) 9-8
6 Abruzzo Mia (GB) 9-8
7 Humanitarian (USA) 9-6
8 Masqool (IRE) 9-4 9 Nasim (GB) 9-1
10 Showmedemoney (IRE) 9-0
11 Little Jo (GB) 8-13
Race 3 1.35 1m 13y
1 Brave Emperor (IRE) 9-10
2 Dagmar Run (IRE) 8-11
3 Mohatu (GB) 8-10
4 Gincident (IRE) 8-7
5 Shot of Love (GB) 8-5
6 Look Back Smiling (IRE) 8-4
7 Naomi’s Charm (IRE) 8-4
SOUTHWELL
Race 4 2.10 7f 14y
1 Witch Hunter (FR) 9-9
2 Lord of The Lodge (IRE) 9-8
3 Moai (FR) 9-7
4 Haziym (IRE) 9-5
5 Tiger Crusade (FR) 9-3
6 Another Batt (IRE) 8-11
7 Zip (GB) 8-11
8 Alexander James (IRE) 8-9
9 Tylos (FR) 8-9
10 Titan Rock (GB) 8-8
Race 5 2.45 6f 16y
1 De Rocker (GB) 9-12
2 Lady’s Surprise (GB) 9-7
3 Agent Mayfair (GB) 9-0
4 Katar (IRE) 9-0
5 Midnightattheoasis (GB) 8-12
6 Chamber Choir (GB) 8-9
7 Mc’s Wag (GB) 8-9
8 Purple Panther (IRE) 8-9
9 Quick Fling (IRE) 8-9
10 State Border (GB) 8-9
11 Nuthatch (GB) 8-7
12 David’s Gift (GB) 8-5
13 Flower Desert (FR) 8-5
Race 6 3.20 6f 16y
1 Alafdhal (IRE) 10-2
2 Walking On Clouds (IRE) 9-11
3 Lynns Boy (GB) 9-10
4 Lord Paramount (GB) 9-9
5 Bare Necessity (IRE) 9-9
6 Astro Jakk (IRE) 9-8
7 Starsong (IRE) 9-6
8 Idoapologise (GB) 9-6
9 Shark Two One (GB) 9-5
10 Calin’s Lad (GB) 9-1
11 Dark Shot (GB) 8-12
Race 7 3.50 4f 214y
1 Ustath (GB) 9-6
2 Good To Go (GB) 9-2
3 Lancashire Life (GB) 9-2
4 Mops Gem (GB) 9-2
5 Mr Funky Monkey (GB) 9-2
6 Pusey Street (GB) 9-2
7 Sapphire’s Moon (GB) 9-2
8 Six O’ Hearts (GB) 9-2
9 Stroxx (IRE) 9-2
10 The Gloaming (IRE) 9-2
11 Tilsworth Jade (GB) 9-2
18+. Begambleaware.org Tote vs Starting Price? We’ll pay whichever is better on win bets!
| FACTS | FANCIES | FORM | STATS | FORM ANALYSIS - A CLOSER LOOK FIRST RACE 12.50 3m 45y THE racingtv.com/freemonth CONDITIONAL JOCKEYS’ HANDICAP STEEPLE CHASE (CLASS 4) (Go North Red Rum Series Qualifier) for five yrs old and upwards x Total prize fund £9150 Owners Prize Money Winner £3696; Second £1847; Third £924; Fourth £462; Fifth £231. (Penalty Value £4832.11) A colours no horse form age st-lb 1 GOOD WORK (FR) (18) F55-022 BF 7 12-0 Gr g Network (GER) - Teskaline (FR) Jockey: Toby Wynne (3) Owner: The Cool Runnings Syndicate II Trainer: Oliver Greenall & Josh Guerriero, Malpas Breeder: Mr Jacques Cypres Sponsor: Swansway TIMEFORM VIEW Again shaped as if ahead of his mark when second of 6 in handicap chase at Chepstow (19.4f, soft, 7/4) 18 days ago but was let down by a mixed round of jumping and was worried out of it late. Capable of going close again. Star RatingHHHHH BHA 110 2 RETURN FIRE (IRE) (35) 30-3114 D BF 7 11-13 B g Leading Light (IRE) - There On Time (IRE) Jockey: Patrick Wadge
Owner: Tay Valley Chasers Racing Club
Lucinda Russell, Kinross Breeder: Barry Murphy
Ian Macleod & Co Ltd, Orion Group TIMEFORM VIEW Won back-to-back events at Hexham and Newcastle in November and ran at least as well from higher mark when fourth of 8 in handicap chase at Ayr (24.1f, good to soft) 35 days ago Respected again. Star RatingHHHHI BHA 109 3 DAWN RAIDER (IRE) (51) 123-440 11 11-10 B g Mahler - Woodview Dawn (IRE) Jockey: Jack Hogan Owner: Mr T. G. Kelly Trainer: Gary Hanmer, Tattenhall Breeder: R. McCarthy Sponsor: TGK Construction Co Ltd TIMEFORM VIEW Won at Carlisle and Leicester last term and shaped as if needing run when ninth of 11 in handicap chase at Uttoxeter (20.9f, soft, 28/1) 51 days ago. Current mark demands more even if sharper this time. Star RatingHHHII BHA 106 4 COURT AT SLIP (IRE) (16) 14-4314 CD 6 11-9 B g Court Cave (IRE) - Lady Fame (IRE) Jockey: Tom Midgley Owner: Mrs Anne Dawson & Partner Trainer: Tim Easterby, Malton Breeder: Leo Matheson Sponsor: Easthorpe Hall Stud TIMEFORMVIEWJumpedsoundlywhenoffthemarkoverfencesinC&DeventinDecemberbutwasoffbridlealongwayoutwhen only fourth of 6 in handicap chase at Doncaster (26f, soft) 16 days ago Frame claims if back to best. Star RatingHHHII BHA 105 5 BRING THE ACTION (IRE) (26) 3154-25 CD 7 11-9 B g Jet Away - Lady Firefly (IRE) Jockey: Tom Buckley Owner: Exors of the Late Ms C. Holmes-Elliott Trainer: Nigel Hawke, Tiverton Breeder: M. O’Gorman & J. Dobbs Sponsor: Jubilee Inn TIMEFORMVIEWWonthisracelastseasonandranwellwhensecondatDoncasteronreturn.Consistencyhasneverbeenhisfortethough,andhewasunderwhelming whenfifthof12inhandicapchaseatUttoxeter(24f,heavy)26daysago Nevertheless,notruledoutifputtinghisbestfootforward. StarRatingHHHHI BHA105 6 ROBIN DES FOX (IRE) (72) 3422-5P 7 11-6 B g Robin des Champs (FR) - Shesafoxylady (IRE) Jockey: Harrison Beswick Owner: Barratt, Signy & Spiers Trainer: Oliver Signy, Lambourn Breeder: Mrs Elizabeth Kiernan Sponsor: Oliver Signy Racing Llp TIMEFORMVIEWLightly-racedsortfailedtobeatarivalonhischasedebutbutjumpedsoundlyintheearlystagesandit’spossiblethisscopeysort (runner-upinapoint)could dobetteroverfences. Heranbadly back overhurdleslasttime, though. Star RatingHHHII BHA102 7 ROBYNDZONE (IRE) (64) 331/12/-5 D 9 11-6 B g Frammassone (IRE) - Rebecca Susan Jockey: NON RUNNER Owner: East India Racing Trainer: Venetia Williams, Hereford Breeder: Harold Byrne Sponsor: Faucets Limited TIMEFORM VIEW NON RUNNER Star RatingHHHII BHA 102 10 BY Williams, Limited NON-RUNNER RACE DESCRIPTION This is a three miles and 45 yards handicap steeple chase for five-year-olds and upwards which have been rated from 0 to 110. In a handicap the weight that each of the runners carries is determined by their official handicap rating which is based on their level of form shown so far. The aim is to ensure competitive racing by asking the higher rated horses to carry more weight than lower rated rival. As a guide, horses rated 60 tend to be at the lower end of the scale whilst the very best performers would be rated as high as 170. Leading course trainer (17-22): O
& J
(9 wins from 54 runners, 17%) runs GOOD WORK Trainer-in-form (last 14 days): L
(2 wins
11 runners, 18%) runs RETURN FIRE Longest Traveller: BRING THE ACTION
273 miles.
(6)
Trainer:
Sponsor:
Greenall
Guerrie
Russell
from
trained by N Hawke, Tiverton,
B g Kapgarde (FR) - Money Humor (IRE)
Jockey: Thomas Willmott (3)
Owner: Mrs S. Smith Trainer: Sue Smith, Bingley Breeder: B. Bossert, R. Lustig & J. Bossert Sponsor: Tuffa Footwear Ltd
9
LOCH GARMAN ARIS (IRE) (26) 1PU2P-P D 13 10-2
B g Jammaal - See Em Aime (IRE)
The Brookes Family
Bolger
10
Jockey: Tabitha Worsley
Gary Hanmer,
LOUGH SALT (IRE) (29) 6-53PPP CD 12 10-2
B g Brian Boru - Castlehill Lady (IRE)
Jockey: Alison Johnson (5) Owner: Mr J Toes & Mr J O’Loan Trainer: Peter Winks, Barnsley Breeder: S. C. D. Syndicate Sponsor: Tote TIMEFORM VIEW Won back-to-back events at Doncaster last season but has pulled up on his last 3 outings, so can’t be fancied. Star RatingHHIII BHA 81
11
BALLYNAGRAN (IRE) (14) 6046-03
8 10-2
Br g Imperial Monarch (IRE) - Fancyfacia (IRE) Jockey: Emma Smith-Chaston Owner: The Yorkshire Racing Partnership Trainer: Joanne Foster, Ilkley Breeder: Tony Lawlor Sponsor: Jo Foster Racing
TIMEFORM VIEW Inconsistent chaser, achieving little despite reaching the placings when third of 8 in handicap chase at Catterick (25.2f, heavy) 14 days ago. Up against it from more than a stone out of the weights. Star RatingHHIII BHA 69
DECLARED RUNNERS 11 2022: BRING THE ACTION (IRE) 6 11 1 Kieren Buckley 9-2 (Nigel Hawke) 11 ran Tongue Strap worn by No 1, 2, 3, 6, 11. Sheepskin Cheek Pieces worn by No 3, 4, 5, 8, 9, 10 Running for the first time since Wind Surgery No 6. Stewards Note: COURT AT SLIP: Following its run on 10/1/2023 it was reported that the trainer could not explain the poor run. LOUGH SALT: Following its run on 28/12/2022 it was reported that the horse was never travelling.
