Page 1

Harga Eceran Rp2.500,-

WASPADA Demi Kebenaran Dan Keadilan

Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999)

SENIN, Legi, 19 Desember 2011/23 Muharram 1433 H

No: 23718 Tahun Ke-65

Terbit 24 Halaman


Waspada/Rasudin Sihotang

FILIPINA porak-poranda dilanda badai Washi, Minggu (18/12).

KAPAL pukat harimau dibakar massa nelayan di perairan Asahan.


Badai Di Filipina, 650 Tewas, 800 Hilang

Lima Pukat Tarik Dibakar Massa

ILIGAN, Filipina (AP): Korban tewas akibat badai tropis Washi di Filipina tercatat 650 orang tewas dan 800 lainnya hilang. Badai yang bertiup Minggu (18/12) setelah tiupan pertamanya Jumat malam menyebabkan bencana besar di Filipina Selatan dan bencana terjadi di saat para korban sedang tertidur. Peristiwa itu juga mengubah dua kota pantai menjadi gurun berlumpur dipenuhi mobil yang hanyut dan pohon tumbang. Menteri Pertahanan Voltaire Gazmin dan sejumlah pejabat militer senior akan meninjau daerah bencana terburuk di Cagayan de Oro untuk membantu mengawasi usaha pencarian dan penyelamatan (SAR) serta melihat kondisi masyarakat yang kehilangan tempat tinggal. Selain barang kebutuhan untuk para korban selamat, mereka juga memerlukan peti mati dan kantung mayat, kata Benito Ramos, yang memimpin dinas penanggulangan bencana pemerintah. The Associated Press memberitakan, para perwira AD melaporkan sejumlah mayat tak dikenal disemayamkan di beberapa masjid di Cagayan de Oro, di mana listrik telah dipulihkan di beberapa kawasan, meski kota yang berpenduduk lebih dari 500.000 jiwa masih tanpa air bersih. Lanjut ke hal A2 kol. 1

BAGANASAHAN (Waspada): Lima pukat tarik dibakar massa di perairan Asahan, tujuh mil dari Panton, Utara Baganasahan, Minggu (18/12). Tidak ada korban jiwa karena para Anak Buah Kapal (ABK) dan nakhoda terlebih dahulu diamankan para nelayan. Namun, kerugian miliaran rupiah. Informasi dihimpun Waspada, pembakaran diduga buntut dari keresahan para nelayan akibat semakin mengganasnya penangkapan ikan menggunakan jaring terlarang itu di perairan Selat Malaka. Aksi spontanitas ribuan nelayan itu diperkirakan dimulai sejak pukul 10:00, dengan melakukan sweeping di laut. Setiap jumpa kapal pukat harimau langsung dibakar. Aksi berakhir setelah pasukan keamanan dari Pangkalan TNI Angkatan Laut Tanjungbalai-Asahan, bekerjasama dengan Kapal Patroli Polair 301 Belawan, turun ke lokasi menghalau nelayan. Ratusan kapal itu kemudian kembali ke pantai dan berkumpul di Panton Baganasahan. Danlanal TBA Letkol (P) Retiono Kunto H yang dikonfirmasi, membenarkan kejadian itu. “Informasi kita terima, lima kapal pukat teri dibakar sekelompok nelayan


KAPTEN tim Barcelona, Carlos Puyol, mengangkat trofi juara Piala Dunia Antarklub 2011 setelah sukses memimpin timnya mengalahkan Santos 4-0 di Yokohama International Stadium, Minggu (18/12). Selain itu, Lionel Messi terpilih sebagai pemain terbaik dan Xavi sebagai runner-up. Baca berita di hal A6.

Lanjut ke hal A2 kol. 3

Tabligh Akbar Medan Meriah Plt Gubsu: Nasyid Sarana Dakwah Efektif MEDAN (Waspada): Plt Gubsu H Gatot Pujo Nugroho, ST mengatakan, seni nasyid layak ditumbuhkembangkan sebagai media peningkatan prestasi sekaligus penghalusan budi pekerti dan akhlak generasi muda. “Melalui seni nasyid yang mengandung puji-pujian kepada Allah SWT dan penghormatan kepada Nabi Muhammad SAW, juga merupakan sarana dakwah yang efektif di tengah masyarakat,” ujar Gatot saat membuka Festival Seni Nasyid ke-19 Tingkat Provsu di Lapangan Merdeka Binjai, Minggu (18/12) malam. Gatot berharap, penyelenggaraan festival nasyid yang rutin diselenggarakan dapat menjadi media dan sarana untuk melecutkan prestasi anak muda. Dia juga berharap melalui kesenian nasyid ini lahir generasi muda Sumut yang memiliki kehalusan budi dan perasaan sehingga dapat berempati dengan orang lain. Seni nasyid menurutnya, memiliki fungsi ganda yaitu satu sisi sebagai sarana dakwah islamiyah untuk menyampaikan pesan-pesan agama sekaligus pembangunan kepada masyarakat lewat syair lagu yang dikumandangkan. “Festival seni nasyid ke-19 di Binjai ini merupakan kebanggaan bagi masyarakat dan saya sangat berterimakasih atas usaha wali kota Binjai yang telah menyelenggarakan festival dengan baik,” ujar Gatot . Lanjut ke hal A2 kol. 7

Kapal Angkut Imigran Timteng Tenggelam 181 Hilang, 34 Selamat JAKARTA (Antara): Mabes TNI Angkatan Laut mengerahkan dua kapal perang dan satu helikopter untuk mendukung proses pencarian dan evakuasi korban kapal imigran Timur Tengah yang tenggelam di perairan Prigi, Kab. Trenggalek, Jawa Timur. Kepala Dinas Penerangan TNI Angkatan Laut Laksamana Pertama TNI Untung Suropati di Jakarta, Minggu (18/12) mengatakan dua kapal yang dikerahkan adalah KRI Untung Suropati-372 dan KRI Oswald Siahaan-354 dari Komando Armada RI Kawasan Timur (Koarmatim). “Selain itu, kami kerahkan pula satu helikopter milik Pusat Penerbangan TNI Angkatan Laut,” kata Laksamana Pertama Untung Suropati, menambahkan. Hingga Minggu (18/12) pagi, dikabarkan 34 orang dari 215 awak kapal sudah diketemukan dan ditampung sementara di gedung PPN (Pelabuhan Perikanan Nusantara) di pelabuhan Prigi. Penumpang kapal diperkirakan terdiri atas para imigran Timur Tengah yang berusaha menuju Australia. Di antara mereka diduga terdapat warga negara Afghanistan dan Turki. Ratusan belum ditemukan Hingga Minggu siang, dikabarkan ratusan penumpang masih belum ditemukan. Pihak Badan SAR Nasional (Basarnas) Lanjut ke hal A2 kol. 6

MEDAN (Waspada): Ribuan warga memenuhi Lapangan Merdeka Medan mengikuti zikir dan tabligh akbar memperingati Tahun Baru Islam 1 Muharram 1433H bersama ustadz kondang asal Makassar Muhammad Nur Maulana, Minggu (18/12). Tabligh akbar berlangsung meriah meski hujan deras mengguyur, namun warga tidak beranjak meninggalkan lokasi. Mereka dengan penuh

antusias mengikuti siraman rohani yang disampaikan dai dengan gaya khasnya yang gaul, jenaka dan murah senyum tersebut.

Lanjut ke hal A2 kol. 3

Waspada/Surya Efendi

Trauma Bom, Kotak Kecil Hebohkan Jemaat Gereja

Korban Penipuan Facebook Mengadu Ke Polisi

MEDAN (Waspada): Kotak berukuran kecil yang diletakkan pria tidak dikenal di sudut pintu masuk Gereja Katholik Katedral Jln. Pemuda, Medan membuat heboh jemaat gereja tersebut. Kotak dengan ukuran panjang 15 cm dan lebar 5 cm itu kemudian dievakuasi tim jihandak Brimob ke Mako Brimobdasu Jln. Wahid Hasyim. Setelah diperiksa, ternyata isinya hanya kertas imbauan untuk tidak memakan buahbuah impor. Kapolsekta Medan Kota

AKSI penipuan dengan modus menawarkan barang melalui Facebook terus bergulir. Kali ini, korbannya Bayu Ferdiansyah, 21, penduduk Kompleks Citra Seroja, Kec. Medan Sunggal. “Korban Bayu menderita kerugian uang Rp2.051.477,” kata petugas kepolisian kepada Waspada, Minggu (18/12). Peristiwa itu terjadi Jumat (16/12) siang, ketika ia berkenalan dengan seorang pria mengaku bernama H. Ilham Kesuma melalui di facebook .Kenalan itu menawarkan handphone Blackberry Kapler dengan harga Rp900 ribu dengan sarat mengirimkan data-data korban dan menstranfer uang pembelian melalui BRI melalui rekening 322901001714500 atas nama Tasya Fadilah. Jika uang ditransfer, handphone Blackberry segera dikirim ke alamat pembeli paling lambat dua hari melalui titipan kilat JNE. Lanjut ke hal A2 kol. 1

Komisaris Polisi Sandy Sinurat kepada wartawan, Minggu (18/12) mengatakan, kotak mencurigakan itu ditemukan petugas keamanan gereja tidak jauh dari pos satpam sebelah kanan pintu masuk gereja sekira pukul 06:30. Berdasarkan keterangan petugas keamanan gereja Nelson Manalu, kata Kapolsek, pria tak dikenal yang mengantar dan meletakan kotak kecil di lakban itu memakai baju Lanjut ke hal A2 kol. 7

PSMS Vs Sime Darby Sarat Prestise Stadion Teladan Malam Ini MEDAN (Waspada): Big match PSMS Medan versus klub Liga Utama Malaysia, Sime Darby, di Stadion Teladan pada Senin (19/12) mala mini dipastikan sarat prestise. Pasalnya, tim asal Negeri Jiran itu diperkuat tiga mantan pemain timnas, yakni Mohd Noor bin Ismail, Mohamad Hairul Nizan bin Haniff, dan Es Lizuan Zahid bin Amir. Demikian dikatakan pelatih PSMS yang tampil di Indonesian Super League (ISL), Raja Isa (foto). Pelatih asal Malaysia itu menambahkan klub yang bermarkas di Kuala Lumpur itu juga memiliki dua pemain nasional asal Liberia,

Oleh Tgk H. Ameer Hamzah Hai Abu Hurairah, engkau akan menemukan orang-orang yang lupa dan lalai ketika melaksanakan rukun haji. Haji mereka tidak diterima Allah dan amal mereka tidak diangkat oleh Allah. (Hadits dari Abu Hurairah)

Waspada/Sarmin Harahap

WARGA Desa Suka Makmur tetap bertahan di Gedung DPRD Madina, menunggu teman mereka dibebaskan.

Warga Bertahan Di Gedung DPRD Madina PANYABUGAN (Waspada): Ratusan warga Desa Suka Makmur, Kec. Muara Batang Gadis, Kab. Mandailing Natal (Madina) bertahan di gedung DPRD Madina, sebelum lima teman mereka dibebaskan. Demikian disampaikan EDH, 40, bersama warga lainnya kepada Waspada, Minggu (18/12), di Gedung DPRD Madina. Dijelaskan, warga sebenarnya tidak menolak Lanjut ke hal A2 kol. 3

KUALA TERENGGANU (Waspada): Enam orang, lima di antaranya adalah warga Indonesia (WNI), ditangkap tiga jam usai merampok satu keluarga di Felda Cerul Dua Scheme, Kemaman, Malaysia, Sabtu kemarin. Para tersangka yang berusia sekira 30 hingga 48 tahun, dibekuk petugas keamanan SRS Felda Cerul Dua yang melacak dan menangkap mereka di perbatasan antara Trengganu dan Pahang pada pukul 6:40 pagi waktu setempat. “Keenamnya, termasuk petugas satpam setempat, kemudian dibawa ke kantor polisi Chukai,” ujar kepala polisi CID Trengganu ACP K Manoharan. Ia mengatakan, empat tersangka yang bersenjatakan Lanjut ke hal A2 kol. 1

Patrick Ronaldinho Wleh dan Sengbah Kennedy. Lanjut ke hal A7 kol. 1

Waspada/H Syahputra MS

417 TKI Terancam Hukuman Mati JAKARTA (Waspada): Migrant Care mendata, hingga akhir tahun 2011 ada 417 buruh migran Indonesia yang terancam hukuman mati di luar negeri. Berdasarkan komposisi data tersebut, Tenaga Kerja Indonesia (TKI) yang paling banyak terancam hukuman mati berada di Malaysia dan Arab Saudi. Migrant Care menjelaskan, dari 417 TKI yang terancam hukuman mati, 348 di antaranya berada di Malaysia, 45 di Arab Saudi, 22 di China dan 2 di Singapura. Dari jumlah tersebut, 32 orang di antaranya telah divonis hukuman mati. “Kasus ancaman hukuman mati tidak bisa diselesaikan hanya dengan pidato dan pembentukan lembaga ad hoc,

tetapi memerlukan lang-kah konkret dengan menghadirkan langsung Presiden Susilo Bambang Yudhoyono, sebagai kepala negara dan kepala pemerintahan, untuk melakukan diplomasi politik tingkat tinggi,” kata Direktur Eksekutif Migrant Care, Anis Hidayah di Jakarta, Minggu (18/12). Menurut Anis, pemerintah kerap alpa menjalankan kewajiban dan tanggung jawabnya dalam melindungi buruh migran Indonesia. “Namun jika bicara soal dimensi ekonomi migrasi Tenaga Kerja Indonesia, pemerintah berada di barisan depan dengan mengharapkan peningkatan aliran remitansi jerih payah buruh migran,” ujar Anis. Lanjut ke hal A2 kol. 7

Ada-ada Saja

Lima WNI Merampok Di Malaysia Ditangkap

Haji Sangkot

Lanjut ke hal A2 kol. 6

hijrah. Tanpa hijrah tak satupun akan berhasil,” katanya. Maulana menyampaikan, ada tiga hal yang harus dilakukan untuk meraih kesuksesan. Pertama, selalu merasa senang. Hati selalu merasa damai. Artinya, jangan pernah sekalipun memiliki musuh. Sebab, orang yang banyak musuh, sempit hidupnya dalam dunia ini.

PERINGATAN TAHUN BARU ISLAM: Ribuan umat muslim menghadiri puncak peringatan Tahun Baru Islam 1433 Hijriah di Lapangan Merdeka Medan, Minggu (18/12). Ustadz Muhammad Nur Maulana memberikan tausyiah (foto kanan).

Al Bayan

DARI makna hadits di atas itulah dalam terminologi bahasa Aceh ada istilah “Haji Sangkot”. Asal usul istilah tersebut adalah gelar yang diberikan kepada orang yang telah naik haji, namun prilakunya tidak mencerminkan seorang haji. Sudah naik haji tetapi masih malas melaksanakan shalat jamaah ke masjid, masih mencari rezeki dengan uang riba, masih kikir dan malah bertambah kikirnya.

Dalam tausyiahnya, Maulana mengajak seluruh yang hadir untuk menjadikan Tahun Baru Islam sebagai momentum untuk hijrah dari melakukan perbuatan kurang baik menjadi baik. Karenanya, dia mengajak untuk menyambut Tahun Baru Islam dengan kebaikan dan menghadapi serta menjalaninya dengan penuh perjuangan. “Di Tahun Baru Islam ini, marilah kita

Mobil Kardus Atasi Pengemudi Ngebut

Waspada/Rahmad F Siregar

BAYI ‘raksasa’ lahir melalui persalinan normal di rumahnya Dusun IV, Desa Baganasahan Induk, Kec. Tanjungbalai.

Bayi ‘Raksasa’ Lahir Di Asahan ASAHAN (Waspada): Seorang istri nelayan di Dusun IV, Desa Baganasahan Induk, Kec. Tanjungbalai, Kab. Asahan, melahirkan bayi ‘raksasa’ dengan berat 8,2 kg dan panjang 54 cm. Kendati bobotnya abnormal, namun bayi berjenis kelamin perempuan itu lahir melalui persalinan normal Lanjut ke hal A2 kol. 3

POLISI di China menemukan cara efektif untuk mengatasi para pengendara bermotor yang suka ngebut, yaitu dengan mobil patroli yang terbuat dari kertas kardus. Jika dilihat dari belakang, mobil kardus ini sangat mirip dengan kendaraan patroli polisi, yang digunakan untuk meredam pengendara yang s u k a n g e b u t d i p r ov i n s i Lanjut ke hal A2 kol. 2

Serampang - Xavi banteng ketaton - He...he...he...

Jembatan Ara Kemudi Aceh Timur Putus ACEH UTARA (Waspada) : Seorang jatuh ke sungai, sejumlah desa terisolasi ketika jembatan Ara Kemudi menghubungkan Lhoksukon Barat dengan Kec. Pirak Timur, Kab. Aceh Utara, putus, Minggu (18/12). Informasi Waspada peroleh, hujan deras yang mengguyur Aceh Utara dan sekitarnya sejak sehari sebelumnya, mengakibatkan pohon-pohon di sekitar Sungai Krueng Kreh tumbang. “Salah satu pohon pinang yang tumbang menimpa tali baja jembatan gantung,” jelas Sulaiman, 35, warga setempat. Akibatnya jembatan runtuh. Sementara air sungai yang deras mengakibatkan jembatan tersebut tidak bisa dilintasi lagi. Menurut warga lainnya, saat musibah terjadi sekitar pukul 11:30, seorang warga yang sedang melintas di atas jembatan. M Daud, 50, jatuh ke dalam sungai. Namun, dapat diselamatkan. Putusnya jembatan tersebut mengakibatkan lumpuhnya jalur transportasi antara Lhoksukon Barat dengan Pirak Timur. Ratusan warga tidak bisa lagi keluar dari desa-desa terpencil ke pusat Kota Lhoksukon. “Desa kami terisolir sekarang,” jelas warga lainnya. Sementara itu, Pj Bupati Aceh Utara Ali Basyah yang meninjau langsung ke lokasi telah memerintahkan Kepala Dinas Bina Marga untuk menyelamatkan aset jembatan. Dia minta dinas untuk membangun jembatan darurat agar warga tidak terisolir.

WASPADA Demi Kebenaran Dan Keadilan

Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999) SENIN, Legi, 19 Desember 2011/23 Muharram 1433 H z zNo: 23718 Tahun Ke-65

Road To Dakwah Waspada Di Aceh Timur

H Abdullah Rasyid: Jangan Alergi Kritik PEUREULAK (Waspada) : Sebuah media akan terus berjaya dan berdiri sepanjang mampu menahan dan menerima kritikan dari masyarakat. Semakin gencar dikritik, semakin kuat sebuah perusahaan media. Begitulah yang dialami Waspada yang kini sudah masuk usia 65 tahun. Lanjut ke hal A2 kol. 1

Terbit 24 Halaman

Lanjut ke hal A2 kol 1

Dua Anak Punk Lari Dari SPN BANDA ACEH (Waspada): Dua anak punk sedang menjalani pembinaan di SPN Seulawah dilaporkan melarikan diri dari lembaga pendidikan tersebut. Kaburnya anak punk dari lembaga pendidikan itu Sabtu (17/12) petang, setelah sempat mengelabui petugas yang mengawasinya. Namun, tim gabungan terdiri dari Polresta Banda Aceh, Kodim 0101/aceh Besar, Pomdam IM dan Satpol PP serta WH Kota Banda Aceh berhasil meringkus kembali kedua anak punk yang melarikan diri itu yakni Saiful asal Banda Aceh dan Syaukani asal Kabupaten Aceh Utara. Syaukani dijumpai di kawasan Raya Baiturrahman sekira pukul 23.00 WIB, Sabtu malam, sedangkan Saiful Fadli ditangkap di kawasan Pasar Sayur Seutui, Banda Aceh pada Minggu dini hari sekira pukul 02.00 WIB. Mereka kabur setelah menipu petugas dengan alasan mau ke kamar mandi,” kata Kapolresta Banda Aceh Kombes Pol Armensyah Thay, kepada Waspada, Minggu (18/12). Dikatakannya, tim gabungan yang melakukan razia sejak menerima laporan tentang pelarian kedua anak punk itu, bukan hanya untuk mencari mereka, tetapi juga untjk membubarkan aksi kebut-kebutan di jalan raya yang sedang berlangsung di kawasan Jalan Mr Muhammad Hasan, Bathoh, Banda Aceh. Menurut Kapolresta, dalam razia itu tim gabungan berhasil menjaring 197 unit sepeda motor yang digunakan dalam aksi balapan yang sudah lama meresahkan masyarakat. (b05)

Bustami Saleh/Waspada

Jembatan gantung yang menghubungkan Kecamatan Lhoksukon di kawasan barat dengan Kecamatan Pirak Timur di Kabupaten Aceh Utara, Minggu (18/12) runtuh seketika ke permukaan sungai akibat besi tiang penyangga sling patah setelah tertimpa pohon tumbang yang diterjang banjir dan sejumlah warga kebetulan menyeberang ikut terjatuh.

Panitia PDT 2011 ‘Sor’ Sendiri PARAPAT (Waspada): Meski gaung diselenggarakannya Pesta Danau Toba (PDT) 2011 sudah terdengar sejak beberapa waktu lalu, namun sambutan masyarakat terhadap pesta tahunan yang akan dilaksanakan sepekan lagi, tetap dingin.

Pengamatan Waspada, Minggu (18/12), kondisi kota Parapat dan kawasan open stage tempat akan dilangsungkannya pembukaan PDT, masih terlihat biasa-biasa saja.

Demikian juga halnya beberapa ruas jalan, mulai dari gerbang hingga lokasi open stage, belum terlihat ada umbulumbul, kecuali baliho berukuran besar bergambar panitia

PDT, itu pun sudah mulai robek. Masyarakat tampaknya kurang antusias, mereka menganggap Pesta Danau Toba hanya even biasa, se-

hingga tidak perlu disambut secara luar biasa. Memang di open stage sedang dilakukan pembenahan, terutama panggung utama, serta pengecatan pagar seke-

liling open stage. Sedangkan pembangunan 25 kios di sekelilingnya (open stage), masih tahap pemasangan batu dan diyakini hingga menjelang pembukaan PDT, tidak akan

terselesaikan. Ini menambah rasa prihatin terhadap persiapan pelaksanaan PDT 2011 yang terkesan dipaksakan. Lanjut ke hal A2 kol 6

Kapal Angkut Imigran Timteng Tenggelam 213 Hilang, 33 Selamat

Waspada/Hasuna Damanik

KOMPLEKS open stage Parapat yang akan menjadi lokasi pembukaan PDT 2011, masih tahap pembenahan, Minggu (18/12).

417 TKI Terancam Mati dari 417 TKI yang terancam hukuman mati, 348 di antaranya berada di Malaysia, 45 di Arab Saudi, 22 di China dan 2 di Singapura. Dari jumlah tersebut, 32 orang di antaranya telah divonis hukuman mati. “Kasus ancaman hukuman mati tidak bisa diselesaikan hanya dengan pidato dan pembentukan lembaga ad hoc, tetapi memerlukan lang-

Al Bayan

Haji Sangkot Oleh: H. Ameer Hamzah Hai Abu Hurairah, engkau akan menemukan orang-orang yang lupa dan lalai ketika melaksanakan rukun haji. Haji mereka tidak diterima Allah dan amal mereka tidak diangkat oleh Allah. (Hadits dari Abu Hurairah)

Badai Di Filipina, 650 Tewas, 800 Hilang

kah konkret dengan menghadirkan langsung Presiden Susilo Bambang Yudhoyono, sebagai kepala negara dan kepala pemerintahan, untuk melakukan diplomasi politik tingkat tinggi,” kata Direktur Eksekutif Migrant Care, Anis Hidayah di Jakarta, Minggu (18/12).

ILIGAN, Filipina (AP): Korban tewas akibat badai tropis Washi di Filipina tercatat 650 orang tewas dan 800 lainnya hilanng. Banjir yang bertiup Minggu (18/12) setelah tiupan pertamanya Jumat malam menyebabkan bencana besar di Filipina Selatan, dan bencana terjadi di saat para korban sedang tertidur lelap. Peristiwa itu juga mengubah dua kota pantai menjadi gurun berlumpur dipenuhi mobil yang hanyut dan pohon tumbang. Menteri Pertahanan Voltaire Gazmin dan sejumlah pejabat militer senior akan melakukan peninjauan ke daerah bencana terburuk di Cagayan de Oro untuk membantu mengawasi usaha pencarian dan penyelamatan (SAR) dan menghibur ribuan penduduk yang kehilangan

Lanjut ke hal A2 kol 3

Lanjut ke hal A2 kol 3

31 Di Antaranya Telah Divonis JAKARTA (Waspada): Migrant Care mendata, hingga akhir tahun 2011 ada 417 buruh migran Indonesia yang terancam hukuman mati di luar negeri. Berdasarkan komposisi data tersebut, Tenaga Kerja Indonesia (TKI) yang paling banyak terancam hukuman mati berada di Malaysia dan Arab Saudi. Migrant Care menjelaskan,

JAKARTA (Antara): Mabes TNI Angkatan Laut mengerahkan dua kapal perang dan satu helikopter untuk mendukung proses pencarian dan evakuasi korban kapal imigran Timur Tengah yang tenggelam di perairan Prigi, Kabupaten Trenggalek, Jawa Timur. Kepala Dinas Penerangan TNI Angkatan Laut Laksamana Pertama TNI Untung Suropati di Jakarta, Minggu (18/12) mengatakan dua kapal yang dikerahkan adalah KRI Untung Suropati-372 dan KRI Oswald Siahaan-354 dari Komando Armada RI Kawasan Timur (Koarmatim). “Selain itu, kami kerahkan pula satu helikopter milik Pusat Penerbangan TNI Angkatan Laut,” kata Laksamana Pertama Untung Suropati, menambahkan. Hingga Minggu (18/12) pagi, dikabarkan 33 orang dari 215 awak kapal sudah diketemukan dan ditampung sementara di gedung PPN (Pelabuhan Perikanan Nusantara) di pelabuhan Prigi. Lanjut ke hal A2 kol 6

Waspada/Sarmin Harahap

WARGA Desa Suka Makmur tetap bertahan di Gedung DPRD Madina, menunggu teman mereka dibebaskan.

Warga Bertahan Di Gedung DPRD Tuntut Teman Mereka Dibebaskan PANYABUGAN ( Waspada): Ratusan warga Desa Suka Makmur, Kec. Muara Batang Gadi, Kab. Mandailing Natal (Madina) bertahan di gedung DPRD Madina, sebelum lima teman mereka dibebaskan. Demikian disampaikan EDH, 40, bersama warga lainnya kepada Waspada, Minggu (18/12), di Gedung DPRD Madina. Dijelaskan, warga sebenarnya tidak menolak kehadiran

perusahaan perkebunan. Mereka hanya minta supaya tapal batas dan lahan mereka jelas keberadaannya. Lahan yang mereka kelola jangan diganggu. Pantauan Waspada di Gedung DPRD, warga terdiri dari kaum ibu dan anak-anak tidur-tiduran dan duduk-duduk di teras. Sementara kaum laki-laki duduk di sudut-sudut taman dan kantor. Mereka juga mendirikan tempat

Ribuan Warga Hadiri Tabligh Akbar Bersama Ustadz Maulana

Bayi ‘Raksasa’ Lahir Lagi Di Asahan

MEDAN (Waspada): Ribuan warga memenuhi Lapangan Merdeka Medan, untuk mengikuti zikir dan tabligh akbar memperingati Tahun Baru Islam 1 Muharram 1433H bersama Al Us-

ASAHAN (Waspada): Seorang istri nelayan di Dusun IV, Desa Baganasahan Induk, Kec. Tanjungbalai, Kab. Asahan, melahirkan bayi ‘raksasa’ dengan berat 8,2 Kg dan Lanjut ke hal A2 kol 5

tadz kondang asal Makasar Muhammad Nur Maulana, Minggu (18/12). Meski hujan deras mengguyur selama acara berlangsung, namun tidak satupun warga ada meninggalkan lo-

Dari makna hadits di atas itulah dalam terminologi bahasa Aceh ada istilah “Haji Sangkot”. Asal usul istilah tersebut adalah gelar yang diberikan kepada orang yang telah naik haji, namun prilakunya tidak mencerminkan seorang haji. Sudah naik haji tetapi masih malas melaksanakan shalat jamaah ke masjid, masih mencari rezeki dengan uang riba, masih kikir dan malah bertambah kikirnya. Ada juga hajjah Sangkot yakni perempuan yang sudah

Lanjut ke hal A2 kol 1

Waspada/Surya Efendi

MUHAMMAD Nur Maulana, ustadz kocak yang terkenal dengan yel-yel jamaah… ooo jamaah… dipeluk Wali Kota Medan Rahudman Harahap menjelang acara puncak peringatan Tahun Baru Islam 1433 Hijriah di Lapangan Merdeka Medan, Minggu (18/12).

kasi. Mereka dengan penuh antusias mengikuti siraman rohani yang disampaikan dai dengan gaya khasnya yang gaul, jenaka, dan murah senyum tersebut. Dalam tausyiahnya, Maulana mengajak seluruh yang hadir untuk menjadikan Tahun Baru Islam sebagai momentum untuk hijrah dari melakukan perbuatan kurang baik menjadi baik. Karenanya, dia mengajak untuk menyambut Tahun Baru Islam dengan kebaikan dan menghadapi serta menjalaninya dengan penuh perjuangan. “Di Tahun Baru Islam ini, marilah kita hijrah. Tanpa hijrah tak satupun akan berhasil,” katanya. Maulana menyampaikan, ada tiga hal yang harus dilakukan untuk meraih kesuksesan. Pertama, selalu merasa senang. Hati selalu merasa damai. Lanjut ke hal A2 kol 6

memasak di depan gerbang utama kantor dewan. Sedangkan biaya makan menurut warga, diperoleh dari bantuan keluarga dan juga anggota dewan. Bahkan Ketua DPRD Madina, As Imran Khaitamiy Daulay sempat mengajak kaum ibu dan anak-anak tinggal di rumah dinas namun mereka tolak. Lanjut ke hal A2 kol 3

Ada-ada Saja

M Akbar Arya Risudin Tumbuh Sehat

Lanjut ke hal A2 kol 6

Mobil Kardus Atasi Pengemudi Ngebut POLISI di China menemukan cara efektif untuk mengatasi para pengendara bermotor yang suka ngebut, yaitu dengan mobil patroli yang terbuat dari kertas kardus. Lanjut ke hal A2 kol 1

Serampang Waspada/Rahmad F Siregar

BAYI ‘raksasa’ berbobot 8,2 Kg dan panjang 54 Cm lahir melalui persalinan normal di rumahnya Dusun IV, Desa Baganasahan Induk, Kec. Tanjungbalai, Kab. Asahan. Inzet: M Akbar Arya Risudin.

- Sor orang dikantongi - He.... he....he....

Berita Utama

A2 Road To Dakwah...

417 TKI...

“Waspada siap dikritik yang sifatnya sehat, sebab kritikan masyarakat yang membuat Waspada terus menjadi incaran dan ditunggu-tunggu masyarakat, khususnya masyarakat Aceh,” papar Tgk H Abdullah Rasyid dalam acara Road to Dakwah Waspada di Balai Pengajian Ulama-Umara se-Aceh Timur di Desa Alue Bu, Kecamatan Peureulak Barat, Sabtu (17/12). Menurut ulama kharismatik Aceh ini, kritikan yang sifatnya bukan memfitnah merupakan sebuah ide dan gagasan yang diberikan seseorang agar sebuah media berkembang sesuai dengan perkembangan zaman. Pengaruh media diakui sangat besar dalam pembangunan sebuah bangsa, karenanya diperlukan masukan dan gagasan baru yang selama ini tidak terfikirkan oleh manajemen sebuah perusahaan media, sehingga Waspada tetap menjadi nomor satu di hati masyarakat, khususnya di Aceh. Di sisi lain, lanjut mantan anggota DPRK Aceh Timur itu, Waspada diakuinya bukan media yang menampilkan gambargambar porno dan memuat berita yang membangkitkan syahwat, tetapi Waspada adalah sebuah media yang mengedepankan etika pers dan menjunjung tinggi nilai-nilai agama dan bekerja secara profesional sesuai dengan kode etik dan Undang-Undang Pers No 40 tahun 1999. “Kita mengakui keakraban Waspada dengan masyarakat Aceh sudah tidak bisa dipisahkan lagi, apalagi memiliki sejarah khusus antara Ali Hasyimi (mantan Gubernur Aceh) dengan pendiri Harian Waspada H Muhammad Said – Hj. Ani Idrus (alm),” kata H Abdullah Rasyid sembari menambah-kan, sejarah itu hari ini, Sabtu (17/12) kembali terulang di Bumi Aceh antara Pemimpin Umum Harian Waspada Ibu Hj Rayati Syafrin dengan Bupati Aceh Timur Muslim Hasballah. Harapan ke depan, masyarakat khususnya pembaca Waspada terus memberikan ide dan gagasan yang sifatnya membangun melalui Perwakilan dan Biro Waspada di Aceh serta para wartawan di lapangan. “Semoga Waspada tetap jaya dan terus bertahan hingga kapanpun dalam mengembangkan misi dakwahnya mencerdaskan bangsa ini dengan semboyan Demi Kebenaran dan Keadilan. (b24)

Menurut Anis, pemerintah kerap alpa menjalankan kewajiban dan tanggung jawabnya dalam melindungi buruh migran Indonesia. “Namun jika bicara soal dimensi ekonomi migrasi Tenaga Kerja Indonesia, pemerintah berada di barisan depan dengan mengharapkan peningkatan aliran remitansi jerih payah buruh migran,” ujar Anis. Dari sisi politik luar negeri, Anis berpendapat Indonesia telah menyia-nyiakan kesempatan dan modal diplomasi yang sebenarnya bisa berperan dalam melindungi buruh migran Indonesia. “Posisi strategis Indonesia sebagai Ketua ASEAN di tahun 2011 tidak dimanfaatkan secara maksimal untuk mendorong implementasi yang lebih konkret,” kata Anis. Bahkan tambah Anis, Presiden Susilo Bambang Yudhoyono tidak mau memanfaatkan forum G-20 sebagai ajang diplomasi tingkat tinggi untuk mendesak Arab Saudi dan China menghentikan praktek hukuman mati. “Ironisnya, di


Jembatan Darurat Kepala Dinas Bina Marga, Syamsuddin Bentara, mengatakan, jembatan darurat tersebut dibangun dengan menarik kembali tali penyanggah. Tiang penyanggah dari besi patah akibat ditimpa pohon. Tiang perlu dibangun kembali, sehingga tali penyangga bisa ditarik agar bisa dilintasi warga. Jembatan tersebut hanya bisa dilintasi orang, tanpa kendaraan. Untuk membangun jembatan diperkirakan membutuhkan anggaran sampai Rp400 juta. Jembatan yang dibangun tahun 1982 tersebut pernah direhab tahun 2006. (b11/b15/b13)

Ada-ada Saja... Jika dilihat dari belakang, mobil kardus ini sangat mirip dengan kendaraan patroli polisi, yang digunakan untuk meredam pengendara yang suka ngebut di provinsi Jiangsu, China. “Saat melihat sesuatu yang mirip mobiol polisi yang sedang parkir di bahu jalan, saya langsung menginjak rem untuk memperlambat (kendaraan),” ujar seorang pengendara bernama Liu Yuan, seperti dikutip Orange, Minggu (18/12). “Namun saat saya lewati, saya kaget melihat bahwa itu hanya tiruan mobil patroli yang terbuat dari kardus tipis.” Jurubicara kepolisian setempat di kota Wuxi, mengkonfirmasi bahwa keberadaan mobil kardus itu memang digunakan untuk mengurangi kecepatan arus lalu lintas. (orange/rzl)

Al Bayan...

menunaikan ibadah haji tapi masih membuka aurat di depan umum seperti kaum selebriti dan artis di ibukota. Apa yang tersangkut (sangkot) dalam ubudiyah mereka? Rupanya amalnya yang tersangkut di pintu langit. Allah tidak menerima hajinya karena si pelaksana haji tadi naik haji dengan rezeki yang haram. Haji dan hajjah model ini semakin banyak di republik ini, sebab naik haji bukan lagi karena ingin mencari ridha Allah, tetapi karena ingin mencari gelar atau tamasya. Memang kalau kita tanya semua mereka menjawab mau mencari haji mabrur, mau taubat nashuha dan sebagainya. Benarkah mereka mau taubat? Syariat mengukurnya. Seandainya mereka mau taubat tentu mereka akan meninggalkan maksiat. Tidak lagi makan riba, korupsi, mengunjing orang, menjual aurat di televisi dan pekerajaan maksiat lainnya. Tetapi nyatanya mereka semakin menjadi-jadi. Tidak baik kita sebut nama mereka satu persatu di sini. Yang jelas mereka hampir semua sudah bergelar haji dan hajjah, tetapi pekerjaannya main sinetron syirik, mendedah aurat dan bahkan ada yang kawin dengan lelaki musyrik. Naudzubillahi mindzalik! Kita sengaja menurunkan tafakkur seperti ini agar menjadi i’tibar bagi saudara-saudara kita. Tak usah menjadi haji dan hajjah sangkot. Jadilah haji y a n g m a b r u r. Un t u k Jawaban Problem Catur, mencapai haji mabrur kita TTS Dan Sudoku harus hidup di bawah naungan Alquranul Karim. Jika Dari Halaman Sport. Alquran menyuruh kita amar makruf dan meni-nggalkan mungkar, maka kitapun wajib Jawaban Problem Catur: patuh secara mutlak. Tidak ada istilah belum siap, masih 1. Kde7+, Rf8. muda dan perlu bertahap. 2. Kfe6+, Re8. Kita harus ingat bila Izrael datang, kematian itu tidak 3. Ke6xg7+, Rf8. bertahap. Maka taubatpun tidak ada istilah bertahap. 4. Ke7g6+, Rg8.

5. Ge6+, Rh7. 6. Kg7f5+mat. (Jika 2. ....., Rf7. 3. Ke7g6+, Re8. 4. Be7+mat).

Jawaban TTS: TTS Topik


Umum Serba “Pra”




7 3 2 9 1 4 8 6 5

1 8 5 6 3 7 2 9 4

Jawaban Sudoku:

8 5 7 4 6 2 1 3 9

6 4 3 7 9 1 5 2 8

2 1 9 8 5 3 6 4 7

3 7 1 2 8 9 4 5 6

5 2 8 3 4 6 9 7 1

9 6 4 1 7 5 3 8 2

4 9 6 5 2 8 7 1 3

Badai... tempat tinggalnyatop. Rencana itu dilakukan pada saat cuaca mulai cerah di lokasi bencana dan banjir telah surut. Selain barang kebutuhan mendesak yang dibutuhkan para korban selamat, mereka juga memerlukan peti mati dan kantung mayat, kata Benito Ramos, yang memimpin dinas penanggulangan bencana pemerintah. “Luar biasa. Kami tidak menyangka demikian banyak yang mati,” kata Ramos. Edmund Rubio, seorang insinyur 44 tahun, mengatakan dia, istrinya dan dua anakanaknya bergegas lari ke lantai dua rumah mereka di Iligan City ketika deru banjir terdengar melanda dan menggenangi lantai satu rumahnya, yang merusak pesawat televisinya dan barang-barang lain, bahkan sebagian dari hartanya dihanyutkan banjir, termasuk sepedamotor dan mobil. Di tengah panik, dia mendengar suara keras menghempaskan pintunya sementara tetangga terdekatnya memohon padanya agar mengizinkan mereka masuk ke kamar di lantai atas rumahnya. Dia mengatakan dia akhirnya menyelamatkan tidak

Warga Bertahan... Dalang Intelektual Kapolres Madina, AKBP Fauzi Dalimunthe, S.Ik kepada Waspada, Jumat (16/12) via seluler mengaku telah ‘mengantongi’ nama-nama dalang intelektual kerusuhan. Kerusuhan, katanya, diduga terjadi karena adanya provokasi dilakukan dalang intelektual, yang sudah melarikan diri, namanya sudah diketahui polisi. Perihal Kepala Desa Suka Makmur, Khairum Nasution yang informasinya telah ditahan polisi, dibantah Kapolres Madina. Katanya, Kepala Desa tidak ada di tempat, diduga telah melarikan diri. “Kepala desa diduga melarikan diri. Sedangkan warga yang diamankan polisi terkait kerusuhan enam orang. Namun karena satu orang wanita, kita lepas. Sehingga jumlah yang masih diamankan lima orang,” ucap Kapolres.

forum G-20, kecaman terhadap Arab Saudi karena mengeksekusi mati TKI Ruyati tidak datang dari Indonesia, tetapi dari Perancis dan Uni Eropa,” kata dia. Berikut data kasus buruh migran tahun 2011 hasil monitoring Migrant Care, seperti yang dikemukakan Anis Hidayah: • Hukuman mati sebanyak 417 kasus. • Eksekusi mati di Arab Saudi 1 kasus. • Overstayers di Arab Saudi 27.348 kasus. • Kekerasan fisik 3.070 kasus. •Kekerasan seksual 1.234 kasus. • Meninggal dunia 1.203 kasus. • Kerja tidak layak 9.023 kasus. • Gaji tidak bayar 14.074 kasus. • Terancam deportasi dari Malaysia sebanyak 150.000 kasus. •TKI bermasalah di penampungan 18 perwakilan luar negeri sebanyak 21.823 kasus. Jumlah total 228.193 kasus. Komitmen Pemerintah Presiden telah berulang kali menegaskan komitmennya dalam melindungi TKI. Menurutnya, pemerintah akan terus memperjuangkan nasib Warga Negara Indonesia

yang dijatuhi hukuman mati di negeri orang. SBY juga menyatakan, pemerintah terus aktif memintakan ampunan dan keringanan hukuman terhadap TKI, dengan cara membentuk satuan tugas. “Tentu kita terus berjuang dari sisi kemanusiaan dan keadilan, untuk berikhtiar memohonkan pengampunan atau peringanan hukuman bagi mereka,” kata SBY beberapa waktu lalu. Ia mengakui, upaya untuk memohon pengampunan dan keringanan hukuman bagi TKI di luar negeri sangat sulit karena masing-masing negara memiliki sistem hukum yang berbeda-beda. “Mengambil pengalaman dari ini, ke depan, pengawasan terhadap penyiapan dan pemberangkatan TKI kita oleh Perusahaan Pengerah Tenaga Kerja Indonesia Swasta (PPT KIS) akan lebih diperketat,” kata dia. SBY juga berharap, percepatan pembangunan ke depannya akan mampu menyediakan lapangan kerja domestik yang luas, sehingga WNI tidak perlu repot mencari kerja di luar negeri.(vvn)

kurang dari 30 tetangganya di lantai dua rumahnya, yang kemudian bergunjang ketika satu batang pohon besar menghantam rumah itu. “Itulah sesuatu yang paling penting, bahwa semua kami harus berkumpul semua di Hari Natal mendatang ini,” kata Rubio kepada The Associated Press. “Ada gubuk di dekatnya yang dihancur-kan oleh air. Saya khawatir banyak orang di sana mungkin belum seberuntung kami.” Para perwira AD melaporkan sejumlah mayat tak dikenal disemayamkan di beberapa masjid di Cagayan de Oro, di mana listrik telah dipulihkan di beberapa kawasan, meski kota yang berpenduduk lebih dari 500.000 jiwa masih tanpa air bersih. Sekjen Palang Merah Filipina Gwendolyn Pang mengatakan kepada AP bahwa sekurang-kurangnya 650 orang tewas akibat banjir, sebagian besar anak-anak dan wanita dan lebih dari 800 lainnya dinyatakan masih hilang. Menurut Palang Merah Filipina, korban yang tewas akibat angin topan itu akan semakin meningkat. Banyak warga yang dinyatakan hilang. Banjir yang dipicu oleh angin topan itu juga sudah menyapu banyak desa di Pulau Mindanao.

Angin Topan Washi menyerang Pulau Mindanao yang terletak di bagian selatan Filipina, tepatnya di Cagayan de Oro dan Iligan Jumat kemarin dan menyebabkan hujan badai. Para petugas huru hara, militer, dan kepolisian Filipina tampak bahu-membahu dalam melakukan evakuasi di tempat kejadian perkara. Sekira 100.000 warga Filipina kini hidup dalam pengungsian karena rumahrumah yang mereka tempati hancur. Sementara itu 200 orang juga dikabarkan hilang dalam bencana ini. Menanggapi hal ini, Amerika Serikat juga menyatakan simpatinya terhadap korban yang tewas dan menegaskan, akan memberikan bantuan ke Filipina. Menteri Luar Negeri AS Hillary Clinton menyampaikan belasungkawa terhadap para korban yang tewas akibat angin topan di Filipina. Clinton pun mengatakan, AS siap membantu Filipina. “Atas nama Presiden Barack Obama dan Rakyat AS, saya mengucapkan belasungkawa terhadap para korban yang tewas akibat Angin TopanWashi, Pemerintah AS siap membantu Pemerintah Fili-pina untuk merespons tragedi ini.” ujar Clinton, Minggu. (m10)

Sementara Bupati Madina, Hidayat Batubara rencananya bertemu Kapolres Madina terkait kerusuhan Desa Suka Makmur, Muara Batang Gadis, supaya peristiwa serupa tidak terulang. “Negara kita negara hukum. Tindakan anarkis tidak dibolehkan,” ucap Baupati kepada Waspada, Jumat (16/12) via selular. Katanya, persoalan lahan yang terjadi kemungkinan hanya di tingkat desa. Sementara anggota DPRD Madina dari Partai Kebangkitan Bangsa Dapil V, H. Suheri Nasution mengatakan siap mendampingi masyarakat Desa Sukamakmur dalam memediasi persoalan yang mereka alami. Dia menilai Pemkab Madina terkesan lamban dan tidak tanggap terhadap yang dialami masyarakat.’’ Konflik itu terjadi sejak adanya izin perkebunan PT. ALM yang dikeluarkan pemerintah,” tegas Suheri.(c14)

Bayi ‘Raksasa’...

panjang 54 Cm. Kendati bobotnya abnormal, namun bayi berjenis kelamin perempuan itu lahir melalui persalinan normal di rumahnya, berkat bantuan bidan desa Elfina Sari, Selasa (13/12). Bayi yang belum diberi nama ini, anak ke tujuh pasangan M. Rizal, 40, dan Efindawati, 30. “Alhamdulillah, kondisinya sehat dan normal,” kata Efindawati kepada Waspada, Minggu (18/12). Wanita berpostur tinggi dan gemuk itu menuturkan, selama kehamilannya 9 bulan 6 hari, dia tidak pernah merasakan sesuatu hal aneh. Kendati bahagia bayinya lahir normal, namun Efindawati dan suaminya mengaku sedih. Pasalnya, kain bedung ukuran 1,5 meter yang dipersiapkan sejak masa kehamilan, ternyata tak cukup membungkus tubuh bayinya. Sebab itu, sejak lahir sampai sekarang bayi ’raksasa’ itu tak pernah dibedung. Kemudian, untuk kebutuhan asupan gizi, Efindawati hanya memberikan ASI. Memang

Kapal Angkut...

WASPADA Senin 19 Desember 2011 kawasan Timur Tengah sehari sebelumnya. Cuaca ekstrem dan gelombang tinggi menjadi penghambat utama dalam proses penyisiran dan evakuasi para korban. Badan Meteorologi, Klimatologi dan Geofisika mengingatkan tim evakuasi korban kapal yang tenggelam di perairan selatan Pantai Prigi, Kabupaten Trenggalek, Jawa Timur, mewaspadai tingginya gelombang di perairan tersebut. “Tinggi gelombang di perairan selatan Jawa Timur berkisar 0,5-2,5 meter dan berpeluang hujan deras. Kondisi ini cukup berbahaya untuk aktivitas pelayaran, utamanya untuk kapal kecil,” kata prakirawan

BMKG Maritim Tanjung Perak Surabaya, Eko Prasetyo. Eko Prasetyo mengatakan tinggi gelombang yang cenderung naik sebenarnya justru terjadi di perairan utara Jawa Timur (Jatim), yakni dari 0,3-1,3 meter menjadi 0,5-3 meter. Namun demikian, kata Eko, karena di perairan utara dan selatan Jatim berpeluang hujan deras maka kondisi tersebut akan bisa berdampak terhadap kelancaran evakuasi korban. Apalagi, arus perairan selatan Jatim, khususnya di selatan Pacitan-Trenggalek, saat ini berkisar 5-25 centimeter per detik, dengan arah dari barat ke timur dan sedikit yang mengarah ke selatan atau ke tengah laut lepas.

kan Natal dan menyambut Tahun Baru. “Kalau memang panitia mau memajukan atau meningkatkan pariwisata Danau Toba, alangkah baiknya jika dilaksanakan pada bulan paceklik pengunjung, seperti April hingga Agustus. Ini baru namanya mendukung pariwisata. Kalau Desember, tanpa ada PDT-pun daerah pariwisata ini tetap ramai,” ketus Sinaga, warga lainnya. Di sisi lain, kelemahan unsur kepanitiaan PDT tahun ini karena tidak melibatkan tokoh masyarakat secara total. Padahal pada PDT sebelumnya, meski panitia inti dari Jakarta atau Medan, tapi tokoh-tokoh masyarakat di daerah itu turut dilibatkan dalam kepanitiaan. “Mungkin ini

salah satu yang menyebabkan minimnya antusias masyarakat menyambut pelaksanaan PDT tahun ini,” tambah Sinaga. Tapi Camat Girsang Sipanganbolon, Ojahan Nainggolan, punya penilaian sendiri. Menurutnya, masyarakat sangat menyambut kegiatan PDT tahun ini. Gaung PDT, katanya, mulai menggema. Bahkan pihaknya mengaku mampu menurunkan 3000 orang pada pelaksanaan apel gotong-royong bersama Muspika dan masyarakat, termasuk pelajar, hari Jumat lalu. “Masyarakat cukup antusias, buktinya kita bisa kumpulkan warga hingga 3000 orang untuk mengikuti apel gotong-royong,” terang Nainggolan, kemarin.(a29)

Artinya, jangan pernah sekalipun memiliki musuh. Sebab, orang yang banyak musuh, sempit hidupnya dalam dunia ini. “Sedangkan yang ketiga adalah mensyukuri nikmat. Untuk mensyukuri nikmat itu bisa dilakukan melalui pikiran, ucapan dan tingkah laku atau perbuatan,” sebutnya. Dia mengungkapkan akan pentingnya waktu. Semua orang memiliki waktu yang sama. Yang membedakannya bagaimana memprioritaskan waktu itu dengan sebaik-baiknya. Selain itu, Ustadz yang identik menyapa jamaahnya dengan panggilan “jamaah oh jamaah” ini, tak lupa mengingatkan kepada jamaah agar sebagai hamba selalu mengingat dan memuja Allah SWT, di mana saja berada. Sementara itu, Wali Kota Medan Rahudman Harahap yang hadir dalam acara itu

mengatakan, zikir dan tabligh akbar ini digelar untuk meningkatkan komunikasi dan silaturahmi dengan masyarakat. Dengan komunikasi dan silaturahmi akan terbangun kebersamaan. “Jadikan acara ini sebagai momentum untuk pembelajaran sekaligus silaturahmi dengan masyarakat,” ujarnya. Dengan digelarnya kegiatan tersebut, Rahudman berharap kondisi Kota Medan tetap aman dan kondusif. Jika itu terwujud, tentunya dapat menjadikan ibu kota Provinsi Sumatera Utara ini menjadi kota yang bermartabat. Untuk itu diperlukan dukungan semua pihak, termasuk warga Kota Medan. Dukungan itu dapat diperoleh jika telah terbangun kebersamaan di antara pemerintah dengan masyarakat. Sedangkan Ketu Majelis Ulama Indonesia (MUI) Sumut Abdullah Syah ketika memberikan sambutan mengata-

kan, Tahun Baru Islam ini merupakan tahun kemenangan bagi umat Islam di seluruh dunia. Di samping itu, banyak pelajaran yang bisa diambil dari perisitiwa hijrah ini. Sebelumnya, Sekda Kota Medan Syaiful Bahri selaku ketua pelakasana kegiatan menyebutkan, melalui kegiatan ini pihaknya mengajak seluruh umat Islam supaya mengingat dan memahami pesan-pesan moral serta nilai luhur dari peristiwa hijrah ini. “Hijrah ini memberi makna kedamaian dan totalitas ke arah yang lebih baik,” sebutnya. Acara zikir dan tabligh akbar dihadiri Kapoldasu Irjen Pol Wisju Amat Sastro, Pangdam I/BB Mayjen TNI Lodewijk F Paulus, Wakil Wali Kota Medan Dzulmi Eldin, unsur Forum Komunikasi Pimpinan Daerah Sumatera Utara dan Kota Medan, Staf Ahli, Asisten, pimpinan SKPD di lingkungan Pemko Medan serta tokoh agama. (m50)

pada usia 1-3 hari, selain ASI, dia juga memberikan susu kaleng kepada bayinya. Karena keterbatasan dana pulalah menyebabkan Efindawati enggan melahirkan melalui operasi di rumah sakit. “Kami enggak punya uang untuk ke rumah sakit, makanya aku memaksa bidan membantu persalinan di rumahku,” ujarnya. Sementara Bidan Desa Elfina Sari menuturkan, proses persalinan bayi berbobot besar itu memakan waktu kurang lebih satu jam. Awalnya Elfina sempat khawatir, karena baru sebatas leher, proses kelahiran bayi itu terhenti. “Begitu sampai leher, tibatiba berhenti. Beberapa menit kemudian, mulai terdorong ke luar hingga bagian perut, namun kembali lagi berhenti. Sempat khawatir juga saya, namun berkat pertolongan Allah SWT, bayi itu akhirnya lahir dalam kondisi selamat dan normal,” jelas Elfina. Diserang Diare Dikatakan Elfina, saat memasuki usia 3 hari, bayi raksasa anak keluarga miskin ini

terserang diare disertai demam. Setelah diberi perawatan medis, kata Elfina, penyakitnya mulai berkurang. “Semua bayi rawan penyakit, apalagi yang berat badannya melebihi normal sehingga perkembangannya tetap kita pantau. Alhamdulillah demamnya sudah sembuh, hanya tinggal diarenya saja,” jelas Elfina. Bayi ‘raksasa’ ini tinggal bersama saudaranya dan kedua orang tua di rumah sewa berukuran 3 x 7 meter. Rumah panggung berdinding dan berlantai papan itu, tidak memiliki kamar tidur. Satu ruangan bersatu menjadi kamar tidur dan dapur, sedangkan untuk mandi dan mencuci, mereka memanfaatkan aliran anak sungai Asahan. “Kehidupan keluarga ini memang memprihatinkan, butuh perhatian dari Bupati Asahan, minimal bisa membantu asupan gizi seimbang buat anak-anaknya,” kata Ketua Asosiasi Nelayan Perjuangan Pesisir Pantai Asahan, Hermansyah Siregar, di dampingi Ketua Rukun Nelayan Hidayat AM.

M Akbar Arya Risudin Sementara itu, bayi ‘raksasa’ Muhammad Akbar Arya Risudin yang lahir pada dua hari Lebaran 2009, kini berusia lebih 26 bulan (2,2 tahun), tumbuh sehat dengan berat mencapai 23 kg dan tinggi 94 Cm. Ayah sang bayi, Hasanuddin, 43, terpaksa merantau ke negeri seberang (Malaysia) menjadi TKI, untuk memenuhi kehidupan keluarga. “Alhamdulillah, Akbar tumbuh sehat, pemeriksaan akhir di Puskesmas, beratnya 23 kg dan tinggi 94 Cm. Sedangkan untuk konsumsi masih tergolong biasa seperti anak seusianya. Tidak begitu banyak makan nasi, lebih memilih jajanan,” ujar ibu Akbar, Ani, 31, ditemui Waspada di kediamannya, di Dusun I Desa Bulan-Bulan, Kec. Limapuluh Kab. Batubara, Minggu (18/12). Sementara tentang janji Bupati Batubara Ok Arya Zulkarnaen, Ani menuturkan belum ada sedikit pun.“Mungkin Bupati sudah lupa dengan kami. Karena terlalu sibuk dengan pekerjaannya, “ jelas Ani. (a14/a15)

Penumpang kapal diperkirakan terdiri atas para imigran Timur Tengah yang berusaha menuju Australia. Di antara mereka diduga terdapat warga negara Afghanistan dan Turki. Ratusan belum ditemukan Hingga Minggu siang, dikabarkan ratusan penumpang masih belum ditemukan. Pihak Badan SAR Nasional (Basarnas) Jatim menyatakan belum mengetahui kepastian jumlah penumpang karena tak mendapat manifes penumpang. Namun disebutkan bahwa dari informasi para penumpang yang selamat disebutkan terdapat lebih dari 200 orang berada di atas kapal saat berangkat dari

Panitia... “Berbeda dengan PDTPDT sebelumnya, PDT tahun ini terkesan hanya untuk kebutuhan para pembesar, sehingga gaungnya tidak sampai kepada masyarakat,” sebut salah seorang ibu pedagang di sekitar open stage. Rendahnya antusias masyarakat terhadap pelaksanaan PDT kali ini, juga karena minimnya sosialisasi yang dilakukan panitia. Apalagi panitia tampaknya ‘sor’ sendiri, hingga tidak lagi mendengar aspirasi masyarakat setempat, khususnya warga Parapat yang kurang setuju dengan jadwal PDT, yang ditetapkan 27 - 30 Desember. Sebab, pada tanggal itu masyarakat tengah sibuk meraya-

Ribuan Warga...


Berita Utama

WASPADA Senin 19 Desember 2011

Dirjen Otda Isyaratkan Pilgubsu 2013 Oleh DPRD Diawasi KPK

Waspada/Muhammad Idris

RUMAH warga porak-poranda diterjang angin puting beliung.

Enam Rumah Diterjang Angin Puting Beliung TEBINGTINGGI (Waspada): Enam rumah di Kel. Damar Sari, Kec. Padang Hilir, Tebingtinggi porak-poranda diterjang angin puting beliung, Minggu (18/12) pagi. Ke enam rumah tersebut berada di Lk III, Jalan Purnawirawan, Jalan Tapian Nauli dan Jalan Gotong Royong, Kel. Damar Sari. Keenam rumah milik R. Sihombing,Toni Silaen, R. Marpaung, S. Siagian, M. Sitanggang dan J. Hutagalung, kerusakan umumnya pada bagian atap. Terparah rumah milik R. Sihombing di Jalan Tapian Nauli.

Menurut Sihombing, peristiwa itu terjadi sekira pukul 01:30 dinihari, saat hujan disertai angin kencang. Saat kejadian, ada yang berusaha melarikan diri ke luar rumah sempat tertimpa kayu atap rumah yang diterbangkan angin hingga terluka. Djuhardin Sinaga, Sekretaris Badan Penanggulangan Bencana Daerah Kota Tebingtinggi mengatakan, saat ini Pemerintah Kota melalui kantor badan penaggulangan bencana daerah mendata jumlah rumah yang dilanda puting beliung. (a11)

Korban Penipuan ...

Sabtu (17/12) pukul 14:00, korban menghubungi HP pelaku dan mendapat jawaban barang sudah dikirim.Setelah itu, korban disarankan menghubungi HP 085396714499. Ketika nomor tersebut dihubungi, si penerima menyarankan korban agar pergi ke ATM dan menyebutkan nominal angka di tabungan korban. Setelah korban meniru arahan itu, ternyata saldo di tabungan korban menjadi berkurang Rp851.477. Pelaku meminta agar korban mengirim voucer pulsa Rp300 ribu dengan nomor HP 085396714499. Namun, saat itu korban sadar sudah menjadi korban penipuan. Kasus ini sudah dilaporkan ke polisi. Kapolsek Medan Baru AKP Dony Alexander, SH,SIK mengatakan, pihaknya mengusut kasus tersebut. (m36)

Korban menghubungi HP pelaku 085366780222 , dan mendapat respon dari pelaku.Lalu, korban menstranfer uang Rp900 ribu melalui BRI Cabang Gatot Subroto di Jln. Gatot Subroto ke nomor rekening pelaku 322901001714500 atas nama Tasya Fadilah. Selanjutnya, pelaku menganjurkan mengirimkan uang lagi. “Tolong kirimkan kembali nomor kode bank tempat kamu mentransfer uangnya,” ungkap korban meniru ucapan pelaku. Kemudian, korban mengirimkan dengan nomor 3382338205 12111104. Ketika korban menghubungi HP pelaku, mendapat jawaban,’’ kamu tunggu saja barangnya sudah saya kirim’’.Namun, hingga kini barang tidak pernah ada.

Badai Di Filipina, ... Sekjen Palang Merah Filipina Gwendolyn Pang mengatakan kepada AP, sekurang-kurangnya 650 orang tewas akibat banjir, sebagian besar anak-anak dan wanita dan lebih dari 800 lainnya dinyatakan masih hilang. Menurut Palang Merah Filipina, korban tewas akibat angin topan itu akan semakin meningkat. Banyak warga yang

Lima WNI ... parang dan linggis menerobos masuk ke dalam rumah korban dengan merusak jendela, sementara dua tersangka lain menunggu di mobil. “Setelah berhasil masuk ke rumah, empat tersangka memaksa pemilik rumah untuk menyerahkan uang dan perhiasan dengan mengancam putri mereka yang berusia 9 tahun dengan parang serta mengancam akan menyakiti nenek ber-

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur: 1. Kde7+, Rf8. 2. Kfe6+, Re8. 3. Ke6xg7+, Rf8. 4. Ke7g6+, Rg8. 5. Ge6+, Rh7. 6. Kg7f5+mat. (Jika 2. ....., Rf7. 3. Ke7g6+, Re8. 4. Be7+mat).

Jawaban TTS: TTS Topik


Umum Serba “Pra”




7 3 2 9 1 4 8 6 5

1 8 5 6 3 7 2 9 4

Jawaban Sudoku:

8 5 7 4 6 2 1 3 9

6 4 3 7 9 1 5 2 8

2 1 9 8 5 3 6 4 7

3 7 1 2 8 9 4 5 6

5 2 8 3 4 6 9 7 1

9 6 4 1 7 5 3 8 2

4 9 6 5 2 8 7 1 3

dinyatakan hilang. Banjir yang dipicu oleh angin topan itu sudah menyapu banyak desa di Pulau Mindanao. Sekira 100.000 warga Filipina, kini hidup dalam pengungsian karena rumah-rumah yang mereka tempati hancur. Presiden Filipina Benigno Aquino berencana mengunjungi lokasi bencana setelah dirinya usai mengadakan rapat dengan anggota kabinetnya. (m10) usia 105 tahun yang ada di rumah itu. Para tersangka juga diikat menggunakan tali kawat. Polisi kemudian menemukan perhiasan, laptop dan sejumlah ponsel yang diduga berasal dari rumah korban. Polisi juga menyita parang dan linggis sebagai barang bukti dari para tersangka. (bernama/rzl)

Ada-ada Saja ... Jiangsu, China. “Saat melihat sesuatu yang mirip mobiol polisi yang sedang parkir di bahu jalan, saya langsung menginjak rem untuk memperlambat (kendaraan),” ujar seorang pengendara bernama Liu Yuan, seperti dikutip Orange, Minggu (18/12). “Namun saat saya lewati, saya kaget melihat bahwa itu hanya tiruan mobil patroli yang terbuat dari kardus tipis.” Jurubicara kepolisian setempat di kota Wuxi, mengkonfirmasi bahwa keberadaan mobil kardus itu memang digunakan untuk mengurangi kecepatan arus lalu lintas. (orange/rzl)

MEDAN (Waspada): Pemilihan Gubernur Sumut (Pilgubsu) tahun 2013 diprediksi kembali dilaksanakan DPRD Sumut yang diawasi oleh Komisi Pemberantasan Korupsi (KPK). Sementara posisi Wakil Gubsu (Wagubsu) diusulkan gubernur terpilih dari jajaran pegawai negeri sipil (PNS) dari jabatan karier eselon I. Isyarat tersebut tersimpul dari pemaparan Direktur Jenderal Otonomi Daerah (Dirjen Otda)KemendagriProfDRHDjohermansyah Djohan, MA pada diskusi ilmiah di Grand Aston City Hall Medan, Sabtu (17/12). “Undang-undang (UU) Pilkada yang baru sebagai pecahan dari revisi UU 32 tahun 2004 rancangannya segera dikirim ke DPR-RI. Diharapkan UU ini

selesai 2012,sehingga tahun 2013, Pilkada sudah memakai UU Pilkada yang baru,” jelasnya. Dialog Ilmiah bertajuk “Revisi UU Nomor 32 Tahun 2004 tentang Pemerintahan Daerah dalam Perspektif Desentralisasi dan Otonomi Daerah “ ini juga menghadirkan narasumber Prof DR SaduWasistiono dengan pembanding utama DR RE Nainggolan, MM (mantan Sekdaprovsu) dan Drs H Afiffuddin Lubis, MM (mantan Pj Wali Kota Medan dan kini anggota Dewan Kota Medan). Topik yang dibahas cukup menjadi perhatian peserta termasuk pembanding dari floor antara lain Drs H Eddy Syofian, MAP (mantan Pj Wali Kota Tebingtinggi dan mantan Kadis Kominfo Sumut). Ia mengisya-

ratkan jika kewenangan gubernur sangat terbatas seperti sekarang ini sebaiknya gubernur cukup diangkat oleh pemerintah pusat tanpa harus melalui pemilihan yang mengeluarkan biaya cukup tinggi. Sedangkan, Dirjen Otda mengemukakan, gubernur cukup dipilih DPRD sehingga lebih efektif dan efisien. “Pencalonan gubernur diajukan oleh fraksi atau gabungan fraksi DPRD karena fraksi adalah perpanjangan tangan partai politik di DPRD,” ujarnya. Namun untuk pemilihan bupati dan walikota, lanjutnya, dipilih secara langsung oleh masyarakat karena sebagai kepala daerah otonom kewenangannya luas dan paling dekat dengan konstituen.

