Page 1

Polda Maluku Bantah Temuan Puluhan Mayat, 3.000 Warga Mengungsi

WASPADA Demi Kebenaran Dan Keadilan

AMBON (Antara): Kepolisian Daerah Maluku membantah adanya penemuan puluhan mayat dalam sebuah rumah yang terbakar saat terjadi bentrokan antarmarga Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999) Salampessy di Pelauw, Kec. Haruku, Kab. Maluku Tengah. “Kalau ada temuan seperti itu aparat Brimob, Samapta SENIN, Pahing, 13 Februari 2012/20 Rabiul Awal 1433 H No: 23773 Tahun Ke-66 Terbit 24 Halaman (A1-8, B1-8-C1-8) Harga Eceran: 2.500,dan Reskrim yang ada di tempat kejadian perkara sudah memberikan laporannya secara resmi,” kata Kabid Humas Polda Maluku AKBP J. Huwae di Ambon, Minggu (12/2). Huwae mengakui bentrokan yang terjadi pada Sabtu (11/2) memang menimbulkan korban jiwa dan dievakuasi ke Negeri Rohomoni untuk dimakamkan. Namun, jumlahnya hanya enam orang ditambah 300 rumah penduduk terbakar dalam peristiwa itu. Empat dari enam korban tewas yang teridentifikasi adalah Syarifudin Tualepe yang BELAWAN (Waspada): Bentrokan antar warga berprofesi sebagai dosen, Hamin Nurlete terjadi di Kelurahan Belawan I, Kec Medan Bela(siswa SMA Negeri 1 Pelauw), Alim Sahubawa, wan, Minggu (12/2) malam sekitar pukul 20:00. dan Abrakip Latupono. Tidak ada korban jiwa dalam bentrokan ini, “Jadi, yang jelas korban meninggal dalam namun seorang polisi Briptu Fernandes Manubentrokan ini hanya enam orang. Akan tetapi, lang, 26, anggota Samapta Polres Pelabuhan kalau ada laporan puluhan mayat ditemukan Belawan dan Khaidir, 17, warga Lorong Melati dalam sebuah reruntuhan rumah hangus Kel Belawan Satu, jadi korban. terbakar belum diketahui secara pasti,” kata Briptu Fernandes Manulang mengalami luka Huwae menandaskan. bacok pada kaki dan tangan kanan serta kepala. Terbakarnya rumah-rumah penduduk Anggota Polri itu terpaksa dirujuk di RSU Pirngadi di pesisir pantai Pelauw mengakibatkan Medan setelah sempat ditangani petugas Rumwarga setempat mengungsi ke kerabat mereka kital Belawan. Sedangkan Khaidir dirawat di di negeri tetangga, seperti Rohomoni dan Rumkital Belawan. Kailolo. Bahkan, ada sebagian di antara Informasi yang diperoleh, sebelum kejadian mereka lansia, wanita, dan anak-anak yang Khaidir bersama pacarnya Rasti pergi ke Ringkai, mengungsi ke Negeri Liang, Kecamatan kawasan Belawan Internasional Center Terminal Salahutu (Pulau Ambon), Kabupaten Maluku (BICT) mengendarai sepeda motor. Tengah. Di tempat itu, dia didatangi 10 orang pria meSejauh ini belum diketahui apakah Pemengendarai 5 sepeda motor dan menuduh Khaidir rintah Kabupaten Maluku Tengah maupun ikut ‘perang’ yang terjadi baru-baru ini. “Aku Pemprov Maluku telah memberikan bantuan membantah namun mereka tetap ngotot dan pangan kepada para pengungsi, sebab Raja menuduh aku ikut,” kata Khaidir yang ditemui Negeri Pelauw, Efendy Latuconsina, tidak bisa di Rumkital Belawan. dihubungi lewat telepon genggamnya. Selanjutnya, sekitar pukul 19:30, Khaidir dibaKabid Humas mengatakan bentrok interwa pelaku ke Lorong Pemancar, Kel Belawan I. nal antarmarga Salampessy ini bukan baru Di tempat itu, Khaidir dipukuli sebelum akhirnya kali pertama terjadi, melainkan sejak lama dijeput keluarganya bersama seorang anggota dan sering berbuntut aksi pembakaran rumah Marinir. “Aku dijeput setelah pacarku mengabari Antara penduduk. keluargaku,” ucapnya. PUING-puing bekas rumah yang terbakar akibat pertikaian antarwarga di Negeri Pelauw, Kabupaten Maluku Tengah, Maluku, Minggu (12/2). Pertikaian Lanjut ke hal A2 kol. 6 itu dipicu selisih pendapat soal ritual adat di Negeri Pelauw mengakibatkan sekitar 500 rumah terbakar. Lanjut ke hal A2 kol. 5

Bentrok Warga Di Belawan Polisi Dibacok

Pemadam Lambat Atasi Kebakaran MEDAN (Waspada): Dinas Pencegah dan Pemadam Kebakaran (P2K) Pemko Medan mengakui armadanya lambat tiba di lokasi kebakaran, terutama pada kasus penanganan kebakaran tiga ruko di Jl. Sultan Ma’moen Alrasyid Medan/Jl. Brigjen Katamso, kemarin. Pejabat terkait mengatakan armadanya selalu terjebak kemacatan sehingga memperlambat akses ke lokasi. Kendala lainnya mobil pemadam tidak bisa

selang panjang. Belum lagi minimnya ketersediaan hydrant. Untuk itu, lanjutnya, pengefektifan kembali hydrant sangat mendesak. Pasalnya, saat ini hydrant di Medan

memasuki lokasi padat penduduk. Bahkan gang kebakaran banyak berubah fungsi menyulitkan pemadam sehingga kita harus menggunakan

yang aktif hanya tinggal 30 persen. “Kendala yang kita rasakan setiap terjadi kebakaran di mana-mana adalah masalah kemacatan. Apalagi pada waktu jam-jam

Whitney Houston: “Saya Bukan Malaikat. Saya Bisa Jatuh Berlumur Kotoran.”

Anggota DPR Temui Nazaruddin, Empat Pejabat Ditjen PAS Dicopot JAKARTA (Antara): Menteri Hukum dan HAM (Menkumham) Amir Syamsuddin mencopot empat pejabat Ditjen Pemasyarakatan (PAS) terkait kedatangan anggota Komisi III DPR M Nasir di luar jam kunjungan di Rumah Tahanan (Rutan) Cipinang, Jakarta Timur. Menkumham mencopot Kepala Kantor Wilayah (Kakanwil) DKI Jakarta Kementerian Hukum dan HAM (Kemkumham), Taswin Tarip, Kepala Divisi Pemasyarakatan Ditjen PAS, Haviludin, Kepala Rutan Cipinang Kemkumham, Suharman dan Kepala Pengamanan

BANDAACEH (Waspada): Deklarasi akbar 16 pasang calon kepala daerah (KDh) yang diusung Partai Aceh, terbilang istimewa. Setidaknya tiga purnawirawan jenderal hadir dalam peusijuk dan deklarasi kandidat yang diusung mantan anggota Gerakan Aceh Merdeka (GAM) itu. Deklarasi pasangan kepala daerah dari Partai Aceh yang diikuti ribuan pendukungnya ini berlangsung di Stadion H Dimoertala Lampineung, Minggu (12/2). Lapangan bola berkapasitas 15 ribu penonton itu dibanjiri lautan manusia. Pemangku Wali Nanggroe Malik Mahmud, menepungtawari 16 pasang

net

Lanjut ke hal A2 kol. 6

kandidat kepala daerah yang disusul sejumlah ulama, seperti Abuya Muhibbuddin Waly, Teungku Usman Kuta Krueng dan Abu Paya Pasie Julok. Kandidat Gubernur dan Wakil Gubernur Zaini Abdullah dan Muzakir Manaf yang pertama dipeusijuk. Lantunan salawat mengiringi acara peusijuk. Usai acara peusijuk dilanjutkan dengan pemberian santunan kepada puluhan anak. Malik Mahmud didampingi Darwis Jeunib serta beberapa pengurus Partai Aceh memberikan santunan pada acara yang dirangkai peringatan maulid Nabi Muhammad SAW. Lanjut ke hal A2 kol. 3

warga, maka dalam waktu paling lama 5 menit armada langsung meluncur. Namun, begitu di jalan terjadi kemacetan panjang sehingga armada terlambat tiba di lokasi. “Kita bisa buktikan kalau ada kebakaran paling lambat 5 menit kita sudah berangkat. Namun, jika terjadi Lanjut ke hal A2 kol. 3

Korban Kebakaran Ruko Di Katamso Dibawa Ke Singapura

Rutan Cipinang, Foneka Afandi. “Pencopotan ini tentu sudah dipertimbangkan dengan matang. Kami melihat ini perlu diputuskan dengan tepat. Karena itu hari ini dilakukan penggantian,” kata Menteri Amir di Jakarta, Minggu (12/2). Ia menegaskan kunjungan anggota DPR M Nasir menemui saudaranya yang menjadi terdakwa dari kasus dugaan suap proyek pembangunan Wisma Atlet SEA Games Jakabaring,

Tiga Jenderal Hadiri Deklarasi Calon KDh Dari Partai Aceh

tertentu seperti pagi, siang dan sore. Jadi, apa yang kami perbuat kalau jalan macat,” kata Kepala Dinas Penanggulangan dan Pencegahan Kebakaran (P2K) Marihot Tampubolon kepada Waspada, Minggu (12/2). Marihot menegaskan, petugasnya selalu stand by di kantor untuk menerima laporan dari masyarakat bila terjadi kebakaran. Dan apabila ada laporan

Whitney Houston bersama putrinya Bobbi Kristina.

Oleh Izharry Agusjaya Munzir “SETAN terbesar adalah diriku! Diriku adalah teman baikku, sekaligus musuh besarku.” Ungkapan itu disampaikan Whitney Houston 10 tahun lalu ketika diwawancara oleh ABC. Dia menyatakan itu dengan penuh keyakinan. Meski tegas, namun kalimat itu bersayap. Tidak ada orang yang percaya dan mampu membayangkan hidup galau dari seorang Diva Internasional. Whitney, geto loh! Mana mungkin penyanyi bersuara malaikat bisa punya masalah dalam hidup ini? Uang mengalir setiap hari ke pundi-pundinya. Lagulagunya selalu menclok di jenjang teratas tangga lagu-lagu dunia. Dia cantik. Lanjut ke hal A2 kol. 1

Meninggal Di Hotel LOS ANGELES, AS (Reuters): Whitney Houston ditemukan sudah tidak bernyawa Sabtu (Minggu 12/2 WIB) sore di satu kamar di Hotel Beverly Hilton. Houston tutup usia 48 tahun. Penyanyi pop itu meninggal dunia menjelang penganugerahan Grammy Awards di Los Angeles yang diadakan di hotel yang sama, dimana gurunya raja rekaman Clive Davis, mengadakan pesta menjelang ajang pemberian penghargaan tahunan itu yang Lanjut ke hal A2 kol. 1

MEDAN (Waspada): Salah seorang dari tiga korban kebakaran yang dirawat di RSU Permata Bunda, Syafrijal, 30, warga Pasar VII Kec. Medan Tembung mulai membaik. Sedangkan korban lainnya, yakni pemilik toko cat, Loi Weng Hoa (Linghua), 48, warga Jalan Sultan Ma’moen Alrasyid/Brigjen Katamso Medan yang mengalami luka bakar 90 persen dirujuk keluarganya ke salah satu rumah sakit di Singapura dan pedagang es tebu Lai Poei Kong alias A Hui, 58, warga Kampung Aur Medan dirujuk ke

RSU Methodist. “Iya, Linghua mau dibawa ke Singapura sore ini karena luka bakarnya sudah mencapai 90 persen,” kata seorang keluarga ditemui di RSU Permata Bunda, Minggu (12/2) sore. Sementara, Syafrijal yang masih dirawat di Ruang Kecubung 202 RSU Permata Bunda mengatakan, saat terjadi kebakaran dirinya sedang berada di luar toko. “Saat itu saya sedang di depan toko, tiba-tiba api menyambar dari toko Lanjut ke hal A2 kol. 1

Aparat Gabungan Razia Kafe, Hotel Dan Warung TANJUNGBALAI (Waspada): Aparat gabungan dari Satpol Pamong Praja Tanjungbalai, Polres T. Balai, POM TNI AL dan Koramil, merazia sejumlah kafe, hotel dan warung remang-remang, Minggu (12/2) sekira pukul 01:00. Hasilnya, dua perempuan dijaring dari warung tuak di Jalan Jati, Kec. Datukbandar yang berdalih sebagai calon Tenaga Kerja Indonesia (TKI) dengan paspor di tangannya. Janda dan gadis itu masing-masing Yan, 37, warga Lumajang, Jawa Timur, dan Kus, 37, asal Jepara, Jawa Tengah, diangkut karena diduga sebagai pelayan hidung belang di kafe tersebut. Sedangkan sejumlah wanita lain di

antaranya RS, 28, Pon, 29, keduanya warga Tanjungbalai, IL, 22, penduduk Pematangsiantar dan Ros, 32, domisili Sentang, Kisaran, diduga sebagai PSK (Pekerja Seks Komersial). Mereka ditangkap dari Lapangan Pasir dan Pantai Amor, meski sempat berusaha kabur dari kejaran petugas. Di tempat lain, aparat juga mengamankan beberapa pria hidung belang bersama wanita yang bukan pasangan sah. Di antaranya JS, 42, warga Sidikalang, berpasangan dengan Ag, 37, warga Tanjungbalai. Kemudian AM, 29, warga Medan, berduaan dengan Mar, 32, janda dari Pematang Gunung, T. Tinggi. Lanjut ke hal A2 kol. 1

Ada-ada Saja

Al Bayan

Nabi Besar

Hobi Makan Plastik

Oleh Tgk H. Ameer Hamzah ISTILAH Nabi Besar sangat sering kita dengar dari mulut para da’i. Gelar itu wajar dan tidak berlebihan. Nabi Muhammad memang yang terbesar di antara para nabi dan rasul. Bukan besar badan tetapi besar tugas dan pengaruhnya. Makanya beliau disebut “penghulu” segala ambiya. Beliaulah satu-satunya rasul yang diutus untuk segala bangsa dan segala makhluk Allah di alam ini. Beliau diutus Allah untuk penutup segala nabi dan rasul. Setelah beliau tidak ada lagi para nabi dan rasul, baik yang membawa wahyu mapun yang tidak. Kalau ada orang yang mendakwakan dirinya nabi yang telah menerima wahyu, mereka disebut nabi palsu dan sesat. Mengenai kebesaran beliau dapat kita teliti dari sejarah kelahirannya. Ketika Siti Aminah (ibunya) mengandung,

Lanjut ke hal A2 kol. 6

SEORANG gadis remaja asal Amerika Serikat mengaku hobi mengkonsumsi plastik seperti botol air, tempat piringan CD, gantungan baju, dan bahkan remote televisi. Karena kecanduannya terhadap plastik, Kailyn mengaku sudah menelan lebih dari 60 ribu berbagai macam bentuk benda plastik selama sekira 11 tahun terakhir.

Waspada/Ist

Laporan Tim Waspada Dari Sydney

TIM Waspada berpose dengan pemilik peternakan Mayberry Farm Craig Whitman/Tammy, kawasan Burrawang, New South Wales, Austalia, Sabtu (11/2).

Waspada/Hendrik Prayetno

PEKERJA Peternakan Sapi Perah Mayberry Farm di Burrawang, New South Wales, Australia, sedang memasang alat pemerah susu pada puting sapi, Sabtu (11/2).

Pilih Susu Atau Daging

KETIKA sedang meminum susu sapi, pernahkah kita terpikir darimana sapi itu diternakkan dan bagaimana susunya diproses? Ternyata hampir 70 persen susu yang kita konsumsi datangnya antara lain dari benua Australia. Sabtu (11/2) kemarin, tim Waspada melanjutkan perjalanan udara satu jam enam menit dari Gold Coast menuju kota lain di Australia, yakni Sydney. Di kota inilah kami mengunjungi sebuah peternakan sapi yang dikelola

keluarga Whatman. Lokasinya di kawasan Burrawang, kira-kira 144 km selatan kota Sydney. Kami memang sudah memprogram kunjungan itu. Apalagi seperti diketahui peternak sapi di negara kita ternyata lebih terfokus hanya untuk menghasilkan daging saja dan meninggalkan produksi susu sapinya. Padahal Lanjut ke hal A2 kol. 6

Lanjut ke hal A2 kol. 1

Serampang - Cepat redam sebelum membara - He...he...he...


Anggota Pramuka Tewas SIGLI (Waspada): Nasib naas menimpa Nailun Muna, 16, seorang anggota Pramuka yang juga siswi SMP Negeri I Padang Tijie, Kabupaten Pidie. Gadis ini meninggal dunia akibat tenggelam di Waduk Rajui, Desa Blang Putek, Kecamatan Padang Tijie. Minggu (12/2) sekira pukul 14:00. Kasat Reskrim Polres Pidie AKP Jatmiko kepada Waspada, mengatakan, peristiwa itu terjadi bermula pada saat korban bersama teman-temannya mengambil air wudhu, seusai makan siang. Tiba-tiba kaki korban terpeleset dan terjatuh ke dalam waduk. (b10)

WASPADA Demi Kebenaran Dan Keadilan

Harian Umum Nasional Terbit Sejak 11 Januari 1947. Pendiri: H. Mohd. Said (1905 - 1995), Hj. Ani Idrus (1918 - 1999) SENIN, Pahing, 13 Februari 2012/20 Rabiulawal 1433 H  z No: 23773 Tahun Ke-66

 z Harga Eceran: Rp 2.500,Terbit 24 Halaman ( A1-8, B1-8, C1-8)

FOTO KANAN: Salah satu rombongan massa menggunakan mobil Pick-Up jenis L300 yang berangkat dari Aceh Timur mengecat wajahnya dengan bendera dan warna Partai Aceh (PA). Sambil meneriakkan yel-yel, massa PA sejak pagi sudah mulai berangkat menuju Banda Aceh dengan tujuan meramaikan deklarasi PA di Banda Aceh Minggu (12/2).

