It was with deep sorrow that we learnt of the death of Her Majesty Queen Elizabeth II. On behalf of everyone at The Jockey Club and Newmarket Racecourse, we send our deepest sympathies and heartfelt condolences to the entire Royal Family for their loss.
HER MAJESTY QUEEN ELIZABETH II 1926 2022 SATURDAY 17 SEPTEMBER
TURNERS turners-distribution.com EBF STALLIONS ebfstallions.com
Michael Prosser (DSL)
Benoit Herinckx
Darren Townsend Farrier
Harry Buckle Safety Officer
Adam Barker (Stewards’ Panel Chair)
Amy Starkey General Manager
Kieran O’Shea
Tom Eaton-Evans
Judge
Stuart Williamson
Ben Ford
Louise Sheridan Elizabeth Budden
Tony McGlone (Chief Steward)
Stewards
Paddy Pritchard-Gordon Managing Director East
Michael Prosser Marketing Manager
Starters
Gordan Markham
Race Conditions can be found on
William Sporborg, Esq
Chris Burton Finance Director
David Hicks
Dr Piers Reinhold
Veterinary Officer
Sarah Drabwell Head Of Operations
Mrs J. George
Jeremy Allen
Julie Lingham
Clerk Of The Scales
Sophie Able (Deputy DSL)
William Jardine
Matthew Lohn Esq.
Dr Juno Jesuthasan
Tim Vestey, Esq.
Polly Greco
William Wyatt, Esq. (Chairman)
Stewart Machin
Equine Welfare & Integrity Officers
Betting Ring Manager
John Bramhill
page 31
Mrs. B. Dunlop
Sarah Woodborne
Jeremy Lind Medical Officers
Sophie Able Regional Head Of Racing & Clerk of the Course
Published by authority of the Managing Executive of the Racecourse. TODAY’S SPONSORS
Dr Ross Worthington
RACEDAY OFFICIALS
Newmarket Racecourses Committee
Colin Roberts Veterinary Surgeons
Clayton White Safeguarding Officers
Commentator
HM QUEEN ELIZABETH II
Horses and in particular, racehorses were her passion, ranking closely behind “country, Commonwealth and family,” as Brough Scott put it in a programme about her wide-ranging equine interests. Within the racing and bloodstock worlds she was greatly respected as an instinctive horsewoman with a superb depth of knowledge of all aspects of the industry, and through the obvious delight she took in victories on the track, the wider public glimpsed what Sir Peter O’Sullevan called “the very human being” her racing friends knew her to be
The first of The Queen’s five British Classic winners arrived in 1957, when the Noel Murless-trained Carrozza, whom she had leased from The National Stud, took the Oaks by a short-head under Lester Piggott. A year later her home-bred Pall Mall, trained by Cecil Boyd-Rochfort and ridden by Doug Smith, won the 2000 Guineas.
While the Royal colours were carried to victory by plenty of good horses in the 1960s, including the 1961 Coronation Stakes winner Aiming High and Hopeful Venture, who took the 1968 Grand Prix de Saint-Cloud, it wasn’t until 1974 that The Queen enjoyed further Classic triumph with Highclere like Aureole, a descendant of the outstanding broodmare Feola, bought and raced by George V. Highclere, trained by Major Dick Hern and ridden by Joe Mercer, won the 1000 Guineas by a short-head from Polygamy, and then the Prix de Diane the French Oaks by two lengths.
In 1977, the year of her silver jubilee, Major Hern handled a second Classic winner for The Queen when Dunfermline scored in The Oaks, staying on strongly to win by three-quarters of a length under Willie Carson, who later that season rode her to beat Alleged and Lester Piggott in the St Leger. She was the champion three-year-old filly in Europe that year
Racing and royalty have been intertwined throughout the sport’s history, but never as closely and as intimately as during the lifetime of Queen Elizabeth II. Only her great grandfather, Edward VII, comes close to matching her level of enthusiasm.
On becoming Queen in 1952, she inherited the Royal Studs and her father’s bloodstock interests, but she had already tasted success as an owner she had her first runner when she was 23 in October 1949, when Astrakhan, given to her as a foal as a wedding present by the Aga Khan, finished second at Ascot. In April the following year the filly became the then Princess Elizabeth’s first winner, at Hurst Park, and the only one to carry her own registered silks of scarlet, purple hooped sleeves and black cap, rather than the royal colours. The Queen enjoyed over 500 winners as an owner
As Queen, significant success on the racecourse came quickly; King George VI had bred a colt called Aureole, runner-up in the Derby in her coronation year of 1953, and the following year winner of Ascot’s King George VI and Queen Elizabeth Stakes named after her parents and the Coronation Cup at Epsom. The Queen was champion owner in 1953 and again in 1957 and, after being sent to stud at Wolferton, Aureole was leading sire in 1960 and 1961.
1926-2022
Although The Queen enjoyed many more successes in major races, including 23 Royal Ascot winners headed by Estimate in the 2013 Gold Cup, of whom there is a huge sculpture at Sandringham House the Derby continued to elude her In 2011 all the pre-race publicity surrounded the Sir Michael Stoute-trained Carlton House, given to her by the ruler of Dubai, Sheikh Mohammed. The colt was sent off the 5/2 favourite for the world’s most famous Flat race under Ryan Moore but could only finish third.
She took great joy in spending time with her horses, at the Royal Studs and at their training yards, to which she was a relaxed and frequent visitor Her horses are foaled at Sandringham, and go as yearlings to Polhampton Stud near Newbury before joining one of her trainers, who recently included Sir Michael Stoute, John & Thady Gosden, Richard Hannon, Andrew Balding, Michael Bell, Harry & Roger Charlton, William Haggas, Clive Cox, Nicky Henderson, Jamie Snowden and Gai Waterhouse in Australia.
The Queen’s involvement in the horse world stretched far beyond racing. As well as thoroughbreds, she bred Highland ponies, Cleveland Bays, polo ponies and sports horses including Doublet, who carried her daughter Princess Anne to victory in the 1971 European Eventing Championships.
Flat racing and breeding was The Queen’s love, but she appreciated Jump racing as well. She and her mother Queen Elizabeth shared the ownership of Monaveen, who gave her a first winner over fences at Fontwell in October 1949, and she inherited her mother’s jumps horses on the Queen Mother’s death in 2001. She continued to own a handful of horses under that code, and scored a first winner at Cheltenham with the Nicky Henderson-trained Sunshade in April 2019
Undoubtedly a source of great pleasure to The Queen and her primary leisure activity, her racing and breeding operation was, however, also a commercial one, and in 1982 the top-class filly Height Of Fashion a daughter of Highclere was sold to Sheikh Hamdan bin Rashid al Maktoum for £1.2million and went on to produce the 1989 2000 Guineas, Derby and Coral-Eclipse winner, Nashwan and four-time G1 scorer Nayef.
John Warren was her bloodstock and racing advisor from 2001, when he took over from his father-in-law, The Queen’s childhood friend Lord Carnarvon, who had held the reins since 1969.
She was a patron of both The Jockey Club and the Thoroughbred Breeders’ Association. The Queen also received two of the most prestigious awards in racing, taking the Cartier Millennium Award of Merit in 2000, and the Sir Peter O’Sullevan Charitable Trust Award in 2002.
6 7 8 9 10 17 THE ROWLEY MILE COURSE MAP FOOD & DRINK OUTLETS Toilets BabyChanging DisabledToilets InformationPoint DisabledViewing WilliamHillBettingShop EmergencyPedestrianGates 1 TheBoulevardFoodCourt Grandstand&Paddock 2 FrankelLounge Grandstand&Paddock 3 MillenniumGrandstand •GroundFloor AutumnDoubleBar Premier, FredArcherBar,GordonRichardsBar, LesterPiggottBar&DevilsDykeCafe Grandstand&Paddock • Owners&TrainersBar Grandstand&Paddock •SecondFloor TheMillenniumBar Premier SeveralsBar AnnualBadgeHoldersFacility •ThirdFloor ChampionsGalleryRestaurant Premier 4 TheAdnamsCaskBar Premier RACECOURSE FACILITIES
15 12 5 11 13 14 16 18 19 20 21 FACILITIES Premier,G&PandGardenEnclosure TicketCollection BettingRing FirstAidPoint CashMachines 5 PremierEnclosureEntrance 6 Grandstand&PaddockEntrance 7 GardenEnclosureEntrance 8 CenturyStand 9 HyperionLawn 10 NewmarketShuttleBusStop 11 MillenniumGrandstand•ThirdFloor LimekilnsSuite 12 MillenniumGrandstand•FourthFloor PrivateBoxes MillenniumBox&Boxes1-12 13 HeadOnStand•FirstFloor TheGuineasSuite&RoyalBox&LegendsLounge 14 HeadOnStand•SecondFloor PrivateBoxes16 25& ThoroughbredLounge ThoroughbredLoungeBadgeHoldersFacility 15 HongKongSuite AnnualBadgeHoldersFacility 16 ParadeRing&Winners’Enclosure 17 WeighingRoom 18 SaddlingBoxes 19 Pre-ParadeRing 20 OutriderBusService 21RunnersBistro
