A very warm welcome from the whole team here at Cartmel Racecourse – thank you for joining us: we are all very grateful for your support today
We are delighted to host our Family Fun Day – after the fun dinosaur takeover last year, we are happy to welcome Bluey and Bingo here today. You may have been a lucky recipient of a free funfair ticket – I hope you enjoy the thrills and spills of the funfair; a firm favourite I know I would like to hope that we are creating some racing fans of the future as well
Our results today will contribute to the new Summer Jumps Championship – a National initiative brought together by all the racecourses to showcase our very special season of races.
We remain grateful to all of sponsors today :
Hadwins Motor Group
The Friends and Family of John and Tony Connell
The Friends and Family of Caroline (celebrating a big birthday)
Our Charity on site today are Carers Support South Lakes, please do visit their stand and learn a bit more about what they do for the community
I am sure we will see some fierce competition on the track today – I do hope you enjoy your day. Good luck!
Lord Cavendish, Chairman
Cartmel Steeplechases (Holker) Ltd
West Air Ambulance Handicap Chase on Defence Witness, landing the spoils in the last few strides for wife Sam.
Among many others just in behind is newly crowned Champion Jockey Sean Bowen, who has a number of strong rides today.
Our season-long Jockeys’ Challenge began with some Cartmel favourites and first time successes.
Heading the leaderboard is Nathan Moscrop with a win and a second from his 3 rides. In one of a number of exciting finishes Nathan showed his strength to get My Friend Yates up by a head in the Hadwins Maiden Hurdle The 3 points gained for first place and the 2 for second has Nathan at the summit after day 1, but there a plenty of familiar names close behind.
Just 1 point off the lead is Brian Hughes, who will be looking to add to his 77 career Cartmel winners with more success today. Jonathan England shares second place after a power-packed drive in the concluding North
A special mention must go to Ben Smith who gained his first Cartmel win on the appropriately named Fathers Advice for his dad R Mike Smith, on only his second visit to the course. This was perfectly judged patient ride and will be the first of many for Ben.
Another family connection won the Bowness Bay Brewing Handicap with a great ride from Fern O’Brien aboard Springtime Promise. This was for Ferns’ father Fergal and was beautifully timed ride hitting the front entering
Ben Smith
Nathan Moscrop
Brian Hughes Fern O’Brien
TRAINER
CARTMEL TRAINERS’ CHALLENGE
The top 2 in the leaderboard are both there after landing a one-two in races. Plaudits must go to R Mike Smith who landed his 5 points in the most competitive race of the afternoon, the Injured Jockeys Handicap Chase. The winning horse Fathers Advice was ridden by his son Ben, and was the most comfortable winning distance of the day by an impressive 18 lengths With stablemate Euchen Falls chasing him home, this was more notable with the pair being the only runners on the card for the yard
Also win a first and second in the same race was last year’s Cartmel Challenge Champion Trainer Ben Haslam Coqolino led home Horn Cape in the John Fogg Memorial Handicap to see Ben sharing first position after day 1. Ben will be hoping to follow up his win last year but there plenty of powerful yards close behind Mickey Bowen is training in his own name and sits just behind after the win of Fairlawn Flyer in the Old Park Wood Handicap Mickey will be a familiar sight on the winners’ podium this year with the ever popular Bowen family always to be respected with their runners here
The opening Cartmel Sticky Toffee Pudding Novices Hurdle was won by D Day Arvalenreeva for Kevin Phillipart De Foy. This was not only Kevin’s first runner at Cartmel, but was also with his only Jumps horse. It made the long journey from Newmarket worthwhile and we hope to see Kevin back with more runners in the future.
Ben Haslam
R Mike Smith
HOW TO PLACE A BET
PLACE YOUR BETS....
Betting is quite straightforward and can be fun - for as little as £2 There is no fool proof way of picking a winner; the odds and the racecard can give you a good guide but you can also have as much luck picking your horse by the name or colour of the silks.
BET IN TWO WAYS -
1. Betting with the tote - a quick, easy and friendly service You’ll find tote betting points all around the racecourse and it will give you a better choice of bets with the lower minimum stake of £2. Look at the counters for the tote how to bet guides
HOW TO READ
2. Bookies - these are all in front of the Grandstand and take only two bets TO WIN and EACH-WAY The bookies offer ‘odds’ on all the horses and you are best to shop around for the best odds. These are given in fractions, such as 8/1.
THE RACECARD
4
DRESSEDFORSUCCESS(GB)(271) P1/1111- CD 9 11-1
Br B g Dapper - Singalong Sal (IRE)
J
O Mr James Latham James Moffatt, Cartmel T
B Mr C. Dawson
TIMEFORM
1. Horse’s Saddlecloth No
2. Owners Silks/Colours
3. Horse’s Name
4. Colour of horse
B = Bay Br = Brown
Ch = Chestnut Gr = Grey
5. Sex of horse
c = colt g = gelding
f = filly m = mare
6. Sire
7. Dam
8. Country of birth
9. Days since last ran
10 Previous Performances
/ = denotes new season
, = denotes new year
C = Course Winner
11 Age
12. Weight St Lbs
13. BHA Rating
14. Star Rating
STAR RATINGS EXPLAINED. Each horse has been given a star rating, these are defined below: Selected to win the race. Good chance of being placed. By no means out of the reckoning but at least one or two hold stronger claims Unlikely to win but not totally without hope.
CD = Course & Distance Winner
D = Distance Winner
BF = Beaten Favourite Last Time Out
Can be given little or no chance.
Charlotte Jones (5)
MARES’ NOVICES’ HURDLE RACE (CLASS 4) (GBB RACE)
for novice four yrs old and upwards fillies and mares ¨ Total prize fund £7100 Owners Prize Money. 1st £2963, 2nd £1482, 3rd £741, 4th £371. (Penalty Value £3866.66)
Race Description Novice races tend to be for younger horses that are still learning their way over hurdles or fences and allow them to race against each other before graduating up the ranks Horses are classed as a novice if they have yet to win a race, under the respective code, prior to the official start of the season, towards the end of April although for wins between 1st March and the end of the season they may continue to contest novice races until the end of the following October This particular two miles and one furlong novices’ hurdle race is for mares aged four-years-old and upwards.
Race Stats
Leading course trainer (20-25): J Moffatt (34 wins from 199 runners, 17%) runs BITTALEMON Trainer-in-form (last 14 days): D Skelton (8 wins from 28 runners, 29%) runs BELLE LE GRAND
Longest Traveller: PATH OF STARS trained by S Mullins, Amesbury, 265 miles.