Probable S.P’s: 7-2 Good Work (FR), Return Fire (IRE), 5-1 Bring The Action (IRE), 7-1 Kaphumor (FR), 9-1 Court At Slip (IRE), 12-1 Robin des Fox (IRE), 20-1 Dawn Raider (IRE), Loch Garman Aris (IRE), 66-1 Lough Salt (IRE), Ballynagran (IRE)
PLAY SMARTER
The manner in which GOOD WORK was outbattled at Chepstow is a worry but he appeals as still being on a fair mark and is given another chance to get off the mark here. Return Fire ran another good race despite having his winning run ended last time and is most feared, with last season’s winner Bring The Action also capable of getting involved.
11
First Race 8 KAPHUMOR (FR) (75) 12P2U-4 D 7 11-0
TIMEFORMVIEWImpressivewinneronreturnatHexhamlastyearbeforetwocreditablerunner-upeffortslaterintheseason.Probablywouldhavebeensuitedbyagreater emphasisonstaminawhenfourthof7inhandicapchase(6/1)atthisC&D(good)75daysago Lackofobviouspaceheremaynotbenefit.
StarRatingHHHII BHA96
Owner:
Trainer:
Tattenhall Breeder: M.
& J. Lazenby TIMEFORMVIEWVeteran won twice in the mud at Bangor in May 2021 but has only completed once since, looking in need of run before pulling up at Uttoxeter on return. Others are easier to fancy. Star RatingHHIII BHA 83
TIMEFORM PREDICTION: 1.GOOD WORK (FR) 2.RETURN FIRE (IRE) 3.BRING THE ACTION (IRE) THE RESULT 1st.............................................................. 2nd Distance 3rd 4th Time ABANDONMENT REFUND DAILY SALES In the event of an abandonment, no refunds for admission purchased at the turnstiles will be made on the day. In order to obtain a refund please return your proof of purchase to the Racecourse within 14 days providing your full name and contact details. The following rules apply: a) Abandonment before completion of the first race - full refund b) Abandonment prior to completion of the third race - 50% refund c) Abandonment thereafter - no refund. ADVANCE SALES Full information regarding the abandonment policy for admissions purchased in advance of the raceday is available at wetherbyracing.co.uk and a notice will be posted on the website home page in the instance of abandonment. WETHERBY
YORK ROAD, WETHERBY LS22 5EJ Wetherby
will present a cash prize of £50 to the stablehand responsible for the Best Turned Out
in this race. They will also present a memento to the winning owner.
RACECOURSE,
Racecourse
Horse
| FACTS | FANCIES | FORM | STATS | FORM ANALYSIS - A CLOSER LOOK SECOND RACE 1.25 2m THE WATCH RACINGTV WITH FREE TRIAL NOW JUVENILE HURDLE RACE (CLASS 4) (Go North Grey Bomber Series Qualifier) (GBB RACE) for juvenile four yrs old x Total prize fund £7000 Owners Prize Money Winner £2921; Second £1461; Third £730; Fourth £365. (Penalty Value £3812.20) colours no horse form st-lb 1 ARTISTIC CHOICE (IRE) (30) 15 D 11-7 Gr g Caravaggio (USA) - Chicago Girl (IRE) Jockey: Sean Bowen Owner: Mr Stuart Mizon Trainer: Michael Bell, Newmarket Breeder: Forenaghts Stud Farm Ltd & Sam Mencoff Sponsor: Michael Bell Racing TIMEFORM VIEW Fairly useful maiden on the level who made a winning start over hurdles at Catterick in November, well on top finish. Went backwards from that run in cheekpieces at Kempton, though. Star RatingHHHII BHA2 CASI CRUDO (GB) (13) 3124 11-7 B g Authorized (IRE) - Adalawa (IRE) Jockey: Kielan Woods Owner: T Acott, L Cross, Sean Cross, P Johnston Trainer: Alex Hales, Edgecote Breeder: M.
TIMEFORMVIEWFairmaidenonFlatforCharlie&MarkJohnston.butoffthemarkatsecondattemptoverhurdlesatLudlowinDecember Ran well upped in grade when fourth of 7 at Huntingdon 13 days ago, making effort earlier than ideal. Respected. Star RatingHHHHI
3 TYING
B g
Trainer: Alan King, Barbury Castle Breeder: Mr Ernest Fronboese Sponsor: Goodwin Racing Ltd TIMEFORM VIEW Fair maiden on Flat who has been going the right way in his 3 starts over hurdles, much improved when winning at Hereford at the beginning of the month, staying on to lead before the last. Could continue to progress. Star RatingHHHII BHA 116 4 DIAMAND DE VINDECY (FR) (90) 11-0 B g Diamond Green (FR) - Miss Chic’vindecy (FR) Jockey: Toby Wynne (5) Owner: EE Williams & JE Brooke Trainer: Robert Bevis, Duckington Breeder: Etienne Raquin & Martine Bonjour TIMEFORM VIEW Fair performer on the level in France, successful in handicap at Saint-Cloud (14.9f) when last seen in October First run for yard after leavingY. Bonnefoy Interesting recruit to hurdling. Star RatingHHHII BHA5 HIGHLAND FROLIC (FR) (30) 23 11-0 B g Highland Reel (IRE) - Beach Frolic Jockey: Paddy Brennan Owner: Mark & Maria Adams Trainer: Milton Harris, Warminster Breeder: Highclere Stud Ltd & Floors Farming Sponsor: Bresbet TIMEFORM VIEW Fairly useful maiden on Flat for John & Thady Gosden. Following a wind op/in first-time tongue tie, left hurdles debut form behind when third at Kempton in December, doing his best work late on. May have more to offer Star RatingHHHHI BHA 109 6 OLIVER’S ARMY (FR) (19) 0 11-0 B g Pedro The Great (USA) - Douriya (USA) Jockey: Nathan Moscrop Owner: Mr Dave Stone Trainer: Rebecca Menzies, Sedgefield Breeder: E.A.R.L. Haras De La Haie Neuve et al Sponsor: Sts Group Ltd, Bluegrass Horse Feeds TIMEFORM VIEW Showed fair form in minor events on Flat in 2021 for Michael Dods. After 16 months off (had wind op), shaped as if better for run tried hurdling when eighth of 14 in novice at Newcastle 19 days ago.This run should reveal more. Star RatingHHIII BHA7 PLANET LEGEND (IRE) (30) U6 11-0 Ch g Galileo (IRE) - Zut Alors (IRE) Jockey: Charlie Hammond Owner: Mark Hough Trainer: Dr Richard Newland, Droitwich Breeder: Knocktoran Stud Sponsor: Coulthursts Ltd TIMEFORMVIEWFairlyusefulandreliablemaidenonFlatforJamesFerguson.Havingunseatedriderafterfirstonhishurdlingbow,looked badly in need of the experience when sixth at this C&D later in December Improvement required. Star RatingHHHII BHA12 RACE DESCRIPTION Juvenile races are designed solely for four-year-olds in order to allow the younger horses to gain valuable experience by racing against each other before taking on their older, more battle-hardened rivals. Initially, every runner in this two miles hurdle race is allotted 10st 12lb (fillies 10st 5lb), before previous winners are given a penalty dependant on the class of race which they won – 6lb for a Class 4 or 5 hurdle race or 10lb for a Class 1 to 3 hurdle race victory. Leading course trainer (17-22): R Menzies (13 wins from 78 runners, 17%) runs OLIVER’S ARMY Trainer-in-form (last 14 days): R Menzies (5 wins from 21 runners, 24%) runs OLIVER’S ARMY Longest Traveller: HIGHLAND FROLIC trained by M Harris, Warminster, 230 miles.
W. Graff Sponsor: Lactodorum Contracts Ltd, Winwood Construction UK Ltd
BHA114
THE KNOT (USA) (22) 351 D 11-7
Noble Mission - Hope’s Diamond (USA) Jockey: Tom Cannon Owner: Mr Andy Peake
by No
Strap
by No
Strap
by No 5.
by No 1, 7,
early-on. Probable S.P’s: 9-2 Highland Frolic (FR), 11-2 Casi Crudo (GB), 6-1 Tying The Knot (USA), 8-1 Ring of Beara (FR), 10-1 Artistic Choice (IRE), Diamand de Vindecy (FR), 12-1 Chicago Gal (GB), 16-1 Planet Legend (IRE), 18-1 Lady Valentine (IRE), 22-1 Shared (GB), 25-1 Oliver’s Army (FR), 40-1 Swift Tuttle (IRE)
RING OF BEARA has made a promising start to his hurdling career, shaping better than the result at Ludlow last time as he weakened after a mistake at the last. He remains capable of better especially if brushing up his jumping, so can open his account over hurdles this time around. Casi Crudo is feared most back down in grade, ahead of Highland Frolic.
13 8
B g Wootton Bassett -
Mistress
Owner: Matt FitzGerald, The Songsters & Ptr Trainer: Tim Easterby, Malton Breeder: Mr J. P. Cayrouze & Mrs L.