1. FORM A quick way to see a horse’s past performance. These are its recent finishing positions. Look out for Letters: C = Has won at this course D = Has won over this distance CD = Has won over this distance at this course BF = Was a beaten favourite Select your horse Note their name and saddlecloth number. Choose your bet. ‘To win’ or ‘each-way’ are popular types of bet. ‘To win’ is for your horse to come first. ‘Each-way’ is for your horse to come first or to be placed. It’s two bets, so ‘£2 each-way’ = £4 total bet. RACECARD Decide the amount or stake you are comfortable to bet. Place your bet. There are different places to bet on course; The Tote, racecourse bookmakers, betting shop or online Each option offers a different experience. Collect. Once ‘Weighed-in’ has been announced, present your betting slip and collect any winnings. BETTING Visit www.racingexplained.co.uk for more information 6 7 8 15 9 1 10 11 32 5 134 14 12 EXPERT VIEW How the experts rate the horse’s chances: 2. BHA rating = the higher the number, the better the horse 3. Timeform view and TFR rating 4. HORSE’S TRAINER & THEIR LOCATION Look out for the summary of leading course trainers before each race 5. JOCKEY Listen out for any jockeys who are having a successful day. OTHER USEFUL DETAILS 6. Owner’s colours worn by the Jockey 7. Saddlecloth number 8. Horse’s name 9. Days since the horse last run 10.Horse’s age 11. Jockey’s weight (stone and Ibs) 12. The horse’s breeding father (sire) and mother (dam) 13. Horse’s owner 14. Horse’s breeder 15. Birthplace of horse (outside GB) 16. Draw position of the horse in the starting stalls MORE INFORMATION ON THE FORM - = New racing season / = Missed racing season P = Was pulled-up and didn’t finish the race F = Horse fell U = Rider unseated R = Horse refused to race CO = The horse was forced out of a race by a loose horse B = Horse was brought down S = Horse slipped r = The horse ran around a jump or took the wrong course in a flat race d = Disqualified Bold form figures = performance in all-weather (Flat) or Point-to-Point (Jump) races 16 67 8 15 9 1 12 13 14 10 3 2 11 16 5 4 Br J O T B S 4 COROEBUS (IRE) (203) 121- CD 3 9-0 (1) B c Dubawi (IRE) First Victory (IRE) (Teofilo (IRE)) James Doyle Godolphin Charlie Appleby, Newmarket Godolphin Emirates Fly Better TIMEFORM VIEW Progressive 2-y-o, winning on the July Course on debut and bouncing back from a narrow defeat to Royal Patronage in the Royal Lodge with animpressivevictory inC&DAutumn Stakes in October Stablemate of NativeTrailand just asexciting. TFRHHHHI BHA115
J Jockey T Trainer O Owner B Breeder S Sponsor Br Breeding | FACTS | FANCIES | FORM | STATS FO| RM ANALYSIS - A CLOSER LOOK 10 colours no horse st-lb Draw 1 CHELSEA GREEN (IRE) (28) 61 9-8 (12) Br B f U S Navy Flag (USA) Agapantha (USA) (Dynaformer (USA)) Harry Davies (3) J O Chelsea Thoroughbreds CG Hugo Palmer, Malpas T B Premier Bloodstock Oliver Brown S TIMEFORM VIEW Much improved from debut when dead-heated for first at Sandown 4 weeks ago, clear of third. Respected under a penalty with top apprentice booked. TFRHHHHI BHA 2 ARIKARA (GB) (45) 0 9-2 (9) Br Ch f Showcasing Glade (Bertolini (USA)) Shane Kelly J O Fairlawns Racing Ltd Peter Chapple-Hyam, Newmarket T B Phoenix Thoroughbred Limited Fairlawns Racing Ltd S TIMEFORM VIEW Once-raced maiden. 66/1, last of 14 in maiden at Yarmouth (6f, good to firm) on debut 45 days ago Significantly up in trip. TFRHIIII BHA3 BEAUTIFUL STAR (IRE) (11) 04 9-2 (7) Br B f U S Navy Flag (USA) Lumiere Noire (FR) (Dashing Blade) Dane O’Neill J O Amo Racing Limited Richard Hannon, Marlborough T B W. Maxwell Ervine TIMEFORM VIEW Twice-raced maiden. Better effort when fourth of 12 in novice event at Leicester (7f, good) 11 days ago. TFRHHIII BHA 4 CLIMATE FRIENDLY (GB) (-) 9-2 (5) Br Ch f Frankel Unex Mona Lisa (Shamardal (USA)) Ray Dawson J O The Gredley Family Roger Varian, Newmarket T B Stetchworth & Middle Park Studs Ltd Unex Group S TIMEFORM VIEWFoaledFebruary20 Frankelfilly Half-sisterto3winners,includingsmart2-y-o6fwinnerPrettyPollyannaand2-y-o7fwinnerRoulette.Dam, unraced,fromfamilyofUserFriendly Yard5-30with2-y-onewcomersthisyear EnteredforFillies’Mile Highlyrespectedondebut. TFRHHHHI BHA 5 DOOM (GB) (-) 9-2 (13) Br B f Dubawi (IRE) Dank (Dansili) Cieren Fallon J O Mr James Wigan William Haggas, Newmarket T B James Wigan TIMEFORM VIEW Foaled April 12. Dubawi filly Dam, 1m-1 1/4m (Breeders’ Cup Filly & Mare Turf ) winner, closely related to high-class winner up to 1 1/4m (stayed 1 1/2m) Eagle Mountain. Yard 2-26 with 2-y-o newcomers this year. Entered for Rockfel. TFRHHHHI BHA6 FORTIS REGINA (GB) (22) 3 9-2 (11) Br B f Ardad (IRE) Regina Cordium (IRE) (Raven’s Pass (USA)) Robert Havlin J O Ms Rachel D. S. Hood John & Thady Gosden, Newmarket T B Rachel D S Hood Tote S TIMEFORM VIEW Promising start when third of 9 in novice at Newmarket (7f, good to soft) 22 days ago, finishing with running left. Sure to improve and leading claims. TFRHHHHH BHA 7 GENTLE WHINNY (IRE) (28) 5 9-2 (3) Br B f Churchill (IRE) Short Call (IRE) (Kodiac) Tom Queally J O Chris van Hoorn Racing Denis Coakley, West Ilsley T B Peter McNulty Denis Coakley Racing, Tattersalls S TIMEFORM VIEW Promising 6 1/4 lengths fifth of 13 to Chelsea Green in maiden at Sandown (7f, good) on debut 28 days ago, finishing with running left. Sure to improve TFRHHHII BHA 8 LADY CLEMMIE (GB) (22) 00 9-2 (4) Br B f Churchill (IRE) Joquina (IRE) (Big Bad Bob (IRE)) Dylan Hogan J O Chris Cleevely & partners Julia Feilden, Newmarket T B Genesis Green Stud Ltd Vaillant UK S TIMEFORM VIEW Twice-raced maiden. Eighth of 9 in novice event at Newmarket (7f, good to soft, 66/1) 22 days ago Hooded for 1st time TFRHIIII BHA1m FIRST RACE 1.31 THE TURNERS BRITISH EBF FILLIES’ NOVICE STAKES (CLASS 4) (GBB RACE) for novice two yrs old fillies ™ Total race value £8000 Owners Prize Money. 1st £3414, 2nd £1706, 3rd £854, 4th £426. (Penalty Value £4320) Leading course trainer (17-22): J & T Gosden (50 wins from 292 runners, 17%) runs FORTIS REGINA Trainer-in-form (last 14 days): R Varian (9 wins from 42 runners, 21%) runs CLIMATE FRIENDLY Fancy That: J & T Gosden won this race in 2017 and 2020 The stable runs FORTIS REGINA today. Longest Traveller: CHELSEA GREEN trained by H Palmer, Malpas, 166 miles.
Homeopathic
TFRHHIII THERAPIST (GB) (42) 2
12
Daniel Muscutt J James Fanshawe, Newmarket T Pegasus Stables LLP S TFRHHIII BHA TRUST THE STARS (IRE) (-)
TIMEFORM VIEWFoaledMay10 135,000gnsyearling,Teofilofilly Dam,8.5fwinner(includingat2yrs)whostayed10.5f,half-sistertosmart 7f/7.5f winner Green Coast and useful 1m-1 1/2m winner St Jean (by Teofilo). Yard 0-10 with 2-y-o newcomers this year
TFR SCENIC (FR) (-)
Cameron
9-2 (1) Teofilo (IRE) Dubai Fashion (IRE) (Dubawi (IRE))
Cheveley Park Stud S second of 9 in Lingfield (1m, AW)
Andrew Balding, Kingsclere Park
novice at
B Hadi Al-Tajir
Br B f Sea
TIMEFORM VIEW Foaled February 20 €140,000 yearling, Sea The Stars filly Dam German/Italian 11f/ (German Group 3)1 winner. Yard 5-41 with 2-y-o newcomers this year.
13
Hood worn first time by No 8. Hood worn by No 6.
Hector Crouch J Valmont Ralph Beckett, Kimpton Down T S.Elektrowelt24 & Sunderland Holding Inc R M Beckett Ltd S
J O David Ward
Pat Cosgrave Ed Walker, Upper Lambourn Bloodstock Catering Facilities Management
Noble J O Premier Thoroughbred Racing Ltd Gay Kelleway, Newmarket T B Rathasker Stud Premier Thoroughbred Racing Ltd, Evolve Hr Consulting S TIMEFORM VIEW Twice-raced maiden. 12/1, third of 4 in maiden at Epsom (8.5f, good to firm) 18 days ago
9-2 (8) (IRE) Ghalyah (Frankel)
9-2 (10)
Limited ABM
1/2m
S TIMEFORM VIEW Foaled March 6. 90,000 gns yearling, Lope De Vega filly Dam unraced half-sister to smart winner up to 11.6f English King. Yard 1-19 with 2-y-o newcomers this year.
11 thejockeyclub.co.uk Firs t Rac e 9 NATIVE MELODY (IRE) (18) 33
TFRHHHII BHA THROUBI (IRE) (-)
T B Rabbah
O Cheveley
9-2 (2) The Stars (IRE) Son Macia (GER) (Soldier Hollow)
B
9-2 (6) Havre (IRE) (Dark Angel (IRE))
Stud
HIIII BHA10
O
Br B f Bungle Inthejungle Native Picture (IRE) (Kodiac)
Br B f Lope de Vega
Stud Limited
BHA11
O Mrs A. M. Swinburn
DECLARED RUNNERS 13 2021: MELLOW YELLOW (IRE) Cieren Fallon 11-4 (William Haggas) 8 ran
2 9 0
Probable S.P’s: 3-1 Fortis Regina (GB), 9-2 Climate Friendly (GB), 11-2 Chelsea Green (IRE), 15-2 Doom (GB), 11-1 Therapist (GB), 16-1 Trust The Stars (IRE), 18-1 Gentle Whinny (IRE), 25-1 Scenic (FR), Throubi (IRE), 33-1 Beautiful Star (IRE), 100-1 Native Melody (IRE), 150-1 Arikara (GB), 300-1 Lady Clemmie (GB)
PLAY SMARTER FORTIS REGINA shaped with plenty of encouragement when third in a Newmarket novice on debut 3 weeks ago and can put that experience to good use Penalised-winner Chelsea Green is a likely threat with Harry Davies taking off 3lb, while there are some interesting newcomers on show, notably Fillies’ Mile entrant Climate Friendly TIMEFORM PREDICTION: 1.FORTIS REGINA 2.CHELSEA GREEN (IRE) 3.CLIMATE FRIENDLY RACE RESULT 1ST 2ND 3RD 4TH RACE TIME DISTANCE GREAT BRITISH BONUS SCHEME The Great British Bonus (GBB) offers multiple bonuses of up to £20,000 per eligible race for British-bred fillies and mares. TODAY’S RACE SPONSORS find out more about today’s race sponsors at turners-distribution.com & ebfstallions.com MEDIAN & RECORD TIME Raceform Median Time: 1 min, 35.00 secs Record Time: 1 min, 35.13 secs Royal Dornoch 28th September 2019, Good
Br B f Le
TIMEFORM VIEW Shaped with encouragement amid greenness when
Stewards Note: GENTLE WHINNY: Following its run on 20/8/2022 it was reported that the horse was hampered at the last furlong.
T B Cheveley
Hayley Turner J Park
Br B f
TFRHHHII BHA-
on debut 6 weeks ago, no match for winner Likely to improve
TFR
87 4 AL HUSN (IRE) (152) 041-1 D 3 9-2 (6) Br B f Dubawi (IRE) Hadaatha (IRE) (Sea The Stars (IRE)) Dane O’Neill J O Shadwell Estate Company Ltd Roger Varian, Newmarket T B Shadwell Estate Company Limited TIMEFORM VIEWReturnedwithabangassheaddedasecond1mKemptonwintoherCVinApril,lookingfarmorepolishedandreadilycomingclear Offagainsincebutcouldbeusefulandratesabigplayerifprovingaseffectiveonturfnowhandicapping.