Dirjen Otda mengakui, pemilihan gubernur secara langsung membuat akseptabilitas kandidat relative lebih kuat, namun dari pengalaman yang ada biaya penyelenggaraannya sangat mahal serta meningkatnya ekskalasi konflik horizontal. “Pilgub langsung sangat mahal sehingga terdapat kecenderungan bagi kepala daerah melakukan korupsi setelah terpilih. Selain itu cenderung menyebabkan praktik politik uang,” ujarnya. Untuk menjawab kekhawatiran munculnya money politics di kalangan lembaga dewan, Dirjen menegaskan pelaksanaan Pilgub oleh DPRD akan berada di bawah pengawasan Komisi Pemberantasan Korupsi (KPK). (m28)

Tabligh Akbar Medan ...

pentingnya waktu. Semua orang memiliki waktu yang sama.Yang membedakannya bagaimana memprioritaskan waktu itu dengan sebaik-baiknya. Selain itu, ustadz yang identik menyapa jamaahnya dengan panggilan “jamaah oh jamaah” ini, tak lupa mengingatkan kepada ja-

maah agar sebagai hamba selalu mengingat dan memuja Allah SWT, di mana saja berada. Sementara itu, Wali Kota Medan Rahudman Harahap yang hadir dalam acara itu mengatakan, zikir dan tabligh akbar ini digelar untuk meningkatkan komunikasi dan silatu-

bayinya. Sebab itu, sejak lahir sampai sekarang bayi ’raksasa’ itu tak pernah dibedung. Kemudian, untuk kebutuhan asupan gizi, Efindawati hanya memberikan ASI. Memang pada usia 1-3 hari, selain ASI, dia juga memberikan susu kaleng kepada bayinya. Karena keterbatasan dana pulalah menyebabkan Efindawati enggan melahirkan melalui operasi di rumah sakit. Sementara Bidan Desa Elfina Sari menuturkan, proses persalinan bayi berbobot besar itu memakan waktu kurang lebih satu jam. Awalnya Elfina sempat khawatir, karena baru sebatas leher, proses kelahiran bayi itu terhenti. “Begitu sampai leher, tibatiba berhenti. Beberapa menit kemudian, mulai terdorong ke luar hingga bagian perut, namun kembali lagi berhenti. Sempat khawatir juga saya, namun berkat pertolongan Allah SWT, bayi itu akhirnya lahir dalam kondisi selamat dan normal,” jelas Elfina. Dia menuturkan, kendati sejak awal sudah menduga postur bayi lebih besar dari biasa, namun Elfina tetap menimbang bayi itu untuk memastikan berat

badannya. Dikatakan Elfina, saat memasuki usia 3 hari, bayi raksasa anak keluarga miskin ini terserang diare disertai demam. Setelah diberi perawatan medis, kata Elfina, penyakitnya mulai berkurang. “Semua bayi rawan penyakit, apalagi yang berat badannyamelebihinormalsehingga perkembangannya tetap kita pantau. Alhamdulillah demamnya sudah sembuh, hanya tinggal diarenya saja,” jelas Elfina. Bayi ‘raksasa’ ini tinggal bersama saudaranya dan kedua orang tua di rumah sewa berukuran 3 x 7 meter. Rumah panggung berdinding dan berlantai papan itu, tidak memiliki kamar tidur. Satu ruangan bersatu menjadi kamar tidur dan dapur, sedangkan untuk mandi dan mencuci, mereka memanfaatkan aliran anak sungai Asahan. “Kehidupan keluarga ini memang memprihatinkan, butuh perhatian dari Bupati Asahan, minimal bisa membantu asupan gizi seimbang buat anakanaknya,” kata Ketua Asosiasi Nelayan Perjuangan Pesisir Pantai Asahan, Hermansyah Siregar, didampingi Ketua Rukun Nelayan Hidayat AM. (a14/a15)

RD Madina, As Imran Khaita-miy Daulay sempat mengajak kaum ibu dan anak-anak tinggal di rumah dinas namun mereka tolak. Dalang Intelektual Kapolres Madina, AKBP Fauzi Dalimunthe, S.Ik kepada Waspada, Jumat (16/12) via seluler mengaku telah ‘mengantongi’ nama-nama dalang intelektual kerusuhan. Kerusuhan, katanya, diduga terjadi karena adanya provokasi dilakukan dalang intelektual, yang sudah melarikan diri, namanya sudah diketahui polisi. Perihal Kepala Desa Suka Makmur, Khairum Nasution yang informasinya telah ditahan polisi, dibantah Kapolres Madina. Katanya, Kepala Desa tidak

ada di tempat, diduga telah melarikan diri. Sedangkan warga yang diamankan polisi terkait kerusuhan enam orang. Namun karena satu orang wanita, kita lepas. Sehingga jumlah yang masih diamankan lima orang,” ucap Kapolres. Sementara Bupati Madina, Hidayat Batubara rencananya bertemu Kapolres Madina terkait kerusuhan Desa Suka Makmur, Muara Batang Gadis, supaya peristiwa serupa tidak terulang. “Negara kita negara hukum. Tindakan anarkis tidak dibolehkan,” ucap Baupati kepada Waspada, Jumat (16/12) via selular. Katanya, persoalan lahan yang terjadi kemungkinan hanya di tingkat desa. (c14)

rahmi dengan masyarakat. Dengan komunikasi dan silaturahmi akan terbangun kebersamaan. “Jadikan acara ini sebagai momentum untuk pem-belajaran sekaligus silaturahmi dengan masyarakat,” ujarnya. Dengan digelarnya kegiatan tersebut, Rahudman berharap kondisi Kota Medan tetap aman dan kondusif. Jika itu terwujud, tentunya dapat menjadikan ibu kota Prov. Sumatera Utara ini menjadi kota yang bermartabat. Untuk itu diperlukan dukungan semua pihak, termasuk warga Kota Medan. Dukungan itu dapat diperoleh jika telah terbangun kebersamaan di antara pemerintah dengan masyarakat. Sedangkan Ketua Majelis Ulama Indonesia (MUI) Sumut Prof. H. Abdullah Syah, MA ketika memberikan sambutan mengatakan, Tahun Baru Islam ini merupakan tahun kemenangan bagi umat Islam di seluruh dunia. Di samping itu, banyak pelajaran yang bisa diambil dari peristiwa hijrah ini. Sebelumnya, Sekda Kota Medan Syaiful Bahri selaku ketua pelaksana kegiatan menyebutkan, melalui kegiatan ini pihaknya mengajak seluruh umat Islam supaya mengingat dan memahami pesan-pesan moral serta nilai luhur dari peristiwa hijrah ini. “Hijrah ini memberi makna kedamaian dan totalitas kearahyanglebihbaik,”sebutnya. Acara zikir dan tabligh akbar dihadiri Kapoldasu Irjen PolWisju Amat Sastro, Pangdam I/BB Mayjen TNI Lodewijk F Paulus, Wakil Wali Kota Medan Dzulmi Eldin, unsur Forum Komunikasi Pimpinan Daerah Sumatera Utara dan Kota Medan, Staf Ahli, Asisten, pimpinan SKPD di lingkungan Pemko Medan serta tokoh agama. (m50)

para nelayan telah kembali ke daratan. “Satu kapal diketahui bernama KM Intisari I. Namun kapal yang dibakar itu belum bisa dikatakan pukat harimau, karena mereka memiliki izin tangkap dari Dinas Perikanan dan Kelautan Provinsi Sumatera Utara,” papar Danlanal. Pantauan di lapangan, ratusan kapal nelayan melakukan sweeping dan pengejaran terhadap kapal diduga pukat harimau. Kapal yang dijumpai kemudian dibakar menggunakan bom molotov, namun ABK

dan nakhoda terlebih dahulu diamankan. Ribuan nelayan itu kemudian kembali ke daratan dan menjejerkan kapal-kapal mereka di pelabuhan Panton, Baganasahan setelah pasukan keamanan tiba di TKP. Sementara para isteri, anak-anak dan keluarga nelayan menunggu di pelabuhan dengan hati bimbang dan was-was. Beberapa hari sebelumnya, seribuan nelayan dari Tanjungbalai-Asahan berunjukrasa ke Kantor DPRD Tanjungbalai, terkait beroperasinya ratusan pukat harimau di Selat Malaka. Sehari kemudian, Komisi B DPRD Tanjungbalai melakukan sidak dan menemukan puluhan pukat harimau (trawl) bersandar di sungai Asahan. (a32)

“Sedangkan yang ketiga adalah mensyukuri nikmat. Untuk mensyukuri nikmat itu bisa dilakukan melalui pikiran, ucapan dan tingkah laku atau perbuatan,” sebutnya. Dia mengungkapkan akan

Bayi ‘Raksasa’ ... di rumahnya, berkat bantuan bidan desa Elfina Sari, Selasa (13/ 12). Bayi yang belum diberi nama ini, anak ke tujuh pasangan M. Rizal, 40, dan Efindawati, 30. “Alhamdulillah, kondisinya sehat dan normal,” kata Efindawati kepada Waspada, Minggu (18/12).Wanita berpostur tinggi dan gemuk itu menuturkan, selama kehamilannya 9 bulan 6 hari, dia tidak pernah merasakan sesuatu hal aneh. Enggak ada yang aneh, semua biasa aja, hanya perutku kelihatan lebih besar,” tutur Efindawati didampingi Kader Posyandu Sembak, Nurainun. Namun, ketika mengandung, Efindawati suka mengkonsumsi es dan selalu sakit-sakitan. “Makan tidur saja kerjaku, paling sesekali mencuci. Memang selama hamil itu bawaan badanku lemas dan sulit bergerak,” aku Efindawati. Kendati bahagia bayinya lahir normal, namun Efindawati dan suaminya mengaku sedih. Pasalnya, kain bedung ukuran 1,5 meter yang dipersiapkan sejak masa kehamilan, ternyata tak cukup membungkus tubuh

Warga Bertahan ... kehadiran perusahaan perkebunan. Mereka hanya minta supaya tapal batas dan lahan mereka jelas keberadaannya. Lahan yang mereka kelola jangan diganggu. Pantauan Waspada di Gedung DPRD, warga terdiri dari kaum ibu dan anak-anak tidurtiduran dan duduk-duduk di teras. Sementara kaum laki-laki duduk di sudut-sudut taman dan kantor. Mereka juga mendirikan tempat memasak di depan gerbang utama kantor dewan. Sedangkan biaya makan menurut warga, diperoleh dari bantuan keluarga dan juga anggota dewan. Bahkan Ketua DP-

Lima Pukat Tarik ... Menurut Danlanal, pihaknya masih melakukan penyelidikan. “Kita belum bisa menduga motif dan penyebab pembakaran karena masih dalam penyelidikan,” jelas Danlanal sembari menyebutkan, belum seorang pun dimintai keterangan. Diterangkan, lima kapal yang dibakar di antaranya dua unit kapal berbobot 28 Gross Ton (GT) dan tiga lainnya berbobot 8 GT, semua berasal dariTanjungbalai. Menurutnya, intensitas aksi sudah menurun sebab

Kapal Angkut ... masih belum ditemukan. Pihak Badan SAR Nasional (Basarnas) Jatim menyatakan belum mengetahui kepastian jumlah penumpang karena tak mendapat manifes penumpang. Namun disebutkan bahwa dari informasi para penumpang yang selamat disebutkan terdapat lebih dari 200 orang berada di atas kapal saat berangkat dari kawasan Timur Tengah sehari sebelumnya. Cuaca ekstrem dan gelombang tinggi menjadi penghambat utama dalam proses penyisiran dan evakuasi para korban.


Plt Gubsu H Gatot Pujo Nugroho didampingi Ketua DPRD Sumut Saleh Bangun, Ketua MUI Sumut Prof Dr Abdullah Syah, MA, Wali Kota Binjai M Idham membuka Festival Seni Nasyid tingkat Sumut di Lapangan Merdeka Binjai, Minggu (18/12) malam.

Plt Gubsu: Nasyid Sarana ... Wali Kota Binjai M Idham selaku Ketua Umum Panitia Pelaksana menjelaskan, festival nasyid ini diikuti 25 kabupaten/kota dan kafilah khusus perguruan tinggi dengan rincian 20 grup putra dan 23 grup putri ditambah satu kafilah. “Total peserta dan official yang mengikuti acara festival sepekan ini 617 orang,” jelas Idham. Pelaksanaan festival nasyid juga dibarengi dengan penyelenggaraan pameran produk-produk UKM, dimeriahkan dengan hiburan tari-tarian Islami. Ketua Lembaga Pengembangan Pembinaan Seni Nasyid (LPPSN) Provsu yang diwakili A Muin Isma Nasution mengucapkan terimakasih kepada wali kota Binjai yang berhasil melaksanakan festival dalam waktu yang relative singkat. Menurutnya, festival nasyid yang digelar secara rutin tidak saja untuk mengasah bakat seni namun juga dalam upaya meningkatkan akhlak mulai para remaja. Festival Seni Nasyid ke19 Tingkat Provsu dihadiri Kakanwil Kementerian Agama Provsu Drs Abdul Rahim, MHum, Ketua DPRD Sumut Saleh Bangun, Ketua MUI Sumut Prof Dr Abddulah Syah, MA, sejumlah bupati dan wali kota, unsur Forum Komunikasi Pimpinan Daerah Sumatera Utara dan Kota Binjai, tokoh agama dan tokoh masyarakat.(m28)

417 TKI Terancam ... Dari sisi politik luar negeri, Anis berpendapat Indonesia telah menyia-nyiakan kesempatan dan modal diplomasi yang sebenarnya bisa berperan dalam melindungi buruh migran Indonesia. “Posisi strategis Indonesia sebagai Ketua ASEAN di tahun 2011 tidak dimanfaatkan secara maksimal untuk mendorong implementasi yang lebih konkret,” kata Anis. Bahkan tambah Anis, Presiden Susilo Bambang Yudhoyono tidak mau memanfaatkan forum G-20 sebagai ajang diplomasi tingkat tinggi untuk mendesak Arab Saudi dan China menghentikan praktek hukuman mati. “Ironisnya, di forum G-20, kecaman terhadap Arab Saudi karena mengeksekusi mati TKI Ruyati tidak datang dari Indonesia, tetapi dari Perancis dan Uni Eropa,” kata dia. Berikut data kasus buruh migran tahun 2011 hasil monitoring Migrant Care, seperti yang dikemukakan Anis Hidayah: • Hukuman mati sebanyak 417 kasus. • Eksekusi mati di Arab Saudi 1 kasus. • Overstayers di Arab Saudi 27.348 kasus. • Kekerasan fisik 3.070 kasus. • Kekerasan seksual 1.234 kasus. • Meninggal dunia 1.203 kasus. • Kerja tidak layak 9.023 kasus. • Gaji tidak bayar 14.074 kasus. • Terancam deportasi dari Malaysia sebanyak 150.000 kasus. • TKI bermasalah di penampungan 18 perwakilan luar negeri sebanyak 21.823 kasus. Jumlah total 228.193 kasus. (vvn)

Trauma Bom, ... kaos putih, celana pendek biru dan mengendarai mobil Escudo hijau tanpa plat. Sebelumnya Manalu mengaku saat itu sedang tidur. Dia tersentak mendengar suara orang melangkah dan melihat seorang pria meletakkan bungkusan di dekat pos satpam sebelah kanan. Manalu mengaku berada di pos satpam sebelah kiri. “Saya terbangun dan melihat laki-laki itu. Dia sempat keluar, lalu masuk lagi mengambil kotak itu dan memindahkannya di atas meja depan gedung gereja,” katanya. Ketika dia hendak menghampirinya, pria tak dikenal itu langsung pergi naik mobil Escudo. Bersama rekan kerjanya, Manalu melihat dan mengamankan kotak yang dibungkus lakban tersebut. Dia kemudian menghubungi pengurus gereja, dan pengurus gereja langsung menghubugi Polsek Medan Kota. Menerima laporan itu, sekira pukul 07:30 sejumlah personel Polsek Medan Kota datang ke lokasi bersama tim Jihandak Brimob mengamankan kotak mencurigakan tersebut. Sandy Sinurat mengatakan, dari hasil pemeriksaan sudah dapat dipastikan bahwa kotak mencurigakan itu bukan bom. “Isinya bukan bom, hanya imbauan-imbauan yang menyuarakan menghentikan makan buah-buahan dan makanan serta minuman impor yang bermasalah. Disitu ditulis, pengirimnya Dewan Pimpinan Wilayah Serikat Kerakyatan Indonesia (SAKTI-SUMUT) berkantor di Jalan Harapan Pasti, Medan. “Saat ini kami mencoba mengkonfirmasi kebenarannya,” kata Sandy.(m27)

Al Bayan ... Ada juga hajjah Sangkot yakni perempuan yang sudah menunaikan ibadah haji tapi masih membuka aurat di depan umum seperti kaum selebriti dan artis di ibukota. Apa yang tersangkut (sangkot) dalam ubudiyah mereka? Rupanya amalnya yang tersangkut di pintu langit. Allah tidak menerima hajinya karena si pelaksana haji tadi naik haji dengan rezeki yang haram. Haji dan hajjah model ini semakin banyak di republik ini, sebab naik haji bukan lagi karena ingin mencari ridha Allah, tetapi karena ingin mencari gelar atau tamasya. Memang kalau kita tanya semua mereka menjawab mau mencari haji mabrur, mau taubat nashuha dan sebagainya. Benarkah mereka mau taubat? Syariat mengukurnya. Seandainya mereka mau taubat tentu mereka akan meninggalkan maksiat. Tidak lagi

makan riba, korupsi, mengunjing orang, menjual aurat di televisi dan pekerajaan maksiat lainnya. Tetapi nyatanya mereka semakin menjadi-jadi. Tidak baik kita sebut nama mereka satu persatu di sini. Yang jelas mereka hampir semua sudah bergelar haji dan hajjah, tetapi pekerjaannya main sinetron syirik, mendedah aurat dan bahkan ada yang kawin dengan lelaki musyrik. Naudzubillahi mindzalik! Kita sengaja menurunkan tafakkur seperti ini agar menjadi i’tibar bagi saudara-saudara kita. Tak usah menjadi haji dan hajjah sangkot. Jadilah haji yang mabrur. Untuk mencapai haji mabrur kitaharushidupdibawahnaunganAlquranulKarim. Jika Alquran menyuruh kita amar makruf dan meninggalkan mungkar, maka kitapun wajib patuh secara mutlak. Tidak ada istilah belum siap, masih muda dan perlu bertahap. Kita harus ingat bila Izrael datang, kematian itu tidak bertahap. Maka taubatpun tidak ada istilah bertahap.

Luar Negeri

WASPADA Senin 19 Desember 2011


AS Angkat Kaki Total Dari Irak LINTAS BATAS KHABARI, Kuwait (AP): Sekelompok tentara terakhir Amerika Serikat angkat kaki dari Irak dan mereka melewati lintas batas memasuki negara tetangganya Kuwait pada Minggu (18/12) pagi. Mereka menunjukkan kegembiraannya lepas dari kekejaman perang dengan mengepalkan tinjunya ke udara dan berpelukan satu sama lain dalam ledakan sukacita dan lega. Keluar konvoi mereka menandai berakhirnya perang pahit perpecahan yang berlangsung selama hampir sembilan tahun dan meninggalkanIrakhancur,denganpertanyaan-pertanyaan mengganggu yang melekat di benak mereka, apakah bangsa Arab akan tetap menjadi sekutu AS teguh. Perang di Irak itu telah menelan korban hampir 4.500 jiwa tentara Amerika dan lebih dari 100.000 jiwa warga Irak serta telah

mengurasdanadariperbendaharaan AS sebesar AS$800 miliar. Pertanyaan apakah itu perlu dan layak dilakukan AS, semua masih belum terjawab. Iring-iringan kendaraan perang MRAP, kendaraan lapis baja angkutan berat, telah melakukan perjalanan lancar keluar kecuali untuk beberapa kerusakan peralatan di sepanjang jalan. Saat itu gelap dan pandangan hanya dapat melihat keluar kendaraan melalui jendela kecil saat mereka melaju MRAP melalui padang pasir Irak Selatan. Ketika iring-iringan melintasi perbatasan memasuki Kuwait sekitar pukul 07:45 pagi waktu

setempat, suasana tetap terkendali di dalam salah satu kendaraan, tanpa berteriak atau berisik menyambut penarikan mereka dari negara yang selama ini telah menyebabkanbanyaktemanmereka stres dan terganggu jiwanya akibat hantu perang. Sepanjang jalan, sekelompok kecil tentara Irak melambaikan tangan kepada pasukan Amerika yang berangkat meninggalkan negara yang telah mereka invasi selama hampir sembilan tahun. “Hati saya telah jauh keluar dari Irak,” kata seorang perwira John Jewell,yangmengakuikinimereka akan menghadapi tantangan ke depan. “Yang berdosa selalu membayar hutangnya.” Perang yang dimulai dalam satu gempuran udara yang dimaksudkan untuk mengejutkan dan membuat kagum diktator SaddamHusseindanparapendu-

kungnya. Presiden Barack Obama cuma tidak menyebutkan usaha AS di Irak mencapai kemenangan ketika dia menjawab wawancara yang direkam Kamis dengan BarbaraWalters dari ABC News Barbara Walters. “Saya menganggap pasukan kita sebagai mencapai sukses dalammisiyangdiberikannyauntuk warga Irak di negara mereka dalam usaha memberikan mereka kesempatanuntukmencapaisukses di masa mendatang,” kata Obama. Dalam penarikan pasukan ini, sekitar 100 kendaraan tempur yang rata-rata lapis baja membawa pergi 500 tentara AS yang cemas bercampur bahagia. Mereka menyeberangi gurun di Irak Selatan sepanjang malam menuju perbatasan Kuwait. “Senang sekali merasakan ini

semua akan berakhir. Saya sudah beradadisinisejakawal[perang],” Sersan Christian Schultz mengungkapkan. Bagi Presiden AS, Barack Obama, penarikan pasukan tempur AS itu merupakan pemenuhan janji yang ia utarakan semasa kampanye kepresidenan. Sementara bagi rakyat Irak, tindakan AS itu memberikan rasa berdaulat, meski kekhawatiran akan berulangnya kekerasan sektarian tetaplah ada. Masalah utama Irak hari-hari ini adalah mereka tak memiliki pertahanan udara yang baik serta kehilangan kemampuan mengumpulkan data intelijen. Namun,problemIraktakberhentidisitu.“Kamitakambilpeduli dengan Amerika. Kami berpikir tentang cara mendapatkan aliran listrik,pekerjaan,danminyak,”kata AbbasJaber,seorangpegawainegeri sipil di Baghdad. (m10)


SEORANG prajurit memberikan isyarat dari atas kendaraan lapis baja terakhirnya di dalam

iring-iringan pasukan dari Brigade Ke-3 Divisi Kaveleri ke-1 AD Amerika Serikat yang menyeberang perbatasan dari Irak ke Kuwait, Minggu (18/12). Batalion dari Pasukan Brigade Spesial itu merupakan pasukan terakhir AS yang meninggalkan Irak pagi itu.

Pembunuhan Khadafi Kejahatan Perang

Medvedev: Obama, Jangan Campur MOSKOW, Rusia (Waspada): Presiden Rusia Dmitry Medvedev mengatakan,diataksudimendengarsegalabentukkritikyangdilontarkan olehAmerikaSerikatterhadapdugaankecurangandiprosespemilihan umumRusia.MedevedevjugalangsungmenelefonPresidenASBarack Obama untuk membahas masalah itu. “Saya terpaksa mengingatkan Presiden Barack Obama lewat telefon bahwa penilaian AS terhadap proses pemilihan umum Rusia tidaklah penting bagi kami,” ujar Medvedev, seperti dikutip AAP, Minggu (18/12). Medvedev juga menegaskan, Rusia sangat terbuka dengan kritik, namunkritikituharusmembangun.Medvedevyangmenilaikomentar AS tidak dapat diterima dan Rusia akan terus bersikap pragmatis demi memenuhi kepentingan nasionalnya dalam interaksi dunia. “Bila mereka (AS) ingin menekan kami, kami akan tekan balik. Namun bila mereka mendengar-kan perkataan kami, kami akan bekerja sama,” tegasnya. Bagi Medvedev, segala bentuk pernyataan AS terhadap Rusia mengingatkannya kepada peristiwa Perang Dingin, dan hal itu tidak akan memperbaiki hubungan antara AS dan Rusia. Pemilihan umum Parlemen Rusia yang digelar 4 Desember lalu dimenangkan oleh Partai Persatuan Rusia yang dipimpin oleh PMVladimir Putin dan juga Medvedev. Namun, banyak pihak yang menilai bahwa ada kecurangan yang dilakukan oleh Partai Persatuan Rusia. Ribuan warga pun berdemo untuk memboikot hasil pemilihan umum itu. Menanggapi hal ini, Putin menuding AS dengan mengatakan, Menteri Luar Negeri AS Hillary Clinton menghasut para demonstran Rusiaagarmenciptakankerusuhan.Clintonpunlangsungmenampik tuduhan itu dengan mengatakan, demonstrasi Rusia muncul dari masyarakat Rusia dan tidak mengandung keterlibatan pihak luar. Pemilihan umum itu juga membuat AS dan Rusia tampak saling mengecam. Rusia juga makin agresif dalam menanggapi sistem pertahanan misil North Atlantic Treaty Organization (NATO) yang digagas oleh AS.(ok)

DENHAAG, Belanda (Waspada): Kematian mantan pemimpin Libya Moammar Khadafi yang ditangkap dan dibunuh oleh pihak pasukan Dewan Transisi Nasional (NTC), dianggap sebagai sebuah kejahatan perang. Jaksa Pengadilan Kriminal Internasional (ICC) Luis MorenoOcampo menyampaikan kecurigaannya kepada para wartawan. “Saya kira terbunuhnya Khadafi menimbulkan kecurigaan terkait kejahatan perang,” ucap Luis Moreno-Ocampo seperti dikutip Reuters, Jumat (16/12). “Bagi saya ini adalah isu penting. Kami mengungkapkan hal inisebagaibagiandarikeprihatinanduniainternasionaldanmempersiapkan rencana untuk melakukan penyelidikan atas kejahatan tersebut,” imbuhnya. Selain ICC, pemerintah sementara Libya yang dikuasai oleh NTC juga didesak untuk melakukan penyelidikan atas kematian Khadafi dan anaknya Motassim. Sebelum kematiannya, Khadafi sempat terekam dalam kamera telepon seluler dalam keadaan hidup. Tetapi selang beberapa lama kemudian, beredar video yang menunjukan Khadafi dalam keadaan sudah tidak bernyawa. Pihak NTC sendiri mengklaim Khadafi tewas dalam baku tembak. Sebelumnya, putri dari mantan pemimpin Libya Moammar Khadafi, Aisha Khadafi, mendesak ICC untuk menyelidiki kematian ayah dan adiknya. Nick Kaufman, pengacara yang mewakili Aisha mengatakan, pihaknya sudah menilai surat kepada Jaksa MorenoOcampo untuk mencari tahu informasi pembunuhan ayah beserta Motassim 20 Oktober lalu. Dalam surat itu disebutkan, Khadafi dan putranya dibunuh dengan cara yang sadis dan kemudian tubuh mereka dipamerkan di muka publik. Bagi Aisha ini jelas melanggar hukum Islam. Khadafi dan putranya Motassim ditangkap di dekat kota kelahirannya di Sirte Oktober lalu. Penangkapan ini berlangsung dua bulan setelah dirinya dilengserkan secara paksa oleh pihak antiKhadafi.

Presiden Korsel Temui PM Jepang Untuk Urusan Mantan Budak Seks

India Akan Dukung Resolusi Rusia Tentang Syria

TOKYO, Jepang (Waspada): Presiden Korea Selatan (Korsel) Lee Myung-bak mendesak PM Jepang Yoshihiko Noda agar turut serta menanggapi keluhan dari mantan budak seks Korsel yang dipaksa melayani tentara Jepang di era Perang Dunia II. Presiden Lee yang saat ini berada di Kyoto, Jepang, mengatakan, masalah yang dialami oleh para mantan budak seks tampak menjadi penghalang bagi hubungan bilateral Jepang dan Korsel. Namun, PM Noda mengatakan, masalah ini sudah dianggap selesai dua tahun yang lalu. Noda mengatakan, para pejabat Jepang sudah meminta maaf kepada mantan budak seks Korut pada 2009 lalu. Meski demikian, paramantanbudaksekstetapmemintakompensasikeJepang.Demikian seperti diberitakan The Associated Press, Minggu (18/12). Pada 14 Desember lalu, 500 perempuan tua mantan budak seks melakukanunjukrasadidepankantorKedutaanBesarJepang.Mereka menuntut permintaan maaf dari Jepang dan pemberian kompensasi. Lee juga mendesak Jepang agar Jepang membayar kompensasi terhadap para perempuan-perempuan tua itu sebelum terlambat. “Korsel dan Jepang harus menjadi mitra perdamaian dan stabilitas di wilayah Asia. Kita semua membutuhkan keberanian untuk memecahkan masalah para mantan budak seks yang saat ini menjadi halangan dalam hubungan Jepang dan Korsel,” ujar Lee. Demonstrasi itu merupakan demonstrasi ke-1.000 yang pernah dilakukan oleh mantan budak seks tersebut. Peristiwa ini juga mendapat tanggapan yang cukup mengejutkan dari Korut yang merupakan rival Korsel. Korut melayangkan surat dukungannya terhadap para mantan budak seks Korsel.(ok)

NEW DELHI, India (Antara/Xinhua-OANA): India mungkin mendukung resolusi PBB Rusia mengenai Syria setelah para analis di sini berpendapat krisis Syria sedang dieksploitasi oleh berbagai kelompok kepentingan, kata laporan surat kabar lokal The Times of India. Dengan mendukung resolusi Rusia, New Delhi berharap bisa mencegah terjadinya intervensi Barat diTimurTengah, kata laporan itumengutipsumber-sumber yangtakdisebutkannamanya. Setelah perang di Libya, India menentang intervensi lain Barat di satu negara Arab melalui kemungkinan resolusi Amerika Serikat atau Eropa di PBB. Seiring dengan negara-negara BRIC lain, India berkesimpulan bahwa kerusuhan di Syria sedang dieksploitasi oleh kepentingankepentingan yang berbeda. Misalnya, para pejabat melacak warga Syria mencatat di sini bahwa kekerasan kini sebagian besar terkonsentrasi di Homs, yang merupakan markas bagi Ikhwanul Muslimin, kata laporan tersebut. Para analis India juga percaya bahwa pembunuhan 27 tentara Syria oleh kelompok pemberontak, Pasukan Pembebasan Syria, yang diduga dipersenjatai oleh Turki, menjadi pemicu jelas bagi resolusi Rusia, kata laporan itu. Resolusi diajukan Rusia di PBB pekan ini yang intinya mengecam baik pemerintah Syria dan pemberontak yang menimbulkan kekerasan.

Presiden Palestina Ke Kairo Untuk Bahas Rekonsiliasi

Rig Pengeboran Ambruk, 76 Orang Dinyatakan Hilang MOSKOW, Rusia (Waspada): Rig pengeboran lepas pantai yang beroperasi di Laut Okhotsk, Rusia, ambruk. Sebanyak 76 orang petugas pengeboran minyak dinyatakan hilang. Pemerintah Rusia melaporkan, sembilan orang saat ini berhasil diselamatkan,namun76lainnyahilang.Merekadiselamatkandengan menggunakan helikopter dan kapal penyelamat. Demikian seperti diberitakan RIA Novosti, Minggu (18/12/2011). Operasi penyelamatan korban juga masih digelar di tengah cuaca yang buruk. Ombak pun tampak meninggi dan tiupan angin juga cukup kencang di wilayah tersebut. Menurut regu penyelamat, seluruh pekerja di rig lepas pantai itu mengenakan rompi pelampung, hal ini menunjukkan adanya kemudahan untuk melakukan penyelamatan. Rig itu juga memiliki empat buah kapal sekoci. Rig lepas pantai itu terletak sekira 200 kilometer dari Pulau Sakhalin, fasilitas pengeboran minyak tersebut dibangun pada 1985 silam dan merupakan salah satu rig lepas pantai terbesar di Negeri Beruang Merah.(ok)

Korut Tunda Program Pengayaan Uranium SEOUL, Korea Selatan (Waspada): Korea Utara (Korut) menyatakankesepakatannyauntukmenundaprosespengayaanuraniumnya. Bersamaan dengan ini, Amerika Serikat (AS) memutuskan untuk memberi bantuan pangan ke negeri komunis itu. MenurutmediaKoreaSelatan(Korsel),Korutberjanjiakanmengimplementasikan proses denuklirisasinya, termasuk menunda program pengayaanuraniumyangselamainidijalankannya.Korutjugasepakat untukmengawasiprosesdistribusibantuanpanganyangakandiberikan oleh AS. Demikian seperti diberitakan Yonhap, Minggu (18/12). Sekira 240.000 ton bantuan pangan akan diberikan oleh Paman Sam kepada negeri komunis itu. Utusan AS untuk Korut, Robert King, juga sudah berdialog dengan pejabat Kementerian Luar Negeri Korut, Ri Gun, Kamis hingga Jumat lalu. Penundaan proses pengayaan uranium merupakan salah satu langkah dari proses denuklirisasi. Dengan hal ini, AS juga berharap akan adanya kelanjutan dari dialog enam pihak. Korut mundur dari dialog enam pihak pada April 2009. Sikap Korut juga semakin mengkhawatirkan negara-negara tetangganya, termasuk AS sendiri. Korut pun sebelumnya mengancam akan menghentikan proses dialog bila AS dan Korsel terus mengadakan latihan militer bersama.(ok)

Militer Mesir Tembaki Lagi Pemrotes, 10 Orang Tewas KAIRO, Mesir (AP): Ratusan tentara Mesir menyerbu Lapangan Tahrir Kairo Sabtu (17/12), memburu para pemrotes dan memukuli mereka dengan pentungan dan melemparkan kamera wartawan televisi pada hari keduapenindasankerasterhadap para pemrotes anti-militer yang mengakibatkan delapan orang tewas dan ratusan lainnya cedera. Kekerasan dan pemandangan yang kacau itu telah menunjukkan ketegangan makin membara antara dewan militer yang berkuasa yang mengambil kekuasaan setelah penggulingan HosniMubarakdenganparaaktivisyangmenuntutpengalihankekuasaandariparajenderalkepada pemerintahansipil.Bentrokanitu juga hampir menggambarkan pengulangan peristiwa pertempuranjalananmautantarapemuda demonstrandanpasukankeamanan November lalu yang berlangsung selama beberapa hari, yang menewaskan lebih dari 40 orang. Sabtu dinihari, ratusan pemrotes melempari batu pada pasukan keamanan yang mengurung

para demonstran dengan cara menguasai jalanan di sekitar gedung parlemen dengan kawat berduri dan balok-balok beton. Tentara di atas atap bangunan melempari kerumunan massa di bawah dengan batu, yang menyebabkan banyak pemrotes menggunakan helm, piringan satelit atau lembaran logam untuk melindungi diri mereka. Batu, sampah dan pecahan kaca bertaburan di jalanan, sementara kobaran api menjulur dari jendela-jendela satu gedung bertingkat dua yang terbakar dekat gedung parlemen, yang menimbulkanasaphitamtebalmenjulang ke angkasa. Sejumlahsaksimatamengatakantentarayangdilengkapiperisai dan pentungan serta peralatan anti-huruharalainnyamelakukan pengejaran atas para pemrotes di jalanan sampai ke Lapangan Tahrir, yang menjadi pusat pergolakan yang telah menggulingkan Mubarak Februari lalu.Tayangan televisi CBC menunjukkan tentara memukuli dua pemrotes dengan tongkat, berulangkali me-

nginjak kepala salah seorang, sebelum meninggalkan tubuhnya yang tak bergerak lagi di jalanan. Tentara membakar tendatenda di dalam lapangan dan melakukan pencarian di seluruh bagiangedungdimanaparaawak televisimembuatfilmdanmereka kemudianmenyitaperalatanpara wartawan dan sempat menahan mereka beberapa saat. Kantor berita Mesir MENA mengatakan sekurang-kurangnya delapan orang tewas dan sekitar 300 lainnya cedera dalam dua hari bentrokan. PM Mesir membela respon pasukan keamanan. Sementara dia mengakui bahwa ada sejumlah yang tewas akibat tembakan, dia membantah militer dan polisi menembaki para pemrotes. Sebaliknya dia mengatakan, satu ‘kelompok yang datang dari belakang menembaki para demonstran’ dan pemerintahnya hanya ingin ‘menyelamatkan revolusi.’ Diamenuduhkelompokprotes anti-militer dari luar gedung Kabinet sebagai ‘anti-revolusi.’ “Saya merasa amat sedih dan

demikian sakit, “ katanya kepada para wartawan dalam satu temu pers yang disiarkan melalui televisi pemerintah Mesir. “Saya tegaskan di sini bahwa pasukan AB tidak bentrok dengan pemrotes dantidakmeninggalkangedung.” (m10)

RAMALLAH, Tepi Barat (Antara/Xinhua-OANA): Seorang pejabatseniorFatahmengatakanbahwaPresidenPalestinaMahmoud Abbas dijadwalkan mengunjungi Mesir Minggu(18/12)untukmelanjutkan diskusi nasional mengenai rekonsiliasi Palestina. Abbas direncanakan menghadiri pertemuan faksi-faksi Palestina di ibu kota Mesir Kairo, yang dijadwalkan Selasa, kata seorang anggota Komite Sentral Fatah Jamal Muhissen kepada Xinhua. “Fatah tegas dan serius” untuk berdamai dengan Hamas menurut perjanjian yang ditengahi Mesir antara dua kelompok bersaingan di Palestina itu Mei, kata Muhissen. Bulan lalu, Abbas, yang memimpin Fatah, bertemu dengan Khaled Mashaal di Kairo dan sepakat bahwa kedua belah pihak akan bekerja sama sebagai mitra. Pada tahun 2007, Hamas mengalahkan pasukan pro-Abbas dan mengambil alih Gaza, menjaga Nasional Palestina yang dipimpin Fatah yang berbatas sampai Tepi Barat. Selama pertemuan Abbas-Mashaal, dua saingan itu sepakat bahwa pemilihan umum akan diselenggarakan pada Mei, tetapi mereka gagal untuk menyepakati pemerintah transisi untuk mempersiapkan pemilu. Abbas akan berangkat ke Kairo setelah dia bertemu tahanantahanan yang diatur Israel untuk dibebaskan pada Minggu sebagai bagian dari kesepakatan yang diperantarai Mesir dengan Hamas. Pada tahap pertama dari perjanjian itu, Israel mengambil Gilad Shalit, tentara Israel yang telah ditahan Hanas selama lima tahun di Gaza, dan membebaskan 450 tahanan Palestina dalam pertukaran.

Polisi Tembaki Pemrotes Di Kazakhstan, 12 Tewas SHETPE, Kazakhkstan (AP): Polisi melepaskan tembakan ke arah para pemrotes rusuh di satu kota di daerah bergolak di baratdaya Kazakhstan, yang menyebabkan 12 orang tewas dalam kerusuhanduahariterakhirdinegeri itu, demikian menurut pihak berwenang Minggu (18/12). Sekurang-kurangnya satu orang tewas dan 11 cedera ketika polisi berusaha membubarkan protes yang dilakukan warga Shetpe Sabtu , katanya menambahkan. Satu pernyataan dari kantor Jaksa Agung mengatakan, kerusuhan yang terjadi Sabtu di kota , Shetpe, di kawasan yang sama

di mana terletak kota Zhanaozen di mana 10 orang tewas dalam bentrokan antara pemrotes dan polisi di kota itu Jumat. Shetpe telah dibanjiri oleh polisi Minggu sore. Polisi yang tampak canggung melakukan patroli di jalanan. Sebagian dari mereka berusaha untuk membatasi gerakan satu kelompok wartawan dan mengancam salah satu di antaranya dengan senjata api. Pernyataan itu mengatakan kira-kira 300 demostran yang mendukung para korban Zhanaozen memblokade lalulintas kereta api selama beberapa jam dan setelah polisi berusaha me-

maksa mereka pergi, satu kelompok yang terdiri dari 50 orang membakarsatulokomotif,kemudian bergerak menuju kota di mana mereka melempari kaca jendela dan membakar pohon Natal di balaikota. Pernyatan itu tidak menyebutkan secara spesifik ke arah mana polisi melepaskan tembakan sehingga mengenai para pemrotes. Kemlu Kazakhstan menyerahkantanggungjawabbentrokan itu pada satu kelompok kecil provokator yang telah mengganggu satu perayaan yang menandai ulangtahun ke-20 kemerdekaan Kazakhstan. (m10)



WASPADA Senin 19 Desember 2011

Ganti Rugi Tanah Melalui Perpres JAKARTA (Waspada): DPR RI menyetujui Rancangan Undang-undang Pengadaan Tanah bagi Pembangunan untuk Kepentingan Umum menjadi Undang-undang. Salah satunya mengatur ganti kerugian tanah melalui Peraturan Presiden (Perpres). Hampir semua fraksi setuju terhadap RUU tersebut, meski beberapa melampirkan dengan catatan. “Kami dari Fraksi Golkar dapat menyetujui dengan catatan tidak ada catatan sama sekali,” kata Ketua Fraksi Golkar Setya Novanto dalam Sidang Paripurna di Gedung MPR/DPR Jakarta, Jumat (16/12). Persetujuan atas RUU Pengadaan Lahan itu juga datang dari juru bicara Fraksi PDI Perjuangan Arif Wibowo. “Yang belum diatur dalam UU ini dibuat peraturan presiden untuk mengakomodasi hal-hal yang terkait tanah dalam sengketa. Diberikan kepada yang berhak, serta tidak ada istilah pemegang hak. Siapa yang berhak adalah rakyat, maka kami memberikan persetujuan atas UU ini,” ujarnya. Anshori Siregar dari Fraksi Partai Keadilan Sejahtera juga mengatakan, secara prinsip fraksinya setuju. Namun, salah satu anggotanya menyatakan harus ada perubahan di pasal 58 mengenai ketentuan peralihan. “Hanya saja, salah satu dari anggota kami meminta harus ada perubahan dalam pasal 58. Namun, secara

prinsip kami setuju,” tutur dia. Dari Fraksi Partai Amanat Nasional Teguh Juwarno turut menyatakan bahwa pada prinsipnyafraksinyamenyetujuisubstansiRUUitu,dengan catatan terkait pasal 9 perihal ganti kerugian yang layak dan adil. “Mengenai ganti kerugian yang sesuai dengan pasal 9 ayat 2 harus diatur dalam Perpres. Jadi, orang yang susah jangan dibuat susah, harus ada jaminannya,” katanya. Fraksi Partai Persatuan Pembangunan melalui Irgan Khairul Nafis juga menyatakan sepakat terhadap RUU Pengadaan Lahan untuk disetujui dalam sidang paripurna. “Fraksi PPP menyepakati UU ini disetujui,” ujarnya. Sementara itu, dari Fraksi Partai Kebangkitan Bangsa Abdul Malik Haramain mengatakan sepakat, asal dalam perjalanan UU ini, swasta tidak terlibat dan untuk penetapan lokasi harus dapat dikontrol dengan baik. “PKB berpendapat, ganti rugi merupakan kesempatan kepada warga untuk menuntut hakhaknya, sedangkan ayat dalam pasal 49 cukup diberikan ke dalam penjelasan,” katanya. Kemudian dari Fraksi Gerindra Ahmad Muzani menuturkan, jika diperlukan sinkronisasi dan harmonisasi dalam RUU itu, fraksinya menilai belum tepat. Namun, untuk naskah final, pihaknya sepakat. “Jika masih ada kekurangan, akan dimasukkan ke dalam Perpres,” ujarnya. (j07)

Anggota DPD Prihatin Krisis Moral Anak Bangsa Antara

AKSI SAURUS BELANDA: Sejumlah seniman asal Belanda berjuluk “Close Act Theater” memakai kostum “Saurus” untuk menghibur pengunjung di Bundaran HI, Jakarta, Minggu (18/12). Aksi ketiga seniman asal Belanda tersebut dalam rangka promosi Jakarta Bienale #14.2011, yang menampilkan seni kontemporer dengan tema “Maximum City: Survive or Escape”.

DPR Pertanyakan Bank Gunakan Debt Collector JAKARTA ( Waspada): Anggota Komisi XI DPR RI dari Fraksi Partai Amanat Nasional (FPAN) Muhammad Ichlas El Qudsi menyatakan keheranannya atas sikap Bank Indonesia yang mengizinkan bank menggunakan jasa debt collector (penagih utang) dalam urusan menagih kredit macet. “Kita akan minta penjelasan

BI. Apa dasarnya mengeluarkan keputusan yang membolehkan perbankan menggunakan jasa penagih utang itu,” ujar Michel usai rapat Paripurna di Gedung DPR RI, Jakarta, Jumat (6/12). Harusnya, lanjut Michel, kasus yang menimpa seorang nasabah Citybank yaitu Irzen Okta –yang tewas akibat perlakuan jasa penagih utang suruhan Citybank itu, menjadi bahan

pelajaran bersama, utamanya pihak perbankan. “Sebaiknya BI tidak lagi membolehkan jasa penagih utang kredit macet di perbankan yang dilakukan pihak outsourcing. Penagihan cukup dilakukan oleh bank itu sendiri,” kata dia. Michael menegaskan, bila argumentasi yang disampaikan BI tidak jelas dan tidak mempunyai dasar yang kuat, maka Komisi XI akan meminta keputu-

PBNU Desak Usut Tuntas Kasus Mesuji JAKARTA (Waspada): Ketua Pengurus Besar Nahdlatul Ulama (PBNU) H Slamet Effendy Yusuf mendesak pemerintah mengusut tuntas kasus Mesuji Lampung maupun Mesuji Sumatera Selatan. Polisi dan Komnas HAM diharapkan dapat melakukan penyidikan dan penyelidikan dan yang salah harus dihukum, sehingga masyarakat dapat dihindarkan dari situasi yang mencekam dan dipenuhi rasa takut. Slamet Effendy Yusuf menanggapi dugaan kuat terjadinya pelanggaran HAM di Mesuji Lampung, maupun Mesuji Sumtaera Selatan, yang telah menelan banyak korban jiwa maupun luka-luka dengan jum-

lah cukup besar akibat tembakan. “Kasus ini tidak boleh berlalu tanpa pengusutan yang tuntas,” tandas mantan Ketua Umum PP GP Ansor itu kepada wartawan Jumat (16/12). Menurut dia, dari laporan masyarakat dapat disimpulkan dari kasus ini ada beberapa masalah yang jika dibiarkan bisa mengakibatkan kehidupan yang abai terhadap aturan hukum dan perlindungan terhadap hakhak asasi manusia (HAM). Pertama, pengabaian terhadap hak milik tradisional masyarakat lokal yang bersifat turun-temurun atas tanah karena ada kekuatan modal yang didukung oleh kuasa aparatus negara. Kedua, adanya upaya adu-

domba masyarakat oleh kekuatan modal yang mengakibatkan konflik sesama masyarakat. Ketiga, adanya dugaan keterlibatan alat negara dalam melakukan kekerasan terhadap rakyat atau setidak-tidaknya melakukan pembiaran atas perbuatan kekerasan tersebut di tengah masyarakat. Hal itu mengindikasikan terjadinya pelanggaran berat atas HAM rakyat Mesuji dan sekitarnya. Karena itu harus ada pengusutan dan tindakan nyata dari penegak hukum maupun Komnas HAM. Dalam hal ini penyelidikan juga harus menjangkau perusahaan yang menggunakan kekerasan seba-gai metode mencapai tujuan. (j07)

Timwas Diperpanjang, Korban Kasus Bank Century Senang JAKARTA (Waspada): Masa kerja Tim Pengawas Kasus Bank Century DPR RI resmi diperpanjang hingga Desember 2012. Perpanjangan masa kerja Timwas Century imi disetujui pada rapat paripurna yang berlangsung di Gedung DPR-Jakarta, Jumat (16/12), dipimpin Pramono Anung Wibowo. Perpanjangan masa kerja Timwas ini disambut dengan gembira oleh nasabah yang menjadi korban. Beberapa nasabah yang jadi korban datang melihat sidang paripurna untuk mengetahui keputusan DPR. Dari sembilan fraksi, PDIP, Partai Gerindra, Partai Hanura,

PKS dan PPP setuju diperpanjang, tiga fraksi yakni Partai Golkar, PKB dan PAN tak tegas sikapnya dan menyerahkan keputusan kepada pimpinan DPR sementara Fraksi Partai Demokrat menolak perpanjangan masa kerja Timwas. Anggota Komisi III DPR Fraksi PDI Perjuangan Trimedya Panjaitan mengatakan Timwas kasus Bank Century memang harus diperpanjang agar Timwas efektif mendorong perkembangan proses hukum perkara Century di KPK. “Saat rapat terakhir memang dire-komendasikan tim kecil untuk Timwas diperpanjang, karena kita meli-

BK DPR Terima 68 Pengaduan JAKARTA (Waspada): Badan Kehormatan DPR RI hingga Desember 2011 menerima 68 pengaduan yang menimpa anggota DPRRI Priode 2009-2014. Ketua Badan Kehormatan (BK) DPR RI Muhammad Prakosa mengatakan dari 68 pengaduan itu, 23 pengaduan tidak ditindaklanjuti karena tidak memenuhi persyaratan administrasi dan bukan merupakan pelanggaran kode etik, serta alamat fiktif sehingga kesulitan dihubungi. Sedangkan keputusan terbaru BK DPR yakni merekomendasikan pemberhentian sementara dua anggota DPRRI yang mendapat persetujuan pada rapat paripurna DPR, Jumat (16/12). Prakoso menjelaskan, sesuai UU MD3 (MPR, DPR,

DPRD, DPD), anggota dewan yang menjadi terdakwa harus diberhentikan sementara. Ketika kasusnya sudah berkekuatan hukum tetap, maka anggota itu harus dipecat. Meski demikian, Prakosa tak mau menyebut siapa dua anggota dewan yang direkomendasikan BK itu untuk diberhentikan sementara. Demikian juga halnya Wakil Ketua DPR Pramono Anung yang memimpin sidang paripurna juga tak menyebutnamaanggotaitusaatmeminta persetujuan para anggota dewan untuk pemberhentian sementara kedua orang itu. Prakosa menegaskan dalam pengambilan keputusan tersebut, BK DPR RI berusaha untuk menanggalkan kepentingan pribadi maupun partai dalam menilai suatu perbuatan. (aya)

hat penegakan hukum belum maksimal misalnya apa yang dilakukan KPK hampir dua tahun tidak ada kemajuan,” ujar Trimedya Panjaitan. Fraksi Hanura melalui juru bicaranya Akbar Faisal mendukung penuh diperpanjangnya Tim pengawas (Timwas) kasus skandal bailout Bank Century sebesar Rp6,7 triliun. Menurut fraksinya, kasus skandal ini hanya bisa diselesaikan dengan penggunaan hak menyatakan pendapat (HMP), yang tentunya, mendukung kinerja Timwas untuk diperpanjang. Akbar Faisal menegaskan, penyelesaikan kasus skandal bailout Bank Century, sebenarnya sudah pada tahap atau fase yang seharusnya membuat DPR khawatir. Bahkan, kata Akbar Faisal, BPK yang sedang melakukan audit forensik dalam kasus ini, seakan sedang tergagap-gagap. Sebelumnya, perwakilan dari Timwas Century Fahri Hamzah meminta agar masa kerja Timwas Century diperpanjang. Sementara, sebagian fraksi beralasan ingin menunggu audit forensik yang dilakukan Badan Pemeriksa Keuangan (BPK). Seperti diketahui, BPK akan menyelesaikan audit pada 23 Desember 2011. Ester Nuriadi, satu dari belasan korban skandal Bank Century mengatakan, paling tidak, kami senang Timwas diperpanjang. Kami tiga tahun menantinanti janji Presiden SBY yang bilang, menuntaskan kasus ini. Kami sudah letih mas, tapi hak kami untuk mendapatkan keadilan,” kata Ester. (aya)

san tersebut dicabut sehingga tidak meresahkan masyarakat, khususnya para nasabah. “Jangan sampai penggunaan jasa debt collector malah membuat masyarakat resah. Dan kita juga tidak ingin kasus yang menimpa seorang nasabah Citybank, terulang kembali,” harapnya. Sebelumnya Kepala Biro Penelitian dan Pengaturan Per-

bankan BI Irwan Lubis menyampaikan untuk memperbolehkan bank menggunakan kembali jasa penagih kredit atau debt collector yang memiliki badan hukum jelas. Alasan BI memperbolehkan perbankan memakai jasa debt collector, selain bisa dipertanggungjawabkan, jasa penagih juga dianggapnya tidak mempengaruhi proses produksi perbankan. (aya)

Agenda Utama DPD Amandemen Kelima UUD 1945 JAKARTA (Waspada): Ketua Dewan Perwakilan Daerah (DPD) Irman Gusman mengharapkan tahun 2012 menjadi momentum bagi DPD untuk mereformasi konstitusi dan memfokuskan kegiatan DPD menata sistem ketatanegaraan dan konsolidasi demokrasi. “Agenda utama DPD tahun 2012 adalah amandemen kelima UUD 1945. Kita berharap tahun 2012 menjadi tahun yang bersinar dan bermakna,” ujar Irman Gusman, sebelum menutup Sidang Paripurna DPD di Gedung DPD Jakarta, Jumat (16/12). Untuk itu Irman mengingatkan semua anggota DPD agar menandatangani Naskah Usul Perubahan Kelima UUD 45 sebelum kembali ke daerah pemilihannya. Menurut Irman, penataan sistem ketatanegaraan menjadi syarat mutlak konsolidasi demokrasi. “Esensi konsolidasi demokrasi ialah sikap, baik elit maupun massa, yang mencakup dan bertolak dari prinsip demokrasi. (aya)

Motif Sondang Bakar Diri Belum Terungkap JAKARTA (Waspada): Setelah 10 hari peristiwa bakar diri di depan Istana Negara, polisi belum dapat memasikan motif bakar diri, namun polisi memastikan pria yang awalnya misterius adalah Sondang Hutagalung, mahasiswa Universitas Bung Karno (UBK) angkatan tahun 2007. “Sampai saat ini belum diketahui secara pasti motivasi Sondang melakukan bunuh diri dengan cara membakar diri,” kata Kasat Reskrim Polres Metro Jakarta Pusat Kompol Hengky Haryadi kepada wartawan di Jakarta, Jumat (15/12). Aksi bakar diri yang dilakukan Sondang seorang diri pada Rabu (7/12) lalu, di depan kantor Presiden SBY masih menimbulkan tanda tanya. Apalagi dengan kenekadan Sondang yang dikenal di kalangan kampus sebagai aktivis yang eksis dengan penegakan Hak Azasi Manusia (HAM) dan berjuang bersama rekan-rekan mahasiswa lainnya dalam menegakkan keadilan. Aksi nekadnya baru diketahui semua pihak termasuk media masa setelah Sondang dilarikan ke RSCM dengan luka bakar mencapai 98 persen. Sedangkan kepastian pria nekad ini setelah 10 hari peristiwa tersebut barulah polisi dapat memastikan identitas Sondang. Hal tersebut berdasarkan hasil tes DNA yang dilakukan forensik Polri saat Sondang masih kritis di RS Cipto Mangunkusumo. “Iya benar, berdasarkan tes DNA adalah Sondang,” kata Hengky. Menurut Hengky, DNA yang dicocokkan dengan keluarga Sondang, telah selesai beberapa waktu yang lalu. (j02)

MEDAN (Waspada): Anggota DPD RI daerah pemilihan Sumatera Utara DR. H. Rahmat Shah menyimpulkan, bangsa ini tengah digerogoti krisis identitas dan krisis moral. Hal ini dapat dilihat dari perkembangan dan dinamika sosial politik kehidupan berbangsa dan bertanah air Indonesia. Krisis identitas merupakan pertarungan kekuatan bangsa ini menghadapi gelombang globalisasi sedangkan krisis moral lebih disebabkan kurangnya perhatian kita untuk meneguhkan identitas kebangsaan dan kenegaraan kepada segenap masyarakat. Kesimpulan ini disampaikan Rahmat yang menjadi narasumber pada kegiatan Sosialisasi Empat Pilar Kehidupan Berbangsa dan Bernegara. Sosialiasasi ini berlangsung di Rahmat International Wildlife Museum & Gallery Jl S. Parman, Medan, Rabu (14/12). Dalam kesempatan tersebut, Rahmat mengingatkan bahwa sejak kemerdekaan hing-ga sekarang, kita belum matang dalam membentuk harga diri sebuah bangsa. Tidak merasa malu mendapat tempat sebagai bangsa yang bernilai rendah, baik dalam indeks sumber daya manusia maupun dalam nilai ketinggian moral sehingga kita senantiasa gagal untuk keluar dari penilaian sebagai bangsa dengan tingkat korupsi yang mengkhawatirkan. Oleh karena itu, menurut Rahmat, Majelis Permusyawaratan Rakyat (MPR RI) meng-amanahkan kepada segenap anggotanya untuk melakukan upaya-upaya peneguhan pemahaman akan identitas kehidupan berkebangsaan dan berkenegaraan kepada masyarakat. “Kita berharap, dari kegiatan sosialisasi ini, akan timbul kesadaran dan semangat baru untuk

bangga berbangsa dan bernegara Indonesia. Selain itu timbul juga semangat untuk ikut aktif berpartisipasi di dalam proses pemba-ngunan dengan segala potensi yang kita miliki,” ujar Rahmat. Rahmat yang juga merupakan Konsul Jenderal Kehormatan Republik Turki untuk wilayah Sumatera, dan baru saja memimpin delegasi DPD RI melakukan studi banding ke Turki, menjelaskan, dalam beberapa hal, kita patut mengambil pelajaran dari negara sahabat tersebut. Rahmat mencontohkan bagaimana rasa bangga warganya akan kebangsaan dan kenegaraan Turki mampu membuat mereka menjadi bangsa dan negara yang diperhitungkan dalam percaturan politik dunia. Selain itu, masyarakat Turki terkenal akan semangat berbuat dan memberi. Hal ini dapat terlihat pada saat Indonesia mengalami bencana tsunami, khususnya yang terjadi di Aceh. Contoh lain yang dikemukakan Rahmat adalah masalah pertanahan. Kasus-kasus pertanahan yang terjadi di sana dapat diputuskan dan dieksekusi oleh pengadilan dalam waktu yang relatif singkat. Oleh karena itu, Rahmat berpesan kepada para peserta sosialisasi agar senantiasa melakukan kebaikan sekecil apapun, kepada siapapun dan dimanapun berada. Dan jangan lakukan yang kita tidak ingin orang lain lakukan kepada kita. Rahmat mengharapkan agar dinamika yang berkembang di dalam upaya melakukan pembinaan dalam sosialisasi ini dapat membangun identitas bangsa kita menjadi lebih baik dan jauh dari korupsi. Dan harga diri bangsa kita tetap terjaga. (rel/m08)

Terbuka Peluang Mengamandemen UUD 1945 JAKARTA (Waspada): Wakil Ketua Majelis Permusyawaratan Rakyat (MPR) Hajriyanto Yasin Thohari menyatakan, mengamandemen Undang-Undang Dasar Negara Republik IndonesiaTahun 1945 (UUD 1945) sangat terbuka asalkan usul perubahannya memenuhi prasyarat atau tata cara dalam UUD 1945. “Mengamandemen UUD 1945 tidak tabu, asalkan menjadi kehendak kolektif dan merupakan pilihan demi menjaga kelarasan dan kelangsungan bangsa dan negara,” ujarnya pada Sarasehan Nasional Kelompok DPD di Gedung DPD RI Jakarta, Kamis (15/12). Menurutnya, peluang sangat terbuka dengan mensyaratkan bahwa usul perubahan konstitusi memenuhi ketentuan tata cara sebagaimana diatur dalam Pasal 37 ayat (1) dan (2) UUD 1945. Dia merujuk kewenangan MPR dalam Pasal 3 ayat (1) UUD 1945 yang menyatakan, MPR berwenang mengubah dan menetapkan UUD. Namun, untuk perubahan kelima UUD 1945 harus memenuhi prasyarat atau tata cara dalam Pasal 37 ayat (3) dan (4) UUD 1945 yang menamanatkan untuk mengubah pasal-pasal UUD 1945, maka sidang MPR harus dihadiri sekurang-kurangnya 2/3 jumlah anggota MPR dan putusan untuk mengubahnya dengan persetujuan sekurang-kurangnya 50% plus 1 anggota MPR. “UUD 1945 tidak sakral, dan tidak perlu disakralkan, meskipun perubahan konstitusi mem-

butuhkan prasyarat yang tidak mudah. Tidak ada konstitusi yang sempurna, karena konstitusi merupakan resultante kebutuhan suatu bangsa atau negara, juga kristalisasi pemikiran anakanak negeri yang berkembang merespon kebutuhan,” tandasnya. Wacana mengubah UUD 1945 di arena publik, tambahnya, adalah wajar, apalagi masyarakat kita sangat dinamis. Merefleksi kilas balik reformasi, dari episode demi episode, ternyata perubahan kesatu, kedua, ketiga, dan keempat UUD 1945 mengandung kelemahan konsepsional, sehingga bermunculan berbagai macam kritikan dan keluhan, bahkan kecaman. Diakuinya, akhir-akhir ini orang mempertanyakan mengapa kita meniadakan GBHN (garis-garis besar haluan negara) dari sistem ketatanegaraan kita, eka prasetya pancakarsa atau P4 (Pedoman Pengamalan dan Penghayatan Pancasila), dan Sidang MPR sebagai lembaga pertanggungjawaban formal presiden dan wakil presiden. Semua kritikan dan keluhan, bahkan kecaman, tersebut membuktikan bahwa perubahan UUD 1945 tidak disiapkan sebaik-baiknya oleh para pemimpin dan para tokoh. “Karenanya, kegiatan DPD selama ini, yang sangat panjang dan tidak kenal lelah, mengadakan forum- forum yang melibatkan banyak pihak agar mereka berpartisipasi dan membicarakan perubahan kelima UUD 1945 harus mendapat apresiasi” ujar Hajriyanto Y Thohari. (aya)

Natal PSBI 27 Desember Di Jakarta JAKARTA (Waspada): Keluarga besar marga Simbolon yang ada di sekitar Jakarta, Bogor, Depok, Tangerang dan Bekasi, seJabodetabek serta Bandung dan Banten, akan memeriahkan Natal Punguan Simbolon Dohot Boruna Indonesia (PSBI) yang akan digelar 27 Desember 2011 di Boulevard Barat, Kepala Gading Jakarta. Natal PSBI ini dikemas dengan sangat apik oleh panitia yang diketuai Manasar Simbolon, SH, M.Si yang didukung Ketua Umum PSBI Drs Effendi Marah Sakti Simblon, yang juga Wakil Ketua Komisi VII DPR RI. Kali ini, natal PSBI akan lebih mengedepankan peranan anakanak untuk bersukaria dengan dengan berpakain ulos Batak. “Kita ingin natal ini sebagai momen keluarga besar marga Simbolon yang menginginkan generasi ke depan lebih sukses,” ujar Manasar Simbolo, didampingi Sekretaris Banjir Krismon Simbolon dan Kordinator Publikasi Ir Ramses Simbolon, MBA pada konfrensi pers di Jakarta, Kamis (15/12). Selain kegiatan pembacaan liturgi dan mendendangkan lagu puji -pujian, pada natal PSBI ini. Para orang tua dan anak juga akan mengumandangkan kidung indah melalui paduan suara PS Ina, Anak dan Nasposo (pemuda/i) PSBI, serta Koor Ama HKBP Menteng dan PS Exaudia. Juga tidak ketinggalan artis papan atas seperti Judika Sihotang, Rani Simbolon, Pasto Band, Simbolon Kid dan Simbolon Grup. (aya)


HARI BURUH MIGRAN: Sejumlah aktivis dari Migrant Care melakukan aksi damai memperingati hari Buruh Migran se-dunia di Bundaran HI, Jakarta, Minggu (18/12). Dalam aksinya mereka menuntut perhatian pemerintah untuk menyelesaikan permasalahan Tenaga Kerja Indonesia yang dirampas haknya, terutama di Arab Saudi.

Ekonomi & Bisnis

WASPADA Senin 19 Desember 2011

Pengamat & Praktisi Manajemen

Inspirasi Bisnis

SELALU menyenangkan berbicara dengan pengusaha sukses. Tak pun harus seorang milyarder, sekadar pengusaha kelas mikro kecil sekali pun selalu ada keindahan dalam perkataannya. Bagi saya, mereka terlihat seperti seorang pahlawan yang baru pulang dari pertempuran suci membela Negara. Pikiran dan batinnya memancarkan cahaya mutiara kemenangan. Bagi mereka yang sudah melampaui pertempuran sengit dalam karir bisnisnya, lebih lagi indah terlihat. Bintang tanda jasanya terlihat berderet pada atribut yang dikenakannya, sebuah perlambang sukses yang layak disandangnya. Tergantung karakter dasar kepribadiannya, masing-masing memiliki gaya penyampaian yang berbeda-beda, ada yang merunduk merendah tetapi tetap tidak bisa mengaburkan pesona suksesnya. Ada yang senang pamer yang menurut saya sahsah saja atas prestasi yang tidak bisa dicapai semua orang. Tetapi ciri khas para jawara itu tetap sama, sarat dengan pengalaman, sesuatu yang bermanfaat bagi siapa saja yang mau belajar tentang kehidupan. Sayangnya, semakin besar dan sukses mereka berbisnis, semakin sulit bagi kita untuk bisa menemuinya. Andaikan bisa bertemu, pengalaman yang mereka kumpulkan begitu banyak dan besar seiring proses panjang yang mereka lewati. Sebegitu banyaknya sehingga kita sulit mengikutinya. Dan karena pertemuannya tidak lama, maka proses perjalanannya yang berliku dan panjang akan disampaikan dalam sebuah kesimpulan layaknya sebuah dongeng indah yang selesai dalam hitungan menit. Dongeng sukses bisnis dan kesejahteraan finansial selalu memukau dan indah ditelinga. Semua orang ingin kaya raya. Hingga tidak sedikit pemimpi yang mengidamkam sukses itu. Aroma kerinduan akan kesejahteraan itu selalu tercium disemua percakapan di kedai kopi, di seminar-seminar motivasi, di pojokpojok perkantoran dan di sudut-sudut tempat merokok bahkan disela-sela pertemuan pengajian sekalipun. Mentor Karena sekolah-sekolah yang ada di negeri ini tidak ada yang memiliki kurikulum cara menjadi orang kaya, maka kita memerlukan guru dan mentor yang bisa bercerita serta membimbing kita dengan intens dan berkelanjutan. Beruntunglah mereka yang mendapatkan mentor bisnis selama proses belajarnya. Sesuatu yang mahal dan sangat bernilai. Para mentor itu akan membimbing kita dengan baik karena mereka sudah mengalami proses-proses yang harus kita lewati ketika belajar menuju bisnis yang sukses. Beruntunglah mereka yang memiliki orang tua, saudara, kerabat atau sahabat yang sudah terlebih dahulu menjalani ujian bisnis, sehingga mereka bisa membimbing kita. Bagi mereka yang tidak punya mentor dekat, bukan berarti kiamat, karena semesta menyediakan mentor-mentor bagi mereka yang mau mencarinya dengan sungguh-sungguh. Karena bisnis adalah proses ilmu praktik. Ilmu yang bisa dipelajari oleh siapa saja. Bagi mereka yang tidak memiliki mentor pribadi, yang diperlukan hanyalah memperbanyak jumlah orang yang ditemui, memperbanyak jumlah buku dan referensi yang dibaca serta banyak mengunjungi tempat-tempat yang berbeda-beda. Tentu saja mendapatkan mentor jalanan ini perlu ketram-

Cahyo Pramono


pilan mendengar, melihat dan memilah-milah mana yang benar dan mana yang tak perlu diikuti. Ketika kita bertemu para mentor gratisan ini, biasanya mereka tidak akan menyebut dirinya sebagai guru tapi sebenarnya merekalah yang memberikan kita inspirasi dan petunjuk praktis untuk kebaikan kita. Bagi saya itulah guru sejati. Pada proses mentoring dengan mentor jalanan ini, kita akan menemukan para calon pengusaha dan pengusaha yang masih menjalani proses menuju suksesnya masing-masing. Isi percakapan mereka terdengar lebih merdu, lebih seru dan penuh bumbu-bumbu mimpi. Tak sedikit dari mereka yang berteori cara mudah mendapatkan uang besar dalam waktu singkat. Mereka mencoba menyakinkan kita bahwa teori mereka benar. Tetapi semua teori selalu ada di tataran tidak riil. Biasanya teori indah itu belum terjadi tapi bisa dibayangkan. Terima saja wejangan itu sebagai pengkaya khasanah pikiran kita, tetapi teruslah fokus hingga kita menemukan mutiara ilmu yang sejati dan benar adanya. Arang dan intan Dalam sebuah penelitian, konon kandungan karbon dalam arang kayu memiliki kesamaan dengan kandungan karbon dalam intan. Dua benda yang sangat berbeda nilai dan harganya. Perbedaan mendasar antara kedua benda itu adalah proses penciptaannya. Intan yang lebih berharga terjadi karena sebuah proses yang lebih panjang, lembih lama, dengan tekanan yang komplek dan berat. Para mentor yang kita temui ada yang sudah mejadi intan dan banyak yang baru menjadi arang. Jangan terjebak dengan impian yang berlebihan dan jangan juga terjebak dengan hanya melihat suksesnya para mentor itu. Memang indah ketika kita membayangkan sukses itu menjadi milik kita. Memang sedap ketika sukses kita bayangkan menjadi milik kita. Sangat senang membayangkan semua kesulitan keuangan akan terselesaikan. Semua kemewahan dunia bisa kita nikmati. Semua hal yang bisa dibeli bisa didapatkan. Semua menjadai berwarna dan indah terbayangkan. Jangan terjebak dalam impian itu tanpa menyadari bagaimana proses para mentor itu mendapatkannya. Pada proses itulah kunci sukses yang harus kita pelajari. Seperti proses alam menempa intan. Kita sering siap dengan hasil yang sukses tetapi banyak yang tidak siap dengan menjalani prosesnya. Karena itu, ketika berkomunikasi dengan para mentor, termasuk pada waktu membaca referensi, pastikan kita mendapatkan petunjuk-petunjuk dan trik-trik bagaimana secara praktik mereka mengerjakannya. Bawa pembicaraan tentang tahapan-tahapan proses sukses mereka. Bawa pertanyaan kearah proses. Ke arah pengalaman nyata yang mereka hadapi. Mentor-mentor jalanan tidak dididik menjadi guru yang pandai menyampaikan dengan runtun dan terstruktur. Mereka bisa lompat kesana-kemari. Karena itulah perlu upaya mengarahkan mereka kepada rahasia-rahasia yang memang hendak kita minta. Bantu mereka dengan pertanyaanpertanyaan. Bantu mereka mengajari kita dengan meminta mereka memberikan contoh praktis, meminta referensi, meminta informasi apa saja yang kita butuhkan. Perhatikan dan catat. Itu cara pertama kita belajar, dalam hitungan jam, niscaya kita akan melupakannya. Hanya ada satu cara efektif untuk bisa menyerap dan mengingat ilmu tersebut dan menjadikannya bermanfaat bagi kita. Praktikkan! Titik. Konsultasi & Pelatihan

Camping Telkomsel School Community Dirancang Edukatif MEDAN (Waspada): Dalam rangka memberikan apresiasi bagi pelanggan tergabung dalam School Community, Telkomsel menggelar School Community Camp, yakni program pengembangan kepribadian bagi para pelajar dalam bentuk kegiatan camping bersifat edukatif sekaligus menghibur. Kegiatan School Community Camp dilakukan secara nasional untuk wilayah Regional Sumbagut diadakan di Medan dengan jumlah peserta 100 pelajar dari 37 SMA tersebar di wilayah Banda Aceh, Lhokseumawe, Sigli, Meulaboh, Medan, Binjai, Lubuk Pakam, Siantar, Padangsidimpuan, Rantauprapat,Tanjung Balai,Sibolga dan Nias. Para peserta mengikuti berbagai kegiatan pelatihan dan pembekalan motivasi dan leadership berupa camping, outbond, dan pertunjukan hiburan di alam terbuka. Sebelumnya acara Telkomsel School Community Camp telah dilakukan di Berastagi. Disela-sela kesibukan mengikuti program Supercamp2 di Kampung Ladang Tuntungan Sabtu (3/12) diantara peserta sempat mengutarakan kegembiraannya bisa terpilih menjadi ambassador Telkomsel di sekolahnya. Karena dengan mengikuti ataupun bergabung dalam Telkomsel School Community banyak pengamalan baru bisa mereka dapatkan selama mengikuti kegiatan tersebut. Josi Firdaus misalnya, pelajar kelas XI SMKN-I Meranti Kabupaten Asahan ini tampak begitu senang bergabung dengan teman-teman barunya yang sama sekali belum dikenalnya. Walaupun baru pertama ikut program Supercamp, namun Yosi Firdaus sudah mampu berinteraksi dengan temantemannya yang dari wilayah Sumbagut. Dia sendiri mengaku menggunakan kartu simPATI, disamping kartu As yang keduanya memiliki kelebihan masingmasing seperti jagoan serbu


Waspada/Dickson Pelawi

MESKIPUN harga kentang di Desember anjlok, namun minat petani terhadap tanaman ini tetap tinggi, Seperti yang terlihat dilahan pertanian kentang yang subur milik Panitra Nedy Tarigan di desa Kabung kecamatan Barusjahe, yang masih tetap menekuni tananam kentangnya.