Sponsor: Easthorpe
TIMEFORM VIEW Fairly useful Flat winner who shaped well on hurdles bow when runner-up at Newcastle in November Better than the result when fifthatLudlownexttime(thirdwhenblunderedlast)soheremainsopentoimprovementinthissphere.Majorplayer Star RatingHHHHH BHA-
B g Almanzor (FR) - Between Us
Paul
Owner: Mr Colm Donlon Trainer: Harry Derham, Upper Lambourn Breeder: Cheveley Park Stud Limited
Sport Insurance Services Ltd TIMEFORM VIEW Fairly useful maiden on Flat who was sold from Harry & Roger Charlton 16,000 gns in October Watch for market clues as he now goes hurdling for new yard Star RatingHHIII BHA -
Ch g Fast Company (IRE) - Lumiere Astrale (FR)
Henry Brooke Owner: Salmon Racing Trainer: Oliver Greenall & Josh Guerriero, Malpas Breeder: Hardys Of Kilkeel Ltd Sponsor: Swansway TIMEFORMVIEWFairlyusefulmaidenonFlatforBrianMeehanbuthasofferedlittleinapairofjuvenilehurdlessofar,faring no better in first-time hood when seventh of 8 at Ludlow 20 days ago Star RatingHHIII BHA11 CHICAGO GAL (GB) (28) 25 10-7 Ch f Cityscape - Crooked Wood (USA) Jockey: Conor O’Farrell Owner: The Chicago Gal Partnership Trainer: Michael & David Easterby, Sheriff Hutton Breeder: Hunscote Stud Sponsor: Stittenham Farms TIMEFORMVIEWFairmaidenonFlatwhowasacheappurchasefromtheAlanKingyard Madeanencouragingstable/hurdlesdebutwhenrunner-up atCatterickinNovember,butfoundittougherwhenmid-fieldinastrongerraceatDoncasternexttime. Star RatingHHHII BHA12 LADY VALENTINE (IRE) (28) 0 10-7 B f No Nay Never (USA) - Mais Si Jockey: Gavin Sheehan Owner: ValueRacingClub.co.uk Trainer: Jamie Snowden, Lambourn Breeder: Minch Bloodstock Sponsor: Betvictor TIMEFORM VIEW Successful as a 2-y-o on the Flat for Tom Dascombe and placed in handicaps for Hugo Palmer in 2022. However, beaten long way out switched to hurdles when seventh of 9 at Doncaster in December Star RatingHHIII BHADECLARED RUNNERS 12 2022: GRAYSTONE (IRE) 4 11 5 Bryony Frost 9-4 (Lucy Wadham) 5 ran Sheepskin Cheek Pieces worn
RING OF BEARA (FR) (20) 25 11-0
Harem
(IRE) Jockey: Jamie Hamilton
Marchand
Hall Stud
9 SHARED (GB) (108) 11-0
Jockey:
O’Brien
Sponsor: All
10 SWIFT TUTTLE (IRE) (20) 60 11-0
Jockey:
first time
12. Tongue
worn
Hood, Tongue
worn
10 Sheepskin Cheek Pieces worn
9. Stewards Note: PLANET LEGEND: Following its run on 27/12/2022 it was reported that the horse ran novicey
PLAY SMARTER
TIMEFORM PREDICTION: 1.RING OF BEARA (FR) 2.CASI CRUDO 3.HIGHLAND FROLIC (FR) THE RESULT 1st.............................................................. 2nd Distance 3rd 4th Time Se cond Race GREAT BRITISH BONUS SCHEME The Great British Bonus (GBB) offers multiple bonuses of up to £20,000 per eligible race for British-bread fillies and mares. Wetherby Racecourse will present a cash prize of £50 to the stablehand responsible for the Best Turned Out Horse in this race. They will also present a memento to the winning owner. H.B.L.B. PRIZE MONEY The Horserace Betting Levy Board prize fund schemes provide for the estimated inclusion of £310,329 in rate card and incremental prize money at this racecourse from January to April 2023.
| FACTS | FANCIES | FORM | STATS | FORM ANALYSIS - A CLOSER LOOK THIRD RACE 2.00 2m 3f 154y THE racingtv.com HANDICAP HURDLE RACE (CLASS 5) (Go North Cab On Target Series Qualifier) for four yrs old and upwards x Total prize fund £6650 Owners Prize Money Winner £2686; Second £1343; Third £672; Fourth £336; Fifth £168. (Penalty Value £3511.86) Weights raised 4lb and paragraph 34 of the Weights and Handicapping Code complied with where applicable. colours no horse form age st-lb 1 FIADH (IRE) (31) 36400-0 D 7 12-0 B m Fame And Glory - Lady Charisma Jockey: Brian Hughes Owner: Mr G. F. White Trainer: Chris Grant, Billingham Breeder: Ms Jill Farrell TIMEFORMVIEWOff8monthsbeforefadingeighthof18inhandicaphurdleatNewcastle(20.3f,soft)31daysago Cantake a step forward so she’s no forlorn hope. Star RatingHHHII BHA 96 2 HOKELAMI (FR) (29) 530 6 11-13 B or Br g Coastal Path - Une Brik (FR) Jockey: Sean Bowen Owner: Mr Adrian Butler Trainer: Olly Murphy, Wilmcote Breeder: E.A.R.L. Trinquet, M. & O. Trinquet Sponsor: McCoy Contractors TIMEFORM VIEW Has been brought along steadily, set a lot to do when twelfth of 13 in novice hurdle (100/1) at Leicester (15.5f, heavy) 29 days ago Up in trip for his handicap debut. Should progress. Star RatingHHHII BHA 95 3 BLUE SHARK (IRE) (31) 400111 D 6 11-12 B g Shirocco (GER) - Meara Trasna (IRE) Jockey: Jonjo O’Neill Jr Owner: The Ocean Partnership Trainer: Jonjo O’Neill, Cheltenham Breeder: Mr Paul Archer Sponsor: Wasdell Group TIMEFORM VIEW Arrives on a 4-timer after wins around 2 1/2m at Ffos Las, Newcastle and Fontwell. Up another 6lb but he remains on a workable mark so is a big player once more. Star RatingHHHHH BHA 94 4 LOUGHERMORE (IRE) (14) 122405 CD 9 11-11 B g Milan - Seductive Dance Jockey: William Shanahan (7) Owner: Northumberland Racing Club Trainer: Simon Waugh, Morpeth Breeder: John Dwan and John Brennan Sponsor: Simon Waugh Racing TIMEFORMVIEWScoredoverfencesatSouthwellinMaybutwellbelowparatWetherbyandCatterickonhislasttwostarts. Tongue strap on 1st time now. Star RatingHHIII BHA 93 5 STORM TIGER (GB) (345) 0/00450- 7 11-11 B g Shirocco (GER) - Lucys Pet Jockey: Nathan Moscrop Owner: G Seward & Stella Barclay Trainer: Stella Barclay Garstang Breeder: Mrs Lucinda White Sponsor: Lancashire Racing Stables Limited TIMEFORM VIEW Winning pointer but yet to score over hurdles and returns from 11 months off here. Others are preferred. Star RatingHHIII BHA 93 6 LARGY REACH (GB) (73) 502463 7 11-10 B g Phoenix Reach (IRE) - Kallithea (IRE) Jockey: Theo Gillard (3) Owner: Red Rum Racing 3 Trainer: Donald McCain, Cholmondeley Breeder: Mrs A. M. O’Sullivan Sponsor: Proactive Personnel Limited TIMEFORM VIEW Still to get his head in front but he comes here in decent nick, third of 5 in handicap hurdle at Leicester (20.5f) 73 days ago. Considered. Star RatingHHHII BHA 92 7 JOIE DE VIVRE (IRE) (84) 0533-34 D 8 11-10 Gr m Mastercraftsman (IRE) - Fragonard Jockey: Sean Quinlan Owner: Exors of the Late Mr J. D. Gordon Trainer: Martin Todhunter, Penrith Breeder: Sir Robert Ogden TIMEFORM VIEW Won in first-time cheekpieces in 14f Flat handicap at Thirsk in September Creditable efforts to make the frame in handicap hurdle at Carlisle and on chase debut at Sedgefield since. Shortlisted. Star RatingHHHII BHA 92 14 RACE DESCRIPTION This is a two miles and three and a half furlongs handicap hurdle race for four-year-olds and upwards which have been rated from 0 to 100. To qualify for a handicap rating horses must have won a race, been placed twice or raced at least three times in order for the handicapper to gauge the level of form shown. This rating then dictates the weight to be carried in a handicap In simple terms a horse rated 100 in this particular race would be required to carry 5lb more than a rival rated 95 Leading course trainer (17-22): J O’Neill (13 wins from 72 runners, 18%) runs BLUE SHARK Trainer-in-form (last 14 days): J O’Neill (2 wins from 13 runners, 15%) runs BLUE SHARK Weightwatcher: LOUGHERMORE won off a handicap mark of 105, his rating is now down 12lb to 93. Longest Traveller: EUCHAN FALLS trained by R M Smith, Galston, 205 miles.