HHHHI BHA86 5 QUEENLET (IRE) (143) 01-6 D 3 8-12 (7) Br B f Kingman Tesoro (IRE) (Galileo (IRE)) Cieren Fallon J O Mr James Wigan William Haggas, Newmarket T B James Wigan TIMEFORM VIEW Signed off last season with victory in 1m Newbury fillies’ novice in the mud. Well held on return in hot Ascot contest in April and given time since (has plenty about her). Could have a lot more to offer 5 months on fitted with tongue tie. TFRHHHII BHA82 6 TAMARAMA (GB) (53) 321104 D 3 8-12 (8) Br B f Muhaarar Kalsa (IRE) (Whipper (USA)) Jamie Spencer J O Mr James A. Oldham Charles Hills, Lambourn T B Mr James A. Oldham TIMEFORM VIEWWonBeverleymaiden/Riponhandicapinthespringandfirmlybackontrackwhenfourthinhot1mGoodwood3-y-o fillies’ handicap in July, shaping well as she finished with running left. 1lb lower here and firmly one to consider TFRHHHHH BHA82 7 AIMING HIGH (GB) (71) 05-2146 3 8-7 (4) Br Ch f Lope de Vega (IRE) High Hopes (Zamindar (USA)) Hayley Turner J O Major M. G. Wyatt David Simcock, Newmarket T B Dunchurch Lodge Stud Company TIMEFORM VIEWImprovedforthestepupto11/4mwhenmakingasuccessfulhandicapdebutatDoncasterinMay.NeverfeaturedatSalisbury(9.9f)inJuneand bestnotjudgedtooharshlyonherlatestAscotsixthwhentackling11/2mforthefirsttime Dropsbackmarkedlyintripafterabreaknow. TFRHHHII BHA77 8 RAINBOW COLOURS (IRE) (22) 112600 D 3 8-5 (3) Br B f Dark Angel (IRE) Rachelle (IRE) (Mark of Esteem (IRE)) John Egan J O Sheikh Hamdan Bin Mohammed Al Maktoum Charlie & Mark Johnston, Middleham T B Godolphin Johnston Racing Ltd S TIMEFORM VIEW Won at Ripon and Chepstow in July over this trip Keeping busy, possibly failing to stay the extended 9f at Hamilton last time Others have the scope to improve past her now. TFRHHHII BHA75 1m SECOND RACE 2.06 THE TURNERS FILLIES’ HANDICAP STAKES (CLASS 3) for three yrs old and upwards fillies and mares ™ Total race value £15000 Owners Prize Money. 1st £6401, 2nd £3200, 3rd £1601, 4th £800 (Penalty Value £8100) Leading course trainer (17-22): J & T Gosden (50 wins from 292 runners, 17%) runs NATASHA Trainer-in-form (last 14 days): R Varian (9 wins from 42 runners, 21%) runs AL HUSN Longest Travellers: RAINBOW COLOURS trained by C & M Johnston & EIDIKOS trained by E Bethell both Middleham, 200 miles.
TIMEFORM
VIEW Successful first 2 starts this season and back on track with a cracking third in 1m Ascot handicap 10 weeks ago Fresh and one to consider with top apprentice booked.
J Jockey T Trainer O Owner B Breeder S Sponsor Br Breeding | FACTS | FANCIES | FORM | STATS FO| RM ANALYSIS - A CLOSER LOOK 12 colours no horse age st-lb Draw 1 NATASHA (GB) (52) 2110-36 D 3 9-10 (5) Br Ch f Frankel Darkova (USA) (Maria’s Mon (USA)) Robert Havlin J O Mr George Strawbridge John & Thady Gosden, Newmarket T B George Strawbridge TIMEFORMVIEWDualwinneroverthistriplastyear WellheldatGloriousGoodwood7weeksagobutcouldhavemore to offer for top yard after a break. TFRHHHII BHA94 2 EIDIKOS (GB) (30) 4-40360 3 9-9 (1) Br B f Ardad (IRE) Elpida (USA) (Giant’s Causeway (USA)) Hector Crouch J O St Albans Bloodstock Limited Edward Bethell, Middleham T B Ropsley Bloodstock & St Albans Bloodstck Tote S TIMEFORM VIEW Has twice reached the frame at listed level this year but well held off this mark in 7f York fillies’ handicap last month. Headgear back on now. TFRHHIII BHA93 3 WASHRAA (IRE) (70) 22-1103 D BF 3 9-3 (2) Br B f Ribchester (IRE) Aneedah (IRE) (Invincible Spirit (IRE)) Harry Davies (3) J O Sheikh Ahmed Al Maktoum Owen Burrows, Lambourn T B Karis Bloodstock Ltd & Rathbarry Stud
TFRHHHII BHA
33-1 Aiming
Probable S.P’s: 11-4 Al Husn (IRE), 7-2 Queenlet (IRE), 11-2 (GB), 6-1 Natasha (GB), 13-2 Washraa (IRE), 25-1 Eidikos (GB), Rainbow Colours (IRE), High (GB)
Tamarama
PLAY SMARTER
NATASHA: Following its run on 27/7/2022 it was reported that the horse ran flat.
TAMARAMA was a big eye-catcher in a similar event at Goodwood 7 weeks ago, which has worked out well and she could be the way to go here. Husn, Queenlet and Washraa
all have unfinished business and are dangerous in a strong-looking heat. TIMEFORM PREDICTION: 1.TAMARAMA 2.AL HUSN (IRE) 3.QUEENLET (IRE) RACE RESULT 1ST 2ND 3RD 4TH RACE TIME DISTANCE POSITION OF STALLS Far Side Course 2m 2f -Centre Remainder Stand Side TODAY’S RACE SPONSORS find out more about today’s race sponsors at turners-distribution.com MEDIAN & RECORD TIME Raceform Median Time: 1 min, 38.60 secs Record Time: 1 min, 34.56 secs Benbatl 24th September 2021, Good to Firm
QUEENLET: Following its run on 27/4/2022 it was reported that the horse lost a shoe
Al
13 thejockeyclub.co.uk Sec ond Rac e DECLARED RUNNERS 8 2021: MADAME TANTZY 5 8 7 Georgia Dobie 3-1 (Eve Johnson Houghton) 6 ran Tongue Strap worn first time by No 5. Sheepskin Cheek Pieces worn first time by No 2. Hood worn by No 7. Stewards Note:
Cieren (3)
J O Godolphin Charlie Appleby, Newmarket T B Irish National Stud Mare Syndicate Emirates Fly Better S TIMEFORM VIEW Off 9 months/gelded, won 4-runner maiden on the July course in July. Failed to land the odds under a penalty at Kempton but well bred and in top hands so could easily improve now handicapping. TFRHHHHI BHA85 4 BAILEYSGUTFEELING (IRE) (39) 312-361 D 9-7 (1) Br B c Gutaifan (IRE) Baileys Pursuit (Pastoral Pursuits) Daniel Muscutt J O The Bumblebees Kevin Philippart de Foy, Newmarket T B Mr Niall Radford Johnson Elborne UK Ltd, Kpf Racing Ltd S TIMEFORM VIEW Given a break and responded with a career-best effort when doubling tally at Lingfield last month, finding plenty 4lb rise shouldn’t prevent another bold bid. TFRHHHII BHA83 5 WAJD (GB) (36) 10-5416 9-6 (10) Br B f Pearl Secret Queen of The Tarts (Royal Applause) Thore Hammer Hansen J O Mr Mohamed Saeed Al Shahi Patrick Owens, Newmarket T B Aspire Stallions & Bloodstock Ltd 8.3 Blanc S TIMEFORM VIEW Yarmouth novice winner (6f) at 2 yrs and found plenty for pressure when gaining first handicap success on the July course. Didn’t look straightforward last time and now goes up in trip. TFRHHIII BHA82 6 WAR IN HEAVEN (IRE) (98) 114206 9-5 (2) Br B g Exceed And Excel (AUS) Burma Sun (IRE) (Rip Van Winkle (IRE)) Alistair Rawlinson J O Mr Matthew Taylor Michael Appleby, Oakham T B Kildaragh Stud Trade Access Panels Ltd S TIMEFORM VIEW Won a brace of AW contests for Andrew Balding during the winter Attitude seemed to prevent him progressing after and has left that yard but joined another successful stable and now gelded. TFRHHHII BHA81 7 THE MOUSE KING (IRE) (24) 520213 D 9-4 (3) Br Gr g El Kabeir (USA) Empress Anna (IRE) (Imperial Ballet (IRE)) Dylan Hogan J O Mrs C. T. Bushnell Julia Feilden, Newmarket T B Tom Anthony Vaillant UK S TIMEFORM VIEW Seven-length winner of 9-runner handicap at Southwell last month. Not far off that level under a penalty at Kempton but up another 4lb and needs to improve if he’s as effective on turf TFRHHIII BHA80 8 SABYINYO (GB) (22) 24106 9-2 (6) Br Gr g Gregorian (IRE) Amahoro (Sixties Icon) Dane O’Neill J O Dave and Gill Hedley Mick Channon, West Ilsley T B G Hedley & Mike Channon Bloodstock Ltd Mike Channon Bloodstock Ltd S TIMEFORM VIEW Got off the mark in 1m Brighton novice in May but too free to see his race out both outings since. Drop back in trip will help TFRHHIII BHA78 7f THIRD RACE 2.41 THE TURNERS HANDICAP STAKES (CLASS 4) for three yrs old ™ Total race value £13000 Owners Prize Money. 1st £5291, 2nd £2645, 3rd £1323, 4th £661, 5th £240, 6th £240 (Penalty Value £6696) Leading course trainer (17-22): C Appleby (69 wins from 231 runners, 30%) runs SENSE OF POWER Trainer-in-form (last 14 days): C Appleby (9 wins from 27 runners, 33%) runs SENSE OF POWER Longest Traveller: GUESS trained by R Beckett, Kimpton Down, 148 miles.
Fallon J O Mrs Fitri Hay Charles Hills, Lambourn T B Mrs Fitri Hay JMH Group S TIMEFORMVIEWConfirmedthepromiseofhisreappearancewhenlandingaNewburyhandicapinJuneandimprovedanotherchink for latest win at that venue a month ago. Up 6lb but manner of latest success suggests that could be lenient. TFRHHHHH BHA85 3 SENSE OF POWER (IRE) (24) 2-12 D BF 9-9 (9) Br B g Invincible Spirit (IRE) Boldarra (USA) (Giant’s Causeway (USA)) Harry Davies
J Jockey T Trainer O Owner B Breeder S Sponsor Br Breeding | FACTS | FANCIES | FORM | STATS FO| RM ANALYSIS - A CLOSER LOOK 16 colours no horse st-lb Draw 1 SEATTLE KING (GB) (84) 140-35 D 9-11 (8) Br B g Kingman Snoqualmie Star (Galileo (IRE)) Tyler Heard (3) J O Mr Trevor Johnson Phil McEntee, Newmarket T B Littleton Stud Tallon International Ltd S TIMEFORM VIEW Highly tried as a juvenile after making a winning debut. Failed to make a significant impact in a brace of handicaps in June and since left Ralph Beckett. Mark looks too high TFRHHIII BHA87 2 BELL SHOT (IRE) (29) 41-4131 D 9-9 (4) Br B g Dark Angel (IRE) Merry Me (IRE) (Invincible Spirit (IRE))
Wajd
28-1 Seattle King
9-1 (7) (IRE), (IRE), (GB), (IRE), Mouse King (IRE), (GB), (GB), Sabyinyo (GB) SMARTER
10-1 Astral Beau (GB), 12-1 Guess
16-1 Chola Empire
TFRHHHII BHA EMPIRE (GB) (21) 13-5
TIMEFORM VIEWWinningdebutontheAWinOctoberandmatchedthatformwhenthirdatKempton3weekslater,ideallyneedingastrongerpace. Off10monthsandsoundreturnfittedwithahoodontheJulycoursebutthatconfirmshismarkisastiffone.
J O Sun Bloodstock SARL
17 thejockeyclub.co.uk Th ir d Rac e 9 GUESS (IRE) (139) 0410 D
J O Chola Dynasty
T B Sun Bloodstock SARL TIMEFORM VIEW Big improver since fitted with blinkers, completing hat-trick at Epsom last week. Up 4lb in a better race but clearly demands respect.