FOTO KIRI: Meuntroe Malik Mahmud pemangku Wali Nanggroe, bersama Ketua DPRA Hasbi Abdullah didampingi per wakilan Pemerintah Aceh mewakili PJ Gubernur Aceh menghadiri yang menghadiri deklarasi pasangan calon gubernur dan wakil gubernur Aceh ZainiMuzakkir, Minggu (12/2) distadion Dimurtala Lampineung Banda Aceh. Waspada/Gito Rolies

Waspada/Muhammad H. Ishak

Deklarasi Calon KDh Dari Partai Aceh

Tiga Jenderal Hadir Puluhan Truk Angkut Sembako Tertahan Di Labuhanhaji TAPAKTUAN(Waspada): Puluhan truk bermuatan sembako dan mobil pribadi lainnya, trayek Sinabang Pulau Simelue, Mi n g g u ( 1 2 / 2 ) , k e m b a l i m e n u m p u k d i p e l a b u h a n Penyeberangan Labuhanhaji, Aceh Selatan, karena kapal feri penyerangan belum beroperasi maksimal. Selain truk, ratusan penumpang ikut telantar, baik awak truk maupun penumpang umum lainnya mengaku kehabisan uang makan karena telah beberapa hari terkatung-katung di kawasan pelabuhan tersebut. Lanjut ke hal A2 kol.5

BANDAACEH (Waspada): Deklarasi akbar 16 pasang calon kepala daerah (KDh) yang diusung Partai Aceh, terbilang istimewa. Setidaknya tiga purnawirawan jenderal hadir dalam peusijuk dan deklarasi kandidat yang diusung mantan anggota Gerakan Aceh Merdeka (GAM) itu. Deklarasi pasangan kepala daerah dari Partai Aceh yang diikuti ribuan pendukungnya ini berlangsung di Stadion H Dimoertala Lampineung, Minggu (12/2). Lapangan bola berkapasitas 15 ribu penonton itu dibanjiri lautan manusia.

Pemangku Wali Nanggroe Malik Mahmud, menepungtawari 16 pasang kandidat kepala daerah yang disusul sejumlah ulama, seperti Abuya Muhibbuddin Waly, Teungku Usman Kuta Krueng dan Abu Paya Pasie Julok. Kandidat

Gubernur dan Wakil Gubernur Zaini Abdullah dan Muzakir Manaf yang pertama dipeusijuek. Lantunan salawat mengiringi acara peusijuk. Usai acara peusijuk dilanjutkan dengan pemberian santunan kepada puluhan anak. Malik Mahmud didampingi Darwis Jeunib serta beberapa pengurus Partai Aceh memberikan santunan pada acara yang dirangkai peringatan maulid Nabi Muhammad SAW. Terasa lebih istimewa,

deklarasi akbar ini dihadiri sejumlah tokoh Aceh dan bekas pejabat tinggi militer semacam mantan Komandan Jenderal Kopassus Letjen (Purn) Sunarko, mantan Panglima Kodam Iskandar Muda Mayjen (Purn) Djali Yusuf, serta mantan Kepala Staf Kodam Iskandar Muda Brigjen (Purn) M. Yahya. Juga hadir mantan Danpuspon TNI Mayjen Sulaiman AB, dan mantan Wakil Panglima TNI Fahrurrazi Lanjut ke hal A2 kol.5

Soal Anggota DPR Temui Nazaruddin

4 Pejabat Ditjen PAS Dicopot JAKARTA (Antara): Menteri Hukum dan HAM (Menkumham) Amir Syamsuddin mencopot empat pejabat Ditjen Pemasyarakatan (PAS) terkait kedatangan anggota Komisi III DPR M Nasir di luar jam kunjungan di Rumah Tahanan (Rutan) Cipinang, Jakarta Timur. Menkumham mencopot Kepala Kantor Wilayah (Kakanwil) DKI Jakarta Kementerian Hukum dan HAM (Kemkumham), Taswin Tarip, Kepala Divisi Pemasyarakatan Ditjen PAS, Haviludin, Kepala Rutan Cipinang Kemkumham, Lanjut ke hal A2 kol.1

Korban Kebakaran Ruko Dibawa Ke Singapura

Antara

PUING-puing bekas rumah yang terbakar akibat pertikaian antarwarga di Negeri Pelauw, Kabupaten Maluku Tengah, Maluku, Minggu (12/2). Pertikaian itu dipicu selisih pendapat soal ritual adat di Negeri Pelauw mengakibatkan sekitar 500 rumah terbakar.

Polda Bantah Temuan Puluhan Mayat AMBON (Antara): Kepolisian Daerah Maluku membantah adanya penemuan puluhan mayat dalam sebuah rumah yang terbakar saat terjadi bentrokan antarmarga Salampessy di Pelauw, Kecamatan Haruku, Kabupaten Maluku Tengah. “Kalau ada temuan seperti itu aparat Brimob, Samapta dan Reskrim yang ada di tem-

pat kejadian perkara sudah memberikan laporannya secara resmi,” kata Kabid Humas Polda Maluku AKBP J. Huwae di Ambon, Minggu (12/2). Huwae mengakui bentrokan yang terjadi pada Sabtu (11/2) memang menimbulkan korban jiwa dan dievakuasi ke Negeri Rohomoni untuk dimakamkan. Namun, jumlahnya hanya enam orang ditambah

300 rumah penduduk terbakar dalam peristiwa itu. Empat dari enam korban tewas yang teridentifikasi adalah Syarifudin Tualepe yang berprofesi sebagai dosen, Hamin Nurlete (siswa SMA Negeri 1 Pelauw), Alim Sahubawa, dan Abrakip Latupono. “Jadi, yang jelas korban Lanjut ke hal A2 kol.3

MEDAN (Waspada): Salah seorang dari tiga korban kebakaran yang dirawat di RSU Permata Bunda, Syafrijal, 30, warga Pasar VII Kec. Medan Tembung mulai membaik. Sedangkan korban lainnya, yakni pemilik toko cat, Loi Weng Hoa (Linghua), 48, warga Jalan Sultan Ma’moen Alrasyid/Brigjen Katamso Medan yang mengalami luka bakar 90 persen dirujuk keluarganya ke salah satu rumah sakit di Singapura dan pedagang es tebu Lai Poei Kong alias A Hui, 58, warga Kampung Aur Medan dirujuk ke RSU Methodist. “Iya, Linghua mau dibawa ke Singapura sore ini karena luka bakarnya sudah mencapai 90 persen,” kata seorang keluarga ditemui di RSU Permata Bunda, Minggu (12/2) sore. Sementara, Syafrijal yang masih dirawat di Ruang Kecubung 202 RSU Permata Bunda mengatakan, saat terjadi kebakaran dirinya sedang berada di luar toko.

“Saat itu saya sedang di depan toko, tiba-tiba api menyambar dari toko cat, terdengar ada ledakan dan api langsung menyambar keluar,” kata Syafrijal ditemui di ruang perawatan, Minggu (12/2). Akibat ledakan tersebut, wajah, tangan, perut serta kakinya mengalami luka bakar. “Saya karyawan di Toko Mega Jaya Teknik di samping toko cat yang terbakar. Toko kami pun ikut terbakar,” katanya. Sementara pemilik Toko Mega Jaya Teknik (samping Toko Cat yang terbakar-red) dijumpai saat menjenguk Syafrijal, AK mengatakan akibat kebakaran itu dirinya mengalami kerugian hingga ratusan juta rupiah. “Tiga sepeda motor terbakar, satu di antaranya milik Syafrijal. Tapi masih ada barang-barang yang berhasil diselamatkan,” kata dia menyebutkan, saat terjadi kebakaran berada di dalam tokonya. Namun ketika mendengar suara ledakan dia

buru-buru meninggalkan toko miliknya. Dalam pemeriksaan Kebakaran yang menghanguskan tiga ruko di Jalan Brigjen Katamso itu kini menyisakan puing-puing. Selain gedung, seluruh isi dalam ruko ikut musnah. Untuk keperluan penyidikan polisi telah memasang police line dan mengambil beberapa barang bukti guna keperluan penyidikan penyebab kebakaran itu. Kapolsek Medan Kota Kompol Sandy Sinurat dihubungi Waspada, Minggu (12/ 2), mengatakan, masih menyelidiki penyebab kebakaran itu. “Penyebab pasti belum diketahui, meski ada kemungkinan akibat meledaknya karbit dari mobil box yang parkir di depan salah satu ruko. Barang bukti yang diperlukan sudah diambil untuk penyidikan, termasuk beberapa saksi. Kalau sudah dipastikan penyebabnya akan segera disampaikan,” kata dia.(m27/h02)

Net

Whitney Houston Meninggal Di Hotel LOS ANGELES, AS (Reuters): Whitney Houston (foto) ditemukan sudah tidak bernyawa Sabtu (Minggu 12/2 WIB) sore di satu kamar di Hotel Beverly Hilton. Houston tutup usia 48 tahun. Penyanyi pop itu meninggal dunia menjelang penganugerahan Grammy Awards di Los Angeles yang diadakan di hotel yang sama, dimana gurunya raja rekaman Clive Davis, mengadakan pesta menjelang ajang pemberian penghargaan tahunan itu yang menampilkan sejumlah selebriti dalam industri permusikan. Lanjut ke hal A2 kol.1

Ada-ada Saja

Al Bayan

Hobi Makan Plastik

Nabi Besar Oleh: H Ameer Hamzah ISTILAH Nabi Besar sangat sering kita dengar dari mulut para da’i. Gelar itu wajar dan tidak berlebihan. Nabi Muhammad memang yang terbesar di antara para nabi dan rasul. Bukan besar badan tetapi besar tugas dan pengaruhnya. Makanya beliau disebut “penghulu” segala ambiya. Beliaulah satu-satunya rasul yang diutus untuk segala bangsa dan segala makhluk Allah di alam ini. Beliau diutus Allah untuk penutup segala nabi dan rasul. Setelah beliau tidak ada lagi para nabi dan rasul, baik yang membawa wahyu mapun yang tidak. Kalau ada orang yang mendakwakan dirinya nabi yang telah menerima wahyu, mereka disebut nabi palsu dan sesat. Mengenai kebesaran beliau dapat kita teliti dari sejarah kelahirannya. Ketika Siti Aminah (ibunya) mengandung, datang kepada sang ibu yang mulia itu ruh Siti Maryam (ibu Nabi Isa) dan Siti Asiah (bekas isteri Firaun) dua wanita salihah yang ditugaskan Allah untuk menghibur Aminah. Tahun kelahiranya terjadi sebuah peristiwa yang Lanjut ke hal A2 kol.1

TIM Waspada berpose dengan pemilik peternakan Mayberry Farm Craig Whitman/Tammy, kawasan Burrawang, New South Wales, Austalia, Sabtu (11/2).

PEKERJA Peternakan Sapi Perah Mayberry Farm di Burrawang, New South Wales, Australia, sedang memasang alat pemerah susu pada puting sapi, Sabtu (11/2).

Pilih Susu Atau Daging KETIKA sedang meminum susu sapi, pernahkah kita terpikir darimana sapi itu diternakkan dan bagaimana susunya diproses? Ternyata hampir 70 persen susu yang kita konsumsi datangnya antara lain dari benua Australia. Sabtu (11/2) kemarin, tim Waspada melanjutkan perjalanan udara satu jam

� Laporan Tim Waspada Dari Sydney enam menit dari Gold Coast menuju kota lain di Australia, yakni Sydney. Di kota inilah kami mengunjungi sebuah peternakan sapi yang dikelola keluarga Whatman. Lokasinya di kawasan Burrawang, kirakira 144 km selatan kota Sydney.

Kami memang sudah memprogram kunjungan itu. Apalagi seperti diketahui peternak sapi di negara kita ternyata lebih terfokus hanya untuk menghasilkan daging saja dan meninggalkan produksi susu sapinya. Padahal di tubuh sapi khususnya be-

tina, ada daging sekaligus susu. Ini mungkin bisa dimaklumi karena masyarakat kita sebagian besar ternyata belum terbiasa meminum susu. Tingkat konsumsi susu kita hanya 11 liter/kapita/tahun. Jumlah itu jauh dibanding Malaysia yang 36 liter/kapita/tahun. Semen-

tara masyarakat Eropa dan Amerika mengonsumsi susu jauh di atas angka itu. Di Indonesia, produksi susu sapi memang belum dimaksimalkan. Buktinya kita baru mampu memproduksi susu sapi 500 juta liter pertahun, dari total 1,5 miliar liter kebutuhan nasional. Lanjut ke hal A2 kol.1

SEORANG gadis remaja asal Amerika Serikat mengaku hobi mengkonsumsi plastik seperti botol air, tempat piringan CD, gantungan baju, dan bahkan remote televisi. Karena kecanduannya terhadap plastik, Kailyn mengaku sudah menelan lebih dari 60 ribu berbagai macam bentuk benda plastik selama sekira 11 tahun terakhir. Saat hadir dalam sebuah acara televisi, perempuan yang kini berusia 18 tahun itu unjuk kemampuannya memakan botol air dan tempat CD. “Saya sudah memakan 12 remote televisi, lebih dari lima Lanjut ke hal A2 kol.3

Serampang - Pilih dua-duanya - He.... he....he....


Berita Utama

A2 4 Pejabat...

Suharman dan Kepala Pengamanan Rutan Cipinang, Foneka Afandi. “Pencopotan ini tentu sudah dipertimbangkan dengan matang. Kami melihat ini perlu diputuskan dengan tepat. Karena itu hari ini dilakukan penggantian,” kata Menteri Amir di Jakarta, Minggu (12/2). Ia menegaskan kunjungan anggota DPR M Nasir menemui saudaranya yang menjadi terdakwa dari kasus dugaan suap proyek pembangunan Wisma Atlet SEA Games Jakabaring, Palembang, yakni M Nazaruddin, merupakan penyimpangan. Ia mengatakan Kemkumham pada dasarnya mendukung pengawasan yang dilakukan oleh anggota DPR, namun harus tetap sesuai dengan aturan yang ada, yakni Peraturan Pemerintan (PP) Nomor 27 Tahun 1983 tentang Pelaksanaan Kitab UndangUndang Hukum Acara Pidana. “Bahkan seorang kuasa hukum pun yang memiliki hak menemui kliennya di penjara juga tetap tidak bisa 24 jam berkunjung,” tegas Amir. Sementara itu, Wakil Menteri Hukum dan HAM (Wamenkumham) Denny Indrayana mengatakan dalam buku tamu milik M Nazaruddin tertulis bahwa M Nasir datang sekitar pukul 21:00 WIB. “Sedangkan saya datang sekitar pukul sebelas malam, yang bersangkutan (M Nasir) masih di sana. Sesuai aturan, kunjungan di rutan atau lembaga pemasyarakatan (Lapas) maksimal hanya setengah jam saja,” katanya. Denny pun mengatakan berdasarkan catatan di buku tamu Nazaruddin tercatat Nasir berulang kali melakukan kunjungan, termasuk di hari libur.

Polda Bantah...

ribu biji plastik, sekira seribu berbagai macam hiasan minuman, 100 garpu dan sekira 10 botol air,” tutur Kailyn seperti dikutip Daily Mail, belum lama ini. “Plastik benar-benar benda yang saya inginkan dan butuhkan,” ucapnya. (net/rzl)

mereka lansia, wanita, dan anak-anak yang mengungsi ke Negeri Liang, Kecamatan Salahutu (Pulau Ambon), Kabupaten Maluku Tengah. Sejauh ini belum diketahui apakah Pemerintah Kabupaten Maluku Tengah maupun Pemprov Maluku telah memberikan bantuan pangan kepada para pengungsi, sebab Raja Negeri Pelauw, Efendy Latuconsina, tidak bisa dihubungi lewat telepon genggamnya. Kabid Humas mengatakan bentrok internal antarmarga Salampessy ini bukan baru kali pertama terjadi, melainkan sejak lama dan sering berbuntut aksi pembakaran rumah penduduk. “Hanya saja, ada pihak yang sering melaporkan kejadiannya ke Mabes Polri dengan menambah jumlah korban,” ujarnya.

meninggal dalam bentrokan ini hanya enam orang. Akan tetapi, kalau ada laporan puluhan mayat ditemukan dalam sebuah reruntuhan rumah hangus terbakar belumdiketahuisecarapasti,”kata Huwae menandaskan. Terbakarnya rumah-rumah penduduk di pesisir pantai Pelauw mengakibatkan warga setempat mengungsi ke kerabat mereka di negeri tetangga, seperti Rohomoni dan Kailolo. Bahkan, ada sebagian di antara

Ada-ada Saja...

Whitney...

Polisi kawasan Beverly Hills mengatakan mereka diminta untuk datang ke Beverly Hilton pada pukul 03:43 sore dan personil pemadam kebakaran sudah ada di lokasi. Whitney berada di kamarnya di lantai empat hotel itu namun tidak merespon pertolongan yang diberikan pihak medis dan dia dinyatakan telah meninggal dunia pukul 03:55 sore. “Kondisinya positif diketa-

hui oleh para teman dan keluarga yang bersamanya di hotel itu dan orang-orang terdekat sudah diberitahu,” kata Letnan Mark Rosen kepada wartawan. Polisi mengatakan tidak ada tanda tindakan kriminal terhadap dirinya. Petugas medis Los Angeles mengeluarkan jenazahWhitney dari hotel menjelang tengah malam lewat pintu belakang untuk menghindari media yang berusahamencaritahupenyebabkema-

tiannya yang mengejutkan itu. Para petugas medis tersebut akan melakukan otopsi selama satu atau dua hari, yang kemudian akan mengumumkan informasi tentang penyebab kematiannya. Jika kematiannya akibat narkoba atau alkohol, maka hal itu tidak akan diumumkan sampai dilakukan uji coba toksikologi yang akan makan waktu enam sampai delapan minggu. (m23)

Albayan...