Jockey: Harry Reed Owner: Mr Paul L. Drinkwater Trainer: Tristan Davidson, Carlisle Breeder: P. Doocey Sponsor: D & D Industrial Coatings Ltd, Jewson Limited
Jockey: Peter Kavanagh (5) Owner: Mclafferty,Whillans &Topkapi Partnership Trainer: Ewan Whillans, Hawick Breeder: Christopher Johnston Bloodstock Sponsor: Sport Of Kings Classic Racewear
11 SAMATIAN (IRE) (26) 3-13222
Bl g Sageburg (IRE) - Bodhran Davis (FR)
Jockey: David Bass
6 11-5
Owner: Mr Norman Carter Trainer: Kim Bailey, Cheltenham Breeder: Clem & Greg Rossiter Sponsor: Kim Bailey Racing Ltd
12
EUCHAN FALLS (IRE) (24) 0060-02
6 11-4
BHA 87
Ch g Poet’s Voice - Miss Anneliese (IRE) Jockey: Danny McMenamin Owner: Blue Circle Racing Trainer: R. Mike Smith, Galston Breeder: W. M. Johnstone TIMEFORM VIEW Posted a very good second of 17 in handicap hurdle at Ayr (20.4f, 50/1) 24 days ago Enters calculations despite 3lb rise in the weights. Star RatingHHHHI BHA 86
13 CALCULUS (IRE) (42) 543P
6 10-12
Jockey: Sam Coltherd Owner: Yorkshire Horseracing Trainer: Sara Ender, Malton Breeder: Mitaab Abdullah Sponsor: Yorkshire Equine Salt Therapy TIMEFORM VIEW Modest 1m4f winner on Flat. Last of 9 in handicap at Southwell (16.5f) 42 days ago so more needed back
B g Frankel - Vital Statistics
Walford, Sheriff Hutton Breeder: Parkville Stud Sponsor: Mark Walford Racing
15 8 NIGHTS OF DOYEN (IRE) (51)
5
TIMEFORM VIEW Modest
maiden
Denis
More is needed for his new yard
0-00000
11-9 Ch g Doyen (IRE) - Midnight Benefit (IRE) Jockey: Ryan Mania Owner: Miss K. Leckenby Trainer: Kate Leckenby, Duns Breeder: Mrs Gillian Browne
ex-Irish
for
Hogan, seventh of 12 in handicap hurdle (28/1) atTramore (21f) 51 days ago.
Star RatingHHIII BHA 91 9 SHANTOU MOON (IRE) (24) 330006 6 11-7 B g Shantou (USA) - Emma Ami (IRE)
TIMEFORM VIEW Maiden
24 days ago Not ruled out.
Irish pointer who posted a creditable sixth of 17 in handicap hurdle at Ayr (20.4f, heavy, 14/1)
Star RatingHHHII BHA 89 10 TOPKAPI STAR (GB) (143) F-635F1 6 11-7 B m Golden Horn - Burlesque Star (IRE)
good account despite 3lb
TIMEFORMVIEWEnded a long losing run in 4-runner handicap hurdle at Perth (23.9f, 15/8) 143 days ago Can give another
rise. Star RatingHHHII BHA 89
TIMEFORM VIEW Off the
mark on return/first run following a wind op at Stratford in October Creditable placed efforts on all 4 outings since. Sound claims. Star RatingHHHII
over
hurdles. Star RatingHHIII BHA 80 14 HAVING A BARNEY (IRE) (31) 3-456P5 6 10-12 Ch g Getaway (GER) - Batren’s Garden (IRE)
VIEW Yet to offer much
Needs to take a
ABBEY (GB) (83) 0P402/-5 8 10-9 B m Multiplex - Evelith Abbey (IRE)
(7) Owner: The Northern Racing Club
Otterburn Breeder: Stella Brasier
Finnies Heavy Haulage TIMEFORM VIEW Off 19 months before good fifth of 13 in handicap hurdle (50/1) at Hexham (23.3f, soft) 83 days ago Needs considering. Star RatingHHHII BHA 77 16 ECONOMIC EDITOR (IRE) (17) 20-4202 BF 7 10-9 B g Jet Away - How Provincial (IRE) Jockey: Dylan Johnston (7) Owner: UP4B Trainer: Adam Nicol, Seahouses Breeder: Arctic Tack Stud Sponsor: Tote TIMEFORM VIEW Remains a maiden in this sphere but comes here on the back of a good second of 9 in handicap hurdle (11/4) at Ayr (21.4f) 17 days ago Not taken lightly off the same mark. Star RatingHHHII BHA 77 17 LOPES DANCER (IRE) (13) 6///-545 11 10-8 B g Lope de Vega (IRE) - Ballet Dancer (IRE) Jockey: Philip Armson (3) Owner: Mr W. A. Bethell Trainer: Harriet Bethell, Arnold Breeder: Carol Burke & Lope de Vega Syndicate TIMEFORM VIEW Veteran who bagged pair of small-field events on AW Flat early last year. Not at best when returned to hurdles, creditable fifth of 16 in handicap at Huntingdon (19.6f) 13 days ago Star RatingHHHII BHA 76 18 RED OCHRE (GB) (207) 16PP-PP 10 10-5 B g Virtual - Red Hibiscus Jockey: Thomas Willmott (3) Owner: Mrs M Nicholas & Chris Grant Trainer: Chris Grant, Billingham Breeder: Miss S. J. Turner Sponsor: www.chrisgrantracing.com TIMEFORM VIEW Shed his maiden tag at Kelso (20.8f) in 2021 but well below par since. Others appeal a lot more. Star RatingHHIII BHA 73 Thir d Race
Jockey: Jamie Hamilton Owner: Royal Blue Racing and Partner Trainer: Mark
TIMEFORM
in 5 starts over hurdles, including in handicaps at Market Rasen last two outings
step forward. Star RatingHHIII BHA 80 15 ORLAS’
Jockey: Dillan Hurst
Trainer: Susan Corbett,
Sponsor:
DECLARED
g Dylan Thomas
Owner:
Breeder:
J.
-
Jockey:
Trainer: Sue
Sponsor:
Ltd
Rating
BHA
2022: SON OF THE SOMME (IRE) 7 11 11 Henry Brooke 11-4 (Brian Ellison) 15 ran
Strap worn first time by No 4. Hood worn by No 10 Visor worn by No 7. Tongue Strap worn by No 9, 14 16 Hood, Tongue Strap worn by No 6. Sheepskin Cheek Pieces worn by No 4, 11, 13, 15, 16 Stewards Note: RIGHT SAID TED: Following its run on 22/11/2022 it was reported that the horse hung right handed. Probable S.P’s: 17-2 Economic Editor (IRE), 9-1 Blue Shark (IRE), 10-1 Joie de Vivre (IRE), Samatian (IRE), Euchan Falls (IRE), 11-1 Topkapi Star (GB), 14-1 Storm Tiger (GB), 16-1 Loughermore (IRE), 18-1 Largy Reach (GB), 25-1 Hokelami (FR), Shantou Moon (IRE), Orlas’ Abbey (GB), Right Said Ted (IRE), 28-1 Having A Barney (IRE), 33-1 Fiadh (IRE), 40-1 Nights of Doyen (IRE), Lopes Dancer (IRE), 50-1 Calculus (IRE), 66-1 Red Ochre (GB)
16 19
6
PLAY SMARTER A few with chances but BLUE SHARK arrives on the up and remains on a
too so Jonjo O’Neill’s charge can complete his four-timer Euchan Falls is weighted to go well on the back of his good Ayr second with in-form duo Economic Editor and Samatian not taken lightly either TIMEFORM PREDICTION: 1.BLUE SHARK (IRE) 2.EUCHAN FALLS (IRE) 3.ECONOMIC EDITOR (IRE) THE RESULT 1st.............................................................. 2nd Distance 3rd 4th Time DALE TAYLOR Happy 34th Birthday Wishing you a very Happy Birthday Hope you have a fantastic day All our love Mum, Dad, Kyle & Rachel xxx Log on to Wetherby Racecourse FREE WIFI today. ST JOHN AMBULANCE The St John Ambulance Brigade attend all meetings. The Executive wish to thank all members for their valuable and voluntary services. Wetherby Racecourse will present a cash prize of £50 to the stablehand responsible for the Best Turned Out Horse in this race. They will also present a memento to the winning owner.
RIGHT SAID TED (IRE) (65) 5/000-35
10-4 B
(IRE)
Patsy Choice (IRE)
Ross Chapman
Mrs S. Smith
Smith, Bingley
Mr
Finlay
Tuffa Footwear
TIMEFORMVIEWStillamaidenandbelowformfifthof9inhandicaphurdleatSouthwell(15.8f)65daysago Backupintrip with work to do Star
HHIII
72
RUNNERS 19
Tongue
workable mark
Call03448551881orvisitracingtv.com ONLY1,000AVAILABLE FREE MONTH TRIAL BE ALL OVER IT ENJOYAFREEMONTHOFUNRIVALLED,UNINTERRUPTEDCOVERAGE OFEVERYRACELIVEFROM62BRITISH&IRISHRACECOURSES Forfulltermsvisitracingtv.com/freetrial
Leading course trainer (17-22): D Skelton (48 wins from 174 runners, 28%) runs VIVA LAVILLA
Trainer-in-form (last 14 days): D Skelton (7 wins from 17 runners, 41%) runs VIVA LAVILLA
Weightwatcher: ADRIMEL won off a handicap mark of 139, his rating is now down 5lb to 134.
Longest Traveller: ADRIMEL trained by T Lacey, Woolhope, 190 miles.