TFRHHHHI BHA BEAU (GB) (22) 144301 D
J O Mr R.A.Pegum & Partner 1
9-2 (5) (IRE))
78 10 CHOLA
Beckett,
David Simcock, Newmarket Al Basti Equiworld S
78 11
Br B g Territories (IRE) Veena (FR) (Elusive
9-1 (11) River (FR)) Spencer
Br B f Brazen Beau (AUS) Asteroidea (Sea The Stars (IRE)) Shane Kelly J O Family Sly Pam Sly, Peterborough T B M. H. Sly & Mrs P. M. Sly Pam Sly Racing S TIMEFORM VIEW Won on debut at Leicester over this trip in April and reacted well to cheekpieces when doubling tally on the July course last month. That was a messy race and this is deeper TFRHHHII BHA77 DECLARED RUNNERS 12 2021: SADIQAA (IRE) 3 9 0 John Fahy 14-1 (Clive Cox) 10 ran Hood worn first time by No 8. Hood worn by No 10 Blinkers worn by No 11. Tongue Strap worn by No 5. Sheepskin Cheek Pieces worn by No 12. Running for the first time since Gelding No 6, 9. Stewards Note: SENSE OF POWER: Following its run on 24/8/2022 it was reported that the horse lost a shoe Probable S.P’s: 7-2 Bell Shot (IRE), 11-2 Sense of Power (IRE), Mount Kosciuszko (GB), 17-2 Baileysgutfeeling
BELL SHOT turned a 3-y-o handica at Newbury into a one-sided affair a month ago, and given the impression he created, the handicapper’s revised mark may not prevent further success Mount Kosciuszko has reacted really well to blinkers in recent weeks and is a threat, along with Sense of Power.
TFRHHHII BHA MOUNT KOSCIUSZKO (GB) (9) 4-24111
Jamie
Down T B Tony Cleary R M Beckett Ltd S TIMEFORM VIEW Didn’t need to improve on Irish form to make a successful debut for Ralph Beckett in April. Disappointing turf/handicap debut over C&D a month later and off since (gelded).
Br Gr g National Defense Sans Equivoque (GER) (Stormy
T B Dr Arujuna Sivananthan
Hector Crouch
Richard Hannon, Marlborough
D
Hayley Turner
TIMEFORM PREDICTION: 1.BELL SHOT (IRE) 2.MOUNT KOSCIUSZKO 3.SENSE OF POWER (IRE) RACE RESULT 1ST 2ND 3RD 4TH RACE TIME DISTANCE WELFARE INTEGRITY EQUALITY SAFEGUARDING W EQUALITY SAFEGUARDING If you have concerns about the integrity of British racing or the wellbeing of the sport’s participants, human or equine, please contact RaceWISE Anonymous reporting. Call 08000 852 580 (free 24 hours a day) Visit britishhorseracing.com/RaceWISE MEDIAN & RECORD TIME Raceform Median Time: 1 min, 25.40 secs Record Time: 1 min, 21.98 secs Tupi (IRE) 16th May 2015, Good to Firm TODAY’S RACE SPONSORS find out more about today’s race sponsors at turners-distribution.com
77 12 ASTRAL
Ralph Kimpton
9-2 (12) City (USA))
20-1 War In Heaven
PLAY
Br B g Elzaam (AUS) Singapore Secret (IRE) (Bushranger
25-1 The
T B Mr S. Chappell
Daniel Muscutt
82 4 EQUIANO SPRINGS (GB) (22) 3-45416 CD 8 9-8 (12) Br B g Equiano (FR) Spring Clean (FR) (Danehill (USA)) Tom Queally J O T T Racing Tom Tate, Tadcaster T B Paddock Space Tom Tate Racing S TIMEFORM VIEW Won this race last year and added to his tally on the July course here last month. A 5lb rise for that was enough to find him out over 7f at Thirsk since but this more his trip TFRHHHII BHA81 5 WONDERFUL WORLD (GB) (70) 21-6426 D BF 3 9-8 (5) Br B c Bungle Inthejungle La Gifted (Fraam) Dane O’Neill J O George Materna & Roger Badley Mick Channon, West Ilsley T B Mike Channon Bloodstock Limited Mike Channon Bloodstock Ltd S TIMEFORMVIEWEndedlastyearwithsuccessinasoft-groundDoncasternursery(6f)inNovember Startedthisseason off reasonably well but he does need to bounce back from a below-par run at Chester last time. TFRHHHII BHA83 6 TWELFTH KNIGHT (IRE) (15) 210346 D 3 9-7 (8) Br B g Haatef (USA) Balm (Oasis Dream) Taylor Fisher (7) J O Hambleton Racing Ltd XLVI Archie Watson, Upper Lambourn T B Castlegrove Stud Hambleton Racing Ltd S TIMEFORM VIEW Dual 6f winner who probably wasn’t suited by the step up to 7f when below par at Ascot last time Has dropped to only 1lb above the mark he was successful from at Yarmouth at the start of the summer TFRHHHII BHA82 7 ABATE (GB) (22) 315035 D 6 9-7 (3) Br Br g Bated Breath Red Kyte (Hawk Wing (USA)) Harry Davies (3) J O The Never Say No Racing Club Adrian Nicholls, Sessay T B Malih L. Al Basti TIMEFORM VIEW Successful over 6f on the July course in June Respectable efforts in defeat lately and he’s back on that winning mark. Another who can’t be discounted. TFRHHHII BHA80 8 AKKERINGA (GB) (44) 36-6010 D 4 9-5 (11) Br B g Dutch Art Annie’s Fortune (IRE) (Montjeu (IRE)) Ray Dawson J O Mr G Johnson & Mr J W Parry
George Scott, Newmarket
VIEW Won over 6f on the July course here this summer and just as good when second at Epsom since. Likely to go well again. TFR
Owners Prize Money. 1st £5291, 2nd £2645, 3rd £1323, 4th £661, 5th £240, 6th £240 (Penalty Value £6696)
Fancy That: T Tate won this race in 2019 and 2021. The stable runs EQUIANO SPRINGS today. Longest Traveller: ABATE trained by A Nicholls, Sessay, 183 miles.
Leading course trainer (17-22): S C Williams (7 wins from 114 runners, 6%) runs AKKERINGA & GOT NO DOLLARS (last 14 days): A Watson (4 wins from 16 runners, 25%) runs TWELFTH KNIGHT
Br B g Dandy Man (IRE) Azhar (Exceed And Excel
Williams, Newmarket T B G. Johnson, J. W. Parry & S. C. Williams Tote S TIMEFORM VIEW Back to form with a 6f July course success on penultimate start. Much better than the bare result (badly hampered) at Doncaster last time Worth another chance to show he’s still on a good mark. TFRHHHHH BHA78 6f FOURTH RACE 3.16 THE TURNERS PARK HOMES HANDICAP STAKES (CLASS 4) for three yrs old and upwards ™ Total race value
87 3 MELLYS FLYER (GB) (18) 166012 D 4
Clover, Newmarket T B Owenstown Stud Tote S TIMEFORM VIEW Back on track this season with victories in 5f handicaps at Ascot and here (July course). Well held when bidding for the hat-trick at Goodwood but was subsequently found to have an irregular heartbeat. TFRHHHHI
S
J Jockey T Trainer O Owner B Breeder S Sponsor Br Breeding | FACTS | FANCIES | FORM | STATS FO| RM ANALYSIS - A CLOSER LOOK 18 colours no horse age st-lb Draw 1 PRONTISSIMO (GB) (28) 10-6424 D 4 10-0 (1) Br B g Toronado (IRE) Eastern Glow (Cape Cross (IRE)) Thore Hammer Hansen J O Mr Khalifa Dasmal Patrick Owens, Newmarket T B BBB Ltd & Let’s Get Racing Limited Al Basti Equiworld S TIMEFORM VIEW Won a couple of times last season. Yet to hit the same heights this year but he was better than the result over 7f at Sandown and he’d be very capable off this mark if back near his best. Return to 6f also in his favour TFRHHHHI BHA87 2 CELSIUS (IRE) (53) 046-110 BF 6 10-0 (6) Br Ch g Dragon Pulse (IRE) Grecian Artisan (IRE) (Mastercraftsman (IRE)) Robert Havlin J O J. Collins, C. Fahy & S. Piper
TIMEFORM HHHHI BHA
Trainer-in-form
Investasurge Consulting Ltd
J O Investasurge Consulting Ltd
Stuart £13000
Tom BHA 9-9 (9) (AUS))
HELLO ZABEEL: Following its run on 14/8/2022 it was reported that the horse was unsuited by the wide draw
Felston Consulting 9-0 (10)
Stewards Note:
AKKERINGA just didn’t get the chance to show what he could do at Doncaster last the form he showed when Flyer,
T B Barronstown Stud Tote S TIMEFORM VIEW Has notched 4 AW wins since joining this yard Creditable third over 7f at Kempton last time Below form both turf starts but it’s too soon to suggest he won’t prove effective on the grass. TFRHHHHI BHA73 11 HELLO ZABEEL (IRE) (34) 1-63330 4
DECLARED
WONDERFUL WORLD: Following its run on 9/7/2022 it was reported that the horse resented the tight track.
successful on the July course prior to that so he gets the nod. Mellys
T B Mr J. O’Donnell & Mr Noel William Kelly
S TIMEFORM VIEWThingswentagainsthimover6fatPontefractlasttime(finalstartforKevinRyan)andpriortothathe’dbeenshaping as if a return to sprinting would suit him. One to keep at eye on in the betting now setting out for a new stable TFRHHHII BHA73 12 ALCAZAN (GB) (15) 613503 D
4 8-8 (4) Fallon
J O Mr Paul Wildes
J O Mr John O’Donnell
67
RUNNERS 12 2021: EQUIANO SPRINGS 7 9 2 Tom Queally 11-2 (Tom Tate) 6 ran Hood worn by No 3. Tongue Strap worn by No 8, 10 Visor, Tongue Strap worn by No 1. Sheepskin Cheek Pieces worn by No 6.
PLAY SMARTER
time and remains nicely treated on
19 thejockeyclub.co.uk Fo urth Rac e 9 SHARK TWO ONE (GB) (78) 0-02605 D 4 9-2 (2) Br B g Adaay (IRE) Touching (IRE) (Kheleyf (USA))
TFRHHHII BHA
J O Mr W Enticknap & Mr B Ralph
Charlie Fellowes, Newmarket
S TIMEFORM VIEW All 5 wins on AW but showed she’s effective on turf when third of 11 at Ascot
T B Killashee House Limited
Limited S TIMEFORM VIEW Drawn a blank since his 2-y-o days, leaving Richard Fahey after finishing a below-form fifth at Haydock last time Probably best watched on this first outing for a new stable TFRHHIII BHA75 10 GOT NO DOLLARS (IRE) (122) 112253 D 4
T B Rabbah Bloodstock Limited
CELSIUS: Following its run on 26/7/2022 it was reported that the horse had an irregular heartbeat.
Turner J O New Vision Bloodstock and Miss J R Macey
Br B g Showcasing Canada Water (Dansili)
Probable S.P’s: 11-2 Got No Dollars (IRE), 6-1 Mellys Flyer (GB), 8-1 Celsius (IRE), 9-1 Akkeringa (GB), 10-1 Alcazan (GB), 12-1 Equiano Springs (GB), 14-1 Prontissimo (GB), Twelfth Knight (IRE), Hello Zabeel (IRE), 16-1 Wonderful World (GB), 18-1 Abate (GB), 25-1 Shark Two One (GB)
Br B f Al Kazeem Glorious Dreams (USA) (Honour And Glory (USA)) Cieren
Jessica Macey, Doncaster
Roger Teal, Lambourn
Chartplan(2004) Ltd last time Remains 1lb
Luke Catton (5)
(7) Br B g Frankel Lady of The Desert (USA) (Rahy (USA))
AKKERINGA: Following its run on 4/8/2022 it was reported that the horse was denied a clear run late-on.
Celsius and the selection’s stablemate Got No Dollars head the dangers. TIMEFORM PREDICTION: 1.AKKERINGA 2.MELLYS FLYER 3.CELSIUS (IRE) RACE RESULT 1ST 2ND 3RD 4TH RACE TIME DISTANCE W: www.thejockeyclub.co.uk/newmarket IMPORTANT NOTICE Please note The Frankel Lounge will be closed on Saturday 1 October due to a private function. MEDIAN & RECORD TIME Raceform Median Time: 1 min, 12.20 secs Record Time: 1 min, 9.55 secs Captain Colby (USA) 16th May 2015, Good to Firm TODAY’S RACE SPONSORS find out more about today’s race sponsors at turners-distribution.com
Wildes Hotel Limited
Jamie Spencer
Stuart Williams, Newmarket 9-0
Hayley
above her highest successful mark, though.