BELLELEGRAND(GB)(21) 3/F413-1
6 11-9
Br B m Universal (IRE) - Saaboog Harry Skelton J
O Paddy Brennan Racing Syndicate BLG Dan Skelton, Alcester T
B Newstead Priory Stud Morson Group S
TIMEFORM VIEW Irish bumper winner who made a successful hurdle debut in 2m Warwick maiden 3 weeks ago. This looks a very good opportunity for her to make it 2-2 in this sphere TFR##### BHA2
ANOTHERPEARL(GB)
(32) 6/565- 5 11-2
Br B m Blue Bresil (FR) - Hollies Pearl
O Roy & Louise Swinburne
Sean Bowen J
Georgina Nicholls, Kingston Lisle T
B James and Jean Potter Ltd Trygunn Limited S
TIMEFORM VIEW Signs of ability in bumpers but well held on Bangor hurdle debut last month. Sean Bowen rides but still hard to be too positive about her prospects. TFR##!!! BHA-
COEURDECOEURS(GB)
(271) 6 11-2
Br B m Mondialiste (IRE) - Blushing Heart
William Maggs (5) J
O Mrs Sarah Pearson Neil Mechie, Middleham T
B Mrs S. M. Pearson Catton Hall S
TIMEFORM VIEW Little form at best on the Flat and likely outsider on hurdle debut after 9 months off TFR#!!!! BHA-
(17) 40P35-0 5 11-2
Br Ch m Ulysses (IRE) - Flood Warning
Mr John Dixon (7) J
O Mrs M. Chapman Michael Chapman, Market Rasen T
B Cheveley Park Stud Limited
TIMEFORM VIEW Fully exposed now and remains vulnerable in any company TFR#!!!! BHA76
Br Gr m Outstrip - Absent Amy (IRE)
Aaron Anderson (5) J
O Hill House Racing Club Jessica Bedi, Yarm T
B Mr Nigel Hardy
TIMEFORM VIEW Modest maiden on Flat (stays 2m). Likely outsider now hurdling TFR#!!!! BHA-
(62) 600-
Br B m Kodiac - Welsh Anthem Jack Hogan J
O Daniel Shapiro & David Clifford
B Luke & Adam Morgan
Ben Haslam, Middleham T
TIMEFORM VIEW AW Flat winner but no show in 3 hurdles over the winter TFR#!!!! BHA-
(236)
Br Ch f Dubawi (IRE) - Bizzarria
O Mr Darren Naylor
Charlotte Jones J
James Moffatt, Cartmel T
B Hascombe & Valiant Stud Ltd Tote S
TIMEFORMVIEW Fair 1 1/2m Flat winner for William Haggas. Bought for 28,000 gns in December Should be up to making an impact in a race like this now hurdling. Wears first-time cheekpieces (blinkered for Flat win). TFR###!! BHA-
Br Breeding O Owner B Breeder J Jockey T Trainer S Sponsor
Br B f Maxios - Tri Na Ceile (IRE)
O Mr John P. McManus
B Mrs Noreen McManus
9
Richie McLernon J
Ben Haslam, Middleham T
TIMEFORM VIEW Placed on second of 2 starts in Irish points (Mar 30). Starts out over hurdles in a weak race and it’ll be interesting to see what the betting makes of her TFR###!! BHA-
PATHOFSTARS(FR)
(218) 6633- 4 10-10
Br B or Br f Masar (IRE) - Amelia May
O Simon & Christine Prout
B S.C.E.A. Le Haras D’Haspel
Micheal Nolan J
Seamus Mullins, Amesbury T
We Do Vans S
TIMEFORM VIEW Well beaten in an AW Flat maiden for the Crisford stable last May and little form at best over hurdles since, finishing a remote third in a couple of juveniles when last seen in October. TFR##!!! BHA74
DECLARED RUNNERS 9
2024: IRISH LULLABY 5 11 9 Henry Brooke 4-7 (Oliver Greenall & Josh Guerriero) 6 ran
Sheepskin Cheek Pieces worn first time by No. 7. Tongue Strap worn by No. 1.
ProbableS.P’s: 1-3 Belle Le Grand (GB), 10-1 Bittalemon (GB), 14-1 First Ever (IRE), 20-1 Another Pearl (GB), 25-1 Path of Stars (FR), 80-1 Raincloud (GB), 100-1 Somebodycomegether (GB), Violeta (IRE), 150-1 Coeur de Coeurs (GB)
Recent Warwick winner BELLE LE GRAND should prove a tough nut to crack for team Skelton. Flat winner Bittalemon and Irish point recruit First Ever can battle it out for the forecast spot. TIMEFORM
RACE RESULT TIME:
GREAT BRITISH BONUS SCHEME
The Johnny & Tony Connell
Memorial Handicap Hurdle
Friends and family of Johnny & Tony Connell have been visiting Cartmel for over 40 years and are very pleased to be supporting Cartmel Races today
Never a dull moment – proud to have shared our lives with you - both very sadly missed
Tony Connell ~ 06/01/1949 – 01/0ò/201ß ~ Johnny Connell ~15/02/1969 – 2ò/09/202ß ~
We wish everyone an enjoyable day at the Races!
5)
for four yrs old and upwards ¨ Total prize fund £6250
Owners Prize Money. 1st £2484, 2nd £1242, 3rd £621, 4th £311, 5th £155, 6th £77. (Penalty Value £3251.87) 16 Eliminated Under Rules (I)9 and (I)10.
Race Description This is a two miles and six furlongs handicap hurdle race for four-year-olds and upwards which have been rated from 0 to 100. In a handicap the weight that each of the runners carries is determined by their official handicap rating which is based on their level of form shown so far The aim is to ensure competitive racing by asking the higher rated horses to carry more weight than lower rated rival. As a guide, horses rated 60 tend to be at the lower end of the scale whilst the very best performers would be rated as high as 170.
Leading course trainer (20-25): J Moffatt (34 wins from 199 runners, 17%) runs SECRET SECRET & SKY LUNA
Trainer-in-form (last 14 days): D Skelton (8 wins from 28 runners, 29%) runs SUPREME YEATS
Longest Traveller: MILITARY TYCOON trained by N Mulholland, Limpley Stoke, 246 miles.