RACE DESCRIPTION This is a two miles and three and a quarter furlongs handicap steeple chase for five-year-olds and upwards which have been rated from 0 to 140. Once a horse has qualified for a handicap rating this is regularly reassessed. A below-par effort could result in a reduced rating whilst a strong performance could see the rating increased. Occasionally, horses are entered to race before their handicap rating has been reviewed and so to avoid recent winners being un-penalised they are allotted a mandatory penalty – usually 7lb
| FACTS | FANCIES | FORM | STATS | FORM ANALYSIS - A CLOSER LOOK FOURTH RACE 2.35 2m 3f 85y THE RACING TV FREE FOR A MONTH HANDICAP STEEPLE CHASE (CLASS 3) for five yrs old and upwards x Total prize fund £15650 Owners Prize Money Winner £6321; Second £3160; Third £1581; Fourth £790; Fifth £394 (Penalty Value £8264.76) colours no horse form age st-lb 1 IRON BRIDGE (IRE) (27) 1/11-151 7 12-0 B g Milan - Chit Chat Jockey: Jonjo O’Neill Jr Owner: Exors of the late Mr Trevor Hemmings Trainer: Jonjo O’Neill, Cheltenham Breeder: Sean Murphy Sponsor: Trust Inns Limited TIMEFORMVIEWBumper/dualhurdlewinnerwhotookrecordto4-4inawarmCarlislenovicehandicaponchasedebutinOctober Lostunbeatenrecordwithabitofa whimperatChepstowandleftwithnothingtobeatatHaydockbutstilllooksthetypetogoonandmakehismarkinsomegoodhandicaps. StarRatingHHHHH BHA137 2 NO RISK DES FLOS (FR) (30) 11P-416 C 8 11-11 Gr g No Risk At All (FR) - Marie Royale (FR)
Sean Bowen Owner: Mrs Diana L. Whateley
Murphy Wilmcote Breeder: Clovis Bardin & Florence Bardin
Cedar Invest Limited TIMEFORM VIEW Four-time winner over hurdles who left his chase debut well behind when winning 6-runner handicap chase here (15f) in November, forging clear No response back at this track following month, however. Star RatingHHHII BHA 134 3 ADRIMEL (FR) (64) P110P-4 8 11-11 B or Br g Tirwanako (FR) - Irise De Gene (FR) Jockey: Stan Sheppard Owner: Lady Bamford & Alice Bamford Trainer: Tom Lacey, Woolhope Breeder: Dr V. Gabriel Descours Sponsor: Plusbac TIMEFORM VIEW Grade 2 winning hurdler in 2020/21 and revitalised in blinkers when bagging 4 and 3-runner chases at Haydock last winter. Proved a disappointment on last 3 starts but might have needed return here after 8 months off. Star RatingHHHII BHA 134 4 UBETYA (IRE) (27) 341-322 8 11-6 B g Le Fou (IRE) - Valentina Gaye (IRE) Jockey: Emma Smith-Chaston (3) Owner: Mr Andy Peake Trainer: Jedd O’Keeffe, Leyburn Breeder: Ms Cecily Purcell Sponsor: Jedd O’Keeffe Racing TIMEFORMVIEWGainedfirstsuccessoverfenceswhenmakingallatPerthinAprilonfinalstartforPaulNicholls.Betterforreturn when excellent second in handicaps at Bangor/Haydock last 2 starts and should go well again. Star RatingHHHHI BHA 129 5 VIVA LAVILLA (IRE) (66) 1242-4F D BF 7 11-2 Br g Getaway (GER) - Viva Forever (FR) Jockey: Harry Skelton Owner: Darren & Annaley Yates Trainer: Dan Skelton, Alcester Breeder: Grove View Stud Limited Sponsor: Ladbrokes, The Air Ambulance Service (Warwickshire & Northamptonshire) TIMEFORMVIEW Pointwinnerwhowona19.5fLingfieldmaidenhurdleonRulesdebutanddidn’tdoagreatdealwrongin3subsequent starts over timber last season. Shade disappointing both starts over fences this season but still early days Star RatingHHHII BHA 125 6 PREVARICATE (IRE) (312) 242410- 7 11-1 B g Fame And Glory - Zita Hall (IRE) Jockey: Charlie Deutsch Owner: East India Racing I Trainer: Venetia Williams, Hereford Breeder: Mrs Elizabeth Moore Sponsor: Faucets Limited TIMEFORMVIEWFairly useful winning hurdler for Gordon Elliott. Off 10 months.Type to make a chaser (won sole start in Irish points). Interesting. Star RatingHHHII BHA 124 7 THE PADDY PIE (IRE) (31) 233-361 CD 10 10-10 B g Beneficial - Salsita (FR) Jockey: Ross Chapman Owner: Mr John Wade Trainer: Sue Smith, Bingley Breeder: Patrick McElroy Sponsor: Tuffa Footwear Ltd TIMEFORM VIEW Ended a lengthy losing sequence despite being 6lb out of the weights over C&D on Boxing Day. Much higher in the weights now, however, and he’s hardly been consistent in recent years.
18
Jockey:
Trainer: Olly
Sponsor:
Star RatingHHHII BHA 119
19 DECLARED RUNNERS 7 2022: MR WHIPPED
9 11
6 ran
Stewards Note: NO RISK DES FLOS:
poor run. Probable S.P’s: 7-2 Iron Bridge (IRE), 5-1 Ubetya (IRE), 6-1 Viva Lavilla (IRE), The Paddy Pie (IRE), 13-2 Adrimel (FR), 15-2 No Risk des Flos (FR), 8-1 Prevaricate (IRE) PLAY SMARTER IRON BRIDGE was left with nothing to beat when resuming winning ways at Haydock but remains one to keep on the right side of Ubetya has made a positive start for this yard so is respected, while Prevaricate looks an interesting recruit from Ireland. TIMEFORM PREDICTION: 1.IRON BRIDGE (IRE) 2.UBETYA (IRE) 3.PREVARICATE (IRE) THE RESULT 1st.............................................................. 2nd Distance 3rd 4th Time Fo urt h Race NOTICES Weights, Pedigrees, Trainers’ Names Descriptions Performances and Values of races have been added for the convenience of the Public, but are subject to alteration. All horses must parade in the Parade Ring except by permission of the Stewards, but in all cases must pass through the Ring on the way to the Post. The Management reserves the right to refuse admission to anyone without assigning a reason for so doing.
(IRE)
1 Nathan Moscrop 6-1 (Brian Ellison)
Blinkers, Tongue Strap worn by No 3. Sheepskin Cheek Pieces worn by No 4.
Following its run on 27/12/2022 it was reported that the trainer could not explain the
£50
Wetherby Racecourse will present a cash prize
of
to the stablehand responsible for the Best Turned Out Horse in this race. They will also present a memento to the winning owner.
Jockey: William Shanahan (7) Owner: green spittal and smith Trainer: R. Mike Smith, Galston Breeder: Kenneth Parkhill TIMEFORM VIEW
held in a brace of bumpers/novice hurdles. Star RatingHIIII BHA4 DEE DAY LANDING (GB) (30) 05-54U 6 11-2 B h Intrinsic - Heidenheim (IRE)
Jockey: Tabitha Worsley (3) Owner: Mark Weatherer & Formidable Fellows Trainer: Mark Weatherer, Malton Breeder: Mr M. Afzal
| FACTS | FANCIES | FORM | STATS | FORM ANALYSIS - A CLOSER LOOK FIFTH RACE 3.10 2m THE TRY RACING TV FOR FREE NOW EBF ‘NATIONAL HUNT’ NOVICES’ HURDLE RACE (CLASS 4) (Qualifier) (GBB RACE) for novice four, five, six and seven yrs old x Total prize fund £7000 Owners Prize Money Winner £2921; Second £1461; Third £730; Fourth £365. (Penalty Value £3812.20) colours no horse form age st-lb 1 BIG AMBITIONS (IRE) (30) 04 5 11-2 B g Shantou (USA) - Midnight Gift (IRE) Jockey: Richie McLernon Owner: Exors of the late Mr Trevor Hemmings Trainer: Jonjo O’Neill, Cheltenham Breeder: Geoffrey Thompson Sponsor: Trust Inns Limited TIMEFORM VIEW Brother to smart hurdler/chaser Death Duty and stepped up on his debut when fourth in a bumper over C&D Should be better in this sphere, so he’s not a forlorn hope. Star RatingHHIII BHA2 BOOMSLANG (GB) (13) 3203 6 11-2 B g Schiaparelli (GER) - Poisonous (FR) Jockey: Nathan Moscrop Owner: Miss Maria D. Myco Trainer: Rebecca Menzies,
Sedgefield Breeder: Stephen Kemble Bloodstock & Mrs L Lawson Sponsor: Bluegrass Horse Feeds TIMEFORM VIEW Schiaparelli gelding who went with some encouragement in a couple of bumpers and bettered his hurdling debut when third at Sedgefield recently Needs more improvement if he’s to feature in this. Star RatingHHHII BHA3 COULDNTGIVAMONKEYS (IRE) (53) 06-60 5 11-2 B g Valirann (FR) - Monets Dream (IRE)
Well
VIEW Well
and
VIEW Yet to make an impact over
are
6 ETALON (IRE) (54) 3-22 BF 6 11-2 Br g Sholokhov (IRE) - So You Said (IRE) Jockey: Harry Skelton Owner: Mrs Suzanne Lawrence Trainer: Dan Skelton, Alcester Breeder: Ms Anne Marie Ryan Sponsor: Ladbrokes, The Air Ambulance Service (Warwickshire & Northamptonshire) TIMEFORMVIEWLooked a bit quirky in a bumper on debut but made a positive impression when runner-up on his first go over hurdles atWarwick. Unsuited bythedropintripwhenfillingsamespotatAintreesincebutremainscapableofbetter,especiallynowbackonsofterground. StarRatingHHHHH BHA119 7 GETABEAU (IRE) (31) 5205 5 11-2 B g Getaway (GER) - Presentinggoeswell (IRE)
Quinlan Owner: Mr G. F. White
Chris
John Hutch TIMEFORM VIEW Fair form in bumpers but has been in need of experience so far over hurdles. Unlikely to feature. Star RatingHHIII BHA20
TIMEFORM
beaten in bumpers
unseated in a novice over C&D on hurdling debut. Star RatingHIIII BHA5 EDDIE MUSH (IRE) (30) 000 5 11-2 Br g Sageburg (IRE) - So Proper (IRE) Jockey: Ross Chapman Owner: Beechfield Trainer: Sue Smith, Bingley Breeder: Clem & Greg Rossiter Sponsor: Tuffa Footwear Ltd TIMEFORM
hurdles. Others
more persuasive. Star RatingHHIII BHA
Jockey: Sean
Trainer:
Grant, Billingham Breeder:
RACE DESCRIPTION As the title suggests, novice races tend to be for younger horses that are still learning their way over hurdles or fences, allowing the inexperienced horses to race against each other before graduating to the ranks of the more established horses. This race differs slightly from a standard novice event in that it is restricted to horses that have been specifically bred for National Hunt racing and therefore horses that have previously run on the Flat are barred from taking part. This two miles hurdle race is for four-year-olds and upwards which have not won more than three hurdle races.