J Jockey T Trainer O Owner B Breeder S Sponsor Br Breeding | FACTS | FANCIES | FORM | STATS FO| RM ANALYSIS - A CLOSER LOOK 20 colours no horse age st-lb Draw 1 RAJINSKY (IRE) (84) 016-134 6 9-12 (6) Br B g Zoffany (IRE) Pink Moon (IRE) (Namid) Harry Davies (3) J O Jastar Capital Limited Hugo Palmer, Malpas T B Miss Elaine Marie Smith TIMEFORM VIEW Genuine and reliable stayer who looked better than ever when winning 2m Ripon handicap on return. Excellent in-the-frame efforts since and looks sure to give another good account back from a break. TFRHHHII BHA102 2 MASTER MILLINER (IRE) (31) 520110 6 9-8 (9) Br Ch g Helmet (AUS) Aqualina (IRE) (King’s Theatre (IRE)) Hector Crouch J O Mrs Jennifer Simpson Racing Emma Lavelle, Marlborough T B George Delahunt Tyto Consultancy S TIMEFORMVIEWWonback-to-backhandicapsinJuly,mostrecentlyovermarathontripatGoodwood.Belowthatlevel at York since, though, and finds himself off career-high mark now. TFRHHHII BHA98 3 THEMAXWECAN (IRE) (42) 040001 6 9-4 (8) Br B g Maxios Psychometry (FR) (Danehill Dancer (IRE)) Jamie Spencer J O Mr Douglas Livingston Charlie & Mark Johnston, Middleham T B Niarchos Family Johnston Racing Ltd S TIMEFORM VIEWLow-keystarttothecampaignbutdropped4lbbelowlastwinningmarkandhecashedinattheShergarCup meeting last month under Jamie Spencer Only 2lb higher now and must enter calculations. TFRHHHII BHA94 4 PRINCE IMPERIAL (USA) (21) 12161-6 5 9-2 (10) Br B g Frankel Proportional (Beat Hollow) Pat Cosgrave J O Highclere T’Bred Racing-Prince Imperial Richard Hughes, Upper Lambourn T B Juddmonte Farms Inc TIMEFORM VIEW Bagged his third win of 2021 in 4-runner handicap at Ayr last September and probably needed his first run for 11 months when only sixth at Newmarket 21 days ago Blinkers back on and should strip fitter for that return. TFRHHHHI BHA92 5 BASCULE (FR) (22) 1111-04 4 9-0 (1) Br Ch g Kendargent (FR) New River (IRE) (Montjeu (IRE)) George Rooke J O The New River Partnership Richard Hughes, Upper Lambourn T B The New River Partnership The Garden Cider Company Ltd S TIMEFORM VIEW Four-time winner in 2022 but he failed to build on reappearance promise when below-par fourth of 6 in handicap at Goodwood (16f) 22 days ago. Needs a couple of these to falter. TFRHHIII BHA90 6 DIAMOND BAY (GB) (12) 424312 BF 4 8-12 (5) Br Ch g New Bay Amarillo Starlight (IRE) (Dalakhani (IRE)) Daniel Muscutt J O Ebury Racing 5 Tom Ward, Upper Lambourn T B Biddestone Stud Ltd The Pheasant Inn S TIMEFORM VIEW Posted a career best when winning 2m handicap at Lingfield in June and backed it up when second at Newcastle 12 days ago Consistent sort who is likely to remain competitive. TFRHHHII BHA88 7 RED FLYER (IRE) (31) 014204 C 4 8-9 (7) Br Ch g Free Eagle (IRE) Hip (Pivotal) Hayley Turner J O From Little Acorns Partnership John Best & Karen Jewell, Sittingbourne T B Irish National Stud Best & Jewell Racing S TIMEFORMVIEWBaggedapairofAWwinsatthestartofyearandalsosuccessfulover1m4fhereinMay.Postedanother solid effort when fourth of 12 in 2m handicap at York 31 days ago so he needs considering. TFRHHHII BHA85 8 CALL MY BLUFF (IRE) (54) 112-340 D 5 8-9 (3) Br B g Make Believe Ocean Bluff (IRE) (Dalakhani (IRE)) Ray Dawson J O The Ffrench Connection Dominic Ffrench Davis, Lambourn T B Michael Phelan & Make Believe Syndicate High View Racing Ltd S TIMEFORM VIEW Dual 2m winner last term but he comes here on the back of a poor effort in 2m handicap at Galway 54 days ago Needs to get back on track. TFRHHHII BHA85 2m 2f FIFTH RACE 3.51 THE TURNERS CESAREWITCH TRIAL HANDICAP STAKES (CLASS 2) for three yrs old and upwards ™ Total race value £50000 Owners Prize Money. 1st £20315, 2nd £10160, 3rd £5080, 4th £2540, 5th £1270, 6th £635 (Penalty Value £25770) Weights raised 3lb and paragraphs 27 to 31 of the Weights and Handicapping Code complied with where applicable Leading course trainer (17-22): C & M Johnston (26 wins from 239 runners, 11%) runs THEMAXWECAN Trainer-in-form (last 14 days): C & M Johnston (6 wins from 64 runners, 9%) runs THEMAXWECAN Longest Traveller: INSANE BOLT trained by P Fahy, Ireland.
21 thejockeyclub.co.uk Fifth Rac e
TIMEFORM PREDICTION: 1.DUKE OF VERONA (IRE) 2.RAJINSKY (IRE) 3.PRINCE IMPERIAL (USA) RACE RESULT 1ST 2ND 3RD 4TH RACE TIME DISTANCE You must be 18 or over to place a bet You may be asked to provide proof of your age when placing a bet If you cannot produce this your bet will not be accepted DISCOVER BRITISH RACING’S COMMUNITY ENGAGEMENT AND EDUCATION ACTIVITY @Rracingtogether.co.uk acingTogether MEDIAN & RECORD TIME Raceform Median Time: 3 mins, 52.0 secs Record Time: 3 mins, 45.59 secs Withhold 14th October 2017, Good TODAY’S RACE SPONSORS find out more about today’s race sponsors at turners-distribution.com The Devils Dyke Restaurant A spacious walk-in restaurant in the heart of the action, serving a variety of food from baguettes to hot carvery lunches Access with Grandstand & Paddock / Premier Enclosure tickets tables available on a first come first served basis and available for all dates at the Rowley Mile
TFRHHHHH BHA84
PLAY SMARTER
10 INSANE BOLT (IRE) (30) 0130-20
TIMEFORMVIEWRelativelylow-mileage4-y-owhobaggedhissecondwinofthesummeratSandown(14f)27daysago, despite conceding first run. Up in trip and must enter calculations despite 4lb rise
DECLARED RUNNERS 10 2021: TURNPIKE TRIP 7 8 2 John Egan 15-8 (Charles Byrnes) 9 ran Blinkers worn by No 4. Blinkers, Tongue Strap worn by No 10 Sheepskin Cheek Pieces worn by No 3, 8. Stewards Note: MASTER MILLINER: Following its run on 17/8/2022 it was reported that the horse ran flat.
9 DUKE OF VERONA (IRE) (27) 1-03161
William Jarvis, Newmarket T
B Deerpark Stud Tattersalls S
Br Gr g Belardo (IRE) Somewhere (IRE) (Dalakhani (IRE)) Cieren Fallon J
John Egan J
O Normal People Partnership Peter Fahey, Ireland T
B Manister House Stud
TIMEFORM VIEW Irish challenger who arrives in good nick, eighth of 14 in 14f handicap at Killarney 30 days ago Not out of things stepping up in trip.
Probable S.P’s: 9-2 Duke of Verona (IRE), 5-1 Rajinsky (IRE), 6-1 Diamond Bay (GB), 15-2 Themaxwecan (IRE), 11-1 Master Milliner (IRE), Insane Bolt (IRE), 14-1 Red Flyer (IRE), Call My Bluff (IRE), 16-1 Prince Imperial (USA), Bascule (FR)
4 8-8 (4)
O Mr R. C. C. Villers
6 8-6 (2)
Br B g Slade Power (IRE) Rahaala (IRE) (Indian Ridge)
TFRHHHII BHA82
A case can be made for most of these but DUKE OF VERONA still looks well weighted on the back of his Sandown success last month and gets the nod with this step up in trip also a likely plus. The admirable Rajinsky is feared most now returning after a break, with Prince Imperial and Themaxwecan also in the mix.
4 FINCH (GB) (14) 321-6
Roger Varian, Newmarket T Cheveley Park Stud Limited
B
B f
Br B f Lawman (FR) Madame Vestris (IRE) (Galileo (IRE))
J Jockey T Trainer O Owner B Breeder S Sponsor Br Breeding | FACTS | FANCIES | FORM | STATS FO| RM ANALYSIS - A CLOSER LOOK 22 colours no horse age st-lb Draw 1 VALUE THEORY (IRE) (19) 653351 D 3 9-9 (4) Br Ch f Gleneagles (IRE) Venetian Beauty (USA) (Lear Fan (USA)) Daniel Muscutt J O Dr J. Walker Charlie & Mark Johnston, Middleham T B Chris & James McHale Johnston Racing Ltd S TIMEFORMVIEWConfirmedrecentpromisewhenwinning6-runnerhandicapatRipon (9.8f,goodtofirm)19daysago, always holding on. Nudged up 3lb but should remain competitive. TFRHHHII BHA90 2 CREMA INGLESA (IRE) (40) 20-23P0 D 4 9-7 (1) Br B f Lope de Vega (IRE) Creme Anglaise (Motivator) Shane Kelly J O Hunscote Stud Ltd & John O’Connor Jamie Osborne, Upper Lambourn T B John O’Connor Tote S TIMEFORM VIEW Won 3 times in 2021 and made the frame first 2 outings this term. Suffered tack problems at Ascot but wasn’t on a going day for whatever reason at Kempton last time, dropping away quickly. Needs to bounce back. TFRHHHII BHA83 3 REEL ROSIE (IRE) (29) 215010 C D 3 9-6 (8)
and Dealers
last month. Not in the same
Br Highland Reel (IRE) Lady Canford (IRE) (Canford Cliffs (IRE))
Hector Crouch J Reel Wheelers
O Cheveley Park Stud
B Oldcourt Stud
TIMEFORMVIEWBouncedbackfromacoupleoflesserrunsatRiponwhenlandinga6-runnereventatNottinghaminfirst-timecheekpieces form off a 7lb higher mark in a stronger race at York since, so others appeal more. TFRHHHII BHA87
FLORA
Ray Dawson J
Cheveley Park Stud S VIEWMadesteadyprogresslastautumn,culminatingin8.6fWolverhamptonnovicewininOctober
Failedtoimproveafter10monthsoffon herturf/handicapdebutatThirsk(1m)butdidn’thelpherchancesbybeingunrulybeforehand,soworthanotherchance.Hooded. TFRHHHII BHA82 5 THEBEAUTIFULGAME (GB) (44) 215-422 3 9-1 (7) Br B f Slade Power (IRE) Imasumaq (IRE) (Teofilo (IRE)) Connor Planas (7) J O The Tripletto Partnership and Partner Tom Clover, Newmarket T B El Catorce Partnership Global Equine Group S TIMEFORMVIEWSalisburymaidenwinnerin2021whohasfoundonlyonetoogoodonherlast2starts,latestover10.2f at Nottingham. Should give another good account. TFRHHHII BHA82 6 BELHAVEN (IRE) (70) 00-5110 3 8-12 (5) Br Ch f Belardo (IRE) Park Haven (IRE) (Marju (IRE)) George Wood J O Mr A. M. Mitchell Harry Eustace, Newmarket T B Gerard Phelan Tattersalls S TIMEFORM VIEW Improved to make a successful handicap debut at Redcar (1m) in May, then overcame a pace bias to follow up comfortably at Sandown in June Latest run at Ascot is easily excused and she remains capable of better Up in trip TFRHHHHI BHA79 7 SEA GALAXY (IRE) (33) 331 D 3 8-11 (6) Br Ch f Sea The Stars (IRE) Ninas Terz (GER) (Tertullian (USA)) Cieren Fallon J O Sunderland Holding Inc. William Haggas, Newmarket T B Sunderland Holdings Inc Somerville Lodge Ltd S TIMEFORM VIEW Built on debut promise at the second attempt when finding the better turn of foot in a steadily-run match at Windsor (10f) 33 days ago, suited by increase in trip Capable of better still now venturing into handicaps. TFRHHHHH BHA78 8 SUZY’S SHOES (GB) (20) 4-30513 3 8-9 (2) Br Ch f Nathaniel (IRE) Wittgenstein (IRE) (Shamardal (USA)) Georgia Dobie (3) J O Mr Marc Middleton-Heath Eve Johnson Houghton, Blewbury T B Newsells Park Stud Abm Catering Limited S TIMEFORM VIEW Opened her account without needing to improve in 11f maiden at Newbury in August but proved to be a disappointment on handicap debut at Goodwood 15 days later. TFRHHHII BHA76 1m 2f SIXTH RACE 4.26 THE TURNERS GROUP FILLIES’ HANDICAP STAKES (CLASS 3) for three yrs old and upwards fillies and mares ™ Total race value £15000 Owners Prize Money. 1st £6401, 2nd £3200, 3rd £1601, 4th £800 (Penalty Value £8100) Leading course trainer (17-22): R Varian (37 wins from 222 runners, 17%) runs FLORA FINCH Trainer-in-form (last 14 days): R Varian (9 wins from 42 runners, 21%) runs FLORA FINCH Longest Travellers: VALUE THEORY trained by C & M Johnston & REEL ROSIE trained by E Bethell both Middleham, 200 miles.