SUPREMEYEATS(IRE)(278) 55/1B52- D 9 12-0
Br B g Yeats (IRE) - Supreme Bailerina (IRE)
Harry Skelton J
O The Old Stag Racing SY Partnership Dan Skelton, Alcester T
B Pigeon Park Stud The Air Ambulance Service (Warks & Northants), Ladbrokes S
TIMEFORMVIEWBacktosomewherenearhisbestwhenscoringonstabledebutatStratfordlastJunebutoff for9monthssinceasolidsecond of 12 in handicap hurdle at Worcester (20f, good). Has won when fresh though so can make his presence felt. TFR##### BHA100
THENAVIGATOR(GB)
(22) 500053- C 10 12-0
Br Gr g Mastercraftsman (IRE) - Blessing (USA)
O Mr G. H. Bell
Henry Brooke J
Dianne Sayer, Penrith T
B Sir Robert Ogden Tote S
TIMEFORMVIEWVeteranwhobagged3morehandicapwins(oneatthiscourse)inthefirsthalf of lastseason.ReturnedfromaspellinthedoldrumswhenthirdatCarlisleon latesthurdlesouting(17f)havebeensuitedbyawell-runrace NeverlandedablowbackonFlatlasttimebutnotruledoutbackhurdling TFR###!! BHA100 3
ASCENSIONDAY(IRE)
(20) 2456P-0 8 11-11
Br B g Imperial Monarch (IRE) - Toulon Breeze (IRE)
O Longdogs Brussel Sprouts
B Eric Barrett
Jack Hogan J
Ben Haslam, Middleham T
TIMEFORMVIEWRunner-up3timesonthebounceoverhurdlesinfirsthalf of 2024butlosthiswayforShaunLycett.Probablyneededtherunof finalstartfor thatyardearlierthismonth.Markisslippingandnosurprisetoseehimbouncebackuppedintriponfirststartforcapableyard. TFR###!! BHA97
BALALLYPARK(IRE)
(171) 50/0604- 6 11-11
Br B g Walk In The Park (IRE) - Endless Moments (IRE)
Nathan Moscrop J
O Miss Maria D. Myco Rebecca Menzies, Sedgefield T
B Pate Ltd Bluegrass Horse Feeds S
TIMEFORMVIEWEx-Irishmaidenhurdlerwhoshapedasif backinformwhenfourthinmaidenhurdleatSedgefieldinDecember Hoodnow added to the tongue tie and cheekpieces he wore that day and is on a fair mark if ready to roll after 171 days off TFR####! BHA97
EVENWOODSONOFAGUN(IRE)
(49) 256144- 7 11-9
Br B g The Gurkha (IRE) - Ravish Sean Quinlan J
O Mrs D Chapman & Mrs E Quinlan Lizzie Quinlan, Appleby-in-Westmorland T
B Glenvale Stud & Edgeridge Ltd Bolton Mill Holiday Park S
O Garry Thexton & Chris Grant Chris Grant, Billingham T
B T. C. Dawson www.chrisgrantracing.com S
TIMEFORMVIEWFairlyconsistentmaidenbuthasbeenonthegosinceOctoberandranbelowforminafirsttimetongue strap when third in a 6-runner handicap at Sedgefield (19.8f) earlier this month. Others preferred. TFR##!!! BHA94
Br B g Born To Sea (IRE) - Maughami Charlotte Jones J O The Secrets James Moffatt, Cartmel T B Miss Annmarie Burke The Sheroot Partnership, The Vilprano Partnership S TIMEFORMVIEWTwiceawinneratthistrack,themostrecentcominginconvincingfashionlastJuly Hasn’t
Br Breeding O Owner B Breeder J Jockey T Trainer S Sponsor
(2) 123PP-0 8 11-7
Br B m Snow Sky - Bay of Islands (IRE)
O Mr M. Scott
B Pat Morrissey
Leah Noreci (10) J
James Moffatt, Cartmel T
TIMEFORM VIEW Lightly-raced maiden. Seventh of 8 in novice hurdle at this C&D (good, 15/2) 2 days ago. Has work to do TFR##!!! BHA93
PATEEN(IRE)
(210) 401P30- CD
Br B or Br g Vinnie Roe (IRE) - Richards Claire (IRE)
O Hill House Racing Club
B John Joe Brady
13 11-5
Joshua Thompson (7) J
Jessica Bedi, Yarm T
TIMEFORM VIEW Veteran C&D winner isn’t the easiest to catch right, followed creditable run with a below-par one when well beaten at Ayr (19.5f) in October Has gone well fresh in the past but isn’t one to hang your hat on. TFR##!!! BHA91
STARVANTAGE(IRE)
(23) 25424-4 8 11-5
Br B g Ocovango - Laura’s Star (IRE)
O Holmfirth Racing
Aaron Anderson (5) J
Rebecca Menzies, Sedgefield T
B Miss Laura Sleator J S Landscapes, Bluegrass Horse Feeds S
TIMEFORM VIEW Fairly treated on the best of her old form but this maiden has plenty to prove (in terms of attitude and form) after pulling up back over hurdles when last seen in December TFR##!!! BHA90
TOPKAPISTAR(GB)
(33) 14P100-
Br B m Golden Horn - Burlesque Star (IRE)
O Mclafferty,Whillans &Topkapi Partnership
B Christopher Johnston Bloodstock
8 11-3
Peter Kavanagh (3) J
Ewan Whillans, Hawick T
Sport Of Kings Classic Racewear S
TIMEFORM VIEW Best performance for a while when scoring in comprehensive style at Ayr (21.4f) in January, seemingly benefitting from first time headgear Not in same form subsequent two starts and probably needs further leniency from the handicapper TFR##!!! BHA89 14
KAJAKI(IRE)
(66) 453420-
Br Gr g Mastercraftsman (IRE) - No Quest (IRE)
O Tarzan Bloodstock
12 11-2
Danny McMenamin J
Nicky Richards, Greystoke T
B Epona Bloodstock Ltd Equine Products Ltd (Equine Nutrition) S
TIMEFORMVIEW Over 2 years since this veteran last got his head but heshaped as if still in goodform when tenth of 15 at Musselburgh (23.8f) in March when stretched by the longer trip Visor refitted and has place prospects dropping back in trip TFR####! BHA88
DECLARED RUNNERS 14
Visor worn by No 14.
Tongue Strap worn by No. 5, 6, 10.
Hood, Tongue Strap worn by No 4, 7.
Visor, Tongue Strap worn by No 9.
2024: PATEEN (IRE) 12 10 13 Aaron Anderson 16-1 (Jessica Bedi) 13 ran
Sheepskin Cheek Pieces worn by No 4, 5, 11, 12, 13
Running for the first time since Wind Surgery No. 5.
Probable S.P’s: 9-2 Supreme Yeats (IRE), Military Tycoon (IRE), 10-1 The Navigator (GB), Evenwood Sonofagun (IRE), 12-1 Ascension Day (IRE), Vanilla Dancer (GB), Star Vantage (IRE), 20-1 Secret Secret (IRE), 22-1 Topkapi Star (GB), 25-1 Sky Luna (IRE), Kajaki (IRE), 28-1 Balally Park (IRE), Pateen (IRE), 33-1 Lady Mendoza (IRE)
A competitive fare in which SUPREME YEATS can claim another victory following a break, just as he did when back to somewhere near his best on debut for this yard last year Military Tycoon has looked a different proposition in his most recent starts for Neil Mulholland and could be open to further improvement, with Balally Park and Kajaki both worthy of consideration from their falling handicap marks TIMEFORM PREDICTION:
KENDAL, CUMBRIA
are pleased to support and supply
(CLASS 2) (GBB RACE)
for four yrs old and upwards ¨ Total prize fund £30000
Race Description This is a three miles and one furlong handicap hurdle race for four-year-olds and upwards To qualify for a handicap rating horses must have won a race, been placed twice or raced at least three times in order for the handicapper to gauge the level of form shown. This rating then dictates the weight to be carried in a handicap
Leading course trainer (20-25): J Moffatt (34 wins from 199 runners, 17%) runs OUR SAM & SEA THE CLOUDS
Trainer-in-form (last 14 days): D Skelton (8 wins from 28 runners, 29%) runs MOSTLY SUNNY
Weightwatcher: OUR SAM won off a handicap mark of 115, his rating is now down 6lb to 109.