Timur tentang akhlak Nabi. “Apakah kalian menuduhnya (Muhammad) sebagai pendusta selama ini?”. Abu Sofyan menjawab, “Tidak!” Heraklius bertanya lagi, “Apa yang ia perintahkan pada kalian?” Abu Sofyan menjawab, “Nabi selalu berseru, sembahlah Allah saja, jangan menyekutukan dengan sesuatu, tinggalkan kebiasaankebiasaan jahiliyah yang diperintahkan orangtuamu. Ia juga memerintahkan kami

shalat, jujur bersih diri dan bersilaturahmi”. Pada akhir pembicaraan Heraklius berkata kepada Abu Sofyan, “Jika apa yang kamu ucapkan itu benar, ia akan menguasai tempat berpijak kakiku ini. Aku tahu bahwa ia orang luar. Aku tak pernah menyangka ia dari golonganmu. Seandainya aku tahu aku segera ingin menjumpainya. Jika aku di sisinya, aku akan mencuci telapak kakinya”.

Kebesaran Nabi telah dinobatkan Allah disisi-Nya, sebagaimana firman-Nya dalam Alquran Surah Alam Nasyrah ayat 4;Warafa’na laka dhikra’ (Dan Kami tinggikan bagimu sebutan namamu). Nama Muhammad SAW juga menjadi bagian dari Syahadatain yang menyebabkan seseorang menjadi sah Islamnya bila mengakui, dan binasa Islamnya bila menginkari. Shalatullah, shalamullah, ‘alaika ya ajmala khalqillah!

Pilih Susu...

kredit bank kepada para peternak. Kepada tim Waspada, Whatman menyatakan sekarang dia beserta istrinya tidak membutuhkan banyak tenaga kerja lagi untuk memerah susu ratusan ekor sapinya, cukup empat orang saja yang bertugas mengawasi proses pemerahan. Di peternakan miliknya, berdiri sebuah bangunan berbentuk gudang. Di dalamnya berjajar dua baris pagar besi untuk tempat sapi yang akan diperah. Satu jalur di isi 20 ekor sapi yang disusun berhadapan. Setiap pagi dan sore, 160 ekor sapi antre menunggu giliran untuk diperah. Hanya satu orang pekerja yang ditugasinya mengatur agar sapi masuk ke jalurnya. Sesudah itu sapi dengan sendirinya akan berjalan masuk ke jerajak besi yang membatasi tempat mereka. Sapi yang masuk duluan berada di posisi paling ujung. Begitu seterusnya, hingga jumlah mereka 40 ekor berhadaphadapan, kemudian diberikan makanan bernutrisi tinggi di tempat yang tersedia. Ada sedikit yang mengherankan kami. Sapi-sapi itu seperti mengerti akan diperah susunya. Induk sapi ini juga tidak khawatir kalau anak-anak mereka tidak kebagian susu induknya. Saat Tammy menyuguhkan susu segar kepada kami untuk diminum, di saat itu pula dia membawa beberapa ember susu sapi lainnya untuk diberikan kepada anak sapi yang menunggu berjejer di sebuah kandang di depan tempat pemerahan itu. Ada lagi yang menarik perhatian. Sebelum masuk ke kandang pemerahan, seorang pekerja memasukkan chips ke

telinga sapi. Dari situ akan diketahui kondisi kesehatan sapi yang dipantau dari layar komputer. Sapi yang kurang sehat diberi tanda berwarna kuning. Susu sapi ini tetap diperah, tapi tidak dijual. Tempatnya diasingkan dengan susu yang baik. Dari kondisi itu pula pemilik peternakan Craig Whatman melakukan perawatan sapi. ‘’Biasanya sapi kurang sehat karena makanannya,’’ kata Whatman. Sebelum dilakukan pemerahan, sapi-sapi yang sudah berada di tempat masing-masing diberikan makanan buatan. Yakni gandum yang dicampur dengan berbagai nutrisi. Setelah lima menit makan, petugas meletakkan alat perah di masing-masing sapi. Tidak terlalu lama kemudian, 25 liter susu dari tiap ekor sapi sudah pindah ke tabung penampungan. Itu dilakukan dua kali sehari sehingga total 50 liter susu diperah dari setiap sapi. ‘’Setiap dua hari datang mobil tanki menjemput susu untuk kemudian dibotolkan di pabrik susu dan dijual di pasar umum,’’ tambah Craig. Whatman tidak hanya memproduksi susu. Dia juga menjual sapi hidup (daging sapi) saat ternaknya tidak lagi produktif. Usia produktif untuk sapi perah 2,5 – 12 tahun. Setelah itu sapi-sapi itu dijual melalui agen. Belum lama ini Craig, mengaku baru menjual 1.500 ekor sapi, yang oleh eksportir mengaku dijual ke Jepang. Satu ekor sapi Craig, dihargai 2.500 dolar Australia (Aud 1 = Rp 9.800). Craig juga mengatakan terus mengembangbiakkan sapi-sapinya, dengan jalan inseminasi buatan. Dia bilang tidak benar, induk sapi yang

diperah tidak bisa lagi menyusui anaknya. Anak-anak sapi tetap disusui induknya, ditambah dengan pemberian susu yang kualitasnya tidak baik, termasuk susu dari sapi yang tidak sehat. Kepada kami diperlhatkan, susu sapi yang kurang sehat dituangkan ke mangkuk besar untuk diminum sendiri oleh anakanak sapi. Lebih terjamin Cerita Craig, banyak keuntungan memerah susu dengan menggunakan peralatan modern. Bukan hanya lebih cepat. Yang paling penting, kesehatan susu yang dihasilkan lebih terjamin. Pemerintah Australia membuat peraturan sangat ketat untuk masalah kesehatan susu ini. Sudah sejak lama dia ingin dapat memiliki mesin pemerah susu. Cerita tentang alat buatan Amerika Serikat itu sudah dia dengar delapan tahun lalu. Tapi dia baru dapat memilikinya tiga tahun lalu. Bank memberikannya fasilitas kredit Aud 1 juta dolar. Pengakuannya, tidak berat dia membayar cicilan pinjaman. Dengan alat yang baik itu kini dia mampu memproduksi 1,2 juta liter susu segar/tahun. Dia menjual susu segar itu dengan harga 47 sen/liter. Itu belum lagi dihitung dari penjualan sapi hidup. ‘’Di luar sapi hidup, penghasilan saya dari menjual susu sapi setahun lebih kurang 700.000 dolar. Keuntungan bersih adalah Aud 300.000, ’’ katanya. Begitu menjanjikan keuntungan yang akan diperoleh. Lalu kenapa peternak sapi di negeri kita tidak mengembangkan hal serupa. Artinya tidak melulu menjadi peternak dengan mengharapkan dagingnya saja tapi juga memproduksi susunya.

Situasi dramatis terlihat di hotel Beverly Hilton ketika para tamu yang datang menghadiri pesta tersebut malah mendapatkan kabar mengejutkan, sementara para wartawan langsung menyerbu hotel itu. Para penggemarnya berkumpul di luar menyalakan lilin untuk mengenang idola mereka dan helikopter terlihat berputarputar di atas hotel.

terkenal dengan tahun Gajah. Raja Habsyah di bawah panglimanya Abrahah ingin meruntuhkan Ka’bah (rumah Allah). Rencana jahat mereka digagalkan oleh Allah dengan mengirim burung Ababil yang melemparkan mereka sampai tewas. Suatu ketika Abu Sofyan (salah seorang pembesar Quraiys dan musuh Nabi, kemudian masuk Islam) ditanya Kaisar Heraklius dari Romawi Mengonsumsi daging sapi masih dianggap lebih baik. Padahal susu mengandung banyak komponen nutrisi yang bermanfaat bagi tubuh, seperti kalsium, lemak jenuh dan lemak tak jenuh, serta vitamin lainnya. Banyak peternak sapi Indonesia berpendapat memproduksi susu dapat menghambat populasi. Anak sapi tidak kebagian susu lagi dari induknya karena sudah habis diperah. Padahal anggapan itu tidak benar. Di peternakan Mayberry Farm milik keluarga Whatman kami menemukan jawaban berbeda dari anggapan itu. Dan dari data, Australia merupakan negara utama pemasok bahan baku susu di Indonesia. Setiap tahun mereka mengekspor 70 persen kebu-tuhan susu Indonesia. Peternakan sapi milik Craig Whatman ini berada di kawasan Burrawang, New South Wales. Bersama istrinya Tammy, Whatman memiliki 360 ekor sapi di lahan seluas 153 hektare. Produksi utama peternakan ini adalah susu murni. Peternak sapi Australia saat ini sudah mulai meninggalkan cara lama dalam memerah susu. Pemerahan tidak lagi dilakukan dengan tangan. Sekarang mereka telah meng-gunakan teknologi modern yang dipandu oleh k o m p u t e r. P e m e r i n t a h Australia memberikan fasilitas

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur: 1. Mh6, MxK atau Md4. 2. Mh7+mat.

Jawaban TTS: TTS Topik

Umum Serba “Pol”

P O L I T E L E K A P N O L I K A T R I S

P K O S MO L I O P P O O L RI L P I O T L B I P O L I O R L P O E M E T R O P O

P O L I O O L P O L A N T P Pol I O S L H UM I S N K E L A N S I L I T A

I T A N D I D I A N O L A P O P O L I S K I N

Jawaban Sudoku: 6 4 3 9 5 1 8 7 2

5 7 1 2 3 8 9 6 4

9 2 8 4 7 6 1 5 3

4 8 7 1 2 5 6 3 9

3 6 2 7 9 4 5 8 1

1 9 5 8 6 3 2 4 7

2 5 4 3 8 9 7 1 6

7 3 6 5 1 2 4 9 8

8 1 9 6 4 7 3 2 5

Puluhan...

Asrul, 28, warga Lhokseumawe, mengaku resah jika kondisi jadwal kapal masih Senin-Kamis. “Kalau terus menerus begini sama halnya bunuh diri, dana dari toke tidak cukup memenuhi kebutuhan, sehingga mesti mengeluarkan gaji sendiri,”katanya. Asrul mengaku sangat kecewa terhadap Dinas Perhubungan Aceh karena sepertinya membiarkan nasib masyarakat yang menyeberang ke pulau,

Tiga Jenderal...

tidak pernah ada kejelasan jadwalnya. Seharusnya, Pemprov Aceh tanggap terhadap keresahan masyarakat. Para sopir angkutan yang sudah bertahan selama seminggu menanti kapal penyeberangan, berharap pemerintah segera menindaklanjuti kebutuhan transpotasi penyeberangan Labuhahaji-Sinabang. Mereka semakin kecewa karena muncul informasi yang menyebutkan, KM Labuhanhaji sudah mangkal di Pelabuhan Ulee-

serta mantan Kapolda Aceh Rismawan Selain tiga jenderal ini, terlihat pula sejumlah tokoh Aceh, seperti M. Nasir Djamil (anggota DPR RI), Bachtiar Aly (mantan staf ahli Kapolri), dan Mahyuddin Adan. Acara deklarasi itu sendiri turut dihadiri Partai Amanat Nasional Aceh dan Forum Lintas Partai Provinsi Aceh (FLP2A) yang ikut memberikan dukungan untuk calon gubernur dari Partai Aceh Zaini Abdullah dan Muzakir Manaf. Saat pidato di hadapan ribuan pendukungnya Muzakir Manaf, Ketua Partai Aceh, menyebutkan, ketiga purnawirawan jenderal ini kini berada di bawah payung Partai Aceh. “Insya Allah mereka akan membimbing dan melihat kita di sini dan ke depannya,” ujar pria yang akrab disapa Mualem ini. Sebelumnya dalam jamuan makan di Hotel Hermes Palace, Sabtu (11/2) malam, Muzakir Manaf sempat memperkenalkan ketiga mantan jenderal itu kepada para kandidat bupati/wakil bupati dan kandidat wali kota/wakil wali kota diusung partai yang didirikan mantan petinggi GAM. Sunarko merupakan mantan jenderal pertama yang diperkenalkan Muzakir Manaf sebagai sosok yang akan ‘berjuang’ untuk pemenangan Calon Gubernur dan Wakil Gubernur dari Partai Aceh. Mantan Pangdam Iskandar Muda Soenarko meyakini Zaini Abdullah dan Muzakir Manaf adalah Sosok Pemimpin amanah. “Saya tahu betul karena saya sering berdiskusi dengan keduanya, jauh sebelum pilkada ini, duanya punya niat membangun Aceh, cuma pimpinan sebelum ini (Irwandi YusufRed) yang tidak amanah, Angkuhnya Masya Allah.” Kata Soenarko secara khusus kepada Waspada, Minggu (12/2) siang. Soenarko mengkritik keras masa kepemimpinan IrwandiYusuf dan Muhammad Nazar yang mengelola dana besar namun pembangunan di Aceh tidak berjalan dengan baik. “Dulu BRR yang bangun Aceh, ditambah Dana Otsus tapi liat saja Aceh sekarang,” kata Soenarko. Kini sebagai mantan anggota TNI Soenarko memiliki hak pilih dan akan berkampanye untuk pasangan Zaini Muzakir, “ Saudara saya banyak di Aceh Utara dan Langsa,” kata anak Medan yang memiliki ibu asal Takengen, Aceh Tengah itu. Selain Soenarko sejumlah mantan jenderal seperti Muhammad Yahya mantan Kasdam Iskandar Muda, Mantan Pangdam Iskandar Muda Jali Yusuf. TNI tetap netral Kodam Iskandar Muda menyatakan TNI tetap bersikap netral dalam proses Pemilukada Aceh. Bergabungnya sejumlah purnawirawan TNI dipastikan tidak akan mempengaruhi netralitas TNI. “Anggapan masyarakat, Kodam Iskandar Muda sudah tidak netral adalah tidak benar,”tegas Kepala Penerangan Kodam Iskandar Muda, Kolonel Subagio Irianto, Sabtu (11/2). Pernyataan itu disampaikan Kapendam IM Kolonel Subagio Irianto kepada sejumlah wartawan di Tower Cafee. Kapendam yang turut di dampingi Dandim Aceh Besar, Letkol CZI Saptono Syiwarudi mengatakan tidak ada pesan dan intruksi khusus dari Markas Besar TNI, Markas Besar Angkatan Darat maupun Kodam IM kepada purnawirawan untuk mendukung calon tertentu dalam pemilukada. “Jadi perlu kita tegaskan, mereka (purnawirawan) bertindak dan mengambil keputusan atas nama pribadi sesuai hak mereka selaku warga negara setelah tidak menjadi anggota TNI,”kata Kolonel Subagio. Menurut Subagio paska bergabungnya purnawirawan TNI ke partai tertentu, baik dirinya maupun website kodam Iskandar Muda kerap menerima pertanyaan masyarakat yang mempertanyakan netralitas TNI. Pertanyaan itu, kata Kolonel Subagio mengesankan TNI telah berpihak kesatu partai tertentu. “Masyarakat kami imbau tidak khawatir dan curiga serta meragukan kami. Kami yakin, pemilukada yang demokratis dan bebas dari intervensi adalah modal membentuk pemerintah yang jujur,”kata Kapendam. Kapendam menjelaskan pihaknya telah mengintruksikan kepada seluruh Dandim di jajaran Kodam Iskandar Muda agar bersikap netral. Pihaknya, kata Kapendam Subagio juga akan mengawasi seluruh fasilitas TNI agar tidak digunakan dalam pemilukada. “Kami berharap masyarakat melapor jika melihat ada alat-alat milik TNI yang dipakai. Tidak perlu takut. Yang terlibat akan kita tindak tegas,”ujarnya. Sementara itu Dandim 0101 Aceh Besar Letkol CZI Saptono Syiwarudi berharap jajarannya tidak terpengaruh dengan isu dan upaya menggiring prajurit untuk mendukung calon tertentu. “Hindari berkomunikasi dengan mereka terutama berkaitan dengan politik praktis. Kita hanya terlibat pada tugas bantuan pengamanan kepada Polri,”ujar Dandim Letkol Saptono. 1.200 Polisi-TNI Amankan 1.200 aparat kepolisian dari Satuan Lalu Lintas dan Intelkam dikerahkan untuk mengamankan 15.000 pendukung dan simpatisan Partai Aceh yang ‘membanjiri’ Kota Banda Aceh untuk menghadiri Deklarasi Calon Gubernur/Wakil Gubernur, Calon Bupati/Wakil Bupati dan Calon Walikota/Wakil Walikota yang diusung partai tersebut serta Peringatan Maulid Nabi Muhammad SAW di Stadion Dimurtala. Massa dengan menggunakan atribut Partai Aceh (PA) dari beberapa kabupaten/kota di Aceh, tampak mulai berdatangan sejak Sabtu (11/2). Memasuki pintu Gerbang Kota Banda Aceh, massa yang menumpangi berbagai kenderaan bermotor langsung diarahkan ke lokasi penampungan, seperti Masjid Raya Baiturrahman, Stadion H. Dimurthala di Lampineung, Taman Sri Ratu Safiatuddin dan Lapangan Tugu Darussalam. Kepala Bidang Humas Polda Aceh Kombes. Pol. Gustav Leo yang Waspada hubungi, Mknggu (12/2) mengatakan, pengamanan acara deklarasi para kandidat yang dirangkai dengan Peringatan Maulid Nabi Muhammad SAW dilakukan secara ketat. Kombes. Pol. Gustav Leo menyebutkan, dari permohonan

WASPADA Senin 13 Februari 2012 lheu, Banda Aceh. Hal serupa dikemukakan Riky, 29, seorang penumpang yang hendak berangkat ke Sinabang. Dia mengaku sudah tiga hari terlantar di Pelabuhan Labuhanhaji menunggu tibanya KMP Teluk Singkil. Menurut dia, karena belum stabilnya penyebarangan, banyak calon penumpang terancam kelaparan sebagaimana menimpa seorang mahasiswa mengaku kehabisan uang makan, sehingga terpaksa menjual barang-barang miliknya seperti HP dan lainnya.