Kebijakan Impor Kentang Rugikan Petani Karo BERASTAGI ( Waspada) : Munculnya kebijakan pemerintah secara nasional tentang impor kentang dari luar negeri yang semula dianggap dapat menjaga keseimbangan harga dan ketersediaan pasokan di pasaran ternyata sebaliknya. Harganya di pasar tradisiolal menjadi turun dan dampak lain yang muncul membuat petani kentang yang ada di daerah produsen kabupaten Karo terimbas dan mengalami kerugian besar. Turunnya harga kentang yang sebelumnya bertahan dengan harga diladang Rp5.500 per kg , turun menjadi Rp5.000 dan turun lagi Rp4.500 dan terakhir menjadi Rp2.000 per kg diprediksi sejumlah kalangan sebagai akibat masuknya kentang dari Bangladesh dan Pakistan ke Indonesia dengan alasan kentang yang ada di dalam negeri tak mampu lagi mencukupi kebu-

Bekas Pabrik AAF Terancam Jadi Besi Tua Diba Nurfath

Josi Firdaus

Mega Putri Loi

yang memang sangat disenangi anak muda karena bisa memilih paket sesuai dengan yang diingikan hanya dengan menekan *100# lalu tekan Ok/yes. Dan khusus untuk pelanggan yang mengaktifkan kartu As mulai 14 Desember 2011 dapat memperoleh gratis nelpon 30 jam cukup dengan menekan *100# dan pilih “GRATIS Nelpon 30 Jam”, atau langsung melalui *100*30# lalu ok/yes Promo ini dapat dinikmati setelah pelanggan kartu As melakukan panggilan ke sesama pelanggan TELKOMSEL mulai pk.00.00 hingga pk.23.59 dengan akumulasi pemakaian pulsa antara Rp500 hingga Rp5.000 sesuai zona lokasi pelanggan. Setelah melewati batas pemakaian pulsa, pelanggan akan mendapatkan total gratis 300 menit nelpon yang berlaku selama 30 jam, dengan pembagian 200 menit untuk pk.00.00 hingga pk.23.59 dan 100 menit untuk pk.00.00 hingga pk.06.00 di keesokan harinya. Selain itu, pelanggan juga dapat menikmati gratis SMS ke semua operator dengan mengirimkan satu hingga 10 SMS sesuai zona lokasi pelanggan. Setelah melewati batas pengiriman SMS, pelanggan akan mendapatkan gratis ribuan SMS pk.00.00 hingga pk.16.59 dan gratis ratusan SMS untuk pk.17.00 hingga pk.23.59. Di tempatnya tinggal Desa Meranti, kata Josi Firdaus jaring-

an juga bagus, hingga memudahkannya berkomunikasi dengan teman maupun sesama anggota TSC lainnya yang baru dikenalnya selama mengikuti program Supercamp. Mega Putri Loi siswi kelas II SMKN I Teluk Dalam Nias pun tampak begitu bersemangat mengikuti program Supercamp-2 ini. “Sangat menyenangkan,” ungkapnya. Di pihak lain, Diba Nurfath siswi SMAN III Banda Aceh yang baru tiga bulan menjadi ambassador Telkomsel di sekolahnya juga tak bisa menyembunyikan perasaan gembiranya bisa ikut program Supercamp-2 diselasela masa libur sekolahnya. Dia sendiri berhasil terpilih setelah mampu merekrut lebih 350 anggota masuk menjadi peserta Telkomsel School Community. Diba mengaku menggunakan kartu As sejak SMP Kelas II sampai sekarang karena banyak kemudahan didapatnya seperti tarif murah ditopang jaringan luas. Dia mengajak temannya bergabung menjadi anggota TSC biasanya lewat internet ataupun teman-teman abangnya diajaknya bergabung. Secara terpisah GM Sales & Customer Service Regional Sumbagut Filin Yulia mengatakan program Supercam diadakan sebagai bentuk apresiasi atas loyalitas anggota Telkomsel School Community (TSC). Dalam kegiatan ini, para peserta akan berpartisipasi dalam beragam permainan petua-

langan menantang yang merangsang keterampilan dan melatih kekompakan, seperti: team building, teamwork, dan problem solving. Para anggota TSC ini juga akan mendapat pengetahuan menarik seputar social media. Di samping itu, Telkomsel juga menghadirkan motivator handal yang akan menyampaikan materi self-improvement untuk memberikan motivasi bagi para peserta. Di samping itu, anggota TSC juga mendapatkan berbagai penawaran menarik berupa diskon harga spesial untuk berbagai layanan Telkomsel. Anggota TSC dapat menikmati tarif murah untuk nelpon, SMS, dan internet.Tersedia pula paket spesial chatting melalui layanan Chatbox (Rp5.500 per 30 hari), paket hemat internet berkecepatan tinggi TelkomselFlash (Rp10.000 untuk 35 MB), serta diskon penggunaan GPRS menjadi Rp1 per kb. Untuk menjadi salah satu peserta program ini, pelajar SMU yang menjadi pelanggan simPATI atau kartu As harus mendaftarkan diri menjadi anggota TSC. Cukup dengan kirim SMS, ketik SEKOLAH<spasi><School I D > , c o n t o h : S E KO L A H 1235456789, lalu kirim ke 2323. Pendaftaran anggota TSC juga dapat dilakukan melalui email Sekolah yang ingin mendapatkan school ID dan bergabung ke dalam TSC dapat menghubungi kantor GraPARI Telkomsel.(m06)

LHOKSEUMAWE ( Waspada):Warga lingkungan mempertanyakan janji Menneg BUMN menghidupkan kembali pabrik pupuk Aceh ASEAN Fertilizer (AAF) di Krueng Geukueh, Aceh Utara. Bekas pabrik milik negara-negara ASEAN itu terancam menjadi besi tua karena belum juga berproduksi. Persatuan warga lingkungan pabrik tergabung dalam ikatan keluarga besar warga gusuran AAF mempertanyakan proses menghidupkan kembali pabrik pupuk di kawasan Krueng Geukueh tersebut. “Pemerintah harus memperjelas status PT AAF. Sampai sekarang belum ada tanda-tandanya akan segera dihidupkan kembali,” ungkap Ketua Ikatan Kelurahan Besar Warga Gusuran AAF, Murdani Abbas kepada Waspada, Jumat (16/12). Sebelumnya, tambah dia, warga mendapat informasi, Pusri telah menunjuk PT Pupuk Iskandar Muda (PIM) untuk mengawasi aset AAF. Namun setelah sekian lama, bekas pabrik AAF belum juga dihidupkan. Bahkan setelah tidak beroperasi selama delapan tahun, pabrik itu terancam menjadi barang rongsokan. Warga sekitarnya, tambah dia, sangat mengharapkan pabrik pupuk tersebut beroperasi. Sehingga perekonomian di sekitarnya bisa berkembang. “Sejak ditutupnya sejumlah industri penting di dewantara, perekonomian terpuruk,” tambah Murdani. Manajer Humas PIM, Mustafa Tahir menjelaskan, pihak Pusri hanya menunjukkan PIM untuk menjaga aset. (b15)

tuhan dalam negeri . Isu ini memicu pelaku bisnis dari luar memanfaatkan peluang pasar yang ada untuk memasok kentang ke Indonesia yang berakibat turunnya harga mendadak petani kentang Tanah Karo diambang bangkrut. Kabupaten Karo adalah salah satunya produsen kentang di Sumatera Utara. Dari data yang diperoleh tahun 2010 tercatat luas areal penanaman kentang mencapai 3.457 hektar, sedangkan produksinya mencapai 53.998.000 kg. Dalam perhitungannya di luas areal satu hektar, tanaman kentang dapat disi 35.000 bibit kentang mencapai rata-rata produksi per hektar 15.619,90 kg setiap panen. Dalam perhitungan seorang petani kentang Panitra Nedy Tarigan asal desa Kabung kecamatan Barusjahe, menuturkan di Kabupaten Karo dalam satu tahun bisa tiga kali panen. Dengan harga kentang AgustusSebtember 2011 mencapai level harga Rp5.500 per kg, maka dana segar yang masuk men-

capai Rp98.993.459.235. Di musim panen bulan November - Desember 2011, pasca masuknya kentang impor ke Indonesia membuat harga kentang di pasar tradisional Berastagi, Tiga Panah dan Pajak Singa Kabanjahe anjlok dan hanya dihargai Rp2.000 per kg. Jadi dengan lahan produksi yang sama maka produksi kentang 17.998.810,77 kg x Rp2.000 per kg =Rp3.599.762.540. Dengan demikian kerugian petani kentang di kabupaten Karo pada panen November –Desember 2011 sebesar Rp98.993.459.235 – Rp35.997. 621.540 setara Rp62.995.837. 695. Kepala UPTD Balai Benih Pertanian Sumatra Utara Kuta Gadung Berastagi, Johni Akim Purba yang dikonfirmasi wartawan melalui telefon Minggu (18/12) memprediksi hal yang sama. Masuknya kentang impor asal Bangladesh dan Pakistan diyakininya mempengaruhi harga kentang di pasar lokal. Namun katanya , dalam

pertemuanya mewakili pemerintahan RI dengan Singapura pekan lalu dalam ranah task force dan business meeting, terungkap kalau produksi kentang kabupaten Karo dan Simalungun masih dianggap memiliki kualitas dan cita rasa nomor satu di mata konsumen kentang di Singapura. Harga penjualan kentang di Singapura rata-rata 3 dolar AS per kg sedangkan harga kentang dari Bangladesh dan Pakistan hanya mencapai 1,3 dolar AS per kg hingga 1,5 dolar AS per kg. Disebutkannya hasil pertemuan ini telah disampaikan kepada Asosiasi Eksportir Sayur dan Buah Indonesia di Berastagi, dengan demikian akan muncul sikap patriotis petani dan asosiasi untuk terus dilakukan ekspor ke Singapura dan petani terus memproduksi kentangnya agar tidak terjadi kekosongan barang, sedangkan pemerintah membuat kebijakan impor kentang ditiadakan, katanya. ( a36)



WASPADA Senin 19 Desember 2011

Bola Emas Untuk Messi YOKOHAMA, Jepang (Waspada): Lionel Messi tampil sebagai PemainTerbaik di Piala Dunia Antarklub 2011 dan berhak mendapatkan bola emas plus sebuah mobil dari Toyota. Messi memang tampil menawan pada final melawan Santos di Yokohama International Stadium, Minggu (18/12). Tak hanya mencetak dua gol yang membawa Barca menang 4-0, Messi juga menjadi inspirator permainan maupun kemenangan tim. Peraih bola perak jatuh ke tangan rekan Messi, Xavi Hernandez. Bintang Santos asal Brazil, Neymar, kebagian bola perunggu. Gelar ini menjadi kedua kali bagi Messi. Sebelumnya, striker andalan tim Tango ini pernah meraihnya pada 2009. (m33/rtr)


PELATIH Barcelona, Josep Guardiola, dilempar pemain setelah mengantar jawara Eropa itu sebagai tim terbaik pada final Piala Dunia Antarklub 2011 di Yokohama International Stadium, Minggu (18/12).

Barca Paling Hebat YOKOHAMA, Jepang (Waspada): Barcelona sukses merengkuh trofi Piala Dunia Antarklub untuk kedua kalinya sepanjang sejarah dengan mengalahkan Santos 4-0 di Stadion Internasional Yokohama, Minggu (18/12). Sepanjang 90 menit, Barcelona tampil sangat dominan. Umpan pendek dipadu terobosan kerap menyulitkan Santos meladeni permainan jawara Eropa itu. Lionel Messi pun mencuri perhatian dengan dua golnya serta determinasi yang ditunjukkan saat mengacakacak pertahanan Santos. Dominasi itu berbuah tiga gol di babak pertama yang dicetak Messi pada menit 16, Xavi Hernandez, dan Cesc Fabregas di penghujung 45 pembuka.

Messi akhirnya melengkapi kejayaan skuad besutan Pep Guardiola dengan gol keduanya di menit 82. Bintang Santos, Neymar, tampil cukup apik dengan mempertontonkan aksi individu dan menciptakan beberapa kans mencetak gol. Sayang segala upaya Neymar masih bisa dihalau Victor Valdes, Aksi striker berusia 19 tahun itu juga masih kalah kelas dengan anak-anak Katalan. Dengan hasil ini, Barcelona

sukses mengangkat gelar Piala Dunia Antarklub keduanya kali, setelah merebutnya pertama kali pada 2009 melawan tim Argentina Estudientes. Selain itu, prestasi ini sekaligus melengkapi gelar Barca sepanjang tahun 2011 dengan empat trofi. Sebelumnya, Messi cs mengangkat trofi Liga Champions, La Liga, dan Piala Super Spanyol. Pamer kehebatan Barca baru membuahkan hasil melalui Messi di menit 17. Melihat Messi masuk ke jantung pertahanan Santos, Cesc Fabregas memberi umpan matang ke kaki striker asal Argentina tersebut. Dengan cerdik, Messi mengangkat bola melewati kepala kiper Santos, Rafael Cabral. Menit 23, Barca memper-

besar keunggulan melalui Xavi. Setelah memiliki andil atas gol pertama, giliran Fabregas mencetak gol di akhir babak pertama. Tendangan Xavi memang masih diblok pemain lawan, namun bola liar diteruskan Fabregas dengan tandukannya. Menit 82, Messi memperlihatkan dirinya layak disebut sebagai calon kuat peraih titel Ballon d’Or tahun ini. Dengan kelincahannya, Messi mengecoh Carbal yang sudah mati langkah untuk meneruskan bola ke gawang kosong. Sementara itu, Al-Sadd berhasil merebut posisi juara ketiga dengan menundukkan Kashiwa Reysol lewat drama adu penalti 5-3. (m33/ap/ini)

STRIKER Barcelona, Lionel Messi (kiri), merebut bola emas dari incaran Neymar (kanan) yang harus puas dengan bola perunggu. -Reuters-

Ronaldo Hatrik Sudah Biasa SEVILLE, Spanyol (Waspada): Dua kartu merah dan hatrik Cristiano Ronaldo (foto) mewarnai sukses Real Madrid melumat Sevilla 6-2 pada lanjutan La Liga di Stadion Ramon Sanchez Pizjuan, Minggu (18/12). Pelatih Real Madrid, Jose Mourinho, mengungkapkan tentang apa yang dilakukan Ronaldo dengan mencetak hatrik dalam kemenangan Los Blancos dari tuan rumah adalah hal normal dari bintang asal Portugal itu. Ronaldo mencetak hatrik kelimanya sepanjang musim ini. Selain itu, CR7 ini juga membawa Madrid ke puncak klasemen sementara dengan selisih tiga poin dari Barcelona yang menempati posisi kedua. “Performa Cristiano malam ini bagi saya adalah normal. Hal yang biasa seperti sebagaimana dia lakukan, mencetak gol, dan membantu tim Anda,” kata Mourinho. Mourinho juga memberikan apresiasi pada sikap profesionalisme Angel Di Maria yang berkabung atas kematian ayah mertuanya awal pekan ini dan kembali ke Argentina setelah pertandingan tersebut. “Di Maria adalah contoh untuk semua orang. Dia berada di sebuah pemakaman di Argentina beberapa hari lalu dan kini bertanding. Sekarang dia kembali ke Argentina lagi untuk berada bersama keluarganya. Dia memiliki jiwa besar,” puji Mou. Dengan kemenangan ini, Los Blancos mengakhiri tahun 2011 sebagai pemuncak klasemen sebelum jeda Natal dan tahun baru. Tanda-tanda sukses Madrid pun sudah tampak di babak pertama. Pasalnya, anak asuh Jose Mourinho tersebut sudah unggul tiga gol sebelum jeda hasil sumbangan Ronaldo (2) dan Jose Callejon. Sayang, penampilan impresif Madrid tercoreng Pepe yang dikeluarkan wasit Sabtu, 17 Desember di menit 45 karena dianggap memukul wajah Alvaro Negredo. Mallorca vs Getafe 1-2 Kalah jumlah pemain,El Merengues Gijon vs Espanyol 1-2 justru mampu mencetak tiga gol tambahan Bilbao vs Zaragoza 2-1 dari Di Maria, Hamit Altintop, dan CR7 yang Sevilla vs Real Madrid 2-6 melengkapi hatriknya. Sementara itu, dua Minggu, 18 Desember gol penghibur bagi Sevilla dihasilkan Jesus Navas dan Alvaro Negredo di masa injury Atletico vs Real Betis 0-2 time. (m33/ant/afp/ap) Granada vs Levante 2-1

Nyonya Tua Berkuasa Lagi TURIN, Italia (Waspada): Setelah pimpinan klasemen Serie A sempat diduduki AC Milan, Juventus akhirnya mengalahkan Novara 2-0 sekaligus menggusur rivalnya itu, Minggu (18/12). Tanpa menemui kesulitan berarti, Juve mengukir kemenangan berkat gol yang dicetak Simone Pepe dan Fabio Quagliarella. Bermain di Juventus Arena, tuan rumah langsung menggebrak pada menit keempat lewat gol Pepe. Di babak kedua, Juventus nyaris menggandakan kedudukan di menit 48. Umpan Pepe kepada Alessandro Del Piero gagal dikonversi menjadi gol setelah tembakan melengkungnya masih melebar tipis. Novara AP

AKSI spektakuler Joe Hart (kiri) menyelamatkan Manchester City yang akhirnya menang atas Arsenal dalam lanjutan Liga Premier di Etihad Stadium, Manchester, Senin (19/12) dinihari.

City Tertolong Aksi Hart MANCHESTER, Inggris Sabtu, 17 Desember (Waspada): David Silva menBlackburn vs West Brom 1-2 cetak gol penentu kemenangan Everton vs Norwich 1-1 Manchester City 1-0 atas ArFulham vs Bolton 2-0 senal dalam lanjutan Liga PreNewcastle vs Swansea 0-0 mier di Etihad Stadium, Senin Wigan vs Chelsea 1-1 (19/12) dinihari. Ini adalah keWolves vs Stoke City 1-2 menangan pertama City dalam dua laga terakhir dan kekalahan Minggu, 18 Desember pertama bagi Arsenal dalam sembilan laga terakhir. QPR vs Man United 0-2 Permainan berlangsung Aston Villa vs Liverpool 0-2 terbuka sejak menit awal. NaTottenham vs Sunderland 1-0 mun, kedua kubu sama-sama Man City vs Arsenal 1-0 kesulitan menuntaskan serangan. Pada momen-momen krusial, alur serangan kedua tim kerap kandas akibat umpan yang tidak akurat. Gol tak kunjung tercipta sampai turun minum dikarenakan performa kiper Joe Hart dan Wojciech Szczesny. Setelah tembakan Sergio Aguero meleset dari sasaran, City mendapat peluang dari David Silva. Namun, tembakan gelandang asal Spanyol itu masih bisa dijinakkan Szczesny. Szczesny juga kemudian berhasil mengeblok tembakan Mario Balotelli dari jarak dekat pada menit 24 dan tembakan Aguero jelang jeda. Arsenal sendiri mampu menciptakan tiga peluang beruntun melalui Aaron Ramsey, Thomas Vermaelen, dan Gervinho. Namun, semuanya kandas di tangan Hart. Gol kemenangan City akhirnya terjadi pada menit 53. Bermula dari tembakan Balotelli yang diblok Szczesny, Vermaelen berhasil mencegah Aguero menjangkau bola muntah, tetapi tidak punya cukup waktu untuk mengantisipasi pergerakan Silva menyepak bola ke gawang Arsenal. Dalam 10 menit terakhir, Arsenal menambah intensitas serangan. Usaha mereka membuahkan sejumlah peluang emas, tetapi tak satu pun bisa menaklukkan Hart yang kemudian terpilih sebagai man of the match. Dengan begitu, pimpinan klasemen tetap bertahan di Kota Manchester. Setelah MU mencicipinya di laga sebelumnya berkat kemenangan atas QPR 2-0, City langsung merebutnya kembali dari tangan rival sekotanya itu. Kemenangan United atas QPR sendiri di Loftus Road Stadium ditentukan gol cepat Wayne Rooney di menit pertama dan aksi solo run spektakuler dari Michael Carrick. Di laga lain, Liverpool naik ke posisi enam klasemen hasil menang 2-0 atas Aston Villa. Kedua gol dicetak Craig Bellamy dan Martin Skrtel. (m33/ant/afp/ini)

justru nyaris menyamakan kedudukan andai sepakan Riccardo Meggiorini tidak menyamping. Menit 64, peluang emas kembali diraih Novara. Umpan silang Michel Morganella berhasil disundul Raffaele Rubino yang mendahului sergapan bek Juve, Giorgio Chiellini. Namun, Gianluigi Buffon dengan cemerlang menepis bola tersebut. Juventus pun mencetak gol kemenangan di menit 75. Melalui sebuah sepak pojok, Quagliarella mampu menanduk bola melewati hadangan kiper Novara, Samir Ujkani. Dengan tiga poin ini, Juve kembali berada di puncak klasemen denga selisih dua poin dari Milan. Novara sendiri masih terjerembab di

peringkat 19 dengan 11 angka. Sebelumnya, Antonio Nocerino kembali mempersembahkan gol buat Milan ketika tampil menghadapi Siena. Itu merupakan gol keenamnya untuk Rossoneri sejak bergabung dari Palermo di awal musim. Setelah 52 menit bermain tanpa gol, Nocerino menjadi pemecah kebuntuan dengan membobol gawang tim tamu melalui tendangan spekulasi yang sempat berbelok arah akibat membentur pemain lawan. Milan sendiri akhirnya meraih kemenangan 2-0 setelah eksekusi penalti Zlatan Ibrahimovic membobol gawang Siena di menit 64. Usai pertandingan, pelatih Massimiliano Allegri menyata-


Minggu, 18 Desember Chievo vs Cagliari Fiorentina vs Atalanta AC Milan vs Siena Catania vs Palermo Cesena vs Inter Milan Genoa vs Bologna Juventus vs Novara Parma vs Lecce

2-0 2-2 2-0 2-0 0-1 2-1 2-0 3-3

kan puas dengan kinerja anakanak asuhnya di pertandingan tersebut. Khusus untuk Nocerino, pria berusia 44 tahun tersebut menyampaikan harapan agar sang gelandang bisa kembali mendulang gol bagi Milan. “Saya harap Nocerino bisa mencetak sampai 15 gol di musim ini. Dia sudah mencetak enam gol dan membuktikan diri sebagai pemain Milan sejati,” ujar Allegri. (m33/ant/afp/fbi)


WASPADA Senin 19 Desember 2011


Ribuan Peserta Ikuti Jalan Santai BRI

Waspada/Surya Efendi

JALAN SEHAT: Sekda Provsu, Nurdin Lubis (tiga kanan), didampingi anggota DPD RI asal Sumut Parlindungan Purba, dan Kepala Perum LKBN ANTARA Biro Sumut Simon Pramono (kanan) melepas peserta Jalan Sehat Perum LKBN ANTARA Sumut bekerjasama dengan Pemprovsu dan Korpri Sumut di Jl Diponegoro, depan kantor Gubsu di Medan, Minggu (18/12). Kegiatan yang diikuti sedikitnya 5.000 peserta dari berbagai kalangan tersebut digelar dalam rangka memeriahkan HUT Perum LKBN ANTARA ke-74.

MEDAN (Waspada): Cuaca mendung disertai rintik hujan tak menghalangi langkah sekira 3.500 orang untuk mengikuti acara jalan santai memeriahkan HUT Bank Rakyat Indonesia (BRI) ke-116 di Medan, Minggu (18/12) pagi. Peserta dilepas Kakanwil BRI Sumut, Don Simatupang. Jalan santai yang melibatkan karyawan/keluarga karyawan BRI, nasabah, dan masyarakat umum itu dipusatkan di halaman kantor BRI Putri Hijau Medan. Rute yang dilalui peserta berada di kawasan inti Kota Medan sepanjang hampir tiga kilo meter. Setelah mengikuti jalan santai, acara dilanjutkan penarikan kupon lucky draw yang menyediakan seratusan paket hadiah. Sebelumnya, pihak BRI juga menyerahkan 25 ribu bibit pohon dalam mendukung program penghijauan Toba Go Green. “Selain ajang silaturahim, kegiatan ini bertujuan meningkatkan semangat dan gairah ma-

Waspada/Dedi Riono

CUACA mendung disertai rintik hujan tak menghalangi langkah ribuan orang dalam mengikuti jalan santai HUT BRI ke-116 di Medan, Minggu (18/12). syarakat berolahraga dalam menjaga kebugaran dan kesehatan tubuh. Berjalan merupakan olahraga paling mudah dilakukan dan murah meriah,”

ucap ujar Kakanwil BRI Sumut, Don Simatupang. Panitia Jalan Santai BRI, Sugito, mengaku jumlah peserta yang mengikuti kegiatan di luar

perkiraannya. “Awalnya, panitia hanya menargetkan 3.000 peserta. Namun peserta yang ikut serta mencapai 3.500,” ucap mantan pemain PSMS itu. (m42)

470 Klub, 28 Pengprov Siap Gelar KLB MEDAN (Waspada): Sejumlah 470 klub sepakbola di Indonesia dari Divisi III hingga Indonesian Super League (ISL) dan 28 Pengprov menilai PSSI yang dipimpin Prof Ir H Djohar Arifin Husin tidak memahami organisasi dan kerap mengeluarkan sejumlah kebijakan yang menabrak aturan.


KAPOLRES Asahan, AKBP Marzuki MM (kiri), standing dengan sepeda motornya dan menjadi pusat perhatian masyarakat Desa Pematang Rambe, Kecamatan Tanjungtiram, Kabupaten Batubara, Sabtu (17/12).

Polres Asahan Pantau Kamtibmas Sambil Ngetrail

Hal ini merupakan salah satu keputusan di dalam Rapat Akbar Sepakbola Nasional (RASN) di Jakarta, Minggu (18/12). Demikian disebutkan perwakilan PSMS Medan di ISL, Drs Benny Tomasoa. “Di samping itu, RASN juga memutuskan semua pemain PSMS yang tampil di Indonesian Premier League (IPL) dinilai tidak sah, karena belum terdaftar di PSSI,” sebut Benny mengutip ucapan anggota

tibmas yang ada di wilayah tersebut. “Ngetrail bukan hanya sekedar hobi, namun kita bisa memantau keadaan kamtibmas dan melihat kehidupan masyarakat pelosok lebih dekat dengan harapan masyarakat lebih nyaman dan terlindungi,” ujar Kapolres Asahan, AKBP Marzuki MM, yang juga pembina Club Motor Monstrack Asahan, kepada Waspada, Sabtu (17/12). Menurut Marzuki didampingi Kabag Ops Kompol Faisal F Napitupulu, Kasat Reskrim AKP Fahrizal, dan Kasat Narkoba AKP Napsanto, keadaan daerah pelosok itu cukup baik. Namun demikian, pihak Polres Asahan tetap memerhatikannya agar

tindakan kejahatan dapat dicegah. “Kita akui jalur pelosok Asahan dan Batubara cukup sulit, namun semua itu bisa dilalui dengan kekompakan tim. Yang lebih menyenangkan, kita bisa berhadapan dan melihat senyum masyarakat karena senang dengan kehadiran kami,” jelas Kapolres. Sebab itu, lanjut Kapolres, kegiatan ini akan terus dilakukan agar nantinya masyarakat bisa lebih dekat dengan polisi. Marzuki menambahkan pihaknya akan terus menyisir seluruh wilayah pelosok Asahan dan Batubara bersama Monstrack demi lebih mudah memantau kamtibmas. (a15)

PSMS Vs Sime ....

sebelum melakoni dua pertandingan tandang pada Januari nanti melawan Pelita Jaya (5/1) dan Persib Bandung (9/1). “ Klub Sime Darby memiliki kualitas bagus dan layak menjadi lawan ujicoba PSMS. Kami akan manfatkan pertandingan untuk rotasi kecil sebelum lanjutan ISL sekaligus adaptasi stimulasi pertandingan guna mencari formula pemain yang pas,” papar Isa di Stadion Kebun Bunga Medan, Minggu (18/12). Sebelumnya, Ayam Kinantan imbang 1-1 dengan Mitra Kukar dan menang 1-0 atas Persisam Putra Samarinda. Isa juga mengakui satu pemain asal Korea Selatan yang baru tiba pekan lalu akan diturunkan memperkuat PSMS nanti. “Choi Dong Soo akan menggantikan peran Zulkarnain untuk membentuk skema ofensif ‘diamond’, sedangkan Zulkarnain sendiri dijadikan gelandang bertahan,” kata Isa yang bakal

beradu taktik dengan pelatih Sime Darby, Ismail bin Zakaria. “Ismail bin Zakaria adalah rekan saya di Malaysia.Tapi nanti akan kakan buktikan siapa pelatih yang lebih baik. Kemenangan mutlak PSMS akan membuktikan klub Indonesa bisa menang dari tim Malaysia,” koar Isa lagi. “Kami punya tiga pemain mantan timnas dan dua anggota skuad Liberia. Kami akan kalahkan PSMS, apalagi kami sudah tahu persis kepiawaian dan kelemahan penjaga gawang Markus Horison, karena sudah sering bertemu di lapangan. Begitu juga dengan karakter pemain Indonesia, termasuk PSMS,” kata Asisten Pelatih Sime Darby, Abdul Ghani bin Malik. Untuk pertandingan tersebut, pihak panitia pertandingan menyebutkan harga tiket tribun terbuka ditetapkan Rp20 ribu dan tribun tertutup Rp50 ribu. (m17)

KISARAN (Waspada): Dalam rangka menyambut Hari Amal Bhakti (HAB) ke-66, Kementerian Agama (Kemenag) Kabupaten Asahan menyelenggarakan Pekan Olahraga Hari Amal Bhakti (Porhab). Kakan Kemenag Kabupaten Asahan, Drs H Syafi’i MA, didampingi Syahrizal SE dari panitia mengatakan Porhab Kabupaten Asahan mempertandingkan cabang sepakbola, bulutangkis, tenis meja, dan bola voli. “Tujuan kegiatan Porhab adalah meningkatkan kesehatan jasmani dan rohani serta terciptanya hubungan silaturrahim pegawai di lingkungan Kankemenag Kabupaten Asahan,” ungkap Syafi’i kepada Waspada di Kisaran, Minggu (18/12). “Porhab akan diikuti oleh jajaran pegawai kantor kemenag, kepala dan pegawai KUA kecamatan, jajaran Madrasah Aliyah, Madrasah Ibtidaiyah, dan Madrasah Tsanawiyah,” ujar Ketua Panpel, Drs H Salamat Nasution. Dikatakan, puncak acara peringatan Hari Amal Bhakti (HAB) akan dilaksanakan pada 3 Januari 2012 di lapangan Parasamya Kisaran. (a31)



Dipandang dari materi skuad, Sime Darby tidak mainmain dan karenanya Raja Isa juga akan menurunkan pemain-pemain terbaiknya. Raja Isa sependapat kekalahan dua kali timnas Garuda dari Malaysia di Piala AFF dan SEA Games akan mempengaruhi duel kedua tim. Sebab bagi Markus Maulana Haris cs pastinya ingin menunjukkan PSMS bukanlah timnas yang sudah tumbang dua kali. Sebaliknya, Sime Darby akan mempertahankan reputasi yang telah diperlihatkan tim nasionalnya. Meski hanya laga eksibisi, laga ini merupakan uji kemampuan bagi kedua tim sebelum bermain di liga negaranya masing-masing. PSMS sendiri, menurut Raja Isa, juga akan mengambil manfaat dari laga ini

Problem Catur Putih melangkah, mematikan lawannya enam langkah.

Jawaban di halaman A2 8







1 A








namun tidak mendapatkan tanggapan. “Forum ini dibentuk atas dasar keprihatinan bersama dengan kondisi sepakbola di tanah air. Sejak dua minggu lalu FPP

telah berupaya menemui Ketua Umum PSSI untuk mengingatkan agar kembali ke jalan yang benar,” ujar Benny yang juga manajer tim PSMS ISL tersebut. (m17)

Komite Alih Status PSSI. Rapat juga memutuskan segera digelarnya Kongres Luar Biasa (KLB) dalam waktu dekat. Menurut Benny, pihak PSMS sendiri sekembali mereka dari Jakarta akan menggelar rapat untuk mengambil sikap terhadap pemain, termasuk pelatih maupun ofisial PSMS IPL plus pihak yang terlibat dalam kompetisi tersebut. Dalam RASN turut disiapkan sebuah tim kecil beranggotakan

TANJUNGTIRAM (Waspada): Polres Asahan memantau ketertiban masyarakat (Kamtibmas) pelosok sambil ngetrail bersama Monstrack (Monster Trail Asahan Community) serta membangun kepercayaan masyarakat terhadap polisi. Ekspedisi kali ini melalui jalur jalan berlumpur dan berbatu perbatasan pelosok AsahanBatubara (jalan lintas pantai) yang diikuti sejumlah anggota Monstrack yang terdiri atas personil polisi dan pengusaha. Dalam kesempatan itu, Polres Asahan menyempatkan diri bercengkrama dengan warga Desa Pematang Rambe di Kecamatan Tanjungtiram untuk mengetahui situasi Kam-

(Lanjutan dari hal 1)

sembilan Pengprov PSSI dan membentuk Forum Pengprov PSSI (FPP) dari hasil pertemuan di Surabaya beberapa waktu lalu. FPP pernah mencoba menemui Djohar selama dua hari,

Kejuaraan Bulutangkis Pelajar Batubara Berakhir BATUBARA (Waspada): Pengurus Pengcab PBSI Batubara, Abd Rahim, mengharapkan atlet bulutangkis pelajar yang sukses menjadi juara agar giat berlatih meningkatkan prestasinya. Demikian disampaikan pada penutupan kejuaraan bulutangkis pelajar se-Batubara di Daya Hall Sei Muka Talawi, Batubara, Sabtu (17/12). Juara U-13 putra diraih Hoji Damanik, Agus Ansori, Tri Bakti, dan Renaldo, sedangkan kelompok putri dimenangi Vinta Rizka, Anisa Abdillah, Sintia Pratiwi, dan Rani Darmayanti. Di kategori U-15 (pa), peserta terbaik adalah Yosafat, Ahmad Hasbi, M Rizki, dan Diki Adiputra denganWulan Fadilah,Yulianti D, Rahma Endiani, dan Ayunda Khairunisa mendominasi bagian putri. Kategori U-17 (pa) melahirkan Ramadani Sahputra, Jesse, Dimas Pranoto, dan Agus D sebagai peserta terbaik. Untuk kelompok putri, predikat tersebut disandang Mardiani, Surya Triana, Hartati, dan Rosiani Azmi. Sementara itu, U-19 (pa) dijuarai Kisan Darianto, Atrika Nanang, Faiz Rasidi, dan Bayu. Peserta terbaik putri kelompok ini disandang Dirma Wahidah, Nur Habibi, Supiana, dan Khairiah Ulfa. (a12)

Kemenag Asahan Gelar Porhab


2. Kota di Sumatera Selatan, penghasil ribuan barel minyak bumi dan jutaan meter kubik gas alam setiap tahunnya. 4. Lazim; Biasa. Salah ____ adalah kesalahan yang umum sekali sehingga orang tidak merasakan sebagai kesalahan. 5. Kusta; Penyakit yang disebabkan bakteri Mycobacterium leprae. 8. Ibukota Republik Ceko, berpenduduk sekitar 1,5 juta orang. 9. Karyawati kelab malam yang bertugas melayani dan menemani tamu. 10. Suara tertinggi pada golongan wanita dan anak laki-laki ( dalam seni suara). 12. Daging buah kelapa yang dikeringkan. 13. Anggota angkatan darat dan udara (tidak memandang pangkat). 14. Singkatan Prajurit Satu, pangkat tamtama peringkat kelima dalam kemiliteran. 15. Pete _____, mantan petenis nomor satu dunia asal AS, menjuarai 14 gelar Grand Slam dan 7 kali juara Wimbledon selama tahun 1993-1998. 18. Perhitungan sebelumnya; Peramalan suatu peristiwa berdasarkan hasil perhitungan rasional atau ketepatan analisis data.

Waspada/Setia Budi Siregar

SEKRETARIS Umum Pengda Shiroite Karatedo Sumut yang juga Dan Denpom I/5 Medan Mayor CPM, Hendra Yosvidar, bersama pengurus lainnya foto bersama di sela-sela pembukaan gashuku dan ujian kenaikan tingkat kyu/sabuk Shiroite Kota Medan dan sekitarnya, Minggu (18/12).

126 Karatedo Ikuti Gashuku Shiroite Medan MEDAN (Waspada): Sekira 126 karatedo mengikuti gashuku dan ujian kenaikan tingkat kyu/sabuk Shiroite Kota Medan dan sekitarnya di Hall Pomdam I/BB, Jl Sena Medan, Minggu (18/12). Gashuku tersebut dibuka Sekretaris Umum Pengda Shiroite Karatedo Sumut yang juga Dan Denpom I/5 Medan, Mayor CPM Hendra Yosvidar. Hendra mewakili Ketua Umum Pengda Shiroite Karatedo Sumut yang juga Dan Pomdam I/BB, Kolonel CPM Supriantro SIP. Dalam sambutannya, Hendra berharap para karatedo dapat memanfaatkan momen kenaikan tingkat dengan sebaik-baiknya. Dia juga meminta kepada karatedo dapat memiliki tanggung jawab dalam arti dapat mempertahankan yang sudah dicapai dalam gashuku dan ujian kenaikkan tingkat. Kegiatan tersebut juga dihadiri Pembina Pengda Shiroite Sumut Drs Wiryanto MBA, Sekretaris I Pengda Shiroite Sumut Drs Helmi Putra, Ketua Komtek Lambok

Hutapea, Ketua Shiroite Medan H Marwansyah, dan panitia pelaksana Aldian SH Nasution. “Shiroite Sumut mengharapkan karatedo dapat mengukir prestasi,” tambah Hendra menambahkan Pengda Shiroite Karatedo Sumut telah berkembang pesat. Hal itu terbukti dengan terbentuknya 13 Pengcab di Sumut dengan 20 dojo di Medan serta memiliki sekitar 1800 karateka. Ke-13 Pengcab yang telah terbentuk adalah Tapanuli Utara, Tapanuli Selatan, Padangsidimpuan, Tapanuli Tengah, Sibolga, Toba Samosir, Samosir, Deliserdang, Pematangsiantar, Labuhanbatu Selatan, Nias Selatan, Binjai, dan Kota Medan. Ketua Komtek, Lambok Hutapea, menyebutkan peserta gashuku dan kenaikan tingkat kyu/sabuk diikuti 126 karatedo dari sembilan dojo daerah Medan dan sekitarnya, yakni Alwasliyah Tembung, Puskesmas, Kenwa, Harapan Mandiri, Sena, Menteng Indah, Aan Brothers, Delitua, dan Satria Utama. (m18)

Popsivo-Samator Jawara Livoli BANDUNG (Waspada):Tim Putri Popsivo merebut gelar juara Liga BolaVoli (Livoli) Divisi Utama 2011, setelah menumbangkan Bank Jatim 3-1 (2523, 20-25, 25-15, 25-20) pada final yang digelar di GOR Padjadjaran Bandung, Minggu (18/12). Gelar juara ini merupakan yang pertama kalinya bagi tim yang dimiliki Polri itu. Tahun ini, prestasi tim yang dilatih Dwi Sari Iswaningsih itu memang menggembirakan. Hal itu dimulai dari Proliga lalu di mana untuk pertama kalinya masuk empat besar dan menjadi finalis. Kini, dengan pemain senior seperti Rita Kurniati dan Ayu Cahyaningsiam, mereka merebut gelar. Proses meraih juara pun meyakinkan. Diawali dengan menaklukkan pemain muda menjanjikan


19. Caci maki; Celaan keras. 20. Doa; Mohon pada Tuhan (Inggris).


1. Derap kegiatan; Gerakan cepat dan dinamis tarian Jawa dalam pertunjukan wayang dsb. 2. Merek produk mode dari Italia, didirikan oleh Mario ____ di Milan tahun 1913. 3. Singkatan Masa Prabakti Mahasiswa, salah satu singkatan perpeloncoan untuk pengenalan kampus sebelum Ospek. 4. Pangkat golongan tamtama dalam ketentaraan, satu tingkat di bawah bintara dan satu tingkat di atas prajurit. 6. Piagam (yang tertulis pada batu). 7. Empu ternama, seorang bujangga sastra Jawa yang hidup pada abad ke-14 pada masa Majapahit. 9. (Sebutan) raja. 11. Karyawan yang bertugas melayani penumpang pesawat di udara. 12. Sandiwara tradisonal Jawa; Makanan khas Jakarta terdiri atas ketupat dll. 13. Sebelum. 14. Singkatan Prajurit Kepala. 16. Singkatan Angkatan Perang Ratu Adil (milisi pimpinan Kapten Westerling tahun 1950). 17. Istimewa; Sering menjadi nama kenderaan bermotor produksi Jepang.

Petrogres di semifinal dan diakhiri dengan mengalahkan dua kali pemegang gelar juara, Bank Jatim. Bank Jatim juga mengandalkan pemain muda yang merupakan andalan Indonesia di SEA Games lalu, Maya Kurnia Indri dan Amalia Fajrina. Menurut Dwi Sari, kemenangan timnya karena mengandalkan receive dan blok serta memperkuat pertahanan. Di bagian putra, tim Samator Surabaya mempertahankan gelar juara setelah di final mengalahkan Tirta Dewata Badung 3-1 (25-23, 25-22, 22-25, 25-16). Dengan demikian, Samator sukses juara tiga kali berturut-turut setelah pada 2009 dan 2010 tampil menjadi yang terbaik. (yuslan)

Isi kotak kosong dengan angka 1 sampai 9. Tidak boleh ada pengulangan angka mendatar, menurun, maupun di dalam kotak 3x3 bergaris tebal. Tidak ada keterlibatan matematika, hanya membutuhkan pertimbangan dan logika. Tingkat kesulitan: sangat mudah (*), bisa diselesaikan dalam waktu tak sampai tujuh menit. Jawabannya lihat di halaman A2 kolom 1.

2 4 1 7 3 1 8 2 9 5 3 9 1 5 4 2 4 7 9


2 8 4 1 4 5 9 3 7

7 3 9 6 9 1 2 4 7 6 1 5

1 5

2 4 *211



WASPADA Senin 19 Desember 2011


PROMOTION Manager CV Indako Trading Co, Gunarko Hartoyo, menyerahkan trofi pemain terbaik kepada pemain Waspada Merah, David Swayana (kanan). ANGGOTA tim Waspada Merah dan Putih foto bersama usai menerima hadiah medali dan trofi Futsal Liga Media III Siwo PWI Sumut 2011 di Lapangan QS Futsal, Jl Bunga Asoka Medan, Minggu (18/12). -Waspada/Hamdani-

WASPADA Merah Terbaik Kedua Putih Penuhi Target MEDAN (Waspada): Meski hanya meraih gelar terbaik kedua pada ajang Futsal Liga Media Siwo PWI Sumut 2011 di Lapangan QS Futsal, Jl Bunga Asoka Medan, Minggu (18/12), Waspada Merah tetap bersyukur. Austin Antariksa cs gagal merebut gelar terbaik setelah menelan kekalahan dalam drama penalti 3-1 dari Harian Analisa. Adu penalti menjadi penentu laga kedua tim setelah bermain imbang 1-1 selama

waktu normal 2x20 menit. “Tim sudah berjuang maksimal dan inilah hasil yang harus kami syukuri. Kekalahan ini tentu tidak mengenakkan, tetapi setidaknya kami kalah terhormat dan masih ada kesempatan

Fabio Janjikan Kebangkitan MEDAN (Waspada): Fabio Lopez menerima tawaran melatih PSMS di Indonesian Premier League (IPL) dalam keadaan krusial. Allenatore asal Italia itu langsung disodori tugas berat membenahi tim yang menderita dua kekalahan kandang pada laga awalnya. Namun Fabio tak gentar dan justru merasa tertantang dalam debut kepelatihan pertamanya di tanah air. Hal itu diungkapkannya saat memperkenalkan diri kepada publik lewat temu pers di Hotel Dhaksina Medan, Minggu (18/12). “Musim kompetisi di Indonesia sangat berbeda dengan Eropa. Namun, secara bertahap melakukan adaptasi dengan pihak manajemen dan pemain untuk mencapai misi agar PSMS menjadi tim tangguh,” ujar pelatih PSMS IPL, Fabio Lopez. Fabio menganggap PSMS adalah salah satu klub besar di Indonesia. Hal itu merupakan salah satu yang mendasari alasan kuatnya membesut klub ber-lambang daun tembakau ini. Diakui, pada 2008 dirinya pernah juga ditawari PSMS saat manajemen ditangani Sihar Sitorus. Namun, Fabio menolak karena masih menjadi pelatih di Lithuania. “PSMS itu klub besar dan 2 juta penduduk merupakan modal utama memberi dukungan kepada PSMS. Apalagi Medan merupakan salah satu kota di Indonesia sebagai lumbung pemain berkualitas,” katanya. Di debut perdananya saat melawat ke markas Arema, Fabio memang gagal mempersembahkan poin. Namun TriYudha cs tampil berbeda di bawah instruksinya. Di bawah asuhan Fabio, PSMS IPL diyakini skuad akan bangkit mulai Januari nanti. Laga menghadapi Persiraja Banda Aceh selanjutnya akan menjadi ujian baginya. Nantinya, Fabio akan mengedepankan strategi menyerang menggunakan formasi 4-3-3. Kendati begitu, pria berusia 38 tahun ini mengaku formasi bisa berubah sesuai lawan yang dihadapi. Mantan pemandu bakat Fiorentina di Serie A itu menjanjikan kualitas permainan yang berbeda. “Selama menangani tim, saya akan memberikan sesuatu kepada PSMS menjadi tim besar dan dapat memberikan kualitas permainan yang berbeda dari klub lain. Materi latihan yang diberikan akan dirasakan pemain sendiri dan tak berimingiming pemain nantinya menjadi incaran klub lain,” pungkasnya. Sementara itu, Manajer PSMS IPL, Dolly S Siregar, mengumumkan struktur kepelatihan PSMS IPL. Dalam lanjutan kompetisi nanti, Fabio Lopez dibantu M Khaidir (asisten pelatih), Deny Paslah (pelatih kiper), dan Hasyim (pelatih fisik).

Dijelaskan Dolly, kehadiran Fabio Lopez membuat persiapan tim semakin berkembang. “Intinya, kita akan terus berjuang untuk menaikkan peringkat PSMS minimal menjadi tiga besar klasemen sementara,” tandasnya. (m33)

tahun depan menjadi tim terbaik,” ujar Kapten Tim Waspada Merah, Austin Antariksa, mewakili rekan-rekannya didampingi Redaktur Olahraga, Jonny Ramadhan Silalahi. Duel final kedua tim berlangsung seru dengan menampilkan permainan keras dan ngotot. Analisa unggul lebih dulu di menit 13 melalui sontekan Guntur. Hendra DS cs pun membalas lewat tandukan terukur dari Austin Antariksa di pertengahan babak kedua tanpa mampu diantisipasi mantan kiper Porwanas Sumut, Aswadi. Meski sama-sama gencar menyerang, kedua kubu gagal menambah gol. Ini pun kedua

kali kedua tim tampil sama kuat, setelah pada laga penyisihan Grup A bermain imbang 3-3. Pada babak adu penalti, Waspada harus menerima kekalahan setelah tendangan David Swayana dan Austin digagalkan Aswadi. Sebaliknya, Said Harahap dan Guntur berhasil menaklukkan kiper Waspada, Zulkifli Harahap. Namun, kegagalan Waspada Merah sedikit terobati saat David Swayana dinobatkan sebagai pemain terbaik. Ini menjadi catatan prestasi individu ketiga kalinya bagi Redaktur Kota Waspada setelah terpilih sebagai top skor pada dua gelaran liga sebelumnya.

Sementara itu, Waspada Putih memenuhi target merebut posisi ketiga hasil menaklukkan Medan Pos 4-2. Empat gol tim Putih disumbangkan Sapri Juanda, Dedi Riono, Rudi Arman, dan Budi Siregar, sedangkan gol balasan Medan Pos dicetak M Syamsir. Event yang didukung Pemprovsu, KONI Sumut, KONI Medan, serta disponsori Honda, Bank Sumut, dan Djarum itu ditutup resmi Ketua PWI Cabang Sumut, M Syahrir, dan turut dihadiri Sekum KONI Sumut, Drs Chairul Azmi MPd, didampingi Gunarko Hartoyo yang juga Promotion Manager CV Indako Trading Co. (m42)

WASPADA Senin 19 Desember 2011

Medan Metropolitan


Romi Lubis Pimpin KNPI Medan Denai

Waspada/Surya Efendi

PEMUKIMAN Kota Medan terutama di pusat kota sudah sangat padat seperti yang terlihat pada foto yang diabadikan dari lantai 25 gedung Cambridge Medan, Sabtu (17/12). Perluasan dan membuka kota baru serta jalan baru dengan menyetop pembangunan di inti kota harus segera dilakukan guna pemerataan. Medan saat ini berpenduduk 2,8 juta jiwa.

Poldasu Gerebek Gudang Penimbunan Arang MEDAN (Waspada): Polda Sumut menggerebek gudang penimbunan arang dan kayu bakau diduga ilegal di Jalan Garuda 2 Km 13,6 Sei Semayang, Sunggal, Kab. Deliserdang. Dari lokasi itu diamankan enam orang sebagai tersangka serta barang bukti truk dan arang. Kapolda Sumut Irjen Pol. Wisjnu Amat Sastro melalui Kabid Humas Poldasu Kombes Pol. Heru Prakoso kepada warta-

wan, Minggu (18/12) mengatakan, pihaknya masih melakukan penyelidikan kasus tersebut. Polisi juga sudah melayangkan surat panggilan kepada pemilik gudang Zaki Badres untuk datang menemui penyidik Poldasu, besok (Senin). Berdasarkan keterangan, penggerebekan dilakukan petugas Reserse Kriminal Khusus (Reskrimsus), Sabtu (17/12). Polisi kemudian meneliti suratsurat dan dokumen usaha. Setelah itu, sopir, kernet, dan truk dibawa ke Poldasu. Penyidik di Mapoldasu mengatakan, tiga truk colt diesel

bermuatan kayu mangrove dan arang diamankan. Namun, kata dia, satu colt diesel BK 8442 PI bermuatan 4,5 ton arang sempat disinggahkan di pelataran parkir Pomdam I/BB Jln. Sena, karena sopir dan kernet truk mengaku truk dan arang itu milik oknum berinisial IH. Tapi setelah dicek, ternyata sopir dan kernet hanya menjual nama aparat itu.“Tersangka In mengaku sopir truk sudah ditahan. Setelah diperiksa ternyata dia pengawas gudang,” kata penyidik. Sementara saat ini, gudang dan ratusan ton arang di Jln. Garuda 2, termasuk kayu ramba-

PWNU Sumut Gelar TOT MEDAN (Waspada): Dalam Anggaran Dasar NU tentang Aqidah/Asas, Pasal 3 disebutkan NU sebagai Jamiyah Diniyah Islamiyah beraqidah/berasas Islam menurut faham Ahlusunnah wal jamaah dan menganut salah satu dari mazhab empat yaitu, Hanafi, Maliki, Syafii dan Hambali. “Sebagai nahdliyin diharapkan dapat memahami wawasan sebagai jam’iyah dan tentang Nahdlatul Ulama secara utuh,” kata Ketua PWNU Sumut H. Ashari Tambunan saat membuka Training of Trainers (TOT) di sekretariat PWNU Sumut Jln. Sei Batanghari Medan, Sabtu (17/12). Dikatakan Ashari, para ulama pesantren pendiri NU mempunyai visi dan misi, serta strategi gerakan kultural untuk menjaga, mengembangkan dan melestarikan Islam Ahlusunnah wal jamaah di tengah kondisi dan dinamika kehidupan berbangsa. Prinsip dasar, kaidah, tradisi

dan metode keilmuan Islam Ahlusunnah wal jamaah telah dipegang teguh warga nahdliyin dalam berpikir, bersikap dan bertindak baik dalam hubungan manusia dengan Allah, manusia dengan manusia, maupun manusia dengan alam semesta. “Hubungan tersebut dibangun dalam suatu sistem kehidupan yang menjamin tegaknya moralitas keagamaan dan martabat kemanusiaan, serta tegaknya jiwa dan semangat amar makruf nahi munkar,” kata Ashari. Penting Ashari menilai, TOT yang diikuti pimpinan wilayah lembaga, lajnah dan Badan Otonom NU Sumut sangat penting dalam memahami Ahlusunnah wal jamaah dan tentang ke-NUan. Dengan demikian, nahdliyin semakin mencintai organisasi tempat berkumpulnya para ulama ini. Selain itu, warga NU diharapkan dapat memahami dan menjalankan ajaran agama

Polresta Musnahkan 9 Kg Ganja MEDAN (Waspada): Sat Narkoba Polresta Medan memusnahkan barang bukti 9 kg ganja senilai Rp9 juta dengan cara dibakar di halaman gedung Sat Narkoba Polresta Medan, Jumat (16/12). Pemusnahan barang bukti ganja dari tersangka ASR, disaksikan Kasat Narkoba Kompol Juli Agung Pramono, didampingi Aiptu P Tarigan dan Aiptu D Dabuke. Menurut Juli Agung, ganja 9 kg senilai Rp9 juta yang dimusnahkan itu berasal dari penangkapan anggota Sat Narkoba di

kawasan Medan Labuhan, dengan tersangka ASR, pada 22 November 2011.“Kita akan terus meningkatkan pengungkapan pelaku narkoba di Kota Medan, yang meresahkan masyarakat,” sebutnya. Pantauan wartawan, barang bukti 9 kg ganja dibakar tersangka ASR di dalam tong sampah halaman Sat Narkoba Polresta Medan dengan dikawal dua polisi. “Yah, kalau sudah begini mau dibilang apa, hanya pasrah menunggu tuntutan,” ujar tersangka ASR sembari membakar barang-bukti tersebut. (m39)

dengan benar, begitu juga keseimbangan dalam membina hubungan dengan sesama manusia dan hubungannya dengan Allah. Ketua Panitia TOT PWNU Sumut Drs H Abdullah Nasution menyampaikan, materi TOT tentang wawasan Ahlusunnah wal jamaah berkaitan dengan akidah, syariah dan akhlak. Kemudian wawasan jamiyah Nahdlatul Ulama dalam kehidupan berbangsa dan bernegara. Sedang cakupan materi keNU-an meliputi, latar belakang kelahiran NU, lambang dan tokoh pendiri NU, bentuk dan sistem organisasi, HAM, gender dan demokrasi, khittah NU dan ukhuwah nahdliyin. Menurut Abdullah, tujuan TOT untuk menambah dan meningkatkan wawasan jamiyah NU sehingga kinerja organisasi semakin meningkat. Selain itu, terbangun silaturahmi antara pimpinan wilayah lembaga, lajnah dan Badan Otonom NU Sumut. Pemateri dalam acara ini adalah Prof Dr H Pagar Hasibuan MA (Ahlusunnah wal jamaah dalam kajian fiqh), Drs H Abdul Hamid Ritonga MA (Ahlusunnah wal jamaah dalam kajian Aqidah), Drs H Musaddad Lubis M Ag (Ahlusunnah wal jamaah dalam kajian akhlak) dan tentang ke-NU-an disampaikan Drs H Abdullah Nasution. Sebelumnya, Rois Syuriah PWNU Sumut Prof DR Pagar Hasibuan berharap TOT ini dapat membuka wawasan berkenaan dengan wawasan kebangsaan jamiyah, Ahlussunnah wal jamaah, aqidah, dan akhlak. Hadir sejumlah sesepuh NU, ulama dan Ketua Bahtsul Masail KH Asnan Ritonga.(m25)

han di dalamnya sudah di police line. Beberapa personel kepolisian juga masih mengawasi sekitar lokasi pergudangan itu, termasuk gudang-gudang di kawasan BintangTerang, Sei Semayang, dimana pemiliknya merupakan mitra kerja Zaki Badres. Secara terpisah, Kadis Kehutanan Sumut Ir JB Siringo-ringomelalui telefon selular mengatakan, telah memerintahkan anggotanya memperketat pengawasan hutan register dan hutan mangrove (bakau) di Kab. Langkat, karena dugaan sementara kayu mangrove sebagai bahan baku arang sebahagian besar dirambah dari Langkat, selebihnya dari kawasan hutan lindung di Aceh. “Segera kita tugaskan polisi kehutanan bekerja sama dengan aparat lainnya melakukan pengawasan,” kata dia.(m27)

Waspada/gito ap

SALAH satu truk arang yang sempat diamankan di Pomdam I/ BB Jalan Sena, saat ini diamankan di Mapoldasu, setelah Reskrimsus Poldasu menggerebek gudang arang Jalan Garuda 2 Sunggal, Deliserdang.

Penghargaan Muallimin Award Bagi Muallim Tanpa Pamrih MEDAN (Waspada): Sebagai ujung tombak dakwah Islamiyah, mengajarkan yang haq kepada umat, para mualimin sudah sepantasnya mendapatkan apresiasi. Karena para mualimin adalah orang-orang yang memiliki dedikasi, kapasitas dan kapabilitas dalam dakwah untuk secara konsisten dan tanpa pamrih mendedikasikan dirinya untuk membimbing umat. Kesimpulan tersebut mencuat dalam pertemuan silaturahim para ulama dan tokoh masyarakat di kediaman anggota DPR RI Dr H Chairuman Harahap SH, MH, di Jalan AH Nasution, Sabtu (17/12) malam. Dalam diskusi itu disepakati untuk memberikan apresiasi kepada para mualimin yang telah menunjukkan dedikasinya di masyarakat. Hadir dalam diskusi tersebut anggota DPR RI Dr H Chairuman Harahap SH, MH, Guru Besar IAIN Sumut Prof Syahrin Harahap, Prof Pagar Hasibuan MA, Dr Nur Asiah H MA, Mantan PimpinanWilayah Muhammadiyah Sumut H Dalail Ahmad, Direktur Institut Solusi Indonesia (ISI) Muhammad Ikhyar Velayati, Sekretaris Majelis Ulama Kota Medan H Hasan Maksum MA, Dosen UMSU yang juga Koordinator Nbasis Jaringan Shohibul Anshor Siregar, dan Ketua Al Jam’iyatul Muallimin Al Ustadz Ahmad Muttaqien.

Sebagai seorang wakil rakyat di DPR RI Chairuman Harahap menunjukkan kepeduliannya dengan menjadi penggagas pemberian penghargaan bagi para muallimin. Atas gagasan tersebut, Al Jam’iyatul Muallimin mengundang para tokoh dan alim ulama dalam pertemuan silaturahim untuk mendiskusikan gagasan itu lebih lanjut. Pertemuan silaturahim itu untuk memberikan apresiasi kepada para muallimin di daerah ini. Tujuannya adalah memberikan perhatian kepada para muallimin agar kegiatan dakwah dan pengajaran membimbing umat bisa semakin mengkristal di tengah masyarakat. Dalam diskusi tersebut merekomendasikan menggelar Muallimin Award sebagai wujud apresiasi kepada muallimin. Award ini tidak lain adalah sebagai penghargaan bagi para muallimin yang telah menunjukan dedikasi tanpa pamrihnya. Selanjutnya, sebagai pelaksana kegiatan Muallimin Award nantinya akan dibentuk Yayasan Muallimin Award yang akan bekerja secara konsisten dan kontiniu memberi apresiasi kepada para muallimin. Chairuman Harahap menyatakan mendukung penuh wujud pemberian penghargaan tersebut. “Saya kira sudah sepantasnya para muallimin yang telah bekerja tanpa pamrih itu diberi-

kan apresiasi,” ujarnya. Chairuman juga menyampaikan kekagumannya serta penghargaannya kepada orangorang yang dengan kebulatan tekadnya telah mengabdikan diri dengan penuh kesadaran untuk menjadi muallim. “Mereka adalah orang yang dengan kesadarannya sendiri mengabdi di masyarakat, membimbing umat dengan bekerjakeras tanpa pamrih,” sebutnya. Sementara itu Direktur ISI Muhammad Ikhyar Velayati menekankan pentingnya objektifitas dan kejernihan dalam memilih dan menentukan sosok muallimin di tengah masyarakat. “Ini penting karena dengan demikian penghargaan seperti ini bisa legitimate dan diterima masyarakat secara umum,” katanya. Dalam diskusi itu direncanakan untuk memilih beberapa orang muallimin yang direkomendasikan jamaahnya. Selanjutnya tim penilai yang akan dibentuk yang terdiri dari para alim ulama akan memberikan penilaian berdasarkan rekomendasi yang disampaikan umat. Bagi para muallimin yang terpilih nanti disediakan hadiah, misalnya berupa paket umroh ke tanah suci. Namun secara lebih rinci, teknis kegiatan pemberian penghargaan kepada para muallimin ini akan dibahas dalam pertemuan lanjutan.(m07)

Alph@T86 Gelar Donor Darah


PENGURUS dan anggota Alph@T86 menjelang pelaksanaan donor darah yang diadakan di Baraya Café, Kompleks Taman Setia Budi Indah I.

MEDAN (Waspada): Alumni SMA Negeri 4 tahun 1986 (Alph@T86) kembali menggelar bakti sosial donor darah bekerjasama dengan Perhimpunan Donor Daerah Indonesia (PDDI) Medan. Kegiatan dilaksanakan berkaitan dengan peringatan hari Natal dan Tahun Baru 2012. Sejak Sabtu (17/12) pagi, puluhan anggota Alph@T86 telah berkumpul di Baraya Café, kompleks Taman Setia Budi Indah I yang menjadi lokasi bakti sosial. Ketua Alph@T86 Sucipto Lubis mengatakan, kegiatan sosial merupakan agenda rutin yang digelar wadah berhimpunnya alumni tahun 1986 ini. Donor darah kali ini mengambil

tema hidup sehat dan bermanfaat. Dipilihnya donor darah sebagai kegiatan bakti sosial menyambut Natal dan Tahun Baru 2012, kata Sucipto, karena pihaknya mendapat kabar bahwa Kota Medan kekurangan stok darah. Setiap hari, Medan membutuhkan 70-100 kantong darah. Sementara yang mampu disuplai Palang Merah Indonesia (PMI) hanya 30 persen dari jumlah kebutuhan tersebut. Pengurus Alph@T86 lainnya Korinawati menyebutkan, sebelum bakti sosial dilaksanakan, pengurus dan anggota paguyuban ini melakukan rapat. Hasil rapat itu diputuskan melaksanakan kegiatan donor darah. Melihat animo pengurus dan

anggota wadah ini yang begitu besar, telah direncanakan donor darah dilaksanakan enam bulan sekali. ‘’Juga secara spontan masyarakat umum banyak yang merespon kegiatan ini,’’ katanya. Sementara itu, Seksi Sosial Alph@T86 Sri Hastuti, menyebutkan, selain donor darah, kegiatan sosial menyambut Natal dan Tahun Baru kali ini juga diisi dengan kegiatan kunjungan ke Panti Asuhan Claresta Jln. Gaperta Ujung. Ketua Alph@T Sucipto Lubis menambahkan, anggota dan pengurus juga menyusun agenda kegiatan tahun 2012, sekaligus pemilihan pengurus baru. ‘’Kita berharap para alumni dapat hadir,’’ katanya. (m12)

MEDAN (Waspada): Romi Ahmad Lubis kembali terpilih menjadi Ketua PK KNPI Medan Denai pada musyawarah PK KNPI Kecamatan Medan Denai ke-11 di kantor Lurah Mandala I, Sabtu (10/12). Romi terpilih secara aklamasi setelah mendapat dukungan 18 suara dari peserta musyawarah. Musyawarah dihadiri Ketua KNPI Kota Medan Zulham Effendi Siregar, unsur Muspika Medan Denai di antaranya Camat Medan Denai Edi Mulya Matondang, para lurah, kepling dan pimpinan OKP di Medan Denai. Zulham Effendi Siregar mengatakan, musyawarah salah satu bentuk konsolidasi organisasi yang bertujuan mengevaluasi program kerja periode lalu, serta membuat rencana program kerja ke depan. Dia juga mengingatkan agar pimpinan KNPI kecamatan peduli dengan lingkungan sekitar, sehingga KNPI bermanfaat bagi masyarakat. “KNPI harus menjadi organisasi yang mandiri dan kritis,” katanya. Sementara, Roni yang terpilih kembali untuk periode 20112014, berjanji melanjutkan program kerja yang belum selesai. Dia juga akan mensikronkan program kerja PK KNPI Medan Denai dengan program kepemudaan yang telah digariskan DPD KNPI Kota Medan. “Kita akan sinkronkan karena sejak KNPI Medan dipimpin Zulham Effendi Siregar banyak program dilakukan KNPI Kota Medan yang menyentuh kepentingan masyarakat, khususnya kalangan pemuda,” sebutnya. Program kerja itu, seperti pelatihan dan keahlian, kegiatan seminar, peringatan hari besar nasional, serta peringatan hari besar keagamaan. “Ini membuktikan KNPI Medan itu wadah berhimpunnya pemuda dari berberbagai latar belakang pendidikan, suku, ras, dan agama,” ujarnya. (m27)

Kadisdik Medan Harus Benahi Sarana Pendidikan MEDAN (Waspada): Wakil Ketua DPD KNPI Kota Medan M Faisal Lubis meminta Kepala Dinas Pendidikan (Kadisdik) Kota Medan M Rajab Lubis membenahi sarana pendidikan terutama di kawasan Medan Utara. “Tugas ini cukup berat bagi pejabat yang baru, apalagi Wali Kota Medan hanya memberikan waktu tiga bulan kepada Pj Kadis Pendidikan untuk membenahi pendidikan, terutama sarana dan prasarana,” kata Faisal kepada wartawan di Sekretariat KNPI Medan Jln. Merbabu, Sabtu (17/12). Dia menilai, salah satu sarana pendidikan yang sangat memprihatinkan ada di Kampung Sentosa Barat, Lingkungan XX Kelurahan Belawan Sicanang, Kecamatan Medan Belawan. Di kawasan itu ada dua sekolah SDN 065507 dan SDN 050100 yang kondisinya tidak memadai. Begitu juga kondisi rumah dinas guru yang jauh dari layak. “Kalau dibiarkan, akan mustahil pemerataan pendidikan dapat tercapai. Mutu dan kualitas pendidikan sangat diperlukan,” kata penasehat BKPRMI Kota Medan itu. Jembatan Sicanang Faisal juga mengharapkan Kepala Dinas Bina Marga Medan lebih serius memperhatikan keluhan masyarakat Kampung Sentosa Barat, Lingkungan XX, karena sarana jembatan menuju kediaman mereka tidak kunjung dibangun. Jembatan yang menjadi sarana penghubung utama masyarakat ke Medan maupun daerah lainnya yang rubuh, sampai kini belum dibangun. “Sudah hampir tiga bulan jembatan itu tidak tersentuh pembangunan, sehingga aktifitas masyarakat lumpuh,” kata dia. Bahkan, anak-anak yang masih duduk di bangku sekolah juga terganggu pendidikannya, karena pembangunan SDN 065507 dan SDN 050100 yang sedang dikerjakan bakal tertunda. Karena itu, Faisal mendesak Kadis Bina Marga Medan secepatnya membangun jembatan itu, sehingga akses masuk dan keluar ke kampung itu berjalan normal seperti biasa. Sementara, Kepling XX Kelurahan Belawan Sicanang Jihadun Akbar mengatakan, sejak jembatan itu rubuh masyarakat sulit melintas. “Karena itu kami bergotong royong membuat jembatan seadanya, tetapi hanya dapat dilewati dengan berjalan kaki,” kata dia.(m27)

Diduga Gelapkan Mobil Rental Diamankan MEDAN (Waspada): Reskrim Unit Ranmor Polresta Medan, mengamankan Hamdan Maulana, 46, warga Tangkahan, Medan Labuhan, yang disebut-sebut mantan tentara diduga terkait jaringan penggelapan ratusan mobil dari tersangka SSH, Sabtu (17/12) sore. Hamdan diamankan saat mencoba menjual mobil rental yang digelapkannya di kawasan Hamparan Perak, Medan Labuhan. Guna penyelidikan, dia berserta barang bukti 1 unit mobil rental diboyong ke Mapolresta Medan. Kasat Reskrim Polresta Medan AKP Yoris Marzuki yang dikonfirmasi melalui Kanit Ranmor AKP Ronald F Sipayung, Minggu (18/12) mengatakan, yang bersangkutan bukan TNI, tapi warga sipil. “Setelah kita amankan dan dilakukan pemeriksaan tidak terpenuhi unsur pidananya karena saat diamankan mobil masih ditangan Hamdan,” sebutnya. Menurut dia, usai pemeriksaan Hamdan Maulana dipulangkan karena hanya unsur perdata dan harus membayar uang rental. “Memang ada kita amankan, namun mobil tersebut belum berpindah tangan. Dari pengakuan Hamdan, mobil rental yang disewanya itu belum dibayar uang sewanya selama 21 hari,” sebutnya. Saat disinggung keterkaitan Hamdan dengan jaringan penggelapan ratusan mobil, Ronald membantahnya. “Tidak ada kaitannya, dia diamankan karena tidak membayar uang rental mobil aja, kalau kemungkinan lainnya masih kita lakukan pengembangan” ujarnya. Informasi di Polresta Medan, Hamdan Maulana ditangkap atas laporan Anas Gozali, 48, warga Jalan Gunung Krakatau, Medan Timur. Dalam laporannya, Hamdan membawa kabur mobil Daihatsu BK 9819 CA milik Anas selama 3 minggu. Atas laporan korban, petugas Unit Ranmor Polresta Medan melakukan pemantauan. Setelah dipastikan, polisi langsung meringkus Hamdan saat mencoba menjual mobil yang direntalnya tersebut kepada seorang penadah. (m39)

Serbuk Herbal Dikira Ganja MEDAN (Waspada): Petugas bagian pengiriman barang (kargo) Bandara Polonia Medan salah mendeteksi serbuk herbal seberat 102 kg yang semula dikira ganja. Pemilik dan serbuk herbal itu sempat diamankan di Poldasu setelah penangkapan di bandara, Selasa (13/12) malam. Namun setelah proses penelitian di Laboratorium Forensik Polri, dipastikan serbuk itu merupakan herbal terbuat dari daun sirih. Direktur Dit Narkoba Poldasu Kombes Pol. Andjar Dewanto kepada wartawan, Minggu (18/12) membenarkannya. Dia menyebutkan, serbuk kering berwarna hijau yang ditemukan petugas X-Ray Bandara Polonia ternyata bukan narkotika jenis ganja. “Hasil pemeriksaan Labfor Polri Cabang Medan menunjukan hasilnya negatif (bukan cannabinoid/narkotika),” katanya. Ini diperkuat dengan surat keterangan hasil pemeriksaan barang bukti narkotika No. Agenda: TA/109/XII/2011 ditandatangani Wakil Kepala Laboratorium Forensik Cabang Medan AKBP Melta Tarigan, MSi dan Kasubbid Narkoba Labfor AKBP Zulni Erma selaku pemeriksa. Sementara pemilik serbuk herbal, Yohny Anwar dari CV Jaya Bersama mengungkapkan kekecewaannya terhadap cara kerja petugas kargo Bandara Polonia. Dia merasa telah merugikan baik secara material ataupun non material. “Perusahaan saya mempunyai izin lengkap, sudah hampir empat tahun berbisnis serbuk terbuat dari daun sirih ke Jakarta dan berbagai negara. Entah kenapa saat pengiriman ke Jakarta terakhir dinyatakan mengandung ganja,” kata dia didampingi kuasa hukum Maswindra, SH. Yohny merasa sangat perlu membersihkan nama baik dan perusahaannya karena saat barang kirimannya diamankan di bandara dan dirinya ditahan polisi, berbagai media terbitan Medan dan Jakarta sudah memberitakannya. (m27/m22)


Medan Metropolitan

WASPADA Senin 19 Desember 2011

YPSA Bantu Tiga Panti Asuhan MEDAN (Waspada): Sambut Milad ke-14, Yayasan Pendidikan Shafiyyatul Amaliyyah (YPSA) memberikan bantuan kepada tiga panti asuhan yakni, Panti Asuhan Bani Adam, Yayasan Pembangunan Didikan Islam Indonesia, dan Aisyiyah, Jumat (16/12). Ketua Panitia Milad Bagoes Maulana, S.Kom mengatakan, bantuan yang diberikan kepada tiga panti asuhan tersebut berupa beras 2020 kg, mi instan 101 kotak, gula 249 kg, minyak makan 163 liter, susu 121 kaleng, kopi 2 bungkus, dan susu sereal 13 kotak. Menurut Bagoes, YPSA juga melakukan penandatanganan MoU dengan PT Musim Mas dalam hal pemberian Beasiswa Anak Mas, yang merupakan beasiswa penuh bagi siswa yang dhuafa agar dapat mengenyam dan menyelesaikan pendidikannya di SMA Bertaraf Internasional YPSA. Selain itu, YPSA juga memberikan penghargaan kepada tokoh masyarakat peduli pendidikan YPSA di antaranya Kapoldasu Irjen Pol Wisjnu Amat Sastro, Bupati Labuhan Batu J Khairuddin Syah Sitorus, Presiden Direktur PT. Musim Mas Bachtiar Karim, Ustadz Dr H Amiruddin MS, Ustadz H Amhar Nasution MA dan Ustadz H Zulfikar Hajar Lc. Dikatakannya, dalam rangka HUT ke-14 YPSA, juga digelar perlombaan yang meliputi, lomba berwudhu, sholat wajib, azan, cerdas cermat keislaman, membaca Al-Quran ayat pendek, hafiz Quran), Juz Amma, shalat jenazah, doa-doa Al-Quran, kaligrafi, melukis Masjid Shafiyyatul Amaliyyah, mewarnai, membaca puisi keislaman/lingkungan hidup, story telling, ceramah agama, manasik haji, kebersihan kelas, paduan suara, tari-tarian, busana muslim dan lain-lain. “Rangkaian lainnya juga melakukan ziarah ke makam pendiri YPSA Hj Djamaliah, ibunda Drs H. Sofyan Raz, Ak. MM,” sebut Bagoes. (m43)

Penutupan Christmas Session Disbudpar Medan Meriah MEDAN (Waspada): Penutupan Christmas Session (natalan) yang digelar Dinas Kebudayaan dan Pariwisata (Disbudpar) Kota Medan di Lapangan Benteng Medan berlangsung meriah, khitmad dan sangat relijius, Jumat (16/12). Dalam penutupan even besar bagi umat Kristiani itu juga terlihat ribuan warga Medan memenuhi lapangan dan terhanyut dalam kebaktian yang dibuat panitia. Tidak hanya itu, pada tahun 2012 mendatang, Pemko Medan berencana akan menggelar even Natalan yang lebih meriah dan besar di dua tempat berbeda. Hal itu dilakukan mengingat antusias warga Medan yang datang memenuhi Lapangan Benteng mencapai ribuan orang dan terinspirasi dari pagelaran even Ramadhan Fair 2011 yang digelar Pemko di Masjid Raya Al-Maksum dan Lapangan Mangaa Medan Deli. “Inspirasi kita itu dari Ramadhan Fair yang di tahun ini kita gelar dia dua tempat. Tahun depan, kita rencanakan akan menggelar Christmas Session di dua tempat juga. Agar seluruh warga Medan dapat menikmatinya dan tidak terlalu jauh menempuh sampai inti kota di Lapangan Benteng seperti di tahun ini,” kata Kadisbudpar Kota Medan Busral Manan kepada wartawan, Jumat (16/12) malam, disela-sela Penutupan Christmas Session yang ditutup oleh Wakil Wali Kota Medan Dzulmi Eldin. Busral menjelaskan inspirasi yang didapatnya itu juga akan lebih dikembangkan lebih besar lagi dengan melibatkan seluruh stakeholder pariwisata. Tidak hanya itu, dunia perbankan juga akan dilibatkan dalam perayaan Christmas Session di tahun depan agar lebih meriah. “Tidak perayaan keagamaan Natal secara khitmad dan relijius saja, kita juga akan lebih mengembangkan transaksi-transaksi ekonomi di setiap acara. Artinya, komitmen serius Pemko Medan untuk lebih mengembangkan UKM akan kita tonjolkan. Kita akan terus menggandeng Dinas Koperasi dan UKM Medan serta dinas terkait dalam setiap perayaan even pariwisata di Medan. Karena, pada perayaan Natal di tahun-tahun sebelumnya tidak pernah dibuat seperti ini atau adanya transaksi ekonomi. Kita juga akan mengundang pihak perbankan untuk membuka stand pada Natalan tahun depan,” ujarnya. Busral menuturkan pelaksanaan even Natalan di tahun depan secara bersamaan di dua lokasi berbeda akan lebih dimatangkannya. Dia mengaku masih belum bisa menentukan lokasi mana saja yang akan dijadikan tempat pelaksanaan even Natalan. “Pastinya belum tahu, akan kita matangkan lagi. Dengan anggaran yang tersedia itu coba kita bagi-bagi agar bisa dilaksanakan di dua lokasi berbeda. Namun tidak sama dengan Ramadhan Fair yang digelar selama 1 bulan. Kita gelar natalan di tahun depan, dalam beberapa hari saja. Karena berbeda dengan Ramadhan Fair, ketika itu memang seluruh umat muslim menjalankan puasa selama 1 tahun,” sebutnya. Busral menyebutkan, lokasi perayaan Natal Pemko Medan di tahun depan bisa saja dilakukan di Kecamatan Medan Tuntungan, Medan Perjuangan atau di Perumnas Mandala Medan Denai. Tempat pelaksanaan akan ditentukan lebih lanjut dengan meminta masukan dari masing-masing kecamatan nantinya dan mempertimbangkan faktor mayoritas warga agama Kristiani yang bertempat tinggal di wilayah mana yang cocok digelar. (m50)

Pasien Dan Keluarga Rayakan Natal Di RSUP Adam Malik MEDAN (Waspada): Ratusan pasien dan keluarga pasien RSUP H Adam Malik (HAM) Medan merayakan natal bersama dengan pegawai rumah sakit tersebut, di gedung Central Medical Unit RSUP HAM, Minggu (18/12) pagi. Tema natal yakni ‘Bangkitlah, menjadi teranglah, sebab terangmu datang dan kemuliaan Tuhan terbit atasmu.’ Ketua Panitia Perayaan Natal dr Pertin Sianturi SpA (K) mengatakan, meskipun dalam keadaan sakit, pasien tetap mendapatkan lawatan dari Tuhan untuk mendapatkan suka cita. “Serta perayaan natal ini juga diharapkan untuk mendapatkan lawatan untuk kesembuhan. Suka cita berlaku untuk semua orang, baik yang sakit maupun yang sehat. Maka keluarga pasien juga kita undang karena mereka juga layak untuk mendapatkan suka cita,” kata Pertin didampingi Kasubbag Humas RSUP HAM Sairi M. Saragih. Dikatakannya, dalam perayaan natal ini juga didoakan para pasien yang sedang sakit untuk mendapatkan kesembuhan yang sempurna. “Setelah Tuhan melawat mereka melalui tangan-tangan dokter dan perawat yang ada di dalam RSUP HAM ini supaya dapat berkat dan kesembuhan. Ini kira-kira tujuan utama natal ini,” sebutnya. Sementara itu, salah tamu dari perayaan natal tersebut Martinus mengungkapkan, perayaan natal ini merupakan bentuk service pelayanan RSUP HAM terhadap pasien dan keluarga pasien. Dalam perayaan natal itu juga menghadirkan PendetaYohannes Siregar. Dia memotivasi pasien untuk bangkit atau sembuh dari penyakitnya. “Marilah kita bangkit dari sakit dan penyakit dari kelemahan sehingga kita bisa menerbitkan terang,” ujarnya. Acara juga menampilkan vocal solo dari Ayu Permata Sari dan Natasha Karina Sianturi, liturgy pasien dan keluarga pasien, penyalaan lilin dan doa. Hadir seluruh pegawai dan staf RSUP HAM yang beragama Kristen. (h02)

Waspada/Mursal AI

KETUA PANITIA dr Pertin Sianturi SpA (K) bersama Pendeta Yohannes Siregar saat menyalakan lilin pada perayaan natal bersama pasien di gedung Central Medical Unit RSUP HAM,Minggu (18/12) pagi.