TIMEFORM
O The
3 9-1 (3)
Edward Bethell, Middleham T
PLAY SMARTER
turners-distribution.com Newmarket Legends Lounge Carvery Premier Enclosure Admission One Course Carvery Meal Only available on 24th September / 1st October from £46.60 (pre-bookings only)
TIMEFORM PREDICTION: GALAXY (IRE)
4 runners, this must be
1/5 odds a place 1-2 5 to 7 runners (inclusive): 1/4 (one quarter) odds for finishing 1st or 2nd 8 or more runners: 1/5 odds for finishing 1st, 2nd or 3rd Handicap races with 12 to 15 runners
1/4 odds
1/5 odds
2.BELHAVEN (IRE) 3.FLORA FINCH RACE RESULT 1ST 2ND 3RD 4TH RACE TIME DISTANCE EACH-WAY BETTING TERMS
Working alongside the Racecourse Association (RCA), bookmakers have introduced standard each-way betting terms across Jockey Club Racecourses. Bookmakers will provide these terms, or better, when offering each-way betting.
Raceform Median
Fewer than 3 runners: win bets only, no places offered 3 or 4 runners: all to win. Where a bookmaker wishes to depart from this default position he may offer place terms for 3 or at (inclusive): for 2nd (inclusive): for
SEA GALAXY came out on top in a match at Windsor last month and remains unexposed, especially at this trip, so she’s selected to follow up on her handicap debut. Belhaven’s latest run is easily excused, so it’s possible she could pick up the progressive thread over a new trip following a break, while it’s far too soon to be writing off Flora Finch.
1.SEA
23 thejockeyclub.co.uk Sixth Rac e DECLARED RUNNERS 8 2021: SAMMARR 3 9 4 Cameron Noble 15-2 (Roger Varian) 6 ran Hood worn first time by No 4. Hood worn by No 2. Sheepskin Cheek Pieces worn by No 3. Stewards Note:
MEDIAN & RECORD TIME Time: 2 mins, 5.80 secs Time: 2 mins, 0.13 secs New Approach October 2008, Good RACE SPONSORS out more about today’s race sponsors at
finishing 1st,
Probable S.P’s: 11-4 Sea Galaxy (IRE), 9-2 Value Theory (IRE), 11-2 Belhaven (IRE), 8-1 Flora Finch (GB), Thebeautifulgame (GB), 11-1 Suzy’s Shoes (GB), 12-1 Reel Rosie (IRE), 14-1 Crema Inglesa (IRE)
CREMA INGLESA: Following its run on 8/8/2022 it was reported that the horse was slow away and never travelled. BELHAVEN: Following its run on 9/7/2022 it was reported that the horse lost a shoe
or 3rd Handicap races with 16 to 21 runners
finishing 1st, 2nd, 3rd or 4th Handicap races with 22 or more runners: 1/4 odds for finishing 1st, 2nd, 3rd and 4th E: info@thejockeyclub.co.uk W: www.thejockeyclub.co.uk
18th
Record
TODAY’S
find
B
3 MOSTAWAA (GB) (16)
CD 8
Voice
Tom Clover, Newmarket T Doyle & Lord Margadale
Br Ch g
so percentage call
Br Ch g Foxwedge (AUS) Glencal (Compton Place)
B G.
TIMEFORM VIEWLosingsequenceismountingupbutheturnedinbesteffortofthecampaign(inblinkers)whenfourthatDoncaster(1m) since though, is to probably look elsewhere. TFRHHIII BHA79 (51) 10-3503 11-0 (11)
James Harding J O Berkeley Dollar Powell Jonathan Portman, Upper Lambourn T B B. Kennedy & Mrs Ann Marie Kennedy Pump Technology Limited S TIMEFORM VIEW Scored at Bath in June and has remained in good order, best of those ridden prominently when seventh of 16 at Goodwood in July. Not at his best back down in trip at
last month. Unable to back that effort up at Windsor
Mr Ross Birkett J Racing Club HQi
Newmarket Racing Club Ltd S
Mr Sandown since is required. TFRHHHII BHA80 220040 11-1 (18) Poet’s Mumtaza (Nayef (USA))
6
so a bounce back
Mr Henry Main J
J Jockey T Trainer O Owner B Breeder S Sponsor Br Breeding | FACTS | FANCIES | FORM | STATS FO| RM ANALYSIS - A CLOSER LOOK 24 colours no horse age st-lb Draw 1 FAST STEPS (IRE) (19) 532213 D BF 4 11-2 (6) Br B g Footstepsinthesand Inis Boffin (Danehill Dancer (IRE)) Mr Patrick Millman J O Mr Eric Gadsden Rod Millman, Cullompton T B Inis Boffin Syndicate Rod Millman Racing Ltd S TIMEFORM VIEWDeservedlygothisheadbackinfrontatSandown(11/4m)lastmonthandmatchedthatformuppedintripwhenthirdatEpsomsince, justleftwithtoomuchtodoinrelationtothepairthatbeathim.Fanciedtobebangtherewiththecheekpiecesbackon. TFRHHHHH BHA80 2 MARK OF RESPECT (IRE) (27) 012200 4 11-2 (16) Br B g Markaz (IRE) Music Pearl (IRE) (Oratorio (IRE))
O The Haroldians Heather Main, Wantage T Shadwell Estate Company Limited Tote S
O Newmarket
TIMEFORMVIEWWonthiscorrespondingeventbackin2020froma2lbhighermark.Beenrunningrespectablythisterm, his effort one of late gains when third of 7 at Epsom (8.5f) last time No surprise were he to go well. TFRHHHII BHA78 5 ALTERNATIVE FACT (GB) (223) 06056-0 C 7 11-0 (13) Br B g Dalakhani (IRE) O Fourlunda (Halling (USA)) Mr Fletcher Yarham J O The Alternative Lot Ed Dunlop, Newmarket T B Rabbah Bloodstock Limited Ed Dunlop Racing Ltd S TIMEFORM VIEWFailedtomakeanysortofimpactinacoupleofstartsoverhurdles(tooheadstrong)andranpoorlybackontheFlatwhen last seen in February. Has rejoined former yard but plenty of work to do if he’s to snap a twelve run losing sequence. TFRHHIII BHA78 6 RIVER DERWENT (GB) (21) 0-20505 4 11-0 (20) Br B g Kingman Just Wood (FR) (Highest Honor (FR)) Mr Lewis Kent J O Mr R. Moore Mike Murphy & Michael Keady, Westoning T B Al-Baha Bloodstock Four Korners Ltd S TIMEFORMVIEWRespectableeffortonfirststartsinceleavingJosephPatrickO’Brien(25,000gns)whenfifthwiththecheekpiecesrefitted at Windsor 3 weeks ago Mark eases a shade but will need to up his game if he’s so notch a second career victory TFRHHHII BHA78 7 MAYSONG (GB) (9) 212032 5 10-13 (1) Br Ch g Mayson Aldeburgh Music (IRE) (In The Wings) Miss Fern O’Brien J O Beaverbrook Alice Haynes, Newmarket T B Tareq Al Mazeedi Colourpin S TIMEFORM VIEW Resumed winning ways in fine style at Sandown in July and has continued in fine form, running right up to his best when runner-up at Epsom 9 days ago Has to be high on the shortlist with a repeat effort. TFRHHHHI BHA77 8 TYNWALD (GB) (16) 451301 4 10-12 (4) Br B g Toronado (IRE) Queen’s Prize (Dansili) Mr John Reddington J O Mr Richard Hughes Richard Hughes, Upper Lambourn T B The Queen The Garden Cider Company Ltd S TIMEFORM VIEWGainedfirsthandicapwinatHamiltoninJuneanddoubledhistallyforthecampaignunderthisrideratHaydock16daysago,seento goodeffectunderasound-tacticalride Unlikelytogetthingshisownwaytodaybutshouldgiveanothergoodaccount. TFRHHHII BHA76 1m 1f SEVENTH RACE 5.01 THE TURNERS AMATEUR JOCKEYS’ CAMBRIDGESHIRE (CLASS 4 HANDICAP) (Special Rider Conditions) for three yrs old and upwards ™ Total race value £13000 Owners Prize Money. 1st £5532, 2nd £2766, 3rd £1383, 4th £692, 5th £240, 6th £240 (Penalty Value £6364.92) 1 Eliminated Under Rules (I)9 and (I)10 Leading course trainer (17-22): E Dunlop (5 wins from 90 runners, 6%) runs ALTERNATIVE FACT Trainer-in-form (last 14 days): A Watson (4 wins from 16 runners, 25%) runs LUNA MAGIC Weightwatcher: LUNA MAGIC won off a handicap mark of 72, her rating is now down 6lb to 66. Longest Travellers: SIR PLATO & FAST STEPS trained by R Millman, Cullompton, 219 miles.
4 BALGAIR (GB)
Craig Lidster, Easingwold T
15 NIGHT BEAR (GB) (10) 441043
5 10-4 (8) Dragon Pulse (IRE) Contenance (IRE) (Dansant)
Mrs Jo Supple J
Br B g Sir Prancealot (IRE) Dessert Flower (IRE) (Intikhab (USA))
Robert Eddery Newmarket T
T B Coolmore Kevin
25 thejockeyclub.co.uk Se ve nth Rac e
Tony Carroll, Cropthorne T Mill House Racing Limited S Backinhandicapcompanytodayandholdseach-wayclaimsifhecankeephisquirksincheck. HHHII BHA68
Phil McEntee, Newmarket T
10 SIR PLATO (IRE) (20) 120532 8 10-6 (12)
TFRHHHII BHA68
Mr Jason Dixon J
take a
16 MAFFEO BARBERINI (IRE) (41) 604431 3 10-2 (5) Br B g Caravaggio (USA) Rain Goddess (IRE) (Galileo (IRE)) Dr Misha Voikhansky J O Dr M Voikhansky & Mrs S Voikhanskaya
B Newtown Anner Stud EDS Roofing Supplies (Midlands) Limited S
4 10-4 (15)
LE REVEUR (IRE) (9) 014006 D
Br Ch g
O R. Bellamy
Mike Murphy & Michael Keady, Westoning T
O Apollo Horses I & Sarabex
O Jp Racing Club Limited
TIMEFORM VIEW Won small-field AW event in March. Mixed bag since but given a chance by the handicapper today.