Kepala Unit Pelaksanaan Teknis Daerah (UPTD) Akhyar membenarkan truk-truk dan ratusan penumpang sudah seminggu terkatung-katung di pelabuhan. Tapi para penumpang dan truk itu, akan diupayakan berangkat, Minggu (12/ 2) malam ini sekira pukul 21.00 melalui KMP Teluk Singkil. Menurut dia, kondisi ini terjadi karena KMP Teluk Simeulue yang melayani selama ini masih dalam perawatan dan diperkirakan baru beroperasi pada Maret mendatang.(b30)

izin yang diajukan Partai Aceh jumlah massa yang datang ke Banda Aceh untuk menghadiri acara tersebut diperkirakan berjumlah 20.000 orang. “Tapi dari pengamatan di lapangan, jumlah yang hadir sekitar 15.000 orang,” urainya. Ditambahkan, untuk pengamanan terdepan dilakukan oleh Polresta Banda Aceh beserta jajaran, sedangkan Polda Aceh hanya memback-up saja. Di samping itu, jajaran Polres di kabupaten/kota juga membantu memberikan pengamanan, termasuk Partai Aceh mengerahkan anggotanya yang memakai pakaian seragam organisasi. “Sejauh ini belum ada laporan terjadinya insiden atau kecelakaan, kecuali dari Saree, Aceh Besar tentang tabrakan roda empat,” ungkapnya lagi. Pantauan Waspada saat acara itu berlangsung, konsentrasi massa selain di Stadion H Dimurthala, Lampineung, juga di Taman Sri Ratu Safiatuddin. Sedangkan posko kegiatan ada di sejumlah lokasi. Massa PA Terjungkal, 10 Luka Satu pick-up -300 BL 8140 D yang mengangkut massa PA dari Aceh Timur ke Banda Aceh terjungkal, Sabtu (11/2) sekira pukul 16:00. Akibatnya, 10 orang mengalami luka serius. Kejadian yang menimpa satu dari puluhan mobil pengangkut massa PA itu terjadi di Jalan Lintasan Sumatera (Jalinsum) Banda Aceh – Medan persisnya di Tikungan Alue Cek Doi (depan Dayah Darul Huda Pimpinan Abu Paya Pasi), Kecamatan Julok, Kab. Aceh Timur. Korban kini ditangani pihak medis yakni M. Nizar warga Julok, M. Fadhil warga Julok, M. Sofyan warga Idi Timur, Mustafa warga Julok, Syahruddin, 35, warga Julok, Heriyadi, 20, warga Julok, Khaidir, 25, warga Julok, Wahyudi, 20, warga Peudawa, Meri, 22, warga Julok. Sementara sopir bernama Edi Saputra, 30, warga Peudawa. Sektaris Aksi Deklarasi Aceh Timur 2012, M. Dahlan alias Apa Gensee membenarkan adanya salah satu Pick-up (bak terbuka— red) yang mengangkut massa PA asal Kecamatan Peudawa, Aceh Timur ke Banda Aceh, masuk ke rawa-rawa di kawasan Julok. Kapolres Aceh Timur AKBP Iwan Eka Putra melalui Kanit Lantas Pos Julok, Aiptu Syahrial menjelaskan, berdasarkan hasil informasi dan keterangan saksi di lapangan, lakalantas terjadi akibat sopir kehilangan kendali karena muatan di bagian bak belakang tidak stabil, karena ditumpangi puluhan massa yang akan berangkat ke Banda Aceh, sebagian di antaranya duduk dibagian bak samping kiri dan kanan. Ribuan Simpatisan Ribuan simpatisan Partai Aceh dari wilayah timur Aceh Utara dan wilayah barat Aceh Timur, sejak Sabtu (11/2) pagi bertolak ke Banda Aceh untuk menghadiri deklarasi akbar di Stadion H Murtala, Lampineung, yang rencananya digelar Minggu (12/2). ‘’Khusus dari sagoe darul falah, daerah II Simpang Ulim, Aceh Timur, jumlah massa yang berangkat sekitar 30 truk colt atau dumptruk plus belasan Mobil pribadi dan sepeda motor,’’kata Marzuki alias Misee, panglima sagoe Darul Falah kepada Waspada di Madat, Aceh Timur, kemarin. Sementara, ratusan kader PA Wilayah Pase dan masyarakat, Sabtu (11/2) pukul 11.00 berangkat menuju Kota Banda Aceh, dengan menggunakan 2000-an unit mobil. Hal itu disampaikan Tgk. Zulkarnaini, Ketua KPA Wilayah Pase ketika dikonfirmasi Waspada, Sabtu (11/2) pagi. “Untuk Wilayah Pase mulai dari Tanah Jambo Aye, Kota Lhokseumawe hingga Muara Batu, kita perkirakan ada sekitar 500 ribu kader PA dan masyarakat yang berangkat ke Banda Aceh. Ke sana kita hanya untuk mendeklarasikan Zeini Abdullah-Muzakir Manaf sebagai calon Gubernur dan Wakil Gubernur Aceh. Di sana kita juga menggelar doa bersama. Di sana kita cuma untuk sehari saja,” kata Zulkarnaini. PA Aceh Barat Berziarah Rombongan kandidat PA Kabupaten Aceh Barat menyempatkan berziarah ke makam Abu Ibrahim Woyla sebelum menuju Banda Aceh, Sabtu (11/2). Sejak Sabtu pagi, para simpatisan PA telah berkumpul di secretariat PA Aceh Barat di Jalan Manek Ro. “Dari Aceh Barat ada 1.300 massa PA dengan menggunakan 200 unit roda empat dan dua. Semoga niat kita menghadiri deklarasi kandidat yang diusung PA baik untuk calon Gubernur/Wakil, Bupati dan Wali kota berjalan lancar,”kata Rizwan, Juru Bicara PA Aceh Barat kepada Waspada. Sebagaimana iring-iringan massa dari kabupaten lain, sejumlah kendaraan yang digunakan massa PA Aceh Barat, juga dihiasi atribut partai lokal itu. Beberapa di antarannya menempel stiker bergambar Zaini dan Muzakir Manaf, calon gubernur yang diusung PA. “Kalau tidak halangan pukul 15:00 rombongan akan tiba di Banda Aceh,”ungkap Ridwan yang juga ketua tim pemenangan calon Bupati Aceh Barat pasangan Drs Adami, MPd/ Bustanuddin yang diusung PA. DPP PA Tunjuk Tgk.Yusri Terganjalnya ‘Panglima Do’ (Panggilan Akrab Tgk.Abdurahman Ubiet) untuk mendampingi Ir Jufri Hasanuddin,MM sebagai calon Wakil Bupati Aceh Barat Daya (Abdya) kini semakin kuat setelah Dewan Pimpinan Pusat (DPP) Partai Aceh mengeluarkan keputusan dengan menunjuk Tgk Yusri yang juga pengurus DPW Partai Aceh di Abdya sebagai pengganti Panglima Do. “Tidak ada proses pemilihan apapun terkait pergantian panglima do, penunjukan Tgk.Yus (Tgk.Yusri –red) adalah keputusan dari DPP PA yang ditandatangani langsung oleh Muzakir Manaf, kita di daerah secara otomatis tunduk dan mengikuti keputusan itu,” ungkap Tgk.Nazier, Ketua DPW PA Abdya kepada Waspada, Minggu (12/2). Dengan adanya keputusan tersebut seprti dilanjutkan Tgk.Nazier, maka pihak partai dalam waktu dekat akan segera mendaftarkan Tgk Yusri ke KIP Abdya sebagai pemngganti Tgk Abdurahman Ubiet yang dinilai gagal akibat tidak melengkapi persyaratan sebagai bakal calon. . Pihak KIP Abdya sendiri melalui ketuanya Nasli Hasan,SAg saat dihubungi Waspada mengaku belum menerima proses pergantian dengan alasan proses verifikasi masih berjalan. (b05/b07/b08/ b18/b19/b24/ cb06/cb05)


A2

Berita Utama

Whitney Houston ... Karirnya tanpa cacat. Lingkungan gereja dan lingkungan keluarga memeliharanya dengan cermat sejak kecil. Nyaris tanpa cacat. Dalam sejarah seni suara, Whitney adalah anak emas industri musik Amerika. Sepuluh tahun, sejak pertengahan 1980 hingga akhir 1990, dia telah menjadi salah seorang artis yang paling laris dijual. Semua kelihatan

Meninggal Di Hotel ... menampilkan sejumlah selebriti dalam industri permusikan. Situasi dramatis terlihat di hotel Beverly Hilton ketika para tamu yang datang menghadiri pesta tersebut malah mendapatkan kabar mengejutkan, sementara para wartawan langsung menyerbu hotel itu. Para penggemarnyaberkumpuldiluar menyalakan lilin untuk mengenang idola mereka dan helikopter terlihatberputar-putardiatashotel. Polisi kawasan Beverly Hills mengatakan mereka diminta untuk datang ke Beverly Hilton pada pukul 03:43 sore dan personil pemadam kebakaran sudah ada di lokasi.Whitney berada di kamarnya di lantai empat

Aparat Gabungan ... Selanjutnya SAL, 23, mahasiswa salah satu Perguruan Tinggi Negeri di Medan jurusan Kimia Industri, sekamar dengan Jul, 33, keduanya penduduk Tebingtinggi. Mereka kemudian diangkut menggunakan mobil patroli menuju Kantor Satpol PP untuk didata dan dimintai keterangan. Sementara itu, petugas juga menemukan sekelompok pasangan remaja berpesta minuman keras di Jalan Jati. Mereka yang masih berstatus pelajar itu mengaku mengkonsumsi minuman keras jenis tuak untuk menyambut ujian akhir sekolah beberapa waktu mendatang. Tim tidak sempat mengamankan mereka, namun orangtuanya dipanggil ke lokasi untuk membawa anak-anaknya pulang guna diberi bimbingan. Pantauan Waspada, Kakan

Korban Kebakaran ... cat, terdengar ada ledakan dan api langsung menyambar keluar,” kata Syafrijal ditemui di ruang perawatan, Minggu (12/2). Akibat ledakan tersebut, wajah, tangan, perut serta kakinya mengalami luka bakar.“Saya karyawan diToko Mega JayaTeknik di samping toko cat yang terbakar. Toko kami pun ikut terbakar,” katanya. Sementara pemilik Toko Mega Jaya Teknik (samping Toko Cat yang terbakar-red) dijumpai saat menjenguk Syafrijal, AK mengatakan akibat kebakaran itu dirinya mengalami kerugian hingga ratusan juta rupiah. “Tiga sepeda motor terbakar, satu di antaranya milik Syafrijal. Tapi masih ada barang-barang yang berhasil diselamatkan,” kata dia menyebutkan, saat terjadi kebakaran berada di dalam tokonya. Namun ketika mendengar suara ledakan dia buru-buru mening-

Ada-ada Saja ... Saat hadir dalam sebuah acara televisi, perempuan yang kini berusia 18 tahun itu unjuk kemampuannya memakan botol air dan tempat CD. “Saya sudah memakan 12 remote televisi, lebih dari lima ribu biji plastik, sekira seribu berbagai macam hiasan minuman,100garpudansekira10botol

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur: 1. Mh6, MxK atau Md4. 2. Mh7+mat.

Jawaban TTS: TTS Topik

Umum Serba “Pol”

P O L I T E L E K A P N O L I K A T R I S

P K O S MO L I P O P O O L RI L P I O T L B I P O L I O R L P O E M E T R O P O

P O L I O O L P O L A N T P Pol I O S L H UM I S N K E L A N S I L I T A

I T A N D I D I A N O L A P O P O L I S K I N

Jawaban Sudoku: 6 4 3 9 5 1 8 7 2

5 7 1 2 3 8 9 6 4

9 2 8 4 7 6 1 5 3

4 8 7 1 2 5 6 3 9

3 6 2 7 9 4 5 8 1

1 9 5 8 6 3 2 4 7

2 5 4 3 8 9 7 1 6

7 3 6 5 1 2 4 9 8

8 1 9 6 4 7 3 2 5

sangat mudah baginya. Dia seakan sengaja terlahir untuk terkenal. Tanpa susah payah, dia menjelma jadi penyanyi tegar dengan lengking suara yang dahsyat. Ibunya, Cissy Houston adalah penyanyi gospel terkenal, bersepupu dengan diva pop era 60-an DionneWarwick, sementara ibu baptisnya adalah penyanyi terkenal Aretha Franklin. Whitney kecil pada mulanya adalah penyanyi gereja kalangan hitam di kampung halamannya. hotel itu namun tidak merespon pertolongan yang diberikan pihak medis dan dia dinyatakan meninggal pukul 03:55 sore. Petugas medis Los Angeles mengeluarkan jenazahWhitney darihotelmenjelangtengahmalam lewat pintu belakang untuk menghindarimediayangberusaha mencaritahupenyebabkematiannya yang mengejutkan itu. Para petugas medis tersebut akan melakukan otopsi selama satu atau dua hari, yang kemudian akan mengumumkan informasi tentang penyebab kematiannya. Jika kematiannya akibat narkoba atau alkohol, maka hal itu tidak akan diumumkan sampai dilakukan uji coba toksikologi yang akan makan waktu enam sampai delapan minggu.(m23) Satpol PPYusmada, SH yang juga Komandan Tim Terpadu, terlihat turun langsung ke lapangan memimpin operasi rutin itu. Di sela-sela kesibukannya,Yusmada mengatakan razia yang dilakukan merupakan jawaban dari keresahan masyarakat selama ini, atas aktivitas para PSK dan pasangan mesum. Yusmada menegaskan akan melaksanakan razia rutin berkesinambungan, untuk memberi jaminan kenyamanan dan ketertiban kepada masyarakatTanjungbalai. “Selain razia rutin, petugas juga berpatroli setiap sore di sepanjang jalan Arteri, Jati dan kawasan lainnya untuk menghilangkan keresahan. Dikatakan, para pria dan wanita yang diamankan kemudian didata dan diberi bimbingan. Namun khusus terhadap para wanita yang diduga PSK, mereka akan dikirim ke panti rehabilitasi di Berastagi. (a32) galkan toko miliknya. Dalam pemeriksaan Kebakaran yang menghanguskan tiga ruko di Jalan Brigjen Katamso itu kini menyisakan puing-puing. Selain gedung, seluruh isi dalam ruko ikut musnah. Untuk keperluan penyidikan polisi telah memasang police line dan mengambil beberapa barang bukti guna keperluan penyidikan penyebab kebakaran itu. Kapolsek Medan Kota Kompol Sandy Sinurat dihubungi Waspada, Minggu (12/2), mengatakan, masih menyelidiki penyebabkebakaranitu.“Penyebab pasti belum diketahui, meski ada kemungkinanakibatmeledaknya karbit dari mobil box yang parkir di depan salah satu ruko. Barang bukti yang diperlukan sudah diambil untuk penyidikan, termasuk beberapa saksi. Kalau sudah dipastikan penyebabnya akan segera disampaikan,” kata dia. (m27/h02) air,” tutur Kailyn seperti dikutip Daily Mail, belum lama ini. “Plastik benar-benar benda yang saya inginkan dan butuhkan,” ucapnya. Saat ditanya mengapa dirinya suka sekali dengan plastik, Kailyn mengaku rasa bukan menjadi alasannya melainkan teksturnya. “Suaranya yang garing dan sekaligus kasar tetapi saat bersama ada tekstur yang lembut, membuat saya menggemari plastik,” tambahnya. Kailyn mengaku bahan plastik yang sering ia konsumsi adalah hiasan minuman keras. Bahan itu mudah didapatkannya karena ia bekerja sebagai pelayan di sebuah restoran. (net/rzl)

Di saat remaja, dia menjadi penyanyi latar dalam mengiringi Chaka Khan, Jermaine Jackson dan penyanyi terkenal lainnya. Dia juga pernah menjadi model. Perubahan besar terjadi saat penemu bakat melihatnya menyanyi mengiringi ibunya yang mentas di klub kecil. “Saya terkesima mendengar seorang gadis kecil bisa memainkan napas dalam alunan musik bergelombang!” kenang Clive Davis diacara Good Morning America. Tidak butuh waktu lama untuk membuat Amerika bisa menikmati alunan napas dahsyat itu. Pada 1985 album pertamanya, Whitney Houston, dirilis. Larisnya hingga berjuta keping. Setelah itu, semua mengalir bagai air. Lagunya Saving All My Love for You memperoleh Grammy untuk kategori Penyanyi Pop Wanita Terbaik, sementara lagu HowWill I Know,You Give Good Love dan The Greatest Love of All laris manis sebagai lagu singelnya. Albumnya Whitney, (1987) diberi predikat multiplatinum, berkat suaranya yang lantang di laguWhere Do Broken Hearts Go dan I Wanna Dance With Somebody. Memang ada juga yang tidak menyulai kiprah Whitney. Itu datang dari kalangan kulit hitam penggemar musik-musik bercorak soul, yang kurang menyukaiWhitney menyanyikan lagulagu pop. Mereka mencapnya sebagai sosok yang melangkah meninggalkan kulit hitam dan mencoba menjadi orang kulit putih. Panggungnya sepi dan dia sering disoraki ketimbang ditepuki.“Ya, kayaknya memang harusjatuhdulu.Sayatidakcukup hitam bagi mereka. Saya tak paham. R&B saya tidak kental. Saya sangat pop. Saya kira, penggemar saya yang berkulit putih telah merampas saya dari tangan publik kulit hitam,” katanya tentang kejatuhan itu. Tapi karirnya tetap bergeming. Dia terus melaju, bahkan hingga ke layar lebar dengan film The Bodyguard dan Waiting to Exhale.

Resepnya mungkin sederhana. Whitney punya alunan suara yang sempurna dan punya citra yang sempurna, yaitu penyanyi sintal yang memiliki daya sexappeal, namun tidak pernah memanfaatkan keseksian itu dalam berkarir. Namun bak kata pepatah ‘Dalam laut dapat diduga, dalam hati siapa tahu?’, Whitney punya konflik batin sendiri. Di ujung karir, dia terjangkit kecanduan narkoba. Itu membawa dampak jelek bagi peredaran albumnya. Penampilannya yang berubah dari anggun menjadi urakan membuat penggemarmulaimeninggal-kan dirinya. Kokain, ganja dan obatobatantelahmengubahsuaranya yang merdu menjadi parau dan serak, dan dia tidak lagi mampu mencapai noot yang tinggi. Ini tragis. Artis yang telah menjual lebih dari 55 juta keping album di Amerika Serikat ini, pada harihari terakhir hidupnya harus terjerembab dalam kepapaan. Banyak yang menduga, benih-benih keruntuhan itu mulai mengkristal saatWhitney menikah dengan penyanyi Bobby Brown di tahun 1992. Pasangan ini terkesan ganjil, karena Whitney yang keanggunannya bagai seorang puteri ningrat, tergoda oleh pria liar yang telah mempunyai anak, sering berurusan dengan polisi dan sering ditangkap karena tindak kekerasan dan ketidakpedulian pada anak kandungnya. Whitney menerima penilaian itu dan menyatakan bahwa dirinya memang mirip dengan penilaian publik. “Jika kau cinta, kau cinta! Maksudku, apakah kita harus berhenti mencintai hanya karena dia memiliki citra yang beda? Saya dan Bobby datang dari ranah yang sama. Kau lihat seseorang, maka kau akan terlibat dengan citranya. Itu hanya sebagain kecil saja, bukan keseluruhan dirinya. Saya tidak selamanya harus berpakaian rapi. Saya bukan malaikat. Saya bisa jatuh berlumur kotoran. Saya bisa kasar,” katanya.