Leading course trainer (17-22): D Skelton (48 wins from 174 runners, 28%) runs ETALON Trainer-in-form (last 14 days): D Skelton (7 wins from 17 runners, 41%) runs ETALON Longest Traveller: COULDNTGIVAMONKEYS trained by R M Smith, Galston, 205 miles.
8 HAUT BERRY (FR) (30) 300-50 6 11-2
Bl g My Risk (FR) - Bonjour Madame (FR)
Jockey: John Kington
Owner: Mr Richard Berry Trainer: Andrew Crook, Leyburn Breeder: Mrs M. Chachignon & Haras De Saint Voir Sponsor: Tote TIMEFORM VIEW Looks limited on early evidence. Star RatingHIIII BHA9 HUNGRY
HILL
(IRE) (53) 4-06 6
B g Fame And Glory - Echo Queen (IRE)
Jockey: Nick Scholfield
11-2
Owner: Martin Tedham & Wasdell Properties Ltd. Trainer: Jonjo O’Neill, Cheltenham Breeder: William P. Delaney Sponsor: Wasdell Group TIMEFORM VIEW Showed ability in bumpers but has shaped as if in need of further on both hurdling outings to date. Likely to be of more interest once qualified for handicaps. Star RatingHHIII BHA10 LETMETELLUSOMETHIN (GB) (65) 03 5
11-2
Jockey: Jonjo O’Neill Jr Owner: Letmetellusomethin Partnership Trainer: Jonjo O’Neill, Cheltenham Breeder: RBR Bloodstock & Little Lodge Farm Sponsor: Wasdell Group TIMEFORM VIEW Bred to need
B g Shirocco (GER) - Early Dawne
Jockey: Brian Hughes Owner: Mr T. G. Leslie Trainer: Donald McCain, Cholmondeley Breeder: Fergal Loman & Joseph Duncan Sponsor: Proactive Personnel Limited
O’Brien
Signy,
21
Likely to have an educational start to hurdling after a couple of months off
time and distance and has only shown modest form in bumpers.
Star RatingHHIII BHA11 PRESENT FAIR (IRE) (29) 4121-04 6 11-2 B g Presenting - Premier Victory (IRE)
TIMEFORM VIEW Dropped away in a Punchestown bumper on Rules debut back in March 2021 and,
scored twice in points after, his hurdling efforts since his return have lacked encouragement. Star RatingHIIII BHA12 PRINCE NINO (FR) (19) 0/-P0 6
Ch g It’s Gino (GER) - Down On My Knees (FR)
Midwicket Cowboys
Lapios Baudry &
TIMEFORMVIEWWellheldinKemptonbumperononlyoutingforPaulNichollsalmost2yearsagoandnoimpactsofarfor current stable over hurdles. Star Rating
B g Walk In The
TIMEFORM VIEW €90,000 3-y-o, third foal, dam unraced sister to useful
Interesting
particularly if the market speaks
while he
11-2
Jockey: Paul O’Brien Owner:
Trainer: Harry Derham, Upper Lambourn Breeder: Marie
Sophie Lapios Sponsor: All Sport Insurance Services Ltd
HIIII BHA13 RANGING BEAR (IRE) (-) 5 11-2
Park (IRE) - Eireann Rose (IRE) Jockey: Aidan Coleman Owner: Mr John P. McManus Trainer: Olly Murphy Wilmcote Breeder: Mr K. D. Cotter
hurdler/smart chaser (stayed 21f) Emily Gray.
newcomer,
in his favour Star RatingHHHHI BHA14 SEA VILLAGE (IRE) (19) 6-00 5 11-2 B g Affinisea (IRE) - Etoile Margot (FR)
15 EMILY WADE (IRE) (12) 444U60 6 10-9 Ch m Lucky Speed (IRE) - Bealath Champ (IRE)
Jonathan England Owner: Mr Stephen Smith
Sam England, Guiseley Breeder: Sunnyhill Stud & Kiernan Leavy
Rsh Bradford Ltd TIMEFORM VIEW Just modest form at best in bumpers (for Tjade Collier) and well held completed starts over hurdles. Star RatingHIIII BHA16 MISS LAMB (GB) (355) 1/123/3- CD 7 10-9 B m Passing Glance - Lucinda Lamb Jockey: Conor O’Farrell Owner: Miss S. E. Hall Trainer: Jedd O’Keeffe, Leyburn Breeder: Miss S. E. Hall Sponsor: Jedd O’Keeffe Racing TIMEFORM VIEW Useful bumper performer (dual winner) who was all the rage in betting but blew her chance with bad mistake 2 out when thirdon hurdlesbowatWetherby(2m) 11monthsago Typetoimprove,possiblysignificantlyon theback ofthat. Star RatingHHHHI BHA17 WELLFLEET WITCH (GB) (31) 3-0 7 10-9 B m Black Sam Bellamy (IRE) - Indeed To Goodness (IRE) Jockey: Sean Bowen Owner: Mr Chris McSharry Trainer: Fionn McSharry, Sheriff Hutton Breeder: Vici and Richard Morse TIMEFORM VIEW Showed something to work on when third in a bumper at Wetherby on debut but down the field at Newcastle 11 months later Unlikely to feature on hurdling debut. Star RatingHIIII BHADECLARED RUNNERS 17 2022: LIMETREE BOY (IRE) 6 11 2 Jonjo O’Neill Jr 11-4 (Jonjo O’Neill) 11 ran Hood worn by No 8, 15 Tongue Strap worn by No 12. Sheepskin Cheek Pieces worn by No 12. Running for the first time since Gelding No 13 Stewards Note: EMILY WADE: Following its run on 14/1/2023 it was reported that the horse was free early Fift h Race
Jockey: Tom
Owner: Mick Fitzgerald Racing Club Trainer: Oliver
Lambourn Breeder: Godfrey Moylan Sponsor: Oliver Signy Racing Llp TIMEFORM VIEW Twice raced in bumpers, much better effort when seventh of 14 at Exeter (50/1). No impact in a novice at Wincanton on hurdling debut recently, though. Star RatingHIIII BHA
Jockey:
Trainer:
Sponsor:
22
PLAY SMARTER ETALON has the best form and remains with potential, so he’s marginally preferred to Miss Lamb, who won twice in bumpers and showed aptitude for hurdling when third over C&D 11 months ago They’re likely to dominate unless well-bred newcomer Ranging Bear proves to be above average. TIMEFORM PREDICTION: 1.ETALON (IRE) 2.MISS LAMB 3.RANGING BEAR (IRE) THE RESULT 1st.............................................................. 2nd Distance 3rd 4th Time THANK YOU COURSE VEHICLES FOR USE BY WETHERBY RACECOURSE ARE GENEROUSLY PROVIDED BY BRISTOL STREET MOTORS St. James Retail Park, Grimbald Crag Road, Knaresborough, HG5 8PY Tel: 0330 0960 848 www.bristolstreet.co.uk/vauxhall HORSE WELFARE Here at Wetherby Racecourse we are committed to minimising risks, dealing quickly and humanely with injuries, and maintaining the highest possible quality of life for the animals in our care. At every meeting we have three specially qualified Equine Vets appointed to look after the welfare of all horses in action. There is also a British Horseracing Authority Veterinary Officer in attendance. During the race three vets follow the action from the centre of the course and can attend to a horse in the same response time as the Paramedic Teams responsible for treating the injured jockeys. It is standard policy that in the event of a horse requiring veterinary treatment whilst on site, screens will be erected round the horse. It is designed to afford the vet and the patient some privacy. Please do not assume the worst. GREAT BRITISH BONUS SCHEME The Great British Bonus (GBB) offers multiple bonuses of up to £20,000 per eligible race for British-bread fillies and mares. CASH MACHINE Cash Machines are located within the Bramham Halland Millennium Stand – Level 2. £ Wetherby
will present a cash prize of £50 to the stablehand responsible for the Best Turned Out Horse in this race. They will also present a memento to the winning owner.
Probable S.P’s: 9-4 Etalon (IRE), 11-4 Miss Lamb (GB), 4-1 Ranging Bear (IRE), 22-1 Boomslang (GB), 25-1 Big Ambitions (IRE), Letmetellusomethin (GB), 50-1 Eddie Mush (IRE), Getabeau (IRE), Hungry Hill (IRE), Present Fair (IRE), 150-1 Prince Nino (FR), Sea Village (IRE), Emily Wade (IRE), Wellfleet Witch (GB), 250-1 Couldntgivamonkeys (IRE), Dee Day Landing (GB), Haut Berry (FR)
Racecourse
| FACTS | FANCIES | FORM | STATS | FORM ANALYSIS - A CLOSER LOOK SIXTH RACE 3.40 2m 3f 85y THE wetherbyracing.co.uk MARES’ HANDICAP STEEPLE CHASE (CLASS 4) (Challenger Mares’ Chase Series Qualifier) for five yrs old and upwards mares x Total prize fund £9150 Owners Prize Money Winner £3696; Second £1847; Third £924; Fourth £462; Fifth £231. (Penalty Value £4832.11) colours no horse form age st-lb 1 SWINCOMBE FLEAT (GB) (51) 1454-1P D BF 7 12-2 B m Yeats (IRE) - Swincombe Flame Jockey: Aidan Coleman Owner: Yeo Racing Partnership Trainer: Anthony Honeyball, Beaminster Breeder: M. C. and Mrs Yeo Sponsor: Geegeez.co.uk TIMEFORM VIEW Promising individual who found improvement when making a winning chase debut in 3-runner handicap at Warwick (20f, soft) in NovemberbutfoldedasifamissatFontwell(26f)nexttime.Returnstoshortertripnowandcheekpiecesappliedforfirsttime.StarRatingHHHIIBHA117 2 MIDNIGHT MARY (GB) (37) 14113-2 7 11-6 B m Midnight Legend -
Owner: Mr S A Richards and
Mr S. A. Richards &
LLP TIMEFORM VIEW Three-time winner at around 3m over hurdles last season for Stuart Edmunds and better than ever in first-time cheekpieces on seasonal/yarddebutwhenrunner-upatPlumpton(20.5f)lastmonth.Shouldgowellagainonfirststartoverfences.