Fancy That: G Hanmer won this race in 2018, 2021 and 2022. The stable runs WBEE today.
Longest Traveller: TOMMIE BEAU trained by S Mullins, Amesbury, 265 miles.
TIMEFORM VIEW Enjoyed productive spring/summer campaign in 2022, winning 4 times (including here), and added 2 more handicaps to his tally during the winter that followed.BetterthaneverwithanothersuccessatDoncasterinFebruary2024,butshapedasif amissatAintreenexttimeandabsentsince TFR##!!! BHA130 3
DINONS(FR)(31) 1P12P0- 12 11-7
Br B g Balko (FR) - Beni Abbes (FR)
O Mr Joseph Bell & The Gilberts
7
Craig Nichol J
Brian Ellison, Malton T
B S.C.E.A. de Maulepaire Brian Ellison Racing Limited, Straightline (NE) Ltd S
TIMEFORMVIEWDidwellfornewyardwhenreturningfromalengthyabsencein2024,bagginghandicapsatHexhamandUttoxeter Alsowentcloseatthe former course during the autumn, but his effortsat Aintree and Perthbackfrom a break last month left muchtobe desired. TFR##!!! BHA128
WBEE(IRE)(302) 125//300- CD
Br B g Yeats (IRE) - Consultation (IRE)
10 11-6
Sean Bowen J
O Mrs D. Ritson Gary Hanmer, Tattenhall T
B Mr Cal Flavin
TIMEFORMVIEWWinnerof thisracein2021and2022,butfailedtobuildonhisencouragingreturnfromalengthyabsencelastsummerin2subsequent appearances Hopes pinned on the return to this track helping to spark a return to form back from a 10-month absence TFR##!!! BHA127
UPFORPAROL(IRE)
(72) 23/2156- 9 11-5
Br B g Flemensfirth (USA) - Clarification (IRE)
Gavin Sheehan J
O Duck Jordan Wright Dellar Doel Woodward Jamie Snowden, Lambourn T
B Mrs Deborah Hobson BetVictor S
TIMEFORM VIEW Capitalised on falling handicap mark and ended long losing sequence when successful in a 9-runner handicap at Ffos Las (3m, heavy) in January, quickeningclear BynomeansdisgracedinavaluablecontestatUttoxeter(23.3f,soft)lasttimeandhe’snotwithouteach-wayhope TFR###!! BHA126
TIMEFORM VIEW Won 3 on the bounce early last year, but his mark inevitably suffered as a result of that hat-trick and he’s been more miss than hit since, including when well held in this race 12 months ago. Visor applied. TFR##!!! BHA120 BETS AVAILABLE ON THIS RACE
Rebecca Menzies, Sedgefield T
Nathan Moscrop J O Club Racing Curley Partnership
B Mrs Mary Tyner Bluegrass Horse Feeds S
Br Breeding O Owner B Breeder J Jockey T Trainer S Sponsor
IMPERIALDATA(IRE)
Br B g Imperial Monarch (IRE) - Rindoon’s Sister (IRE)
O Mr E. A. Brook
Brian Hughes J
Rebecca Menzies, Sedgefield T
B Joe & Mel Power Bluegrass Horse Feeds S
TIMEFORM VIEW Has proved pretty consistent under Rules, adding to her 3 wins in 2023 when coming from off the pace to land a 2 3/4m handicap here (soft) last May. Largely creditable efforts in defeat since and this step up in trip looks a good move. TFR####! BHA120
MOSTLYSUNNY(IRE)
(16) 50512-4
Br Ch g Zarak (FR) - Belle Above All
O Mighty Macs Syndicate
B Mrs D J James
6 10-12
Harry Skelton J
Dan Skelton, Alcester T
TIMEFORMVIEWReturnedtoformwithfirst-timecheekpiecesaddedwhenscoringatPlumpton(20.5f,goodtosoft)lastmonth.Solideffortsin defeat at Sandown and Haydock since and should give another good account, for all that he’s edging up the weights TFR###!! BHA119
MUSIQUEDEFEE(IRE)
(2) 3112-13
Br Gr m Jukebox Jury (IRE) - Fairy Tale (FR)
6 10-12
Joshua Bryan J
O Ms M. L. Peterson Georgina Nicholls, Kingston Lisle T
B Vambeck Bloodstock Ltd Revival Solutions Group Limited S
O Carnaby, Thomson & Smith R. Mike Smith, Galston T
B Eamonn Bracken Tote S
TIMEFORM VIEW Improved when landing a couple of Perth handicaps within the space of 10 days last summer Raised his game another notch when belying oddsof 50/1inavaluablecontestatthePunchestownFestival,butthis10lbhighermarkcallsforanotherjoltof improvement. TFR###!! BHA115
CITYDERBY(IRE)
(48) 324054- CD
Br Ch g Ask - Reine d’Or (IRE)
9 10-4
Sean Quinlan J
O Fools Who Dream Partnership Lizzie Quinlan, Appleby-in-Westmorland T
B Mr & Mrs P. Haughey Bolton Mill Holiday Park, Eden Commercials Cumbria Limited S
TIMEFORMVIEWLookedbetterthaneverfollowingawindopatthiscourselastyear,winning4onthebounce,including2overthisC&D Shouldcomeon for last month’spipe-opener at Carlisle (19.3f,good)and merits respectreturned tothis course andmoving backup in trip TFR###!! BHA111 14
OURSAM(GB)
(102) 504FP0- CD
Br B g Black Sam Bellamy (IRE) - Arisea (IRE)
O Paul Bartlett & DJM
B Mr B. Walton & Mr P. Bartlett
9 10-2
Danny McMenamin J
James Moffatt, Cartmel T
TIMEFORM VIEW Back-to-back C&D winner in 2023 and wasn’t disgraced when fifth of 12 to Tommie Beau in this race 12 months ago. However, it’s been all downhill since and hopes now pinned on the addition of cheekpieces sparking a return to form. TFR#!!!! BHA109
DECLARED RUNNERS 14
2024: TOMMIE BEAU (IRE) 9 11 8 James Best 10-3 (Seamus Mullins) 12 ran Visor worn first time by No 7. Sheepskin Cheek Pieces worn first time by No 14. Tongue Strap worn by No 6, 7, 14. Sheepskin Cheek Pieces worn by No 3, 6, 8, 9, 10, 11, 13.
Probable S.P’s: 11-2 Mostly Sunny (IRE), 6-1 Musique de Fee (IRE), 7-1 Buy Some Time (IRE), 8-1 Tommie Beau (IRE), 17-2 Olivers Travels (IRE), 11-1 Imperial Data (IRE), 14-1 Up For Parol (IRE), City Derby (IRE), 22-1 Johnson’s Blue (IRE), 25-1 Wbee (IRE), Sea The Clouds (IRE), 28-1 Dinons (FR), 40-1 Curley Finger (IRE), 50-1 Our Sam (GB)
The vote goes to OLIVERS TRAVELS, who has found just one too good in a couple of handicap chases since returning from a break and he may well exploit a lower mark in this sphere This step back up in trip and booking of Brian Hughes are positive factors where Imperial Data is concerned and he is second choice ahead of Mostly Sunny and last year’s winner Tommie Beau.