Waspada/Surya Efendi

ABAIKAN TANDA LARANGAN: Pengemudi becak bermotor (betor) tanpa mengenakan helm menerobos masuk dari Jln. Sisingamangaraja menuju Pasar Sambas Medan, Jumat (16/12). Padahal, di pinggir jalan tersebut terpasang rambu larangan masuk bagi betor.

Revitalisasi Agribisnis Tingkatkan Kualitas Produk Lokal MEDAN (Waspada): Secara perlahan, dampak pasar bebas mulai dirasakan petani lokal. Imbasan impor produk pertanian mulai membanjiri pasar lokal, mulai dari produk hasil pertanian, baik pangan segar seperti bawang putih hingga jahe ataupun pangan olahan. Untuk mengatasi hal ini, maka perlu dilakukan revitalisasi agribisnis sebagai upaya untuk meningkatkan daya saing produk lokal. “Kalau kita masih mempertahankan cara pengolahan produk pertanian mulai dari on farm sampai off farm begitu-begitu saja, maka kita akan dijajah oleh negara lain melalui produksi mereka yang sudah membanjiri pasar Indonesia,” kata Kepala Badan Ketahanan Pangan Sumut Setio Purwadi di sela-sela kerjasama workshop Revitalisasi AgribisnisWujudkan Akses Pangan yang digelar Korps Alumni Himpunan Mahasiswa Islam (KAHMI) Sumut dengan Badan Ketahanan Pangan Sumut, Sabtu (17/12). Dikatakan Setio, untuk menjadikan produk pertanian lokal berdaya saing, maka harus ada upaya untuk mengubah pola pikir baik petugas maupun pelaku agribisnis dalam me-

ningkatkan kualitas dan kuantitas hasil pertaniannya, sehingga dapat bersaing dengan produk lokal. “Workshop seperti ini sangat baik dan saya harapkan setiap petugas badan ketahanan pangan yang hadir dari 33 kabupaten/kota di Sumut, dapat mengidentifikasi persoalan di lapangan, melakukan analisis permasalahan, merumuskannya sehingga bisa membuat rencana aksi sehingga produk dari kelompok tani atau pelaku agribisnis mempunyai daya saing, dengan sendirinya akan meningkat pendapatannya tanpa harus menunggu penyelesaian dari pemprovsu ataupun pemerintah pusat,” sebutnya. Tujuan pembangunan ketahanan pangan ini, tutur Setio, untuk menjamin ketersediaan pangan yang cukup untuk dikonsumsi dalam kondisi aman. “Ketersediaan pangan akan terwujud apabila seluruh subsistem ketahanan pangan berjalan secara efektif dan efesien,” ujarnya. Untuk mewujudkan peningkatan akses pangan, maka peran pemerintah daerah sangat penting karena selama ini pemerintah daerah yang langsung berhadapan dengan masyarakat dan yang mengetahui hambatan-hambatan terhadap akses pangan di daerahnya. ”Pemerintah provinsi hanya berperan menetapkan

kebijakan dan program yang dapat menciptakan kondisi yang kondusif dan mendorong terjadinya akses pangan masyarakat yang lancar,” katanya. Sementara itu, Pimpinan Kolektif MajelisWilayah KAHMI Sumut Rusdi Lubis menyebutkan, selama ini proses pembangunan yang dilaksanakan selalu berorientasi mengejar pertumbuhan tanpa memperdulikan lingkungan, telah mengeskploitasi sumber daya alam tanpa batas sehingga keanekaragaman hayati mengalami degradasi yang signifikan. “Kondisi ini berimbas kepada sistem pertanian kita, di mana keanekaragaman hayati mengalami kemerosotan yang nyata. Hal ini dapat kita lihat dari semakin sedikitnya jenis tanaman penyedia kebutuhan pokok. Jika hal ini terus berlanjut bukan tidak mungkin kita akan mengalami degradasi ketersediaan pangan yang memprihatinkan dan upaya secara nasional untuk meningkatkan produksi pangan melalui varietas unggul akan menurun,” ujarnya. Dikatakan Rusdi, KAHMI Sumut memberikan apresiasi kepada Badan Ketahanan Pangan Sumut yang berupaya mencari dan memperkenalkan kepada masyarakat keanekaragaman pangan seperti mencoba sumber pangan lain dari Tapanuli yang dikenal dengan

Perawat Diminta Tingkatkan Kepedulian Layani Pasien MEDAN (Waspada): Dalam melayani pasien, perawat diminta untuk lebih meningkatk a n k e p e d u l i a n n y a ( caring). Dalam ilmu keperawatan, caring merupakan bagian inti yang penting terutama dalam praktik keperawatan. Untuk itu, perawat harus bisa mencip-takan caring moment kepada pasien. “Perawat harus ada waktu untuk menemani pasien dan keluarganya, karena tiap pertemuan mempunyai peluang untuk menjadi caring moment. Teori human caring ini dibuat antara tahun 1975 dan 1979 yang dikenalkan oleh ahli keperawatan Watson,” kata Ketua Program Studi Magister Ilmu Kepereawatan USU dr Setiawan, S.Kp, MNS saat seminar sehari di Aula Fakultas Keperawatan USU, Sabtu (17/12). Dalam teori yang diperkenalkan Watson ini, lanjutnya, mempertegas caring sebagai jenis hubungan dan transaksi yang diperlukan antara pemberi dan penerima asuhan untuk

meningkatkan dan melindungi pasien sebagai manusia, de-ngan demikian mempengaruhi kesanggupanpasienuntuksembuh. Sementara itu, Pembantu I Dekan Fakultas Keperawatan USU Erniyati, S.Kp, MNS mengatakan, sebagai disiplin ilmu, keperawatan merupakan kebutuhan sosial yang unik dan praktek keperawatan adalah suatu respon. “Keperawatan harus dipandang secara utuh, jika keperawatan hanya dipandang secara parsial, seperti ilmu atau etik saja maka tidak cukup mendukung kebutuhan praktek keperawatan, pendidikan keperawatan dan riset keperawatan,” ujarnya. Selain itu, lanjutnya, jika dilihat dari aspek profesi, maka keperawatan harus memenuhi kebutuhan sosial yang muncul terhadap respon keperawatan. “Untuk itu, agar dapat menunjukkan caring dalam keperawatan dalam keseharian praktek keperawatan diperlukan intuisi, ilmiah kuantitatif data

yang muncul dari penelitian, pengetahuan dari berbagai disiplin ilmu dan etika kepercayaan dan lainnya,” sebutnya. Seminar sehari dengan tema ‘Caring Scince Sebagai Landasan Aplikasi Dalam Pendidikan Pelayanan dan Penelitian Keperawatan’ dihadiri 500 peserta dari mahasiswa diploma, sarjana, pascasarjana dari Meulaboh, Langsa, dan Fakultas Keperawatan USU. “Awalnya hanya 200 peserta rencana kita, tapi karena tenaga perawat haus akan ilmu pengetahuan, dan ingin berubah kearah yang ingin lebih baik lagi, maka pesertanya membludak. Itupun sudah kita batasi,” kata Ketua Panitia Ahmad Sobari. Acara seminar dibuka oleh Dekan Fak Keperawatan USU dr Dedi Ardinata, M.Kes. Dia mengharapkan, caring atau kepedulian harus diciptakan dalam kehidupan sehari-hari. “Inti dari keperawatan itu adalah caring. Ini tindakan dari segalanya,” tuturnya. (h02)

Manggadong yaitu ubi jalar. Untuk itulah, sebutnya, melalui kerjasama ini diharapkan workshop Revitalisasi

Agribisnis Mewujudkan Akses Pangan dapat menemukan kajian terhadap hal-hal ketersediaan pangan sehingga petani

dapat melakukan rekayasa terhadap varietas baru tanaman yang menghasilkan kualitas yang lebih baik. (m50)

Kampus Harus Buka Diri Berikan Pendidikan Politik MEDAN (Waspada): Kampus harus membuka diri dalam memberikan pendidikan politik dan tidak perlu khawatir ekses dari pendidikan politik di universitas. “Pendidikan politik bukan hanya tanggung jawab partai politik, tapi juga kampus sebagai lembaga pendidikan,” ujar Pengamat Politik USU Warjio, MA PhD menjawab pertanyaan peserta seminar dan pelantikan Kepengurusan Himpunan Mahasiswa Jurusan Ilmu Pemerintahan (Himajip) UMA, di Kampus I UMA Jalan Kolam Medan Estate, Rabu (14/12). Seminar dengan moderator Drs M Aswin Hasibuan MAP itu, juga menampilkan pembicara Wakil Ketua DPD Partai Golkar Ir H Chaidir Ritonga MM dan Wakil Direktur Esekutif Partai Demokrat Zulkifli SAg. Seminar bertema “Penguatan Fungsi Partai Politik dalam Pendidikan Politik Bangsa” tesebut dibuka dan ditutup Dekan FISIP UMA Drs Irwan Nasution MAP dan turut hadir Wakil Dekan Bidang Kemahasiswaan Drs Bahrum Jamil MAP, Kabag Humas UMA Ir Asmah Indrawati MP, Ketua Panitia Mustakim, serta para dosen dan mahasiswa FISIP UMA. Menurut Warjio, untuk mencerdaskan

bangsa, maka pendidikan politik bukan hanya tanggungjawab para Parpol tapi juga kampus sebagai lembaga pendidikan. Karena itu, jangan terlalu alergi karena konteks pendidikan politik yang diharapkan output-nya untuk memberikan pencerdasan bukan menuju politik praktis dalam kampus. “Jadi pembelajaran politik tidak bisa diberikan saja kepada Parpol tetapi seluruh komponen masyarakat termasuk perguruan tinggi,” sebut Sekretaris Prodi MAP Pascasarjan UMA itu. Dia mengatakan, ideologi Parpol saat ini sudah mulai kabur dan runtuh karena banyak Parpol bergerak ke ‘tengah’ tanpa memikirkan ideologi dari partai, sehingga jika dilihat dari manajemen Parpol maka manajemennya buruk. Sementara itu, Chaidir Ritonga mengakui perkembangan proses dari demokrasi pasca reformasi sudah mulai kebablasan. Bahkan, dia mengakui Parpol tidak hanya diisi oleh para kader. Sebelumnya dilakukan pelantikan Pengurus Himajip FISIP UMA. Pengurus yang dilantik terdiri Ketua Yakin Kasih Tapanoa, Sekretaris Samudra Sitepu, Bendahara, Aprodita Harahap dan pengurus berbagai bidang. (m49)

STIE Harapan Lantik 523 Wisudawan MEDAN (Waspada): Sekolah Tinggi Ilmu Ekonomi (STIE) Harapan Medan melantik Ahli Madya, Sarjana dan Magister Manajemen (S2) untuk tahun akademi 2010/2011, di Selecta Convention Hall Medan, baru-baru ini. Wisudawan yang dilantik sebanyak 523 orang terdiri dari 22 orang Ahli Madya Jurusan Manajemen Perkantoran, 413 Sarjana Ekonomi yang terbagi atas 207 sarjana Ekonomi jurusan Akuntansi dan 206 Sarjana Ekonomi jurusan Manajemen serta 88 Magister Manajemen. Dari jumlah tersebut sebanyak 60 orang memperoleh predikat Cum-Laude yang terdiri dari 34 Sarjana Ekonomi dan 25 Magister Manajemen dan 1 orang Diploma-III yang berhasil memperoleh predikat kelulusan tertinggi CumLaude. Dengan wisuda tersebut maka jumlah alumni yang telah dihasilkan STIEHarapan Medan yang berdiri tahun 1974 tersebut sebanyak 14.017 alumni yang terdiri atas 4.437 alumni jenjang Diploma, 9.429 alumni jenjang Strata -1 dan 151 alumni jenjang Strata -2. Ketua STIE Harapan Medan H Kersna Minan,SE.M.Si.Ak dalam sambutannya mengatakan, pemerintah Indonesia sedang fokus meningkatkan jumlah wirausaha agar dapat berperan dalam mendukung ekonomi negara lebih maju pada masa datang. Menurut data yang ada saat ini jumlah wirausaha di Indonesia hanya sekitar 0,24 persen dari jumlah penduduk di Indonesia yang sekitar 238 juta jiwa. Jumlah tersebut lebih rendah dibanding dengan jumlah wirausaha di beberapa negara lain yang tingkat pertumbuhan ekonominya tinggi. Bila dibandingkan dengan negara lain seperti Amerika Serikat mencapai 11 Persen, Singapura 7 persen, dan Malaisia mencapai 5 persen. Hasilkan bibit unggul Ketua UmumYaspendhar H Adi Dermawan Putra Thaher mengatakan, Yaspendhar hanya

menghasilkan bibit unggul. Tidak semua bibit menghasilkan yang baik. Yaspendhar melepas bibit setelah yakin bahwa bibit itu bibit yang unggul. “Secara resmi Yaspendhar kembalikan wisudawan kepada orangtuanya sebagai berlian yang memancarkan cahaya yang telah diasah di Yaspendhar selama inim” sebutnya. Sementara Koordinator KopertisWil-I AcehSumut Prof.Ir.M.Nawawiy Lubis,M.Phil,Phd mengatakan, kualitas kelulusan sangat ditentukan oleh proses belajar dan mengajar. “Hakekat dari pendidikan itu adalah ilmu bukan ijazah atau gelar kesarjanaan. Upaya peningkatan kualitas pendidikan diharapkan seluruh stakeholders yang terlibat dalam pengelolaan PTS bekerja berdasarkan peraturan yang ada,” ujarnya. Dalam acara wisuda tersebut turut dihadiri seluruh pengurus harian Yaspendhar Medan, senat dan dosen dilingkungan STIE Harapan dan undangan yang berhadir. (m49)


KETUA STIE Harapan H Kersna Minan melantik mahasiswi di Selecta Convention Hall Medan.

Medan Metropolitan

WASPADA Senin 19 Desember 2011


Dani Ginting Layak Pimpin MPC PP Deliserdang MEDAN (Waspada): H Jasa Wardani Ginting SE, (H Dani Ginting) layak menjadi ketua MPC Pemuda Pancasila Deliserdang. “Dani Ginting sudah dua priode menduduki ketua PAC PP Sunggal, Kabupaten Deliserdang, dan kepemimpinannya tidak perlu diragukan lagi,” kata Ketua PAC Pemuda Pancasila Hamparan Perak Marhot Harahap kepada Waspada, Minggu (18/12) sore. Marhot mengatakan, Dani Ginting layak jadi ketua MPC Deliserdang tidak perlu diragukan karena mempunyai wawasan yang luas tentang kewiraswastaan, mengayomi Pemuda Pancasila yang ada di Kabupaten Deliserdang. Untuk kesetian dari kepemimpinan Dani Ginting juga tidak perlu diragukan. “Selain ketua PAC Sunggal dua priode, Dani juga sudah dua priode sebagai wakil ketua Koti MPW PP Sumut,” sebutnya. Menurut Marhot, hubungan Dani Ginting dengan pemerintah daerah dan masyarakat serta kepada pimpinan PAC PP se Kabupaten Deliserdang dan lainnya cukup baik. “Saya yakin empat tahun ke depan MPC PP dibawa pimpinan Dani Ginting lebih baik sesuai apa yang diharapkan PP khsususnya keluarga besar PAC PP se Kabupaten Deliserdang,” ujarnya. Marhot Harahap yang sudah 20 tahun menjadi Ketua PAC Hamparan Perak itu mengajak dan mengharapkan para peserta dapat hadir dan sekaligus melaksanakan musyawah MPC PP Deliserdang pada 23 Desember 2011 di kantor MPW PP Sumut Jln. Thamrin Medan, dengan tertib dan aman, agar dapat melahirkan pemimpin MPC PP Deliserdang yang solid. Disebutkannya, musyawarah MPC PP Deliserdang pernah dilakukan pada 22 Oktober 2011 di Tanjungmorawa, tapi gagal karena terjadi keributan pada saat musyawarah sehingga pelaksananakan muscab dibatalkan. “Kita selaku anak cabang mengimbau/mengajak seluruh Pemuda Pancasila di Kabupaten Deliserdang khususnya anak cabang, mari kita jaga kesatuan dan persatuan dalam mengadakan muscab di kantor MPW PP Sumut Jln. Thamrin Medan,” kata Marhot. (m36) Waspada/Surya Efendi

BELUM TERATASI: Arus lalulintas terlihat padat di kawasan Jln. Gatot Subroto hingga persimpangan Jln. Iskandar Muda Medan, Jumat (16/12) sore. Kemacetan di sejumlah ruas jalan di Kota Medan pada jam-jam tertentu belum bisa teratasi.

Wali Kota Akan Terbitkan Perwal Ruang Terbuka Hijau MEDAN (Waspada): Wali Kota Medan Rahudman Harahap akan menerbitkan Peraturan Wali Kota (Perwal) tentang Ruang Terbuka Hijau (RTH) di Medan. Kebijakan itu diambil untuk mewujudkan Medan hijau dan bersih. Dalam Perwal itu, masyarakat diimbau untuk menanam tanaman-tanaman yang produktif seperti mangga, belimbing, nangka, maupun yang lainnya di halaman rumahnya. Bagi warga yang tidak memiliki halaman, mereka diharuskan menanam bunga dalam pot. “Jika seluruh masyarakat melakukan ini, saya yakin Kota Medan akan menjadi hijau dan bersih. Untuk itu, harus dibangun sinergitas dengan masyarakat sehingga masyarakat dengan sukarela mendukung penuh kegiatan ini. Di samping itu saya juga berharap kepada para tokoh agama untuk mendukung kegiatan ini,” kata Rahudman di sela-sela acara pe-

nanaman pohon dan pelepasan bibitikanmasdilahanCadikaKec. Medan Johor, Sabtu (17/12). Menurut Rahudman, dalam Per wal itu juga nantinya diwajibkan setiap rumah yang ada di Medan untuk menanam pohon meskipun hanya satu atau dua batang pohon. “Setiap rumah akan diwajibkan menanam pohon, satu atau dua batang. Dan bila pemilik rumah tidak sanggup membeli bibit pohonnya, Pemko Medan akan memberikan bibit pohonnya,” sebutnya. Apalagi, lanjutnya, jika melihat tantangan ke depan tentunya akan semakin berat. Karenanya, kebersamaan harus terus dijalin. Dengan terciptanya kebersamaan tentunya akan melahirkan rasa kasih sayang dan memiliki. “Apabila kita telah memiliki rasa kebersamaan dan kasih sayang, maka kita akan bisa mengimbangi kota-kota besar lainnya di Indonesia,” tuturnya. Untuk mewujudkan kota Medan yang hijau dan bersih, kata Rahudman, pihaknya juga sudah melakukan upaya membangun Kota Metropolitan, yaitu melakukan program Go

Green. “Saat ini salah satu realisasinya sudah dilakukan, dan realisasi Kota Hijau atau membangun Hutan Kota sudah ditangani oleh BNI, baik penataan ruang, membangun hutan kota maupun ruang terbuka hijau. Ruang terbuka hijau ini akan dijadikan sebagai taman atau tempat bermain anak-anak nantinya,” ujarnya. Kata Rahudman, untuk menjadikan Kota Medan menjadi kota yang peduli terhadap lingkungan hidup untuk menuju Kota Metropolitan yang aman dan nyaman, setiap lahan perkuburan di Medan, juga akan dijadikan sebagai ruang terbuka hijau. “Perkuburan akan ditata menjadi ruang terbukan hijau. Di situ akan dibuat lampu sehingga setiap pekuburan akan tampak indah,” katanya. Di tempat yang sama, Direktur Jendral Otonomi Daerah Kementerian Dalam Negeri (Dirjen Otda Kemendagri) Prof DR Djohermansyah Djohan menyebutkan, Kota Metropolitan bukan hanya dilihat dari banyaknya gedung besar, tinggi dan mewah atau gedunggedung pencakar langit. Kota

Hendra DS Ketua Pujakesuma Medan MEDAN (Waspada): Drs Hendra Desmo Santoso (Hendra DS) terpilih secara aklamasi sebagai ketua Pujakesuma Kota Medan pada Musda I, di Amaliun Convention Hall Jln. Amaliun Medan, Minggu (18/12). Musyawarah Daerah (Musda) I Pujakesuma Kota Medan yang dibuka Ketua Majelis Pembina Pengurus Pusat Pujakesuma Kasim Siyo menetapkan Hendra dengan suara bulat (aklamasi), meski sebelumnya ada tiga figur ý yang menyatakan maju sebagai calon ketua. “Berdasarkan kesepakatan poro sedulur, yakni pengurus-pengurus kecamatan serta utusan pengurus wilayah Pujakesuma Sumut yang menjadi peserta, tepat pukul 12:22 WIB, Hendra DS kami tetapkan sebagai Ketua Pujakesuma Kota Medan periode 2011-2016,” ujar Redwin SH, pimpinan sidang juga wakil ketua Bidang Program PengurusWilayah Pujakesuma Sumut tersebut. Redwin bertindak sebagai pimpinan sidang berdasarkan musyawarah dan mufakat para peserta. Wakil Sekretaris Jenderal (Wasekjen) Pengurus Pusat Pujakesuma Indra Gunawan, turut ditunjuk sebagai pimpinan sidang bersama Sekretaris Pengurus Wilayah Sumut Rusmayadi, fungsionaris (demisioner) Pujakesuma Kota Medan Drs Indra Bakti Lubis dan Sunardi

yang mewakili Pengurus Kecamatan Medan Area. Usai ditetapkan sebagai Ketua Pujakesuma Kota Medan, Hendra DS dalam sambutannya, menekankan tekadnya untuk kembali memasyarakatkan Bahasa Jawa sebagai bahasa pergaulan di Kota Medan. “Paling tidak, Bahasa Jawa mesti dipakai dalam pergaulan antar sesama warga Pujakesuma. Ketemu di mall atau di mana saja, kita pakai Bahasa Jawa,” ujarnya. Putra Jawa kelahiran Sumatera yang pernah duduk di lembaga legislatif ini selebihnya mengaku tidak mau melontarkan terlalu banyak program. Hanya, satu hal yang akan jadikan fokus pengabdian di Pujakesuma adalah mengeliminir kasus-kasus putus sekolah di kalangan masyarakat Jawa Kota Medan, khususnya pada anakanak warga Pujakesuma. Sementara itu, Ketua Pengurus Wilayah Sumut Pujakesuma Kompol Drs H Joko Susilo dalam sesi penutupan musda mengimbau agar warga Pujakesuma melestarikan budaya musyawarah dan mufakat pada setiap pengambilan keputusan, bahkan pada pemilihan pimpinan. “Gak boleh ada kubu-kubuan dalam musyawarah,” sebutnya. Usai musda, acara dilanjutkan dengan kegiatan silaturahmi dan konsolidasi fungsionaris Pujakesuma.(m46)

Waspada/Surya Efendi

KETUA Pujakesuma Kota Medan terpilih Drs Hendra DS diabadikan bersama sejumlah keluarga besar Pujakesuma usai Musda I, di Amaliun Convention Hall Jln. Amaliun Medan, Minggu (18/12).

Metropolitan itu merupakan kota yang perduli terhadap lingkungan hidup. “Banyak orang yang menganggap Kota Metropolitan dilihat dari segi bangunan di kota itu, sekarang paradigma itu harus diubah. Kota Metropolitan juga dilihat dari segi lingkungan,” sebutnya. Djohermansyah mengatakan, salah satu upaya untuk membangun Kota Metropolitan

harus membuat hutan kota, seperti program yang sudah dilakukan Pemko Medan yaitu Go Grenn. “Membuat hutan kota maupun taman kota yang indah dan tertata sehingga terlihat indah. Orang yang melewati kota itu merasa nyaman. Kemudian masyarakatnya juga harus ikut mendukung dan menjaga lingkungan hidup,” katanya.

Untuk itu, lanjutnya, Pemko Medan diharapkan terus meningkatkan program Go Green demi terciptanya Kota Metropolitan yang aman, nyaman dan indah. “Tahun 2012 Pemko Medan terus melakukan pemeliharaan lingkungan hidup, dan terus meningkatkan program Go Grenn demi kepentingan masyarakat bersama,” tutur Djohermansyah. (m50)

Pengusaha Muda Sumut Dapat Penghargaan APEA MEDAN (Waspada): Potensi pengusaha Irfan Anwar Usman dalam mengelola perusahaan denganbaikdiSumut,mendapatkan perhatian masyarakat dunia. Betapa tidak dalam pemilihan yang dilakukan di Hotel JW Marriott, baru-baru ini, di Jakarta, pengusaha muda dari Sumut tersebut berhasil mengalahkan pesaingnya yang hadir dalam acara itu telah mendapatkan penghargaan Oustanding Entrepreneurship Award 2011 dari Asia Pasifik Entrepreneurship Award (APEA). Keberhasilan itu tak terlepas kepiawaiannya diberikan kepercayaan untuk mengelola PT. Coffindo dengan sukses. “Saya sangat bersyukur salah satu pengusaha muda yang mendapatkan penghargaan tertinggi dari APEA tersebut,” kata Irfan (foto) didampingi Ketua Himpunan Pengusaha Muda Indonesia (HIPMI) Sumut Firsal Ferial Mutyara kepada wartawan di Medan, Minggu (18/12). Keberhasilan itu tidak terlepas dari dukungan yang diberikan HIPMI kepada pengurus lainnya yang mempunyai potensi dalam mengelola perusa-

haan mengutamakan kebersamaan dan kekompakan dalam memajukan perusahaan tersebut. Sehingga Irfan mempunyai pengalaman itu mendapatkan perhatian dari APEA, berani berkorban melakukan inovasi baru menjadikan PT Coffindo salah satu perusahaan pengelolan kopi yang terbaik di Indonesia. Jadi dengan penghargaan itu, dirinya bertekat akan melakukan terobosan baru kepada pengusaha lainnya dalam membuka peluang wirausaha dan mampu menggerakan perekonomian rakyat. “Prestasi itu

akan dipertahankan,” sebut Irfan yang juga Ketua Bidang Internasional Good Corpored Government HIPMI Sumut ini. Dia berharap kepada pemerintah bisa merangkul pengusaha muda yang banyak tersebar di Sumut. “Jangan takut untuk berwirausaha,” tuturnya. Sementara itu, Ketua HIPMI Sumut Firsal Ferial Mutyara mengatakan, sangat bangga kepada Irfanyangmempunyaibakattelah berhasil mendapatkan penghargaan tersebut. Sehingga mendorong pengusaha lainnya ingin mendapatkan prestasi yang telah diraih Irfan tersebut. Selain Irfan Anwar Usman, APEA juga memberikan penghargaan kepada 22 orang lainnya di antaranya Jusuf Kalla penghargaan Lifetime Archievement Award, Frankie Wijaya dari Sinar Mas penghargaan Enterpreneur Of The Year, Hartati Moerdoyo penghargaanWoman Enterpreneur Of The Year, Ketua HIPMI Rajasapta Octohari penghargaan Young Enterpreneur, dan Ex Vice President Angung Sedayu penghargaan Community Service. (m36)

Warga Penggarap Mohon Perlindungan Ke PP Sumut MEDAN (Waspada): Karena diintimidasi oleh sejumlah aparat keamanan, 10 warga penggarap lahan di Jalan Rawe Raya Lingkungan XIV, Kelurahan Titipapan, Kecamatan Medan Deli, mengadukan nasibnya sekaligus memohon perlindungan hukum ke MPW Pemuda Pancasila (PP) Sumut, Rabu (14/12) sore. Para penggarap didampingi penasihat hukumnya S Sulaikha SH, Zaki Suhairi dan Ir Edo Binsar diterima Pokja Humas MPW Sumut Indra Gunawan SSos. Kata S Sulaikha, kesepuluh penggarap tersebut selama ini mengusahai tanah seluas 16 hektar milik Z Ibnu Kaldun, namun secara tiba-tiba diklaim milik perusahaan swasta. Pengusaha swasta tersebut menyerobot sedikitnya 3,2 hektar tanah sekaligus membangun gudang cangkang kelapa sawit.

Menurutnya, tanah seluas 16 ha tersebut milik Z Ibnu Kaldun, 58, warga Jalan Karya Damai I, Kelurahan Pangkalan Mansyur, Kecamatan Medan Johor, berdasarkan surat grand sultan dan digarap oleh 31 penggarap yang seizin pemilik tanah. Namun, belakangan 3,2 ha dari tanah tersebut diklaim milik pengusaha swasta sekaligus menduduki dan membangun gudang cangkang kelapa sawit. Namun, warga mempertahankan areal garapannya sehingga nyaris bentrok dengan pihak pengusaha dan sejumlah aparat keamanan. Selanjutnya dibuat surat pernyataan bersama antara pihak pemilik tanah dengan perusahaan swasta itu pada 18 Nopember 2011, yang intinya kedua pihak mundur dari lokasi sengketa sampai ada keputusan sah soal kepemilikan tanah dari

Badan Pertanahan Nasional (BPN) Medan. Namun, pihak perusahaan swasta tersebut tetap melakukan aktivitas di areal sengketa. Sementara itu, sorang penggarap mengakui, dirinya dipanggil untuk segera datang ke penyidik Polres KP3 Belawan, Selasa (13/12), namun tidak diketahui dalam kasus apa dan atas laporan siapa. Namun, karena penggarap tersebut didampingi penasihat hukumnya, pemeriksaan tidak dilakukan tanpa alasan yang jelas. Indra Gunawan dan Idrus Junaidi dari Pokja Humas MPW Pemuda Pancasila Sumut yang menerima pengaduan warga penggarap dan pemilik lahan tersebut mengatakan, pihaknya sangat menyayangkan sikap arogansi aparatkeamanandanpengusaha swasta tersebut yang tidak berpihak kepada rakyat kecil. (h04)

Pasien Luka Bakar Pesimis Sembuh MEDAN (Waspada): Pasien di RSU dr Pirngadi Medan (RSUPM) Andreas Janter, 21, warga Tanjung Balai, mengaku putus asa untuk sembuh dari luka bakar yang dideritanya. Pasalnya, selain tidak ada saudara yang datang dan peduli sama kondisinya, dia juga merasa tidak dilayani oleh pihak rumah sakit. “Mungkin karena kondisi saya seperti ini, bau busuk. Saya minta tolong antarkan ke kamar mandi saja, tidak ada yang mau,” sebutnya kepada wartawan di Lantai IV Ruang 8 RSUPM, Kamis (16/12). Dia menuturkan, luka bakar yang dialaminya itu akibat dirinya dituduh mencuri sepedamotor di rumah kos Jalan Harmonika, Kelurahan Selayang II, Kecamatan Medan Selayang, Februari 2011 lalu. “Saya dibakar massa, padahal saya cuma diajak teman, saya tidak tahu mau mencuri karena saya hanya disuruh duduk di sepedamotor saja,” ujarnya. Sebelum dibawa ke RSUPM, dia mendapatkan perawatan di RS Bhayangkara. Di sana anak keempat dari empat bersaudara itu menjalani perawatan selama satu bulan. Namun, luka bakar yang mencapai 70 persen itu tak kunjung sembuh dan mengeluarkan aroma tak sedap. “Saya keluar dari situ dan sempat dirawat di rumah teman. Tapi keluarga dari teman saya itu tidak setuju dengan keberadaan saya, sehingga saya sempat jadi gelandangan,” katanya. Saat dirinya menjadi gelandangan, dia dibawa seseorang ke gereja di Lau Dendang. Jemaat gereja yang iba dengan kondisinya, memberikan makan. Salah seorang jemaat gereja pun membawanya ke RSU Dr Pirngadi Medan untuk mendapat perawatan. “Yang membawa saya perawat di rumah sakit ini. Tapi, setelah antar saya, tidak pernah terlihat lagi,” katanya, namun ketika ditanya nama orangtuanya serta keberadaan saudarasaudaranya, dia enggan menyebutkannya. Sementara itu, Kasubbag Hukum dan Humas RSU Dr Pirngadi Medan Edison Peranginangin menuturkan, pengakuan pasien yang menyatakan dirinya ditelantarkan adalah hak pasien merasa tidak dilayani. “Kalau dia merasa seperti itu, itu haknya. Tapi, kita tidak pernah menelantarkan pasien. Karena rumah sakit wajib merawat pasien. Persoalan biaya itu nanti, yang penting kesembuhannya,” sebutnya. (h02)

Satkom Laskar Merah Putih Bagikan Ratusan Nasi Kotak MEDAN (Waspada): Menyambut Natal 2011 dan Tahun Baru 2012, Satuan Komunikasi (Satkom) Laskar Merah Putih Medan membagi-bagikan nasi kotak kepada para tahanan di empat Polsek jajaran Polresta Medan. “Pemberian nasi kotak kepada para tahanan merupakan wujud berbagi kasih dan mempererat hubungan antara Satkom Laskar Merah Putih Medan dengan pihak kepolisian,” kata Wakadiv Monitoring Satkom Laskar Merah Putih Medan Junaidi kepada Waspada usai menyerahkan nasi kotak kepada tahanan di Mapolsek Medan Baru, Sabtu (17/12) siang. Menurut Junaidi, Satkom Laskar Merah Putih Medan tidak membedakan latar belakang pendidikan, suku, ras dan agama sehingga perbedaan menjadi kekuatan membangun bangsa. Kegiatan ini sudah menjadi program pokok Satkom Laskar Merah Putih Medan. “Tingkatkan rasa kebersamaan dan kasih di antara sesama,” ujar Junaidi seraya mengucapkan terimakasih kepada Kapolsek Medan Baru AKP Dony Alexander, SH, SIK yang menerima kehadiran Satkom Laskar Merah Putih Medan. “Para tahanan di empat Polsek yang menerima nasi kotak yakni Polsek Medan Baru, Polsek Percutseituan, Polsek Medan Area dan Polsek Medan Barat,” jelasnya.(m36)

Waspada/Ismanto Ismail

KAPOLSEK Medan Baru AKP Dony Alexander, SH,SIK menerima nasi kotak secara simbolis dari pihak Satkom Laskar Merah Putih Medan, Sabtu (17/12) siang.

Medan Metropolitan


WASPADA Senin 19 Desember 2011

Pakaian Bekas Tangkapan Lantamal Diperiksa Anjing Pelacak PETUGAS Bea dan Cukai Polonia Medan mengerahkan anjing pelacak memeriksa sekitar 200 bal pres pakaian bekas tangkapan Lantamal I, Jumat (15/12).

Waspada/Rustam Effendi

Jadwal Penerbangan Di Bandara Polonia No. Penerbangan Ke Flight


Tiba Dari

GARUDA INDONESIA 1 Jakarta GA-181 2 Jakarta GA-183 3 Jakarta GA-185 4 Jakarta GA-187 5 Jakarta GA-189 6 Jakarta GA-191 7 Jakarta GA-193 8 Jakarta GA-147 9 Jakarta GA-195 10 Banda Aceh GA-142 11 Banda Aceh GA-14.6

05.30 08.40 10.45 11.55 13.55 15.45 18.35 18.30 19.50 09.40 14.50

Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Banda Aceh Banda Aceh

GA-180 GA-182 GA-184 GA-186 GA-146 GA-188 GA-190 GA-192 GA-196 GA-143 GA-147

07.55 08.55 11.10 13.00 14.05 15.10 17.50 19.05 21.35 12.25 17.45

CITILINK 1 Jakarta 2 Jakarta

09.45 19.00

Jakarta Jakarta

GA-040 GA-044

09.15 18.30

06.15 09.40 08.05 17.55 10.05 18.25 21.20 13.30 15.05 08.40 12.00

Kuala Lumpur Kuala Lumpur Kuala Lumpur Kuala Lumpur Penang Penang Kuala Lumpur Jakarta Bangkok (2,4,6) Bandung Surabaya

QZ-8051 QZ-8055 AK-450 AK-454 QZ-8073 AK-5836 AK-456 QZ-7502 QZ-8085 QZ-7986 QZ-7610

08.40 12.05 07.35 17.30 09.40 18.00 20.55 13.05 20.10 05.45 08.30

Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Penang Penang Jakarta Jakarta Jakarta Jakarta Jakarta Surabay Surabaya Banda Aceh Batam

JT-380 JT-300 JT-394 JT-302 JT-210 JT-200 JT-204 JT-398 JT-382 JT-384 JT-202 JT-212 JT-396 JT- 8289 JT-8287 JT-206 JT-208 JT-388 JT-308 JT-218 JT-971 JT-973 JT-397 JT-970

08.20 09.20 10.20 11.20 11.50 12.20 13.20 14.20 15.20 16.20 17.20 17.50 18.20 11.35 15.00 19.20 20.20 21.55 22.20 23.20 12.16 15.55 07.40 12.15

GA-041 GA-045

AIR ASIA 1 Kuala Lumpur QZ-8050 2 Kuala Lumpur QZ- 8054 3 Kuala Lumpur AK- 451 4 Kuala Lumpur AK-455 5 Penang QZ-8072 6 Penang AK-5937 8 Kuala Lumpur AK-457 9 Jakarta QZ-7503 10 Bangkok (1,4,6) QZ-8084 11 Bandung QZ-7487 12 Surabaya QZ-7611 LION AIR 1 Jakarta 2 Jakarta 3 Jakarta 4 Jakarta 5 Jakarta 6 Jakarta 7 Jakarta 8 Jakarta 9 Jakarta 10 Jakarta 11 Jakarta 12 Jakarta 13 Jakarta 14 Penang 15 Penang 16 Jakarta 17 Jakarta 18 Jakarta 19 Jakarta 20 Jakarta 21 Surabaya 22 Surabaya 23 Banda Aceh 24 Batam

JT- 211 JT- 381 JT- 397 JT- 207 JT- 301 JT- 395 JT- 303 JT- 213 JT-201 JT- 387 JT-399 JT-383 JT-205 JT-8288 JT-8286 JT-385 JT-203 JT-215 JT-309 JT-209 JT-972 JT-972 JT-396 JT 970

06.00 07.00 08.20 09.00 10.00 11.00 12.00 12.30 13.00 14.00 15.00 16.00 16.35 09.10 12.30 17.00 18.00 18.30 20,00 21.00 07.00 12.55 19.00 07.00



MALAYSIA 1 Kuala Lumpur MH-861 2 Kuala Lumpur MH-865

09.05 15.45

Kuala Lumpur MH-860 08.25 Kuala Lumpur MH-864 15.00

SILK AIR 1 Singapura 2 Singapura 3 Singapura (7)

MI-233 MI-237 MI-241

08.40 20.35 21.05

Singapura Singapura Singapura (7)

MI-232 MI-238 MI-242

07.50 19.50 20.00

VALUAIR 1 Singapura (4,7) VF-582 2 Singapura (1,3,6) VF-584

09.35 17.25

Singapura (4.7) VF-581 Singapura (1,3,6) VF-583

09.10 17.50

BATAVIA AIR 1 Jakarta 2 Jakarta 3 Jakarta 4 Batam

Y6-592 Y6-594 Y6-596 7P-568

10.10 16.15 20.00 13.00

Jakarta Jakarta Jakarta Batam

Y6-591 Y6-593 Y6-595 7P-567

09.55 18.30 19.20 11.05

SRIWIJAYA AIR 1 Jakarta 2 Jakarta 3 Batam 4 Pekanbaru 5 Pekanbaru 6 Banda Aceh 7 Penang 8 Padang

SJ-015 SJ-011 SJ-035 SJ-043 SJ-041 SJ-010 SJ-102 SJ-021

13.25 15.00 16.20 10.20 16.00 11.55 07.20 15.25

Jakarta Jakarta Batam Pekanbaru Pekanbaru Banda Aceh Penang Padang

SJ-010 SJ-016 SJ-034 SJ-042 SJ-040 SJ-011 SJ-103 SJ-020

11.20 18.35 15.45 12.50 15.25 13.25 10. 00 14.50

13.15 11.00

Subang Penang

FY-3412 FY-3402

12.56 10.40

SRIWIJAYA AIR 1 Subang FY -3413 2 Penang FY- 34.03

Jadwal Perjalanan Kereta Api No KA

Nama KA




U.2 U.4 U.6 U.8 U.1 U.3 U.5 U.7 U.10 U.12 U.9 U.11 U.14 U.16 U.18 U.13 U.15 U.17 U.22 U.21 PLB 7000 PLB 7007 PLB 7014 PLB 7017 PLB 7002 PLB 7004 PLB 7008 PLB 7010 PLB 7012 PLB 7001 PLB 7006 PLB 7015 PLB 7003 PLB 7005 PLB 7009 PLB 7011 PLB 7013

Sri Bilah Sri Bilah Sri Bilah Sri Bilah Sri Bilah Sri Bilah Sri Bilah Sri Bilah Sri Bilah Sri Bilah Sri Bilah Sri Bilah Putri Deli Putri Deli Putri Deli Putri Deli Putri Deli Putri Deli Siantar Ekspres Siantar Ekspres Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa

Eks/Bisnis Eks/Bisnis Eks/Bisnis Eks/Bisnis Eks/Bisnis Eks/Bisnis Eks/Bisnis Eks/Bisnis Bisnis Bisnis Bisnis Bisnis Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonom Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi

Medan Medan Medan Medan Rantau Prapat Rantau Prapat Rantau Prapat Rantau Prapat Medan Medan Binjai Binjai Medan Medan Medan Tanjung Balai Tanjung Balai Tanjung Balai Medan Siantar Medan Medan Medan Medan Medan Medan Medan Medan Medan Tebing Tinggi Belawan Belawan Binjai Binjai Binjai Binjai Binjai

Rantau Prapat Rantau Prapat Rantau Prapat Rantau Prapat Medan Medan Medan Medan Binjai Binjai Medan Medan Tanjung Balai Tanjung Balai Tanjung Balai Medan Medan Medan Siantar Medan Tebing Tinggi Belawan Belawan Belawan Binjai Binjai Binjai Binjai Binjai Medan Medan Medan Medan Medan Medan Medan Medan

Berangkat Datang 08.00 10.30 15.00 22.50 08.00 14.45 17.10 23.00 04.50 20.15 09.20 21.40 06.50 12.50 17.10 07.15 11.55 19.25 11.25 07.00 18.00 07.30 16.50 12.00 07.30 05.00 09.50 12.15 14.40 06.20 08.40 17.50 08.55 06.30 11.00 13.30 15.50

13.21 15.25 20.28 03.52 13.22 19.59 22.01 04.24 05.42 21.07 10.12 22.32 11.17 17.27 22.15 11.54 16.28 22.47 14.50 10.45 20.04 08.17 17.37 12.47 08.22 05.52 10.42 13.07 15.32 07.21 09.27 18.27 09.47 07.22 11.52 14.22 16.42

Informasi Pemesanan -Stasiun KA Medan (061) 4514114, -Stasiun KA R. Prapat (0624) 21617.

BELAWAN (Waspada): Sebanyak 200 bal pres pakaian bekas atau umum disebut warga “monza” tangkapan petugas Lantamal I, diperiksa menggunakan anjing pelacak milik Bea dan Cukai (BC) Polonia, disaksikan pejabat Lantamal I. Anjing pelacak itu dikerahkan karena sebelumnya petugas curiga didalam karung pakain bekas tersebut dicurigai terselip narkotika dan obat-obat berbahaya (narkoba). Setelah satu persatu karung pakain bekas itu dicium dua anjing pelacak, narkoba dimaksud tidak ditemukan. “Ini salah satu bentuk upaya kita mencegah masuknya narkoba ke Sumut,” kata Kadispen Lantamal I Mayor H Sinuhaji, Jumat (15/12). Usai pemeriksaan, petugas BC Polonia Petrus mengatakan, dua anjing bernama Strom dan Lulu telah lama digunakan untuk

memeriksa barang-barang penumpang pesawat di Bandara Polonia, Medan. “Biasanya kalau ada narkoba anjing ini langsung mencakar bagian barang yang terselip narkoba, tapi dari hasil yang kami periksa tidak ada ditemukan,” sebutnya. Sebelumnya, Danlantamal I Belawan Laksaman Pertama TNI Bambang Soesilo mengatakan, pihaknya mencurigai kalau didalam 200 bal pres pakaian bekas itu ada narkoba. Untuk itu pihaknya meminta pemeriksaan dengan anjing pelacak dilakukan. “Kita dapat informasi dari intelejen di dalam bal ini terselip narkoba,” katanya, saat menggelar penangkapan pakaian bekas asal Port Klang Malaysia itu beberapa hari lalu. (h03)

Pencuri HP Dihajar Massa MEDAN (Waspada): Dua warga Jalan Prof HM Yamin Gang Obat, Kelurahan Sei Kera Hilir I, Kecamatan Medan Perjuangan, dipukuli massa usai mencuri handphone di Jalan

Pendidikan, Kelurahan Indrakasih, Kecamatan Medan Tembung, Minggu (18/12) sekira pukul 14:00. Bersama barang bukti 1 HP dan sepedamotor Yamaha BK

6147 FF, tersangka berinisial PL, 22, dan Fau, 31, dijebloskan ke dalam sel Polsek Percut Seituan, sedangkan korbannya Kristina Sembiring, 71, warga Jalan Pendidikan Kelurahan Indrakasih,

Pemilik Rental Diimbau Lengkapi Standard GPS Di Mobil MEDAN (Waspada): Reskrim Unit Ranmor Polresta Medan mengimbau kepada masyarakat khususnya pemilik mobil untuk melengkapi standardisasi Global Positioning System (GPS) di mobil rental. “Ini dilakukan untuk meminilasir agar kejadian penggelapan mobil rental tidak terjadi kembali khususnya menjelang Natal dan Tahun Baru 2012 yang pesananan semakin meningkat,” kata Kasat Reskrim Polresta Medan AKP MYoris Marzuki melalui Kanit Ranmor AKP RonaldFSipayung,Jumat(16/12). Ronald meminta pengusaha mobil rental agar lebih berhati-hati kepada orang yang

merental seperti orangnya harus jelas, identitasnya, terutama di mobil dilengkapi GPS. Hal itu dilakukan untuk memudahkan apabila terjadi penggelapan. Menurutnya, dalam kasus penggelapan mobil rental dengan tersangka SSH, 40, polisi masih kesulitan mencari barang bukti mobil yang hilang. Begitu juga dengan dua tersangka yang masih diburon. “Kesulitannya dalam mengungkap kasus ini, yakni mobil yang hilang tidak dilengkapi GPS,” sebut Ronald. Dikatakannya, terkait kasus penggelapan mobil dengan no LP STPL/3115/XII/2011/SU/ Resta Medan atas nama Zakaria Silaen, tersangka memberikan

identitas jelas kepada korbannya. Bahkan untuk lebih meyakinkan lagi, tersangka juga melampirkan usaha CV miliknya kepada pengusaha rental. Menurut Ronald, setelah pihaknya meringkus tersangka penggelapan, banyak masyarakat yang menghubungi mengaku menjadi korban penggelapan mobil. “Ada orang yang menelepon, mengatakan menjadi korban hingga lima mobil rentalnya digelapkan, namun sampai saat ini belum membuat LP,” ujarnya sembari mengimbau korban yang mobil rentalnya digelapkan segera mendatangi Polresta Medan membuat laporan polisi. (m39)

Instansi Terkait Diminta Terbuka Soal Sengketa Tanah Bagan Deli BELAWAN (Waspada): Instansi terkait yang terlibat dalam penerbitan surat hak milik (SHM) No 76 tahun 2011 milik GS, diminta untuk terbuka dan menjelaskan alas hak yang menjadi dasar terbitnya surat tersebut. Demikian dikatakan anggota DPRD Kota Medan dari Fraksi PAN HT Bahrumsyah, menanggapi masalah sengketa tanah di Bagan Deli, Jumat (16/12). Bahrum yang merupakan wakil rakyat dari dapem Kecamatan Medan Belawan menjelaskan, sejak dulu warga telah tinggal secara turun temurun di Kelurahan Bagan Deli dan memiliki surat tanah berupa akte camat dan SHM Badan Pertanahan Nasional. “Aku men-

duga ada permainan dalam masalah ini. Apalagi belakangan ini sudah ada intimidasi terhadap warga,” katanya. Dia meminta warga melaporkan masalah itu DPRD Kota Medan, agar pihaknya segera memanggil sejumlah instansi yang terkait dalam hal penerbitan surat SHM milik GS. “Ini sudah tidak benar dan kami akan segera bertindak membela kepentingan warga,” sebutnya. Pertemuan Sementara itu, Camat Medan Belawan Andi Harahap mengatakan, guna mencari penyelesaian masalah sengketa tanah tersebut, Muspika Kec. Medan Belawan, akan mengadakan pertemuan antara warga dan

GS Cs di Balai Pelatihan Kerja (BPL) Pelindo, Selasa (20/12). Sebanyak 30 perwakilan warga akan diundang dalam pertemuan tersebut. “Kita berharap dalam pertemuan itu berhasil. Sehingga permasalahan ini bisa selesai dengan baik,” ujarnya. Sedangkan rencana pertemuan tersebut ditentang Khairuddin alias Kadin, warga Bagan Deli. Menurutnya, pertemuan itu akan sia-sia sebab GS bukanlah orang yang patut didengar keterangannya. “Tanah dia tidak ada di sini, jadi untuk apa dia dihadirkan. Muspika sepertinya tidak terlalu berpihak dan tidak perduli kepada masyarakat,” katanya. (h03)

Anak Bacok Ibu Kandung MEDAN (Waspada): Kerap dituduh mencuri, seorang anak tega membacok ibu kandungnya hingga menderita 12 luka jahitan di kepalanya. Sang anak berinisial ET, 26, warga Jalan Letda Sujono Gang Jawa, Kelurahan Banteng, Kecamatan Medan Tembung, dijebloskan ke dalam sel Polsek Percut Seituan, Minggu (18/12). Informasi yang diperoleh di kepolisian, peristiwa itu terjadi Minggu sekira pukul 08:30, di rumah korban. Saat itu, tersangka ET mengaku kehilangan handphone di rumahnya sendiri. Tersangka sempat menanyakan keberadaan HP miliknya itu kepada keluarga dan ibunya bernama Suna, 54. Namun, keluarga tersangka menjawab tak tau menahu. Tak hanya itu, ibunya itu malah menuding tersangka ET yang kerap mencuri barang-barang di rumahnya. Diduga tak senang dituduh kerap mencuri di rumahnya sendiri, ET marah-marah lalu mengambil parang tumpul dan membacok ibunya berkali-kali. Akibat bacokan tersebut, kepala korban berlumuran darah dan pingsan seketika. Sejumlah tetangga yang mendengar keributan, segera membawa korban ke Rumah Sakit Marthondi. Di rumah sakit tersebut, korban mendapat 12 jahitan akibat luka bacok yang dilakukan anak kandungnya. Petugas Polsek Percut Seituan yang mendapat informasi meringkus tersangka ET. Saat diperiksa petugas, tersangka ET mengaku emosi karena dirinya

dituduh sebagai maling atas hilangnya beberapa barang berharga di rumahnya sendiri. Namun, saat ditanya kenapa membacok ibunya, tersangka ET malah bingung. Diduga, tersangka menderita kelainan jiwa, apalagi disebut-sebut, dia pernah dirawat di rumah sakit jiwa.

Kanit Reskrim Polsek Percut Seituan AKP Faidir Chan menyebutkan, tersangka masih memberikan keterangan yang berbelit-belit dan akan segera menjalani pemeriksaan kejiwaan. “Saat ditanya, jawaban tersangka selalu tak masuk akal dan akan segera menjalani pemeriksaankejiwaan,”sebutnya. (h04)

Waspada/Andi Aria Tirtayasa

TERSANGKA ET dengan tangan diborgol menunggu pemeriksaan di ruang penyidik Polsek Percut Seituan.

Kecamatan Medan Tembung, sudah membuat laporan pengaduan ke Polsek Percut Seituan. Informasi yang diperoleh di kepolisian, Minggu siang kedua tersangka mengendarai sepedamotor Yamaha King BK 6147 FF melintas di Jalan Pendidikan. Saat berada di depan rumah korban Kristina Sembiring, tersangka PL melihat HP berada di atas meja rumah korban. Suasana rumah korban yang sepi dan pintu depannya terbuka membuat tersangka PL turun dari boncengan dan langsung masuk ke dalam rumah. Setelah menyikat HP tersebut, keduanya langsung tancap gas, namun aksinya diketahui tetangga korban. Selanjutnya, Kristina Sembiring ke luar dari dalam kamar dan melihat HPnya telah raib. Korban dan tetangganya itu mencari pelaku dan melihat keduanya berada di pinggir jalan karena sepedamotor nya mogok. Korban mendatangi kedua tersangka yang sedang berusaha memperbaiki mesin sepedamotornya yang mogok. Saat korban menanyakan keberadaan HP nya, tersangka PL malah mengancam akan memukul korban meski sempat memperlihatkan HP hasil curiannya

kepada korban. Begitu melihat HP berada di tangan pelaku, spontan korban menjerit minta tolong, sehingga warga sekitar Jalan Pendidikan berdatangan lalu memukuli kedua pelaku. Setelah diikat dengan tali plastik, kedua pencuri HP tersebut dibo-

yong petugas Reskrim Polsek Percut Seituan. Kanit Reskrim Polsek Percut Seituan AKP Faidir Chaniago menjelaskan, kedua tersangka terpaksa diselamatkan petugas dari amuk warga usai mencuri HP di rumah Kristina Sembiring. (h04)

Waspada/Andi Aria Tirtayasa

TERSANGKA PL dan Fau, digelandang ke Polsek Percut Seituan usai dipukuli massa karena mencuri HP di Jalan Pendidikan, Kecamatan Medan Tembung, Minggu (18/12).

Rp15 Juta Raib Saat Ganti Ban Mobil Kempes MEDAN (Waspada): Tas ransel berisikan uang Rp15 juta dan surat berharga milik Bambang Satria, 33, dilarikan perampok dari mobilnya saat korban mengganti ban belakang kendaraannya yang kempes di Jln. Abdullah Lubis dekat cafe Bakso Gila, Kamis (15/12) malam. Saksi mata kepada Waspada di lapangan mengatakan, korban, warga Jln. M Nawi Harahap Gg Raja Aceh, Kelurahan Binjai, Medan Denai, dengan mengendarai Suzuki APV BK 1934 KW warna hitam datang dari Bandara Polonia menuju ke Jln. Ir H Juanda, namun di perjalanan ban belakang sebelah kiri mobilnya kempes. Kemudian korban mengganti ban mobil yang kempes dengan ban serap. Dia lalu melanjutkan perjalanan hendak kearah Sunggal. Ketika melintasi Jln. Abdullah Lubis, ban mobilnya yang baru diganti kembali kempes. Korban selanjutnya memakirkan kendaraannya di pinggir jalan dekat cafe Bakso Gila. Karena di lokasi tidak ada penambal ban, dia minta bantuan pengemudi betor membawa ban serapnya untuk ditempelkan. Tidak berapa lama menunggu, pengemudi betor datang

membawa ban mobilnya yang sudah ditempel. Korban kemudian turun dari mobilnya mengganti ban yang kempes. Ketika sedang mengganti ban mobilnya, tiba-tiba korban mendengar suara teriakan rampok dari warga dan melihat seorang pria mengendarai sepedamotor melaju kencang. Korban langsung memeriksa ke dalam mobilnya, ternyata tas ransel warna hitam merek Okley berisikan laptop merek Dell M1330, hardick Tonibhe 500 GB, polis asuransi ACA, surat emas, surat gadaian emas Bank Syariah Mandiri, paspor atas nama Ivan Juliarti Sitepu, modem BCA, Token Mandiri, dan uang Rp15 juta telah hilang. Selanjutnya korban membuat pengaduan ke Polsek Medan Baru. Kapolsek Medan Baru AKP Dony Alexander, SH,SIK ketika dikonfirmasi membenarkan kejadian tersebut. “Korban sedang diambil keterangannya dan sejumlah saksi lainnya. Sedangkan, pelaku masih dalam buronan,” katanya. Selesai menjalanipemeriksaan,korbanBambangmengatakan,ketikabantublesmobilyangkempesdiperiksa ternyata tertancap paku warna perak. (m36)

Penjual Anak Dibawah Umur Terancam 15 Tahun Penjara MEDAN (Waspada) : Terdakwa Vivi yang menyediakan wanita dibawah umur sebagai pekerja seks komersial (PSK) terancam hukuman 15 tahun penjara, setelah didakwa Jaksa Penuntut Umum (JPU) Pasal 2 atau Pasal 10 UU RI No 21/2007 tentang tindak pindana perdagangan orang, dalam persidangan di Pengadilan Negeri Medan, Selasa (13/12). Terdakwa ditangkap pada 13 September 2011, di Hotel Emerald Garden. Setelah melakukan transaksi dengan polisi yang menyamar sebagai pria hidung belang. Setelah menyepakati harga satu wanita untuk short time sebesar Rp2 juta, mereka pun bertemu di hotel tersebut. “Saya memboking sendiri kamarnya dengan menggunakan identitas saya. Saat berkomunikasi, saya memesan dua orang cewek dengan harga Rp4 juta,” kata Putra Agung, petugas kepolisian yang menyaru sebagai pria hidung belang, dalam keterangannya di persidangan. Agung menjelaskan, saat berkomunikasi melalui email dan hp, terdakwa menunjukkan foto cewek peliharaannya. Namun tidak jelas, maka bertemu langsung. Sempat terjadi nego harga, tapi tidak kurang. Setelah berkomunikasi dan ada kesepakatan, Vivi langsung menemui Putra Agung di Hotel Emerald Garden kamar 414. “Dia (Vivi) datang jam delapan malam lansung ke kamar. Jam delapan lewat baru datang Dea, 18, (cewek bokingan) ke hotel tersebut. Seharusnya adaVanesa. Namun, dia tidak jadi datang,” sebut Agung. Begitu Dea datang, uang Rp2 juta langsung diserahkan ke Vivi. Terdakwa menyerahkan uang tersebut ke Dea di dalam kamar mandi.