Pemadam Lambat ...

Harahap kepada Waspada seusai dialog dengan korban kebakaran, Sabtu (11/2). Menurut Rahudman, untuk saat ini saja sudah terkumpul dari donator sebanyak Rp1,3 miliar. Ini terjadi karena adanya kerjasama, dan kerjasama itu modal membangun kota ini,” ucapnya. Kadis TRTB Medan Syampurno Pohan dalam kesem-patan itu mengatakan, lokasi kebakaran akan ditata ulang kembali dan mengacu dengan rencana kota, maka jalan yang ada di lingkungan kebakaran akan dilebarkan menjadi 6 meter mulai dari Gang Bakung I Gang Bakung II dan Gang Bakung yang melurus ke Jalan AR Hakim. Perwakilan korban kebakaran, Aswin, mengapresiasi bantuan yang telah diberikan dari berbagai pihak. “Kami sangat berterima kasih kepada semua yang sudah mendukung kami. (m50)

kebakaran terkadang informasi yang diterima P2K sudah 15 menit. Seharusnya Standar Operasional Prosedur (SOP) dari kejadian kebakaran dalam kurun waktu 15 menit api harus sudah dipadamkan,” ujarnya. Mulai dibangun Sementara itu akhir bulan ini Pemko Medan akan merealisasikan pembangunan rumah korban kebakaran di Jalan AR Hakim Gang Bakung I dan II, Kecamatan Medan Area. Selain itu, Pemko juga menggratiskan retribusi izin mendirikan bangunan (IMB). “Kita sudah melakukan pendataan berapa jumlah korban kebakaran. Saat ini jelas surat tanah yang dimiliki mereka juga pasti terbakar, namun kita minta ada surat keterangan dari lurah tentang tanah dari masing-masing pemiliknya,” kata Wali Kota Medan Rahudman

Tiga Jenderal ... Terasa lebih istimewa, deklarasi akbar ini dihadiri sejumlah tokoh Aceh dan bekas pejabat tinggi militer semacam mantan Komandan Jenderal Kopassus Letjen (Purn) Sunarko, mantan Panglima Kodam Iskandar Muda Mayjen (Purn) Djali Yusuf, serta mantan Kepala Staf Kodam Iskandar Muda Brigjen (Purn) M. Yahya. Juga hadir mantan Danpuspon TNI Mayjen Sulaiman AB, dan mantanWakil Panglima TNI Fahrurrazi serta mantan Kapolda Aceh Rismawan Selain tiga jenderal ini, terlihat pula sejumlah tokoh Aceh, seperti M. Nasir Djamil (anggota DPR RI), Bachtiar Aly (mantan staf ahli Kapolri), dan Mahyuddin Adan. Acara deklarasi itu sendiri turut dihadiri Partai Amanat Nasional Aceh dan Forum Lin-

tas Partai Provinsi Aceh (FLP2A) yang ikut memberikan dukungan untuk calon gubernur dari Partai Aceh Zaini Abdullah dan Muzakir Manaf. Saat pidato di hadapan ribuan pendukungnya Muzakir Manaf, Ketua Partai Aceh, menyebutkan, ketiga purnawirawan jenderal ini kini berada di bawah payung Partai Aceh. “Insya Allah mereka akan membimbing dan melihat kita di sini dan ke depannya,” ujar pria yang akrab disapa Mualem ini. Sebelumnya dalam jamuan makan di Hotel Hermes Palace, Sabtu (11/2) malam, Muzakir Manaf sempat memperkenalkan ketiga mantan jenderal itu kepada para kandidat bupati/ wakil bupati dan kandidat wali kota/wakil wali kota diusung partai yang didirikan mantan petinggi GAM. (b05/b07/b08/ b18/b19/b24/ cb06/cb05)

Sebaliknya dalam wawancara lain, Whitney menimpakan keruntuhan popularitas dirinya kepada Bobby Brown. Dia menuturkan penderitaan yang dialaminya akibat perilaku kasar suaminya itu. Mereka akhirnya memang bercerai di 2007, namun setelah itu,Whitney terlihat gamang. Dia sempat dirawat di Pusat Rehabilitasi Pengguna Narkoba. Di 2010, kepada Oprah dia menyatakan dirinya bebas dari ketergantungan obat bius dan narkoba, namun tetap saja terjadi beberapa pembatalan konser karenaWhitney kedapatan menggunakan drugs. Dia juga berulang kali ditangkap di bandar udara karena kepemilikan obat bius dan narkoba. Pada saat konser penghargaan kepada Michael Jackson, Whitney terlihat sangat kurus dan lunglai, hingga menimbulkan spekulasi bahwa dia akan mati keesokan hari. Kekasaran sikap dan penampilannya yang urakan pada acara Being Bobby Brown adalah contoh menyedihkan lainnya. Hal ini membuat publik jadi hambar. Satu-satu keanggunan Whitney runtuh. Konsernya untuk promosi album Good Morning America, sangat mengecewakan karena suaranya terdengar serak dan fals, tak sesuai dengan noot dan irama. Dan dia bilang, itu “... karena terlalu lama diwawancarai oleh Oprah.” Beberapa pertunjukannya di luar negeri sering dibatalkan karena promotor khawatir suara Whitney yang sudah kacau akan tidak enak lagi didengar penonton. Dan orang-orang pun mulai curiga akan penye-babnya, yaitu drugs, meskipun dia selalu menyangkal hal itu dengan menyatakan dirinya tetap dalam kondisi prima. Kini, Whitney Houston sudah tiada. Dia meninggal dunia di usia 48 tahun. Penyebab kematiannya juga belum jelas. Lokasinya juga simpang siur. Yang diketahui sementara ini adalah bahwa Kantor Polisi di Beverly Hillslah yang menerima panggilan gawat darurat pertama dari Hotel Beverly Hilton di Sabtu 11 Februari itu. Beberapa karyawan hotel dan petugas pemadam kebakaran telah mencoba melakukan upaya penyelamatan pertama untuk membuat Whitney tetap bernapas, tetapi upaya itu sia-sia. Sementara pihak kepolisian sama sekali tidak melihat adanya tandatanda kekerasan dan kriminal. “Sangat mengguncang perasaandansangattidakbisadipercaya,” ujar penyanyi Aretha Franklin, ibu baptis yang mendidik Whitney menjadi pernyanyi terkenal. Ya, samalah. Kita juga sulit mempercayai ini, tetapi kita harus benar-benar percaya bahwaWhitneybenar-benartelah tiada, meski suaranya masih melantun dahsyat lewat CD yang kita putar di ruang tempat kita berada. (AP)

Bentrok Warga ... Mengetahui hal itu, warga Lorong Melati tersulut emosi karena tidak terima warganya dianiaya. Berselang beberapa waktu kemudian, warga berkerumun dan melakukan penyerangan ke kawasan Lorong Pemancar. Namun 10 orang yang melakukan penculikan itu tidak ditemukan. Dalam keributan itu, terlihat tiga polisi yang sedang berjaga- jagi di Pos Polisi Lor Pemancar. Warga langsung menyerang ketiga polisi itu dan menghancurkan posnya. Naas bagi Briptu Fernandes Manulang, dia tidak berhasil melarikan diri dan menjadi luapan emosi warga. Sedangkan dua orang temannya melarikan diri. “Mungkin warga menilai polisi berpihak ke waga lorong Pemancar, sebab waktu Khaidir diculik, mereka tidak respon saat warga minta tolong untuk dilepaskan,” sebut seorang sumber yang tidak berkenan namanya disebutkan. Saat ini, puluhan petugas Polres Pelabuhan Belawan berpakaian dinas dan sipil serta sejumlah anggota Marinir disiagakan di lokasi kejadian. Belum ada keterangan polisi mengenai bentrokan itu dan Kapolsek Belawan Kompol AH Puluhan tidak bersedia menjawab saat dihubungi via handphone. (h03)

Polda Maluku ... Padatahunlalu,KapoldaMaluku Brigjen Polisi Syarief Gunawan dalam rapat kerja dengan DPRD Maluku juga mengaku kaget dengan adanya laporan ke Mabes Polri tentang besarnya jumlah korban tewas dalam bentrokan internal warga di Pelauw. Namun, setelah tim dari Ma-

Anggota DPR Temui ... Palembang, yakni M Nazaruddin, merupakan penyimpangan. Ia mengatakan Kemkumham pada dasarnya mendukung pengawasan yang dilakukan oleh anggota DPR, namun harus tetap sesuai dengan aturan yang ada, yakni Peraturan Pemerintan (PP) Nomor 27 Tahun 1983 tentang Pelaksanaan Kitab Undang-Undang Hukum Acara Pidana. “Bahkan seorang kuasa hukum pun yang memiliki hak menemui kliennya di penjara juga tetap tidak bisa 24 jam berkunjung,” tegas Amir. Sementara itu, Wakil Men-

Pilih Susu Atau ... di tubuh sapi khususnya betina, ada daging sekaligus susu. Ini mungkin bisa dimaklumi karena masyarakat kita sebagian besar ternyata belum terbiasa meminum susu. Tingkat konsumsi susu kita hanya 11 liter/kapita/ tahun. Jumlah itu jauh dibanding Malaysia yang 36 liter/kapita/tahun. Sementara masyarakat Eropa dan Amerika mengonsumsi susu jauh di atas angka itu. Di Indonesia, produksi susu sapi memang belum dimaksimalkan. Buktinya kita baru mampu memproduksi susu sapi 500 juta liter pertahun, dari total 1,5 miliar liter kebutuhan nasional. Mengonsumsi daging sapi masih dianggap lebih baik. Padahal susu mengandung banyak komponen nutrisi yang bermanfaat bagi tubuh, seperti kalsium, lemak jenuh dan lemak tak jenuh, serta vitamin lainnya. Banyak peternak sapi Indonesia berpendapat memproduksi susu dapat menghambat populasi. Anak sapi tidak kebagian susu lagi dari induknya karena sudah habis diperah. Padahal anggapan itu tidak benar. Di peternakan Mayberry Farm milik keluarga Whatman kami menemukan jawaban berbeda dari anggapan itu. Dan dari data, Australia merupakan negara utama pemasok bahan baku susu di Indonesia. Setiap tahun mereka mengekspor 70 persen kebutuhan susu Indonesia. Peternakan sapi milik Craig Whatman ini berada di kawasan Burrawang, New South Wales. Bersama istrinya Tammy,Whatman memiliki 360 ekor sapi di lahan seluas 153 hektare. Produksi utama peternakan ini adalah susu murni. Peternak sapi Australia saat ini sudah mulai meninggalkan cara lama dalam memerah susu. Pemerahan tidak lagi dilakukan dengan tangan. Sekarang mereka telah menggunakan teknologi modern yang dipandu oleh komputer. Pemerintah Australia memberikan fasilitas kredit bank kepada para peternak. Kepada tim Waspada,Whatman menyatakan sekarang dia beserta istrinya tidak membutuhkan banyak tenaga kerja lagi untuk memerah susu ratusan ekor sapinya, cukup empat orang saja yang bertugas mengawasi proses pemerahan.

WASPADA Senin 13 Februari 2012 bes bersama Polda Maluku turun ke lokasi kejadian, ternyata orang yang meninggal dunia hanya satu orang. 3.000 Warga Mengungsi Sekitar 3.000 warga Desa Pelauw, Pulau Haruku, Kabupaten MalukuTengah, Maluku, mengungsi menyusul bentrokan antarwarga Pelauw yang terjadi mulai Jumat (10/2) hingga Sabteri Hukum dan HAM (Wamenkumham) Denny Indrayana mengatakan dalam buku tamu milik M Nazaruddin tertulis bahwa M Nasir datang sekitar pukul 21:00 WIB. “Sedangkan saya datang sekitar pukul sebelas malam, yang bersangkutan (M Nasir) masih di sana. Sesuai aturan, kunjungan di rutan atau lembaga pemasyarakatan (Lapas) maksimal hanya setengah jam saja,” katanya. Denny pun mengatakan berdasarkan catatan di buku tamu Nazaruddin tercatat Nasir berulang kali melakukan kunjungan, termasuk di hari libur.

tu (11/2). Bupati Maluku Tengah Abdullah Tuasikal yang ditemui, Minggu (12/2), seusai mengunjungi para pengungsi dan lokasi rumah-rumah yang terbakar di Pelauw mengatakan, sebagian besar dari 3.000 warga itu mengungsi ke tiga desa yang berdekatan dengan Pelauw, yaitu Kailolo, Rohimoni, dan Ori. Selain tiga desa ini, ada pula yang mengungsi ke Pulau Ambon. “Mayoritas dari mereka yang mengungsi karena rumah mereka terbakar habis meski ada pula yang mengungsi karena takut,” ujar Abdullah. Pendataan jumlah rumah yang rusak ataupun terbakar masih dilakukan pemerintah. Namun, perkiraan awal ada sekitar 400 rumah yang rusak ataupun terbakar habis. Semen-tara jumlah korban tewas akibat bentrokan itu menjadi enam orang. Pemerintah,kataAbdullah,segera mungkin mengirim bantuan makanankepadaparapengungsi,selain juga bantuan obat-obatan dan pelayanan kesehatan. (ant/kps)

Di peternakan miliknya, berdiri sebuah bangunan berbentuk gudang. Di dalamnya berjajar dua baris pagar besi untuk tempat sapi yang akan diperah. Satu jalur di isi 20 ekor sapi yang disusun berhadapan. Setiap pagi dan sore, 160 ekor sapi antre menunggu giliran untuk diperah. Hanya satu orang pekerja yang ditugasinya mengatur agar sapi masuk ke jalurnya. Sesudah itu sapi dengan sendirinya akan berjalan masuk ke jerajak besi yang membatasi tempat mereka. Sapi yang masuk duluan berada di posisi paling ujung. Begitu seterusnya, hingga jumlah mereka 40 ekor berhadap-hadapan, kemudian diberikan makanan bernutrisi tinggi di tempat yang tersedia. Ada sedikit yang mengherankan kami. Sapi-sapi itu seperti mengerti akan diperah susunya. Induk sapi ini juga tidak khawatir kalau anak-anak mereka tidak kebagian susu induknya. Saat Tammy menyuguhkan susu segar kepada kami untuk diminum, di saat itu pula dia membawa beberapa ember susu sapi lainnya untuk diberikan kepada anak sapi yang menunggu berjejer di sebuah kandang di depan tempat pemerahan itu. Ada lagi yang menarik perhatian. Sebelum masuk ke kandang pemerahan, seorang pekerja memasukkan chips ke telingasapi.Darisituakandiketahui kondisi kesehatan sapi yang dipantau dari layar komputer. Sapi yang kurang sehat diberi tanda berwarna kuning. Susu sapi ini tetap diperah, tapi tidak dijual. Tempatnya diasingkan dengan susu yang baik. Dari kondisi itu pula pemilik peternakan Craig Whatman melakukan perawatan sapi. ‘’Biasanya sapi kurang sehat karena makanannya,’’ kata Whatman. Sebelum dilakukan pemerahan, sapi-sapi yang sudah berada di tempat masing-masing diberikan makanan buatan. Yakni gandum yang dicampur dengan berbagai nutrisi. Setelah lima menit makan, petugas meletakkan alat perah di masingmasing sapi. Tidak terlalu lama kemudian, 25 liter susu dari tiap ekor sapi sudah pindah ke tabung penampungan. Itu dilakukan dua kali sehari sehingga total 50 liter susu diperah dari setiap sapi. ‘’Setiap dua hari datang mobil tanki menjemput susu untuk kemudian dibotolkan di

pabrik susu dan dijual di pasar umum,’’ tambah Craig. Whatman tidak hanya memproduksi susu. Dia juga menjual sapi hidup (daging sapi) saat ternaknya tidak lagi produktif. Usia produktif untuk sapi perah 2,5 – 12 tahun. Setelah itu sapi-sapi itu dijual melalui agen. Belum lama ini Craig, mengaku baru menjual 1.500 ekor sapi, yang oleh eksportir mengaku dijual ke Jepang. Satu ekor sapi Craig, dihargai 2.500 dolar Australia (Aud 1 = Rp 9.800). Craig juga mengatakan terus mengembangbiakkan sapisapinya, dengan jalan inseminasi buatan. Dia bilang tidak benar, induk sapi yang diperah tidak bisa lagi menyusui anaknya. Anak-anak sapi tetap disusui induknya, ditambah dengan pemberian susu yang kualitasnya tidak baik, termasuk susu dari sapi yang tidak sehat. Kepada kami diperlhatkan, susu sapi yang kurang sehat dituangkan ke mangkuk besar untuk diminum sendiri oleh anak-anak sapi. Lebih terjamin Cerita Craig, banyak keuntungan memerah susu dengan menggunakan peralatan modern. Bukan hanya lebih cepat. Yang paling penting, kesehatan susu yang dihasilkan lebih terjamin. Pemerintah Australia membuat peraturan sangat ketat untuk masalah kesehatan susu ini. Sudah sejak lama dia ingin dapat memiliki mesin pemerah susu. Cerita tentang alat buatan Amerika Serikat itu sudah dia dengar delapan tahun lalu. Tapi dia baru dapat memilikinya tiga tahun lalu. Bank memberikannya fasilitas kredit Aud 1 juta dolar. Pengakuannya, tidak berat dia membayar cicilan pinjaman. Dengan alat yang baik itu kini dia mampu memproduksi 1,2 juta liter susu segar/tahun. Dia menjual susu segar itu dengan harga 47 sen/liter. Itu belum lagi dihitung dari penjualan sapi hidup. ‘’Di luar sapi hidup, penghasilan saya dari menjual susu sapi setahun lebih kurang 700.000 dolar. Keuntungan bersih adalah Aud 300.000, ’’ katanya. Begitu menjanjikan keuntungan yang akan diperoleh. Lalu kenapa peternak sapi di negeri kita tidak mengembang-kan hal serupa.Artinyatidakmelulumenjadi peternak dengan mengharapkan dagingnya saja tapi juga memproduksi susunya.