TIMEFORMVIEWCapitalisedonfallingmarkinachangeofheadgearatChepstow(7f)inJuneandbesteffortsincewhenrunner-up at Goodwood 20 days ago, typically taking plenty of pushing. One to look out for kept to this trip. TFRHHHII BHA70
Cheekpieces
Br Ch g Galileo Gold Masela (IRE) (Medicean)
Br B g Dream Ahead (USA) Don’t Be (Cape Cross (IRE))
Br B g Oasis Dream Dubai Bounty (Dubai Destination (USA))
5 10-4 (10)
TFRHHHII BHA68
THE
TIMEFORM VIEWGainedjusthissecondsuccessinJulyatHaydockandconfirmedreturntoforminfirst-timecheekpieceswhenthirdinLegerLegends contestatDoncaster10daysago
Br B g Sir Percy Charming (IRE) (Invincible Spirit (IRE))
S TIMEFORM VIEW Fair performer who merely needed to match best to open account in a claimer at Leicester just under 6 weeks ago. This a different kettle of fish altogether today though. TFRHHIII BHA71 17 LUNA MAGIC (GB) (20) 063116 D 8 10-2 (19) Br Br m Mayson Dayia (IRE) (Act One) Miss Brodie Hampson J O Marco Polo Archie Watson, Upper Lambourn T B Lady Jennifer Green Archie Watson Racing Ltd S TIMEFORMVIEWArriveshereingoodorder,landingpairofSalisburyhandicaps(atupto1m)inrecentmonths.Shadebelow her best in hat-trick bid at Goodwood last time but she’s the type who’s likely to bounce back quickly TFRHHHII BHA66 18 VOLTAIC (GB) (20) 420363 D 6 10-1 (14) Br Ch g Power Seramindar (Zamindar (USA)) Miss Sarah Bowen J O SF Racing Club Tony Carroll, Cropthorne T B Deepwood Farm Stud Mill House Racing Limited S TIMEFORM VIEWDualscoreratWolverhampton(8.6f)inFebruarywhohavingslippedbelowhislastwinningmark,ranoneofhisbetter races after 8 weeks off when third at Goodwood last month. Nudged up just 1lb and should remain competitive. TFRHHHII BHA65 19 GALACTIC GLOW (IRE) (105) 0-04655 5 9-7 (2) Br B g No Nay Never (USA) Shine Like A Star (Fantastic Light (USA)) Mr Guy Mitchell J O The Sussex Syndicate Luke Dace, Billingshurst T B D. Boocock Luke Dace S TIMEFORMVIEWLong-standingmaidenwhowasfartooheadstrongtoseeoutthelongertripatLingfieldbackinJune Mark continues to slide but it’s easy to look elsewhere on reappearance. TFRHHIII BHA57
B Mr J. Hughes
Craig Lidster, Easingwold T Mr Oliver Donlon
TIMEFORM VIEW Belatedly showed himself effective on turf when in a first-time visor at Beverley 3 months ago go back on today and needs to sizeable step forward to land this.
11 MASQUE OF ANARCHY (IRE) (19) 005111 6 10-5 (3)
O Newgen Racing Group & Partner
O Carol & David Whymark
5 10-9 (7)
TFR
9
TIMEFORMVIEWOpenedaccountfortheseasonatNottinghaminJuneandfilledherunner-upspotonacoupleofoccasionssince.Unabletomake anyimpactinClass3contestatNewcastlelastmonthbutnosurpriseshouldhebeinvolvedatthebusinessendtoday.
B Noel Finegan Rod Millman Racing Ltd S
Br B g Zoffany (IRE) Dark Crusader (IRE) (Cape Cross (IRE))
TIMEFORM VIEW Completed a hat-trick in amateur events when getting up late in the piece at Ripon 19 days ago. Another career-high mark to defy today but he has to be respected in his current mood. TFRHHHHI BHA69
Mr Eireann Cagney J
O Mr R. J. Creese
12 BAKERSBOY (GB) (36) 534404
13 MENSTONE GEM (IRE) (88) 22-5005 3 10-4 (9)
O M.J Tidball & B.R. Millman Rod Millman, Cullompton T
Mr James Turner J
Mr Matt Brown J
Miss Becky Smith J
B Denniff Farms Ltd
fifth
TFRHHIII BHA73
B Mrs Olivia Hoare Agma Ltd S
14 HOTSPUR HARRY (IRE) (23) 126620
B N. O’Neill
Tote S
Kevin Frost, Newark Frost Racing
B
TIMEFORMVIEWQuirkysortwhowonatDoncasterinJunebutrecenteffortshavebeenlessencouraging,neverlooking keen after a poor start at Chelmsford 9 days ago Has the ability but is best treated with caution. TFRHHIII BHA73
Mr George Eddery J
50
ALTERNATIVE FACT: Following its run on 6/2/2022 it was reported that the horse hung right handed throughout.
LE REVEUR: Following its run on 8/9/2022 it was reported that the horse was slowly away NIGHT BEAR: Following its run on 7/9/2022 it was reported that the horse suffered interference in running.
TFRHHHII BHA
1
Majestic Dawn 26th September 2020, Good TODAY’S RACE SPONSORS find out more about today’s race sponsors at turners-distribution.com
GALACTIC GLOW: Following its run on 4/6/2022 it was reported that the horse ran too freely
Stewards Note:
TIMEFORM PREDICTION: 1.FAST STEPS (IRE) 2.MAYSONG 3.MASQUE OF ANARCHY (IRE) RACE RESULT 1ST 2ND 3RD 4TH RACE TIME DISTANCE
DECLARED RUNNERS 20 2021: GLOBAL ART 6 10 6 Miss Sophie Smith 20-1 (Ed Dunlop) 13 ran Hood worn by No 4. Blinkers worn by No 9, 19 Sheepskin Cheek Pieces worn by No 1, 6, 7, 10, 13, 14.
RIVER DERWENT: Following its run on 27/8/2022 it was reported that the horse hung left-handed under pressure.
Record
26 thejockeyclub.co.uk 20 SONNETINA (GB) (20) 2024-04 6 9-4 (17) Br B m Poet’s Voice Tebee’s Oasis (Oasis Dream) Miss Sophie Smith J O The Good Mixers Denis Coakley, West Ilsley T B Minster Stud Denis Coakley Racing S TIMEFORM VIEWOnlyonewinfrom27Flatrunsbutshowedmorethanonherreappearanceafterafurther12weeksoffwhenfourthatGoodwood lasttime Registeredplentyofsolideffortsindefeatduringlasttermbutshe’slikelytofindafewtoostrongtoday.
Probable S.P’s: 7-1 Fast Steps (IRE), 17-2 Masque of Anarchy (IRE), 11-1 Tynwald (GB), 12-1 Maysong (GB), Sir Plato (IRE), 16-1 Balgair (GB), Luna Magic (GB), Voltaic (GB), 20-1 Night Bear (GB), 22-1 Mark of Respect (IRE), 25-1 Mostawaa (GB), Hotspur Harry (IRE), Maffeo Barberini (IRE), 28-1 Bakersboy (GB), 33-1 River Derwent (GB), The Menstone Gem (IRE), Galactic Glow (IRE), Sonnetina (GB), 40-1 Alternative Fact (GB), 66-1 Le Reveur (IRE)
PLAY SMARTER
Raceform Median
MEDIAN & RECORD TIME Time: 1 min, 47.80 secs Time: min, 46.94 secs
A strong pace has set things up for those ridden patiently in this contest on both previous renewals and with that in mind FAST STEPS is fancied to notch a third win of his career with the cheekpieces reapplied. Maysong is in fine form at present so he’s put forward as the main danger to the selection, while Masque of Anarchy arrives seeking a 4-timer in amateur events so he completes the shortlist in what looks an ultra-competitive finale
Newmarket Racecourses has put in place a number of security and safety measures to ensure your safety, comfort and enjoyment. However an incident may occur which is beyond our control and it is important that you are aware of how we intend to look after you in the event of an emergency. As part of our safety management, we have employed professionally trained and experienced stewards and you will see them at various points throughout the racecourse.
Emergency Procedures
Racing Only:
Entry to the racecourse is subject to the right of the Racecourse Executive to refuse to admit and/or to expel, without prior notice, and person whose behaviour is considered to be unruly or unacceptable or is a disqualified person.
In the event of racing being abandoned, refunds on badges or tickets purchased will only be paid in the following circumstances:
Ladies and Gentleman are encouraged to dress up smartly in the Premier Enclosure, jeans are rarely seen in this enclosure
Chairs are not permitted to be brought into the Premier or Grandstand & Paddock Enclosures in the interest of safety, unless arranged prior to the day on medical grounds
Conditions Of Entry & Abandoned Racing
In the event of a situation which requires partial or full evacuation of the stands or racecourse, announcements will be broadcast and stewards will undertake the responsibility of ushering you to a place of safety; it is essential that you follow their instructions calmly and quickly. Please take your belongings with you and proceed out of the area quickly and calmly with the guidance of the stewards
Abandonment before completion of the first race a full refund will be given Abandonment before completion of the third or feature race, whichever is later a 50% refund will be given Abandonment thereafter no refund will be given No refunds can be issued on the day. Racegoers who purchase in advance over the phone, internet or post will be given an automatic refund Racegoers that purchased tickets on the day need to write to: Ticket Refund Office, Newmarket Racecourses, Westfield House, The Links, Newmarket, Suffolk, CB8 0TG
For more information about our terms and conditions of entry visit our website www.newmarketracecourses.co.uk
When all enclosures are at full capacity there will be strictly NO transfers between enclosures. Grandstand & Paddock and Premier racegoers will not gain access into the Garden Enclosure if full capacity is reached
Picnics can only be enjoyed in the Garden Enclosure (when open and subject to capacity) or the car parks. BBQ’s are not permitted at the racecourse. Bringing your own food or drink into the Grandstand & Paddock or Premier Enclosures is prohibited.
IMPORTANT NOTICES
In Grandstand & Paddock and Garden Enclosures, the dress code is more relaxed.
Dress Code
The evacuation procedures have been carefully planned to lead you to a safe area Should it be necessary to evacuate the course, the most likely scenario is that you will be ushered onto the track itself via the emergency gates. From there you will be held in an area of safety and receive further instructions as appropriate It may give you some peace of mind if you pre plan and agree a meeting place, just in case you become separated from your party The above is precautionary only and we trust that the procedures will never be required. However, please remember in the event of an emergency: TAKE YOUR BELONGINGS WITH YOU. UNDER THE DIRECTION OF THE STEWARDS, PROCEED QUICKLY AND CALMLY TO THE SAFE AREA Racegoers are reminded to keep all their belongings with them at all times, and not to leave any packages unattended Any such packages may be confiscated by the Racecourse Management.
For safety reasons, only assistance dogs are allowed into the racecourse enclosures on racedays For the welfare of dogs, they should not be left unattended in vehicles in the racecourse car parks. Racecourses officials reserve the right to enter vehicles if an animal is in distress
The official photographer is John Hoy. To see any of his images please visit www.hoycubedphotography.com.