Tidak tahu persis berapa uang yang diserahkan kepada Dea. “Saya hanya melihat uang itu diserahkan ke Dea di dalam kamar mandi karena pintunya terbuka. Berapa jumlahnya, tidak tahu,” ujar Agung lagi. Begitu uang diserahkan, terdakwa langsung keluar kamar dan diikuti Firman, petugas kepolisian lainnya yang juga berada di kamar tersebut. Tidak lama kemudian Vivi diamankan oleh petugas Poldasu. “Begitu keluar langsung ditangkap. Dea masih dikamar mandi. Dea juga dibawa ke Polda untuk diperiksa. Begitu selesai pemeriksaan langsung dipulangkan. Tidak ada saya cicipi dia Pak,” tuturnya. Sementara itu, saksi lainnya Erwin Syahputra selaku receptionis Hotel Emerald Garden mengaku tidak banyak tahu tentang perkara itu. Dia mengakui, baru kenal dengan terdakwa di persidangan tersebut. Erwin mengaku, tidak tahu ada keributan di kamar 414 ataupun ada penggerebekan. Begitu juga siapa ditangkap. “Saya hanya tahu kamar itu dipesan atas nama Putra Agung dan dia datang sendiri. Apa yang dilakukan di dalam kamar tidak tahu. Semua orang bisa check in. Adanya kejadian saya tahu setelah keesokan harinya dari teman,” sebutnya. Jaksa Penuntut Umum Sani Sianturi mengatakan, terdakwa dikenakan Pasal 2 atau Pasal 10 UU RI No 21/2007 tentang tindak pindana perdagangan orang dengan ancaman pidana paling singkat tiga tahun dan paling lama 15 tahun. Selain itu dikenakan denda paling sedikit Rp120 juta dan paling banyak Rp600 juta. “Dikenakan Pasal 2 atau 10. Ancaman hukumannya sama,” katanya. (m38)

Sumatera Utara B5 2 Tewas, 7 Luka Bakar Kadinkes Simalungun WASPADA

Senin 19 Desember 2011

Keluar Daerah Tanpa Izin

Dicopot Mendadak SIMALUNGUN (Waspada): Bupati Simalungun, JR Saragih, mencopot secara mendadak Kepala Dinas Kesehatan, dr Saberina Tarigan, Sabtu (17/ 12). Sementara, dr Antonius Purba diunjuk sebagai Plt (pelaksana tugas) kadis hingga ditetapkannya kepala dinas kesehatan baru. Pencopotan jabatan Kepala Dinas dari dr Saberina Tarigan sesaat setelah Bupati Simalungun JR Saragih mengadakan inspeksi mendadak di Rumah Sakit Umum (RSU) Raya, karena saat dipanggil atau dihubungi melalui telepon, Saberina berada di Medan tanpa izin. Seyogianya, setiap pejabat eselon II harus tinggal di ibukota kabupaten di Pamatang Raya dan apabila hendak keluar daerah harus terlebih dahulu mendapat izin dari bupati. JR Saragih mengatakan, sangat kecewa dengan kinerja Kepala Dinas Kesehatan Pemkab Simalungun yang tidak mengindahkan instruksinya dan tidak optimal mendukung program pelayanan prima kesehatan kepada masyarakat. “Ini

(pencopotan kadis kesehatan) merupakan konsekuensi atas kinerja yang bersangkutan dan saya nilai tidak mampu mendukung program pemerintah dalam memberikan pelayanan prima di bidang kesehatan kepada masyarakat,” kata Saragih. Sebelumnya, bupati telah menekankan kepada para kepala Puskesmas, Kepala RSUD dan Kepala Dinas Kesehatan agar pelayanan prima di bidang kesehatan dilakukan dengan penuh tanggungjawab dan tidak boleh masyarakat kecewa, serta tidak boleh meninggalkan tempat tugas tanpa izin atasan, sehingga bagi PNS yang mengabaikannya harus siap menerima sanksi tegas. Kepala Badan Kepegawain Daerah, Resman Saragih yang dikonfirmasi mengatakan, pengganti Saberina Tarigan untuk sementara ditunjuk Antonius Purba sebagai pelaksana tugas (Plt) Kepala Dinas. (a29)

Pasutri Terdakwa Penipuan Rp411 Juta Divonis Bebas GUNUNGSITOLI (Waspada): Pasangan suamiistri terdakwa perkara penipuan terhadap korban Alm Alexander Yampo Dachi sebesar Rp411 juta, divonis bebas oleh Majelis Hakim Pengadilan Negeri Gunungsitoli. Menurut majelis hakim kedua terdakwa dibebaskan, karena kasus yang disangkakan tidak termasuk kasus tindak pidana melainkan kasus perdata. Akibat pustusan ini keluarga korban merasa kecewa dan mohon keadilan ditegakkan. Vonis bebas terhadap kedua terdakwa perkara pidana nomor 164/Pid.B/2011/PN-GS atas nama Denisman Bulolo alias Ama Vivin bersama istrinya, Simalai Sarumaha alias Ina Vivin diputuskan oleh Ketua Majelis Hakim, Jahoras Siringo-ringo, SH didampingi Hakim anggota Bangun Sagita Rambey, SH dan Obaja David J.H Sitorus, SH di Pengadilan Negeri Gunungsitoli, Kamis (15/12). Putusan dijatuhkan majelis hakim Pengadilan Negeri Gunungsitoli terhadap kedua terdakwa berbanding terbalik dengan tuntutan yang diberikan oleh Jaksa Penuntut Umum, Rozama Nazara, SH sebelumnya. Denisman Buulolo sebelumnya dituntut oleh Jaksa enam bulan penjara sedangkan istrinya Simalai Sarumaha

dituntut lima bulan penjara dengan 1 tahun percobaan. Mayasari Dachi anak korban Alm. Alexander Yampo Dachi kepada Waspada, Jumat (16/12) di kediamannya di Jln. Diponegoro, Kelurahan Ilir, Kecamatan Gunungsitoli, mengaku sangat kecewa dengan putusan bebas yang diberikan oleh Majelis Hakim Pengadilan Negeri Gunungsitoli terhadap kedua terdakwa. Menurut Mayasari, putusan terhadap kedua terdakwa tidak mengedepankan rasa keadilan karena tidak mempertimbangkan bukti-bukti serta keterangan saksi selama persidangan. Menyikapi putusan tersebut keluarga korban melalui JPU akan melakukan banding ke tingkat kasasi terhadap putusan bebas yang diberikan Majelis Hakim Pengadilan Negri Gunungsitoli kepada kedua terdakwa. Selain itu, Mayasari juga mengungkapkan dia bersama keluarga akan membuat laporan kepada KomisiYudisial terkait Majelis Hakim PN Gunungsitoli yang memberikan putusan bebas terhadap kedua terdakwa pelaku penipuan terhadap orangtuanya. (a25)

PENERIMA Beasiswa ASKES – KORPRI, Hardi Tri Prastyo Bukit foto bersama dengan Kacab PT Askes Kabanjahe, Asral Aziz M.Kes. Kabupaten Karo. Untuk mencapai visi tersebut, katanya, Askes membuat misi: memberikan kepastian jaminan pemeliharaan kesehatan kepada peserta melalui sistem pengelolaan efektif dan efisien, mengoptimalkan pengelolaan dana dan pengembangan sistem untuk memberikan pelayanan prima secara berkelanjutan kepada peserta. Selain itu, mengembangkan pegawai mencapai kinerja optimal dan menjadi salah satu keunggulan bersaing utama perusahaan; dan membangun kordinasi dan kemitraan yang erat dengan seluruh stakeholder untuk bersama menciptakan pelayanan kesehatan berkualitas. Sosialiasi tersebut dibuka resmi Bupati Karo melalui Asisten II Pemkab Karo Drs Simon Sembiring, dihadiri para kepala SKPD, para Camat dan para dokter Kepala Puskesmas se Kabupaten Karo. (c09)

Nasyid Simalungun Diharap Terbaik SIMALUNGUN (Waspada): Bupati Simalungun, JR Saragih, mengharapkan kontingen Nasyid putra dan putri mampu meraih prestasi, bahkan diharap menjadi yang terbaik, di ajang Festival Nasyid tingkat Propinsi Sumatera Uatara digelar di Kota Binjai, 17 sampai 23 Desember 2011. Harapan itu dikemukakan bupati melalui Kepala Badan Kesatuan Bangsa, Politik dan Perlindungan Masyarakat (Kesbangpol dan Linmas) Kabupaten Simalungun, H. Jadiaman Purba saat pemberangkatan kontingen Nasyid putra-putri utusan Kabupaten Simalungun di eks rumah dinas bupati Jalan Perintis Kemerdekaan Pematangsiantar, Sabtu (17/12). Bupati mengharapakan kepada peserta group nasyid yang akan mengikuti perlombaan agar tetap menjaga kekompakan, disiplin dan mengikuti segala ketentuanselamamengikutifestivalterutamamenjaga nama baik pemerintah dan masyarakat Kabupaten Simalungun. “Dalam pertandingan ada yang menang dan ada yang kalah. Akan tetapi tetaplah berusaha semaksimal mungkin, mudah-mudahan menjadi yangterbaikpadafestivalseninasyidnantinya.Jadikan

Informasi dihimpun Waspada, Minggu (18/12), akibat menubruk mobil barang sedang berhenti, pengendara sepedamotor, Putra Surya Wiguna, 21, warga Dusun Emplasmen Dolok Merangir, Kecamatan Dolok Batunanggar, Kabupaten Simalungun, tewas dengan kondisi mengenaskan. Peristiwa tragis ini terjadi Sabtu kemarin sekira pukul 22:50 di jalan umum km17-18 Pematangsiantar-Medan, Desa Batu Silangit, Kecamatan Tapian Dolok. Saat itu korban dengan se-

pedamotor Honda Mega Pro BK 6229 TAK menghantam bagian belakang mobil barang BK 8376 DK yang terparkir karena mengalami kerusakan. Kapolres Simalungun AKBP M. Agus Fajar H, S.Ik saat dikonfirmasi melalui Kasubbag Humas AKP H. Panggabean, SH, Kasat Lantas AKP Baginda Sitohang dan Kanit Laka Ipda Alsem Sinaga, Minggu (18/12) menyebutkan kecelakaan lalulintas yang mengakibatkan korban jiwa itu masih dalam penyelidikan dan pengemudi mobil barang

masih dalam pencarian. Tersengat Listrik Sedangkan akibat kurang hati-hati saat mendirikan tiang listrik terbuat dari besi, satu tewas dan enam luka bakar tersengat arus listrik tegangan tinggi dari kabel PLN. Korban adalah buruh dan mandor lapangan pemborong PT Hariara. Korban tewas, Teguh, 23, buruh PT Hariara, warga Batangkuis, Kabupaten Deliserdang, korban luka bakar terdiri Suprayetno, 31, mandor lapangan PT Hariara, warga Tembung, Kabupaten Deliserdang, Arun, 27, buruh PT Hariara, warga Batangkuis, Deliserdang. Kemudian,Yahya, 21, buruh PT Hariara, warga Padang Bulan, Kota Medan, Iwan, 32, buruh PT Hariara, warga Batang Kuis, Deliserdang, Iwan, 32, bu-

ruh PT hariara, warga Batangkuis, Deliserdang, Fernandus, 23, buruh PT Hariara, warga Jalan Seksama, Medan dan Bangun Hutagalung,22,buruhPTHariara, warga Padang Bulan, Medan. Kapolres Simalungun AKBP M. Agus Fajar H, S.Ik saat dikonfirmasi melalui Kasubbag Humas AKP H. Panggabean, SH, Kasat Reskrim AKP M. Adenan AS, SH, S.Ik, MH dan Kapolsek Bosar maligas AKP Bustami, SH, Minggu (18/12) menyebutkan korban tewas dan luka bakar akibat tersengat arus listrik itu masih dalam penyelidikan. 2 Rumah Hangus Dua unit rumah milik korban Birensius Marbun, 58, wiraswasta dan Hartati Sibuea, 45, wiraswasta, keduanya warga Dusun I, Desa Parbutaran, Kecamatan Bosar Maligas, Kabu-

paten Simalungun hangus terbakar. Akibat musibah yang terjadi Sabtu sekira pukul 17:15 ini, satu orang mengalami luka bakar, Toto Marbun, 18, pelajar, putra Birensius Marbun. Kapolres Simalungun AKBP M. Agus Fajar H, S.Ik saat dikonfirmasi Minggu (18/12) menyebutkan, asal api dan penyebab kebakaran serta kerugian yang dialami korban masih dalam penyelidikan. Dugaan sementara, api berasal dari korsleting listrik di play station milik Birensius Marbun dan kerugian ditaksir Rp800 juta, sedang barang bukti yang disita terdiri satu potong kayu terbakar, satu shock sepeda motor yang hangus terbakar dan satu tabung televisi yang hangus terbakar sebagai bahan penyelidikan. (a30)

Menjelang Tutup Tahun

Bupati Karo Serahkan Beasiswa KABANJAHE (Waspada): Bupati Karo diwakili Asisten II Drs Simon Sembiring didampingi Kepala Cabang PT Askes (Pesero) Kabanjahe Asral Aziz M, Kes, menyerahkan bantuan beasiswa dari Askes – KORPRI peduli pendidikan, dalam rangkaian acara sosialisasi program Jamkesmas bagi perangkat desa di aula lantai III Kantor Bupati Karo. Menurut Kepala Cabang Askes Kabanjahe Asral Aziz M.Kes kepada wartawan, Jumat (16/ 12) di kantornya, beasiswa tersebut diberikan khusus kepada anak anggota KORPRI. Untuk tahun ini beasiswa diberikan kepada Hardi Tri Prastyo Bukit, siswa kelas III jurusan otomotif SMK Negeri 1 Merdeka Kabupaten Karo, senilai Rp3 juta, anak dari Basita Bukit, pegawai Bakesbang, Pol dan Linmas Kabupaten Karo. Bupati Karo diwakili Asisten II Drs Simon mengatakan, untuk tahun ini bantuan pendidikan kepada anak anggota KORPRI Kabupaten Karo, baru terealisasi untuk satu orang dari sekitar 7.000 anggota KORPRI di Kabupaten Karo. Dia berharap tahun depan bantuan tersebut semakin bertambah. Diharapkan kepada siswa penerima bantuan pendidikan dan orangtuanya dapat memanfaatkan bantuan tersebut sesuai peruntukannya, guna menunjang dan meningkatkan prestasi belajar anak anggota KORPRI. Simon Sembiring juga menyampaikan keprihatinannya terhadap perilaku siswa/i yang kerap menghabiskan waktunya di warnet dan tempattempat permainan yang dapat merusak perilaku dan mental anak usia sekolah. Perilaku anak di usia sekolah tersebut, katanya, perlu mendapat perhatian dan pengawasan para guru, terutama para orangtua agar tidak terjerumus ke dalam perbuatan dan perilaku melanggar hukum. Dalam pada itu Bupati Karo juga menyerahkan bantuan program kemitraan diterima Yuni Nuraini senilai Rp25 juta, Aswin Kacaribu Rp25 juta dan Netral Ginting Rp20 juta, yang diberikan Asisten II Pemkab Karo Drs Budiman Sembiring, M.Si bersama Kepala Cabang Askes Kabanjahe Asral Aziz MKes. Pada acara sosialisasi itu, Kepala Cabang Askes Kabanjahe mengatakan, visi PT Askes (Persero) menjadi spesialis dan pusat unggulan Asuransi Kesehatan di Indonesia, akan terwujud di

PEMATANGSIANTAR (Waspada): Dua orang tewas dan tujuh lainnya luka bakar dalam peristiwa tabrakan dan kebakaran di Pematangsiantar. Kejadian ini masih dalam penyelidikan pihak kepolisian.

festival pada tingkat provinsi tersebut sebagai sarana untuk menggali ilmu dan pengalaman,” harap bupati, sembari menekankan kepada para official dan pelatih untuk tetap membimbing dan membina peserta sehingga mereka tampil maksimal. Dalam peberangkatan duta Kabupaten Simalungun tersebut, Kepala Kesbangpol dan Linmas didampingi Ketua Lembaga Pembinaan Pengembangan Seni Nasyid (LPPSN) Kabupaten Simalungun Fai’i Nasir dan ketua pelaksnana festival seni nasyid Kabupaten Simalungun, Nasaruddin Lubis. MenurutNasaruddinLubis,dutagroupnasyid dari Kabupaten Simalungun untuk mengikuti festival seni nasyid di tingkat Prov. Sumatera Utara adalah juara I putra dan putri pada pelaksanaan festival seni nasyid yang dilaksanakan Pemerintah Kabupaten Simalungun pada 8 sampai 10 Desember 2011. Dalam mengikuti festival tingkat provinsi ini semua peserta diberikan pakaian seragam dari Pemkab Simalungun dan akomodasi. (a29)


KONTINGEN Nasyid putra-putri Kabupaten Simalungun foto bersama dengan Kaban Kesbangpol dan Linmas H Jadiaman Purba sesaat sebelum berangakat menuju kota Binjai.

Sejumlah Proyek Di T.Karo Dikerjakan Asal Jadi BERASTAGI ( Waspada): Menjelang tutup tahun 2011, para rekanan sibuk merampungkan proyek yang sedang ditanganinya. Namun, dari sejumlah proyek yang ada di Kabupaten Karo, ada pula di antara rekanan yang mengerjakannya asal jadi seperti yang terpantau pada proyek pembangunan satu unit Poskesdes di Desa Gung Pinto Kecamatan Naman Teran. Informasi dihimpun Waspada, Minggu (18/12). proyek yang dilaksanakan CV. MRT dengan nilai Rp224.550.000, seyogianya selesai Selasa (13/ 12). Namun hingga Sabtu kemarin pekerjaaannya masih belum rampung dan terkesan dikebut meskipun banyak ditemui kejanggalan. Pengamatan wartawan pada kondisi bangunan masih terlihat pada lantai keramik yang belum dikunci dengan semen. Begitu pula pemasangan asbes di langit-langit bangunan masih terlihat belum rapi. Yang mengejutkan, lantai yang ada dalam ruangan bangunan, beda ketinggianya dengan bangunan lantai yang berada di bagian belakang bangunan. Selain itu, kosen dan daun pintu yang telah dipasang, diduga terbuat dari bahan kayu sembarang ringan yang mudah dimakanrayapdanbagiandaunpintu dan kosen sudah mulai retak. Ketua Lembaga Swadaya,

Eckaronologi Resources Intitute Ery Tarigan yang melintas di desa itu, mengungkapkan rasa herannya melihat bangunan ini. “Sangat mengherankan pembangunan di desa, karena jarak yang jauh dari ibukota kabupaten, kelihatannya para rekanan hanya memoles bangunan agar terlihat indah, sedangkan kualitas jelek,” kata Tarigan. Anehnya lagi, kata Tarigan, bangunan ini diduga tidak selesai tepat waktu, begitu pula dengan plank proyek sengaja disembunyikan di dalam gedung agar masyarakat tidak mengetahui, dan di sini tidak ada keterbukaan kepada masyarakat yang ingin mendapatkan informasi. Beberapa hal yang patut diperhatikan aparat hukum, selain belum ada sambungan listrik, beberapa titik di bangunan terlihat ada yang sudah retak. Diduga Menyalahi Perpres Proyek peningkatan jalan jurusan Desa Ndeskati – Desa Gung Pinto, Kecamatan Naman Teran (tahap I) (DAK-TP) nomor kontrak 620/49/BMPPK/ DAK dan DAU Wil-III/2011dengan kontraktor, CV.B G, bernilai Rp333.106.000, juga belum rampung dikerjakan, begitu pula pada proyek pembangunan jembatan jurusan Desa Ndeskati – Desa Gung Pinto yang menelan anggaran Rp598.200. 000, rekanan CV.SS. Kedua perusahaan yang


PROYEK peningkatan jalan Desa Gung Pinto- Ndeskati belum selesai walaupuan sudah jatuh tempo. Seperti diabadikan Sabtu (17/12), masih terlihat tumpukan batu kali yang belum terpasang. Pengerjaan yang “ngebut” di penghujung tahun anggaran dikhawatirkan mempengaruhi kualitas pekerjaan. dipercayakan pihak PUD Karo ini diduga telah menyalahi Perpres No.54/2011 tentang pengadaan barang/jasa, karena hingga tanggal kontrak sesuai dengan plank yang seharusnya selesai 13 Desember 2011, namun hingga kini pekerjaan belum juga rampung. Pantauan wartawan, Sabtu (17/12) para pekerjaan peningkatan jalan dan jembatan masih beraktifitas dengan memasang batu yang masih setengah pekerjaan ditabur pasir gunung sebagai pengikat. Sedangkan

sekira 200 meter baru sebatas pengantaran yang dilakukan dua mobildieselyangmengantarbatu. Sedangkan pembangunan jembatan yang tidak jauh dari jalan yang sedang dibangun, yang terlihat hanya bangunan fondasi di kedua sisi. Besi sebagai tulang jembatan sebahagian besar jumlahnya masih berada di sekitar desa, sedangkan aktifitas tukang masih terus menyambung besi hingga malam hari. Pada bagian jalan di sisi jembatan yang mengarah ke Desa Ndeskati, profil jalanya

terkesan berbahaya untuk dilewati karena belum diperlebar Diperhitungkan terlalu sempit sehinggauntukmobilukurankecil saja diperkirakan tidak bisa lewat. Direktur CV.BG yang juga pelaksana CV.SS. O. Sitepu yang dihubungi wartawan melalui telepon selulernya, Sabtu (17/12) mengakui,pekerjaannyamengalami keterlambatan karena ada kesalahandalamprogramsehingga telat menyelesaikan proyek. “Namunkarenapekerjaaninitelah dilaksanakan,harusdiselesaikan,” kata Sitepu. (a36)

Ketua PKK P.Siantar Kesal, Ada Warga Rusak Pohon P E M ATA N G S I A N TA R (Waspada): Ketua Tim Penggerak PKK Kota Pematangsiantar menyatakan kegiatan menanam pohon merupakan hal mudah, tapi akan menjadi sulit jika tidak didukung seluruh lapisan masyarakat. “Kenyataannya, masih ada masyarakat yang belum sadar akan pentingnya pohon dan dengan sengaja merusak pohon yang sudah ditanam,” sesal Ketua Tim Penggerak PKK Pematangsiantar Ny. Rusmiati Romana Hulman Sitorus saat pelaksanaan Gerakan Perempuan Tanam dan Pelihara Pohon (GPTP) dengan melakukan penanaman pohon di Kelurahan Sigulanggulng, Kecamatan Siantar Utara, Jumat (16/12) seperti dikutip Kabag Humas dan Protokoler Pemko Drs. Daniel H Siregar, Minggu (18/12). Kegiatan penanaman pohon itu turut dihadiri mewakili Muspida, Asisten III Leonardo

Warga Buru Gerombolan Monyet PAKPAK BHARAT (Waspada): Takut perladangan semakin hancur, puluhan warga yang berladang di kawasan Sindeka, Napatolong sekitarnya berburu hama monyet yang dirasakan semakin meresahkan. Pantauan wartawan di lapangan, Minggu (18/12), terlihat warga memburu gerombolan monyetdidugasengajadilepaskan salahsatubadankonservasisatwa dari Pemprovsu. “Hewan-hewan ini telah menghancurkan pertanian kami. Apapunyangkamitanamhancur total karena ulahnya. Untuk itu kami terpaksa berburu di siang hari saat hama monyet itu memasuki kawasan perladangan kami,” ungkap R. Banurea yang berladang di kawasan Sindeka. Hal itu juga diakui Sama Boangmanalu. Menurutnya, hama monyet tersebut mau tidak mau harus disingkirkan dari kawasan pertanian mereka sebelum seluruh tanaman mereka dirusak hingga habis. Lebih parah, kebun nenas milik K. Padang yang selama ini telah mampumenghidupikeluarganya dirusak gerombolan hama monyet. (csb)

Simanjuntak, SH, MHum, Kepala Badan Lingkungan Hidup (BLH) Drs. Jekson Hasan Gultom dan SKPD lainnya. Siregar menyebut, bibit pohon ditanam itu merupakan sumbangan dari PT Sucopindo, sedang lokasi penanaman bibit pohon itu di sekitar Jalan Pendidikan dan Jalan Bah Biak. Sesudah bibit pohon ditanam, selanjutnya dibuat pagar pelindung agar dapat tumbuh dengan baik dan tidak mengalami gangguan.

Selanjutnya , Ny Rusmiati mengharapkan agar hal seperti itu tidak terjadi lagi. “Kedekatan perempuan dengan lingkungan sekitar, semestinya membuat perempuan lebih peka dan arif dalam menjaga lingkungan,” katanya. Kepala BLH menyebutkan tentang keberadaan instansinya yang tetap secara serius melakukan kegiatan penanaman pohon. “Ini sesuai program kegiatan penanaman pohon 1 milyar,” katanya lagi.

Dalam melakukan penanaman pohon itu, Gultom menyebutkan, Pemko melalui BLH bekerjasama dengan dunia usaha, LSM, sekolah, insan pers, SKPD, BUMN, BUMD dan berbagai elemen lainnya melakukan penanaman pohon secara berkesinambungan. “Setiap Jumat dilakukan kegiatan gotong royong dan penanaman pohon di setiap kelurahan.” Gultom menambahkan, pada 2011, BLH menerima berbagai jenis bibit pohon seperti

palem, tanjung, kayu manis, glodokan tiang, mahoni dan lainnya berjumlah 44.335 batang, sedangkan pohon ditanam Wali Kota Hulman Sitorus, SE dan jajaran Pemko bekerjasama dengan pihak lain mencapai 27.910 batang. “Kita saat ini masih memiliki berbagai jenis pohon yang siap tanam. Bagi masyarakat dan elemen lain yang ingin melakukan penanaman pohon dapat berkoordinasi dengan BLH,” ujar Gultom. (a30)

Sumatera Utara


Warga Minta Oprit Jembatan Disiapkan


Pemimpin Umum Dr. Hj. Rayati Syafrin Pemimpin Redaksi/Penanggung Jawab H. Prabudi Said Wakil Pemimpin Umum/Wapemred H. Teruna Jasa Said Wakil Penanggung Jawab H. Sofyan Harahap Redaktur Senior H. Azwir Thahir

TANJUNGTIRAM (Waspada) Warga nelayan Dusun I,VI Desa Bagandalam, Kec.Tanjung tiram Batubara minta pembangunan jembatan menghubungkan kedua dusun diselesaikan. Kenyataan, sampai Minggu (18/12), bangunan oprit di pangkal jembatan, lantai sudah siap, tetapi bangunan oprit di ujung jembatan belum dikerjakan, dan belum diisi tanah timbun. “Mungkin pemborong khawatir bila di isi tanah, dinding turap akan merekah ambruk karena sudah retak-retak dan dipasang penyokong, “kata Nahruddin Kadus I Bagandalam,Minggu (18/12). Menurut Nahruddin, nasib jembatan komposit dibangun dana APBD BatubaraTA 2009 dan 2011 sebesar Rp 812 juta ditambah Rp400 juta lebih, masih diragukan penyelesaiannya. Hal ini disebabkan awal pembangunan tak selesai karena ditinggalkan pemborongnya, bangunan abudmen miring, oprit retak-retak, lantai belum dipasang. Pekerjaan tahap kedua, pemborongnya harus hati-hati jangan sampai menimbulkan kerusak an lebih besar. “Abudmen, lantai sudah diperbaiki, tinggal oprit di ujung jembatan belum ber isi tanah, dinding turap terancam merekah. Warga terpaksa meniti diatas turap” ujarnya, seraya mengharapkan jembatan yang sudah dua tahun ditunggu warga itu jangan mengecewakan lagi. (a12)

Pemimpin Perusahaan: Dr. Hj. Rayati Syafrin. Wakil Pemimpin Perusahaan: H. Bahtiar Tanjung. Iklan: Hj. Hilda Mulina (Kabag), Rumondang Siagian (Medan), Lulu (Jakarta). Redaktur Pelaksana Berita: Armin Rahmansyah Nasution. Redaktur Pelaksana Opini & Artikel: Dedi Sahputra. Redaktur Minggu & Akhir Pekan: Muhammad Thariq. Redaktur Berita: H. Halim Hasan, Hendra DS. Redaktur Medan: David Swayana. Redaktur Sumatera Utara: H.T. Dony Paridi. Redaktur Aceh: M. Zeini Zen. Redaktur Luar Negeri: H. Muhammad Joni. Redaktur Nusantara: Edward Thahir. Redaktur Olahraga: Jonny Ramadhan Silalahi. Redaktur Ekonomi: Armin R. Nasution. Redaktur Agama: H. Syarifuddin Elhayat. Litbang: H. Akmal AZ (Kabag). Humas: H. Erwan Effendi (Kabag), Aidi Yursal. Sekretaris Redaksi: Hj. Hartati Zein. Pemasaran: H. Subagio PN (Medan), Zultamser (Sumatera Utara), Sinur Manik (Aceh). Asisten Redaktur: Irwandi Harahap (Medan); Irham Hagabean Nasution (Sumatera Utara); Armansyah Thahir (Sumatera Utara, Otomotif); Diurna Wantana (Aceh); Austin Antariksa (Olahraga, KMS Kreasi); Syafriwani Harahap (Luar Negeri, Popular, Pariwisata); Rudi Faliskan (Berita); Erwin Siregar (Opini); Hj. Hoyriah Siregar (Ekonomi); T. Junaidi (Hiburan); Hj. Erma Sujianti Tarigan (Agama), Hj. Neneng Khairiah Zen (KMS Remaja, Mode); Anum Purba (Keluarga); David Swayana (Infotainmen); Hj. Ayu Kesumaningtyas (Kesehatan); Dedi Riono (Budaya); Denny Adil (Pelangi). Wartawan Kota Medan: Umum: Zulkifli Harahap, Amir Syarifuddin, Ismanto Ismail, Rudi Arman, Zulkifli Darwis, H. Abdullah Dadeh, H. Suyono, Ayu Kesumaningtyas, Feirizal Purba, Gito AP, M. Ferdinan Sembiring, M. Edison Ginting, Anum Purba, Sahrizal, Sulaiman Hamzah, Sugiarto, Rustam Effendi, Mursal Alfa Iswara, Andi Aria Tirtayasa, Maini Anggita, Silfa Humaira. Olahraga: Austin E. Antariksa, H. Syahputra MS, Setia Budi Siregar, Dedi Riono. Fotografer: Muhammad Faisal, Hang Tuah Jasa Said, Surya Effendi, Hamdani. Otomotif: Armansyah Thahir. Koran Masuk Sekolah/KMS: Dedek Juliadi, Hajrul Azhari Ritonga. Wartawan Jakarta: Andi Yanto Aritonang (Koordinator Liputan), Hermanto, H. Ramadhan Usman, Hasriwal AS, Nurhilal, Edi Supardi Emon, Agus Sumariyadi, Dian Warastuti, Aji K, Yuslan Kisra. Wartawan Sumatera Utara: Binjai: H. Riswan Rika, Nazelian Tanjung. Deli Serdang: H.M. Husni Siregar, Hotma Darwis Pasaribu, Rizaldi Anwar, M. Suhandi Nasution. Serdang Bedagai: Eddi Gultom, Edi Sahputra. Stabat: H. Ibnu Kasir, Abdul Hakim. Pangkalan Brandan: Chairil Rusli, Asri Rais. Kabanjahe/ Berastagi: Dickson Pelawi, Basita Bukit, Dedek Mohan Basri Hasibuan, Micky Maliki. Tebing Tinggi: Muhammad Idris, Abdul Khalik. Pematang Siantar: Mulia Siregar, Edoard Sinaga. Simalungun: Ali Bey, Hasuna Damanik, Balas Sirait. Aek Kanopan: Indra Muheri Simatupang, Syahril Ilham. Rantau Prapat: H. Nazran Nazier, Armansyah Abdi, Neirul Nizam, Budi Surya Hasibuan. Kota Pinang: Hasanuddin Harahap, Deni Syafrizal Daulay. Pangururan: Edison Samosir. Balige: Jimmy Sitinjak. Sidikalang: Natar Manalu. Pakpak Bharat: Arlius Tumanggor. Tarutung: Parlindungan Hutasoit, Marolop Panggabean. Sibolga/Tapanuli Tengah: Zulfan Nasution, Alam Satriwal Tanjung. Padangsidimpuan: H. Syarifuddin Nasution, Sukri Falah Harahap, Ahmad Cerem Meha. Gunung Tua: Sori Parlah Harahap. Sibuhuan: Idaham Butarbutar, Syarif Ali Usman. Panyabungan: Munir Lubis, Sarmin Harahap, Alpin Lubis. Gunung Sitoli: Bothaniman Jaya Telaumbanua. Kisaran: Nurkarim Nehe (Koordinator Liputan Asahan, Batubara & Tanjungbalai), Bustami Chie Pit, Sapriadi. Batubara: Helmy Hasibuan, Agus Diansyah Hasibuan, Sahril, Iwan Hasibuan. Tanjung Balai: Rahmad Fansur Siregar, Rasudin Sihotang. Wartawan Aceh: Banda Aceh: Aldin Nainggolan (Ka Perwakilan), Iskandarsyah (Koordinator Liputan), Muhammad Zairin, Munawardi Ismail, Zafrullah, T. Mansursyah, T. Ardiansyah, Jaka Rasyid, Gito Rollies. Lhokseumawe: Bustami Saleh (Ka Perwakilan/Koordinator Liputan), M. Jakfar Ahmad, Zainal Abidin, Zainuddin Abdullah, Maimun, Arafat Nur. Kuala Simpang: Muhammad Hanafiah, Hasanul Hidayat. Langsa: H. Syahrul Karim, H. Ibnu Sa’dan, H. Samsuar. Lhoksukon: Musyawir, Mustafa Kamal. Idi: Muhammad H. Ishak. Bireuen: HAR Djuli, Amiruddin, Abdul Mukti Hasan. Takengen: Bahtiar Gayo, Irwandi. Sigli: Muhammad Riza, H. Rusli Ismail. Sabang: T. Zakaria Al-Bahri. Subulussalam: Khairul Boang Manalu. Tapaktuan: Zamzamy Surya. Blangpidie: Sudarmansyah Putra. Kutacane: Mahadi Pinem, Ali Amran. Blangkejeren: Bustanuddin, Wintoni. Bener Meriah: Khairul Akhyar, Irham Hakim. Singkil: Tarmizi Ripan, Mansurdin. Sinabang: Muhammad Rapyan.

� Semua wartawan Waspada dilengkapi dengan kartu pers. Tidak dibenarkan menerima uang dalam bentuk apapun. Jangan layani dan segera laporkan ke pihak berwajib atau ke Sekretaris Redaksi bila ada oknum yang mengaku wartawan Waspada tetapi tidak bisa menunjukkan kartu pers yang sah, ditandatangani Pemimpin Redaksi �

Hubungi kami Penerbit: PT Penerbitan Harian Waspada Komisaris Utama: Tribuana Said Direktur Utama: dr. Hj. Rayati Syafrin, MBA, MM SIUPP: 065/SK/MENPEN/SIUPP/A.7/198 tanggal 25 Februari 1988 Anggota SPS No. 13/1947/02/A/2002 KANTOR PUSAT Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 4150858, Faks Redaksi: (061) 4510025, Faks Tata Usaha: (061) 4531010. E-mail Redaksi: KANTOR PERWAKILAN DAN BIRO � Perwakilan dan Biro Jakarta: Jalan Siaga II No. 6 C Pejaten Barat, Pasar Minggu Jakarta Selatan. Tel: (021) 79197052, Faks: (021) 79199874. � Perwakilan dan Biro Banda Aceh: Jalan Ratu Syafiatuddin No. 21 C, Banda Aceh. Tel & Faks: (0651) 22385. � Perwakilan dan Biro Lhokseumawe: Jalan Iskandar Muda No. 65, Lhokseumawe. Tel: (0645) 42109. � Biro Asahan, Batubara & Tanjungbalai: Jalan Sutami No. 30 Kisaran. Tel: (0623) 41412. Harga iklan per mm kolom: Hitam-putih Rp. 11.000,-, berwarna Rp. 30.000,Halaman depan: hitam-putih Rp. 33.000,-, berwarna Rp. 90.000,Ukuran kolom: 40,5 mm. E-mail Iklan: Pencetak: PT Prakarsa Abadi Press, Jalan Sidorukun Medan. Isi di luar tanggung jawab percetakan

PT AKAS Aspal Jalinsum Cikampak Saat Hujan Deras TORGAMBA (Waspada): Kualitas pengaspalan di beberapa bagian Jalan Lintas Sumatera (Jalinsum) di Dusun Cikampak, Desa Aek Batu, Kec. Torgamba, Kab. Labuhanbatu Selatan (Labusel) dikhawatirkan tidak bertahan lama. Pasalnya, pihak rekanan yakni PT. Anugerah Karya Agra Sentosa (PT. AKAS) melakukan pengaspalan saat hujan deras yang terjadi, Jumat (16/12) malam. Berdasarkan pengamatan Waspada di lokasi proyek yang dibiayai APBN 2011 senilai Rp27,103 miliar itu, pihak rekanan mulai melakukan pengaspalan mulai pukul 20:00. Semula kondisi cuaca terlihat cerah, namun sekira pukul 22:30, hujan deras mengguyur kawasan tersebut, namun bukannya menghentikan pekerjaan, pihak rekanan justru melanjutkan penghamparan aspal dalam guyuran hujan, sehingga suhu dan kualitas aspal tidak memenuhi standar. Salah seorang pekerja yang ditemui mengaku, mereka hanya menjalankan perintah atasan. Menurut pekerja yang tak mau menyebutkan nama tersebut, penghamparan tetap dilakukan meski dalam guyuran hujan karena aspal sudah terlanjur didatangkan. Pihak PT. AKAS, Erik yang dikonfirmasi mengenai hal itu tidak bersedia memberikan keterangan. Erik beralasan hal itu bukan kewenangannya. “Maaf Pak, kalau masalah itu tanya GS dan konsultannya, bukan wewenang saya,” katanya. Salah seorang aktifis Garuda Labusel, Erwin Alaina Tanjung yang juga menyaksikan peristiwa itu mengatakan, mereka menemukan berbagai kejanggalan di antaranya tidak adanya pengaman bagi pengguna jalan di lokasi pekerjaan, pekerja proyek tidak dilengkapi peralatan standar Kesehatan dan Keselamatan Kerja (K-3). (c18)

WASPADA Senin 19 Desember 2011

Waspada/Helmy Has

OPRIT jembatan komposit di Desa Bagandalam Tanjungtiram belum di isi tanah timbun, diragukan dinding turap merekah.

Masyarakat Batubara Kecam HUT Bernuansa Kemewahan LIMAPULUH(Waspada): Peringatan HUT yang Ke-5 Kab. Batubara di Lapangan Dolok Estate Limapuluh bernuansa kemewahan mendapat kecaman keras dari sejumlah kalangan di Batubara. Di tengah kondisi rakyat yang kesulitan dan keuangan Pemkab yang hilang Rp80 miliar, mengapa masih juga menghambur – hamburkan uang. Demikian dikatakan Ketua Dewan Penasehat Ormas Obaja Mr. C Jabi El Manik kepada Waspada, Sabtu (17/12) usai melihat lokasi perayaan HUT yang menggunakan bangunan layaknya tenda besar, beralaskan karpet merah dan disetiap sudutnya dipasangi AC portable. Didalamnya diisi puluhan stand yang ditempati seluruh Satuan Kerja Perangkat Daerah (SKPD)

Pemkab Batubara, menampilkan foto – foto dan pernak – pernik kegiatan lainnya. “Jika kita melihat kemewahan ini, hati kita sangat tersentuh dengan kondisi kemiskinan yang ada di tengah – tengah rakyat Batubara. Apalagi jika mengingat tragedi penggusuran pedagang di Pantai Perjuangan Medang Deras yang pondok – pondoknya dirubuhkan paksa

karena dinilai merusak pemandangan, sedang mereka berjualan hanya sekedar mencari hidup”. “Saya tidak tahu kemana arah slogan Sejahtra Berjaya Pemkab Batubara itu, apa yang ingin ditunjukkan dengan kemewahan ini,” kata Manik. Hal yang sama juga disampaikan Unit Masyarakat Pemantau Anggaran (Ummar) Kab. Batubara Sahuri, yang menyatakan di dalam APBD 2011 Pemkab Batubara telah menganggarkan biaya HUT yang ke-5 ini sebesar Rp 600 juta. “Herannya kita mengenai anggaran, tidak jelasnya skala prioritas anggaran untuk kepentingan rakyat. Dalam P –APBD 2011 ini, kita ketahui sejumlah kegiatan dibatalkan atau di-

kurangi, tapi mengapa malah kegiatan yang minim manfaat ini dipertahankan,” sesalnya. Sementara itu Ketua Komisi A DPRD Batubara Al As’ari kepada Waspada mengatakan, gaya mewah seperti ini adalah gambaran yang mencolok dari gaya hidup hedonisme, luapan kegembiraan. Dengan bertambahnya usia kabupaten ini seharusnya dijadikan sebagai sarana evaluasi sekaligus introspeksi diri. “Bukankah kita sudah lakukan zikir, doa pun sudah dilantunkan. Idealnya kesemua itu menjadi energi baru yang menggerakkan kita untuk lebih mendekatkan diri kepada Allah dan melandasi seluruh aktivitas kita semata – mata karena Allah,” pinta As’ari. (c05)

Toke Pisang Tewas Di Tangan Dukun INDRAPURA(Waspada): Bermaksud mencari solusi untuk dapatkan keturunan, Junanten Manurung, 31, warga Dusun XIII Desa Laut Tador Pekan, Kec. Sei Suka, Kab. BatuBara diketahui tewas mengenaskan. Tewasnya Junanten diduga akibat metode pengobatan dengan cara penganiayaan oleh seorang yang mengaku orang pintar alias dukun, boru M, tiga minggu yang lalu, tepatnya 28 November. Menurut keterangan kakak kandung korban yang tinggal serumah dengan korban, Lince Br Manurung, 35, didampingi keluarga lainnya saat dikunjungi wartawan, Jum’at (16/12), sebelum korban tewas malam itu Lince melihat adiknya itu dalam keadaan sehat segar bugar sekira pukul 23.00 pergi menuju rumah Santun Manalu. Satu jam kemudian adiknya itu pulang kerumah dan membangunkan istrinya yang sudah tidur, untuk diajak pergi berobat ke rumah Santun Manalu, karena menurut korban di rumah Santun ada orang pintar alias dukun datang dari Medan, berinisial Boru M diperkirakan berumur 23 tahun yang katanya mampu mengobati segala penyakit. Korban pun kembali ke rumah Santun bersama istrinya Farida br Penjaitan, karena menurut Lince sudah dua tahun adiknya itu menikah belum dikaruniai keturunan. Namun,

sekira pukul 02.00 dini hari itu, korban yang sehari – harinya berjualan pisang itu belum juga pulang ke rumah. Kemudian, Lince pergi ke rumah Santun untuk melihat adiknya itu, akan tetapi sesampainya di kediaman rumah Santun, Lince melihat korban dalam keadaan tak pakai baju hanya memakai celana ponggol dalam posisi terlentang dipeganggi enam orang laki – laki, yang tiga diantaranya ia kenali. Lebih lanjut Lince mengatakan, dirinya saat berada di rumah Santun mendengar suara

adiknya itu meminta tolong sambil mengatakan: “aku sudah tak tahan lagi, kalau nanti aku kalian lepaskan, kalian semua aku adukan sama polisi, karena kalian sudah nyiksa aku” dalam bahasa Batak. Karena diusir, Lince pun pulang kerumahnya, dan sekira pukul 03.30 jenazah adiknya diantarkan oleh beberapa orang laki -laki yang tak sempat dikenalnya dan korban diletakkan di lantai teras rumahnya dan ditinggalkan begitu saja. Kepala Dusun XIII Desa Laut Tador Pekan, Marudut Silalahi yang ditemui dikediaman-

nya membenarkan ada warganya yang meninggal saat itu atas nama Junanten Manurung. Mengenai kematian korban diduga dianiaya, menurut Marudut dirinya tidak mengetahuinya. Kapolsek Indrapura AKP.MA Ritonga kepada Waspada, Minggu (18/12) mengatakan hingga saat ini keluarga korban belum ada yang mengadukan tewasnya Junanten Manurung. Meski demikian dia akan mengerahkan anggota untuk mencari tahu kebenaran cerita ini. (c05)

Pembangunan Ekonomi Jangan Merusak Sosbud Bangsa RNTAUPRAPAT (Waspada): Saat membacakan Pidato Ketua Umum Darma Wanita Persatuan, Nila F Moeloek, Ketua Dharma Wanita Persatuan Kab. Labuhanbatu Ny Hj Fitra Laila SpTHT menyatakan, pembangunan ekonomi jangan merusak tatanan sosial budaya suatu bangsa. Ny Hj Fitra Laila TP Siregar SpTHT membacakan itu pada Peringatan Hari Ulang Tahun Dhama Wanita Persatuan Ke12 Tahun 2011 di Pendopo Rantauprapat, Jumat (16/12). Ditambahkan, tanggungjawab sosial perusahaan (Co-

operate Social Responsibility) dapat dikerjakan bersama Dharma Wanita Persatuan (DWP) guna memberikan nilai positif bagi masyarakat dan nilai produktif bagi perusahaan. Sementara itu Bupati L.Batu dr H Tigor Panusunan Siregar SpPD dalam sambutan tertulisnya yang dibacakan Asisten Administrasi Umum Ahmad Muflih SH mengatakan, DWP sebagai kitra kerja pemerintah harus ikut berkiprah dan mengambil peran dalam pembangunan, mau membangun dan mengembangkan kemitraan dan menjalin komunikasi

dengan seluruh elemen masyarakat. “Memiliki SDM yang berkualitas merupakan tujuan kita dan ini hanya dapat dibentuk melalui pembangunan ketahanan keluarga,” kata Bupati. Ketua Panpel HUT ke-12 DWP L.Batu Ny Hj Khairani Ali Usman dalam laporannya menjelaskan, berbagai kegiatan telah dilaksanakan dalam rangka HUT ke-12 DWP di L.Batu seperti penanaman pohon di lapangan Ika Bina, Stadion Bina Raga, Taman Makam Pahlawan dan Panti Werda Rantauprapat. (a18)

Alur Sungai Itu, Kini Dipenuhi Eceng Gondok Biasanya, jernih tidaknya air sungai dapat dilihat dari daratan. Namun, pada Sungai Aek Kelubi Desa Padang Genting Kec. Talawi, Kab. Batubara, kondisi airnya tidak dapat diketahui karena permukaan sungai dipenuhi atau tertutup tanaman eceng gondok (Eichomia Crassipes). Padahal bila ditelusuri, sungai ini pernah dibersihkan melalui proyek normalisasi diperkirakan pada 2008/2009. Sedangkan sumber anggarannya berbeda versi. Ada mengatakan bantuan

Waspada/Iwan Has

ALUR Sungai Aek Kelubi Desa Padang Genting, Kec Talawi, Kab Batubara yang pernah dibersihkan melalui proyek normalisasi, kondisinya kini dipenuhi eceng gondok.

pribadi dari Pejabat Bupati dan ada pula mengatakan Bantuan Daerah Bawahan (BDB) Provsu nilainya tidak diketahui. Sehingga, Fraksi PPP DPRD Batubara melalui Ketuanya Ahmad Badri angkat bicara untuk menelusuri sumber pendanaan proyek karena berkeyakinan hal itu tidak mungkin bersumber bantuan pribadi jika melihat dari luas dan median sungai dibersihkan. Tujuannya, tidak lain sebagai mengantisipasi banjir yang kerap terjadi melanda desa terutama pada musim penghujan. Namun, keberadaan proyek kesannya tidak bermanfaat dan desa tetap menjadi bulanan banjir. Salah satu faktor, disebabkan riol/parit sampai alur sungai di sekitarnya tidak berfungsi secara maksimal. Sebagian mengalami tumpat akibat sampah atau tanah yang membuat air tidak mengalir secara leluasa ke laut dan bertahan mengenangi daratan desa, terkadang berhari-hari bahkan seminggu lamanya. Sehingga aktivitas warga menjadi terganggu. Pembenahan riol atau parit tumpat/rusak salah satu menjadi agenda program kerja Pemkab Batubara sebagaimana mengutip keterangan Bupati H OK Arya Zulkarnain, SH,MM, ke depan master plan pembangunan lebih mengarah dari Labuhan Ruku, Kec Talawi-Tanjungtiram. ‘’Mudah-mudahan saja Desa Padang Genting termasuk di dalam agenda master plan pembangunan pembenahan parit/ riol sampai sungai yang tumpat,’ ‘tutur Khaidir, Ismail dan Tatan, warga desa. Seperti banjir baru ini 5 dusun terendam.Selain pemukiman penduduk juga areal tanaman Palawija dan kebun sampai sarana pendidikan sehingga sekolah PAUD diliburkan karena tergenang banjir. Iwan Has

Pameran Gebyar Hari Jadi Batubara LIMAPULUH (Waspada): Pameran Gebyar Hari Jadi Batubara ke 5 Tahun 2011 diikuti 50 stand meliputi dari Satuan Kerja Perangkat Daerah (SKPD), kecamatan dan perusahaan di lapangan Perkebunan PT Lonsum Dolok Estate, Kec Lima Puluh, di buka oleh Bupati Batubara H OK Arya Zulkarnain, SH, MM, Sabtu (17/12). Bupati Batubara dalam pidatonya yang disampaikan Asisten III, Sekdakab H Azrai, SH menyatakan patut disyukuri bersama atas hasil yang dicapai daerah selama lima tahun, sejak pemekaran dari Asahan 8 Desember 2006.Sedangkan program yang belum terlaksana diharapkan dapat berjalan dan terwujud pada tahun berikutnya. Kadisbudparpora selaku Ketua Panitia Pelaksana, H Helman SH M AP melaporkan pameran berlangsung sampai 23 Desember 2011.Peserta menampilkan produk dari institusinya mulai hasil kerajinan dan kain tenun (songket) Batubara. Dinas Pendidikan, buku-buku ilmu pengetahuan dan hasil karya para ilmuwan. Sedangkan dinas lain jenis tanaman pertanian dan produk perkebunan sampai hasil laut dan obyek wisata di Batubara.(a13)

Pengangguran Tertangkap Tulis Judi Martabe TANJUNGBALAI (Waspada): Seorang lelaki pengangguran tertangkap tangan menulis angka-angka judi Martabe di sebuah warung di Kel. Pulaosimardan, Rabu (14/12) sekira pukul 21:00. Tersangka berinisial BS, 41, warga Jalan Binjai, Kel. Semulajadi, Kec.DatukbandarTimur,ditangkapberdasarkankeresahanmasyarakat atas aktibitas perjudian di daerah itu. Petugas lalu menggiring tersangka ke Mapolsek Datukbandar. Dari tangan BS petugas mengamankan barang bukti uang tunai Rp178 ribu, 4 block notes terdiri dari 2 block notes berisi nomor togel dan 2 block notes kosong, satu unit telepon genggam merek Nokia, dan sebatang pulpen. Kapolres Tanjungbalai AKBP EP Sirait melalui Kasubbag Humas AKP Y Sinulingga didampingi Kapolsek Datukbandar AKP H Sihite membenarkan. Dikatakan, penangkapan itu dipimpin langsung Kanit Reskrim Polsek Aiptu S Sirait. Dikatakan, tersangka dijerat pasal 303 KUH Pidana dengan ancaman 5 Tahun penjara. (a32)

Anjani Dapat Bantuan Kaki Palsu RANTAUPRAPAT (Waspada): Pelajar dan mahasiswa Kabupaten Labuhanbatu yang tergabung dalam Gerakan Peduli Sosial (GPS) memberikan sebuah kaki palsu kepada siswi kelas1 SLTP Negeri 3 Rantau Utara Tri Anjani Zubaidah, 13, yang mengalami cacat pada kaki kanan akibat kecelakaan lalu lintas tahun 2000 silam. Koordinator GPS Dedi Anwar pohan mengatakan, kaki palsu yang diberikan kepada gadis remaja yang sering disapa Anjani itu merupakan bantuan dari donatur dan sumbangan dari warga Labuhanbatu. “Kami berhasil mengumpulkan uang sumbangan Rp11 juta, kemudian uang tersebut dibelikan kaki palsu dan kita berikan kepada Anjani, ujar Dedi kepada Waspada, Sabtu (17/12). Dedi menambahkan, berbagai upaya telah mereka lakukan selama satu bulan terakhir untuk mendapatkan kaki palsu, diantaranya dengan berulangkali menggelar aksi pengumpulan dana di jalan, mengamen ke sekolah dan tempat lainnya. “Ternyata upaya yang dilakukan tidak sia-sia, ini semua berkat kerja keras seluruh teman-teman yang tergabung dalam GPS,” ujarnya. Sementara Anjani yang menerima bantuan kaki palsu mengungkapkan rasa terima kasih kepada seluruh pihak yang telah meringankan beban hidupnya, dengan adanya kaki palsu dirinya kini dapat berjalan layaknya manusia normal lainnya. “Kalau selama ini saya berjalan mengengklek, tapi sekarang karena kaki palsu ini saya bisa berjalan normal seperti teman-teman lainnya,” ujar Anjani kepada Waspada, Sabtu (17/12). “Saya sangat terharu dengan bantuan yang diberikan oleh GPS berupa kaki palsu kepada Anjani, dan saya berharap agar Anjani lebih giat lagi belajar,” ujar H Isma Padli A Pulungan, anggota DPRD Provinsi Sumut ketika memberikan bantuan kepada Anjani.(c07)

Kodim 0209/LB Serahkan Beasiswa RANTAUPRAPAT (Waspada): Kodim 0209 Labuhanbatu menyerahkan beasiswa kepada sejumlah putra-putri personil Kodim yang berprestasi mulai tingkat SD, SLTP dan SLTA yang diserahkan di lapangan Makodim 0209 L. Batu pada upacara Peringatan Hari Juang Kartika 2011, Kamis (15/12). Selain itu, Pemkab L. Batu Utara juga menyerahkan bantuan 1 unit Ambulans yang diserahkan oleh Asisten Pemerintahan mewakili Bupati Labura. Pada kesempatan itu Bupati L. Batu Dr H Tigor Panusunan Siregar SpPD juga memberikan sumbangan uang kepada siswa-siswi berprestasi itu. Dalam amanatnya, Kepala Staf Angkatan Darat Jenderal TNI Pramono Edhi Wibowo yang dibacakan Dandim 0209 Letkol Inf Abdi Iman Sakti Zebua mengatakan, bahwa tema pada HUT tahun ini yaitu: “Dengan Dijiwai Sapta Marga dan Sumpah Prajurit, TNI Angkatan Darat Bersama Segenap Komponen Bangsa, Siap Menjaga Integritas dan Eksistensi NKRI”. Hadir pada kesempatan itu para Kepala SKPD, para perwira, tamtama dan bintara Kodim 0209 Labuhanbatu, personil Kompi 126/KC, pengurus Persit Kartika, personil Polres, Satpol PP dan Pramuka.(a18)

Waspada/Armansyah Abdi

DANDIM 0209 Labuhanbatu Letkol Inf Abdi Iman Sakti Zebua ketika memeriksa pasukan pada upacara Peringatan Hari Juang Kartika di Lapangan Makodim, Kamis (15/12).

Sumatera Utara

WASPADA Senin 19 Desember 2011


PTPN IV Dan PT Palmaris Saling Serobot Lahan PANYABUNGAN (Waspada): Peninjauan langsung lapangan dipimpin Wakil Bupati Madina, Dahlan Hasan Nasution pada 16 – 17 Desember 2011 di Kec. Batahan, Kab. Mandailing Natal (Madina), menemukan banyak kejanggalan terkait masalah perkebunan. Diantaranya, masalah izin lokasiperkebunanyangtumpang tindih antara PTPN IV dengan PT. Palmaris, maupun antara kedua perusahaan tersebut dengan lahanmasyarakat, baik itudi Desa Sari Kenanga, Batahan I,II, dan III, serta desa lainnya. Data sementara dihimpun dari berbagai sumber, di TSM Batahan III ada areal perkebunan masyarakat transmigrasi seluas 900 Ha. Namun, sejak PT. Palmaris Raya yang dulunya bernama PT. Suprapremoris beroperasi tahun 2000 – 2008, telah berhasil membuka lahan itu lebih kurang 170,75Ha,danlahankliringseluas lebih kurang 44 Ha. Karena penggarapan lahan

terus berlangsung sampai sekarang tidak terbendung, diperkirakan lahan yang masyarakat yang tersisahanyaberkisarlebihkurang 80–100Hasaja.Halsamajugaterjadi di TSM Bukit Langit Batahan memiliki TSM seluas 798, 24 Ha. Namunlahanitudidugatelah di serobot PTPN IV seluas lebih kurang 560 Ha, dan PT. Palmaris seluas lebih kurang 200 Ha. Masyarakat sudah berulang kali mengadakan “perlawanan” namun tetap saja investor melenggang kangkung, dan masyarakat terkungkungmenjerittidakberdaya. Itu semua terjadi karena Pemkab Madina dan legislatif, bahkan mungkin Muspida“dibutakan” kepentingan pengusaha

kaya dan berkuasa. Itu masih gambaran kecil perkebunan di kawasan Pantai Barat Madina yang masalahnya sudah kompleks akibat keteledoran atapun keegoisan para pemegang kebijakan dari daerah hingga pusat ketika itu. Bahkan, tragedi di Desa Suka Makmur, Kec. Muara Batang Gadis15Desember2011lalu,menjadi gambaran bahwa masyarakat mengadakanperlawanansebagai aksi penolakan “penjajahan” di tanah kelahiran mereka, demi menyambung hidup keluarga. Aksi anarkis masyarakat itu seharusnya menjadi cemeti yang mampu mengetuk pintu nurani pihak eksekutif dan legislatif serta yudikatif,supayabersuaralantang dan keras membela kepentingan rakyat yang benar-benar rakyat. Untukitulah,WabupMadina, Dahlan Hasan Nasution turun langsung“mencuci piring kotor” ke lapangan untuk menyahuti dan mencari solusi atas aspirasi

masyarakat sebelum bergolak, dalam rangka implementasi visi dan misi Bupati danWakil Bupati Madina Periode 2011 – 2016, HM. Hidayat Batubara – H. Dahlan Hasan Nasution. Langkahsaatiniyangdiambil Pemda Madina dalam menyelesaikan permasalahan antara masyarakat dengan perusahan di Kec. Batahan tidak jauh berbeda dengan yang di lakukan di Kec. Natal baru-baru ini, yakni dengan cara membentuk tim perivikasi di pimpin camat guna menginventarisir persoalan lahan antara masyarakat dengan investor di tempuhdenganlangkah-langkah yakni, megumpulkan alat bukti berupa alas hak lahan (surat). Selanjutnya bukti fisik tanaman,dankesaksiansaksidibawah sumpah kitab suci. Dan juga memeriksa kebenaran dokumendokumen perusahaan sebagai legalitassahatauresminyasebuah perusahaan beroperasi. Saat peninjaun lapangan di

wilayahSituakKecil,Kec.Batahan yang dihadiri PTPN IV dan PT. Palmarissertamasyarakatpemilik lahan, Dahlan dengan tegas memerintahkan pihak perusahaan terkait dan juga masyarakat, supaya jangan ada yang mengerjakan lahan di lokasi bermasalah. Kemudian, pada 27 Desember 2011 mendatang diadakan pertemuan lintas sektor di Pemkab Madina, mulai dari perwakilan masyarakat, muspika, muspida. PTPN IV, PT. Palmaris, BPN Madina dan BPN Provinsi, serta Dinas Transmigrasi Sumut. “Itu agenda penting dalam waktu dekat untuk mencari solusi persoalan, supaya tidak ada penjajahan di daerah yang merdeka. Karena itu semua komponen terkait harus jujur untuk membuka benang merah persoalan yang dilemmatis ini. Kita tidak akan membiarkan masyarakat ditindas oleh siapaun itu,” ucap Dahlan Hasan yang dikenal tegas itu. (c14)

Soal Dugaan Penyelewengan Anggaran

Penegak Hukum Diminta Serius Sikapi Tuntutan Aksi PMII Palas


DIREKTUR Utama PT. Bank Sumut, H. Gus Irawan Pasaribu menyantuni 50 anak yatim pada acara peresmian Kantor Cabang (Kancab) Bank Sumut Gunungtua, Kamis (15/12) di Pasar Gunungtua, Padanglawas Utara.

KCP Bank Sumut Gunungtua Jadi Kancab GUNUNGTUA (Waspada): Direktur Utama PT. Bank Sumut, H. Gus Irawan Pasaribu meresmikan Kantor Cabang (Kancab) Bank Sumut Gunungtua, Kamis (15/12) di Pasar Gunungtua, Padanglawas Utara. Sebelumnya, ini adalah Kantor Cabang Pembantu (KCP) Bank Sumut. Sebagai tanda syukur, Bank Sumut menyantuni 50 anak yatim. Ketua DPRD Padang Lawas Utara, Muhlis Harahap melakukan pengguntingan pita. Selain dihadiri Ketua DPRD Padanglawas Utara Muchlis Harahap, juga tampak Danki Rajawali 123 Gunungtua Infanteri Usman, Staf Ahli Bagian Hukum, Abdul Madjid Siregar, Kadis Peternakan, Mara Bangun Harahap, Kadis Pertanian Aminusin, Ketua MUI Paluta, H.Kosim, Camat Padang Bolak Tunggul Harahap, Camat Simangambat Busryo Lakum, beserta para undangan. Pemimpin Cabang Gunung Tua, Toguan Siregar dan Wakil Pemimpin Imron Basir Daulay. Kantor Cabang Gunung Tua membawahi (2) cabang pembantu, yakni KCP Sibuhuan dan KCP Sosa. Dengan peningkatan status ini, secara total kantor cabang Bank SUMUT menjadi 185. “Kantor Cabang Gunung Tua telah terkoneksi secara online dan real time. Kami mengajak masyarakat bersama-sama menjadi nasabahdiBankSumutdenganmemanfaatkanfasiltasyangdisediakan seoptimal mungkin,” ungkapnya. Gus Irawan Pasaribu, mengucapkan syukur, dengan kerja keras, kedisipilinanyangtinggi,semangatkerjayangprofesionaldanketulusan dalam memberikan pelayanan terbaik Bank Sumut melakukan lompatan besar. Dengan mengukir prestasi demi prestasi dan mensejajarkan diri dengan perbankan nasional. Muchlis berharap, diresmikannya Bank Sumut Cabang Gunungtua dapat terjalin kerjasama yang baik terhadap Pemerintah Kabupaten Padanglawas Utara untuk membangun daerah baru mekar ini. “Cita-cita Bank Sumut sejalan dengan Pemkab Paluta untuk memberikan kemudahan dalam penyaluran dana pengembangan UMKM,” katanya. (a35)

SIBUHUAN (Waspada): Aparatpenegakhukumdimintaserius menyikapi tuntutan aksi PergerakanMahasiswaIslamIndonesia (PMII) Pengurus Cabang (PC) KabupatenPadangLawas(Palas), terkait sejumlah dugaan penyelewengan pengelolaan anggaran di lingkungan Pemerintah Kabupaten Padang Lawas. Demikian Mardan Hanafi Hasibuan, Ketua Gerakan Mahasiswa, Pelajar Peduli Padang Lawas, Jumat (16/12), menanggapi berita aksi massa PMII Padang Lawas belum lama ini. Dikatakan, sepanjang kepemimpinan Bupati H. Basyrah Lubis, SH danWakil Bupati H Ali Sutan Harahap, Ketua DPRD

HM. Rido Harahap bersama Sekda Drs. Gusnar Hasibuan dinilai gagal, bahkan sampai saat ini masih jauh dari harapan masyarakat Padang Lawas. Sebagaimana disampaikan Koordintor Aksi PMII, bahwa proses tender proyek TA 2011 disinyalir tidak sesuai ketentuan Perpres No 54 tahun 2010 tentang pengadaan barang dan jasa, baik di Dinas PUD, Kehutanan Perkebunan, Pertanian, Pendidikan serta dinas Perikanan dan Peternakan. Selain penggunaan anggaran perjalanan dinas DPRD Palas TA 2011,jugadugaanpenyimpangan dana bantuan sosial di Dinsos Palas sekira Rp5 miliar untuk

Kelompok BKB Nelayan Pancuran Bambu Terbaik I Tingkat Sumut SIBOLGA (Waspada): Kelompok Bina Keluarga Balita (BKB) Nelayan Kelurahan Pancuran Bambu, Kec. Sibolga Sambas terbaik I tingkat Sumut dan sebagai duta Sumut menerima penghargaan dalam rangka peringatan Hari Ibu ke 83 tingkat Nasional di Jakarta. Hal itu dikatakan Lurah Pancuran Bambu Dicky Syahputra Lubis, SS didampingi koordinator PLKB Kec. Sibolga Sambas, Ida Rosdiana Sihotang, Penyuluh Lapangan Keluarga Berencana (PLKB) Kelurahan Pancuran Bambu, Alam Satriwal Tanjung, S.Sos, saat akan memberangkatkan Ummi Kalsum menuju Medan, Sabtu (17/12).

Sesuai surat BKKBN Provsu nomor 2625/PD-300/J-4/2011 tertanggal 14 Desember 2011 yang ditujukan kepadaWali Kota Sibolga, bahwa tim penilai dari provinsi telah melakukan penilaian terhadap kelompok BKB percontohan terbaik tingkat Kabupaten/Kota se-Sumatera Utara pada Oktober lalu. “Darihasiltimpenilaiprovinsi telahmenetapkankelompokBKB percontohan terbaik tingkat Provinsi Sumut Tahun 2011 bahwa BKB Nelayan Kelurahan Pancuran Bambu, Kec. Sibolga Sambas, Kota Sibolga ditetapkan terbaik I. Sementara terbaik diraih kelompok BKB Primadona Kab. Toba Samosir dan terbaik III

Sibolga Sambas Terbaik I Registrasi Kependudukan SIBOLGA (Waspada): Dinas Capil dan Kependudukan Kota Sibolga menetapkan Kec. Sibolga Sambas terbaik I Registrasi Kependudukan di Kota Sibolga, sedangkan untuk tingkat Kelurahan juara I diraih Kelurahan Aek Muara Pinang. Demikian dikatakan Kadis Capil dan Kependudukan Kota Sibolga H. Ahmad Sulhan Sitompul, MAP, Jumat (16/12) saat mengumumkan hasil lomba Registrasi Kependudukan Kota Sibolga di aula kantor Lurah Pancuran Dewa. Dikatakan Sulhan, perlombaan dilakukan digelar tiap tahun guna mengevaluasi petugas registrasi di tingkat kelurahan dan kecamatan untuk keakuratan data penduduk dalam melakukan pelayanan terhadap masyarakat. Sulhan mengatakan, tim penilai bekerja selama 3 bulan guna menentukankelurahandankecamatanyangterbaikdalammelakukan registrasi data penduduk yang saat ini sudah on line. Diamenambahkankegiatanperlombaanregistrasikependudukan ini akan dilakukan setiap tahun untuk melihat kinerja petugas di tingkat kelurahan dan tingkat kecamatan dalam meningkatkan etos kerja. Adapun hasil lengkap pemenang untuk tingkat kecamatan yakni juara I Sibolga Sambas, juara II Sibolga Selatan, Juara III Sibolga Utara dan Harapan I Sibolga Kota. Sedangkan tingkat kelurahan, Juara I Keluarahan Aek Muara Pinang, juara II Kelurahan Simaremare dan juara III Kelurahan Kota Baringin. (a24)


KADIS Capil dan Kependudukan Kota Sibolga H. Ahmad Sulhan Sitompul menyerahkan piagam penghargaan kepada Camat Sibolga Sambas H.Abdul Gani Hutagalung, Jumat (16/12).

bantuanfakirmiskin,penyandang cacat, guru madrasah, imam masjid dan bilal mayit. Serta masalah proyek multi years, pembangunan sarana perkantoran Pemerintah Kabupaten Padang Lawas yang dianggarkan Rp216 miliar, namun sampai saat ini belum tuntas. Untuk itu diminta kepada aparat penegak hukum agar serius menyikapi sejumlah persoalan dugaan penyelewengan di lingkungan Pemerintah Kabupaten Padang Lawas, yang diduga kuat telah menimbulkan kerugian besar bagi daerah, termasuk terjadinya keterlambatan pembangunan, jelas Mardan. (a33)

Waspada/Zulfan Nasution

LURAH Pancuran Bambu Dicky Syahputra, Koordinator PLKB Sibolga Sambas Ida Rosdiana Sihotang, PLKB Kelurahan Pancuran Bambu Alamsatriwal Tanjung,dan Pengurus BKB Nelayan Pancuran Bambu saat foto bersama, Sabtu (17/12).

diraih kelompok BKB Cempaka dari Kota Padangsidempuan”, jelas Dicky. Dicky mengatakan, sesuai surat tersebut, khusus untuk pemenang terbaik I tingkat Provinsi Sumut akan diundang untuk mengikuti puncak acara peringatan hari Ibu ke 83 tahun 2011 ke tingkat Nasional 22 Desember 2011 bertempat di Gedung Balai Kartini Jakarta. Justru itu, terang Dicky,Wali Kota Sibolga akan mengutus Ketua Kelompok BKB Percontohan Nelayan Ummi Kalsum yang Insya Allah akan diberangkatkan, Minggu (19/12), dari Sibolga menuju kantor perwakilan BKKBN Provinsi Sumut. Pada kesempatan tersebut Dicky mengakui, bahwa prestasi yangdiraihtidakterlepasperanan dan motivasi dari Wali Kota Sibolga, Drs. HM Syarfi Hutauruk dan ketua tim PKK Kota Sibolga melalui Badan KB dan PP Kota Sibolga serta Camat Sibolga Sambas, Ketua Tim PKK Sibolga Sambas dan Koordinator PLKB Kec. Sibolga Sambas. Alamsatriwal Tanjung menambahkan, Rabu (21/12) para pemenang terbaik I masingmasing provinsi seluruh Indonesia akan mengikuti malam ramah tamah dengan Kepala BKKBN Pusat di gedung HalimI, Jakarta Timur. (a23/a24)

Rp4,5 M Untuk Program Cetak Sawah Madina PANYABUNGAN(Waspada): Program cetak sawah di Kabupaten Mandailing Natal (Madina) tahun 2011 sumber dana APBN Rp4,5 milliar, merupakan salah satu upaya pemerintah pusat diaplikasikan di daerah dalam kaitan persiapan ketahanan pangan nasional sesuai instruksi Presiden RI Susilo Bambng Yudhoyono. DemikianWakil Bupati Madina Drs. Dahlan Hasan Nasution diampingi Kadis Pertanian Dan Peternakan, Taufik Zulhandra, kepada wartawan, baru-baru ini usai mengunjungi lokasi proyek cetak sawah di DesaTunas Karya sekira 300 ha tergabung dalam gabungan kelompok tani (Gapoktan)Tunas Karya, Kecamatan Natal. KemudiandiDesaBanjarAur UtaratergabungdalamGapoktan Banjar Aur Utara, Kecamatan Sinunukan sekira 300 ha. Wakil Bupati menjelaskan, program cetaksawahtahun2011diMadina berjalan bagus.

Ia berharap masyarakat tergabung dalam kelompok tani bisabekerjasemaksimalmungkin supaya program cetak sawah berjalansesuaitarget,menjadikan kawasan cetak sawah menjadi lumbung pangan bagi Madina. “Saya akan pantau langsung kegiatan cetak swah ini. Karena itusayamintasemuapihaksamasama aktif memantau perkembangan cetak sawah dengan mengedepankanprinsifmembangun dan mengkoreksi secar positif. Program cetak sawah ini memilikiaturanbakudaripemerintah supaya dalam pelaksanaannya jangan menyalahi hukum. Jika adayangmelanggarakandiproses secara hukum tanpa pandang bulu. Sebaliknya bila ada yang coba-coba mengganggu akan dihadapkanpadaaparathukum,” ucap Dahlan Dahlan mengakui, apa yang didengarnya tentang isu cetak sawah banyak masalah di lapangan ternyata bertolak belakang

dengan hasil peninjauan di lapangan. Menurutnya, kendala yang dihadapiGapoktansaatiniadalah masalah cuaca banjir dan hujan. Masyarakat juga sangat bersemangat dalam mengerjakan cetak sawah tersebut. KadisPertanianDanPeternakan,TaufikZulhanramengatakan, program cetak sawah di Madina berjalan transparan. Begitu juga dengan anggaran cetak sawah itu dikelola langsung masyarakat karena dana langsung dikirim pemerintah pusat c/q menteri pertanian ke rekening Gapoktan. Ketua Gapoktan Tunas Karya, Sinar, dan Ketua Gapoktan Banjar Aur, Sakban Hasibuan di tempat berbeda menjelaskan, kondisi cetak sawah di daerah mereka seharusnya sudah siap tanam Desember 2012 mengingat persemaian juga sudah diadakan, namun faktor cuaca menjadi kendala. Dan waktu pekerjaanya akan diundur (adendum) sampai Januari 2012. (c14)

Waspada/Sarmin Harahap

WABUP Madina, Dahlan Hasan Nasution bersama Asisten I, Sahnan Pasaribu, Sabtu (17/ 12) diabadikan bersama plank merek Transmigrasi, yang lahannya di duga di serobot PTPN IV dan PT. Palmaris.