Al Bayan ... datang kepada sang ibu yang mulia itu ruh Siti Maryam (ibu Nabi Isa) dan Siti Asiah (bekas Isteri Firaun) dua wanita salihah yang ditugaskan Allah untuk menghibur Aminah. Tahun kelahiranya terjadi sebuah peristiwa yang terkenal dengan tahun Gajah. Raja Habsyah di bawah panglimanya Abrahah ingin meruntuhkan Ka’bah (rumah Allah). Rencana jahat mereka digagalkan oleh Allah dengan mengirim burung Ababil yang melemparkan mereka sampai tewas. Suatu ketika Abu Sofyan (salah seorang pembesar Quraiys dan musuh Nabi, kemudian masuk Islam) ditanya Kaisar Heraklius dari Romawi Timur tentang akhlak Nabi. “Apakah kalian menuduhnya (Muhammad) sebagai pendusta selama ini?”. Abu Sofyan menjawab, “Tidak!” Heraklius bertanya lagi, “Apa yang ia perintahkan pada kalian?” Abu Sofyan menjawab, “Nabi selalu berseru, sembahlah Allah saja, jangan menyeku-

tukan dengan sesuatu, tinggalkan kebiasaankebiasaan jahiliyah yang diperintahkan orangtuamu. Ia juga memerintahkan kami shalat, jujur bersih diri dan bersilaturahmi”. Pada akhir pembicaraan Heraklius berkata kepada Abu Sofyan, “Jika apa yang kamu ucapkan itu benar, ia akan menguasai tempat berpijak kakiku ini. Aku tahu bahwa ia orang luar. Aku tak pernah menyangka ia dari golonganmu. Seandainya aku tahu aku segera ingin menjumpainya. Jika aku di sisinya, aku akan mencuci telapak kakinya”. Kebesaran Nabi telah dinobatkan Allah disisiNya, sebagaimana firman-Nya dalam Alquran Surah Alam Nasyrah ayat 4; Warafa’na laka dhikra’ (Dan Kami tinggikan bagimu sebutan namamu). Nama Muhammad SAW juga menjadi bagian dari Syahadatain yang menyebabkan seseorang menjadi sah Islamnya bila mengakui, dan binasa Islamnya bila menginkari. Shalatullah, shalamullah, ‘alaika ya ajmala khalqillah!


Luar Negeri

WASPADA Senin, 13 Februari 2012

Liga Arab Pertimbangkan Hidupkan Lagi Misi Di Syria KAIRO (AP): Liga Arab mempertimbangkan satu usulan Minggu (12/2) untuk menghidupkan kembali misi peninjaunya di Syria yang telah dibekukan dengan memperpanjang masa tugasnya dengan memasukkan para peninjau dari negara non-Arab, negara Muslim dan PBB, kata sejumlah pejabat dari kelompok beranggota 22 negara tersebut. Usul tersebut akan dibahas lagi dalam satu pertemuan di Kairo oleh satu ‘Kelompok Syria’ yang terdiri dari tujuh negara anggota yang dipimpin Qatar, de-

mikian menurut sejumlah pejabat. Kelompok tersebut akan mengajukan rekomendasi kepada sidang para Menlu Liga Arab yang dijadwalkan Minggu larut

malam di ibukota Mesir. Bulan lalu, Liga menarik keluar misi peninjaunya ke Syria setelah misi itu menghadapi kecaman karena gagal menghentikan pertumpahan darah yang memporak-porandakan negeri itu.Warga Syria tampaknya tidak menerimasatutimpeninjauyang baru. Rezim Presiden Bashar Assad telah melaksanakan satu penumpasan keras terhadap pergolakan sejak dimulainya 11 bulan lalu. PBB memperkirakan bahwa

5.400 orang tewas sejak Maret lalu. Jenderal Syria Tewas Dalam perkembangan lainnya, kelompok bersenjata membunuhseorangjenderalangkatan daratdiDamaskusdalampembunuhan pertama perwira tinggi militer di ibukota Syria itu sejak timbulnya pergolakan terhadap rezim Presiden Bashar Assad yang dimulai sejak Maret tahun lalu, kata kantor berita pemerintah. SANA mengatakan tiga pria

bersenjatamelepaskantembakan ke arah Brigjend. Issa al-Khouli Sabtu pagi ketika dia meninggalkan rumah di kawasan Rukh-Eddine di Damaskus. Al-Khouli adalah seorang dokter dan kepala saturumahsakitmiliterdiibukota Syria. Belum ada satu pun yang menyatakan bertanggungjawab atas pembunuhan itu. Serangan itu menunjukkan bahwa kekerasan di Syria telah mencapai ibukota yang dijaga ketat, kota yang dianggap tenang dibanding dengan kota lainnya.

Montenegro Hampir Terkucil Karena Salju Tebal PODGORICA (AP): Pihak berwenang mengatakan salju paling tebal dalam masa 63 tahun yang mengurung ratusan desa, menutup jalan-jalan serta bandarautamadinegarakecilBalkan, Montenegro. Para pejabat kereta api pemerintah mengatakan Sabtu (11/ 2) satu kereta api lokal telah berhenti di dekat kota pegunungan Kolasin akibat terjadinya longsor yang menimpa jalur kereta api. Kereta api lainnya dikirimkan un-

tuk menyelamatkan 50 penumpang yang terjebak, yang harus berjalan kaki akibat tebalnya salju. Salju tebal hampir-hampir memutus ibukota Podgarica, yang memutuskan semua hubungan ke dan dari ibukota Podgorica, yang menutup bandaranya dan menghambat kereta api dan lalu lintas jalan. Cuaca dingin di Eropa, yang dimulai akhir Januari lalu, yang menewaskan ratusan orang — sebagian besar adalah pria dan

Pemimpin Oposisi Myanmar Aung San Suu Kyi Mulai Berkampanye YANGON, Myanmar (Antara/Xinhua-0ANA): Aung San Suu Kyi, pemimpin oposisi Myanmar Liga Nasional untuk Demokrasi (NLD), pada Sabtu (11/2) mulai menggelar kampanye pemilihan parlemen di konstituennya. Suu Kyi akan bersaing untuk memperebutkan kursi parlemen mewakilikota Kawhmu di wilayahYangon sebagai calon dari partainya dengan Dr U Soe Min, calon dari partai berkuasa Uni Solidaritas dan Pembangunan (USDP). Mereka memperebutkan kursi DPR pada pemilu sela 1 April. Ada 48 kursi kosong yang disiapkan untuk diperebutkan di 10 wilayah atau negara bagian termasuk 40 kursi DPR, enam kursi Dewan Nasional dan dua kursi dari daerah atau parlemen negara. Kedua partai, NLD dan USDP, telah mengajukan kandidat untuk memperebutkan semua kursi yang kosong, sementara 15 partai politik lainnya akan bersaing untuk memperebutkan kursi sisanya. NLD memboikot pemilihan umum November 2010, pemilihan multi-partai pertama sejak 1990, dengan menolak mendaftarkan berdasarkan peraturan pendaftaran partai yang diberlakukan junta militer saat itu.

Malaysia Deportasi Jurnalis Penghina Nabi KUALA LUMPUR (Waspada): Desakan aktivis HAM internasional agar Pemerintah Malaysia tidak mendeportasi seorang jurnalis asal Arab Saudi Hamza Kashgari, yang dituding melakukan penghinaan terhadap Nabi Muhammad lewat jejaring sosial twitter ternyata diabaikan Kuala Lumpur. Hal itu terbukti dengan tindakan Pemerintah Malaysia yang hari ini memutuskan untuk mendeportasi jurnalis Arab Saudi itu. “Hamza Kashgari, yang ditahan di Malaysia selama minggu terakhir setelah melarikan diri dari Arab Saudi, telah meninggalkan Malaysia,” ujar seorang pejabat Malaysia yang enggan menyebutkan namanya seperti dikutip AFP Minggu, (12/2). Lebih lanjut pejabat itu menjelaskan, “Kashgari telah dideportasi. Dia dijemput oleh para pejabat Saudi di bandara Kuala Lumpur.”

Sejumlah Bintang Ternama Berikan Penghormatan Pada Paul McCartney SEJUMLAHbintangternamayangmasihterusbersinar,diantaranya Katy Perry, Tony Bennett dan NeilYoung ‘telah membuka-buka buku laguPaulMcCartneyyangluasdanbesar’—yangdisusunnyasepanjang karir musiknya yang lebih dari 50 tahun — untuk memilih lagu yang akan mereka lantunkan pada malam penganugerahan kehormatan Musicares Person of the Year bagi mantan Beatle itu. Selain mereka, juga terdapat James Taylor, Diana Krall dan Foo Fighters yang ikut meramaikan konser musik untuk memeriahkan malam penganugerahan penghormatan bagi Paul itu. McCartney, yang memasuki usia 70 tahun Juni mendatang, telah mendapat penghargaan untuk prestasi musik dan kerja filantropisnya dua hari sebelum upacara penganugerahan Grammy Awards. “Sangat menyenangkan bagi saya untuk berada di sini,” katanya kepada kerumunan orang di Los Angeles Convention Center. “Ini fantastis untuk mendengar semua seniman fantastis mendendangkan lagu-lagu saya.” Menu acara jamuan makan malam yang disajikan bahkan mencerminkan gaya hidupnya yang vegetarian, dimulai dengan sajian tomat dan mozzarella segar sampai ke buah-buahan bakar. Mantan Beatle itu memilihkan versi gaduh I Saw Her Standing There untuk Young, sementara “yang lain menempatkan nuansa pada lagu yang saya tidak tahu ada di sana.” Dia berdiri memimpin tepuk tangan setelah Foo Fighters memilih hit kelompok musik Wings, Jet. Penyanyi Coldplay, Chris Martin mengatakan, “Kami sayang pada Paul dan kami bahagia untuk tampil di sini sebelum meluncurkan We Can Work It Out. Saat itu juga merupakan suatu kerja keras malam hari bagi McCartney, yang menyenandungkan satu medley pembuka dengan lagu Beatles Love. Pada akhir acara malam itu, McCartney mengubah suasana di aula yang besar itu ketika dia menampilkan gaya jazz dengan lagu My Valentine, satu lagu yang ditulisnya untuk istrinya yang baru Nancy Shevell, dan I’m Gonna Sit Right Down serta Write Myself a Letter,” dua lagu dari album terakhirnya, Kisses On the Bottom. Dia didampingi oleh Krall pada piano. Alicia Keys menyajikan satu nada soul Blackbird. Perry memukau penonton ketika dia membawakan lagu Hei Jude, membimbing McCartney dan Shevell untuk bernyanyi bersama. Gaya penampilan Perry malam itu juga mengagumkan ketika dia naik ke panggung dengan topi berbentuk kembang berwarna ungu muda. Di antara bintang yang bersinar malam itu di antara kerumunan 2.800 penonton terdapat Yoko Ono, Juri American Idol Randy Jackson, David Crosby, Rosanna Arquette, Bonnie Raitt, Berry Gordy, Tom Hanks dan istrinya Rita Wilson.(ap/bbc/mujo)

The Associated Press/Reuters

SIR Paul McCartney (kanan) tampil menyanyikan lagunya pada acara penyerahan penghargaan MusiCares Person of theYear Jumat (Sabtu 11/2 WIB) di Los Angeles, California. Inzet: Katy Perry yang ikut meramaikan penampilan para bintang malam itu, terlihat membawakan lagu Beatle, Hey Jude.

gelandangan. Sementara itu, para warga nomaden di Austria tampak mengantre untuk masuk masuk ke rumah bordil guna menghangatkan dirinya. Pemilik dari rumah bordil itu juga menyediakan penginapan gratis bagi para warga yangtakmemilikirumahtersebut. PeterLaskaris,pemilikrumah bordil Red Room Laufhaus diWina,Austria,memperbolehkanpara warga tuna wisma untuk tinggal di rumah bordirnya karena temperatursuhudiEropasudahmencapai minus 20 derajad celcius. Laskaris menawarkan kamar gratis, air panas, dan makanan bagi 10 orang warga. Meski demikianLaskaristidakmemberikan jasa pelayanan prostitusi secara gratis. “Kami tidak menjalankan bisnis ini dengan gencar saat musim dingin muncul dan liburan sekolah. Banyak kamar-kamar kamikosongdantampaknyaakan lebih baik lagi bila kami menyediakan kamar bagi yang membutuhkan. Cuaca Eropa sudah makindingin,seharusnyaparawarga tidak boleh berada di luar rumahnya,” ujar Laskaris seperti dikutip Orange, Sabtu. Cuaca dingin di Eropa menciptakan musibah yang cukup serius di sejumlah negara. Para warga di negara-negara Eropa juga diperingatkan akan munculnya salju yang diikuti oleh banjir bandang ketika temperatur suhu mulai meningkat dan salju meleleh. “Untuk dua pekan ke depan, para warga Eropa akan mengalamikesulitankarenacuacamulai menghangat dan salju pun mencair. Situasi itu akan jauh lebih

buruk dibandingkan yang terjadi pada saat ini,” ujar Ketua Komisi Penanggulangan Bencana Eropa KristaliaGeorgieva,sepertidikutip Daily Mail, Rabu. DisalahsatudesadiRumania, salju tampak memblokir jalan raya dan rel kereta api, 174 desa juga dikabarkan tidak dialiri listrik.

Sementara itu di Bulgaria, banyak pula jalanan yang ditutup. Di Ukraina, 135 warga sudah tewas akibat cuaca dingin tersebut. Kedinginan pun tidak hanya dirasakanolehmanusia,sejumlah hewan-hewan yang ada di taman margasatwaatauhewanliar merasakancuacadinginEropa.(ok/m10)

Pembunuhan seperti penembakan atas jenderal tersebut merupakan tidak biasa di luar Damaskus dan sejumlah perwira AD telah dibunuh pada masa lalu, sebagian besar di provinsi bergolak seperti di Homs dan Idlib. Kementerian Luar Negeri Syria Jumat menyatakan dua ledakan yang terjadi di kota Aleppo di bagian utara negeri itu terjadi dalam konteks “kampanye tidak adil” yang didanai dan didukung negara regional. Sementara itu, jurubicara Kementerian Luar Negeri Syria Sabtu mengatakan bahwa Damaskus telah memberikan waktu 72 jam kepada para dutabesar Libya danTunisia untuk meninggalkan Syria. Kedutaan Syria di Qatar juga ditutup dan Dutabesar Syria untukKuwaitdanArabSaudijuga telah dipanggil kembali, kata Jurubicara Kementerian Luar NegeriSyriaJihadMakdissidalam pertemuan dengan wartawan. (m10)

A3


Nusantara

A4

WASPADA Senin 13 Februari 2012

Panglima OPM Nyatakan Kembali Ke NKRI JAK ARTA ( Waspada): Panglima Tentara Pembebasan Papua Organisasi Papua Merdeka, Alex Mebri menemui Ketua Umum Partai Golkar Aburizal Bakrie di kediaman Aburizal di Jalan Mangunsarkoro, Jakarta, Minggu (12/2) sore. Kedatangan Alex bersama sebelas orang aktivis gerakan Papua itu untuk membicarakan solusi bagi segala permasalahan yang terjadi Papua. Kepada Aburizal, mereka menyatakan diri kembali ke Negara Kesatuan Republik Indonesia (NKRI), dan siap secara bersama-sama membangun Papua lebih

sejahtera serta berkomitmen mengakhiri seluruh kekerasan seperti yang selama ini terjadi. Alex yang dalam kesempatan itu didampingi politisi asal Papua sekaligus anggota Fraksi Partai Golkar DPR Yorris Raweyai mengungkapkan, Papua tidak akan pernah sejahtera kalau masih terus-menerus terjadi kekerasan dan konflik. “Kami, bersama pemerintah Republik Indonesia siap mencari solusi untuk Papua, dan siap bekerja untuk membangun Papua,” ujarnya. Aburizal menyatakan gembira dan menyambut baik hal itu. Ia pun mengaku secara pribadi sangat mencintai dan menga-

gumi Papua. Pengalamannya beberapa kali mengunjungi Papua selama menjadi Menteri Koordinator Kesejahteraan Rakyat telah menggugah kesadarannya bahwa permasalahan Papua tidak dapat dise-lesaikan dengan pendekatan kekerasan/ militer, melainkan dengan pendekatan kesejahteraan. “Papua, terutama di daerah-daerah pegunungan harus disejahterakan, dibangun jalan raya, ditingkatkan pendidikan dan kesehatannya. Bukan dengan pendekatan militer,” kata Aburizal. Hal tersebut, ungkapnya, telah berulang kali disampaikan kepada Presiden Susilo Bam-

bang Yudhoyono. “Saya sering katakan kepada Presiden, Papua tidak mau merdeka, Papua ingin sejahtera. Maka, jangan gunakan pendekatan militer, tetapi pendekatan kesejahteraan.” Aburizal berjanji kepada Alex dan sejumlah aktivis Papua lainnya, bahwa seluruh aspirasi tersebut akan diperjuangkan, melalui Fraksi Partai Golkar di DPR maupun melalui Sekretariat Gabungan partai politik pendukung pemerintah. “Bapak (Alex), saya janji —dan janji saya ini tentu disaksikan Tuhan dan kami semua yang ada di sini— saya akan memperjuangkannya dengan seluruh kekuatan saya. Saya janji.” (vvn)

80% Perda Kurang Dukung Program KB

Antara

TERIMA TOKOH OPM: Ketua Umum Partai Golkar Aburizal Bakrie (kanan) berbincang dengan Panglima Tertinggi TPN/ OPM Alex Mebri (kiri) di kediaman pribadi Aburizal Bakrie di Jakarta, Minggu (12/2). Selain melakukan audiensi dengan Aburizal Bakrie yang mereka nilai sebagai tokoh yang dekat dengan orang-orang Papua, Pdt John Ramandey mengatakan akan bertemu dengan Ketua DPR dan Presiden untuk menyampaikan pernyataan sikap soal masuknya TPN/OPM ke dalam NKRI.