GREAT BRITISH BONUS SCHEME
FOURTH RACE | 4.05
for ten yrs old and upwards ¨ Total prize fund £14650 Owners Prize Money. 1st £5917, 2nd £2958, 3rd £1480, 4th £740, 5th £369. (Penalty Value £7736.66)
Race Description This is a three miles and five furlongs handicap steeple chase for ten-year-olds and upwards veterans which have been rated from 0 to 135. Once a horse has qualified for a handicap rating this is regularly reassessed. A below par effort could result in a reduced rating whilst a strong performance could see the rating increased. Occasionally, horses are entered to race before their handicap rating has been reviewed and so to avoid recent winners being un-penalised they are allotted a mandatory penalty – usually 7lb.
Leading course trainer (20-25): B Haslam (19 wins from 91 runners, 21%) runs ILIKEDWAYURTHINKIN
Trainer-in-form (last 14 days): M Bowen (3 wins from 12 runners, 25%) runs EQUUS DANCER & SIBERIAN STAR
Weightwatcher: AMATEUR won off a handicap mark of 122, his rating is now down 5lb to 117.
Longest Traveller: MORODER trained by S Mullins, Amesbury, 265 miles.
2/P41P-0
Br B g Morozov (USA) - Another Tonto (IRE)
James Best J
O Mrs Ann Leftley Seamus Mullins, Amesbury T
B Michael Conlon
We Do Vans S
TIMEFORM VIEW 33/1 winner in the Grimthorpe Handicap Chase at Doncaster in March, his first victory since taking the same race in 2023. Below-par twice since though and needs new headgear to spark him back into life returned to veterans’ company TFR###!! BHA129
Br B g Yeats (IRE) - Sway (FR)
Richie McLernon J
O Mr John P. McManus Ben Haslam, Middleham T
B Mrs Noreen McManus
TIMEFORMVIEWDidwelllastseason,with2of his4winsinhandicapchasescominghere Shapedasif amissintheEiderwhenlastseen in February but had run well off this mark at Ayr prior to that and must be respected returning at this venue. TFR##### BHA129
EQUUSDANCER(IRE)
(20) 010/3/6-4 11 11-4
Br B g Jeremy (USA) - Celtic Cailin (IRE)
O Mr Roddy Owen
Sean Bowen J
Mickey Bowen, Haverfordwest T
B Patrick Keating Foodnet Ltd S
TIMEFORMVIEWWon5outof 6startsina2-yearperioduptoMarch2023butlightlyracedsince,offeringlittlein2runs back this spring (well backed for similar race at Fakenham 3 weeks ago). Steps up in trip now. TFR###!! BHA119
(31) PPP540- 12 11-2
Br Ch g Giant’s Causeway (USA) - Adja (IRE)
O Burnham P & D Ltd
Connor Brace J
John & Rhys Flint, Bridgend T
B Dayton Investments Ltd Burnham Plastering & Drylining Ltd S
TIMEFORM VIEW Good record at Ffos Las but has deteriorated since his latest success there a year ago. Change of headgear TFR##!!! BHA117
FUJIFLIGHT(FR)
(33) 5P344//3- 10 11-2
Br B g Day Flight - Silverlea (FR)
O George and Drury
Charlie Deutsch J
Venetia Williams, Hereford T
B Mr Jacques Cypres & Mr Laurent Couetil Faucets Limited S
TIMEFORM VIEW A useful winning chaser in 2022 and should have come on for his first run in 2 years at Ludlow last month. Lazy sort but on a career-low mark for first run in a veterans’ handicap and can go well if he
TFR####! BHA117
(9) 43504-0 11 11-0
Br B or Br g Network (GER) - Triple Star (FR)
O The Ridgeway Racing For Fun Partnership
B Bruno Vagne
Jack Quinlan J
Neil King, Burderop T
TIMEFORMVIEW Veteran on a losing run that stretches back to 2021 and well held in 2 runs for new yard (both hurdles and fences). Tongue tie back on. TFR##!!! BHA115
Br Breeding O Owner B Breeder J Jockey T Trainer S Sponsor
DECLARED RUNNERS 7
2024: MILL GREEN 12 12 2 Nico de Boinville 15-8 (Nicky Henderson) 4 ran
Visor worn first time by No 1. Blinkers worn by No 4. Tongue Strap worn by No 7. Visor, Tongue Strap worn by No 6. Sheepskin Cheek Pieces worn by No 2, 3, 7.
Stewards Note:
ILIKEDWAYURTHINKIN: Following its run on 22/2/2025 it was reported that the horse weakened quickly in home straight.
ILIKEDWAYURTHINKIN did well over these fences last summer and is selected to make a winning return on his first go in a veterans’ handicap Fuji Flight is feared most ahead of Siberian Star.
TIMEFORM PREDICTION: 1.ILIKEDWAYURTHINKIN (IRE) 2.FUJI FLIGHT (FR) 3.SIBERIAN STAR RACE
UNAUTHORISED BOOKMAKING
It is a condition of entry to this Racecourse that only individuals in possession of a valid betting badge and occupying an authorised pitch are entitled to lay bets in the course of their business. Any individual found contravening these conditions will be evicted.
ABBREVIATIONS
BF - BEATEN FAVOURITE B - BROUGHT DOWN C - COURSE WINNER
- DISTANCE WINNER
- FELL P - PULLED UP R - REFUSED S - SLIPPED UP U - UNSEATED
THE CAROLINE’S BIG BIRTHDAY CELEBRATION HANDICAP STEEPLE CHASE (CLASS 3) (GBB RACE)
for five yrs old and upwards ¨ Total prize fund £14300
Owners Prize Money. 1st £5684, 2nd £2841, 3rd £1421, 4th £711, 5th £355, 6th £177. (Penalty Value £7440.29) Weights raised 6lb and paragraph 34 of the Weights and Handicapping Code complied with where applicable
BETS AVAILABLE ON THIS RACE
Race Description This two miles, one furlong handicap steeple chase has been designed for fiveyear-olds and upwards which are rated from 0 to 140. In most National Hunt handicaps, there is a minimum weight of 10st so any horse whose official rating would allocate them less than that still has to shoulder that burden. The horses that fall into this category are said to be racing from ‘out of the handicap’ – usually a distinct disadvantage.
Leading course trainer (20-25): J Moffatt (34 wins from 199 runners, 17%) runs CUZCO DU MATHAN
Trainer-in-form (last 14 days): S England (4 wins from 18 runners, 22%) runs GLORY AND HONOUR
Longest Traveller: SIR TIVO trained by G Hanmer, Tattenhall, 111 miles.