Racehorse & Jockey Welfare
The welfare of the sport’s equine and human participants is paramount to British Horseracing. All racehorses competing in Britain are stabled at the premises of trainers who are licensed by The British Horseracing Authority The standards demanded by The BHA of licensed racehorse trainers far exceed those prescribed by animal welfare legislation. The British Horseracing Authority similarly licenses every racecourse, setting high standards for the racing surface and all parts of the course used by competitors, both human and equine BHA Officials are here to ensure that the racecourse delivers those standards. In addition Newmarket Racecourses employs two veterinary surgeons, whose sole responsibility it is to provide care to the horses throughout their time at the racecourse
Racegoers may take photographs for private purposes in the racecourse enclosures. Photography is not permitted in any other area without the permission of the Head of Racing. Under no circumstances may photographs taken on the racecourse be used for publication. Racegoers are reminded that flash photography is not permitted as the flash can alarm horses and may endanger horses, jockeys and public.
Racegoers are reminded that many racedays are given coverage on television, radio and in print, various other forms of media and for Newmarket Racecourses commercial use By entering the Racecourse racegoers are accepting they may appear in such coverage
NEED TO KNOW MORE Want to know about Racing Language, Hints & Tips, New to Racing, Betting information and much, much more visit our website below or scan our QR code jockeyclubracecourses.com/come-racing
Photography
In the event of an incident on the racecourse, any horse affected will receive immediate treatment from the racecourse’s veterinary team. Qualified paramedics and doctors are also on hand in the case of any incident involving a jockey
Health And Safety Notice
If any incident occurs during a race it is routine practice for screens to be erected around the horse or jockey receiving treatment. This is to allow the veterinary or medical personnel to make a safe and accurate diagnosis and so that they may perform any treatment in a private and calm environment. If necessary, horses and riders will be transported from the course to receive further treatment at the nearest equine hospital or Accident & Emergency hospital.
Newmarket Racecourses Official Photographer
The Racecourse would be grateful if you would observe all Health & Safety requirements whilst you are at Newmarket Racecourses. The emergency exits from the bars onto the grandstand steppings are painted yellow and we would request that you do not stop whilst in this area. We would also request that only those that are disabled use the disabled viewing ramp and that parents keep a close eye on all children and prevent them from climbing the running rails and getting on to the actual racecourse We would also like to remind racegoers that the first aid room is located adjacent to the main Premier Enclosure Entrance (Rowley Mile) or Premier Entrance 2 (July Course).
PAGE 24 FOR
SEE PAGE 16 FOR THIS RACE.
TODAY’S RACE CONDITIONS
Third Race 2.41 THE TURNERS HANDICAP STAKES (CLASS 4) Distributed in accordance with the Stakes and Prize Money Code £6696 to the winning horse The second to receive £3143, the third £1572, the fourth £786, the fifth £300 and the sixth £300 for three yrs old only, Rated 66-85 (also open to such horses rated 86 and 87; such horses rated 65 and below are also eligible see Standard Conditions). £60 stake if the horse is rated 66 or higher, or £12 stake if the horse is rated 65 or lower with £48 extra if the horse is declared to run Declare by 10.00 a.m. September 15th. Lowest weight 8st 4lb; Highest weight 9st 9lb Penalties, after September 10th, 2022, for each race won 6lb TURNERS have generously sponsored this race and will kindly present a memento to the winning owner, trainer and jockey In addition, they will award a £200 cash prize to the stable employee responsible for the best turned out horse in this race 26 entries, at £60. Closed September 12th, 2022. Owners Prize Money. Winner £5291; Second £2645; Third £1323; Fourth £661; Fifth £240; Sixth £240. (Penalty Value £6696) SS
SEE PAGE 10 FOR THIS RACE.
Fifth Race 3.51 - THE TURNERS CESAREWITCH TRIAL HANDICAP STAKES (CLASS 2) Distributed in accordance with the Stakes and Prize Money Code £25770 to the winning horse The second to receive £12085, the third £6045, the fourth £3020 the fifth £1510 and the sixth £755. for three yrs old and upwards, Rated 0-105 (also open to such horses rated 106 and 107 see Standard Conditions). Enter by noon, September 12th and pay £250 stake, Declare by 10.00 a.m. September 15th. Lowest weight 8st 2lb; Highest weight not less than 9st 12lb Penalties, after September 10th, 2022, for each race won 3yo 6lb; 4yo to 6yo 5lb; 7yo and up 4lb TURNERS have generously sponsored this race and will kindly present a memento to the winning owner, trainer and jockey In addition, they will award a £200 cash prize to the stable employee responsible for the best turned out horse in this race PLEASE NOTE: In accordance with the provisions of paragraph 9 of the Weights and Handicapping Code a horse must have run three times or more in order to qualify to run in this race 21 entries at £250 Closed September 12th, 2022. Owners Prize Money. Winner £20315; Second £10160; Third £5080; Fourth £2540; Fifth £1270; Sixth £635 (Penalty Value £25770) Weights raised 3lb and paragraphs 27 to 31 of the Weights and Handicapping Code complied with where applicable. SS SEE PAGE 22 FOR THIS RACE.
Seventh Race 5.01 THE TURNERS AMATEUR JOCKEYS’ CAMBRIDGESHIRE (CLASS 4 HANDICAP) (Special Rider Conditions) Distributed in accordance with the Stakes and Prize Money Code £6364 to the winning horse The second to receive £3183, the third £1590, the fourth £796, the fifth £300 and the sixth £300 for three yrs old and upwards, Rated 0-80 (also open to such horses rated 81 and 82; such horses rated 55 and below are also eligible see Standard Conditions). £60 stake if the horse is rated 56 or higher, or £12 stake if the horse is rated 55 or lower with £48 extra if the horse is declared to run Declare by 10.00 a.m. September 15th. Lowest weight: 4-y-o and up 9st 4lb; 3-y-o 8st 13lb Highest weight not less than 11st 2lb Penalties, after September 10th, 2022, for each race won 3yo 6lb; 4yo to 6yo 5lb; 7yo and up 4lb To be ridden by Amateur Jockeys who are members of the Amateur Jockeys’ Association of Great Britain by the deadline for Declaration of Jockeys and on the day of the race and who prior to September 14th, 2022, have ridden one or more winners in races under the Rules of Racing or the Rules of a recognised Racing Authority and have had ten or more rides under the Rules of Racing or the Rules of a recognised Racing Authority TURNERS have generously sponsored this race and will kindly present a memento to the winning owner, trainer and jockey In addition, they will award a £200 cash prize to the stable employee responsible for the best turned out horse in this race NOTE: The highest weight stated above will apply at the entry stage and declaration to run stage regardless of the age of the highest rated horse 30 entries, at £60. Closed September 12th, 2022. Owners Prize Money. Winner £5532; Second £2766; Third £1383; Fourth £692; Fifth £240; Sixth £240 (Penalty Value £6364.92) 1 Eliminated Under Rules (I)9 and (I)10 A SS SEE THIS RACE.
SEE PAGE 18 FOR THIS RACE.
Second Race 2.06 - THE TURNERS FILLIES’ HANDICAP STAKES (CLASS 3) Distributed in accordance with the Stakes and Prize Money Code £8100 to the winning horse The second to receive £3802, the third £1902 and the fourth £951. for three yrs old and upwards fillies and mares only, Rated 76-95 (also open to such horses rated 96 and 97; such horses rated 75 and below are also eligible see Standard Conditions). £75 stake if the horse is rated 76 or higher or £15 stake if the horse is rated 75 or lower with £60 extra if the horse is declared to run Declare by 10.00 a.m. September 15th. Lowest weight: 4-y-o and up 8st 9lb; 3-y-o 8st 5lb Highest weight: 4-y-o and up 10st; 3-y-o 9st 10lb Penalties, after September 10th, 2022, for each race won 3yo 6lb; 4yo to 6yo 5lb; 7yo and up 4lb TURNERS have generously sponsored this race and will kindly present a memento to the winning owner, trainer and jockey In addition, they will award a £200 cash prize to the stable employee responsible for the best turned out horse in this race 17 entries, at £75. Closed September 12th, 2022. Owners Prize Money. Winner £6401; Second £3200; Third £1601; Fourth £800 (Penalty Value £8100) SS SEE PAGE 12 FOR THIS RACE.
Sixth Race 4.26 - THE TURNERS GROUP FILLIES’ HANDICAP STAKES (CLASS 3) Distributed in accordance with the Stakes and Prize Money Code £8100 to the winning horse The second to receive £3802, the third £1902 and the fourth £951. for three yrs old and upwards fillies and mares only, Rated 71-90 (also open to such horses rated 91 and 92; such horses rated 70 and below are also eligible see Standard Conditions). £75 stake if the horse is rated 71 or higher or £15 stake if the horse is rated 70 or lower with £60 extra if the horse is declared to run Declare by 10.00 a.m. September 15th. Lowest weight: 4-y-o and up 8st 9lb; 3-y-o 8st 4lb Highest weight: 4-y-o and up 10st; 3-y-o 9st 9lb Penalties, after September 10th, 2022, for each race won 3yo 6lb; 4yo to 6yo 5lb; 7yo and up 4lb TURNERS have generously sponsored this race and will kindly present a memento to the winning owner, trainer and jockey In addition, they will award a £200 cash prize to the stable employee responsible for the best turned out horse in this race 16 entries, at £75. Closed September 12th, 2022. Owners Prize Money. Winner £6401; Second £3200; Third £1601; Fourth £800 (Penalty Value £8100) SS SEE PAGE 0 FOR THIS RACE.
First Race 1.31 THE TURNERS BRITISH EBF FILLIES’ NOVICE STAKES (CLASS 4) (GBB RACE) Distributed in accordance with the Stakes and Prize Money Code £4320 to the winning horse The second to receive £2028, the third £1014 and the fourth £507. for novice two yrs old fillies only, which are E.B.F eligible Enter by noon, September 12th and pay £40 stake, Declare by 10.00 a.m. September 15th. Weights: 9st 2lb each Penalties, for each Restricted Novice or Maiden race won 3lb For each other race won 6lb (Sellers and Claimers excluded for the purposes of penalties). TURNERS have generously sponsored this race and will kindly present a memento to the winning owner trainer and jockey In addition, they will award a £200 cash prize to the stable employee responsible for the best turned out horse in this race THE TRUSTEES OF THE E.B.F have kindly contributed £1000 towards the prize money for this race 25 entries at £40. Closed September 12th, 2022. Owners Prize Money. Winner £3414; Second £1706; Third £854; Fourth £426. (Penalty Value £4320) SS
Fourth Race 3.16 THE TURNERS PARK HOMES HANDICAP STAKES (CLASS 4) Distributed in accordance with the Stakes and Prize Money Code £6696 to the winning horse The second to receive £3143, the third £1572, the fourth £786, the fifth £300 and the sixth £300 for three yrs old and upwards, Rated 66-85 (also open to such horses rated 86 and 87; such horses rated 65 and below are also eligible see Standard Conditions). £60 stake if the horse is rated 66 or higher, or £12 stake if the horse is rated 65 or lower with £48 extra if the horse is declared to run Declare by 10.00 a.m. September 15th. Lowest weight: 4-y-o and up 8st 7lb; 3-y-o 8st 5lb Highest weight: 4-y-o and up 9st 12lb; 3-y-o 9st 10lb Penalties, after September 10th, 2022, for each race won 3yo 6lb; 4yo to 6yo 5lb; 7yo and up 4lb TURNERS have generously sponsored this race and will kindly present a memento to the winning owner, trainer and jockey In addition, they will award a £200 cash prize to the stable employee responsible for the best turned out horse in this race 26 entries, at £60 Closed September 12th, 2022. Owners Prize Money. Winner £5291; Second £2645; Third £1323; Fourth £661; Fifth £240; Sixth £240 (Penalty Value £6696) SS