JAKARTA (Waspada): Hampir 80 persen peraturan daerah (Perda) di 497 kabupaten dan kota dinilai tidak sinkron bahkan terkesan kurang mendukung program Keluarga Berencana (KB). Kondisi itu menjadi tantangan berat program kependudukan di tingkat nasional. Kepala Badan Kependudukan dan Keluarga Berencana Nasional (BKKBN) Sugiri Syarif dalam Rapat Kerja Nasional (Rakernas) BKKBN 2012, kemarin mengatakan, sasaran program KB adalah 7,3 juta akseptor KB baru. Untuk itu diperlukan perda yang mendukung keberhasilannya. “Tapi banyak perda yang kurang mendukung, utamanya dalam masalah penganggaran KB,” kata Sugiri. Dia menyontohkan, untuk satu kali operasi tubektomi atau

operasi KB mantap bagi wanita dibutuhkan biaya besar. Subsidi diberikan pemerintah pusat angkanya tinggal Rp900 ribu saja. Sementara tarif di beberapa daerah berdasar perda masih dua juta hingga dua setengah juta rupiah. “Ini membuat masyarakat enggan menjadi akseptor kontrasepsi mantap, biayanya mahal sekali,” kata dia akan bertahap mengadvokasi program KB kepada bupati dan walikota di seluruh Indonesia. Pada 2012 ini, Sugiri menargetkan adanya 7,3 juta peserta KB baru di seluruh daerah. Jawa Barat menjadi kandidat provinsi dengan peserta KB terbesar karena jumlah penduduknya yang terbanyak. “Sasaran yang akan dicapai menurunnya rata-rata laju pertumbuhan penduduk,” sebutnya.(dianw)

321 Kabupaten/Kota Rawan Bencana Berkas Afriyani Cs JAKARTA (Waspada): Sebanyak 321 atau 65 persen dari 479 kabupaten/kota di Indonesia rawan bencana, sedangkan 173 atau 35 persen kabupaten/ kota berisiko sedang. Peta risiko nasional yang telah diselesaikan Badan Nasional Penanggulangan Bencana (BNPB) mencantumkan ada sedikitnya 13 jenis bencana yang rawan terjadi di 321 kabupaten/ kota, seperti gempa bumi, tsunami, letusan gunung api, puting beliung, kekeringan, banjir, tanah longsor, gelombang pasang, kebakaran lahan dan

hutan, epidemi dan wabah penyakit, gagal teknologi, kebakaran gedung dan permukiman, serta konflik sosial. Kepala Pusat Data Informasi dan Humas BNPB, DR Sutopo Purwonugroho mengatakan, peta risiko bencana juga memuat peta bahaya, peta kerentanan dan peta kapasitas. “Berdasarkan peta risiko tersebut maka tidak ada kabupaten/kota yang berisiko rendah terhadap bencana. Untuk itu pemda perlu memberikan prioritas pembangunan terhadap penanggulangan bencana,” kata

Sutopo, Kamis (9/2). Kenyataannya masih ada 138 kabupaten/kota yang belum membentuk BPBD (Badan Penanggulangan Bencana Daerah). Yang sudah terbentuk BPBD pun ternyata masih sangat terbatas dukungan anggaran, peralatan dan SDM-nya sehingga Pemda bersama DPRD perlu memberikan dukungan. “Sebab itu semua menjadi kewenangan bupati/walikota bersama DPRD. Jika tidak maka bencana akan terus menimbulkan kerusakan dan kerugian yang besar,” kata dia.(dianw)

Indofood Siapkan Biaya Penelitian Pangan JAKARTA (Waspada): PT Indofood Sukses Makmur (ISM) kembali menyelenggarakan Indofood Riset Nugraha (IRN). Program bantuan dana penelitian bagi mahasiswa S1, dosen dan peneliti dari Perguruan Tinggi (PT) dan non PT pada tahun ini bertema ‘menuju penganekaragaman pangan berbasis kearifan lokal melalui pembangunan tepung dan pati’. Direktur PT ISM, Franciscus Welirang saat peluncuran IRN di Jakarta, Kamis (9/2) mengatakan, IRN adalah bentuk kepedulian pihaknya untuk pembangunan pangan nasional, khususnya di kalangan civitas akademika. “Antusiasme riset bidang pangan harus dibuda-

yakan. Harapannya ada banyak orang yang memikirkan upaya penganekaragaman pangan di negara ini,” kata dia. Ahli pangan yang juga guru besar Institut Pertanian Bogor (IPB) FG Winarno mengatakan, diversifikasi pangan sangat dibutuhkan sebagai upaya stabilitas pembangunan bangsa. Instabilitas pangan akan menyebabkan terganggunya ketahanan dan keamanan bangsa. “Kearifan lokal dapat mendukung program diversifikasi pangan. Artinya, kalau di suatu daerah masyarakatnya biasa makan jagung, maka itu dapat dikembangkan sebagai sebuah kearifan lokal,” kata Winarno.

Saat ini, katanya, konsumsi beras sangat tinggi. Kalau saja Indonesia dapat mengurangi 7,5 persen konsumsi beras, maka potensi menjadi negara pengekspor beras sangat tinggi. “Kenyataannya sekarang ini kita malah impor beras terus, karena kebutuhan akan beras meningkat terus,” kata Winarno. IRN sudah ada sejak 1998. Sejak saat itu proposal yang masuk sejumlah 3.240 yang diajukan mahasiswa, dosen dan penelitian dari berbagai lembaga penelitian. Dari jumlah itu, se-banyak 396 proposal dinyatakan layak untuk didanai. Jumlah dana bervariasi antara Rp10 juta sampai Rp50 juta.(dianw)

Dilimpahkan Ke Kejaksaan

JAKARTA (Waspada): Penyidik Direktorat Narkoba Polda Metro Jaya melimpahkan berkas kasus narkoba pengemudi ‘Xenia maut’, Afriyani Susanti ,29, dan tiga temannya ke Kejaksaan, Kamis (9/2). “Empat berkas perkara yang dilimpahkan masing-masing, tersangka Afriyani Susanti, Asisendi, 34, Deny M, 30 dan Adistina Putri Grani, 25,” kata Kabid Humas Polda Metro Jaya Kombes Pol. Rikwanto kepada wartawan di Jakarta, Kamis (9/2). Kata Rikwanto, proses rekonstruksi (reka ulang) kasus Afriyani sudah dilakukan di dua tempat yakni, di Upstair Cikini Jakarta dan Diskotek Stadium Hayam Wuruk, Jakarta. “Semua rekonstruksi narkoba sudah selesai, baik yang di Upstair maupun di Stadium. Berkas sudah lengkap, jadi langsung dilimpahkan ke Kejaksaan,” katanya. Sedangkan rekonstruksi kasus kecelakaan lalulintas yang mengakibatkan sembilan orang meninggal dunia, Rikwanto mengatakan, rekonstruksi akan digelar pada minggu depan. Tetapi Rikwanto tidak menjelaskan jadwal rekonstruksi digelar. “Untuk rekonstruksi Lakalantas pastinya melibatkan Afriyani dan ketiga rekannya minggu depan lah, tapi harinya belum tahu kapan,” sebut dia.(j02)

Antara

GAJAH SUMATERA: Sejumlah gajah Sumatera jinak dewasa berada di dalam Sungai kawasan “Flying Squad” Taman Nasional Tesso Nilo (TNTN), Kabupaten Pelalawan, Riau, Sabtu, (11/2). di kawasan Flying Squad di TNTN tersebut terdapat 10 gajah Sumatera jinak dewasa dan 4 anak gajah lainya yang masih membutuhkan pelatihan khusus.

Cegah Plagiat, Calon Sarjana S1 Wajib Terbitkan Jurnal Ilmiah JAKARTA (Waspada): Kementerian Pendidikan dan Kebudayaan, melalui Direktorat Jenderal Pendidikan Tinggi (Dikti) mengeluarkan kebijakan baru. Mahasiswa S1 sampai S3 wajib membuat dan mempublikasikan karya ilmiah sebagai syarat kelulusan. Kebijakan tesebut tertuang dalam surat edaran bernomor 152/E/T/2012, yang diedarkan kepada Rektor/Ketua/Direktur PTN dan PTS di seluruh Indonesia dan akan berlaku bagi mahasiswa yang akan lulus setelah Agustus 2012. Menteri Pendidikan dan Kebudayaan (Mendikbud) Mohammad Nuh mengatakan, tujuan dari diwajibkannya mahasiswa untuk membuat karya tulis serta di publikasikan ke dalam jurnal tersebut untuk menekan adanya plagiat di kalangan mahasiswa. “Ini dapat mengantisipasi plagiat,”kata mendikbud kepada wartawan di Jakarta, belum lama ini. Menurutnya, dengan digenjotnya mahasiswa untuk menciptakan karya ilmiah yang dipublikasi diharapkan ada pengembangan keilmuan. Ilmu pengetahuan pun dapat diman-

investasi sektor swasta sekaligus melestarikan sumber daya alam, mendekatkan hubungan antara bidang pertanian dan perguruan tinggi, dan meningkatkan perdagangan bilateral produk-produk pertanian. Upaya-upaya ini menjadi komponen inti dalam Kemitraan Komprehensif AS-Indonesia, demikian siaran pers Kedubes AS kepada Waspada Rabu. AS juga bekerjasama dengan Indonesia untuk mengatasi ketahanan pangan melalui perikanan. Laut memainkan peran yang sangat penting dalam ketahanan pangan Indonesia. Program-program AS berfokus pada meningkatkan kesinambungan melalui perencanaan dan pengelolaan kelautan yang bertanggung jawab pada tingkat lokal, menambah persediaan pangan yang berasal dari perikanan Indonesia, dan meningkatkan pemasukan bagi masyarakat miskin di wilayah pesisir dan pulau-pulau kecil. AS bermitra dengan Pemerintah Indonesia dan perusahaanperusahaan sektor swasta untuk mengembangkan dan memperluas model bisnis yang berkesimbangbungan dan pengelolaan sumber daya alam

yang berkesinambungan. Dukungan AS terhadap peneliltian dan kolaborasi pengembangan merupakan bidang kegiatan lainnya yang terus berkembang. Prakarsa penelitian dan pendidikan pertanian di Indonesia mencakup: dukungan AS bagi pembentukan Pusat Penelitian Pertanian Lanjutan di Indonesia yang akan terhubung dengan lembaga-lembaga penelitian pertanian di AS. Di samping itu, program beasiswa pertanian dari USAID senilai satu juta dollar akan memberikan kesempatan bagi warga Indonesia yang berbakat untuk belajar di perguruan tinggi di AS dan memperoleh gelar tingkat lanjut di bidang ilmu pertanian. Program Bioteknologi Pertanian USAID senilai AS$1,5 juta selama tiga tahun membangun kemitraan antara lembaga-lembaga AS dan Indonesia untuk memperkenalkan teknologiteknologi baru seperti varietas beras diperkaya beta carotene dan kentang dan tomat yang tahan virus. Program ini juga mempromosikan teknik pengendalian hama terpadu berbiaya rendah untuk meningkatkan produksi pertanian dan

mata pencarian di pedesaan. Program Cochran and Borlaug Fellowship Departemen Pertanian AS terus mendukung pengembangan sumber daya manusia di Indonesia di bidang pangan dan pertanian dengan memilih orang terbaik (fellows) untuk berangkat ke Amerika Serikat dan mengikuti programprogram pendidikan dan penelitian jangka pendek. Sebuah program Departemen Luar Negeri AS akan terus mendukung sejumah pembicara mengenai teknologi pertanian dan perikanan termasuk di bidang bioteknologi, dan dilaksanakan bekerjasama dengan Winrock International dan para pakar dari Dewan Pengembangan Pertanian Indonesia (A/D/C). Perdagangan pertanian merupakan komponen yang sangat penting dalam ketahanan pangan. Amerika Serikat dan Indonesia telah menetapkan tujuan untuk meraih 10 milyar dolar dari perdagangan pertanian, perikanan, dan produkproduk kehutanan pada 2014. Dengan mencapai tujuan ini, maka kesempatan kerja dan dukungan pemasukan bagi kedua negara akan semakin luas. (m10)

antara 3 sampai 6 halaman, itu cukup,” terang Mendikbud. Karya ilmiah tersebut, tidak harus dimasukkan dalam jurnal cetak, namun dapat dipublikasikan melalui jurnal yang bersifat online. Dalm surat edaran tersebut disebutkan bahwa untuk lulus program Sarjana harus menghasilkan makalah yang terbit pada jurnal ilmiah. Untuk lulus program Magister harus telah menghasilkan makalah yang terbit pada junal ilmiah nasional yang diutamakan yang terakreditasi Dikti. Untuk lulus program Doktor, harus telah menghasilkan makalah yang diterima untuk terbit pada jurnal internasional. Sebelumnya, Ketua Asosiasi Perguruan Tinggi Swasta Indonesia yang juga Rektor UII, Edy Suandi Hamid mengatakan kebijakan Dikti tentang penerbitan makalah bagi calon sarjana S1 sebagai kebijakan yang tidak realistis. Pasalnya, daya dukung jurnal di tanah air masih jauh dari harapan.. “Seandainya dari lebijh 3000 perguruan tinggi negeri dan swasta di tanah air, setiap tahun ada 750 ribu saja calon sarjana

yang akan lulus setiap tahun, maka harus ada puluhan ribu jurnal yang ada di negeri ini. Padahal jumlah jurnal ilmiah kita saat ini tidak lebih dari 2 ribu jurnal. Terbitnya pun 6 bulan sekali. Sulit sekali tertampung,” kata Edy. Dia memperhitungkan, seandainya di Indonesia saat ini ada 2000 jurnal, dan setiap jurnal terbit setahun dua kali, dan setiap terbit bisa mempublikasikan lima artikel, maka setiap tahun bisa memuat 20.000 tulisan para calon sarjana. “Kalaupun jurnal itu jumlahnya berlipat lima, tetap tidak mampu menampung tuilisan ilmiah calon sarjana S1 tersebut. Masih ada ratusan ribu calon sarjana yang antre untuk dimuat. Padahal, jurnal itu juga digunakan oleh para dosen, peneliti, mahasiswa S-2 dan S3,” tambah Edy. Dia khawatir jika tidak ditinjau ulang, kebijakan itu akan menimbulkan keresahan di masyarakat. “Kalau memang terus diberlakukan, sebaiknya secara bertahap. Mungkin dapat dimulai pada perguruan tinggi yang terakreditasi A,” tandas Edy. (dianw)

LPK Minta Surat Edaran Menteri PU Dicabut JAKARTA (Waspada): Ketua Umum Lembaga Pengembangan Jasa Kontruksi Nasional (LPJKN) Rendy Lamadjido meminta KomisiV DPR RI menjadi mediator perseteruannya dengan Kementerian Pekerjaan Umum yang membekukan keberadaan LPJKN dengan Surat Edaran Kementerian PU No. 9 Tahun 2011. “Surat Edaran itu merupakan penzoliman kepada 240 ribu anggota LPKJ di seluruh Indonesia dari Menteri PU mengatasnamakan pemerintah terhadap LPJKN yang sudah berkiprah

selama 12 tahun menjadi mitra pemerintah,” ujar Rendy dalam rapat dengar pendapat dengan Komisi V, Kamis (9/2). Rendy yang juga anggota Komisi V dari Fraksi PDIP itu menegaskan, surat edaran Kementerian PU merupakan pelanggaran UU dan melanggar Peraturan Presiden tentang masyarakat kontruksi yang tergabung dalam LPJK. Menurut dia, seluruh anggota LPJK yang sudah memperoleh sertifikat dari LPJK dari provinsi Aceh hingga Papua resah dengan adanya surat

edaran itu. “Apalagi sekarang ini Kementerian PU begitu gampang dan mudahnya mengeluarkan sertifikat Sertifikat Badan Usaha (SBU), bahkan bisa memperolehnya ‘dibawah meja’,” sebutnya. Apa yang dilakukan oleh Kementerian PU menurut Rendy, akan melahirkan pelaku-pelaku usaha yang berindikasi korupsi. “Lihat saja kasus pembangunan Wisma Atlet, pemborongnya tidak terdaftar da-lam anggota LPJK Munas,” kata dia menjelaskan, semua

anggota LPJK berjumlah 240 ribu lebih adalah profesinal di masing-masing bidangnya dan bisa dilihat keberadaannya di website. Sementara pimpinan KomisiV Muladi mengatakan, akan meminta penjelasan dari Kementerian PU yang juga menerbitkan Sertifikat Badan Usaha. “Yang perlu kita selamat-kan ratusan ribu anggota yang sudah terdaftar, bahkan sudah 12 tahun berkiprah membantu pembangunan di negeri ini,” katanya.(j07)

POLLING PEMBACA WASPADA BERHADIAH

POLLING PEMBACA WASPADA BERHADIAH

SIAPA GUBERNUR/ WAKIL GUBERNUR PILIHAN ANDA?

SIAPA... BUPATI/WAKIL BUPATI - WALI KOTA/ WAKIL WALI KOTA ACEH PILIHAN ANDA?