SPECIALRATE(IRE)
(37) U05224- CD 8 12-0
Br B g Valirann (FR) - Estuary Princess (IRE)
Sean Quinlan J O Quinn Lizzie Quinlan, Appleby-in-Westmorland T
B Francis Flynn
TIMEFORM VIEW Enjoyed a most productive campaign over hurdles/fences last term, winning 7 from 10 starts for Philip Kirby. Below par initially for this yardbut backonthe right trackwith a brace of runner-up effortsthis spring Backward stepat Carlisle amonth ago,though. TFR###!! BHA124
ARTHUR’SQUAY(IRE)
(93) P60561- C D 11 11-13
Br B g Beat Hollow - Bannow Girl (IRE)
O Mr John P. McManus
B Mr Jonathan Deacon
Richie McLernon J
Ben Haslam, Middleham T
TIMEFORMVIEW Successful in back-to-back handicaps in 2023 but struggled for form at the end of last year Cashed in on falling mark/ drop in class to win 5-runner handicap at Newcastle in February. Off since and isn’t the easiest to predict. TFR###!! BHA123
SIRTIVO(FR)
(163) 5424P0- D 11 11-7
Br B g Deportivo - Miss Possibility (USA)
O Mrs J. A. Ashley
B Mr Christophe Jouandou
Sean Bowen J
Gary Hanmer, Tattenhall T
TIMEFORM VIEW Won twice in a light 2023 but only gave his running twice in a busier campaign last year, weakening tamely at Doncaster when last seen in December Given a major chance by the assesosr on return and Sean Bowen is a very positive booking TFR####! BHA117
TIMEFORMVIEWUsefulhandicapchaseratbestbutlittleimpactinhandfulof startsforGordonElliott.Quicklydroppedalongwayintheweights having failed to arrest the slide for current connections but much more like it when second at Carlisle a month ago. TFR###!! BHA114
CUZCODUMATHAN(FR)
(273) 15/6121- CD 7 11-2
Br Gr g Martaline - Thisbee du Mathan (FR)
O Mr Thomas Gardner
Charlotte Jones J
James Moffatt, Cartmel T
B Mr Jean-Marie Baradeau Fitzdares Limited, Fitzdares S
TIMEFORM VIEW Cartmel regular who won a brace of C&D handicaps in a 4-race campaign in 2024/25. Upp 5lb on first run for 9 months but sure to be well prepared for this. TFR####! BHA112
DISCOANNIE(IRE)(2) 6250-44 D BF 7 10-11
Br B m Court Cave (IRE) - Betty Beck (IRE) Nathan Moscrop J
O Graham & Christine Seward
Rebecca Menzies, Sedgefield T
B Mr Michael Halpin Bluegrass Horse Feeds S
TIMEFORM VIEW Fourth of 5 in handicap chase at this C&D (good, 9/4) 2 days ago. Others more persuasive. TFR###!! BHA107
Br Breeding O Owner B Breeder J Jockey T Trainer S Sponsor
DECLARED RUNNERS 7
2024: AL ZARAQAAN 7 11 11 Jonathan England 4-1 (Sam England) 8 ran
Visor worn by No 6. Tongue Strap worn by No 1, 2, 3, 4. Hood, Tongue Strap worn by No 5, 7.
Sheepskin Cheek Pieces worn by No 3.
Probable S.P’s: 10-3 Arthur’s Quay (IRE), 4-1 Glory And Honour (IRE), 5-1 Cuzco du Mathan (FR), 13-2 Grey Diamond (FR), 8-1 Disco Annie (IRE), 9-1 Special Rate (IRE), Sir Tivo (FR)
This looks trappy but GLORY AND HONOUR finds himself on his last winning mark and representing an in-form yard, he could be the way to go Cuzco du Mathan lacks a recent run but is sure to be well prepared for this by his local handler, with Sir Tivo also of some interest with Bowen booked.
3) (GBB RACE)
for five yrs old and upwards ¨ Total prize fund £13100
Race Description The penultimate race this afternoon is a two miles and five furlongs handicap steeple chase for five-year-old and upwards which have been officially rated 0-130. As in all handicaps on this afternoon’s card the weight that each runner carries is determined by their official handicap rating In this instance, a horse rated 130 would be required to carry 5lb more than a rival rated 125.
Leading course trainer (20-25): D Sayer (14 wins from 76 runners, 18%) runs CHARLIE UBERALLES
Trainer-in-form (last 14 days): R Menzies (3 wins from 15 runners, 20%) runs DALYOTIN & HIGH MOON
Longest Traveller: REXEM trained by J Mcconnell, Ireland.
REXEM(IRE)(32) 4210/05- 8
Br B g Leading Light (IRE) - Jim’s Article (IRE) Callum Pritchard (5) J
O Mr D. Kierans John McConnell, Ireland T
B Pat Kinsella
TIMEFORMVIEWFairlyusefulhurdlerandconfirmedpreviouspromiseoverfenceswhenwinningnovices’handicapatLudlow(20.1f,good)inOctober 2023. Restricted to just 3 runs since and nowhere near that level. Still commands respect given yard he represents TFR####! BHA131
TIMEFORM VIEW Held off subsequent Great Yorkshire winner Docpickedme by a neck at Doncaster in December Made a better fist of things than being pulled up might suggest at Kempton next time but harder to excuse latest Aintree run. TFR###!! BHA126
DALYOTIN(FR)
(706) 20P61/P/- D 9 10-13
Br B g Poliglote - Dalyonne (FR)
O Gay and Peter Hartley
Nathan Moscrop J
Rebecca Menzies, Sedgefield T
B Mr Gilles Le Baron Bluegrass Horse Feeds S
TIMEFORM VIEW Off the mark over fences at Sedgefield (21f) in March, 2022, but pulled up when last seen out in claiming chase at Clairefontaine (19.4f, soft) the following June In good hands but well-being has to be taken on trust. TFR###!! BHA115
CAPTAINIVAN(IRE)
(37) 054121- 11 10-10
Br Ch g Stowaway - Western Starlight (IRE)
O Racing On Together Club
Craig Nichol J
Ewan Whillans, Hawick T
B G. Foley Sport Of Kings Classic Racewear S
TIMEFORM VIEW Struck at the fourth time of asking for the Ewan Whillans yard when seeing off 4 rivals at Market Rasen (19f) in February and confirmed he’s back on the up with cheekpieces on when adding to tally at Haydock last month. 3lb rise could be lenient. TFR##### BHA112
HIGHMOON(GB)
(23) 54F53-3
Br B g Midnight Legend - Dizzy Frizzy
10 10-4
Brian Hughes J O Miss Maria D. Myco
Rebecca Menzies, Sedgefield T B Jethro Bloodstock Bluegrass Horse Feeds S
TIMEFORMVIEW Over 2 years since last win and failed to get the job done after trading odds on in-running for the fourth time last season at Kelso last month. Failed to fire at Uttoxeter 3 weeks ago and cheekpieces are back on. TFR###!! BHA106
DECLARED RUNNERS 6
2024: WILL CARVER (IRE) 9 12 0 Nico de Boinville 11-1 (Nicky Henderson) 7 ran Tongue Strap worn first time by No. 4. Tongue Strap worn by No. 2, 5, 6. Sheepskin Cheek Pieces worn by No 2, 4, 5, 6.