3 STANLEY
TIMEFORMVIEWWasgoingtherightwayinhandicaphurdlesforPaulNichollswhenlastseen,openingaccountatNewtonAbbot(21.5f)inJuly2021andfollowingupat thesameC&Dlaterinthemonth.Goeschasingfornewyardandmustbetakenseriously,particularlyifthemarketspeaksinherfavour. StarRatingHHHHI BHA105 4 LA RENOMMEE (FR) (37) 6322-46 5 11-3 B m Doctor Dino (FR) - Grande Cavale (FR)
Charlie Hammond Owner: Mrs L. J. Newland
Dr Richard Newland, Droitwich Breeder: S.C.E.A. de Maulepaire
Coulthursts Ltd TIMEFORM VIEW Yet to score for current yard and went backwards from her reappearance effort at Plumpton 37 days ago Makes chase debut. Star RatingHHIII BHA 110 5 RING PRETENDER (FR) (29) 44-40 7 10-9 B m Great Pretender (IRE) - Ring Blood (FR) Jockey: Sam Coltherd Owner: The Vacuum Pouch Company Limited Trainer: Stuart Coltherd, Selkirk Breeder: Dr V. Gerard Samain Sponsor: Bell Rural Solutions TIMEFORMVIEWGreat Pretender mare who showed ability in brace of novice hurdles 8 months apart but failed to make an impact making handicap chasedebutatCatterick(15.6f)lastmonth,struggling4outandneverathreat.Needstostepuptofigure. Star RatingHHIII BHA96 6 LINCOLN LYN (GB) (25) 2P3-141 7 10-8 B m Universal (IRE) - Altesse de Sou (FR) Jockey: Lee Edwards Owner: Team Burton, Ray and Warburton Trainer: Tom Gretton, Inkberrow Breeder: Yorton Farm Stud Sponsor: Jmc Surfacing Contractors, Treehouse Sporting Colours TIMEFORM VIEW Off the mark over hurdles at Southwell in May and shaped encouragingly, on second start over fences, when fourth at same course in November. ConfirmedthatpromisewhenscoringatFakenham(21.2f,goodtosoft)earlierthismonthandshouldhavemoretoofferinthissphere. StarRatingHHHHH BHA95 DECLARED RUNNERS 6 2022: MAID O’MALLEY 9 11 5 Sam Coltherd 11-2 (Stuart Coltherd) 7 ran Sheepskin Cheek Pieces worn first time by No 1. Tongue Strap worn by No 6. Sheepskin Cheek Pieces worn by No 2. Stewards Note: SWINCOMBE FLEAT: Following its run on 6/12/2022 it was reported that the trainer could not explain the poor run. 24 RACE DESCRIPTION This is a two miles and three and a quarter furlongs handicap steeple chase for five-year-olds and upwards mares which have been rated from 0 to 115. Once a horse has qualified for a handicap rating this is regularly reassessed. A below-par effort could result in a reduced rating whilst a strong performance could see the rating increased. Occasionally, horses are entered to race before their handicap rating has been reviewed and so to avoid recent winners being un-penalised they are allotted a mandatory penalty – usually 7lb
Trainer-in-form
Epee Celeste (FR) Jockey: Bryony Frost
Louise Kemble Trainer: Lucy Wadham, Newmarket Breeder:
Mrs L. Kemble Sponsor: Weatherbys Hamilton
Star RatingHHHII BHA107
STANLEY (GB) (549) 45/0211- 6 11-4 B m Camelot - Seaham Hall Jockey: Charlie Deutsch Owner: Ms Sharon Kinsella Trainer: Venetia Williams, Hereford Breeder: Seasons Holidays PLC Sponsor: Faucets Limited
Jockey:
Trainer:
Sponsor:
Leading course trainer (17-22): Dr R Newland (8 wins from 33 runners, 24%) runs LA RENOMMEE
(last 14 days): L Wadham (2 wins from 8 runners, 25%) runs MIDNIGHT MARY Longest Traveller: SWINCOMBE FLEAT trained by A Honeyball, Beaminster, 268 miles.
Condolences to the family & friends of John Parker, who passed away recently after a short illness. John had been a fence attendant at Wetherby for many years and will be sadly missed by his colleagues.
25
Preference is for
who
account over fences
and remains fairly treated. Stanley Stanley is feared most, sent chasing
TIMEFORM PREDICTION: 1.LINCOLN LYN 2.STANLEY STANLEY 3.MIDNIGHT MARY THE RESULT 1st.............................................................. 2nd Distance 3rd 4th Time Sixt
leave a review TRIPADVISOR.CO.UK
Probable S.P’s: 9-4 Lincoln Lyn (GB), 7-2 Midnight Mary (GB), 4-1 Swincombe Fleat (GB), 6-1 Stanley Stanley (GB), 12-1 Ring Pretender (FR), 14-1 La Renommee (FR) PLAY SMARTER
LINCOLN LYN,
opened her
at Fakenham earlier this month
on her debut for Venetia Williams.
h Race
Wetherby Racecourse will present a cash prize of £50 to the stablehand responsible for the Best Turned Out Horse in this race.
They will
also present a memento to the winning owner.
| FACTS | FANCIES | FORM | STATS | FORM ANALYSIS - A CLOSER LOOK SEVENTH RACE 4.15 3m 26y THE START YOUR RACINGTV FREE TRIAL NOW NOVICES’ HANDICAP HURDLE RACE (CLASS 5) for novice four yrs old and upwards x Total prize fund £6650 Owners Prize Money Winner £2686; Second £1343; Third £672; Fourth £336; Fifth £168. (Penalty Value £3511.86) colours no horse form age st-lb 1 THE GOONER (IRE) (19) 1-33 D 5 12-0 B g Flemensfirth (USA) - Rose of Milana (IRE) Jockey: Jonjo O’Neill Jr Owner: Mrs Gay Smith & Mr Paul Smith Trainer: Jonjo O’Neill, Cheltenham Breeder: Brucetown Farms Ltd Sponsor: Wasdell Group TIMEFORMVIEWIrishpointwinnerwhohaslookedshortofpaceinacoupleofnovicehurdlesbutwillbesuitedby3mand is a potential improver now making a quick switch to handicaps. Star RatingHHHHI BHA 100 2 JET LEGS (IRE) (24) 62-4653 BF 6 11-13 B g Jet Away - Supreme Magical Jockey: Sean Quinlan Owner: Mrs Suzy Brown & Mr Peter R Brown Trainer: Martin Todhunter, Penrith Breeder: Michael McCullagh Sponsor: Weatherbys Racing Bank TIMEFORMVIEWHasyettobuild onhisearlierpromiseinnovicehurdlesbutwasn’tseentoanythinglikebesteffectwhen thirdatAyr (20.4f) last time, hampered home turn/stumbling approaching 3 out. Interesting now upped to 3m. Star RatingHHHHH BHA 99 3 IMPERIAL HURRICANE (GB) (56) 5644-5 6 11-11 B g Black Sam Bellamy (IRE) - Silverlined Jockey: David Bass Owner: Imperial Racing & Mr John Blackburn Trainer: Kim Bailey, Cheltenham Breeder: Mrs A. M. Varmen Sponsor: Sheridan Ny Llp TIMEFORMVIEWShapedlikeastayerinmaiden/novicehurdlesbutfailedtoimprovesenthandicappingupintripatMarketRasen(23.1f)56daysago, goinginsnatches.Stillearlydaysandshouldstilldobetteratsomepoint.Cheekpiecesonfor1sttime. Star RatingHHHII BHA97 4 THE IMPOSTER (FR) (16) 5-31112 CD BF 6 11-9 B g Authorized (IRE) - Miss Dixie Jockey: Tom Buckley (3) Owner: Mark Philips and J H Gumbley Trainer: Nigel Hawke, Tiverton Breeder: Mr Recep Demirsoy & Le Thenney Sponsor: Junction 24 Ltd TIMEFORMVIEWThrivingthisseason,completingahat-trickoverC&DinDecemberandfoundonlyanunexposedonetoo strong at Exeter (21.6f) last time. Can give another good account back up in trip Star RatingHHHHI BHA 95 5 BLENDED STEALTH (GB) (29) 30-2P24 6 11-7 B g Walk In The Park (IRE) - Wyldello Jockey: Sam Twiston-Davies Owner: Graham and Alison Jelley Trainer: Nigel Twiston-Davies, Cheltenham Breeder: R. D and Mrs J. S. Chugg Sponsor: Jelson Ltd TIMEFORM VIEW Maiden who ran well when second in 6-runner handicap at Leicester in December (15.5f, soft), coming clear of the remainder Wasn’t in the same form back up in trip there 3 weeks later, though. Cheekpieces back on. Star RatingHHHII BHA 93 6 DEV OF TARA (IRE) (90) 0P006-0 7 11-5 Br g Kayf Tara - Sinnaja Jockey: Non Runner Owner: Touchwood Racing Trainer: Olly Murphy, Wilmcote Breeder: Cathal Ennis Sponsor: McCoy Contractors TIMEFORM VIEW NON RUNNER. Star RatingIIIII BHA 91 7 GET GOING (GB) (31) 64P-00 6 10-12 B g Getaway (GER) - Bright Cloud (IRE) Jockey: Tom Midgley (5) Owner: Mrs M. Cooper Trainer: Mark Walford, Sheriff Hutton Breeder: Mrs M. Cooper Sponsor: Cube3 Construction TIMEFORMVIEWPoorformonlystartinbumpersandhasyettomakeanimpactoverhurdles,includingonhandicapdebut last time. First-time cheekpieces need to bring about improvement. Star RatingHHIII BHA 84 26 NON-RUNNER RACE DESCRIPTION This three miles handicap hurdle race has been designed for novice four-year-olds and upwards which are rated from 0 to 100. In most National Hunt handicaps, there is a minimum weight of 10st so any horse whose official rating would allocate them less than that still has to shoulder that burden. The horses that fall into this category are said to be racing from ‘out of the handicap – usually a distinct disadvantage. Leading course trainer (17-22): Mrs P Kirby (20 wins from 159 runners, 13%) runs MY STRONG MAN Trainer-in-form (last 14 days): Mrs P Kirby (2 wins from 18 runners, 11%) runs MY STRONG MAN Longest Traveller: THE IMPOSTER trained by N Hawke, Tiverton, 273 miles.