UGN P. Sidimpuan Akan Jadi Universitas Negeri P. SIDIMPUAN (Waspada): Tim Visitasi Direktorat Jenderal Pendidikan Tinggi (Ditjen Dikti) Kementerian Pendidikan Nasional (Kemendiknas) RI mendatangi Universitas Graha Nusantara (UGN) Padangsidimpuan dalam proses penegerian perguruan tinggi tersebut Selasa-Kamis (13-15/12). Peninjauandilakukanuntukmengetahuilebih dekatdandetailpersiapanUGNPadangsidimpuan untuk menjadi Perguruan Tinggi Negeri (PTN) di wilayah Tapanuli Bagian Selatan atau Pantai Barat Sumatera Utara. Rektor UGN Padangsidimpuan, Prof Dr Ir Erwin Masrul Harahap MS, menyatakan, UGN sudah lama menanti kedatangan TimVisitasi ini, yakni setelah pihaknya menyerahkan seluruh persyaratan administrasi peningkatan status menjadi perguruan tinggi negeri ke Ditjen Dikti. Tim Visitasi Ditjen Dikti itu diketuai Muhammad Djohar, dengan anggota tim Umar Solahuddin,HadiSuhendra,Maman,danYunishar. Civitas akademika UGN sangat antusias menyambut kedatangan mereka. Kampus ini dikabarkan memiliki 13.380 mahasiswa. Selama di Padangsidimpuan, Tim Visitasi melihat kesiapan seluruh aspek di UGN. Seperti kondisi infrastruktur lima fakultas, FKIP, Pertanian, Sospol, Ekonomi dan Tehnik, dan 13 program studi, sarana kampus, ruang perkuliahan, perpustakaan, dan memastikan legal formal kepemilikan infrastruktur serta aset UGN lainnya. Kemudian, dalam satu ruangan di UGN, Tim Visitasi mewawancarai satu per satu perwakilan Pembantu Rektor, Dekan, Dosen, dan mahasiswa. Merekajugadijadwalkanbertemulangsungdengan lima kepala daerah dan lima Ketua DPRD di Tabagsel serta para tokoh masyarakat, Ormas, OKP, dan perguruan tinggi lainnya. “Mereka ingin mengetahui komitmen lima

pemerintah daerah dan para pimpinan legislatif diTabagsel,danpihakYayasanYADPIselakupendiri UGNdalamkaitanmendukungpeningkatanstatus UGN menjadi negeri,” k ata Prof Erwin Masrul Harahap. Dambakan PTN Secara terpisah, Bupati Tapsel Syahrul M Pasaribu mengaku dirinya dan seluruh jajaran Pemkab Tapsel sangat mendambakan peningkatanstatusUGNmenjadiperguruantinggi negeri. Karena, keberadaan UGN setelah menjadi PTN sangat mendukung dimensi pendidikan di wilayah Tabagsel dan ini sejalan dengan visi misi lima kabupaten kota dalam meningkatkan SDM. Dari pertemuan dengan Ditjen Dikti, kata Syahrul, ditargetkanTahun 2012 mendatang UGN sudahmenjadiperguruantingginegeri.“Iniharapan masyarakat Tapsel danTabagsel umumnya,” ujar Syahrul yang saat dihubungi mengaku sedang menyambut kedatangan Tim Visitasi di ruang kerjanya. Yang telah diwawancarai TimVisitasi antara lain Rektor UGN Prof Dr Ir Erwin Masrul Harahap MS, Ketua Pelaksana YADPI, Ir H Sori Pada Harahap,Wakil Ketua DPRD Tapsel Abdurrasyid Lubis, Asisten II Pemko Padangsidimpuan Dr Ali Pada Harahap, MPd, Kepala Bappeda Tapsel Saulian Sahbi. Kadisdik Tapsel Mara Saud, Kadisnaker dan Transmigrasi Tapsel Syamsul B Siregar, para Camat, Kasek, civitas UGN, pihak Universitas swasta lainnya dari UMTS Sawaluddin Hasibuan dan Drs H Amil Mahzul, dan masyarakat lainnya. Dalam pertemuan tersebut seluruh elemen mulai dari Pemda, DPRD, Ormas, Perguruan Tinggi dan masyarakat pada intinya mendukung penuh UGN Padangsidimpuan berubah status menjadi Perguruan Tinggi Negeri. (a27)

Waspada/Sukri Falah Harahap

TIM Visitasi Ditjen Dikti berdiskusi dengan elemen pemerintah, DPRD, Civitas UGN, Ormas dan masyarakat dalam rangka penegrerian UGN, Kamis (15/12).

Ibu-ibu Tapsel Bantu Keluarga Kurang Mampu SIPIROK (Waspada): Ibu-ibu yang tergabung ini salah seorang tokoh masyarakat Dusun dalam Dharmawanita Persatuan, Tim Penggerak Mandurana, Desa Situmba Julu, Kec. Sipirok, PKK, dan Persatuan Istri TNI (Persit) di Kab. Oloan Tua Siregar, mengaku sangat terharu dan Tapanuli Selatan, menyerahkan bantuan kepada mengucap rasa terimakasih kepada ibu-ibu yang keluarga kurang mampu di Kec. Sipirok, Arse, tergabung dalam Dharmawanita Persatuan, TP dan Saipar Dolok Hole, Kamis (15/12). Para ibu PKK dan Persit. ini bergerak menyerahkan bantuan secara Hal senada diungkapkan Camat Sipirok langsung dari pintu ke pintu. Parlindungan Harahap. Dia berharap intensitas Kegiatananjangsanayangdilaksanakandalam kegiatansepertiinidapatditingkatkandikemudian rangka menyambut Hari Ibu ke-83 di 22 Desember hari. Karena itu dimintanya seluruh unsur mendatang, bantuan uang, beras, kain, dan nasi masyarakat Tapsel, khususnya di Kec. Sipirok, kotak, yang totalnya Rp25.500.000 langsung agar lebih mendukung semua program Pemkab diserahkan ke rumah-rumah penduduk. Tapsel di bawah kepemimpinan Bupati Tapsel, Menruut Ketua Panitia Hari Ibu ke-83 juga Syahrul M Pasaribu. (a27) Kepala Kantor Pemberdayaan Perempuan dan Keluarga Berencanan (KB) Pemkab Tapsel, Emsi Ermida Hasibuan, anjangsana ini merupakan kegiatan tahunan dilaksanakan setiap menyambut hari ibu. “Biasanya anjangsana kita laksanakan ke sejumlah panti asuhan. Tapi untuk tahun ini kita ubah teknis dan sasarannya menjadi ke rumah warga kurang mampu di sejumlah desa,” ujarnya. Penyerahan bantuan langsung ke rumah penduduk desa ini merupakan salah satu bentuk wujud kepedulian Pemkab Tapsel dalam meWaspada/Sukri Falah Harahap nyambung tali asih dan silaIBU-IBU pengurus Dharmawanita Persatuan, TP PKK, Persit, turahmi dengan masyara- bersama Kakan Perlindungan Perempuan dan Anak Pemkab Tapsel, katnya. menyerahkan bantuan kepada warga tiga kecamatan dalam kaitan Atas pemberian bantuan menyambut Hari Ibu ke-83.

Sumatera Utara

B8 Kota Medan B. Aceh Binjai Bireuen B. Pidie G. Sitoli K. Jahe Kisaran Kutacane Langsa

Zhuhur 12:22 12:36 12:23 12:30 12:30 12:26 12:23 12:19 12:25 12:25

‘Ashar 15:46 15:58 15:47 15:53 15:53 15:51 15:47 15:43 15:49 15:48

Magrib 18:20 18:30 18:21 18:25 18:26 18:29 18:22 18:18 18:24 18:22



Shubuh Syuruq


19:34 19:44 19:35 19:39 19:40 19:43 19:36 19:33 19:38 19:36

04:52 05:08 04:53 05:02 04:01 04:52 04:52 04:47 04:55 04:56

05:02 05:18 05:03 05:13 05:11 05:02 05:02 04:57 05:05 05:06

L.Seumawe 12:28 L. Pakam 12:22 Sei Rampah12:21 Meulaboh 12:32 P.Sidimpuan12:20 P. Siantar 12:21 Balige 12:21 R. Prapat 12:18 Sabang 12:36 Pandan 12:22

06:23 06:39 06:23 06:33 06:32 06:23 06:23 06:18 06:26 06:27

Zhuhur ‘Ashar 15:51 15:45 15:44 15:56 15:45 15:45 15:45 15:42 15:58 15:47

WASPADA Senin 19 Desember 2011




Shubuh Syuruq


Zhuhur ‘Ashar




Shubuh Syuruq


18:24 18:20 18:19 18:30 18:22 18:20 18:21 18:18 18:30 18:23

19:38 19:34 19:33 19:44 19:36 19:34 19:35 19:32 20:44 19:37

05:01 04:51 04:51 05:03 04:46 04:49 04:48 04:45 05:09 04:48

05:11 05:01 05:01 05:13 04:56 04:59 04:58 04:55 05:19 04:58

Sibolga Sidikalang Sigli Singkil Stabat Takengon T.Balai Tapaktuan Tarutung T.Tinggi

12:22 12:23 12:33 12:26 12:23 12:30 12:18 12:28 12:21 12:20

18:23 18:23 18:28 18:26 18:21 18:26 18:17 18:27 18:22 18:13

19:37 19:37 19:42 19:40 19:35 19:41 19:32 19:41 19:36 19:33

04:48 04:52 05:06 04:54 04:53 05:01 04:46 04:57 04:48 04:50

04:58 05:02 05:16 05:03 05:03 05:11 04:56 05:07 04:58 05:00

Panyabungan 12:19 Teluk Dalam12:26 Salak 12:24 Limapuluh 12:19 Parapat 12:21 GunungTua 12:18 Sibuhuan 12:18 Lhoksukon 12:28 D.Sanggul 12:22 Kotapinang 12:17 AekKanopan 12:18

06:32 06:22 06:21 06:34 06:17 06:20 06:19 06:15 06:40 06:19

15:47 15:48 15:56 15:51 15:47 15:53 15:42 15:52 15:46 15:45

Dihisab oleh: Tim Ahli Badan Hisab dan Rukyat (BHR) Sumut

06:19 06:22 06:36 06:24 06:23 06:32 06:17 06:28 06:19 06:20

Zhuhur ‘Ashar 15:44 15:52 15:48 15:43 15:46 15:43 15:43 15:51 15:46 15:41 15:43




Shubuh Syuruq

18:22 18:29 18:24 18:18 18:21 18:20 18:21 18:24 18:23 18:18 18:18

19:36 19:43 19:38 19:32 19:35 19:34 19:35 19:37 19:37 19:32 19:32

04:43 04:50 04:51 04:48 04:49 04:43 04:43 05:00 04:49 04:43 04:46

04:53 05:00 05:01 04:58 04:59 04:54 04:53 05:10 04:59 04:53 04:56

06:14 06:21 06:22 06:19 06:20 06:15 06:14 06:31 06:20 06:14 06:17

MUI Dan Kapolres Binjai Bahas Penistaan Agama Waspada/Ibnu Kasir

BUPATI Langkat H. Ngogesa Sitepu, SH didampingi Kapolres AKBP H. Mardiyono, menyampaikan terima kasih kepada keluarga besar PSHT.

Bupati Langkat Didaulat Jadi Anggota Kehormatan PSHT STABAT (Waspada): Keberadaan Persaudaraan Setia Hati Terate (PSHT) yang mengedepankan persaudaraan dan kejujuran, dua modal besar paling ampuh dalam menjalani kehidupan bermasyarakat. Nilai persaudaraan dan kejujuran takkan pernah lapuk di hujan dan lekang di panas, kata Bupati Langkat H. Ngogesa Sitepu, SH pada malam pengesahan warga baru kelompok persilatan PSHT di halaman SD.No.050711 Kampung Pasiran Lk IV Hinaikiri, Kec. Secanggang, Sabtu (17/12) malam. Bupati H. Ngogesa yang hadir bersama Kapolres Langkat AKBP H. Mardiyono, juga berharap kepada warga yang bergabung dalam wadah PSHT, mampu menjadi contoh tauladan untuk ikut membangun jiwa dan mental masyarakat Langkat, agar bertindak sesuai norma agama. Sebelumnya Ketua PSHT Cabang Langkat Sarwoko melaporkan, 54 orang diterima sebagai warga baru persilatan PSHT yang sudah disahkan. “Secara khusus kita daulat H. Ngogesa Sitepu sebagai anggota kehormatan Persaudaraan Setia Hati Terate,” ujar Sarwoko disambut aplaus meriah warga yang hadir. Sementara Ketua Umum PSHT Pusat diwakili Edi Purnomo, memberikan apresiasi atas kepedulian Ngogesa dalam memberi perhatian. Merupakan kewajiban pengurus PSHT untuk menerimanya sebagai anggota kehormatan kelompok bela diri ini,” kata Edi Purnomo seraya mengucapkan terimakasih atas bantuan Ngogesa berupa pengadaan matras senilai Rp22 juta. (a01)

16 PLKB Menangani 26.143 Pasangan Usia Subur TEBINGTINGGI (Waspada): Terdapat 26.134 pasangan usia subur di KotaTebingtinggi. Namun, dalam upaya menyukseskan program keluarga berencana hanya ada 16 petugas lapangan KB yang melayani mereka. Kondisi demikian jelas tidak seimbang, karena ada PLKB yang harus melayani dua hingga tiga kelurahan. Padahal, layaknya satu kelurahan dilayani satu PLKB. HalitudisampaikanKepalaKantorPemberdayaanPerempuan Anak dan KB Drg. Hj. Dina Kamarina, kemarin, terkait seminar ‘Pembangunan Berwawasan Kependudukan’ dalam rangka peningkatan status institusi itu, menjadi badan. Menurut Dina Kamarina, saat ini keberadaan Kantor Pemberdayaan, Anak dan KB Kota Tebingtinggi terlampau kecil. Secara institusional, sudah tidak lagi mampu menangani berbagai persoalan seputar perempuan, anak dan KB. Untuk urusan perempuan misalnya, hanya diurus seksi dengan jumlah pegawai tiga orang. Padahal, persoalan perempuan di perkotaan terus meningkat. Ditambahkan, untuk tiga bidang yang ditangani, paling tidak ada 15 urusan wajib dilaksanakan. Namun status kelembagaan yang masih eselon III, mengakibatkan pelayanan tidak maksimal. “Padahalurusaninisangatstrategisdankrusial,”ujarDinaKamarina. Sebelumnya, Kepala Perwakilan BKKBN Sumut H. Novrijal, MA memaparkan pentingnya pembanguan berwawasan kependudukan. Di masa era reformasi saat ini, persoalan kependudukan terkesan tidak menjadi prioritas penting. Padahal, persoalan kependudukan menyangkut eksistensi suatu bangsa. Ledakan penduduk yang tidak terkendali akan memunculkan berbagai dampak bagi kehidupan manusia. Berupa tragedi kelaparan, kerusakan ekologi serta berbagai dampak lainnya, akibat ketidakmampuan bumi memenuhi kebutuhan penghuninya.(a09)

Masyarakat Bangun Menara Masjid LABUHAN DELI,DS (Waspada): Masyarakat Desa Manunggal bersama perangkat desa, unsur pemerintahan Kecamatan Labuhan Deli Kab. Deliserdang serta anggota DPRD Deliserdang, melaksanakan gotong-royong kebersihan serta pembangunan menara Masjid Al-Ikhlas, DusunV Desa Manunggal Kec. Labuhan Deli , Minggu (18/12). Kegiatan dihadiri anggota DPRD Deliserdang Sofyan Sauri, CamatLabuhanDeliDedyMaswardy,S.Sos,MAP,KadesManunggal Misgiat, BKM Al-Ikhlas Ari Anto, beberapa PAC Partai Demokrat, anggota DPRD SU Guntur Manurung (F-PD) dan undangan lainnya. Kades Manunggal Kec. Labuhan Deli Misgiat didampingi BKM Al-Ikhlas, mengatakan menara masjid yang dibangun setinggi 17 meter dengan biaya Rp560 juta secara swadaya masyarakat. Hingga kini baru memasuki lantai 8 menghabiskan anggaran Rp68 juta. Selain itu juga menerima bantuan sosial (Bansos) dari Pemprovsu Rp25 juta. Disebutkan, selama tahun anggaran 2011, ada 6 rumah ibadah di Kec.Labuhan Deli yang sudah menerima Bantuan Sosial (Bansos) masing-masing Rp25 juta dari Pemprovsu. (a06)

B I N J A I ( Wa s p a d a ) : Majelis Ulama Indonesia (MUI) dan Kapolres Binjai, Sabtu (17/12), mengadakan pertemuan di kantor MUI Kota Binjai Jalan Olahraga, membahas dugaan adanya penistaan agama. Sekretaris Umum MUI Jafar Siddik mengemukakan, pertemuan pengurus MUI dengan Kapolres Binjai AKBP MusaTampubolon untuk memperoleh kepastian tentang penistaan agama oleh anggota Polres Binjai, dengan menodai buku yasin milik Agus, di tahanan Polres Binjai. MUIberharapKapolresBinjai konsekuenterhadapkesepakatan bersama MUI dengan berbagai institusi pemerintah, TNI dan Polri memberantas penyakit masyarakat (pekat) seperti perjudian, narkoba, premanisme dan hiburan malam yang mengganggu ketertiban masyarakat. Ketua MUI Binjai HM. Jamil menyebutkan, penjelasan Kapolres Binjai secara positif sangat diperlukan sehingga pertanyaan masyarakat kepada MUI tentang penistaan agama, isu SARA dan lainnya bisa terjawab. Pertemuan MUI dengan Kapolres Binjai dihadiri Ketua Muhammadiyah, Al JamiatulWasliyah, NU dan pengurus MUI Kota Binjai. Kapolres Binjai AKBP Musa Tambupolon dalam penjelasannya di kantor MUI Binjai membantah terjadi penistaan agama, seperti menodai surat Yasin denganairseni.“Silakancek,apakah ada bau air seni,” ujarnya sembari menyerahkan bungkusan ber-

warnahijauberisisuratyasinyang disebutkan milik Agus. Musa Tampubolonmengemukakankejadian itu diawali masalah makanan.Danmakanansebenarnya padapukul13:00sudahdiletakkan di depan pintu sel.Ternyata tidak ada yang berani mengambil. Kemudian tahanan diberi makan pukul17:00yangmerupakanjatah makan malam. “Tentu nasi yang sudahdisediakansejakpukul13:00 menjadi basi dan berbau,” ujarnya. Dijelaskan juga ada terjadi pengumpulan pakaian, dan pakaian yang dikumpulkan itu diletakkan di ruang lain. Pada tumpukan pakaian itu yang ada tercium bau air seni. Kapolres Binjaimengakuimasalahtersebut masih dalam penelitian Propam PolresBinjai.Jikaterbuktiadaanggota bersalah sudah pasti ditindak.Yang pasti Kapolres mengakui salah seorang anggotanya terindikasi pemakai narkoba. “Anggota pemakai narkoba tersebut akan diproses,” ujarnya. Kapolres Binjai AKBP MusaTampubolon menegaskan, akan me-

lakukan pemeriksaan anggota Polres Binjai, apakah masih ada terlibat pemakai narkoba. “Saya punya alat deteksi, sehingga anggota tidak bisa bohong,” ujarnya. Di sisi lain Kapolres Binjai AKBP Musa Tampubolon merespon berbagai masalah yang dikemukakan Ketua MUI HM Jamil tentang penyakit masyarakat, terutama perjudian dan narkoba. Dan Kapolres menyatakan kesiapannyasecararutinmelakukan pemberantasan perjudian dan narkoba. Begitu juga hiburan malam dan keybord yang main sampai dini hari. Ketua MUI Binjai HM Jamil, usai pertemuan menjelaskan, pertemuan dengan Kapolres Binjai guna memperoleh penjelasan berkaitan masalah aktual yang ada guna menjaga ketentraman umat, sehingga tidak terjadi kesimpangsiuran informasi. MUI BinjaimenghargaipenjelasanKapolres AKBP MusaTampubolon. “Kita berharap, tidak ada hal yang disembunyikan, sehingga kepercayaan masyarakat terhadap institusi Polri positif,” ujarnya.(a04)

Waspada/Riswan Rika

KETUA MUI Binjai HM Jamil melihat bukuYasin yang diserahkan Kapolres Binjai AKBP Musa Tampubolon milik tahanan Agus, yang disebut dinodai dengan air seni untuk dicek kebenarannya.

Sampah Rumah Tangga Dan Industri Kecil Sangat Rawan DELISERDANG (Waspada): Perlupenelitianmendalamterhadap produksi sampah rumah tanggadanindustrikecil,disebabkan intensitas perharinya sangat rawan bagi lingkungan. “Saya berharap ada mahasiswa yang tertarik meneliti produksi sampah, samplenya di Sukaramai Kota Medan. Untuk bahan thesis, mengapa harus di Sukaramai, nanti akan diketahui permasalahannya setelah penelitian dan itu sangat berguna bagi publik,”kataKetuaSekolahPascasarjanaStudiPembangunanFisip USU, Prof. Dr. M. Arif Nasution, MA saat membuka pelatihan penulisan proporsal thesis Magister Studi Pembangunan Angkatan XXI, di The Hill Sibolangit, Kecamatan Namorambe, Deliserdang, Jumat hingga Minggu (16-18/12). Nasution menggarisbawahi thesis mahasiswa Magister Studi Pembangunan Fisip USU harus ‘sempit dan mendalam’. tapi berguna bagi kepentingan publik, baik bagi pribadi warga, praktisi dan pengamat pembangunan, perencanaan pembangunan, legislatif dan eksekutif, perusahaan juga kepentingan referensi penelitianlingkunganselanjutnya. Sekretaris Jurusan Sekolah Pascasarjana Fisip USU, DR. R. HamdaniHarahap,M.Simenambahkan, saat perhatian penelitian maupun pengawasan produksi sampah atau limbah terfokus kepada industri besar, jangan sampai melupakan produksi sampah rumah tangga dan industri kecil.

“Realitanyaindustrikeciltidak sedikit memproduksi sampah yang mengancam kelestarian lingkungan, juga rumah tangga. Kita saja secara pribadi terkadang tanpa sadar membuang sampah nonorganiksembarangan,misalnya plastik kresek, ini merusak struktur tanah,” ujar Harahap. Sedikit sekali, lanjutnya, kita yang peduli terhadap pelestarian lingkungan. “Untuk thesis objek penelitian sampah sangat bermanfaat dan bernilai tinggi,” ujarnya sambil memberi perbandingan Kelurahan Percontohan Lingkungan SehatTanjung Gusta Medan,olehPenggiatLingkungan dan Pembina KOPLING, Dewi Budiati Teruna Jasa Said. NasutiondanHarahapdalam melatih peserta pelatihan penulisan proporsal thesis Magister Studi Pembangunan Fisip USU Angkatan XXI, dibantu dosen Drs. Bengkel Ginting, M.Si, Drs. NurmanAchmad,M.Soc.Sc,Drs.Agus Suriadi, M.Si, Husni Thamrin, S.Sos, MSP, Achyar, S.Sos, M.Si, Miswanto, SH dan Endika Pratama, S.Sos. “Pelatihan ini untuk memfokuskan mahasiswa dalam metodologi penelitian sehingga diharapkan hasil thesis maksimal dan bermanfaat,” tukas Harahap. Mahasiswa Sekolah PascasarjanaStudiPembangunanFisip USUAngkatanXXIyangmengikuti pelatihan, Novembri Yusuf Simanjuntak (Ketua Kelas/PNS KPUKab.Simalungun),Irwansyah Damanik (politikus PAN/Ketua IMMSP Fisip USU 2011-2012),

Zulkarnain (Ketua DPRK Aceh Tengah/politikus Partai Demokrat), Usman Hasibuan (pengusaha/politikus PAN), Nurkarim Nehe (Wartawan Waspada/Sekretaris IMMSP Fisip USU 20112012), Takdir Edi, Enna Malikussaleh,JusmalearaSenja(PNSPemkabGayoLues),Ismail(PNSPemkab Deliserdang), Irda Fairous, Dilly Asril (PNS Pemko Medan), Arif Hanafiah (PNS Pemko Tebingtinggi), Budi Ristianto (Developer/politisi Golkar), Adlin Tambunan (wiraswasta/politisi Golkar), Pin Pin (wiraswasta/ penggiat sosial), Sylvi Ade Kartika (pendidik), Kaswinata (Bank Sumut Syariah). Dalam acara penutupan pelatihan Minggu (18/12), DR. R. Hamdani Harahap, M.Si yakin setiap mahasiswa sudah mendapat gambaran mengenai proporsal thesis yang akan diselesaikan, bahkan lebih cepat dari yang dijadwalkan. “Kami sejak awal sudah bertekad, sama masuk sama ke luar,” cetus Ketua Kelas AngkatanXXIMSPFisipUSU,Novembri YS dalam sambutan penutupan. Sedangkan Irwansyah Damanik mewakili peserta dalam kesan pesan menyarankan Angkatan XXI mendapatan kesempatanstudibandingkeperguruan tinggi di luar negeri sebelum merampungkan thesis. “Angkatan XXI ini tidak hanya lintas kabupaten kota di Sumut, tapi juga lintas provinsi, tidak ada salahnya jika kami go internasional,” papar Damanik. (m41)

BRI Cabang Stabat Serahkan 1300 Pohon STABAT (Waspada): Dalam program nasional Hari Menanam Pohon Indonesia (HMPI) satu miliar pohon, jajaran BRI cabang Stabat menyerahkan 1.300 batang pohon mangga dan pohon rambutan kepada masyarakat di beberapa kecamatan di Kab. Langkat. “Penyerahan bibit pohon dirangkai dengan HUT ke 116 BRI,” kata Pimpinan BRI cabang Stabat Muhyidin Zainal, barubaru ini. “Saatnya menamam pohon kita jadikan budaya untuk memelihara lingkungan yang bersih, sejuk indah dan sehat,” tambahnya. Dengan pemberian pohon itu, harap Muhyidin, masyarakat tergugah untuk melestarikan lingkungan salah satunya dengan terus menanam untuk penghijauan. Pemberian bibit pohon berlangsung di Kec. Tanjungpura, Secanggang, Hinai, Batangserangan, Sawit Seberang, Gebang, Babalan, P. Brandan, Besitang dan di P. Susu.(a03)


PESERTA Pelatihan Penulisan Proporsal Thesis Sekolah Pascasarjana Magister Studi Pembangunan Fisip USU Angkatan XXI di The Hill Resort Sibolangit, Deliserdang, bersama Sekretaris Jurusan DR. R. Hamdani Harahap MSi, tutor Drs. Bengkel Ginting, M.Si, Drs. Nurman Achmad, M.Soc.Sc, Drs. Agus Suriadi, M.Si (kolomnisWaspada), Husni Thamrin, S.Sos, M.Si, Achyar, S.Sos, M.Si, Miswanto, SH usai acara penutupan.


BUPATI Sergai HT. Erry Nuradi didampingi Ketua TP PKK Ny. Hj. Evi Diana Erry, Kadisdik Drs. H. Rifai Bakri Tanjung, MAP saat meninjau SMK Negeri 1 Kec. Pantai Cermin.

Bukan Sekadar Janji, Tapi Bukti PEGAJAHAN (Waspada): Kepemimpinan Bupati HT. Erry Nuradi merupakan sosok yang peduliuntukmengentaskankemiskinanrakyatnya, dalammelaksanakantugasbukanhanyamemberi janji, tapi memberikan bukti nyata. SebabKab.SerdangBedagaiyangmempunyai 17 kecamatan saat ini hampir semua pelosok desa menikmati jalan beraspal yang sebelumnya sangat sulit dilalui. Begitu juga sarana pendidikan setiap kecamatan sudah memiliki SMA Negeri. Ke depan, semua kecamatan akan dibangun SMK Negeri. Hal itu disampaikan Kedisdik Kab. Serdang Bedagai Drs. H. Rifai Bakri Tanjung, MAP di hadapan para PNS ketika mempimpin apel pagi gabungan yang dilaksanakan di halaman kantor Camat Pegajahan, baru-baru ini. Dilanjutkan rapat koordinasi dipimpin Kadisdik, di aula kantor Camat Pegajahan. Hadir Staf Ahli Bupati Bidang Politik dan Hukum, Hotman Hutajulu, SH, MH, Sekretaris Disdik Eddi Syahputra, Camat Pegajahan Misran, SE, KCD Pegajahan Dra Nurhaida, yang mewakili Danramil Perbaungan, mewakili Polsek Perbaungan, pimpinan Puskesmas Pegajahan, Kepala SMA, SMP, SD, PS, Kepala Desa, para Sekretaris Desa dan lainnya. Dikatakan Kadisdik, dalam satu periode (5 tahun) kepemimpinan Bupati HT. Erry NuradiSoekirman sudah merealisasi pembangunan sarana dan prasarana pendidikan. Kini gedung SMA Negeri 18 unit. Begitu juga gedung SMK Negeri sudah ada 5 unit, dan tahun 2011 dibangun 2 unit lagi SMK Negeri, 1 di antaranya di Desa Sialang Buah, Kec. Teluk Mengkudu. Tentang perbaikan ruang kelas gedung SMP Negeri telah dilaksanakan 128 ruangan dari 36

unit gedung SMP Negeri. Selain itu merenovasi 2569 ruang kelas SD dari 448 SD Negeri yang ada dan terwujudnya SD bertaraf internasional di Kec. Perbaungan. Pembangunan infrastruktur bidang jalan dan jembatan sudah dilaksanakan di setiap kecamatan hingga sampai ke desa dan dusun. Setelah di era priode ke dua kepemimpinan Bupati HT. Erry Nuradi - H. Soekirman pelaksanaan program pembangunan di Kabupaten Tanah Bertuah Negeri Beradat ini terus berlanjut sesuai program demi terwujudnya kebutuhan masyarakat. Untuk itu, kata Kadisdik, mari sama sama kita dukung visi dan misi Bupati HT. Erry Nuradi untuk menjadikan Kab. Serdang Bedagai, salah satu kabupaten terbaik di Indonesia dengan masyarakatnya yang Pancasilais, modern dan kompetitif berwawasan lingkungan, sebagaimana selalu disampaikan Bupati HT. Erry Nuradi, bahwa kita bukan hanya mengejar penghargaan, tapi mengejar prestasi. Karena itu Kadisdik mengharapkan para PNS terutama PNS di jajaran Dinas Pendidikan tetap disiplin menjalankan tugas, sebab tanpa adanya kedisiplinantakmungkinkeberhasilandapatdiraih. “Saya masih mendengar salah seorang kepala sekolah yang memberi contoh kurang baik kepada masyarakat. Sementara guru adalah orang yang harus ditiru dan digugu. Selain itu juga Kadisdik menyarankan agar guru jangan banyak mengeluh dan menyalahkan orang lain. Jadikan hari ini lebih baik dari hari kemarin dan jadikan hari esok lebih baik dari hari ini. Sebab bila hari ini lebih buruk dari hari kemarin, berarti kita adalah orang yang tidak beruntung,” kata Kadisdik sembari menambahkan, seorang PNS harus tegar dan loyal kepada atasan walau apa pun yang akan terjadi.(a08)

waspada/HM Husni Siregar

DR Fikarwin Zuska staf pengajar Ketua Departemen Antropologi FISIP USU Medan (kanan) memberi paparan pada forum tatap muka dengan Bupati Deliserdang, pimpinan ormas, tokoh masyarakat, agama dan adat se-Kab. Deliserdang.

DS Gelar Pelestarian Nilai Sosial Budaya LUBUK PAKAM ( Waspada): Pemkab Deliserdang melalui Dinas Infokom menggelar pelestarian nilai-nilai sosial budaya, mendukung program pembangunan melalui forum tatap muka dengan pimpinan Ormas, tokoh masyarakat, agama dan tokoh adat menghadirkan nara sumber DR Fikarwin Zuska, staf pengajar/ Ketua Departemen Antropologi Fisip USU Medan. Forum tatap muka dihadiri unsur Muspida, sejumlah pimpinan SKPD serta camat se-Kab. Deliserdang dibuka Wabup Deliserdang H. Zainuddin Mars, di Balairung Pemkab Deliserdang Lubuk Pakam, kemarin. Wabup H. Zainuddin Mars mengatakan, dalam melaksanakan percepatan pembangunan Pemkab Deliserdang melalui pola kebersamaan mensinergikan 3 pilar kekuatan melibatkan peran pemerintah, dukungan pihak swasta serta partisipasi aktif masyarakat, dengan mensosialisaikan berbagai program melalui keterbukaan. Dengan keterbukaan itu, berbagai program yang digerakkan di daerah ini mendapat sambutan seperti konsep ‘Cerdas’ (Percepatan rehabilitasi dan apresiasi terhadap sekolah) mampu menjadikan seluruh gedung SD yang mencapai 621, menjadi layak pakai sebagai sarana dan prasarana menciptakan generasi muda handal dan berkualitas.

Demikian juga pembangunan infrastruktur jalan melalui program ‘GDSM’ (Gerakan Deli Serdang Membangun), masyarakat ikut berpartisipasi membangun jalan dengan merelakan tanah dan tanamannya untuk pelebaran jalan sehingga saat ini jalan kabupaten sudah mencapai 3.727 Km dimana 1.650 Km sudah diaspal. Semua ini, kata Wabup, tidak terlepas dari tingginya rasa kebersamaan dan masih lestarinya nilai-nilai sosial budaya di daerah ini. Dr. Fikarwin Zuska selaku narasumber, menjelaskan nilai-nilai sosial budaya sangat berpengaruh terhadap program pembangunan suatu daerah. Demikian juga program pembangunan yang sudah dilaksanakan, dapat berpengaruh terhadap perkembangan sosial budaya. “Keduanya saling berkaitan karenanya nilai-nilai sosial budaya menjadi jati diri bangsa seperti budaya gotong-royong yang harus dilestarikan.” Kadis Infokom, Drs Neken Ketaren didampingi Kabid Penjaringan Data dan Informasi, Drs Ronald Manurung selaku penyelenggara menjelaskan, melalui forum tatap muka ini diharap muncul berbagai tanggapan serta masukan untuk mendukung program pembangunan berkelanjutan di Kab. Deliserdang. Peserta 160 dengan tema, ‘Menjalin kebersamaan membangun Deliserdang’.(a06)


WASPADA Senin 19 Desember 2011


Waspada/Mohammad Faisal

Waspada/Mohammad Faisal

PEMIMPIN Umum Harian Waspada Dr Hj Rayati Syafrin, MBA. MM berfoto bersama sebagian wartawan Waspada di Provinsi Aceh yang hadir dalam acara Road to Dakwah di Pendopo Ulama-Umara Peureulak, Aceh Timur, Sabtu (17/12).

8 Jembatan Diterjang Banjir 1 Jembatan Di Julok Putus, Ratusan KK Terkurung JULOK (Waspada) : Sedikitnya 8 jembatan di Kecamatan Julok, Kabupaten Aceh Timur, diterjang ketika banjir memuncak di kawasan itu, Minggu (18/12). Salah satunya kini putus total dan mengakibatkan ratusan kepala keluarga di daerah itu terkurung. Jembatan yang hancur akibat banjir kali ini yakni dua jembatan di Bineh Ramphak, empat jembatan di Julok Tunong dan dua jembatan di Blang Jembee. Ambruknya dan putusnya jembatan di Julok Tunong (Julok) semata-mata karena faktor pengerukan sungai tanpa ada tebing sungai yang layak dan standar yang ada. Geuchik Julok Tunong M Yunus mengatakan, jembatan ambruk di desanya terjadi akibat banjir yang meluap selama dua hari terakhir. “Hujan deras yang terjadi di Julok dan beberapa kawasan lain di Aceh Timur terjadi akibat hujan deras, termasuk saat puncak banjir mengakibatkan jembatan ambruk,” sebutnya.

Tak hanya itu, akibat banjir mengakibatkan karamnya areal persawahan dan tergenangnya air dalam rumah-rumah penduduk. “Ketinggian air mencapai satu meter dari permukaan tanah, tapi banjir di Julok Tunong mengakibatkan jembatan putus akibat tanah longsor dan kini ratusan KK terkurung,” kata Yunus. “Pengerukan sungai di Julok tanpa ada pembangunan tebing sungai yang memadai, sehingga terjadi longsor yang begitu parah. Ini tidak bisa dibiarkan dan harus segera ditangani Dinas Pekerjaan Umum,” ujar Ketua Forum Pemuda Julok (FPJ), Hasballah Kadimin, Minggu (18/12) di Julok. Hasballah meminta Kepala BPBD, PU, Bagian Kesra segera ke lapangan melihat langsung sejumlah fasilitas umum yang rusak diterjang banjir. “Jika tidak segera ditangani, masyarakat sengsara, apalagi akses ke ibukota Julok kini putus dan masyarakat terpaksa mencari jalan lain melalui desa tetangga,” katanya. Kepala Badan Penanggulangan Bencana Daerah (BPBD) Aceh Timur Muhammad Ikbal saat dimintai keterangan mengaku telah memantau

seluruh kecamatan yang dilanda banjir, terutama di kawasan Julok. “Jika ada yang mengungsi kita akan salurkan bantuan, tapi

sampai saat ini belum ada titik pengungsi,” sebutnya seraya menandaskan, seluruh fasilitas umum yang rusak akibat banjir

kini dalam proses pendataan dan akan dilaporkan ke Bupati Aceh Timur dan BPBA di Banda Aceh. (b24)

dan penghijauan hutan kembali melalui reboisasi. Tapi tidak mungkin, sebab kerusakannya sangat parah,” papar Bupati Aceh Timur Muslim Hasballah kepada Waspada, Minggu (18/ 12) di Idi. Kata Bupati Muslim Hasballah, penebangan hutan adalah salah satu faktor terjadinya banjir. Namun faktor tersebut adalah faktor yang paling besar penyebab banjir khususnya di Aceh Timur. “Sumbatnya sungai dan anak sungai (alur—red) juga pengaruh banjir, tapi kerusakan hutan bertahun-tahun faktor utama. Jadi untuk pemulihan

Waspada/Muhammad H. Ishak

TERANCAM:Warga sedang melihat tumpukan sampah yang dibawa arus banjir di bawah jembatan negara Jalinsum Banda Aceh - Medan di Desa Julok Tunong, Kecamatan Julok, Kabupaten Aceh Timur, Minggu (18/12).

hutan di Aceh butuh waktu puluhan tahun,” sebutnya. Moratorium loging yang diterapkan Gubernur Aceh beberapa tahun silam adalah salah satu usaha Pemerintah Aceh dalam menjaga dan melestarikan hutan, sehingga alam tidak lagi diganggu dengan aksi-aksi ilegal seperti ilegal loging yang belakangan marak diungkap pihak kepolisian, termasuk Polres Aceh Timur. “Kita harap masyarakat menjaga lingku-ngan dan terus meningkatkan penghijauan khususnya di lingkungan rumah,” tutur Muslim Has-

ballah. Sementara pengamatan Waspada, Kabupaten Aceh Timur dikepung banjir sejak Sabtu (17/12) pagi. Hingga Minggu (18/12) petang, tercatat lebih setengah wilayah dilanda bencana banjir musiman. Kecamatan yang dilanda banjir yakni Kecamatan Madat, Simpang Ulim, Pantee Bidari, Julok, Alue Ie Mirah, Nurussalam, Darul Falah, Darul Aman, Idi Rayeuk, Idi Timur, Peudawa, Peureulak Barat, Peureulak Kota, dan beberapa kecamatan lainnya seperti Idi Tunong dan Banda Alam yang terletak di kawa-

san pedalaman. Akibat banjir yang terjadi dua hari terakhir, aktivitas petani sawah lumpuh total. Bibit padi yang sudah dicabut dan siap untuk dilakukan penanaman hanyut dibawa air banjir seperti di kawasan Meudang Ara, Kecamatan Nurussalam. Hingga berita ini diturunkan, ketinggian air masih di atas satu meter di atas permukaan tanah. Diperkirakan, jika hujan musiman kali ini terus terjadi, maka ketinggian air akan bertambah dan warga diminta oleh pemerintah daerah untuk mengungsi. (b24)

Tenis Meja Bawa Desy Devayanti Keliling Indonesia DESY Devayanti, 16, siswi kelas XI IPS II di Sekolah Menengah Atas (SMA) Negeri 1 Lhoksukon, Aceh Utara tersenyum malu-malu ketika ditanya Waspada sudah pernah mendapat prestasi apa saja selama hidupnya. Anak sulung dari pasangan Anwar, SPd-Mardhiah, SPd dari Gampong Alue Ie Puteh, Baktya, Aceh Utara itu mengaku sudah keliling Indonesia, gara-gara olah raga tenis meja. Pada tahun 2010, Desy berhasil memboyong juara I kejuaraan nasional di Jakarta, pada tahun yang sama, dia juga berhasil membawa juara II dalam Liga Kasih Bangsa Internasional di Senayan. Pada tahun 2010 juga, Desy menyabet juara I Popwil Sumatera Wilayah I Bangka Belitung dan dara hitam manis ini juga merupakan juara bertahan O2SN tingkat Provinsi Aceh sejak tahun 2004-2011. Selanjutnya, Desy juga sang juara di Kejurda tahun 20092011, Juara I Kejurnas di Jakarta,

Juara I Popda di Aceh Tamiang tahun 2010 dan juara I tingkat Kabupaten Aceh Utara sejak tahun 2005-2011. Dara Aceh yang bercita-cita ingin menjadi Polwan itu mengaku telah mulai menggeluti

STAI Al-Aziziyah Samalanga Gelar Seminar LHOKSEUMAWE (Waspada) : Sekolah Tinggi Agama Islam (STAI) Al-Aziziyah bersama Dayah MUDI Masjid Raya Samalanga menggelar seminar dan konferensi internasional, Senin (19/12). Kegiatan didukung Forum Keilmuwan Muslim Nusantara (FORKIM) yang berpusat di Malaysia, berlansung selama dua hari. Ketua panitia pelaksana konferensi, Tgk H Helmi Imran melalui siaran persnya kepada Waspada, Minggu (18/12) mengatakan, tema konferensi tentang pendidikan Islam. “Temanya, Nilai Tradisi Pendidikan Islam Dalam Pembinaan Karakter dan Peradaban Melayu di Nusantara : Harapan dan Tantangan Masa Kini,” jelas Tgk Helmi. Tujuan kegiatan, tambahnya, menggali kembali konsep pendidikan berbasis Islam yang relevan untuk diterapkan pada lembaga pendidikan dayah, perguruan tinggi agama dan umum. Wakil Gubernur Aceh Muhammad Nazar dan dan Prof Dr H Hasballah Thaib MA, (alumni dayah MUDI Samalanga) dijadwalkan sebagai Keynote speaker.

Sedangkan pematerinya, Prof Dr Badlihisham Mohd.Nasir (Profesor dalam bidang Ilmu Dakwah Fakultas Pengajian Islam Universitas Kebangsaan Malaysia), Tuan Guru Hamiding Sanor MA (Direktur Institut Keguruan Islam Padangru Yala Thailand), Prof Dr Ahmad Nidzammuddin Sulaiman (Peneliti pada Institut Kajian Etnik Universitas Kebangsaan Malaysia) Selain itu, juga sebagai pemateri, Ibrahim Yahya MA (DirekturYayasan Kebudayaan Islam Selatan (Yakis) The Islamic Cultural Southern Border Province). Sedangkan para pemateri dari Indonesia adalah, Tgk HM Yusuf A Wahab Jeunieb, DR Tgk H Ridwan Hasan MTh, Prof Abdul Hadi Arifin, Prof Dr Samsul Rijal MA, Dr Muhammad Abu Bakar. Seminar dan konferensi internasional ini dihadiri para akademisi perwakilan dari USM Pulau Penang, KITAB Pulau Penang Malaysia, IPTIP Perlis Malaysia, PSU Pattani Thailand, PNU Narathiwat Thailand,YMIT Yala Thailand, IKIP JAHA YALA Thailand, UIY Yala Thailand, HSD Makassar dan dari IAIN Medan.(b15)

TSEL Akan Bayar Rumpun Nelayan Aceh Timur

Kerusakan Hutan Penyebab Utama Banjir IDI (Waspada) : Bupati Aceh Timur Muslim Hasballah memperkirakan, banjir yang terjadi sejak 20 tahun terakhir di Aceh, khususnya Aceh Timur akibat penebangan hutan yang terjadi sejak tahun 1980-an. Pemberian izin penebangan hutan melalui program Hak Penggunaan Hutan (HPH)mengakibatkan hutan Aceh rusak dan penampungan debit air yang tersisa sangat kecil. “Akhirnya terjadi banjir sejak tahun 1990 sampai sekarang. Perusakan sudah terjadi sangat parah sejak dulu, sekarang kita punya program pemeliharaan

BUPATI Aceh Timur Muslim Hasballah mengalungkan selendang ulama kepada kepala Litbang H Akmal AZ seusai acara Road to Dakwah di Pendopo Ulama Umara Peureulak, Aceh Timur, selendang ulama juga diberikan kepada Wakil Penanggung Jawab Harian Waspada Sofyan Harahap dan Redaktur Aceh Muhammad Zeini Zen sebagai tanda silaturahmi dan persaudaraan disaksikan Pemimpin Umum Harian Waspada Dr Hj Rayati Syafrin, MBA. MM

dunia olah raga tenis meja sejak masih duduk di bangku kelas IV Sekolah Dasar. Olah raga ini juga yang membuat Desy bisa tukar pengalaman tentang dunia olah raga dengan atletatlet dari luar Aceh dan bahkan di tingkat internasional. Desy Devayanti “ Te n i s meja telah membawa saya keliling Indonesia. Mungkin kalau pakai uang sendiri untuk keliling Indonesia saya tidak sanggup. Keliling Indonesia membuat saya tambah dewasa dan tambah pengalaman juga tambah

teman. Selain itu, saya bangga karena dengan tenis meja saya telah mampu meng-harumkan nama Aceh dan Indonesia,” katanya tersenyum. Selain ke beberapa daerah yang telah disebutkan di atas, Desy juga telah pernah ke Nusa Tenggara Timur (NTT) pada tahun 2004, dan ke Makassar. Ditanya mengapa suka jadi polisi, Desi mengaku biar tampak gagah dan ingin memberikan rasa aman kepada masyarakat. Sang juara tenis meja itu mengaku kepada Waspada sama sekali tidak merasa kehilangan masa remajanya, karena justru dia mengaku sangat enjoy bisa menghabiskan masa remaja untuk menggapai prestasi demi mengharumkan nama bangsa di mata internasional. Menurut dia, pada usia remaja seseorang bisa melakukan apa saja yang diinginkan, sedangkan di masa tua sudah banyak persoalan hidup yang harus dihadapi.

Anak pertama yang terlahir dari keluarga Pegawai Negeri Sipil (PNS) itu mengaku takjub dengan perjuangan Cut Nyak Dhien, Cut Mutia dan beberapa pahlwan wanita Aceh lainnya. Rasa takjub itu muncul karena rasa berani yang mereka meliliki. Dengan keberaniannya, Cut Mutia dan Cut Nyak Dhien berhasil melawan penjajah Belanda demi menyelamatkan Aceh dan Indonesia dari penjahan. Bukan hanya untuk kemerdekaan, dua wanita Aceh tersebut berjuang juga demi menegakkan kalimah Lailahaillaulah. “Karena itu hendaknya, kita bisa menyumbangkan prestasi demi untuk menghormati para pahlawan. Dalam merebut kemerdekaan, mereka rela mengorbankan harta, darah dan nyawa. Jangan membuat para pahlawan itu bersedih,” kata Desy penuh harap. Maimun Asnawi

LANGSA (Waspada) : Perusahaan migas Transworld Seruway Exploration Ltd (TSEL) dalam waktu dekat ini akan membayar ganti rugi 40 rumpon milik nelayan di Aceh Timur. Pembayaran itu dilakukan sebagai bentuk ganti rugi atas pemotongan ketika kegiatan seismik berlangsung. Site Public and Government Relation, Zubir MA, Minggu (18/12) mengatakan, kategori pembayaran rumpon milik nelayan ini dibagi dua jenis, rumpon pinggir dan rumpon menengah. Untuk rumpon pinggir, pihak perusahaan Transworld Seruway Exploration Ltd, akan membayar sekitar Rp5 juta hingga Rp10 juta per rumpon, sedangkan rumpon menengah pembayarannya berkisar Rp20 hingga Rp32 juta per rumpon. Menurutnya, sebelum dilakukan kegiatan seismik, pihak perusahaan telah melakukan koordinasi baik dengan pihak nelayan maupun Pemerintah Kabupaten Aceh Timur. Dan pembayarannya dilakukan sesuai Surat Keputusan (SK) Bupati Aceh Timur yang telah dikeluarkan sebelumnya. Dijelaskannya, sebelumnya pada November 2011 lalu, juga digelar rapat antara Panglima Laot dan pihak Transworld Seruway Exploration Ltd yang difasilitasi Dinas Kelautan dan Perikanan (DKP) Aceh Timur, guna membahas persoalan ganti rugi serta hal-hal lain yang dianggap penting. Selanjutnya perusahaan juga mela-kukan sosialisasi dengan perwakilan panglima laot,

tentang kegiatan seismik di lepas pantai Aceh Timur ini. Tujuannya agar nelayan dapat mengetahui aktivitas seismik, sehingga nelayan tidak melakukan kegiatan melaut di sekitar areal seismik, demi menghindari hal-hal berbahaya bagi nelayan. “Kapal untuk kegiatan seismik ini berjumlah enam unit, satu di antaranya kapal induk dan lima sebagai kapal pengawal kabel sepanjang 7.000 meter dan lebar 700 meter di laut. Jadi di areal tersebut nelayan harus menghindari aktivitasnya untuk menghindari hal yang berbahaya,” katanya. Sementara itu, Zubir juga membantah isu bahwa beberapa hari lalu pihak Transworld Seruway Exploration Ltd pernah mengancam dengan menggunakan senjata terhadap nelayan yang melakukan aktivitasnya di laut. Yang pernah terjadi, katanya, dilakukan tembakan suar untuk mengarahkan nelayan keluar dari jalur areal berbahaya kegiatan seismik. “Ini harus kita luruskan, dan isu tersebut sengaja dihembuskan pihak lama yang tidak senang dengan keberadaan seismik, mereka sengaja hendak mengganggu kegiatan seismik. Namun persoalan ini telah selesai dan nyatanya nelayan tidak terprovokasi atas tindakan pihak tak bertanggungjawab tersebut, karena sebelum kegiatan seismik di laut lepas Aceh Timur ini kita lakukan, jauh hari nelayan telah diberikan pemahaman dan sosialisasi yang sebenarnya,” katanya. (b20)

Setahun Pengurus MPU Tak Terima Gaji IDI (Waspada) : Pengurus Majelis Permusyawaratan Ulama (MPU) kecamatan di seluruh Kabupaten Aceh Timur dikabarkan tidak menerima gaji selama setahun terakhir mulai Januari hingga Desember 2011. Padahal dalam SK kepengurusan disebutkan segala biaya yang timbul akan dibebankan pada APBK setempat. Pihak sekretariat MPU kabupaten mengaku sudah mengajukan dana untuk honor pengurus MPU kecamatan, namun sampai sekarang belum ada realisasi, baik dalam APBK atau dalam APBK-P. Sekretaris MPU Kecamatan Peureulak Barat, Anwar Abda, Jumat (16/12) mengatakan, beberapa waktu lalu pengurus MPU kecamatan sudah meneken pernyataan bersama agar Bupati Aceh Timur memberikan honor. Namun surat yang diteken pengurus MPU kecamatan itu tidak diteruskan, lantaran pihak sekretariat MPU kabupaten sudah melayangkan surat yang sama. “Meski demikian sejauh ini honor yang dimaksud belum juga ada realisasinya,” katanya seraya menambahkan, dasar pengurus MPU kecamatan menagih honornya sesuai SK yang tertera pada poin 8 dan peraturan daerah No: 21 tahun 2000 tentang pembentukan organisasi dan tata kerja Majelis Permusyawaratan Ulama.

Dalam keputusan tersebut menetapkan pada angka kesatu MPU masa khidmat 20082012 bahwa segala biaya yang timbul akibat dikeluarkan keputusan tersebut akan dibebankan pada APBK Aceh Timur. Anwar Abda juga menunjukkan fococopy surat sekretariat MPU kabupaten yang pernah ditujukan kepada Bupati Aceh Timur c/q Sekretaris Daerah Syaifannur. “Di surat ini disebutkan, setelah disahkan APBK tahun anggaran 2011 ternyata honorarium untuk MPU kecamatan tidak dianggarkan lagi di masing-masing kecamatan,” katanya. Sekretariat MPU juga mengusulkan mendahului anggaran perubahan tahun 2011 di RKA/ DPA perubahan sebesar Rp225.600.000. “Honor untuk ketua MPU kecamatan Rp200.000,Wakil Ketua Rp150.000, Sekretaris Rp100.000, uang meugang dan biaya BOP. Kita mengharapkan agar ini bisa diakomodir,” sebut Anwar. Sekda Aceh Timur Syaifannur ketika dikonfirmasi kemarin mengatakan, pihaknya sebagai panggar eksekutif telah memberikan platfon besaran anggaran untuk MPU. “Misalnya platfonnya Rp200 juta. Berapa untuk sekretariat dan berapa untuk kecamatan. Jangan tidak ada sama sekali. Tapi itu semua akan kita cek kembali,” tandasnya singkat. (b24)



Apa Lahu Ditilang Polisi

Pedagang Korban Penipuan LHOKSEUMAWE (Waspada) : Aksi penipuan di Lhokseumawe semakin berani dan marak. Mereka memperdaya korbannya dengan berbagai cara, menyamar sebagai teungku mengaji, atau pengurus pesantren dan berbagai cara lainnya guna meyakinkan korbannya. Sebagaimana yang dialami M Yusuf, warga Desa Ujong Blang, Banda Sakti, Lhokseumawe, Mingggu (18/12). Seorang lelaki berpeci dan berpakaian serba putih mendatangi pedagang ini yang sedang berada di kedainya. Lelaki yang berwajah bersih dan berkulit kuning langsat ini menawarkan pada M Yusuf untuk menitip-jual beras sebanyak 20 zak dan 8 jerigen minyak masing-masing 35 liter. “Sebagai pedagang, saya menyetujuinya karena begitu yakin dengan omongannya, sekalipun saya tak melihat barang yang ditawarkan,” ujarnya. Menurut si pelaku, kata M Yusuf, beras beserta minyak itu masih di pesantren Panggoi, Muara Dua, Lhokseumawe, yang merupakan barang sumbangan masyarakat. MYusuf yakin dirinya tidak akan ditipu, apalagi oleh seorang teungku, maka menyetujui memberikan uang sebesar Rp300 ribu, seperti yang diminta pelaku. Namun sebelum berangkat untuk mengambil barangbarang itu, lelaki itu menanyakan berapa jumlah harga beras dan minyak seluruhnya bila terjual, yaitu 20 zak beras fiktif dan 18 jerigen minyak yang entah di mana. “Lalu dia minta uang Rp200 ribu lagi, agar jumlah seluruhan Rp500 ribu. Dan anehnya saya memberikannya,” ujarnya. Ketika berangkat dengan sepedamotor berplat merah, Yusuf minta ikut serta. Si pelaku menolak, beralasan sedang membeli semen 2 zak untuk pesantren. Begitu dia mengikuti korban ke tiga toko bangunan terdekat, lelaki itu tidak ditemukan dan tidak pula ada orang yang membeli semen. Bersama Makfirah,12, anak gadisnya, Yusuf pergi mencaricari si penipu, sampai kemudian dia berada di pesantren yang dimaksud. Ternyata, pelaku tidak ada, dan dia bukanlah teungku. Saat itulah Yusuf semakin yakin bahwa dia sudah ditipu dengan perdaya yang begitu halus dan lembut. Karena kesal dan lelah mencari, akhirnya Yusuf singgah ke Kantor Biro Waspada membeberkan peristiwa yang telah menimpanya. Dia tidak berencana melaporkan masalah itu pada polisi, karena tidak ingin menyibukkan diri dan lagi uangnya belum tentu akan kembali.(b14)

Cuaca Ekstrim Dan Gelombang Tinggi Landa Perairan Bireuen BIREUEN (Waspada) : Cuaca ekstrim dan gelombang tinggi yang terjadi di perairan Bireuen sejak beberapa pekan lalu, sampai sekarang belum juga surut. Bahkan dalam dua hari ini ditambah lagi curah hujan yang cukup tinggi, sehingga kawasan pengairan wilayah Bireuen tersebut berbahaya atau tidak menguntungkan bagi nelayan bila nekat melaksanakan pekerjaannya melaut. “Resiko kalau melaut sekarang ini sangat tinggi, karena selain gelombang tinggi, juga cuacanya ekstrim sekali, jadi kalau nelayan tetap melaksanakan pekerjaannya harus tetap waspadai jam-jam tertentu dan kalau boleh saya mengimbau keadaan seperti sekarang ini lebih baik menunda melaut,” kata Abu Laot Bireuen, Badruddin terkait ada informasi sejumlah nelayan nekat melaut untuk menutupi kebutuhan hidupnya. Menurut Abu Laot, cuaca ekstrim di kawasan Bireuen sekarang ini diperkirakan akan berlangsung hingga bulan depan dan selama itu diharapkan nelayan kalau memang terpaksa harus pergi, hendaknya harus benar-benar ekstra hati-hati. Namun, dirinya sebagai Panglima Laot mengimbau jangan melakukan hal yang menantang maut. “Kami mengimbau nelayan di Bireuen, supaya membaca situasi dan iklim di laut, kalau cuaca ekstrim dan membahayakan jiwa, lebih baik ditunda melaut atau jangan nekat melaut,” imbaunya lagi dengan tegas. Sejumlah nelayan mulai nekat melaksanakan aktivitas melaut karena mereka mengaku tidak mungkin tidak melaut walaupun nyawa taruhannya. Karena kondisi ekonomi mereka makin lama juga makin serba sulit. “Nelayan bukan tidak sengaja menantang maut, namun mereka tidak mungkin tidak melaut, karena kebutuhan ekonomi keluarga tidak mau kompromi,” kata Jafar, seorang nelayan. (cb02)

Nelayan Bireuen Diserang DBD BIREUEN (Waspada) : Muhamamad Ben, 64, seorang nelayan dari Desa Ujong Blang Mesjid, Kecamatan Kuala, Bireuen, Minggu (18/12) dirawat di RSUD dr Fauziah Bireuen. Karena dia diduga kuat diserang penyakit Demam Berdarah Dengue (DBD). Sejak Kamis dimasukkan ke rumah sakit tersebut oleh keluarganya. Informasi yang diperoleh, Minggu, nelayan dari Ujong Blang itu positif mengidap penyakit DBD, bahkan dia sudah dibawa keluarganya Kamis (15/12), namun hingga kemarin masih dirawat di rumah sakit itu. “Benar bapak Muhammad Ben positif diserang DBD, bahkan trumbositnya mencapai 77/pl,” kata seorang tenaga medis di RSUD dr Fauziah Bireuen, seraya menambahkan, trumbosit yang normalnya adalah, 150/PL. Sementara itu, Kepala Dinas Kesehatan Bireuen dr Amir Adani secera terpisah mengatakan, perubahan iklim dari musim panas ke musim hujan rentan terjadinya DBD. Maka masyarakat diingatkan agar waspadai dengan penyebab dari penyakit tersebut. “Jentik-jentik nyamuk penyebab DBD sangat cepat berkembang biak di tempat-tempat atau wadah yang tergenang air, maka masyarakat jangan membiarkan tempat-tempat yang dapat tergenang air,” imbaunya. Dalam kondisi yang rentan hujan, kata Kadis, masyarakat harus menjaga lingkungan secera bersama, sehingga tempat yang dapat menggenagi air dapat dimusnahkan. (cb02)

Suryadi Kembali Terima Penghargaan Anugerah Adiwarta BIREUEN (Waspada) : Suryadi, wartawan Tabloid Berita Mingguan Modus Aceh wilayah Bireuen kembali menerima Anugerah Adiwarta 2011 di Financial Hall Ballroom, Graha Niaga, Jakarta belum lama ini bersama sejumlah wartawan lain. Tahun lalu dia juga menerima anugerah yang sama dari lembaga tersebut dari berita yang berbeda dikirimkannya. Wartawan media lokal Aceh itu, menerima penghargaan kategori cetak dan online, liputan kemanusiaan, bidang politik yang judul beritanya: Pak Ketua ‘Alergi’ Perempuan?. Sedangkan tahun lalu pria asal Peusangan itu mendapat penghargaan karena tulisannya berjudul: Mancong dan Inovasi Seorang Mantan Kombatan.“Alhamdulillah, saya kembali mendapat penghargaan dari Adiwarta Jakarta,” katanya, Minggu (18/12). (cb02)

Penerbangan Di Bandara SIM Banda Aceh Tiba (flight, asal, waktu) Garuda Indonesia

Berangkat (flight, tujuan, waktu)

GA 142 Jakarta/Medan GA 146 Jakarta/Medan

10:40 15:50

GA 143 Medan/Jakarta GA 147 Medan/Jakarta

11:25 16:45

Y6 555 Jakarta * Y6 537 Jakarta/Medan

19:05 12:30

Y6 556 Jakarta** Y6 538 Medan/Jakarta

07:05 12:30

JT 304 Jakarta JT 396 Jakarta/Medan

11:35 20:00

JT 397 Medan/Jakarta JT 307 Jakarta

06:40 12:15

SJ 010 Jakarta/Medan


SJ 011 Medan/Jakarta


Batavia Air Lion Air

Sriwijaya Air Air Asia

AK 305 Kuala Lumpur *** 12:20

AK 306 Kuala Lumpur*** 12:45

FY 3401 Penang ****

FY3400 Penang ****

Fire Fly


* Setiap Selasa, Kamis, Minggu. ** Setiap Senin, Rabu, Jumat. *** Setiap Senin, Rabu , Jumat dan Minggu. **** Setiap Selasa, Kamis dan Minggu.


WASPADA Senin 19 Desember 2011

BIREUEN (Waspada) : Apa Lahu, artis Aceh kenamaan, tidak kuasa mengelak lagi saat dirinya bersama sepeda motor Supra yang dikendarai digiring anggota Satlantas Polres Bireuen ke Pos Penjagaan di kawasan Simpang IV kota setempat, Sabtu (17/12). Pasalnya, dia mengendarai motornya saat itu tidak memakai helm. “Alahai, ka meucarueh kueh kali nyoe, karena hana roeh ku pakek helm, get that-that kanjai teuh (aduh hai, aku tidak bisa mengelak lagi kali ini, karena tidak kupakai helm saat mengendarai, benar-benar malu aku),” katanya. Pantauan di lapangan, Apa Lahu, terperangkap razia polisi dan sejumlah kendaraan roda dua sudah diamankan di depan Pos Lantas yang muncul tiba-tiba. Kapolres Bireuen AKBPYuri Karsono melalui Kasat Lantas AKP H Suharmadi melalui KBO Satlantas Ipda Sufly di sela-sela menggelar razia

mengatakan, razia tersebut sebagai upaya untuk meningkatkan kesadaran hukum berlalulintas, sekaligus untuk meminimalisir kecelakaan yang sering terjadi di wilayah hukumnya. Selain itu, kata Sufly, operasi rutin tersebut juga untuk mencegah maraknya aksi balap liar yang mulai kambuh lagi di kalangan para ABG. “Berdasarkan perintah Kapolres sepedamotor para pembalap liar bila tertangkap maka motornya akan ditahan selama dua bulan,” katanya. “Dalam razia sebelumnya 46 unit sepedamotor yang ditilang, sedangkan malam ini 32 unit termasuk milik Apa Lahu, 10 unit penindakan STNK, SIM 12 dan 10 unit sepeda motor ditilang. Sanksi tilang diberlakukan karena ada di antara pengemudi tidak membawa surat lengkap dan tidak memakai helm depan belakang,” kata Sufly. (cb02)

Ratusan Anggota Pramuka Sakawira Kartika Ikut Persami Waspada/Abdul Mukthi Hasan

Kanit Tujawali Aiptu Hendri Yanan, menanyakan surat kendaraan kepada Apa Lahu, artis, pelawak dan penyanyi Aceh di depan Pos Satlantas Polres Bireuen, Sabtu (17/12) malam.