Probable S.P’s: 9-4 Captain Ivan (IRE), 7-2 Spyglass Hill (IRE),
5-1 High Moon (GB), 7-1 Rexem (IRE), 15-2 Dalyotin (FR), 10-1 Charlie Uberalles (GB)
Br Breeding O Owner B Breeder J Jockey T Trainer S Sponsor
CAPTAIN IVAN is firmly into the veteran stage of his career but he’s been revived by the re-application of cheekpieces of late and he remains on a very workable mark. Spyglass Hill is a danger to all if keeping the errors down, with Remex of some interest down in class
GREAT BRITISH BONUS SCHEME
PRIZE MONEY
for maiden five yrs old and upwards ¨ Total prize fund £7200
Race Description A Hunter Chase gives the regulars of the Point-to-Pointing world a chance to shine under National Hunt rules A horse is only qualified for this type of event if it holds a Hunters’ Certificate, something provided by a Master of Hounds to prove that the horse has been regularly hunted throughout the season. This particular event is for maiden five-year-olds and upwards, and is to be run over two miles, five furlongs. All Hunter Chases are restricted to amateur jockeys
Trainer-in-form (last 14 days): N Sanderson (1 win from 1 runners, 100%) runs SHE IS THE ENEMY
Longest Traveller: WHAT’S UP HARRY trained by E M Rees, Dorchester, 319 miles.
Br Breeding O Owner B Breeder J Jockey T Trainer H Hunt
Br B g Sandmason - Innova (IRE)
Miss Natasha Cookson (7) J
O Mrs Amy Fife T. W. Fife, Northallerton T
H Hurworth
TIMEFORM VIEW No show in 2 bumpers in Ireland last summer but does arrive on the back of a recent point win for new connections Check the betting TFR###!! BHA-
CARRIGLUX(IRE)
(85) F46/S21- 9 12-0
Br B g Jet Away - Two of Each (IRE)
Mr Joe Wright (3) J
O Mr Joe Wright Joe Wright, Whykeham T
H Derwent
TIMEFORMVIEW Little form over hurdles in 2022/23 season but has scored in the pointing field for these connections, including last time Hunter debut. TFR###!! BHA93
MONTICELLO(IRE)
(89) 5PP0//PP- 11 12-0
Br B g Teofilo (IRE) - Towards (USA)
Miss Imogen Mathias (5) J
O Mr N. Mechie Neil Mechie, Middleham T
H Bedale
TIMEFORM VIEW Always behind on belated chase debut at Wetherby in February and would be a surprise winner of this TFR##!!! BHA69
(21) 11322-1
6 12-0
Br B g Lucky Speed (IRE) - Strange Bird (IRE) J
O Roy & Louise Swinburne Bradley Gibbs, Lemsford T H Carmarthenshire
NON-RUNNER
TIMEFORM VIEW Multiple point winner, including last time (May 5). A respected hunter newcomer TFR####! BHA-
SURPRISEATTACK(IRE)(21) 1P111-1
8 12-0
Br Br g Sageburg (IRE) - Seventh Surprise (IRE) Mr John Dawson J
O Mrs C. H. Covell
Mrs John Dawson, Great Ayton T H Hurworth
TIMEFORM VIEW Second in a bumper at the start of his career. Has completed a 4-timer in points this year and likely to have major say on hunter debut under John Dawson. TFR##### BHA-
(15) 6r22-21 7 12-0
Br Gr or Ro g Shirocco (GER) - Marta Mes (FR)
Mr Felix Foster (7) J
O The Golden Syndicate F. Foster T H Hurworth
TIMEFORM VIEW Won a point recently but exposed as a modest maiden under Rules TFR##!!! BHA81
(49) P2/P450- 9 12-0
Br Ch g Kapgarde (FR) - Loin de Moi (FR)
TIMEFORM VIEW Turned in a lacklustre display when seventh of 8 in hunter chase at Kelso (23.5f, good) 7 weeks ago. Hard to fancy on the back of that. TFR##!!! BHA88 & point winner, last time A hunter A
Mr Thomas Greenwood (7) J
O Mr T. Greenwood T. Greenwood, Carnforth T H Haydon Greenwoods Fish Merchants S
(23) 5P341-1
Br B g Mountain High (IRE) - Queen Bessie
O Mr Michael Rees
H Blackmore & Sparkford Vale
7 12-0
Miss Thomasina Eyston (3) J
E. M. Rees, Dorchester T
TIMEFORM VIEW Successful last 2 starts in points (latest May 3). Has to enter the reckoning on hunter debut. TFR###!! BHA-
WHATUDOING(IRE)
(49) U51225-
Br B g Milan - Shamrock Miss (IRE)
O Mrs Diana Walton
H Jedforest
6 12-0
Miss J Walton J
Mrs Diana Walton, Hawick T
TIMEFORM VIEW A winning pointer but beaten 10 lengths when fifth of 8 on Kelso hunter debut 7 weeks ago. TFR##!!! BHA-
HOLLYWOODHARMON(IRE)
Br B m Ask - Local Lingo (IRE)
(15) 12211-3
8 11-7
Miss Pippa Brown (5) J
O Mr A C Wilson A C Wilson, Oulston T
H York North & West of Yore
TIMEFORMVIEW Third on her hunter debut in this race last year and arrives fit from a productive spell in points. Needs considering TFR####! BHA86
SHEISTHEENEMY(IRE)
(9) 52621-1
Br Ch m Dansant - Queen Michaela (IRE)
8 11-7
Mr Gregor Walkingshaw (7) J
O Mr Norman Sanderson Norman Sanderson, Sanquhar T
H Lanark & Renfrew
TIMEFORM VIEW Remote fourth in this last year but has won her last 2 points, providing hope that she might get a lot closer this time TFR###!! BHA72
Visor, Tongue Strap worn first time by No. 8. Sheepskin Cheek Pieces worn first time by No. 5. Tongue Strap worn by No. 5. Sheepskin Cheek Pieces worn by No 7, 9.
Probable S.P’s: 5-2 Surprise Attack (IRE), 4-1 What’s Up Harry (GB), 7-1 Hollywood Harmon (IRE), 8-1 Carriglux (IRE), 10-1 Titanium Bullet (IRE), 14-1 As The Lad Says (IRE), 16-1 She Is The Enemy (IRE), 22-1 Whatudoing (IRE), 28-1 Torngat (FR), 200-1 Monticello (IRE)
PLAY SMARTER
SURPRISE ATTACK has mopped up in points lately and might prove a tough nut to crack on hunter debut under John Dawson. Last year’s third Hollywood Harmon is next best..