27 8 TOP
6
TIMEFORM VIEW Successful in a point bumper and produced a promising first effort under Rules when third
a
bumper Just poor form in 3 novice hurdles, though, and needs to brush up his jumping now handicapping. Star Rating
82
TIMEFORM VIEW Has made an encouraging return after 22 months off with second placings in 2m4f handicaps at Carlisle and Kelso this winter Brought down fifth at Newcastle latest. Should make presence felt if seeing out this longer trip Star Rating
82 10 WOTSMYNAME
TIMEFORM VIEW
no sort of
TIMEFORM VIEW
who produced one
cheekpieces when third
hurdle at Ayr
17 days ago, staying on. This looks a deeper
12 TELEFINA
5
CLOUD (GB) (31) 213-666
10-10 Gr g Cloudings (IRE) - Too Generous Jockey: Brian Hughes Owner: Exors of the late Mr Trevor Hemmings Trainer: Chris Grant, Billingham Breeder: Wood Farm Stud Sponsor: Trust Inns Limited
in
Hexham
HHHII BHA
9 ROCKMANN (FR) (31) 060/-22B BF 8 10-10 B g Kap Rock (FR) - All Berry (FR) Jockey: Jamie Hamilton Owner: Mr C. N. Herman Trainer: Mark Walford, Sheriff Hutton Breeder: S.C.E.A. de Maulde Sponsor: Mark Walford Racing
HHHII BHA
(IRE) (17) 654-500 6 10-10 Ch g Famous Name - Nadeems Stella (IRE) Jockey: Derek Fox Owner: Mr A Kerr Mr L Kerr Trainer: Leonard Kerr Irvine Breeder: O’Neill Family
Maiden who ran
race at Ayr (21.4f, heavy) 17 days ago. Plenty to prove at present. Star RatingHHIII BHA 82 11 MOONACURA (IRE) (17) 0P30-03 6 10-9 B g Fame And Glory - Monks Charm (IRE) Jockey: Sam Coltherd Owner: Flannigan Newitt French Valender Herriot Trainer: Stuart Coltherd, Selkirk Breeder: Liam Norris Sponsor: Bell Rural Solutions
Maiden
of his better efforts in first-time
of 9 in handicap
(21.4f, heavy)
race, however. Star RatingHHHII BHA 81
(GB) (36) 4-0P253
10-8 B m Telescope (IRE) - Haatefina
TIMEFORM VIEW Poor maiden who ran well
good to
36 days ago, though typically made
13 MY STRONG MAN (IRE) (25) 4
F/-362 BF 7 10-6
Jockey: Lee Edwards Owner: Silver Lining Racing Trainer: Adam West, Epsom Breeder: Francis, Mc Geoch & Jackson
from 7lb out of the handicap when third of 11 in handicap hurdle at Taunton (23.9f,
soft)
hard work of it. Star RatingHHHII BHA 80
0
B g Authorized (IRE) - Lady Chloe
TIMEFORM VIEW Turned
25 days ago, sticking to task. Cheekpieces on for 1st time. Respected up
Star
14 STORM FORCE ONE (GB) (14) 33-02PF 7 10-6 B
- Force
TIMEFORM VIEW Remains a maiden after 21 NH runs and took a heavy fall
first
just
Star Rating
78 15 TOMMY’S FORTUNE (IRE) (30) 45060P 5 10-6 Br g Soldier of
-
Owner: T C Racing Syndicate
TIMEFORM VIEW Modest in bumpers and remains with no form over hurdles, struggling when pulled up after seventh in C&D handicap won by The Imposter last time. Cheekpieces now tried. Star RatingHHIII BHA 78 16 ELUSIVE RED (IRE) (462) P/3652F- 9 10-2 B g Elusive Pimpernel (USA) - Spin In The Wind (IRE) Jockey: Lorcan Murtagh (3) Owner: Hurst Farm Racing Trainer: Barry Murtagh, Carlisle Breeder: Virginia Lady Petersham TIMEFORM VIEW Was in the process of running creditably when falling 2 out in Carlisle handicap hurdle (20f) in October 2021. Not seen since. Star RatingHHIII BHA 73 DECLARED RUNNERS 16 2022: MALINAS ISLAND 7 11 1 Kevin Brogan 5-2 (Neil Mulholland) 18 ran Tongue Strap worn first time by No 6. Sheepskin Cheek Pieces worn first time by No 3, 6, 7, 8, 13, 15 Visor, Tongue Strap worn by No 4. Sheepskin Cheek Pieces worn by No 5, 11, 14, 16 Stewards Note: JET LEGS: Following its run on 2/1/2023 it was reported that the horse waas hampered by a faller late-on. TOMMY’S FORTUNE: Following its run on 27/12/2022 it was reported that the horse was never travelling. Probable S.P’s: 11-2 The Imposter (FR), 13-2 The Gooner (IRE), 15-2 Rockmann (FR), 10-1 Jet Legs (IRE), Moonacura (IRE), 12-1 My Strong Man (IRE), 14-1 Blended Stealth (GB), Telefina (GB), 16-1 Imperial Hurricane (GB), 18-1 Top Cloud (GB), 22-1 Elusive Red (IRE), 28-1 Storm Force One (GB), 50-1 Wotsmyname (IRE), 66-1 Get Going (GB), 80-1 Tommy’s Fortune (IRE) Se ve nt h Race
Jockey: Joe Williamson (5) Owner: The Platinum Partnership Trainer: Philip Kirby Richmond Breeder: Philip Kirby Sponsor: Topspec Equine Ltd, Philip Kirby Racing
in his best effort of the season when second of 12 in handicap hurdle at Catterick (25.3f, soft)
3lb
RatingHHHII BHA 78
m Schiaparelli (GER)
In The Wings (IRE) Jockey: Danny McMenamin Owner: Hedley, Little & Tomkins Trainer: Peter Niven, Malton Breeder: T. M. Hayes Sponsor: P D Niven Racing Ltd
at the
at Catterick
2 weeks ago
HHIII BHA
Fortune (IRE)
Jessies Delight Jockey: Ross Chapman
Trainer: Tjade Collier, Wilsden Breeder: Tomas Wafer
28 PLAY SMARTER JET LEGS has yet to build on his initial promise, but he wasn’t seen to anything like best effect at Ayr last time and is taken to strike with the longer trip promising to suit. The Gooner could prove a different proposition now venturing into handicaps up in trip, while The Imposter has been thriving of late and can give another good account. TIMEFORM PREDICTION: 1.JET LEGS (IRE) 2.THE GOONER (IRE) 3.THE IMPOSTER (FR) THE RESULT 1st.............................................................. 2nd Distance 3rd 4th Time Official fuel consumption figures in mpg (l/100km): All-new Astra range combined 52-67mpg. Official CO2 emissions 114-124g/km. The mpg figures quoted are sourced from official EU-regulated test results (EU Directive and Regulation 692/2008), are provided for comparability purposes and may not reflect your actual driving experience. Bristol Street Motors Vauxhall is a trading name of Vertu Motors (VMC) Limited which is authorised and regulated by the Financial Conduct Authority (Company registration number 00694464). VAT Registration number 902737238 Registered office: Vertu House, Fifth Avenue Business Park, Team Valley, Gateshead, NE11 0XA. ALL-NEW ASTRA. THE FUTURE OF DRIVING Petrol. Diesel. Hybrid SALES SERVICE. MOTABILITY. PARTS Bristol Street Motors Vauxhall Knaresborough St. James Retail Park, Grimbald Crag Rd, Knaresborough HG5 8PY 0330 0960 848 | bristolstreet.co.uk EMERGENCY PROCEDURES SAFETY & SECURITY - KNOW THE RACEDAY/EVENT PLAN ACTIONS TO KEEP YOU SAFE AND ENHANCE RACECOURSE SECURITY Arrive early and minimise what you carry which will speed up entry if bag searches are in operation. BE VIGILANT: If you see anything suspicious inform a racecourse member of staff immediately. If you see anything that could pose an immediate threat to safety, dial 999. In an emergency: if INSIDE a stand, follow the instructions of the public address system or staff. If OUTSIDE, our advice is RUN, HIDE & TELL. If told to evacuate do not wait around to film on your mobile. Follow instructions provided to help ensure your safety. Once away and safe, for advice and incident updates follow the local Police Force on Twitter. For additional information, check the racecourse website and social media. STAY ALERT - STAY SAFE Thank You for Your Co-Operation
will
Wetherby Racecourse will present a cash prize of
£50
to the stablehand responsible for the Best Turned Out Horse in this race. They
also present
a
memento to the winning owner.
01937 582035 www.wetherbyracing.co.uk SAT NAV: LS22 5EJ • Competitive Day Delegate rates • Ideal location for the A1M with close links to the M1 and M62 • Acres of FREE on-site parking • Unique location set in magnificent countryside • Conference suites to seat 30–500 delegates • Banqueting suites to seat 70–340 guests • Outside areas for team-building events • Professional event management service • High quality catering
Booketh your tickets now! Medieval Day Featuring the William Hill Towton Novices' Chase Saturday 4th February 2023 Exciting Jump Racing. Medieval Living History Encampment & Weapon Displays. Birds of Prey. Join us in 1461 Country, the era of the orginal Battle of Towton! wetherbyracing.co.uk