Kapal Bocor, KMP Teluk Sinabang Batal Berangkat LABUHAN HAJI (Waspada): KMP Teluk Sinabang yang melayani rute Pelabuhan Labuhan Haji Aceh Selatan menuju Sinabang di Kabupaten Simeulu, dalam perjalanan, Sabtu (17/12) terpaksa harus kembali merapat ke pelabuhan dan gagal berangkat akibat adanya laporan kebocoran di bagian dek mesin di kapal tersebut. Akibat kondisi tersebut sampai saat ini ratusan penumpang serta puluhan kendaraan harus terlantar dan menumpuk di pelabuhan karena pembatalan keberangkatan tersebut. Chief Officer KMP Teluk Sinabang, Eko Medianto yang ditemui Waspada, Minggu (18/ 12) menjelaskan, kapal yang memuat 276 penumpang, 46 unit kendaran roda dua, 13 unit roda empat, 10 unit kendaran golongan lima dan 4 unit kenda-

ran golongan enam serta 107 ton barang, harus kembali merapat ke Pelabuhan Labuhan Haji setelah melakukan pelayaran selama hampir satu jam setelah berangkat dari pelabuhan pada pukul 22:10. Keputusan untuk merapat kembali ke pelabuhan tersebut menurut Eko sebagai bentuk tindakan safety (keselamatan) mengingat jarak tempuh yang masih terlalu jauh. “Kita mengambil keputusan itu (balik ke pelabuhan) karena jarak tempuh yang memang jauh, sekaligus kita ingin mengatasi terlebih dahulu kebocoran di dek mesin, saat ini kebocoran sudah kita tangani dengan menyemen, namun pihak Sahbandar membuat keputusan bahwa kapal tidak laik berlayar, sehingga kita tidak dapat melakukan pelayaran, kita juga belum mengetahui kapan kapal pengganti akan masuk mengingat penumpang juga sudah antri dan belum dapat diberangkatkan,” jelas Eko yang memastikan kondisi kapal yang berusia 4 tahun tersebut masih

laik untuk berlayar. Daminsyah Moningka, Kepala Operasi ASDP Cabang Singkil yang menjadi operator pelayaran KMP Teluk Sinabang terkait persoalan tersebut mengaku belum dapat memberikan kepastian terhadap kapal pengganti yang akan melayani penumpang yang menunggu di pelabuhan. Pihak ASDP mencoba mencarikan solusi berupa kapal pengganti yang akan diusahakan sesegera mungkin merapat ke Labuhan Haji. “Saya masih menunggu keputusan dari direksi untuk kapal pengganti, saat ini ada kemungkinan kapal KMP Simeulu di Sabang untuk kita turunkan, persoalan yang terjadi dengan KMP Teluk Sinabang juga sudah kita laporkan,” ujar Daminsyah. Sedangkan pihak Sahbandar yang telah memutuskan penghentian pelayaran KMP Teluk Sinabang ketika dimintai konfirmasinya enggan memberikan keterangan secara jelas. (cb05)

Banyak PNS Tak Masuk Dinas Siang MEUREUDU (Waspada) : Banyak pegawai negeri sipil (PNS) tidak hadir pada dinas siang hari. Tidak sedikit pegawai yang bolos usai jam istirahat siang, mereka tidak lagi masuk dinas, ungkap beberapa sumber, Minggu (18/12). Meskipun jumlah pegawai yang mangkir tergolong banyak di siang hari hingga jam pulang kerja pada sore hari, namun belum ada tindakan dan sanksi yang diberikan Pemkab setempat sehingga kebiasaan mangkir para PNS di siang hari semakin leluasa. Begitupun, sumber berkompeten di Setdakab Pidie Jaya itu secara tegas mengatakan, terhadap PNS yang mangkir alias tidak lagi masuk siang setelah istirahat tetap dikenakan sanksi. “Kalau sudah diingatkan berulang kali, namun tetap saja membandel,

maka sanksinya akan dikenakan,“ katanya tanpa menyebut sanksi yang diberikan itu dalam bentuk apa. Bupati Pidie Jaya (PiJay) HM Gade Salam juga mengakui tingkat kedisiplinan PNS di lingkungan Pemkab PiJay itu dinilai mulai menurun. Gejala buruk itu dikhawatirkan akan berpengaruh terhadap capaian kinerja Satuan Kerja Perangkat Kabupaten (SKPK) serta terganggunya pelayanan masyarakat yang seharusnya menjadi prioritas utama. Untuk menindaklanjuti persoalan itu, Bupati PiJay telah menyurati semua pimpinan SKPK, mulai Sekda, asisten, para kadis, badan, kantor, kabag, camat, Majelis Permusyawaratan Ulama (MPU), Majelis Pendidikan Daerah (MPD), Majelis Adat Aceh (MAA) dan Baital Mal setempat, supaya disiplin dan

taat aturan adalah kewajiban PNS. Jika melanggar akan diambil tindakan tegas. Surat Bupati ber-nomor 060/7248, tanggal 10 Oktober 2011 ditujukan kepada Sekda, asisten, pimpinan SKPK, sekretaris DPRK, Inspektur, semua camat, sekretaris KIP/MPU/ MPD,MAA serta Baital Mal dan tembusannya disampaikan kepada gubernur dan Ketua DPRK setempat menyebutkan, penurunan tingkat kedisiplinan PNS adalah berdasarkan hasil pantauan, evaluasi dan monitoring dilakukan Pemkab Pidie jaya dalam kurun waktu selama empat bulan terakhir. Bupati Gade Salam, yang ditanya mengenai hal itu tidak membantah. Jika belakangan ada penurunan kedisiplinan PNS, Pemkab, kata bupati, telah menyurati semua pimpinan supaya menjadi perhatian. (b09)

Bakal Dibangun Sistem Terpadu, UNDP Survei TPA Alue Liem LHOKSEUMAWE (Waspada) : Tim United Nations Development Programme (UNDP) mengirim utusannya untuk melakukan surveI di Tempat Pembangunan Akhir (TPA) di Desa Alu Liem, Kecamatan Muara Dua, Kota Lhokseumawe, Minggu (18/2) menyusul rencana ajuan Badan Lingkungan Hidup dan Kebersihan (BLHK) membangun sistem buang sampah secara terpadu di kawasan itu. Hal itu diungkapkan Kepala Badan Lingkungan Hidup dan Kebersihan (BLHK) Lhok-seumawe Saiful Amri melalui Kabid Kebersihan dan Sanitasi Marsidan, kemarin, terkait kunjungan UNDP. Marsidan mengatakan, UNDP mengutus Firza Subchan selaku konsultan yang mela-kukan survei di TPA Alue Liem pada Jumat (16/12) dan BLHK mendampinginya selama berada di lapangan. Bahkan kunjungan ini merupakan yang kedua kalinya dilakukan UNDP di mana sebelumnya pada

Januari 2010 mengutus Faisal sebagai konsultan. Marsidan menyebutkan, kedatangan mereka dalam rangka melakukan survei kelayakan TPA Alue Liem yang rencananya akan dibangun sistem terpadu jenis TPA Open Dumping yang pertama kali di Lhokseumawe. “Ini merupakan respon UNDP terhadap program pembangunan TPA terpadu Open Dumping dan Lead Land Fiil yang kami ajukan terkait pada Januari 2010. Mereka sedang memantau langsung kondisi kelayakan TPA Alue Liem,” papar Marsidan. Selama ini TPA Desa Alue Liem menerapkan sistem Open Dumping yang kinerjanya mudah, biaya operasi dan intensifnya murah, namun banyak menimbulkan kerugian dan dampak buruk. Misalnya menimbulkan pencemaran udara oleh gas, debu, bau dan cepat terjadinya lendir yang mendorong timbul-

nya sarang nyamuk. Diperkirakan pembangunan TPA terpadu yang pernah dibangun oleh UNDP di Kota Banda Aceh menelan biaya Rp3,5 miliar. Bila TPA Alue Liem layak diterapkan sistem terpadu, sambung Marsidan, maka pihak UNDP akan membantu biaya pembangunannya. Sedangkan untuk kelanjutan pasca pembangunan seperti biaya pemeliharaan dan perawatan akan ditangani sendiri Pemko Lhokseumawe. Hasil pantauan sementara pihak UNDP, tutur Marsidan, mereka terlihat puas dengan kondisi TPA Alue Liem seluas enam hektare yang memenuhi kriteria untuk diubah menjadi TPA terpadu. “Pihak UNDP akan memberi keputusan resmi dan membuat MoU dengan BLHK dan Pemko Lhokseumawe sebelum April 2012. Karena posisi UNDP sekarang menjelang akhir tugas, maka dalam waktu singkat akan mencoba merealisasikannya,” ujarnya. (b16)

BIREUEN (Waspada) : Sekitar ratusan anggota Pramuka Sakawira Kartika binaan Koramil 01 Bireeun, mengikuti kegiatan perkemahan Sabtu-Minggu (Persami) di Pantai Ujong Blang, di komplek Koramil Kuala, kecamatan setempat, 17-18 Desember. Dandim 0111/Bireuen Letkol Inf M Arfah melalui Danramil 01 Kota Juang, Kapten Arh Ronald Samosir, Minggu (18/12) mengatakan, dalam rangka mengembangkan fungsi utama gerakan pramuka sekaligus untuk membentuk generasi muda Indonesia yang berkepribadian, berwatak serta berbudi pekerti luhur dan untuk membangkitkan semangat kaum muda, maka acara Persami seperti itu digelar. Selain itu, kata Samosir, dalam acara Persami yang dilaksanakan tersebut juga dalam rangka pelantikan penegak bantara untuk Sakawira

Kartika yang sudah dididik selama setahun sekaligus melaksanakan tradisi penyambutan anggota penegak baru, dari berbagai SMA sederajat di Bireuen. Di samping itu juga turut melaksanakan upacara penyematan pangkat bantara kepada anggota senior dan pemasangan kacu bagi anggora pramuka Sakawira Kartika. Pelatih Pramuka Hayatul Fitriani secera terpisah menambahkan, 32 bantara penegak yang mendapatkan penyematan pangkat bantara sebelumnya dibimbing bersikap sopan dan santun dalam kegiatan kepramukaan yang juga menjadi salah satu penilaian untuk mendapatkan pangkat bantara penegak. “Dalam kegiatan pramuka Sakawira Kartika kali ini ada lima krida yaitu, krida Sofifa, montenering, pionering, krida penanggulangan dan krida navigasi darat (navrat-red),” kata Hayatul Fitriani. (cb02)

Pembebasan Tanah Jalur KA Di Bireuen Rampung Ganti Rugi Akan Dibayar Bulan Ini BIREUEN (Waspada) : Pembebasan tanah untuk pembangunan jalur Kereta Api Aceh di empat desa di Kecamatan Gandapura dan tiga desa di Kecamatan Kuta Blang sudah rampung setelah mendapat kesepakatan pemilik tanah dengan Pemkab dan Panitia Sembilan. Pembayaran ganti rugi untuk 126 pemilik tanah di Kecamatan Gandapura dan 268 pemilik tanah di Kecamatan Kuta Blang akan dibayar Desember ini dengan sumber dana APBN 2011 sebesar Rp49 miliar lebih. Asisten I Setdakab Bireuen Murdani didampingi Muhammad Dahlan Kepala Satuan Kerja (Satker) KA dan sejumlah Panitia Sembilan menjelaskan hal itu di kantor Satker KA Bireuen, Minggu (18/12). Dijelaskan, harga ganti rugi tanah yang disepakati 126 pemilik tanah di Kecamatan Gandapura dan 268 pemilik tanah di Kecamatan Kuta Blang yang terkena jalur pembangunan rel KA Bireuen – Lhokseumawe yang sudah mendapat kesepakatan antara pemilik tanah dengan Panitia Sembilan, Sekdakab, Asisten I, BPN, Kabag Pemerintahan, Kabag Umum, Camat Gandapura, Camat Kuta Blang, Dinas PU, Pertanian dan para Geuchiek setempat, 6 Desember lalu. Kesepakatan itu dikukuhkan dengan Surat Keputusan Bupati Bireuen No. 456 Tahun 2011, tanggal 7 Desember 2011 disepakati bersama Rp120 ribu hingga Rp150 ribu per meter bujur sangkar tergantung letak lokasi tanah, harga ganti rugi dibagi dua kategori. Selain ganti rugi tanah juga dibayar ganti rugi bangunan permanen Rp2.336.000 per meter bujur sangkar, semi permanen Rp2.045.968, per meter bujur sangkar dan bangunan biasa Rp1.937.285 per meter bujur sangkar. Menyusul pagar beton dan kawat duri dibayar tiga kategori, Rp1.152.301, Rp1.014.025 dan Rp 944.887 per meter bujur sangkar. Pagar BRC, tiga kategori Rp1.138.897, Rp1.178,228 dan

Rp1.097. 895 per meter bujur sangkar. Beton Cor Rp408 ribu per meter bujur sangkar, kuburan permanen Rp650 ribu per meter bujur sangkar, kuburan biasa Rp450 ribu per meter bujur sangkar. Kandang lembu Rp850 ribu per meter bujur sangkar dan kandang kambing Rp500 ribu per meter bujur sangkar. 126 Pemilik tanah yang terkena lokasi jalur KA di Kecamatan Gandapura Desa Alur Mangki, Lingka Kuta, Lapang Barat dan dan Blang Keude. Sedang 268 pemilik tanah yag terkena jalur KA di Kecamatan Kuta Blang, Desa Paya Rangkulueh, Kulu Kuta dan Desa Blang Me. Kepala Satker KA Bireuen, Muhammad Dahlan menjelaskan, jalur rel kereta api Bireuen – Lhokseuawe dibangun sepanjang 57 kilometer. Lokasi tanah yang dibebaskan untuk pembangunan jalur KA Gandapura – Bireuen tahap pertamaa sepajang 26,9 kilometer setelah selesai pembayaran ganti rugi tanah pembangunannya akan dimulai awal 2012 dan akan dilanjutkan dengan tahap berikutnya ditargetkan jika tidak ada halangan 2015 akan rampung. Muhammad Dahlan menyampaikan penghargaan dan terima kasih kepada seluruh pemilik tanah di Kecamatan Gandapura dan Kuta Blang yang berpartisipasi besar memberikan tanahnya dibebasklan untuk pembangunan jalur KA Bireuen. Rel KA yang akan dibangun sekarang ini dengan lebar standar Sepur 1435 mm (1,435 meter) agar KA lebih aman tidak mudah terguling, lebih lebar dibanding dengan pembangunan rel KA sebelumnya yang sudah dibongkar. Keunggulan angkutan KA sebagai angkutan massal mampu mengangkut barang dalam jumlah besar, ekonomis, tepat waktu, ramah lingkungan, keselamatan umum lebih terjamin dibanding angkutan umum lain yang melalui jalur jalinsum yang semakin padat. (b12)

Abdul Hadi Djuli Pimpinan “DPR” Di Gampong BIREUEN (Waspada) : Abdul Hadi Djuli, yang juga Ketua PWI Perwakilan Bireuen, kembali terpilih sebagai pimpinan “DPR” di Gampong (desa) Juli Meunasah Tambo Kecamatan Juli, Bireuen melalui prosesi pemilihan Peutuha Peut (fungsi lembaga Peutuha Peut ini menyerupai lembagai legislatif), Sabtu (17/ 12) malam di meunasah desa setempat. Kepala Desa Juli Meunasah Tambo, Fakhri Hasballah usai memimpin rapat pemilihan tersebut menjelaskan, penunjukannya sebagai pimpinan Peutuha Peut terpilih secara aklamasi. Sebelumnya, masyarakat memilih sembilan anggota Tuha Peut desa tersebut dan oleh anggota terpilih tersebut secara aklamasi menetapkan A Hadi Djuli sebagai Peutuha Peut (Pim-

pinan Tuha Peut). Dia merincikan, susunan lengkap Tuha Peut desa setempat yaitu, Abdul Hadi Djuli (Peutuha), Mansor Saidi (Wakil Peutuha), Badriah binti Yusuf (Sekretaris), Agussalim, M Jamil Adam, Ghazali Yusuf, Anisah binti Mahmud dan Jamaluddin, semuanya sebagai anggota. “Peutuha Peut ini segera diusulkan agar di SK-kan oleh Pemkab Bireuen,” terangnya. Peutuha Peut merupakan mitra kerja kepala desa, terutama untuk mengawasi roda pemerintahan di desa. Dia menyebutkan, Peutuha Peut di bawah pimpinan Abdul Hadi mampu mengamankan perangkat desa sehingga masyarakat memilihnya kembali untuk masa bakti enam tahun ke depan. (b17)

Seleksi Panwascam Hampir Rampung BIREUEN (Waspada) : Tahapan seleksi calon anggota Panitia Pengawas Pemilu Kecamatan (Panwascam) untuk Pemilihan Umum Kepala Daerah, Gubernur/Wakil Gubernur Aceh di Kabupaten Bireuen hampir rampung dilaksanakan Panwaslu kabupaten setempat. “InsyaAllah beberapa hari lagi bisa kita lantik,” ucap anggota Panwaslu Kabupaten Bireuen, Abdul Majid, menjawab Waspada, Minggu (18/12) di Bireuen. Dia menyebutkan, seluruh calon anggota Panwascam dari 17 kecamatan di Kabupaten Bireuen akan mengikuti test kemampuan baca Alquran serta uji kepatutan dan kelayakan. “Dari 17 kecamatan ini ujiannya kita laksanakan selama dua hari, besok (hari ini-red) dan hari Selasa,” terang Abdul Majid seraya menye-

butkan, hasil uji tersebut akan ditetapkan tiga orang untuk anggota Panwascam tiap kecamatan. Menurutnya, usai pelantikan anggota Panwascam akan mengikuti Bimbingan Teknis (Bimtek) tentang pengawasan tahapan Pilkada. “Bimtek ini juga kita upayakan pelaksanaannya Desember ini, kemudian Panwascam akan membentuk PPL di setiap desa,” ucap dia. Abdul Majid menjelaskan, pembentukan Panwascam dan PPL dianggap mendesak mengingat hari pemungutan suara akan dilaksanakan 16 Februari 2012. “Kami mengharapkan dukungan dari semua pihak agar semua tahapan pemilihan gubernur dan wakil gubernur dapat berjalan damai dan aman,” harap Abdul Majid. (b17)


WASPADA Senin 19 Desember 2011

C3 Komedi Aceh Apa Lambak Kawen Laen Diluncurkan BANDA ACEH (Waspada) : Lambak Record kembali meluncurkan sebuah film komedi Aceh. Kehadiran film komedi terbaru ini makin menambah koleksi film serupa di Tanah Rencong. Produser Lambak Record, T Mukhtaruddin Fatani kepada Waspada, Sabtu (17/12) menyebutkan, Film Komedi Aceh bertajuk “Salah Faham, Apa Lambak Kawen Laen” sudah diluncurkan ke seluruh wilayah Aceh. “Ada 20 ribu keping yang sudah disebar ke seluruh Aceh,” kata T Mukhtaruddin Fatani, yang juga pelawak Aceh dengan nama tenar Apa Lambak ini. “Kami harap semoga ini mampu menghibur masyarakat Aceh,” katanya. Apa Lambak menyebutkan, film komedi Aceh itu berisikan kritik sosial yang selama ini acap terjadi di masyarakat. “Mengkritik sambil mengocok perut,” ujar pelawak yang juga penyanyi Aceh ini. Kata dia, film penuh tawa ini diperankan T Mukhtaruddin Fatani (Apa Lambak) Ajrina alias (Dek Maneh), Sumaiya, (Dek Maya), M Sofyan (Mr Gend), Rustam Effendi (Ayah Akob), Sulaiman Ishak (Ayah Klaha), Ledyawati (Ibu Klaha). Mukhtaruddin menambahkan, film ini menceritakan kesalahpahaman antara Apa Lambak yang beristrikan Dek Maya dengan sang mertua Ayah Klaha. “Akibat kesalahan paham itulah yang membuat Apa Lambak kawen Laen,” katanya. (b07)

Perlu Payung Hukum Soal Anak Punk

Waspada/Muhammad Riza

SEJUMLAH siswa SMAN 1 Simpang Ulim, Aceh Timur mengarungi banjir yang merendam sekolahnya. Banjir itu juga merendam ribuan rumah warga di Aceh Timur serta ratusan hektare tanaman padi yang baru siap ditanam.

Pedagang Di Aceh Barat Tertipu Karcis Palsu MEULABOH (Waspada) : Aparat Satpol PP dan WH Aceh Barat mengamankan SG, 35, warga lr Manggis, Kampung Belakang, Kec. Johan Pahlawan, karena diduga melakukan penipuan terhadap sejumlah pedagang. SG ditangkap Jumat (16/12) malam, saat menjalankan aksinya ke pedagang durian di Jalan Manekroo. Dalam aksinya, pelaku menggunakan karcis parkir yang berkorp Pemkab Aceh Barat yang sudah tidak berlaku. Setiap pedagang wajib menyerahkan Rp2.000 sesuai nilai tertera pada karcis yang juga menggunakan stempel parkir resmi tersebut. Kasi Trantib Satpol PP dan WH Aceh Barat, Chairizal Ramli mengatakan, penangkapan pelaku berdasarkan laporan pedagang yang menjadi korban penipuan. Meski telah berkoordinasi dengan pihak terkait (Dinas Perhubungan), namun tidak ditindaklanjuti. “Aksi ini sudah dua bulan sejak musim durian. Selain Manek Roo karcis ini juga digunakan di Pasar Bina Usaha. Per hari mereka bisa mengantongi 70 ribu,” kata Chairizal. Meski sempat diamankan di kantor WH setempat, namun SG akhirnya dilepas setelah dilakukan pembinaan. Petugas menyatakan mengetahui alamat dan pelaku cukup koperatif sehingga tidak perlu ditahan. (cb06)

Pengemis Sambil Gendong Bayi Marak Di Banda Aceh BANDA ACEH (Waspada) : Kendati berbagai upaya telah dilakukan oleh Pemerintah Kota (Pemko) Banda Aceh untuk penertiban gelandangan dan pengemis (gepeng) termasuk mening-katkan kesejahteraan masyarakat miskin, Namun upaya ini belum melahirkan harapan dari pemerintah setempat, serta berbagai kalangan termasuk pemerhati sosial di daerah itu. Sorotan tajam tentang banyaknya pengemis di Kota Banda Aceh yang setiap harinya beraktivitas di sejumlah tempat baik kantor, pasar, dan tak luput persimpangan lampu merah, SPBU, dilihat beresiko tinggi. Namun, kondisi ini sepertinya pihak terkait terlihat cuek dengan perkembangan itu, meski dinilai itu merupakan kewajibannya Dinsos dan Satpol PP dan WH. Sejumlah PNS di beberapa instansi di Banda Aceh, yang ditanyai Waspada terkait jumlah pengemis yang masuk ke kantor mereka meminta sumbangan, rata-rata setiap hari mencapai 10 orang, di antaranya paling banyak kaum perempuan, mulai usia muda termasuk yang menggendong anak sampai sudah lansia. Perbandingan lain, Waspada juga meminta tanggapan dari para pedagang di Kota Banda Aceh, Zainal Arian, 27, salah seorang pedagang membenarkan masih banyak peminta-minta termasuk yang meminta sumbangan untuk santunan anak yatim, pemba-ngunan masjid, pesantren, dan kebutuhan lainnya. Pantauan Waspada, Minggu (18/12) siang di simpang lampu merah di Jalan Mahmudsyah, Banda Aceh, seorang wanita paruh baya dengan menggendong bayi masih saja mengejar sejumlah pengendara kendaraan bermotor baik roda dua maupun roda empat untuk meminta bantuan. Bahkan pemadangan serupa juga sering terjadi di kawasan Simpang Lima Banda Aceh. “Kadang disayangkan anak-anak masih balita dijadikan alasan mengemis. Selain pengemis yang kian hari semakin bertambah, jumlah orang gila juga masih terlihat lalu lalang di Banda Aceh, anehnya suasana itu terlihat di sepanjang jalan protokol. Sangat disayangkan perhatian keluarga dan pihak terkait sama cueknya,“ ujarnya. (b09)


Dalam rangka HUT ke-116 BRI, Pimpinan Cabang BRI Blangpidie H Moch. Saleh beserta unsur Muspida Abdya melakukan serangkaian kegiatan sosial seperti penghijauan dengan melakukan penanaman ribuan pohon buah-buahan serta khitanan massal terhadap 116 anak yatim piatu, Sabtu (17/12) di Kantor Cabang BRI Blangpidie.

Tiga Hari Diguyur Hujan Puluhan Gampong Terendam PANTONLABU (Waspada) : Setelah tiga hari diguyur hujan deras, lima sekolah di Pantonlabu, Kecamatan Tanah Jambo Aye, Aceh Utara digenangi banjir. Akibatnya, aktivitas belajar mengajar di lima sekolah itu lumpuh total. Bukan hanya itu, puluhan gampong ikut terendam dengan ketinggian air rata-rata selutut orang dewasa. Kelima sekolah yang digenangi banjir, yakni SD Inpres

Meunasah Panton, SMP Negeri 1 Pantonlabu, SD Negeri 7, SD Negeri 3 dan SD Negeri 4. Selain itu, beberapa gampong juga ikut digenangi banjir yaitu Meunasah Panton, Rawang Iteik, Samakurok, Tanjong Cengai, Tanjong Minje, Tanjong Dalam, Meunasah Krueng, sebagian Desa Tanjong Ara, Matang Drien dan Kota Pantonlabu. Namun kondisi terparah terjadi di Gampong Samakurok. “Sudah dua hari banjir tak kunjung surut, malah bertambah. Banjir ini terjadi akibat sumbatan di saluran pembuang. Untuk mengatasi banjir tahunan ini, kita membutuhkan

lima plat beton dan ikut membersihkan saluran yang tersumbat,” kata Abdul Gafar, warga Pantonlabu. Backtiar H Anas, Geusyiek Meunasah Panton mengatakan, banjir di Pantonlabu disebabkan proyek pembangunan jalan yang mengakibatkan saluran tersumbat. “Dari 876 KK, sebanyak 300-an KK rumahnya terendam banjir. Karena itu, warga tersebut lebih memilih diam di rumah,” katanya. M Nasir, 30, tokoh masyarakat Gampong Matang Tengoh melaporkan, tiga gampong di daerahnya berubah menjadi kolam akibat terendam banjir.

Banjir disebabkan tidak adanya gorong-gorong di bawah badan tanggul irigasi yang dibangun beberapa tahun silam. Ke tiga gampong tersebut, Lhok Beuringen, Matang Teungoh dan Lhok Meurubo. “Kami mohon perhatian Kadis SDA untuk segera membangun goronggorong dan normalisasi tanggul,” pinta Nasir. Erfendi, Geusyik Gampong Cot Laba, Kecamatan Baktiya Barat menyebutkan, banjir melanda Kemukiman Buah, selain dikarenakan faktor hujan, juga diperparah dengan sumbatnya saluran buang di perbatasan Gampong Cot Murong dan Cot Laba. (b18)

Hasdian: Dana Aspirasi DPRK Simeulue Dipastikan Untuk Publik SIMEULUE (Waspada) : Wakil Ketua Dewan Perwakilan Rakyat Kabupaten (DPRK) Simeulue, HasdianYasin Sarmadiah, memastikan dana aspirasi dewan setempat yang dialokasikan dalam Anggaran Pendapatan Belanja Kabupaten (APBK) Simeulue tahun 2012 dipastikan sepenuhnya untuk kepentingan umum/publik. Pernyataan ini disampaikan Hasdian kepada Waspada di Sinabang, kemarin, menjawab adanya opini miring yang berkembang di tengah masyarakat di mana sebagian mengkhawatirkan dana aspirasi dewan itu pada realisasinya disalahgunakan oknum wakil rakyat untuk kepentingan

Hasdian Yasin Sarmadiah pribadi. “Kami semua dewan sudah komitmen akan menggunakan

seutuhnya dana yang ada untuk konsituen,” jelas Hasdian yang baru sekitar sebulan dilantik menjadi salah satu pimpinan DPRK menggantikan rekannya satu Partai Demokrat, Edwarmin yang meninggal dunia beberapa lalu akibat lever kronis. Adapun dirincihkannya jumlah besaran dana aspirasi dewan untuk masing-masing anggota sebesar Rp600 juta. Untuk wakil ketua dua orang dia dan Asdar Mansya MAS dari Golkar Rp800 juta per orang. Sedangkan untuk jatah Ketua DPRK Simeulue dari Partai Aceh H Arya Udin Rp1 miliar. Katanya, untuk kabupaten kepulauan itu, direncanakan baru pada 2012 itulah pertama

kali ada pengalokasian dana aspirasi. Diciptakan sematamata untuk menjawab tuntutan konsituen. Tatkala ada aitemaitem pembangunan diperkampungan/desa yang dianggap sangat urgen dilaksanakan dalam skala kecil dapat dijawab dengan aspirasi itu. Selama ini, kata Hasdian, seakan-akan eksekutif saja yang menentukan porsi pembangunan. Sehingga masyarakat banyak apatis terhadap peran wakil-wakilnya di lembaga legislatif. Diharapkan dengan cara ini sedikit stigma negatif bagi legislator di sana akan terkikis dan berubah menjadi positif. (cb04)

Ormas Islam Dukung Penerimaan Polisi Dari Santri Dayah BANDA ACEH (Waspada): Dua ormas Islam di Provinsi Aceh menyambut baik dan mendukung keinginan Kapolda Aceh menerima santri dayah menjadi polisi. Namun, keduanya berharap keinginan tersebut tidak hanya sekadar wacana, tapi benar-benar dapat direalisasikan. Pernyataan tersebut disampaikan Rais ‘Am Pengurus Besar Rabithah Thaliban Aceh (PBRTA), Tgk Hasby Albayuni dan Ketua Umum Pengurus Besar Rabithah Muta’allin Pidie seAceh (PB-RAMPI), Tgk Mukhtar Syafari S.Sos.I, secara terpisah di Banda Aceh, Minggu (18/12). Sebelumnya, Rabu (14/12), Kapolda Aceh Irjen Pol Iskandar Hasan menyampaikan bahwa untuk penerimaan polisi di Aceh tahun 2012 akan diutamakan dari dayah/pesantren atau sekolah agama. Hal ini

dilakukan menyusul banyaknya anggota polisi Aceh yang terindikasi bermoral buruk, terutama terkait narkoba. Menurut Tgk. Hasby Albayuni, pihaknya siap bekerjasama dengan Polda Aceh dan saat ini banyak santri dayah di Aceh yang mampu untuk menjadi polisi. “Kita juga memiliki Komando Ansarullah yang memiliki kriteria sebagaimana diharapkan Kapolda Aceh,” imbuhnya. Dengan adanya polisi yang berasal dari santri dayah/pesantren, sebut dia, PB-RTA mengharapkan nantinya ada di antara polisi yang akan menjadi da’i untuk mendidik umat, serta melakukan razia berbagai macam kemaksiatan yang marak terjadi belakangan ini seperti perjudian, perzinahan, mengonsumsi narkoba.

“Sehingga ke depan akan ada polisi syariat yang dipersenjatai. Mereka tidak hanya melakukan pembinaan bagi umat, tapi juga mampu bersikap tegas menegakkan Syariat Islam secara kaffah di Aceh,” pungkas Tgk Hasby Albayuni. Ketua Umum Pengurus Besar Rabithah Muta’allimin Pidie (PB-RAMPI) se-Aceh Tgk Mukhtar Syafri mengatakan, pihaknya sangat mendukung wacana Kapolda Aceh mengenai penerimaan anggota polisi yang berasal dari santri dayah/pesantren. “Selama ini, kita menyesalkan banyaknya polisi yang justru menjadi pelindung berbagai pelanggaran seperti mengonsumsi dan mengedarkan narkoba, yang semuanya terjadi karena rapuhnya pendidikan moral yang mereka dapatkan,” katanya. Karena itu, Tgk. Muhktar

menyatakan bahwa keinginan Kapolda Aceh untuk menerima santri dayah/pesantren menjadi anggota polisi tersebut merupakan kebijakan yang sangat tepat, terutama untuk meminimalisir pelanggaran hukum oleh anggota polisi itu sendiri. Dalam kesempatan itu, PBRAMPI se-Aceh juga mengapresiasi tindakan Kapolda Aceh atas pembongkaran kasus 1.000 anggota polisi di Aceh yang mengonsumsi narkoba, serta banyaknya temuan obat-obat terlarang dan narkotika oleh aparat kepolisian Aceh belakangan ini. “Kami harap anggota polisi yang terbukti menggunakan narkoba itu dapat diberikan hukuman yang adil sebagaimana masyarakat lainnya, begitu juga terhadap pelaku pengedar narkoba yang masih banyak bergentayangan di Aceh,” papar Mukhtar Syafari. (b04)

BANDA ACEH (Waspada) : Sejumlah kalangan di Aceh menilai, perlu ada payung hukum untuk penanganan anak-anak punk di Aceh, tidak hanya menyangkut pembinaan, tetapi juga penindakan agar perilaku menyimpang dari adat-istiadat dan agama tidak terulang lagi ke depan. Banyak kalangan di Aceh menilai, selama ini kehidupan anakanak punk di Bumi Serambi Makkah itu terlalu bebas dan sulit dikendalikan. Awal kehadiran mereka bahkan telah menimbulkan anti-pati dari masyarakat setempat. Tidak hanya penampilan mereka yang terkesan lusuh dan bertentangan dengan Syariat Islam, tetapi sikap mereka juga terkadang tidak bersahabat dan tempramen. “Saya pikir payung hukum itu perlu, tidak hanya untuk anakanak punk, tetapi juga untuk anak-anak yang lain. Tetapi persoalannya menyusun payung hukum atau qanun itu butuh waktu. Sambil menunggu payung hukum rampung dikerjakan, penanganan terhadap mereka harus tetap dilakukan,” kata Ketua PW Nahdhatul Ulama Aceh Tgk Faisal Ali saat berbicara dengan Waspada di Banda Aceh, Minggu (18/12). Tgk Faisal Ali yang juga Sekretaris Ulama Dayah Aceh (HUDA) mengajak seluruh lembaga di Aceh, Pemerintah Aceh dan pihak kepolisian setempat tidak perlu ragu dan khawatir dengan pelanggaran HAM dalam menertibkan anak punk di daerah itu. Sebab yang dilakukan Pemerintah Kota Banda Aceh dan pihak kepolisian itu adalah melakukan pembinaan, bukan kekerasan. Tgk Faisal bahkan meminta Pemerintah Perancis dalam hal ini pihak kedutaannya di Jakarta untuk tidak ikut campur tangan persoalan yang terjadi di Aceh. “Di Perancis orang menggunakan cadar dilarang, tapi mengapa aktivis atau lembaga-lembaga yang bergerak di bidang hak azazi manuasia tidak menyuarakan bahwa itu melanggar HAM. Inikan sikap yang tidak adil terhadap kita,” kata Tgk Faisal Ali. Menurutnya, akibat ada pihak-pihak yang mengait-ngaitkan masalah tindakan pembinaan yang dilakukan Pemerintah Kota Banda Aceh terhadap anak-anak punk sesuai Undang-Undang Syariat Islam yang diberlakukan di Aceh dengan pelanggaran HAM, menjadikan HAM tidak ada lagi nilainya di mata masyarakat Aceh. “Ini membuat HAM menjadi tidak berharga di mata masyarakat,” tegasnya. M Juned, 61, warga Kota Banda saat ditemui terpisah mengungkapkan, dirinya sependapat jika memang masalah penanganan anak punk dan anak-anak terlantar di daerah itu diatur dalam qanun. “Ini akan membuat penanganannya terhadap anak-anak tersebut lebih serius. Soal ada pendapat macam-macam di luar, Pemerintah Aceh maupun Kota Banda Aceh dana kabupatenkota lainnya tidak perlu khawatir,” kata M Juned. Soal pembinaan terhadap anak punk yang dilakukan Pemerintah Kota Banda Aceh dengan dibantu aparat kepolisian, telah menimbulkan pro dan kontra dari sejumlah pihak terutama dari luar Aceh. Sedangkan di Aceh sendiri, berbagai kalangan justru mendukung tindakan yang diambil Pemerintah Kota dan Polresta Banda Aceh. Kapolda Aceh Irjen Pol Iskandar Hasan yang ditanya mengenai hal itu membenarkan ada dugaan dari dunia luar bahwa pembinaan yang dilakukan terhadap anak-anak punk di Aceh diduga telah melanggar HAM karena merampas kemerdekaan seseorang. “Semua yang kita lakukan itu tidak melanggar HAM karena kita membina anak-anak yang berperilaku menyimpang agar kembali berperilaku normal serta menaati norma yang berlaku di tengah-tengah masyarakat,” katanya. Menurut Kapolda, yang harus mendapat perhatian dari semua pihak sekarang ini satu adalah bagaimana kelanjutan pembinaan setelah sepuluh hari anak-anak tersebut mengikuti pembinaan di SPN. “Saya pikir memang perlu ada payung hukum untuk membina maupun menindak mereka (anak punk-red) bila ada lagi, baik yang baru maupun yang pernah dibina mengulangi lagi berperilaku menyimpang di Aceh. Karenanya Pemerintah Aceh perlu memikirkan hal itu,” kata Kapolda. (b05)

Sikap Wali Kota Banda Aceh Tolak Qanuh Akidah Akhlaq Dipertanyakan BANDA ACEH (Waspada) : Sikap Wali Kota Banda Aceh yang menolak menandatangani Qanun Akidah Akhlak yang disodorkan DPRK Banda Aceh serta tidak memasukkannya dalam RAPBK Banda Aceh Tahun 2012, mengundang tanda tanya dari berbagai kalangan. Pertanyaan itu salah satunya datang dari Ketua Senat Mahasiswa Pasca Sarjana IAIN Ar-Raniry Banda Aceh, Teuku Zulkhairi, yang mengaku tidak habis pikir dengan sikap wali kota tersebut dan mempertanyakan apakah urusan akidah dan akhlak tidak penting lagi di Banda Aceh. “Sudah jelas begitu rusaknya moral remaja kita sekarang. Tapi, kenapa untuk itu masih dibutuhkan diskusi panjang? Anehnya lagi, kenapa sebagian fraksi yang notabene anggota dewan muslim, justru menganulir keputusannya sendiri yang sudah disepakati dalam paripurna DPRK,” ungkapnya di Banda Aceh, Minggu (18/ 12). Zulkhairi terus terang mengaku aneh dengan kondisi ini. Di satu sisi Pemko Banda Aceh sangat gencar melakukan razia syariat, menangkap komunitas anak punk, menangkap aktivis aliran sesat, razia salon, hotel yang terindikasi membuka praktik mesum, namun di sisi lain, ketika ada Qanun Akidah Akhlak yang diharapkan menjadi upaya preventif (pencegahan) lewat jalur pendidikan di sekolah bagi timbulnya kemaksiatan dan pelanggaran syariah dan kemaksiatan, pihak eksekutif di Banda Aceh malah enggan menandatanganinya. “Bukankah ini sama saja dengan bohong,” katanya. Menurut dia, urusan akidah dan akhlak sesungguhnya bukan urusan sesaat. Maka, lahirnya Komisi Akidah Akhlak seharusnya tidak perlu dihalang-halangi dengan alasan apapun. “Jika alasannya akan berbenturan dengan program Dinas Pendidikan dan Dinas Syariat Islam sehingga qanun tersebut tidak disahkan, maka ini saya kira sangat tidak masuk akal,” kata Zulkhairi. Menurut dia, kalau pola pelaksanaannya dititip pada dinasdinas, maka ini adalah pola lama yang sudah diketahui kurang berhasil. Karena persoalan moral dan aqidah dianggap sangat penting, sudah semestinya ada komisi khusus yang menanganinya, seperti KPK yang dlahirkan karena korupsi sudah merajarela dan tidak sanggup lagi ditangani oleh institusi yang sudah ada. Jika alasanya akan menguras anggaran, dia juga menganggapnya tidak masuk akal. Sebab, dari hasil penelusuran, Pemko juga tidak mengalokasikan anggaran yang makimal untuk Dinas Syariat Islam. Apalagi Banda Aceh sedang digadang-gadang menjadi Bandar Wisata Islami. “Kenapa persoalan anggaran dijadikan masalah. Bukankah jika moral yang rusak, harga yang harus kita tebus akan lebih mahal,” ujar Teuku Zulkhairi. (b04)

C4 1 CM 2 CM


Rp. 12.000 Rp. 24.000

3 CM Rp. 36.000 4 CM Rp. 48.000


AUTOMOTIVE Informasi Pembaca


Bursa Automotive

: Air Condition : Ban Radial : Central Lock : Nippon Denso : Double Blower


: Power Stearing : Power Window : Radio Tape : Velg Racing : Electric Window


Terios Angs. 3,6Jt-an Minibus Luxio, Sirion Pick Up Angs 2,3Jtan Adek Astra: 081 263 400 55, PIN: 274CA61C SERBU....DAIHATSU BARU...!!

Terios Sirion, Luxio, Pick Up, atw ingin Bw plg “All New Xenia !!” DP & Angs. Ringan. Proses Cpt. Data dijemput. Hub. ZOEL: 0852 7542 2777 - 0819 833 506


Terios Pick Up New Xenia Minibus Luxio Sirion Dapatkan juga Undian total 5 Milyar Pesan sekarang di nomor: 0813 6237 8733 (Virton Astra)


AllNewXeniaDPMulai18Jt-an,Angs.3Jt-an TERIOS,LUXIO,SIRION,PICKUP,GRANDMAX Disc sampai 15 Jt DP 15%, Syarat mudah Hub. Tono: 0813.7067.5757 - 7517.0677


Gran Max Pick Up 1.3...DP 8 Jt’an Angs 9 Jt’an Luxio D......................DP 15 Jt’an Angs. 18 Jt’an Xenia 1.0 D New...DP 14 Jt’an Angs.22 Jt’an Terios TS Xtra...............DP 18 Jt’an Angs. 5 Jt’an Pesan New Xenia sekarang !!! Hub. Erwin HP. 0812.6315.4132 (061) 7740.2067


1. Daihatsu Zebra 1.0 ‘87 BK/ Mesin/ No. seksi Asli, Harga Rp. 17,5 Jt/nego 2. Pick Up ‘89, W. Hijau, Mulus, Siap pakai, Rp. 17 Jt 3. Carry ‘86 M. Bus, W. Mrh, Krs. G. Mada, Rp. 12,5 Jt 4. Zebra Prima 21 M/ Bus Mulus Thn ‘95 Hrg Rp. 22 Jt 5. Ford Lazer Sedan Mrh ‘98 Mulus, Hrg Rp. 16 Jt Hub. 0852.9678.0680 (Bpk. T. Sitepu)


Carry PU 1.5 FD. Rp. 11Jt-an Angs. 2.494.000,APV Arena Rp. 14Jt-an Angs. 3.880.000,Splash GL Rp. 13 Jt Angs. 3.977.000,Hub. 0812 6540 809 / 77722121 NISSAN Livina XR M/T Thn. 2008. Biru met, BK Rp. 133 Jt. Hub. Jl. Biduk No. 57 (77863981) Cash/Kredit.

5 CM 6 CM

Rp. 65.000 Rp. 78.000

NISSAN Xtrail XT A/T Thn. 2004 VR 18. Coklat Met. BK Mdn Rp. 150Jt. Hub. 91327433 TOYOTA Innova G Matic Thn. 2005. Silver, BK Mdn Rp. 149Jt. Hub. 0853 70899893 TOYOTA Kijang LGX 1.8 Bensin Thn. 2003. Silver, plat B Rp. 122Jt. Hub. Jl. Biduk No. 57 (77863981) TOYOTA Kijang LX 1.8 Bensin Thn. 2004. AC, VR, PS, CL, Jok kulit, silver, Plat BM/Pekan Baru Rp. 105Jt. Hub. 0812 6594 2789 TOYOTA Kijang Super Thn. 88 SOHC, 5 pintu AC, Tape, Jok kulit, warna abu2. Mobil terawat. Harga Rp. 34Jt. Hub. 0813 6126 5117

TOYOTA Kijang 93. Hijau metalik Long 6 Speed. Cantik Siap pakai. Hp. 0821 6506 4322

TOYOTA STARLET DIJUAL 1.3 SEG. Thn. 97, Warna Biru Mika, BK Medan asli, Velg Racing. Hub. 0812 6587 7895 TOYOTA BARU 100% Ready Stock

Gran New, Innova Diesel / Bensin. Rush, Dan Yaris Fortuner Diesel Avanza, Hilux. Dapatkan Discon Menarik. Bisa Tukar Tambah. Hub. 0813 6120 1719 / 6878 3325

TIMOR Thn ‘97 Warna Biru, Velag Racing, AC, Tape, Asli Medan, Hrg Rp. 38 Jt Hub. 0852.9663.2368


SEPEDA MOTOR DIJUAL S. Motor Mocin, model Supra X, Thn. 2005. Sehat, pajak Bln 5. Boleh T. Tambah dengan Astrea Grand/Legenda/Supra Fit S. Hrg. 2,9Juta Nego. HP. 0852 7637 4444

7 CM 8 CM

Rp. 91.000 Rp. 104.000

BURSA BUTUH DANA BUTUH DANA Jaminan Apa Saja. Sertifikat Tanah Mobil & Sp. Motor. Segala tahun. Hub. 061.8222 774 HP. 0853.6199.1500-0816 314 1807


Jaminan: SHM, SK Camat, HGB dan BPKB (Bantu Pelunasan BPKB). 3 Jam Cair 1 Juta - 500Juta. Hub. FAMILY FINANCE. 0813 7044 6668 - 0813 7044 6633





- Ganti Oli - Pasang Power Steering - Service Power Steering Jln. Sisingamangaraja No. 5 A.B. Medan Telp. (061) 7369224 (061) 7344954



SEDAN Rp. 600.000 Rp. 900.000 Rp. 1.000.000 Rp. 1.400.000

MINI BUS Rp. 700.000 Rp. 1.000.000 Rp. 1.100.000 Rp. 1.600.000


IKLAN KHUSUS 6x1,5 kolom Rp. 120.000

Pelanggan Yang Terhormat HA TI-HA TI terhadap penipuan yang mengatas HATI-HA TI-HATI namakan PT. Harian WASPADA, kami dari PT. Harian WASPADA tidak pernah mengirim sms untuk membeli TI-HA TI apabila anda ingin produk anda, dan HA HATI-HA TI-HATI melakukan transaksi jual beli melalui transfer. Segala akibat yang terjadi diluar tanggungjawab PT. Harian WASPADA. Apabila anda mencurigai sesuatu, silahkan hubungi kami di 061-4576602. Terimakasih



Siapa Cepat Dia Dapat Harga Mulai: Mdn - Jakarta Rp. 485.000,Mdn - P. Baru Rp. 360.000,Mdn - Batam Rp. 490.000,Mdn - Pdg Rp. 405.000,Mdn - Aceh Rp. 310.000,Mes - Pen Rp. 680.000,Paket P. Bintan Rp. 669.000,Segera Hubungi:



Door to Door Domestik & Int’l SRT-MOVING Telp. (061) 7711.8811 Jl. B. Katamso 557 Medan, - Ritra Group





Hub. Jl. Nibung II No. 114 Medan (Samping Medan Plaza) Telp. (061) 4566884 (Hunting) dekat Carrefour.

Khusus Medan Deli, Marelan, Labuhan, Belawan Hub. 0812 6390 660 Iklan Anda Dijemput





Penerbangan Via Singapore * Khusus bagi jama’ah dari luar kota nginap di Hotel Madani Gratis * Seluruh Jamaah Tertanggung ASURANSI

DAFTAR SEGERA Kantor Pusat: Gedung Gelora Plaza Lt. 1 Jl. S.M. Raja No. 4 / 18 Medan Telp. 061-7326981, 0813 7503 1889, 0852 6213 3488




Selamat & Sukses Atas Pelantikan


dr. H. AMRIN HAKIM SpB & Hj. IRAN ESLY LUBIS Yang diwisuda pada hari Rabu tanggal 24 Oktober 2011 di Hotel Grand Aston City Hall

dari AKHMAD DHAIROBI, SP & Keluarga


KRISNA WATER 1. Pemasangan Depot Air Minum Sistem

Multi Filtrasi & RO Rp. 14 Jt s/d 38 Jt 2. Pemasangan AMDK dan Pengurusan SNI & BPOM 3. Air Pegunungan 7000 Liter 4. Menyediakan Segala jenis Spare Part Depot Air Minum 5. Menyediakan Mesin Penjernih Air Rumah Tangga, R.S, Pabrik dll



Telp: 4158262, 77885049/69/79



Jual: - Prod anak” Dws blus, dress, tas second\ - Prod Anak” Dws blus, dress, kemeja New - Prod Sophie, Paloma, Kokopelli - Prod Tupperware, Oriflame - Prod Es Cream Mr. Cool, Doremi, Capinos, Fruties, Mr. Jell & alat” Hub: 0812 6530 373 / 7630 6625 U. Es Cream cr daerah Binjai, Stabat, Brandan, Labuhan Batu, Kutacane, P. Sidempuan, dll. NB: Cr. Member u. Prod. Sophie, Paloma, Kokopelli, Tuperware, Oriflame.




Jl. Kapt. Muslim No. 53-D Medan Telp. (061) 8457879 Jl. Serdang No. 368 B Medan Telp. (061) 453.2484 - 77839790 HP. 0812 600 5410

TV LCD 32” 22 LG= 1,8jt. 32”LCD/LG=3,2JT, 42” LCD Samsung=3,5Jt, 34 Sony = 2 Jt, 29” Flat Baru LG =2 Jt, 29” Bekas 900rb - 1,7 Jt. 14 - 21=300rb - 650rb, 17” LCD Monitor 1Jt, 22”=1,5jt. PS1=400rb, PS 2=800rb, DVD 200rb, Vortable = 700rb. Ampli Gitar=700rb, Sansui Technics-SU 7600 Spk. BMB= 1,45 Jt - EQ - TV Mobil=500rb

PROYEKTOR/ Infokus - LCD/ LED TV - LAPTOP - CAMERA DIGITAL (Semua merek, type, kondisi) projector lamp, spare part, accesories

Melayani luar kota Medan (ACEH - SUMBAR - RIAU) Info:

11 CM Rp. 165.000 12 CM Rp. 180.000


PUSAT SERVICE & RENTAL Hub: GOLDEN VISUAL Telp: (061) 7501.9693 - 8002.5611 HP. 0813.7310.5258 - 0813.6111.4147

9 CM Rp. 126.000 10 CM Rp. 140.000

Senin, 19 Desember 2011



Handicam Sony Hi-8=1Jt, Mini DVJVC=1,5Jt, DVD/HDD=3Jt, Camera 5 Mp - 12 Mp 500rb 1,2Jt. Fax= 600rb, LCD Projector, Printer HP= 450rb, Epson = 3Jt.


UD. SENANG HATI Hub. 4517509 - 0821 6322 4343 (Jual - Beli) Jl. Sekip 67 A

SAKAI Crystal Lamp



Distributor Mr. Genios Menyediakan Aneka Es suntik Mr. Genios, Mr. Cool, Capinos, Camelo, Jojo, Fruties, dan Aneka Snack. Dengan modal ringan untung besar. 100% halal. Berminat hubungi Bp. Fauzi. 0852 6012 8271. Perum Bumi Serdang Permai. Jl. Delima Raya Blok BB 10 Marindal Medan


BPKB Spd. Motor Honda BK 6297 SJ a/n. JAUTAN JUDIKA SIMAMORA Alamat: Jl. Cemara Kel. PB. Bengkel Baru Medan. No. Rangka: MHI JB 811X 8 K359886 No. Mesin JB81E - 1356196


1 Bh BPKB & 1 Bh STNK Toyota Kijang Standard KF 60 (Pick Up). Atas nama: PT. Sumatera EGa Mekinka,BK9322BT.No.Rangka: MHF 31 KF 6050044805. No. Mesin: FK - 0811 512. Bagi yang menemukan harap menghubungi ke 0812 6566 2797 atau 6871818. Tidak dituntut & Akan diberikan imbalan sepantasnya


1 Bh BPKB & 1 Bh STNK. Toyota Kijang Standard KF 60 (Pick Up) atas nama: PT. Sumatera Ega Mekinka BK 9323 BT. No. Rangka: MHF 31 KF 6050044682. No. Mesin: 7K-0811223. Bagi yang menemukan harap menghubungi ke 0812 6566 2797 atau 061 6871818. Tidak dituntut & Akan diberikan imbalan sepantasnya.




Didukung Oleh MNC Finance


WASPADA Senin 19 Desember 2011


SMS Hujat Calon Wali Kota Mulai Bertebaran

MUSIM SABU-SABU : Nelayan di wilayah Alue Bilie, Kecamatan Darul Makmur, Nagan Raya, selama Desember ini mendapatkan penghasilan tambahan dari kegiatan pengeringan sabu (sejenis udang ukuran kecil) dengan tingkat pendapatan mencapai jutaan rupiah saban harinya. Gelombang tinggi yang melanda sebagian pantai barat selatan Aceh menyebabkan penangkapan sabu meningkat karena populasinya cenderung mendekat ke arah pantai. Harga sabu kering setiap kilogram dihargai Rp20.000 hingga Rp25.000. Foto direkam pekan lalu ketika Adnan NS, tokoh masyarakat asal pantai barat selatan Aceh melakukan pengecekan kondisi lingkungan di wilayah Nagan Raya.

LANGSA (Waspada) : Salah satu Calon Wali Kota Langsa Tgk H Syech Muhajir yang akan maju dalam Pilkada mendatang mulai gerahdengantindakansejumlahoknumyangtidakbertang-gungjawab. Maka itu dia minta seluruh warga Kota Langsa agar jangan ada yang terpengaruh fitnah murahan dan tetap menge-depankan kedewasaan dalam berfikir rasional. Kepada Waspada di Langsa, Minggu (18/12), Syech Muhajir yang berpasangan dengan Tgk H Kamarullah mengatakan, pihaknya menyesalkan tindakan orang-orang yang tak bertang-gungjawab tersebut. Tindakan yang dimaksudkan itu, khususnya yang berkaitan dengan beredarnya SMS gelap yang belakangan ini marak terjadi. Dalam menyikapi hal tersebut, Syech Muhajir meminta para pendukungnya dan para pendukung calon-calon yang lain agar tetap menjaga komitmen menjaga perdamaian. Kemudianparapendukungmasing-masingcalonjugadiharapkan tidakmemburuk-burukkancalonlainnyabaiksecaraindividumaupun kelompok. “Jika bukan berasal dari pendukung, sebaiknya pahami saja visi dan misi masing-masing calon, kemudian tentukan pilihan sesuai dengan hati nurani,” kata Syech Muhajir. (b20)

Padi Uji Coba Biomaxx Capai 11 Ton LHOKSUKON (Waspada) : Panen padi menggunakan pupuk Biomaxx mencapai hasil sebanyak 11 ton per ha di Desa Blang, Kec. Tanah Pasir, Aceh Utara, Sabtu (17/12). Pemanenan perdana tersebut dilakukan Koramil bersama kelompok tani Makmue Beusare pada lahan seluas tiga hektare. “Pemberian pupuk ini pada padi untuk memberikan gambaran dan pemahaman kepada masyarakat, dengan pupuk dan bibit Biomaxx dalam satu hektare bisa menghasilkan gabah seba-nyak 9-11 ton. Itu terbukti hari ini,” kata Rahmadsyah, penyuluh dari Biomaxx. Dikatakannya, semua biaya serta perawatan ditanggung, tapi setelah panen hasilnya bagi dua. Kelebihan pupuk tersebut, bisa dimanfaatkan untuk semua tanaman. Karena itu waktu panen lebih cepat, dalam satu tahun bisa panen sampai empat kali. Namun dari itu, Tgk. Hanafiah, 51, pemilik lahan menyebutkan, saat ini mereka terkendala irigasi yang tidak stabil. “Kami berharap kepada pemerintah untuk bisa membangun saluran irigasi yang memadai agar bisa mengaliri sawah sesuai kebutuhan air pasca penanaman sampai panen,” tuturnya. (cmk)

Pengesahan APBK 2012 Jangan Asal Jadi BLANGPIDIE (Waspada) : Pengesahan Anggaran Pendapatan Belanja Kabupaten (APBK) Aceh Barat Daya (Abdya) tahun 2012 yang saat ini dalam proses penggodokan di DPRK setempat diharapkan tidak asal jadi, sehingga dikhawatirkan karena selama ini keberpihakan anggaran masih sedikit manfaat yang dirasakan rakyat kecil.

Waspada/Mustafa Kamal:

PANEN padi perdana dilakukan sejumlah anggota Koramil dan masyarakat di Desa Blang, Kec. Tanah Pasir, Aceh Utara, Sabtu (17/12).




Chawan Kupi, Tenaga: Koki, Martabak & Hamburger - Ahli jus - Nasi Goreng Yg berminat hub. 0852.6187.0066 atau Lokasi di Pantolabu


Kami perusahaan percetakan memerlukan beberapa tenaga kerja di bidang SABLON, dengan syarat sbb: - Pria, max 30 tahun (belum berkeluarga) - Tamatan min. SMA/ sederajat - Lebih diutamakan yang berpengalaman min. 2-3 tahun - Bertanggung jawab, rajin, jujur dan mampu bekerjasama Lamaran lengkap dikirimkan via pos ke alamat:

Jl. Timor No. 10VV/ 43 Medan 20231 (Tidak melayani lamaran yang diantar langsung) Paling lambat 7 (tujuh) hari sejak iklan dipasangkan


Biro perjalanan wisata yang sedang berkembang pesat membutuhkan karyawan dan karyawati untuk ditempatkan pada kantor Medan, dengan kualifikasi sebagai berikut: 1.Wanita usia max 30 tahun 2.Berpenampilan menarik dan bagi wanita bersedia mengenakan jilbab 3.P e n d i d i k a n D 3 P a r i w i s a t a , pengalaman min. 2 tahun bekerja di travel agent 4.Mampu berbahasa inggris 5.Bersedia bekerja dibawah tekanan 6.Lamaran dapat diantar langsung dengan kode: “MDN” Bagi yang bermiant lamaran dapat dikirim atau diantar ke:


Dengan Alamat Jl. Sutomo Ujung No. 102B Medan


Berpengalaman ada jaminan Rp. 50.000/ hari yang berminat hubungi: 0853 5959 3038 (Putra)


Gaji tetap, komisi, bonus Hubungi: Bpk. Akbar: 0821.6388.6438


Toko kelontong di Medan, membutuhkan tamatan Aliyah/ Samanniyah, tinggal ditempat kerja, rajin, jujur, sopan dan bersih/ tidak merokok Hub. 0821.6049.7202/ Andi DIBUTUHKAN

- Asisten Koky (Laki²) - Wetress (Laki² Perempuan) Syarat: - Rajin, jujur, berpengalaman - Muslim - Dari luar kota disediakan mess Antarkan lamaran ke: Jl. AR. Hakim No. 222CD Bagindo’s Cafe HP. 0852.9751.8008


LPGTK/ PAUT Favorit butuh cepat SMU/ D3/ S1 sbg guru, syarat: Kreatif datang langsung hub: Jl. KH. Wahid Hasyim no. 92 Medan Tp. 7623.5314/ 9158.3487 4533.875 - 456.9269



Informasi Pembaca Bursa Property

G R : Garasi LB : Luas Bangunan KM : Kamar Mandi LT : Luas Tanah KP : Kamar Pembantu RM : Ruang Makan KT : Kamar Tidur RT : Ruang Tamu SHM: Sertifikat Hak Milik

Harapan itu disampaikan Ikatan Mahasiswa Muhammadiyah (IMM) Cabang Abdya Julida Fisma, Sabtu (17/12).



Hub Telp. (061) 661.8116 - (061) 661.6802 - 7653.2188

4x20 m Jl. Sekip Gg. Padi 6F Petisah Hub. 0817.4799.202 LB. 100M², LT. 12X22M²,SHM, LISTRIK 900 WATT, PAM, BBS BANJIR, BISA MASUK MOBIL, HRG 310 JT/NEGO JL. RAHMADSYAH GG. SEKOLAH NO. 416 P. KOMAT I TANAH ADA BANGUNAN TUA JL. PURI NO. 161 SBH GG. PURNAWA, SHM, UKURAN 11X22M, Rp. 550 Jt/nego Hub. Pak Gafar 08139.756.756.7 (TP)


Sedang dibangun 11 pintu ruko di Jalan Mandor No. 23 Simp. Krakatau, LB.4x16m, Row 6 meter, SHM, PLN, PAM, Pintu plat, Full keramik, Cocok untuk usaha Praktek Dokter/ Toko HP & Warnet, H. 550 Jt, KPR/ bulan 6 Juta, Bisa bantu KPR, 2 Tkt, Siap huni/ Full keramik, Komplek 450 Jt, Sisa 8 Unit


Tnh Dijual Uk. 5x20m, SK Camat Jl. Makmur Psr. VII Tembung

Hub. 0852.7601.2770 - 0852.6113.0111


BANDA ACEH (Waspada) : Menjelang Tahun Baru 2012, cabai merah di pasar-pasar tradisional di Kota Banda Aceh dan Aceh Besar hingga Sabtu dan Minggu (17-18/12) masih terasa ‘pedas’ alias tinggi, sehingga merepotkan kaum ibu melengkapi kebutuhan dapurnya. Kenaikan harga dinilai signifikan itu, karena naik hampir mencapai 100 persen dari beberapa hari sebelumnya dianggap merepotkan ibu rumah tanggadalammengaturkeuanganke-luarga.Harga cabai sekarang mencapai Rp40.000 hingga Rp45.000 per kg, sebelumnya Rp18.000 hingga Rp20.000 per kg. PantauanSabtudanMinggu,selainhargacabai yang mengalami kenaikan, juga harga tomat ikutikutan kenaikannya bervariasi antara Rp8.000 hingga Rp10.000 per kg, padahal beberapa hari lalu harga tomat masih pada kisaran Rp5.000 sampai Rp6.000 per kg. Sejumlah pedagang mengaku kenaikan harga ini telah terjadi beberapa hari lalu. Kondisi ini bisa terjadi menjelang tahun baru karena permintaan yang banyak dan minimnya pasokan dari sentra produksi yang disebabkan kondisi

Pihaknya mengharapkan DPRK lebih teliti melihat susunan anggaran prog-ram yang diusul eksekutif. Apalagi mengingat pembahasan dalam masa menyambut dan mau pelaksanaan Pilkada, sehingga jangan sampai anggaran sarat dengan muatan program-program kepentingan politik yang disabotase untuk kampanye calon incumbent. “Sementara program prioritas untuk kepentingan semua sektor yang sesungguhnya diharapkan rakyat Aceh Barat Daya tidak tersentuh dalam anggaran 2012,” paparnya. (cb05)



Berbagai Model dan Warna Jl. Prof. H.M. Yamin SH. No. 344/Jl. Serdang Depan Gg. Sado Medan, HARI MINGGU TETAP BUKA



(TEMPAT KURSUS TERBAIK DI MEDAN) Word + Excel............................................................. 200 Rb (2 minggu) Word + Excel + Internet..................................... 300 Rb (3 minggu) Ms. Office + Internet............................................... 450 Rb (1 bulan) Design Grafis (Komplit)........................................ 600 Rb (1 bulan) Autocad 2D, 3D.......................................................300 Rb (10 hari) Merakit komputer/ Installing............................ 400 Rb (6 hari) Bhs Mandarin............................................................ 500 Rb (Paket) Bhs Inggris................................................................... 400 Rb (Paket) Daftarkan lsg belajar, waktu bebas, Tanpa batas usia Jl. Sei Batang Hari No. 170 Medan Telp. (061) 844.2158 - Website:



MEDAN: Jl. Serdang Gg. Sado 43B, Tempuling Medan, Sumatera Utara Telp. (061) 6634.2201


Hub. 7772.2123 - 7759.8123 HP. 081.165.1123






Anda Butuh Perabot Jepara Asli?

MALIOBORO PERABOT Hubungi: Jl. Bilal No. 90 P. Brayan Medan Telephone Toko : 661.6285 Rumah : 661.1540 Fax : 661.6285 (061) Jl. K.L. Yos Sudarso depan SMA Negeri 1 Tebing Tinggi Telp. (0621) 24243

Ciri2 Ambeyen: Disekeliling Dubur Ada Benjolan Seperti Daging Tumbuh/Jerawat, Gatal, B.A.B Keras, Keluar Darah Segar. Susah Duduk Seperti Ada Yang Mengganjal. Duduk Serba Salah. Nyeri (Ngilu). Dubur Seperti Luka, Solusinya Datang dan Berobatlah ke


Jl. Bunga Harum (Benteng) No. 26 Suka Jadi Telp. 0761-45368 -HP. 0812 6568 700 Pekan Baru Te l p. ( 0 7 6 1 ) 4 5 3 6 8 H P. 0 8 1 2 . 6 5 6 . 8 7 0 0 Cabang II: Komp. Perhub. Laut Jl. Baruna II/II Telp. 0765 36906 HP. 0852 6201 0594, 0812 60311 695 Dumai


Untuk Alumni, SMA/ SMK/ MA Tahun ajaran 2011 dan 2012

Mulai Belajar: Senin, 16 Januari 2012 s/d Pelaksanaan SNMPTN 2012

TEMPAHAN MURAH - Lemari pakaian 3 pintu Sungkai asli Rp. 1.500.000 tempahan - Kitchen set atas bawah Sungkai asli Rp. 1,5 Jt/mtr Hub Telp. (061) 661.8116 - (061) 661.6802- 7653.2188


Jl. Prof. H.M. Yamin S.H No. 251 A Simpang Pahlawan Tel.(061) 4563067 Cabang I






TANAH Di Binjai Timur Kota Binjai dengan Harga Rp. 55 Jt, Jl. Lapangan Tenis Lingkungan VI Kelurahan Sumber Karya, Panjang 28,20m, Lebar 14m HP. 0813.7682.7422, Tanpa perantara

cuaca hujan. “Sudah menjadi hukum ekonomi permintaanbanyakdanpersediaanmenipis, harga pasti akan naik,“ ungkap beberapa peda-gang. “Biasalahharganyanaikmenjelangtahunbaru seperti saat ini. Kenaikan itu biasa terjadi setiap ada momen penting seperti tahun baru, meugang, harirayadanmaulid,soalpasokanmenipis,barang datangsetiapharibaikdariSumateraUtaramaupun Pidie,“ ujar Subban, 40, pedagang di Pasar Lambaro. “Dalam seminggu ini, harga cabai itu pernah tiga kali turun, tetapi besoknya naik lagi,“ aku, Fadhila, pedagang cabai di pasar tradisional Peunayong Banda Aceh. Ditanya soal stok cabai yang masuk ke kota itu, pedagang mengaku sudah cukup lama berdagang itu masih menipis. Dia sebutkan karena curah hujan berkepanjangan di daerah-daerah pertanian cabai itu, seperti sebagian Aceh Besar dan Pidie, selaku pemasok utama cabai dan jenis sayuran lainnya ke Kota Banda Aceh, produksi cabai masih sedikit. (b09)


Jual cepat, Rumah 7 KT, 4 KM, Garasi, SHM, LT. 335m², Harga 1,3 M, Jl. Seroja No. 20 dekat dengan RSU Bina Kasih dan 3 menit ke Jl. Ringroad, Sudah ada calon penyewa pasti deal sebelum Tahun baru, Rp. 150 Jt/ 3 tahun, Cash. Bisa bayar ½ dulu, ½ lagi cicil 1 tahun tanpa bunga. Harga ke depan dijamin naik, Bisa dibuktikan dengan dapat dijual balik kembali. Buruan segera Hub. 0813.7697.4062 No SMS

RUMAH Dijual Uk. 5x15m, Model minimalis, Lt. 2, Kamar 3, Garasi Km 3 Jl. HM. Joni Gg. Istimewa No. 25 Harga Rp. 220 Jt HP. 0821.6767.9090

Uk. Tanah 10x43m, Jl. Bromo/ Raya Cangkuk III No. 8 depan Ktr Camat Mdn Denai

Spring Bed 6 kaki 2 lapis Rp. 1.150.000 Spring Bed 5 kaki 2 lapis Rp. 1.075.000 Spring Bed 4 kaki 2 lapis Rp. 1.000.000 Spring Bed 3 kaki 2 lapis Rp. 900.000 Spring Bed 3 kaki Dorong Rp. 1.000.000 Garansi Per 10 tahun

Harga Cabai Merah Di Banda Aceh Makin Mahal




Pihaknya berha-rap Badan Anggaran (Banggar) DPRK tidak asal jadi melihat skala prioritas anggaran yang sedang dalam masa pembahasan. Dika-takan, APBK jangan sempat dibajak untuk program tidak mendasar bagi kebutuhan dan kepentingan rakyat. Penganggaran APBK 2012 seharusnya berbasis kebutuhan rakyat. “Aspek ini yang kurang diperhatikan dalam setiap pembahasan APBK,” katanya. Selama ini anggaran untuk program-program pemberdayaan sosial begitu kecil dan hampir sama sekali tidak ada.


Rumah/ Ruko 3 Tingkat, Jl. Laksana No. 1 HP. 0813.9611.3753

RUMAH Dijual Uk. 13x10m², 2 KT, 2 KM, Garasi, Dpr, RT, RK, Jl. Beringin Gg. Mangga Tembung HP. 0853.7217.9665 Aris


TELP: 082169696868 - (061) 69696868

Daftarkan sekarang juga di lokasi belajar MEDICA Jl. Bantam No. 12 Medan Telp. (061) 457.8058 Jl. Iskandar Muda No. 19B Medan Telp. (061) 415.9280 Atau hubungi/ SMS ke: - Jonris M, S.Pd (0852.7955.6481) - Basri Ginting, ST (0812.639.6209) - Ir. Tagor Silalahi (0812.6493.252) Pendaftaran sudah dibuka...!!! Jam belajar boleh pilih pagi atau sore hari: Pagi : Les 1 Pukul 08.00 Sore : Les 1 Pukul 13.00/ 14.55








0813 6147 0812

Jl. Gatot Subroto Medan Ada Garansi











Cuci AC - Isi Freon Bongkar - Pasang - Referensi Kulkas - Mesin Cuci

0813 9735 7061 061 696 44786

REPARASI AC, KULKAS, MESIN CUCI Kompor Gas, Dispenser H & C TV, M. Pompa Air Sanyo

Hub. SURYA TEKNIK SERVICE Telp.66482216-081375898757-082163120894 Siap Ketempat

1. 2. 3.


4. 5. 6.

Siap Ketempat


SERVICE/REPARASI: AC - KULKAS M.CUCI, ISI FREON-BGKR PSG. Hub. 061.69678231 0857 6078 7441


8. 9.