RACE CONDITIONS
First Race 2.20 - THE HADWINS MARES’ NOVICES’ HURDLE RACE (CLASS 4) (GBB RACE) Distributed in accordance with the Stakes and Prize Money Code £3866 to the winning horse The second to receive £1781, the third £890 and the fourth £445. for novice four yrs old and upwards fillies and mares only, which have not won more than two hurdle races Enter by noon, May 20th and pay £22 stake, Declare by 10.00 a.m. May 24th. Weights: 4-y-o 10st 10lb; 5-y-o and up 11st 2lb Penalties, a winner of a hurdle race 7lb Of 2 hurdle races 12lb A memento will be awarded to the winning Owner, Trainer and Jockey. In addition, a prize will be awarded to person in charge of the best turned out horse 17 entries at £22. - Closed May 20th, 2025. Owners Prize Money Winner £2963; Second £1482; Third £741; Fourth £371. (Penalty Value £3866.66)
SEE PAGE 8 FOR THIS RACE.
Second Race 2.55 - THE JOHNNY & TONY CONNELL MEMORIAL HANDICAP HURDLE RACE (CLASS 5) Distributed in accordance with the Stakes and Prize Money Code £3251 to the winning horse The second to receive £1494, the third £747, the fourth £373, the fifth £186 and the sixth £93. for four yrs old and upwards, Rated 0-100. Enter by noon, May 20th and pay £16 stake, Declare by 10.00 a.m. May 24th. Penalties, after May 17th, 2025, for each hurdle race won 7lb A memento will be awarded to the winning owner and a prize awarded to the stable employee in charge of the best turned out horse in this race 22 entries at £16. - Closed May 20th, 2025. Owners Prize Money. Winner £2484; Second £1242; Third £621; Fourth £311; Fifth £155; Sixth £77. (Penalty Value £3251.87) 16 Eliminated Under Rules (I)9 and (I)10.
SEE PAGE 12 FOR THIS RACE.
Third Race 3.30 - THE MOLSON COORS HANDICAP HURDLE RACE (CLASS 2) (GBB RACE) Distributed in accordance with the Stakes and Prize Money Code £15609 to the winning horse The second to receive £7176, the third £3588, the fourth £1794, the fifth £897 and the sixth £447. for four yrs old and upwards £120 stake if the horse is rated 125 or higher, or £24 stake if the horse is rated 124 or lower with £96 extra if the horse is declared to run Declare by 10.00 a.m. May 24th. Penalties, after May 17th, 2025, for each hurdle race won 7lb Cartmel Races has generously sponsored this race and will present a memento to the winning owner, trainer and jockey. In addition a £50 cash prize will be presented to the stable employee in charge of the best turned out horse in this race PLEASE NOTE: A novice or juvenile horse shall only be qualified to run in this race if it has run a minimum of four times in Hurdle races in Great Britain, Ireland or France in accordance with paragraph 15 of the Weights and Handicapping Code 22 entries, 8 at £24 and 14 at £120. - Closed May 20th, 2025. Owners Prize Money Winner £11925; Second £5961; Third £2982; Fourth £1491; Fifth £744; Sixth £372. (Penalty Value £15609)
SEE PAGE 16 FOR THIS RACE.
Fourth Race 4.05 - THE MOLSON COORS VETERANS’ HANDICAP STEEPLE CHASE (CLASS 3) Distributed in accordance with the Stakes and Prize Money Code £7736 to the winning horse The second to receive £3559, the third £1779, the fourth £890 and the fifth £443. for ten yrs old and upwards, Rated 0-135 (also open to such horses rated 136 and 137 - see Standard Conditions). £58 stake if the horse is rated 104 or higher, or £12 stake if the horse is rated 103 or lower with £46 extra if the horse is declared to run Declare by 10.00 a.m. May 24th. Penalties, after May 17th, 2025, for each steeple chase won 7lb A memento will be awarded to the winning owner, jockey and trainer In addition, a prize will be awarded to the stable employee in charge of the best turned out horse in this race 8 entries at £58. - Closed May 20th, 2025. Owners Prize Money. Winner £5917; Second £2958; Third £1480; Fourth £740; Fifth £369. (Penalty Value £7736.66) SEE PAGE 18 FOR THIS RACE.
Fifth Race 4.40 - THE CAROLINE’S BIG BIRTHDAY CELEBRATION HANDICAP STEEPLE CHASE (CLASS 3) (GBB RACE) Distributed in accordance with the Stakes and Prize Money Code £7440 to the winning horse The second to receive £3420, the third £1710, the fourth £855, the fifth £427 and the sixth £213. for five yrs old and upwards, Rated 0-140 (also open to such horses rated 141 and 142 - see Standard Conditions). £51 stake if the horse is rated 114 or higher, or £9 stake if the horse is rated 113 or lower with £42 extra if the horse is declared to run Declare by 10.00 a.m. May 24th. Penalties, after May 17th, 2025, for each steeple chase won 7lb A memento will be awarded to the winning owner, trainer and jockey and a prize awarded to the stable employee in charge of the best turned out horse 11 entries, 2 at £9 and 9 at £51. - Closed May 20th, 2025. Owners Prize Money Winner £5684; Second £2841; Third £1421; Fourth £711; Fifth £355; Sixth £177. (Penalty Value £7440.29) Weights raised 6lb and paragraph 34 of the Weights and Handicapping Code complied with where applicable.
SEE PAGE 20 FOR THIS RACE.
Sixth Race 5.15 - THE CARER SUPPORT SOUTH LAKES HANDICAP STEEPLE CHASE (CLASS 3) (GBB RACE) Distributed in accordance with the Stakes and Prize Money Code £6918 to the winning horse The second to receive £3183, the third £1591, the fourth £796 and the fifth £396. for five yrs old and upwards, Rated 0-130 (also open to such horses rated 131 and 132 - see Standard Conditions). £46 stake if the horse is rated 104 or higher, or £9 stake if the horse is rated 103 or lower with £37 extra if the horse is declared to run Declare by 10.00 a.m. May 24th. Penalties, after May 17th, 2025, for each steeple chase won 7lb A memento will be awarded to the winning owner, trainer and jockey. In addition, a prize will be awarded to the person in charge of the best turned out horse 15 entries, 1 at £9 and 14 at £46. - Closed May 20th, 2025. Owners Prize Money Winner £5291; Second £2645; Third £1323; Fourth £662; Fifth £330. (Penalty Value £6918.11)
SEE PAGE 24 FOR THIS RACE.
Seventh Race 5.50 - THE FRASER CUP MAIDEN HUNTERS’ STEEPLE CHASE (CLASS 5) Distributed in accordance with the Stakes and Prize Money Code £3520 to the winning horse The second to receive £1759, the third £879, the fourth £439, the fifth £220 and the sixth £110. for maiden five yrs old and upwards Enter by noon, May 20th and pay £22 stake, Declare by 10.00 a.m. May 24th. Weights: 12st each Mares allowed 7lb To be ridden by Amateur Jockeys A memento will be awarded to the winning owner, trainer and jockey. In addition, a prize will be presented to the person in charge of the best turned out horse in this race The Fraser Cup will be presented to the winning owner, to be held for one year only 13 entries at £22. - Closed May 20th, 2025. Owners Prize Money Winner £3059; Second £1529; Third £765; Fourth £382; Fifth £192; Sixth £96. (Penalty Value £3520.08) HC