FORUM KOMUNIKASI PARANORMAL DAN PENYEMBUHAN ALTERNATIF INDONESIA IZIN DEPKES. 448/15830 - IZIN KEJATI No. B270/DSP5.08 Gendam Asmaradhana (Solusi Kilat) Problem asmra dan rumah tangga Gendam pedotshih (pemutus hubungan asmara dan perselingkuhan PIL dan WIL) Puter Giling (menarik/ memanggil orang yang minggat, kabur) Insya Allah, Suami, Istri atau Pacar dalam waktu singkat akan kembali dengan cepat Asmara Gay/ Lesby/ Hypersex Susuk aura, pemikat, pemanis, pengasihan, kecantikan dan ketampanan Penglarisan dagang, kedai, rumah makan/ restoran GARANSI jual beli tanah dgn cepat TUNAS Penyembuhan segala macam penyakit medis - non medis (kutukan, keturunan, bawaan dan guna-guna) Keluhan khusus pria (ejakulasi dini dan impotensi) Pengobatan/ penyembuhan alternatif bisa jarak jauh

BUKA TIAP HARI DARI PUKUL 08.00 Wib s/d 23.00 WIB Kantor: Jl. Sisingamangaraja masuk jalan Puri (200M dari RM. Family) No. 57F Medan Telp. (061) 7678.1087/ 0813.6246.7777 - 0813.7040.5888

Dapat disembuhkan sampai tuntas Segala jenis mata seperti mata: - Katarak, Plus, Minus, Glaucoma - Mata Merah, Berair, Bengkak, dll Khusus yg mau masuk angkatan minus jarak pandang ± 7 Meter B/W (buta warna), juga dapat di sembuhkan sampai tuntas, Insya Allah Hub. IBU FARIDA AKRAM Jl. Prof. H.M. Yamin S.H (Serdang) No. 251 A Tel.(061) - 4563067 Mdn Izin Depkes R.I Terdaftar web:


Telah ditemukan cara baru yaitu dengan cara Inokulasi (penyuntikan) Umur 6 thn Bisa panen puluhan juta. Yang mahal isi batangnya Nananya Gubal/ Teras. Ukuran Bibit yang tersedia 40 cm. Harga bibit Rp. 11.000/Pokok. Jenis Bibit Akuilaria Malaccensis yang butuh bibit. Hub. Bapak Jamal HP. 0813 7091 2113. Alamat Desa Limau Manis Tanjung Morawa. KLINIK TERAPY ALAT VITAL MAK EROT YANG TERUJI DAN TERBUKTI

Dengan H. TEJA SAEFUL Cucu Asli Mak Erot Bersama


BILA anda ingin perkasa ingat jangan sampai salah masuk carilah yang benar-benar pewaris ilmu Mak Erot Sejati, karena keahlian H. Teja Saeful sudah tidak diragukan lagi dalam menangani keluhan seputar alat vital bahkan pengobatan H. Teja Saeful, sudah terkenal Indonesia dan kota-kota besar di Indonesia, sudah ribuan pasien tertolong dipengobatan Mak Erot ini yang aman tanpa efek samping, bahkan dimanca negara sekalipun pengobatan Mak ERot sudah tidak diragukan lagi keberhasilannya. INGAT untuk Kaum Pria jangan sampai Anda terhina Kaum wanita karena kondisi alat vital yang kurang sempurna Izin Dinkes No. 448 Hak Paten No. 00.2004.09965.10041 KONSULTASI UMUM: KHUSUS PRIA: - Buka Aura - Ejakulasi dini - Cari Jodoh - Impotensi - Sesama jenis - Memperbesar “Alvit” - Pelaris - Memperpanjang “Alvit” - Memikat lawan jenis - Keras dan tahan lama dll - Besar PYDR KHUSUS WANITA: - Ingin punya keturunan - Memperkencang & memperbesar payudara - Mengobati keputihan dll

DIJAMIN 100% Hanya Tempat Kami Klinik Mak Erot Jl. Laksana No. 55J masuk dari Jl. Amaliun Yuki Simpang Raya Medan (Praktek Tetap) HP. 0 8 1 2 . 4 0 3 8 . 3 3 3



Pembinaan Anak Punk Positif


erita 60an anak punk dicukur gundul dan diceburkan di kolam oleh aparat kepolisian Banda Aceh mendapat tanggapan serius, baik dari Aceh maupun luar Aceh. Media massa asing, seperti New York Daily, The Telegraph, Washington Post, Daily Mail, Sydney Morning Herald, CBS News dan sebagainya mengecam tindakan polisi Aceh melanggar hak asasi manusia. Seperti diberitakan Waspada, aparat kepolisian di Banda Aceh menangkap 64 punkers yang berasal dari Aceh maupun luar daerah. Mereka datang dan berkumpul di Aceh dalam acara di Taman Budaya, Banda Aceh pekan lalu. Adalah hak siapa saja untuk menilai, apakah tindakan polisi Aceh itu positif atau negatif menurut sudut pandang atau perspektifnya masing-masing. Namun bagi polisi Aceh, tindakan itu dipandang perlu untuk membina anak-anak punk agar tidak mengganggu adat dan budaya setempat, membuat mereka bisa lebih kreatif dan berguna bagi masyarakat, bangsa, negara, termasuk bagi masa depannya sendiri. Kalaupun akhirnya penangkapan anak-anak punk di Banda Aceh mengundang simpati dari komunitas punk internasional, hal itu merupakan kenyataan yang harus dihadapi dengan memberi penjelasan kepada dunia. Di situs jejaring sosial Facebook, muncul acara ‘’Support Indonesian Punks’’ yang digagas seorang punk asal Swedia, Tom Holmquist. Boleh saja Holmquist mengecam dan berpendapat: ‘’Punks Not Dead” karena memang kejadiannya hanya terjadi (ditolak) di Aceh sehingga di daerah-daerah lain atau di belahan dunia lainnya, terutama di Amerika dan Eropa, kegiatan anak-anak punk bisa terus berjalan. Hemat kita, bisa jadi solidaritas seperti itu muncul karena mereka tidak mengerti apa dan bagaimana kondisi perkembangan anak punk di Indonesia serta kaitannya dengan budaya timur yang menjunjung tinggi etika, moral dan agama sehingga budaya luar (punk) itu sulit diterima masyarakat Indonesia yang masih kental menjunjung tinggi budaya lokal. Apalagi kalau banyak anak punk ternyata merusak citra komunitas mereka sendiri dengan perbuatan yang negatif, menjadi berandalan, bertindak arogan, dan melakukan aksi kriminalitas. Yang juga belum banyak dipahami oleh dunia luar adalah kasus penangkapan anak Intisari punk di Aceh bukan tanpa sebab. Mayoritas masyarakat Aceh menolak kehadiran anakanak punk yang mulai trend di Indonesia Keberadaan budaya luar tahun 2000an. Lebih separuh dari anak punk ditangkap berasal dari luar Aceh dan ‘’punkers’’sebuah realitas yang beragama non-Muslim. Sedangkan di Aceh dan pembinaan terhadap sudah diberlakukan syariat Islam sehingga mereka di Aceh dinilai bagi anak punk yang wanita pastilah ‘’bermasalah’’, sulit diterima masyarakat positif Aceh yang dikenal sebagai Serambi Makkahnya Indonesia. Ciri khas dari komunitas anak punk umumnya berusia muda berpenampilan unik, seperti rambut model mowhak, badan penuh tato atau muka penuh dengan ‘’piercing ‘’(tindikan) di kuping, alis, hidung, lidah, dagu dll. Pola hidup mereka yang senang di jalanan acapkali berbenturan dengan masyarakat dan pemakai jalan sehingga dicap negatif. Sikap hidup mereka cenderung acuh dengan lingkungan, mengedepankan kebebasan. Di luar negeri kehidupan bebas seperti itu sah-sah saja, apalagi model hidup punkers di luar negeri dikaitakan dengan simbol perlawanan untuk rezim berkuasa. Memang tidak semua anak jalanan (punk) melakukan tindakan negatif. Sebagian anak punk yang memiliki persatuan dengan aturan yang jelas, punya pimpinan, malah bisa kreatif menghasilkan karya seni, seperti grup musik dan teater.Oleh karena itu, penjelasan yang komprehensif diperlukan. Jangan hanya melihat dari segi kebebasan berekspresi belaka. Jika anak-anak punk tidak mengganggu dan kreatif mendukung dan berbaur dengan budaya lokal pastilah tidak ada penolakan dari masyarakat dan berujung penangkapan. Bahkan mereka bisa menjadi tontonan alternatif dan memperkaya budaya lokal jika mereka mampu memperlihatkan eksistensinya di masyarakat dan pemerintah, seperti menjadi pendukung dan melakukan gerakan kampanye anti-narkoba. Justru itu, penolakan dan pembinaan terhadap anak punk di Aceh kita nilai positif, meskipun orang luar terutama dari Eropa dan Amerika mencap tindakan polisi Aceh melanggar HAM. Acuannya tentu saja masyarakat. Di sinilah peranan tokoh Aceh dari kalangan ulama, adat, pendidikan musti bicara. Kita yakin mereka mendukung polisi Aceh membina anak punk, seperti diberitakan media bahwa kalangan ulama Aceh memberikan apresiasi terhadap gebrakan aparat Polda setempat melakukan pembinaan terhadap anak punk ke arah hidup yang lebih baik. Tentunya diharapkan Kapolda Aceh Irjen (Pol) Iskandar Hasan dalam membina anak punk juga berlaku adil. Artinya, jangan jangan ‘’ever acting’’ dan jangan pula melakukan tindakan represif. Lakukan secara persuasif dengan mengundang tokoh-tokoh adat, budaya, agama untuk meluruskan jalan hidup anak punk khususnya di Aceh karena mungkin selama ini mereka kurang perhatian dan kurang memperoleh pendidikan agama agar mereka kembali ke jalan yang benar, tidak melakukan tindakan negatif di masyarakat, khususnya di jalanan.+


Faks 061 4510025


+628126285469 Halo Manajemen PSMS. Betapa yg Anda2 lakukan, ibarat kata Pepatah Melayu ; ‘AIR SUSU DIBALAS AIR TUBA’. Prof.Djohar Arifin telah berupaya agar PSMS bisa kembali eksis main di”kasta”tertinggi kompetisi PSSI tahun ini, tentunya diajang kompetisi LPI, tp Anda2 menggiring mereka ke ISL. Awalnya EXCO PSSI menolak PSMS utk bermain di “kasta”tertinggi kompetisi PSSI, apapun ALASAN yg disampaikan Prof.Djohar (yg jg mantan pemain PSMS), agar PSMS bisa bermain di kompetisi “kasta” tertinggi PSSI. Tp skrg koq mereka “MENGHALALKAN” PSMS bermain di ISL? Yg jelas, EXCO dan kroni2 mrk tetap ingin menjalankan SKENARIO yg tlh mrk rancang, yaitu “menggulingkan” Prof.Djohar dari kursi Ketua PSSI, setelah beberapa bulan menjabat Ketua PSSI, sebagaimana adanya pernyataan salah seorang Ketua Klub yg tlh terungkap pada saat Kongres tempo hari. +6283197565856 LAPORAN HASIL PEMANTAUAN AL-FALAK Kehadapan yang mulya Bapak PRESIDEN RI . Melalui Media Berita Rakyat Mandiri , kami beritahukan , jika Bapak Presiden belum mengetahui bahwa Ternyata Hasil Kerja Majelis Hisab ALFALAK Regional ASEAN di Brunai Darussalam yang dijadikan Pedoman oleh Majelis Hisab RI . Ternyata MELESET . Sehingga Malam Satu Syuro atau Malam Satu Mukharrom di yakini Rakyat banyak Tepat pada Malam Ahad ( malam minggu ) 26 malam 27 November. Tetapi ternyata malam tersebut Sudah Malam Kedua Syuro atau Malam Kedua Mukharrom . Dan sudah pasti , Malam 09 malam 10 Des. Adalah MALAM BULAN PURNAMA atau Rembulan malam yang ke 15 . Memang Rakyat banyak menyadari bahwa Kalkulasi HISAB selalu MELESET dengan RU’YAH dan dengan Kalimat lain boleh disebut; “THEORY ITU SELALU MELESET !” Demikian saja wahai Bapak Presiden RI . WASSALAM Hormat dari kami ; All Moslem Solidarity ~ Dato’ MNSejok ~Western of NKRI +6282124207000 Kpd yth, dr.Polin di RSU Kumpulan Pane T.Tinggi, pasien itu juga manusia, jgn karna pasien jamkesda anda perlakukan sesuka mulut anda. Menurut laporan orangtua pasien dan dibenarkan pihak rsu, anda selalu kasar terhadap pasien (anak) yg dirawat disana, Anda tidak pantas membentak lalu marah marah, mengeluarkan kata kata monyet, lutung serta ucapan yg tidak pantas didengar oleh anak anak apalagi yg lagi sakit. Selanjutnya anda mengatakan ‘kalo tidak suka dgn saya cari dokter lain,’ itu yg selalu anda katakan jika orangtua pasien komplain karna anda.Anda itu digaji pake uang rakyat, rakyat itu butuh pelayanan bukan caci maki dari dokternya. Kepada pimpinan RSU T.Tinggi, mohon perhatiannya, karna pada kamis, 8/12 seorang anak pasien jamkesda minta pulang karena takut dgn dokter yg merawatnya.pasien bernamaDELA. 7 thn warga kel.D.Sundoro, minta pulang karena dibentak dibentak dgn kata kata kasar ‘ BUKA MULUTMU, KURUS KALI BADAN KAU MACAM MONYET, TAU KAU MONYET....APA.!! GAK SENANG KALIAN, CARI DOKTER LAIN..! Dan kejadian ini sering terjadi pd pasien lainnya terutama pasien jamkesda. Dari pasien jamkesda. +6281370667115 Yth Bapak Walikota dan Plt Gubernur Sumut. Utk penghematan APBD salah satunya adalah adanya kerja sama antara departemen. Misalnya pihak PU bekerja memperbaiki jalan terus 1 bln kemudian dijalan yg sama masuk pihak Telkom atau Tirtanadi melakukan pengorekan jalan yg baru dibenahi. Kapan jalan itu bagus....dan apa setiap tahun kita buat anggaran kejalan yg sama. Ini bahan pertimbangan bagaimana supaya pembangunan kita mantap dan berkwalitas

WASPADA Senin 19 Desember 2011

Sadar Kerukunan Di Tanjungpinang Oleh M Ridwan Lubis Sekalipun mulanya masyarakatTanjungpinang homogen sebagai etnis Melayu dan menganut Islam, kenyataannya mereka sudah menjadi masyarakat terbuka baik ketika terjalin hubungan dengan kerajaan di Malaka maupun sekarang...


etiap kali berkunjung ke Tanjungpinang ibukota Provinsi Kepulauan Riau selalu disuguhi dengan tema pembicaraan seputar upaya pemeliharaan kerukunan. Tanjungpinang adalah kota yang relatif penduduknya tidak terlalu padat hanya dihuni sekitar 230.000 jiwa. Akan tetapi, kota ini telah berbeda jauh sebelum terjadinya perputaran roda perekonomian di kawasan daerah perbatasan. Dilihat dari posisi geografis, kota ini cukup beruntung karena berada di alur pelayaran kapal-kapal niaga yang melintasi Selat Malaka. Jaraknya begitu dekat ke kota Batam sebagai kota yang secara tiba-tiba menjadi sumbu yang menggerakkan ekonomi di kawasan bagian barat Indonesia. Demikian juga jaraknya dengan negara tetangga yaitu Malaysia dan Singapura menjadikan kota Tanjungpinang laksana manisan yang dikerubuti oleh semut-semut para pelaku ekonomi. Tidak mengherankan apabila selain Batam, Tanjungpinang juga menjadi salah satu tujuan para perantau untuk mengadu nasibnya. Terjadinya perubahan konstruk demografis di kawasan pulau Bintan ini tentu saja membawa berbagai implikasi. Pertama, masyarakat dihadapkan kepada kenyataan bahwa kemajemukan menjadi pemandangan yang nyata. Adanya keragaman manusia dari berbagai etnis tentu saja tidak bisa dilepaskan bahwa mereka yang datang memiliki latar belakang budaya maupun agama yang berbeda. Penduduk asli Tanjungpinang terdiri dari para nelayan yang umumnya adalah terdiri dari etnis Melayu. Persoalan utama yang ingin digambarkan dalam uraian ini adalah bahwa Tanjungpinang telah menyandang sebagai tanah gurindam yang dibangun berdasarkan nilai-nilai Islam sebagai agama rakyat dengan situs keIslaman di Pulau Penyengat. Artinya etnis dasar sebagai Melayu ditambah dengan Islam sebagai identitas agama dan budaya maka dapat

dipahami manakala secara teoritis masyarakatnya cenderung bersikap defensif dan reaktif apabila berhadapan dengan etnis serta penganut agama lain. Akan tetapi hal itu tidak terjadi. Masyarakat Melayu dapat hidup berdampingan dengan suku dan penganut agama yang berbeda. Persoalannya kenapa terjadi yang demikian. Hal ini dapat dilihat dalam kerangka analisis sebagai berikut. Pertama, masyarakat Tanjungpinang sekalipun pada mulanya sebagai masyarakat yang homogen sebagai etnis Melayu dan menganut Islam akan tetapi pada kenyataannya mereka sudah menjadi masyarakat yang terbuka baik ketika terjalin hubungan dengan kerajaan di Malaka maupun sekarang setelah dipisahkan sebagai bagian dari dua negara yang bertetangga. Apalagi sekarang, jarak yang amat dekat antara ketiga kawasan yaitu Riau, Malaysia dan Singapura sehingga membuat lalu lintas social dan budaya antara masyarakat di kawasan tersebut sangatlah dekat. Kedua, Masyarakat Riau sadar betapa besarnya kawasan budaya di daerah ini menyumbang bagi kepentingan persatuan bangsa Indonesia yaitu sebagai cikal bakal bahasa persatuan yaitu bahasa Indonesia. Struktur Bahasa Melayu yang kemudian menjadi Bahasa Indonesia tumbuh serta mewarnai peta berpikir masyarakat dengan karakternya yang egaliter yang berbeda dari bahasa-bahasa daerah lainnya yang cenderung dibentuk oleh tradisi feodal-aristokratis agaknya membuat masyarakat Tanjungpinang dan sekitarnya tidak terlalu sulit menjalin komunikasi dan berbagi informasi dengan para pendatang lainnya. Ketiga, faktor kepemimpinan kota Tanjungpinang juga turut mewarnai betapa warga masyarakat di kota itu sadar terhadap perlunya memelihara kerukunan. Kepemimpinan Dra Hj. Suryatati A Manan yang sekarang memangku jabatan wali kota untuk peiode yang kedua. Sebagai seorang perempuan yang memimpin kota Tan-

jungpinang memiliki seni tersendiri dalam menumbuhkan kepercayaan masyarakat terhadap pentingnya kerukunan. Ia menggalang kebersamaan seluruh warga kota terhadap program pemeliharaan kerukunan. Begitu tingginya frekuensi pertemuan yang diselenggarakan baik oleh Pemko, instansi Kemenag dalam menggalang kebersamaan para pemuka agama. Apabila tidak salah ingat, penulis sudah mengunjungi kota tersebut tidak kurang dari lima kali semua berbicara tentang meningkatkan kualitas kerukunan umat beragama. Sekalipun para pemimpin yang telah berjasa mengembangkan semangat kerukunan di kalangan warga masyarakat tidak mengharapkan adanya perhatian dari pemerintah akan tetapi adalah merupakan suatu hal

yang wajar apabila kepada tokoh-tokoh yang memiliki kepedulian terhadap pemeliharaan kerukunan ini memperoleh penghargaan dari pemerintah. Mungkin sudah waktunya apabila momentum peringatan Hari Amal Bhakti Kementerian Agama pada awal Januari 2012, pemerintah memberikan penghargaan terhadap daerah yang telah berhasil menumbuhkan kepedulian masyarakat terhadap kerukunan. Bukankah kerukunan hidup umat beragama merupakan bagian terpenting dari kerukunan nasional mengingat isu-isu agama sering ditampilkan oleh pihak tertentu guna menimbulkan konflik di tengah masyarakat. Penulis adalah Dosen UIN Syarif Hidayatullah Jakarta.

Jabatan & Kekuasaan Di Pasar Gelap Oleh Hari Murti, SSos Pasar gelap politik diisi penjahat-penjahat yang ingin lebih sekadar keuntungan,juga teman lebih banyak lagi untuk bersama-sama mengisi neraka.Mereka yang sudah di dalam kesalahan itu tak bisa kembali.


alau materialisme dan nafsu menguasai orang lain mendominasi dalam proses bernegara, maka politik bisa berubah menjadi pasar gelap yang menransaksikan jabatan dan kekuasaan. Inilah politik berbiaya tinggi akibat praktik ilegal. Meskipun banyak yang sanggup, siapa yang mau membeli jabatan sekaligus kekuasaan dengan materi hasil dari keringat sendiri? Sangat jarang. Lalu, apa yang terburuk dari situasi ini? Adalah ketika orang harus memilih membeli salahsatunya, apakah jabatan atau kekuasaan, dengan menggadaikan terlebih dahulu salahsatu yang lainnya. Artinya, jabatan dengan kekuasaan menjadi terpisah karena untuk membeli jabatan, orang terlebih dahulu menggadaikan kekuasaan yang seharusnya melekat pada jabatan itu. Ya, jabatan dengan kekuasaan menjadi dua dimensi yang dipaksa berpisah. Maka, tak heran jika cerita tentang Satrio Piningit bukan sekadar mitos dalam politik nusantara hingga Indonesia hari ini. Begitu banyak “satrio piningit” di negeri ini, yaitu kalangan pejabat yang “terpingit”, tanpa kekuasaan de facto di tangannya akibat telah ditransaksikan untuk mendapatkan jabatan itu. Padahal, jika tidak tanggung-tanggung melakukan komodifikasi melalui pasar gelap politik dimana kekuatan materi milik sendiri digunakan untuk membeli jabatan sekaligus kekuasaan—setidaknya tidak menimbulkan kebingungan siapa yang bersalah ketika sebuah penyimpangan terjadi. Tapi kalau si pejabat adalah orang yang berbeda dengan si penguasa, kita lihat sendirilah begitu sulit membedakan siapa pahlawan dan siapa pula penjahat di negeri ini. Tapi sudahlah. Gejala ini bukan hanya ada di negeri ini, tapi di begitu banyak negara. Mengapa? Sebagian besar karena tak berpikir bahwa tak ada mesin waktu yang bisa membuat kita kembali ke masa lalu untuk meralat pilihan. Yang ada setelah sebuah kesalahan terjadi adalah keterlanjuran, keterpaksaan harus melanjutkan, dan sebagian besar berakhir dengan pe-

nyesalan yang ditelah pahit sendiri. Mengapa bisa kesalahan menggadai kekuasaan untuk dan membeli jabatan tak bisa diralat lagi? Karena pasar gelap politik diisi penjahat-penjahat yang ingin lebih jauh dari sekadar keuntungan, juga teman lebih banyak dan terus lebih banyak lagi untuk bersamasama mengisi neraka. Mereka yang sudah di dalam kesalahan itu tak bisa kembali. Sayang, orang selalu ingin merasakan pengalaman baru dengan terkadang tidak memikirkan bahwa apa yang dilakoninya sekarang adalah pilihan dari Tuhan. Ketika penguasa di balik layar melihat penguasa terpingit itu begitu dipuja di depan layar, ia pun ingin. Ia sadar secara tanggung-tanggung lagi, bahwa hidup ini memang memilih. Maka, untuk jadi idola di depan layar itu, pilih dan lepas saja kekuasaan de facto di balik layar. Kekuasaan dan jabatan pun terpisah lagi. “satrio piningit” pun bertambah lagi. “Satrio piningit” bukan hanya mereka yang memegang jabatan tanpa kekuasaan. Juga, mereka yang menjadi korban situasi abu-abu yang menyamarkan siapa hitam dan siapa putih. Dada-dada mereka mungkin sesak oleh idealisme, nasionalisme, dan dedikasi, tetapi politik telah dipaksa menjadi habitat para pelaku pasar gelap politik. Mereka tersingkir dan harus puas dengan hanya sifat dan karakter personal sebagai kstaria, tetapi tidak dalam kosnteks kenegaraan. Jangan pisahkan Tidak cukup hanya menyatukan kekuasaan dengan jabatan pada satu orang yang sama. Elemen pemastian diri untuk berbuat yang terbaik bagi negara adalah langkah lanjutan dari penyatuan kekuasaan dan jabatan itu sendiri. Lihat, kita sudah sedemikian lama merasakan kekuasaan dan jabatan melekat pada satu orang yang sama, tetapi penyatuan keduanya malah mewujud menjadi apa yang kita sebut sebagai tirani. Elemen pemastian diri untuk berbuat terbaik bagi negara tidak hadir sehingga perpaduan antara jabatan dengan kekuasaan itu menjadi energi liar yang daya rusaknya masih

sangat kita rasakan sekarang. Maka pasca-rezim tirani itu, adalah sangat mengherankan ketika, misalnya, kita melihat seorang yang telah mengalami diskredibilitas begitu parah malah begitu percaya diri untuk berkompetisi memegang jabatan tinggi dalam negara. Lebih mengherankan lagi mengapa orang ini masih juga dipilih. Jauh lebih mengherankan lagi setelah orang ini terpilih, ternyata ia tak melihat betapa perkasa pengaruhnya sebenarnya karena jabatan tetap dipercayakan padanya setelah begitu banyak hal negatif yang mencorengnya. Bukankah ia seharusnya berbuat banyak untuk menunjukkan bahwa corengan itu hanyalah akibat politik gelap di pasar gelap politik? Seringkali terkesankan bahwa orang ini telah menjadi “satrio piningit” karena kesalahannya di masa lalu telah membuat ia hanya mendapat jabatan, tetapi tidak berpengaruh dan berkuasa. Terpisahnya jabatan dengan kekuasaan pada orang yang berbeda mengakibatkan negara sering tak hadir ketika rakyat membutuhkannya. Sebagian penyelenggara negara bahkan di jajaran jabatan politis sekalipun sering menjadi sekadar pelaksana-pelaksana administrasi yang berkekuasaan dangkal, tetapi mau menang sendiri. Mereka terlalu menimbang risiko jika harus berperang melawan predatorpredator rakyat yang seharusnya dibasmi oleh negara melalui tangan-tangan mereka. Bahkan, untuk menjadi eksekutor terobosan pun mereka melihat risiko standar sebagai sesuatu yang sangat besar mengancam kenyamanannya. Mereka ingin pensiun sebagai pejabat tinggi dengan tingkat ke-ayem-an sekelas pegawai negeri, tanpa musuh. Mereka kemudian akan menjadi contoh bagi lahirnya generasi baru melalui pasar gelap politik, yang lagi-lagi menjadi sekadar pelaksanapelaksana administrasi negara. Virus amnesia tujuan politik menyebabkan orang mengejar surplus materi dan kesenangan pribadi serta kelompok semata melalui politik. Caranya, kekuasaan dengan jabatan tidak disatupaketkan untuk ditransaksikan, tetapi justru di posisikan berseberangan agar terjadi pertukaran antara keduanya sehingga tidak perlu dana besar untuk meraih salahsatunya. Dalam konteks politik dan operasional negara demokrasi sebesar Indonesia, saya menyebut pola semacam ini adalah gaya politik modal dengkul sebelah saja. Coba pikir, untuk menjadi segelintir elite negara di tengah lautan warga negara, si pengingin jabatan

cukup bermodal melepaskan kekuasaan yang seharusnya melekat pada jabatannya kelak. Sedangkan si pengingin kekuasaan cukup bermodal ratusan miliar untuk kemudian mengeduk keuntungan jauh lebih besar setelah si “satrio piningit” tampil di depan layar. Maka, agar kekuasaan dan jabatan bersatu pada sosok yang sama dan kemudian diwujudkan dalam bentuk dedikasi ikhlas kepada negara, jangan pernah menjadi pemain dalam pasar gelap politik itu. Jika ruang-ruang politik tak menyisakan tempat untuk terjadinya politik ideal, berbuat baik sajalah sejak sekarang. Sebab, besar – kecilnya perbuatan baik Anda bukan ditentukan oleh besar kecilnya posisi Anda dalam negara, melainkan dari komitmen Anda yang orang kecil itu untuk perbuatan yang selalu baik. Penulis adalah, Alumnus Sekolah Tinggi Ilmu Komunikasi “Pembangunan” Medan, Pemerhati Komunikasi Politik.

Pengumuman Redaksi menerima kiriman karya tulis berupa artikel/opini, surat pembaca. Kirim ke alamat redaksi dengan tujuan ‘Redaktur Opini Waspada’ dengan disertai CD atau melalui email: opiniwaspada@yahoo. com. Panjang artikel 5.000-10.000 karakter dengan dilengkapi biodata penulis dan kartu pengenal (KTP). Naskah yang dikirim adalah karya orisinil, belum/tidak diterbitkan di Media manapun.Tulisan menjadi milik Waspada dan isi tulisan menjadi tanggungjawab penulis.

SUDUT BATUAH * Harapan Square, Pemko dituding tidak komit - Mungkin karena sudah komit, he...he...he * Pelanggar lalulintas disidangkan meningkat - Tensi pun ikut meningkat! * Pemerintah tak gegabah naikkan harga BBM - Awakpun malas membahasnya


D Wak


C8 07.00 Si Doel Anak Sekolahan 07.45 Dahsyat 11:00 Infotainment INTENS 12:00 Seputar Indonesia Siang 12:30 Mega Sinema 14 Hari Anak Band Atau Pak Guru 2 14.30 Kabar Kabari 15.15 Selebriti Berbagi 15.5 Give Me 5 16.15 Silet 17.00 Seputar Indonesia 17.30 Mega Sinetron : Dewa 19.00 Mega Sinetron : Binar Bening Berlian 21.00 Mega Sinetron Anugerah 22.30 Mega Sinema


07.15 Inbox 09.00 Halo Selebriti 10.00 SCTV FTV Pagi 11:00 SL Liputan 6 Terkini 12:00 Liputan 6 Siang 12.30 SCTV FTV 14:00 Liputan 6 Terkini 14:30 Status Selebriti 15.00 Uya Emang Kuya 16.00 Liputan 6 Terkini 16.03 Cinta Juga Kuya 16.30 Big Fans 17:00 Liputan 6 Petang 17.30 Parade FT V Istimewa 19.30 SCTV Sinetron : Aliya 20.00 Liputan 6 Terkini 21.00 SCTV Sinetron Dia Atau Diriku 22.30 Liputan 6 Terkini 22.30 SCTV FTV Utama

07:30 Disney Club 08:15 layar Pagi 10.30 Di Antara Kita 11:30 Lintas Siang 12:00 Layar Kemilau 13.30 Cerita Siang 15.00 Starlite 15:30 Lintas Petang 16:30 Animasi Spesial Oscar Oasis 17.45 Animasi Spesial The Owl 18:00 Filler Didi Tikus 19:00 Sampeyan Muslim 20.00 Cinta Sejati 22.00 Panggung Bintang 00.30 Lintas Malam

06:30 Hati Ke Hati Bersama Mamah Dedeh 07:30 Wooow…! 08:00 Friends 09:00 Mister Laper 09:30 Segeeerr Beneerrr 10:30 Catatan Sang Dai 11:30 Topik Siang (Live) 12:00 Klik ! 13:00 Sinema Siang: Mr. Vampire I 15:00 Mantap (Live) 16:00 Topik Petang (Live) 16:30 Fenomania 17:00 Warkop Series 18:00 Pesbukers (Live) 1 9 : 0 0 Ta w a S u t r a Coooyyy… 20:00 Layar Lebay: 22:00 Dr.Brady Barr 22:30 Black In News 00:00 Topik Kita

06:00 - Fokus Pagi 07:00 - KISS Pagi 07:30 - FTV Pagi 09:30 - Hitzteria 11:30 - Patroli 12:00 - Drama Asia (Korea) 13:30 - Drama Asia (Korea) 15:00 - KISS 16:00 - Fokus 16:30 - Drama Asia (Korea) 18:00 - Drama Asia: Monkey King 19:00 - Satria 20:00 - Tutur Tinular 22:00 - Buaya Show 23:00 - Mega Asia

07.05 Editorial Media Indonesia 08.05 Eleven Show 09.05 Eleven Show 10.30 Metro Xin Wen 11.05 e Lifestyle 13.05 Zero to Hero 14.30 Metro Sore 15.30 Public Corner 16.05 Discover Indonesia 16.30 Metro Highlights 17.05 Metro Hari Ini 18.05 Metro Hari Ini 19.05 Suara Anda 20.30 Prime Interview 21.05 Top Nine News 22.05 Economic Challenges 23.05 Metro Realitas 23.00 Metro Sports

WASPADA Senin 19 Desember 2011

07:30 Ranking 1 08:30 Derings 10:00 Ngulik 10:30 IBU 11:00 Insert 12:00 Reportase Siang 12:30 Jelang Siang 13:00 Bingkai Berita 13:30 Ceriwis 14:30 86 15:00 Keluarga Minus 15:30 Sketsa 16:00 Happy Family 17:00 Reportase Sore 17:30 Insert Sore 18:00 Jika Aku Menjadi 19:00 Comedy Project 20:00 The Hits 21:00 Bioskop TransTV 23:00 Kakek-Kakek Narsis 00:00 Bioskop TransTV

06.30 Apa Kabar Indonesia 09.30 Kabar Pasar Pagi 10.00 Coffee Break 11.30 Kisah Sukses UMKM 12.00 Live News Kabar Siang 13.30 Satu Jam lebih Dekat 14:30 Live News Kabar Pasar 15.00 Best Match La Liga 17.00 Live News KAbar Petang 19.30 Apa Kabar Indonesia Malam 21.00 Live News Kabar Malam 22.00 Live News KAbar Arena 23.30 The Legend

07.30 Selebrita Pagi 08.00 Aku Mau Tahu 08.30 Kunci SUkses 10.00 Spotlite 11.00 Warna 11.30 Redaksi Siang 12.00 Selebrita Siang 13.30 Cita Citaku 14.30 Kuas Ajaib 15.00 Koki Cilik 15.30 Asal Usul Fauna 16.00 Jejak Petualang 16.30 Redaksi Sore 18.00 Beritawa 18.30 Hitam Putih 19.30 OnThe Spot Malam 20.00 OVJ 22.00 Bukan EMpat Mata 23.30 Jam Malam

08.00 Fairly Odd Parents 0 8 . 3 0 Me n g g a p a i Bintang 10.00 Obsesi 11.00 Top Banget 11.30 Hot Spot 12.00 Awas Ada Sule 13.00 Main Kata 13.30 Global Siang 14.00 Petualangan Panji 14.30 Denny Manusia Ikan 15.00 Hand Made 15.30 Berita Global 16.00 Fokus Selebriti 17.00 Chalkzone 17.30 Spongebob 19:00 Awas Ada Sule 20.00 BIG Movies 22.30 BIG Movies


Jadwal acara TV di atas bisa diubah sewaktu-waktu oleh stasiun TV yang bersangkutan tanpa pemberitahuan

Andy Lau Jadi Perempuan Di What Women Want Super star Hong Kong, aktor veteran Andy Lau tentu telah memainkan ratusan peran. Kali ini ia menjajal peran sebagai perempuan, dalam remake film Hollywood berjudul sama (2000) What Women Want akan tayang di kanal Celestial Movies, Sabtu, (24/ 12) Pukul 20:00.

Christian Bale/

Bintang Terminator III Digebuk Petugas Keamanan China AKTOR pemenang Oscar juga bintang film eksyen Terminator III, Christian Bale, terluka setelah diserang para petugas keamanan China yang berusaha mencegah sang aktor dan seorang awak CNN menjenguk seorang aktivis tengah menjalani tahanan rumah. Bale sedang mengunjungi China dalam rangka mempromosikan film mendatangnya tentang Pembantaian Nanjing berjudul “The Flowers of War”, dihentikan di pinggiran sebuah desa di China Timur di mana aktivis Chen Guangcheng ditahan. Bale menggambarkan Chen sebagai pribadi inspiratif, mengundang seorang awak CNN untuk mendampinginya dalam perjalanan selama delapan jam berkendaraan dari Beijing ke desa di wilayah Linyi. Para pengawal berseragamkan hijau ala militer pernah menyerang awak CNN Februari lalu kembali muncul, dan berusaha meninju Bale dan sang awak CNN, demikian laporan CNN. “Mengapa saya tak boleh mengunjungi orang merdeka ini?” tanya Bale berulang-ulang, sementara para petugas keamanan berusaha menjauhkan kamera dari bintang The Dark Knight dan The Fighter untuk kemudian menyingkirkan dia. Aktor Hollywood dan awak CNN itu kemudian mundur ke van mereka namun kemudian diuber-uber si petugas di sepanjang jalanan bergerinjal dengan menggunakan kendaraan lain selama 40 menit, sampai van mereka mengalami kerusakan. “Saya bukannya berani melakukan ini,” kata Bale di dalam van begitu mereka lolos dari kejaran. “Orang-orang setempat yang berani melawan pihak berwenang untuk mengunjungi Chen dan keluarganya disiksa karena ini...Saya ingin mendukung apa yang mereka lakukan,” katanya. Chen terkenal karena mengungkap sterilisasi dan aborsi paksa terhadap ribuan perempuan China di provinsi Shandong sebagai bagian dari upaya menekan angka kelahiran. Tindakannya ini dibela Barat, termasuk Menteri Luar Negeri AS Hillary Clinton yang khusus berpidato untuknya bulan lalu. Bale mengaku terkesan pada kisah Chen selagi berada di China untuk produksi film The Flowers of War yang berkisah tentang Pembantaian Nanjing manakala tentara Jepang membunuh puluhan ribu warga sipil China selama 1937-38. Aktor Inggris ini memerankan seorang gembel Amerika yang berubah menjadi pelindung sekelompok gadis dan pelacur China berusaha menyelamatkan diri dari kebrutalan tentara Jepang yang menduduki ibukota China selama Perang Dunia II. “Ini tidak muncul alamiah dari diri saya, sebenarnya ini tidak saya sukai, ini bukan mengenai saya,” katanya selama perjalanan panjang dari Beijing ke desa di mana sang aktivis ditahan. Kawan akrab Bale, Jennifer Allen, berkata kepada AFP lewat telepon dari Los Angeles, “Kepergian Bale ke desa itu untuk melihat pria (aktivis) sungguh karena alasan pribadi. Dia meresapi kisahnya dan tergerak, serta ingin berbuat apa yang dia bisa.” (ant)

What Women Want adalah film romantis komedi China ditulis serta disutradarai Chen Daming, dirilis Februari 2011. Inilah film pertama kalinya mempertemukan dua bintang

ternama Andy Lau (Shaolin, Detective Dee) dan Gong Li (Miami Vice, Memoirs of Geisha, Shanghai). Digambarkan, Sun Zigang (Andy Lau) memang bukanlah suami dan ayah yang ideal namun keluarganya sangat bergantung kepada karir sang kepala rumah tangga. Di kantor biro iklan tempatnya bekerja, Sun sedang mengincar posisi sebagai Executive Creative Director, namun ia kecewa dengan hadirnya karyawan baru Li Yilong (Gong Li) yang dikenal sebagai ‘wanita besi di industri iklan’. Setelah mengalami kecelakaan, Sun memperoleh kemampuan luar biasa untuk membaca dan mendengarkan pikiran perempuan. Kekuatan khusus ini menjadi kutukan dan

sekaligus berkat tentunya. Sun paham betul cara memikat wanita, dia juga menggunakan kekuatannya untuk melawan Li dan mencuri ide-idenya, tapi dalam proses tersebut dia malah menemukan dirinya jatuh cinta pada kecantikan dalam dari musuh ini. “Saya benar-benar merasakan perubahan dalam karakter saya ini, dimana saya harus berperan sebagai mantan istri, anak perempuan, kemudian harus bersaing dengan Gong Li, juga merasakan menjadi staf perempuan. Walau ini remake tapi tidak membuat saya harus menjadi Mel Gibson karena akan siasia dan mengecewakan fans yang menyukai akting saya”, jelas Lau, peraih Hong Kong Guiness Awards untuk penghargaan terbanyak ini.(m19)

Andy Lau di What Women Want

Britney Spears/

Britney Spears Resmi Bertunangan Bintang pop Britney Spears resmi bertunangan dengan pacarnya, Jason Trawick, demikian laporan media selebriti Jumat (16/12). Sebelumnya penyanyi itu menyiarkan pesan di status Twitter mengenai ia menerima hadiah telah lama diimpikannya. Host acara tayang-bincang televisi Billy Bush menghubungi Jason melalui “surel” (surat elektronik) dan sang calon mempelai pria pun mengkonfirmasi berita tersebut. “Ya, kami bertunangan,” kata Trawick kepada Billy Bush sebagaimana dikutip dalam acara tayang-bincang itu. Majalah berita selebriti Us Weekly juga melaporkan pertunangan tersebut, dengan mengutip sumber tanpa nama. Majalah itu, sebagaimana dilaporkan Reuters Sabtu siang, menyatakan Jason Trawick menjawab pertanyaannya dalam

acara santap malam pribadi Kamis (15/12), saat ulang tahunnya ke-40. Britney,30 menyiram minyak ke dalam api mengenai berita tersebut dengan mentweet pada Jumat, “OMG. Semalam Jason membuat aku terkejut dengan satu hadiah yang sudah lama aku nantikan. Gak bisa nunggu buat memperlihatkan kepada kalian! BENAR-BENAR, AMAT, SANGAT, bahagia!!!”. Juru bicara Britney tak bisa dimintai komentar. Britney pernah berumah tangga dengan penari Kevin Federline selama dua tahun, dan memiliki dua anak. Penyanyi itu juga pernah menikahi teman masa kecilnya, Jason Alexander, selama perjalanan ke Las Vegas pada 2004. Pernikahan tersebut cuma berlangsung 5 jam sebelum Britney membubarkan hubungannya.(ant)

Sebelum Cerai Ashton Kutcher Jadi Penasehat Perkawinan Ashton Kutcher menawarkan nasehat perkawinan kepada editor majalah top wanita hanya beberapa minggu sebelum perkawinannya dengan Demi Moore dinyatakan gagal. Kutcher kini berusia 33 tahun dan Demi Moore berumur 49 tahun dinyatakan bercerai beberapa waktu lalu. Aktor ini bercerita tentang rumahtangganya yang harmonis dengan bos majalah kesehatan wanita itu untuk publikasi bulan Desember dan aktor ini menerangkan kunci keberhasilan rumahtangganya adalah selalu berkomunikasi dengan istrinya bintang film ‘Ghost’. Namun tip menjaga keharmonisan perkawinan kini menjadi pertanyaan

setelah Demi moore mengumumkan perceraian perkawinan mereka selama enam tahun sebelum majalah itu menerbitkan wawancara mereka dengan Kutcher. Pasangan ini diikuti rumor ketidaksetiaan Kutcher sejak menghabiskan waktu ulangtahun perkawinan mereka yang keenam pada September lalu. Kutcher muncul menerangkan kesulitan perkawinan mereka. Bintang film Two and a Half Men ini menyatakan ia menyesal tidak berusaha mempertahankan hubungannya dengan Moore jauh sebelum problem mereka menjadi berita media massa. Ketika ditanya nasehat perkawinan terbaik yang ia

terima, Kutcher mengatakan, “ saya kira semuanya mengenai usaha-usaha memperbaiki hubungan perkawinan dan membuat hubungan itu menjadi lebih baik. Jangan tunggu masalah muncul. Tujuan nasehat perkawinan bukannya mendapatkan hubungan, namun untuk bagaimana mempertahankan hubungan perkawinan agar jadi langgeng,” jelas Kutcher. Dalam chating di majalah kesehatan wanita itu beberapa minggu sebelum konfirmasi perceraian mereka, Kutcher mengakui kekurangannya untuk mendengar selalu menjadi problem dalam rumahtangganya dengan Demi Moore. “Saya hanya menginginkan wanita kapan dan dimana

saja. Pada beberapa hal saya seorang pendengar yang baik, namun sering saya tidak mau mendengarkan dalam banyak hal. Sekarang saya mulai berusaha untuk mendengarkan segala sesuatunya,” ujar Kutcher. Sebenarnya problem pasangan ini menjadi begitu sulit untuk diselesikan karena perkataan Kutcher sendiri dan tidak adanya keinginan untuk merubah kebiasaan lama. Seperti diakui aktor ini ia tidak pernah bersama wanita yang merasa ingin merubah dirinya. Karena perceraian itu baik Kutcher maupun Moore merasa tidak senang. Tapi hubungan panjang itu dirusak sikap ketidaksetiaan,” ungkap satu sumber. Nur/thr

Ashton Kutcher/


WASPADA Senin 19 Desember 2011

Salut Pada Himpunan Mahasiswa Akuntansi FE-USU Mata saya langsung menangkap judul berita Waspada, Senin, 12/12/11 hal B2. Beritanya tentang Gus Irawan, sebagai seorang tokoh ekonomi syariah, mengemukakan pendapatnya bahwa sudah saatnya masyarakat dunia berhijrah ke sistem ekonomi syariah. Itu disampaikan ketika menjadi nara sumber pada Seminar Akuntansi Keuangan Syariah yang diadakan oleh Himpunan Mahasiswa Akuntansi Fakultas Ekonomi USU dalam rangkaian acara Pekan Semarak Akuntansi Kreatif (PSAK) 2011. Sebagai salah seorang alumni, saya malah jadi tertarik untuk tahu lebih banyak tentang kegiatan anak-anak ini. Bagi saya kemauan, kemampuan dan kesediaan mereka untuk melakukan kegiatan kreatif seperti itu sangat layak diberitakan. Apalagi di saat-saat maraknya berita negatif kegiatan mahasiswa yang seakan cuma bisa protes dan kadang cenderung anarkis. Panitia mampu mendatangkan ratusan mahasiswa dan seorang tokoh seperti Gus Irawan, menurut saya itu sebuah prestasi. Dan, setelah tanya sana sini, saya jadi tahu ternyata kegiatan PSAK 2011 ini adalah yang kedua. Untuk tahun 2011 dilaksanakan sejak tanggal 07 s/d 10 Desember 2011 dengan tema “Pemuda Peduli, Pemuda Mengubah, Pemuda Menginspirasi” yang mengambil momen hari AIDS sedunia dan bekerja sama dengan Warung SAHIVA. Rangkaian kegiatan yang dilaksanakan antara lain, Seminar Akuntansi Keuangan Syariah di Amaliun Convention Hall pada 10 Desember 2011, Accounting Star (olimpiade akuntansi) yang diikuti oleh 7 universitas di kota Medan pada tanggal 9 – 10 Desember 2011 di Fakultas Ekonomi, Turnamen Futsal antar universitas tanggal 9 – 10 Desember 2011 di SDH Futsal Ringroad, Cheerleadance Competition yang melibatkan 8 SMA se-Kota Medan pada tanggal 10 Desember di Pendopo USU, Turnamen PES yang diikuti oleh masyarakat umum, bazaar dan gebyar band, serta acara puncak pada tanggal 10 Desember 2011 di Pendopo USU termasuk penyerahan piala dan penghargaan seluruh lomba, sekaligus penutupan acara PSAK 2011 dengan atraksi kembang api. Di tengah kegalauan hati saya mencermati berita mahasiswa bakar diri, informasi kegiatan anak-anak FE USU ini terasa patut menjadi penting untuk membangkitkan optimisme pembangunan karakter pemuda yang mampu membawa bangsa ini mencapai cita-cita kemerdekaan Indonesia. Apalagi seluruh kegiatan mereka ini sepenuhnya didukung oleh Dekan, karena saya dengar awal kegiatan dibuka langsung oleh pak Ami Dilham, PD-III Fakultas Ekonomi USU. Pokoknya salut, deh ! Syahrul Zain Nasution Alumni FE-USU

Kepada Bapak Walikota Medan Assalamualaikum Warahmatullahi Wabarakatuh Dengan hormat, mencermati berita Harian Waspada Jum;at 9 Desember 2011 pada halaman B1 Kolom 1-3 dengan topik “16 Pelajar Medan Timba Ilmu di Sekolah Terbaik Korsel”, selaku anggota masyarakat pecinta MAN I Medan, sangat-sangat menyesalkan penyampaian berita seperti topik diatas yang tidak lengkap, yaitu sebagai berikut : ke-16 pelajar Kota Medan tersebut, tambah Rivai terdiri dari : 4 siswa asal SMAN 1 Medan, 2 siswa dari SMAN 3 Medan, 1 dari SMAN 4 Medan, 2 dari SMA Sutomo 1 Medan, 3 dari SMA Harapan Medan dan 2 dari SMA Shafiyatul Amaliyah Jumlah 14 Siswa, 2 siswa lagi tidak disebut dari MAN 1 Medan, mengapa tidak disebut/ dimuat dalam berita dimaksud, padahal satu-satunya identitas yang mewakili sekolah Islam. Karenanya saya mohon penjelasan dari Bapak Kabag dan Kasubag, Bapak Drs Rivai Nasution MM dan Drs Zainul Achmaddin : 1. Apakah karena lupa? 2. Apakah karena silap tidak ada didokumen? 3. Apakah ada hal-hal pertimbangan lain? Atas penjelasan bapak-bapak terlebih dahulu diucapkan Alhamdulillah dan terima kasih semoga Allah SWT meridhoi. Wassalamualaikum Warahmatullahi Wabarakatuh. Drs H Sayuti Medan


Dedi Sahputra

Perkataan (2) “Saya disebut sebagai legenda hidup. Oleh karena saya sebagai legenda, maka saya sudah mulai memasang tarif dan tidak sembarang mempratekkan standing comedy.” Pria tambun kepala plontos itu berujar dengan santai. Sesekali dia tertawa. Pikiran saya berputar menyaksikan acara talk show tersebut. Saya mengingat-ingat apa yang dimaksudnya dengan standing comedy itu. Dapat... Saya ingat ada acara seperti itu di sebuah stasiun televisi swasta. Ini jenis acara lawakan monolog yang si pelawak ngomong sendirian di depan penonton. Isi lawakannya sering, bahkan selalu nyerimpet-nyerimpet pada tema seksualitas juga SARA. Di acara ini, cerita-cerita tentang seksual ditertawakan,persoalan SARAdicekikiki. Bahkan ada seorang personilnya menisbatkan dirinya sebagai spesialis etnis tertentu. Dia secara eksploitatif mengolok-olok satu etnis, hanya karena dia berasal dari etnis yang diolok-oloknya itu. Ya, saya ingat itu. Tapi saya gagal mengingat sosok pria tambun tadi. Dia bahkan baru pertama kalinya saya lihat di televisi. Orang ini ternyata memang bukan orang yangterkenal.Diabukanartisyangpunyabanyak penggemat,diabukanpublikfiguryangwajahnya sering nampang di berbagai media. Saya bahkan tidak tahu siapa namanya, tapi saya tahu, dia jenis orang yang menggunakan perkataannya untuk memanipulasi situasi dan kondisi. Dia merekayasa fakta melalui perkataannya. Tujuannya tidak lain karena ada kepentingan-kepentingantertentu.Yanginijenisperkataan politis yang untuk mengucapkannya harus adaoverconfidencedisana.Kira-kirasepertipolitisi yangsedangkampanye.Andaharusbicaramoral, meski Anda sendiri kurangbermoral, Anda harus bicara demi orang banyak meski sikap Anda adalah demi perut sendiri, dan Anda harus piawai menyebutkannya. *** Dalam perang shiffin, ketika dua kelompok yang bertikai itu sepakat memilih dua penengah yaitu Abu Musa al‘Asyari radhiallahu ‘anhu dan ‘Amr bin Ash radhiallahu‘anhu, mendadak kaum Khawarij keluar dan berlepas diri dari dua kelompok tersebut. Mereka mengangkat mushaf di ujung-ujung pedang mereka seraya berteriak

lantang:“Tidak ada hukum kecuali milik Allah”. Ali bin AbiThalib radhiallahu‘anhu tertegun. Ia adalah khalifah saat itu. Ini bibit perpecahan lainnya. Maka Ali berujar: “Kalimat yang hak, tapi yang mereka maukan adalah kebathilan”. Apa yang diucapkan Khawarij sejatinya adalah kebenaran. Dia bahkan mengutip nash dalam Alquran, perkataan Allah SWT. Tapi sejatinyaapayangmerekalakukanadalahsemata untuk perpecahan. Inilah syubhat kaum Khawarij. Mereka menganggap kalau mengangkat seseorang sebagai hakim untuk menengahi suatu pertikaian, makaitutermasukperbuatanberhukumkepada selain Allah. Maka sampailah mereka pada kesimpulan, kafir. Ali bin Abi Thalib, Muawiyah bin Abi Sufyan, Abu Musa Al‘Asyari, Amr bin Ash dan seluruh para sahabat yang ikut dalam dua pasukan tersebut dihukumkan pada: kafir. Tidak sampai di situ saja, terhadap seluruh kaum Musliminyangridhapadaduahakim penengah yang ditunjuk, mereka juga dihukum kafir. “Barangsiapa yang tidak berhukum dengan hukum Allah maka mereka adalah orangorang kafirr,” Khawarij berteriak lantang, lagi-lagi mengutip firman Tuhan. *** Ketika Luhfi Assyaukanie, salah seorang pendiri Jaringan Islam Liberal (JIL) itu mengutip filsuf kontemporer Prancis, dia berkata begini; teks— dan apalagi teks-teks suci—selalu bersifat “repressive,violent,andauthoritarian.”Satu-satunya cara menyelamatkannya adalah dengan membebaskannya. Dia menyitir pendapat orang itu untuk mengatakan bahwa Alquran itu tidak lagi asli. Tapi telah mengalami berbagai proses “copy-editing” oleh para sahabat, tabi’in, ahli bacaan,qurra, otografi, mesin cetak, dan kekuasaann. Pada saat yang lain dia masih juga mengaku Islam dengan Alquran sebagai sumber utama ajarannya. Ternyata memang begitu. Perkataan itu bukan sekedar bunyi yang keluar dari mulut seseorang . Tapi dia bisa menjadi penentu kemuliaanseseorang.Diabisamenjadikanseorang yang sederhana menjadi mulia, dia menjadi ukuran tingkat kecerdasan seseorang. Tapi dengan perkataan juga orang cerdas dan orang beruntungakankelihatan,dandenganperkataan juga orang bodoh bisa tampak seperti cerdas.(Vol.276, 19/12/2011)

Kolom foliopini dapat juga diakses melalui


Agresi Belanda II 19 Desember 1948 Oleh Muhammad TWH Ketika Amir Syarifuddin Perdana Menteri,dua kali Belanda melancarkan agresi dan hasil persetujuan“Linggarjati” dan Renville menguntungkan Belanda.


aik Agresi pertama maupun Agresi kedua Belanda terhadap republik ini merupakan peristiwa sejarah yang tidak akan “lapuk oleh hujan dan tidak akan lekang dan panas”. Peristiwa itu tidak bisa dilupakan bangsa Indonesia dan selalu diingat pihak Belanda sendiri. Belanda yang juga menghargai peristiwa sejarah, tahun 1997 pernah mengirim dua orang wartawati dari televisi Belanda ke Medan masing-masing bernama StepVaessen dan KannethVanToll. Mereka mengumpulkan fakta-fakta mengenai Agresi Belanda di Sumatera Utara di masa perang kemerdekaan. Sementara itu alat-alat perang seperti pesawatmustangyangdikenalganasmasa perangkemerdekaan,kinidisimpandalam “Museum Perang” di Overloon negeri Belanda Gerakan pasukan Belanda di Sumut Mengenai Agresi Belanda kedua 19 Desember 1948 di Sumatera Utara, menurut laporan pihak Belanda sebagai berikut : Operasi militer Belanda di Sumatera Utara dilancarkan kearah Utara sampai batas Tanah Alas melalui Tanah Karo, ke arah Barat menduduki kabupaten Asahan Selatan dan Labuhan Batu dari kekuasaan RI. Operasi kearah Selatan Sumatera Timur disebut“Operatie Doorbraak” melalui darat yang bergerak Batalyon “33 Res. Infantri pimpinan Mayor Wellemen, melalui jalan raya dari Bunut merebut Rantau Prapat kemudian dari Wingfoot masuk ke Kota Pinang. Agresi Belanda pertama berbeda dengan Agresi Belanda Kedua Letak perbedaannya dalam Agresi Kedua ini Belanda merebut dan mendudukiYogyakarta menawan Presiden dan wakil Presiden serta seluruhMenteriRepublikini.PresidenSoekarno Perdana Menteri Sutan Syahrir dan Menteri Luar Negeri H. Agus Salim diterbangkan ke Medan dan ditawan di Pasanggerahan Lau Gumba Brastagi. Sedangkan wakil Presiden Hatta dan para menteri lainnya ditawan di Pulau Bangka. SeminggusetelahBungKarnoditawan di Brastagi beberapa orang petinggi Belanda datang ke Pasanggerahan Lau Gumba dengan membawa satu peti penuh uang Golden(uangBelanda)dansatupetipenuh dengan pakaian mewah, kedua peti itu dibuka di ruang tengah dengan dikelilingi oleh pembesar Belanda itu, Bung Karno dipanggil dari kamarnya dan diperlihatkan isi kedua peti tersebut, salah seorang pembesar Belanda itu menyodorkan satu surat

yang telah dipersiapkan dan pulpen untuk ditanda tangani oleh Bung Karno, Bung Karno membaca surat tersebut, kemudian beliau berkata : “Saya Bapak rakyat, saya akan tanya dulu kepada rakyat, apakah rakyat setuju atau tidak setuju, saya tanda tangani surat ini”. Kemudian Bung Karno kembali ke kamarnya. Maksud surat itu diduga untuk membatalkan Proklamasi atau“menyerah”kepadaBelanda.Peristiwa ini disaksikan dengan mata kepala sendiri oleh Karno Sobiran (Alm) pelayan Bung Karno ketika ditawan Belanda di Pasanggerahan Lau Gumba itu. Beberapa hari setelah gagal menyuap BungKarnoBelandabermaksudmeracuni beliau. Ketika pelayan Bung Karno bernamaKarnoSobiranitumembawamakanan BungKarnomenujukekamarnya,diadicegat oleh seorang perwira Belanda , satu botol kecil racun disuruh dicampur dalam makanan Bung Karno, pelayanan Bung Karno itu membentak perwira Belanda “gila kau, kau sendiri kalau berhadapan denganbeliausepertitikusdisiramminyak”. Setelah Belanda gagal menyuap Bung Karno dan gagal meracuni beliau, maka Presiden RI ini dipindahkan dan ditawan di Parapat. Jenderal kita sudah mati Ketika Presiden Soekarno ditawan di Parapat, radio Belanda mengumumkan, bahwa panglima Tentara Belanda di IndonesiaJenderalSHSpoorakanmelakukan inspeksi ke daerah-daerah dalam rangka zuiverings actie (aksi pembersihan). Mendengar ada kunjungan Jenderal Belanda itu, komandan Sektor IV Mayor Maraden Panggabean menginstruksikan kepada anggota pasukannya yang berada antara jalanTarutung – Sibolga untuk meningkatkan penghadangan terhadap konvoi Belanda . Tanggal 24 Mei 1949 iring-iringan konvoi Belanda dari Sibolga menuju ke Tarutung melewati kelompok pasukan pimpinan Letnan Agus Marpaung, segera melepaskan tembakan salvo tanda serangan dimulai pertempuran dan berlangsung seru. Pasukan Belanda melepaskan tembakan mortir bertubi-tubi. Pasukan Henry Siregarjugamelancarkanseranganbertubitubi.Setelahbertempuranbeberapawaktu lamanya,pasukanbergerakdanberpindah dari tempat penghadangan untuk menghindarseranganpesawatMustangBelanda yang datang membantu Menimbulkankeheranan,konvoiyang diserang itu tidak meneruskan perjalanan kearahTarutung tetapi kembali ke Sibolga.

Terdengar sirine, meraung-raung semua jalan diblokir. Siti Rahmanun Sitompul yang berada di Rumah Sakit Sibolga melihat kesibukan serdadu Belanda begitu memuncak. Sebuah ambulance berhenti di depan Rumah Sakit dan menurunkan peti mati yang ditutup dengan bendera Belanda dan dikawal oleh empat perwira Belanda . Seorang dokter Belanda keluar dariruangandanbertanyakepadaperwira pengawal “Wie is het?” (siapa itu?) onze general is al dood, Hij is er al gaweet (Jenderal kita sudah mati. Dia sudah dari sana) ucapan ini jelas didengar oleh Siti Rahmunun yang sangat menguasai bahasa Belanda , dia segera berkesimpulan yang mati itu tidak lain dari Jenderal Spoor. Sore harinya pesawat catalina datang dan landing di laut Sibolga, dan membawa mayat Jenderal itu menuju Medan kemudian ke Jakarta. Keesok harinya radio Belanda mengumumkan bahwa Jenderal Spoor mati karena serangan jantung, BelandatidakmengakuiJenderalspoortewas karena penghadangan pasukan TNI. Tahun 1951 mantan Kopral KNIL (Koninkelijke Nederlands Indishe Leger) yang turut mengawal Jenderal Spoor bernama Justin Lumban Tobing pernah mengatakan kepada Maraden Penggabean, Jenderal Spoor, mati bukan karena serangan jantung tetapi karena luka-luka akibatserangandanpenghadanganantara Sibolga dan Aek Maranti. Sersan Mayor Tumanggor mantan Ajudan Jenderal Spoor pernah mengatakan kepada Pak Bedjo bahwa Jenderal Spoor tewas bukan karena serangan jantung tetapi karena serangan dan penghadangan TNI di Sumatera Utara. Menguntungkan Belanda Ketika Amir Syarifuddin menjadi Perdana Menteri pasukan Belanda melancarkan agresinya dua kali,. Agresi pertama 21 Juli 1947 dan Agresi Kedua 19 Desember 1948. selama Amir Syarifuddin memegang kendali pemerintah di republik ini dua kali dilangsungkan perundingan yang menghasilkan persetujuan “Linggar jati” dan “Persetujuan Renville” hasil kedua persetujuan ini sangat merugikan Indonesia dan menguntungkan Belanda . Partai-partai politik menyerang apa yang dihasilkan oleh pemerintah waktu itu. Dalam persetujuan linggarjati pasal 8 menyebutkan “Baginda Raja sebagai kepala Persekutuan”. Perjanjian itu tidak menghormati anggota Barisan Bersenjatayangtelahmengorbankanjiwa, mempertahankan kemerdekaan. Hasil perundingan ini juga merendahkan bangsa Indonesia. Hasil persetujuan “Renville” sangat memukul dan merugikan Indonesia persetujuan ini menyetujui tuntutan Belanda supayasemuapasukanRepublikmeninggalkan daerah-daerah yang diduduki Belanda.Sedikitnya35.000pasukanRepublik

harus hijra ke sisa wilayah RI baik di Jawa maupun di Sumatera. Penandatanganan persetujuan Renville ini telah menimbulkan serangan yang bertubi-tubi dari partai politik yang menyebabkan kabinet Amir Syarifuddin jatuh dan diganti oleh Kabinet Hatta. Partai yang mendukung hasil persetujuan“Linggarjati” dan Renville hanya PKI, Persindo, SOBSI, BTI dan Lasykar Rakyat Jawa Tengah Pimpinan Ir. Sukirman. Setelah Amir Syarifuddin tidak lagi menjadi Perdana Menteri dia segera menghimpun kelompok sayap kiri dan ormas-ormas pro komunis dalam Front Demokrasi Rakyat (FDR) dan bergabung dengan PKI Muso kemudian melakukan pemberontakan di Madiun. PKI /Muso danFDRmemproklamirkan“NegaraSovyet Republik Indonesia” menaikkan bendera merah dan mengangkat Djokosuyono menjadi Gubernur Militer Madiun. Dalam waktu yang tidak begitu lama pemberontakan PKI Madiun berhasilditumpas,minggupertamabulan Desember 1948 penumpasan selesai. Pemimpin-pemimpin pemberontak yang terbunuh dalam pemberontakan Madiun adalah Muso, Amir Syarifuddin, Suripno, Sardjono, Haryono dan Djokosuyono. Pentolan PKI yang berhasil melarikan diri adalah Alimin, Ngadimin. D.N Aidit, Nyoto,Tan Ling Djie, dan Sumarno, tindakan hukum baik terhadap partai PKI maupunanggotanyatidaksempatdilakukan karena Belanda melancarkan agresinya yang kedua. Buku berjudul “Penyusupan PKI KedalamMediaMassaIndonesia1948-1946” yang disusun wartawan senior ibukota, Drs. Sumono Mustoffa dan Muhammad Chudori, mengungkapkan fakta pemberontakan PKI di Madiun dan kudeta berdarah tahun 1965. Berdasarkanuraianmengenaitingkah polah Amir Syarifuddin, mungkin timbul pertanyaan siapa sebenarnya dalang di belakang pemberontakan Madiun? Apakah Peking, Moskow atau NICA? (Nederlands Indies Civil Administration). Perlu diketahui bahwa baik Sarjono maupun Amir Syarifuddin telah lama menjadi anggota PKI kedua tokoh pemberontak Madiun 1948. Mereka telah bekerjasamadenganpemerintahBelanda Van Mook sebelum pemberontakan Madiun,keduanyaadalahanggota“Neterlands Indies Government Invormation Service”diMelbourne,Australia.Berdasarkan fakta tersebut diyakini Amir Syarifuddin kaki tangan Belanda (NICA). Ketika Amir Syarifuddin menduduki puncak pimpinan pemerintahan, tindakannya sangat merugikan Indonesia dan menguntungkan Belanda. Penulis adalah Veteran Pejuang Kemerdekaan Gol B,Wartawan Senior Pemerhati Sejarah.

Peluang Dan Tantangan Perguruan Tinggi Oleh Dr Ir Muhammad Buhari Sibuea, MSi Paling tidak kompetensi bidang ilmu yang dimiliki wajib diback up oleh kompetensi IT,komunikasi bahasa mancanegara dan the last but not list kemampuan enterpreneurship yang handal.


endidikan dewasa ini menjadi barang yang mahal di Indonesia. Tidak semua penduduk bisa menikmati pendidikan, bahkan pendidikan dasar sekali pun. Celakanya, lulusan perguruan tinggi terkadang tidak memiliki kualitas dan kualifikasi yang baik sebagaimana mimpi dan angan-angan setiap calon mahasiswa dan keluarganya saat seseorang memasuki perguruan tinggi. “Mau jadi apa nanti ketika selesai kuliah?” Idealnya, lulusan perguruan tinggi mampu menganalisis masalah yang terjadi, bahkan out put dunia pendidikan harus menjadi an independent knowledge worker yakni, pekerja mandiri yang berpengetahuan. Artinya, lulusan perguruan tinggi harus mampu “menciptakan” lapangan pekerjaan sendiri dan mampu mempekerjakan orang lain. Tetapi fakta yang fenomenal di lapangan adalah hal sebaliknya. Betapa setiap lulusan perguruan tinggi baik PTN maupun PTS dominan ingin “mencari” pekerjaan dengan fokus mendapatkan gaji tetap dan kontinu tanpa mengindahkan profesionalisme. Hal ini sangat menarik untuk dicermati, mengingat saat ini lulusan Perguruan tinggi di Indonesia sebagian besar hanya sebagai kolektor teori. Dan menurut berbagai kalangan sudah sampai kepada taraf kolektor pendapat atau teoritisi. Benarkah? Banyak bukti yang membenarkan pendapat ini, di antaranya yang paling jelas adalah bahwa jumlah pengangguran lulusan perguruan tinggi jauh lebih besar dari pengangguran lulusan pendidikan dasar. Mengapa demikian? Barangkali sikap terlalu memilih pekerjaan, gengsi berlebihan dan malu bekerja di sektor informal, menyebabkan lulusan perguruan tinggi banyak menganggur dan tidak terpakai di lapangan. Secara teoritis lulusan perguruan tinggi seharusnya telah memiliki wawasan, pemahaman berbagai teori dan pengalaman yang memadai untuk bisa berlaku mandiri. Selain itu, lulusan perguruan tinggi juga telah mendalami bidang ilmu tertentu, yang idealnya bidang ilmu itu sesuai dengan minatnya.Walaupun tidak bisa dinafikan bahwa pada saat ini sangat perlu untuk menggugat apakah idealisme minat, bakat, kompetensi dan relevansi itu benar-benar masih teguh dipegang oleh setiap mahasis-

wa pada saat akan dan mengikuti proses belajar dan mengajar di kampus. Apakah prinsip the right student in the right section masih tetap dipertahankan? Wallahu a’lam. Mengapa lulusan perguruan tinggi kita saat ini masih tetap menjadi dilema? Argumentasi-argumentasi berikut dapat menjadi acuan dalam menelaah dilema dimaksud, sehingga pada gilirannya dapat diperoleh solusi terbaik nantinya. Solusi yang akan menempatkan lulusan perguruan tinggi pada posisi yang terhormat proporsional. Pertama,secara kebijakan, struktur kurikulum di perguruan tinggi harus memberi tempat yang cukup leluasa bagi mahasiswa untuk belajar mandiri, baik dalam struktur utuh kurikulum maupun dalam struktur materi setiap mata kuliah. Struktur kurikulum seperti kelompok mata kuliah dasar umum, kelompok mata kuliah dasar keahlian dan kelompok mata kuliah keahlian perlu dipertajam. Dalam struktur tersebut, perlu dimasukkan mata kuliah wawasan dan praktik enterpreneurships. Konsep inilah yang sekarang dikenal dengan Kurikulum Berbasis Kompetensi (KBK) dengan suatu tujuan utama yaitu mempersiapkan lulusan perguruan tinggi yang kompeten (ahli dalam bidangnya) dan sesuai dengan permintaan stakeholder. Kedua, dalam setiap perkuliahan, perlu disediakan waktu yang memadai untuk memahami dan memecahkan berbagai masalah aktual, terutama yang terkait dengan disiplin ilmunya. Implikasi lebih lanjut dari tuntutan ini adalah struktur bahan ajar perkuliahan terdiri atas teori-teori yang telah mapan tidak lebih dari 40%, temuan baru atau hasil-

hasil penelitian mutakhir 30%, dan kajian masalah-masalah atau data mentah yang digali dari lapangan untuk dipahami, dianalisis, dan diberi makna sebesar 30%. Pembobotan ini pun masih menimbulkan kontroversi yang berkepanjangan di antara sesama pengelola pendidikan itu sendiri. Ketiga, dalam setiap perkuliahan, hasil pemahaman, analisis, pemaknaan, dan pemecahan berbagai masalah, perlu dituangkan dalam tulisan-tulisan kritis dan kreatif. Pemberian tugas berupa menulis makalah yang tidak jelas arahnya, hanya membuang waktu. Apalagi kalau makalah itu hanya berisi kumpulan kutipan dan / atau pendapat para ahli terdahulu, sementara mahasiswa tidak pernah berpendapat. Seyogyanya para mahasiswa mesti diajak atau dirangsang untuk berani mengemukakan sesuatu yang baru dan inovatif serta tidak membeo sebagaimana yang sering ditemukan pada saat seseorang lulusan Perguruan tinggi akan memasuki dunia kerja. Keempat,perkuliahan yang memberi tempat bagi mahasiswa untuk memahami dan menganalisis berbagai masalah. Kemudian, menuangkan hasil pemahaman dan analisisnya itu dalambentuktulisan ilmiah, dikembangkan pula kelompok-kelompok diskusi yang akan ikut mewadahi dan menyuburkan tumbuhnya iklim dan budaya akademik ilmiah di setiap Perguruan tinggi. Forum-forum diskusi tersebut akan memberi tempat bagi dosen dan mahasiswa dapat berinteraksi secara lebih intensif, yang berarti akan mengatasi terbatasnya petemuan yang terjadi dalam kelas perkuliahan. Dalam konteks ini dituntut style sesorang dosen yang mau menjemput dan mengalirkan bola dan style seseorang mahasiswa yang rajin mencari bola dan menjelajah lapangan. Kelima,perlu dikembangkan tes dan sistem pengujian yang mementingkan pengembangan gagasan atau penalaran dan karya nyata. Tes yang berbentuk objektif (pilihan ganda dan sejenisnya) hendaknya ditekan sekecil-kecilnya bahkan bila perlu dihilangkan sama sekali.

Untuk itu perlu dikembangkan assessment (pengumpulan data untuk menentukan hasil belajar) yang mengutamakan karya nyata melalui portofolio dan self-assessment. Keenam, skripsi yang dibuat mahasiswa hendaknya lebih mengutamakan pemecahan masalah dan pemunculan/pengembangan gagasan orisinal daripada hanya replikasi penelitian dengan lokasi yang berbeda. Dalam batas-batas tertentu penelitian kajian pustaka dan long essay jauh lebih bermanfaat daripada penelitian lapangan yang hanya replikasi dengan berbeda lokasi seperti yang banyak dilakukan saat ini. Setiap program studi perlu melakukan pemetaan masalah untuk memberi wawasan makro kepada mahasiswa yang akan menulis skripsi. Pemetaan masalah ini perlu agar masalah yang ditulis untuk menyelesaikan skripsi tidak hanya berkutat pada masalah tertentu saja. Hendaknya setiap lulusan perguruan tinggi mampu menulis sebuah skripsi yang new perfect sekalipun dalam skala paling kecil. Ketujuh, kegiatan ekstra kurikuler hendaknya tidak hanya mengutamakan kegiatan demonstratif atraktif insidental tetapi diupayakan juga lebih mengutamakan aktivitas pembinaan penalaran melalui berbagai forum ilmiah, baik lintas jurusan, lintas fakultas dan bahkan lintas institusi terutama bila dikaitkan dengan persiapan menghadapi dunia kerja nantinya. Saatnyalah Perguruan tinggi membuka mata dan telinga terhadap aktifitas duniakerjasehinggakonseplinkandmatch dapat menjadi sebuahsinergiyangdahsyat dan kontinu. Dewasa ini, tantangan mahasiswa dan lulusan perguruan tinggi memang makin berat, di era informasi dan globalisasi ini diperlukan sumber daya manusia yang tidakhanyamemilikikeahlianyangspesifik tetapi juga memiliki wawasan yang luas. Paling tidak kompetensi bidang ilmu yang dimiliki wajib diback up oleh kompetensi IT, komunikasi bahasa mancanegara dan the last but not list kemampuan enterpreneurship yang handal. Insya Allah jika kompetensi ini dikuasai maka tidak sulit untuk berkarir. Untuk itu, berbagai upaya strategis perlu dilakukan baik oleh mahasiswayangbersangkutanmaupunlembaga penyelenggara Perguruan tinggi. Hanya dengan strategi dan upaya yang terarah dan sistematis, penyelenggaraan Perguruan tinggi akan efektif dan efisien dalam menyiapkan sumber daya manusia yang unggul untuk pembangunan yang berkelanjutandanberwawasantotalquality management. Semoga. Penulis adalah Doktor Bidang Pembangunan Manusia lulusan University of Malaya,Staf Pengajar ` Fakultas Pertanian UMSU Medan.

Waspada, Senin 19 Desember 2011  

waspada daily

Read more
Read more
Similar to
Popular now
Just for you