USAID Canangkan Program AMARTA II JAKARTA (Waspada): Amerika Serikat berkomitmen untuk bermitra dengan Pemerintah Indonesia dan sektor swasta untuk memajukan ketahanan pangan Indonesia. Sebagai bentuk komitmen tersebut Dutabesar AS Scot Marciel mengumumkan bahwa Badan Pembangunan Internasional AS (USAID) akan mencanangkan sebuah program bertajuk Agribusiness Market and Support Activity (AMARTA II). Program senilai AS$15 juta selama lima tahun ini akan menitikberatkan pada peningkatan produksi komoditas bernilai tinggi seperti coklat, kopi, dan tanaman hortikultura, perluasan akses kredit bagi wilayah pedesaan, dan dukungan reformasi peraturan yang memihak pada petani. Program AMARTA II akan lebih memperluas jenis kegiatan dan kerjasama antara Amerika Serikat dan Indonesia di bidang pertanian dan ketahanan pangan. Selain program AMARTA II yang diresmikan Dubes Marciel Rabu (8/2) itu, Pemerintah AS juga meningkatkan dukungan bagi produksi pertanian dan perikanan yang berkesinambungan, mendorong

faatkan dan diketahui khalayak.Tidak berkutat di seputar kampus saja. Kebijakan tersebut, kata Nuh, juga datang dari keprihatinan bahwa budaya menulis di Indonesia, termasuk dikalangan mahasiswa masih sangat rendah. Jika dibandingkan dengan Malaysia, karya ilmiah di Indonesia baru sepertujuh dari jumlah karya ilmiah di Malaysia. Oleh karena itu, untuk menumbuhkan budaya menulis memang perlu dilakukan sebuah paksakan. “Dikti ingin membangun, dan membangun itu harus dipaksa. Karena kalau menunggu kesadaran, kebanyakan sulit sadarnya. Tapi tidak semua paksaan itu negatif. Dalam pendidikan pada dasarnya itu penuh dengan paksaan,”imbuh mendikbud. Mendikbud berharap pihak universitas dan para mahasiswa tidak terlalu khawatir dengan kebijakan dan ketentuan tersebut. Pasalnya, karya tulis yang harus dikerjakan oleh mahasiswa S1 tidak serumit yang dibayangkan. Apalagi sampai menghambat keluluan para mahasiswa. “Tidak sulit, cukup menulis

Gubenur

:

Kabupaten/Kota

:

Bupati/Wali Kota

:

Wakil Gubernur :

Wakil Bupati/Wakil Wali Kota:

Data Pengirim (sesuai KTP)

Data Pengirim (sesuai KTP)

Nama

Nama

:

:

Alamat :

Alamat :

Mulai 1 Februari 2012 s/d sepekan sebelum pemilihan, Harian WASPADA menyiarkan polling pembaca berhadiah untuk Pemilihan Gubernur Aceh. Kupon polling yang telah diisi dapat dikirim langsung atau melalui pos ke Bumi Warta Harian WASPADA Jl. Brig. Katamso No. 1 Medan 20151 atau melalui agen-agen WASPADA antara lain: TB. Lautan Ilmu (Langsa), Hamzah A.Gani.R/Arun Post (Lhokseumawe), T. Ardiansyah Perwakilan WASPADA Jl. T. Saifuddin (B.Aceh). Hasil polling akan diumumkan secara berkala, sesuai jumlah kupon yang diterima. Di akhir masa polling kuponkupon yang masuk akan diundi untuk menentukan pemenang yang akan diumumkan pada 15 April 2012. Para pemenang akan menerima hadiah sbb: Pemenang I : Rp. 1.000.000,Pemenang II : Rp. 750.000,Pemenang III : Rp. 500.000,-

Mulai 1 Februari 2012 s/d sepekan sebelum pemilihan, Harian WASPADA menyiarkan polling pembaca berhadiah untuk pemilihan bupati/wali kota di 6 kab/kota di Aceh (Aceh Timur, Langsa, Aceh Utara, Lhokseumawe, Banda Aceh dan Gayo Lues). Kupon polling yang telah diisi dapat dikirim langsung atau melalui pos ke Bumi Warta Harian WASPADA Jl. Brig. Katamso No.1 Medan 20151 atau melalui agen-agen WASPADA antara lain : TB. Lautan Ilmu (Langsa), Hamzah A. Gani.R/Arun Post (Lhokseumawe), T. Ardiansyah Perwakilan WASPADA Jl.T.Saifuddin (B. Aceh). Hasil polling akan diumumkan secara berkala, sesuai jumlah kupon yang diterima. Di akhir masa polling kuponkupon yang masuk akan diundi untuk menentukan pemenang yang akan diumumkan pada 15 April 2012. Para pemenang akan menerima hadiah sbb: Pemenang I : Rp. 1.000.000,Pemenang II : Rp. 750.000,Pemenang III : Rp. 500.000,-


Sport

WASPADA Senin 13 Februari 2012

A5

Duka Ganda Barca AP

KAPTEN MU Patrice Evra (kanan) merayakan kemenangan timnya tepat di depan striker Liverpool Luis Suarez.

Evra, Suarez Sama-sama Salah LONDON ( Waspada): Manager Manchester United (MU) Sir Alex Ferguson, menyalahkan kapten timnya Patrick Evra serta striker Liverpool Luiz Suarez dalam insiden matchday 25 Liga Premier di Stadion Old Trafford. Evra disalahkan Ferguson, sebab seperti mengejek atau malah memprovokasi saat merayakan kemenangan 2-1 The Red Devils atas The Reds, justru tepat di depan Suarez. “Evra seharusnya tidak perlu melakukan hal seperti melompat-lompat di depan Suarez saat selebrasi di akhir pertandingan,” sesal Sir Fergie, seperti dilansir BBC Sports, Minggu (12/2). Selebrasi ala Evra sempat membuat beberapa pemain The Kop marah, terutama kiper Pepe Reina yang segera menghampiri bek Prancis itu. “Sungguh, semestinya dia (Evra) tidak perlu melakukan hal itu,” kecam Ferguson.

Suarez baru saja menyelesaikan hukuman skorsing delapan partai, karena terbukti bersalah mengatakan negro kepada Evra pada jumpa pertama MU-Liverpool di Liga Premier musim ini, Oktober silam di Stadion Anfield. Saat prosesi jabat tangan jumpa kedua klub musuh bebuyutan itu di Old Trafford, Sabtu lalu, Suarez menolak salaman dengan Evra. Bomber Uruguay itu bersalaman dengan para pemain United lainny, tapi melewati Evra yang sebenarnya sudah menjulurkan tangannya. “Saya tidak bisa percaya. Saya mengobrol dengan Patrice (Evra)pagiinidandiaberkataakan menjabat tangannya (Suarez). Dia mengatakan ‘Saya tidak perlu malu’,” beber Sir Fergie. “Suarez aib bagi Liverpool, dia seharusnya tidak dibolehkan bermain untuk Liverpool lagi. Klub itu punya sejarah, dia bisa menyebabkan kerusuhan dan mengerikan apa yang telah dilakukannya,” kritik pelatih berusia 70 tahun asal Skotlandia itu.

Dua gol kemenangan MU ke gawang Liverpool diborong Wayne Rooney menit 47 dan 50, sedangkan gol balasan tim tamu dicetak Suarez menit 80. Ketika ditanyakan sikap Suarez yang menolak salaman dengan Evra, manajer Liverpool Kenny Dalglish mengaku, tidak mengetahui kejadiannya. “Jika Anda ingin tahu yang terjadi di sana, tanyalah kepada orang yang ada di sana, sebab saya ada di sini,” dalihnya melalui Sky Sports. Namun mantan striker subur Si Merah itu menyalahkan wartawan, yang terus menyudutkan penyerang andalannya tersebut. “Saya rasa Anda (wartawan) sudah terlalu berlebihan dan melewati batas dalam menyalahkan Suarez,” tuding Dalglish. “Saya hanya ingin bilang bahwa kalian terus berupaya membesar-besarkan masalah. Beda ketika kami melawan United di Piala FAp, peristiwa seperti ini tidak terjadi karena tidak ada siaran terus-menerus,” katanya menambahkan. (m15/bbc/sky)

Semifinal Penguntit Dortmund BERLIN ( Wa s p a d a ) : Bayern Munich dan Borussia Monchengladbach yang terus menguntit Borussia Dortmund di puncak klasemen Bundesliga, wajib saling bunuh pada semifinal Piala Jerman 20-21 Maret mendatang. Bayern dan Gladbach sesuai hasil undian yang diumumkan Minggu (12/2), jumpa di babak empat besar setelah sebelumnya menyingkirkanVfB Stuttgart dan Hertha Berlin, sama-sama lewat skor 2-0 Laga semifinal lainnya mempertemukan Dortmund dengan tim divisi bawah Greuther Furth. Furth yang akan menjadi tuan rumah, tampil mengesankan sekaligus mengejutkan dengan menyingkirkan Nuremberg dan Hoffenheim pada babak sebelumnya. Gladbach juga diuntungkan karena bertindak sebagai tuan rumah bagi FC Hollywood. Borussia Park pun bakal menjadi neraka buat anak asuh Jupp Heynckes, yang musim ini kalah kandang dan tandang atas Juan Arango cs di Bundesliga. Filip Daems cs kini hanya satu angka di bawah Bayern di klasemen sementara Bundesliga, setelah secara perkasa

MADRID (Waspada): Harapan Barcelona untuk meraih gelar juara La Liga Primera buat keempat kali berturut-turut, semakin memudar setelah dipecundangi 2-3 oleh tuan rumah Osasuna pada journada 22. Duka ganda pun diderita El Barca di Stadion Reyno de Navarra, Pamplona, Sabtu (Minggu WIB), karena pemainnya yang serba bisa, Javier Mascherano, terkena hukuman kartu merah secara unik. Mascherano mendapatkan kartu kuning pertamanya menit 88 karena memprotes keputusan wasit Jose Romero. Mantan gelandang Liverpool dan West Ham itu kemudian diberikan kartu merah karena terlibat konfrontasi dengan Romero di lorong menuju kamar ganti pakaian pemain. Wasit Romero dalam laporannya juga memasukkan nama entrenador Barca Pep Guardiola sebagai penerima kartu kuning akibat melakukan protes berlebihan seusai pertandingan. “Kami sedih dengan cara pertandingan berakhir. Kami sungguh tidak gembira,” papar winger Pedro Rodriguez, seperti dilansir Goal, Minggu, (12/1). “Kami berjuang mendapatkan hasil bagus dan Osasuna keluar sebagai yang terkuat. Kami mestinya bisa menandingi mereka, tetapi nyatanya kami tak mampu,” tambah Pedro, yang digantikan Isaac Cuenca begitu memasuki awal babak kedua. Tempur di bawah udara dingin membeku di Pamplona,

Klasemen Bundesliga Dortmund 21 14 4 3 B Munich 21 14 2 5 M’gladbach 21 13 4 4 Schalke 21 13 2 6 W Bremen 21 9 6 6 Leverkusen 21 8 7 6 Hanover 21 7 10 4 Wolfsburg 21 8 3 10 Stuttgart 21 7 5 9 Hoffenheim 21 6 7 8 FC Koeln 20 7 3 10 Mainz 21 5 8 8 Hamburg 20 5 8 7 Nuremberg 20 6 3 11 Hertha 21 4 8 9 K’lautern 21 3 9 9 Augsburg 20 3 8 9 Freiburg 21 4 5 12

46-14 49-14 34-12 46-28 34-35 28-28 23-25 27-38 31-28 23-25 29-40 29-35 25-34 19-31 25-36 15-26 19-33 27-47

46 44 43 41 33 31 31 27 26 25 24 23 23 21 20 18 17 17

menggunduli FC Schalke 3-0 pada matchday 21, Minggu (12/2) dinihari WIB. Penyerang Jerman Marco Reus membuka pesta Gladbach ketika laga baru berjalan dua menit. Gawang kiper Schalke Lars Unnerstall bergetar lagi untuk kedua kali terjangan Mike Hanke menit 15, menuntaskan hasil kerjasama cantik Daems dan Arango. Gladbach semakin jauh unggul saat tendangan bebas Arango menjebol gawang Royal Blues buat ketiga kali menit 32. Kemenangan ini merupakan respons positif Gladbach, sebab sebelumnya Munich memukul

AP

STRIKER Gladbach Juan Arango (kiri) dan kawan-kawan terlalu tangguh bagi pemain Schalke Joel Matip di Borussia Park, Minggu (12/2) dinihari WIB. Kaiserslautern 2-0 dan Dortmund menaklukkan Bayer Leverkusen 1-0. “Ini membuktikan bahwa kami berada dalam tren menaik

dan sangat pantas memenangkan duel. Kami memainkan sepakbola luar biasa terutama di babak kedua,” klaim Heynckes. (m15/dpa/uefa)

Pemain Terbaik Inalum Kerap Pecahkan Kaca TANJUNGGADING (Waspada): Christ Ananda Silaen, 16, pemain Inalum FC yang dinobatkan sebagai pemain terbaik Piala Inalum 2012, ternyata kerap memecahkan kaca lemari dan pajangan dari kaca lainnya saat bermain bola di dalam rumah. Pasti Sinaga dan Jonni Silaen, orangtua Ananda kepada Waspada, kemarin menuturkan, bungsu dari tiga bersaudara ini sejak kelas dua SD lebih dulu menggeluti karate hingga sabuk coklat. Keengganannya muncul saat uji kenaikan tingkat terpaksa melawan orang yang berpostur lebih tinggi. Di sela-sela latihan karate, ia juga tetap masuk ke SSB Aldas

Prima Tanjunggading. Akhirnya, perhatian siswa kelas II SMAN I Sei Suka inipun fokus ke sepakbola. Tidak ingin mengecewakan anak kesayangannya, ibu Ananda yang energik ini tetap mendukung hobi baru putranya. Meski sibuk dengan jabatannya sebagai Kepala UPTD Kecamatan Airputih Badan Peranan Wanita dan Anak Pemkab Batubara, sang ibunda terus mendampingi Ananda kemanapun dirinya bertanding. “Setiap bertanding ke luar daerah seperti Popnas di Riau dan Kejurnas di Semarang yang lalu, saya turut mendampingi. Kalau saya tak bisa, bapaknya pasti ikut,” ujar Pasti.

Waspada/Agusdiansyah Hasibuan

CHRIST Ananda Silaen (foto), diapit kedua orang tuanya dengan trofi pemain Terbaik Piala Inalum 2012.

Selain mengawal putranya bertanding, ibu Ipda Johan Christy Silaen dan Anastasia Cristie Silaen ini juga turut menjaga stamina Nanda dengan memberikan nutrisi seimbang setiap minggunya. “Dengan prestasinya dalam turnamen ini rasanya kaca lemari yang pecah, vas bunga, dan pajangan dari kaca lainnya dapat terobati. Saya akan tetap mendukung apapun keinginan-

nya yang positif, apalagi olahraga,” kata Pasti. Jonni Silaen tetap membatasi Ananda untuk masuk dalam salah satu klub secara permanen, karena masih berstatus siswa kelas II. “Saya mau Ananda menyelesaikan sekolah dulu. Nanti sudah tamat, baru terserah dia mau masuk klub pilihannya,” kata Jonni. (c05)

Senin, 13 Februari (GMT) Sociedad vs Sevilla 20:00 *tvOne live pkl 03:00 WIB

Minggu, 12 Februari Espanyol vs Zaragoza

0-2

Sabtu, 11 Februari Real Betis vs Bilbao Osasuna vs Barcelona Santander vs Atletico

2-1 3-2 0-0

Klasemen La Liga

AP

TRIO Barca Lionel Messi, Alexis Sanchez dan Sergi Roberto (kanan ke kiri) tertunduk di markas Osasuna, Stadion Reyno de Navarra, Pamplona, Minggu (12/2) dinihari WIB. permainan tiki tika El Blaugrana nyaris tak berkembang. Penyerang Dejan Lekic membawa tim tuan rumah unggul cepat menit keempat. Lekic menggandakan keunggulan tuan rumah menit 22, skor 2-0 bertahan hingga turun minum. Winger Chile Alexis Sanchez sempat menghidupkan harapan tim tamu dengan golnya menit 51, tapi Raul Garcia segera memulihkan kemenangan anakanak Pamplona menit 56. Cristian Tello menyarangkan gol kedua Barca menit 73, tapi setelah itu tidak ada lagi tambahan gol yang tercipta. El Catalan pun tetap tertinggal tujuh poin di bawah pemimpin klasemen Real Madrid, yang baru bertanding dinihari tadi melawan Levante di Santiago Bernabeu. “Laga liga memasuki tahap yang lebih sulit saat ini. Saya kira kami akan menyaksikan selisih itu akan semakin besar,” ujar

Guardiola, yang menilai El Real bakal menambah poin dari kedatangan Levante. Liga Champions Hanya saja Guardiola ingin Lionel Messi cs segera melupakan duka ganda di Pamplona sekaligus fokus lagi ke laga berikutnya. Barca akan menjamu Valencia pada 19 Februati 2012, tapi sebelumnya mesti tandang

ke markas Bayer Leverkusen untuk laga leg pertama babak 16 besar Liga Champions, Selasa (14/2) malam GMT. “Kami tidak boleh terlalu larut dalam kedukaan ini. Kami harus benar-benar mempersiapkan diri untuk partai berikutnya, supaya dapat menampilkan yang terbaik,” harap Guardiola melalui TribalFootball.

Real Madrid Barcelona Valencia Levante Espanyol Atl Madrid Osasuna Ath Bilbao Malaga Getafe Sevilla Real Betis Vallecano Mallorca Granada Sociedad Santander Villarreal S Gijon Zaragoza

21 18 1 2 71-19 55 22 14 6 2 63-16 48 21 10 7 4 31-22 37 21 9 5 7 27-25 32 22 9 5 8 25-26 32 22 8 7 7 31-27 31 22 7 10 5 26-35 31 22 7 9 6 34-30 30 21 8 4 9 25-31 28 21 7 6 8 22-27 27 21 6 8 7 22-24 26 22 8 2 12 25-31 26 21 7 4 10 25-32 25 21 6 7 8 18-25 25 21 7 4 10 16-28 25 21 6 6 9 23-30 24 22 4 11 7 18-26 23 21 5 8 8 20-29 23 21 5 4 12 20-39 19 22 3 6 13 18-38 15

“Kami akan bekerja keras untuk memenangkan laga berikutnya (lawan Leverkusen). Kami juga siap untuk mempertahankan gelar juara di Eropa,” tekad mantan kapten El Catalan tersebut. (m15/goal/tf/espn)

Ali Hatta Pimpin PSSI Batubara LIMAPULUH (Waspada): Ali Hatta (foto) terpilih secara aklamasi sebagai Ketua Pengcab PSSI Batubara melalui Musyawarah Cabang (Muscab) di Sei Suka, Kabupaten Batubara, Minggu (12/2). Muscab dihadiri Koordinator Wilayah Pengprov PSSI Sumut Eko Harianto dan DR Helmi ini, diikuti 19 dari 20 klub yang terdaftar di Pengcab PSSI Batubara. Meskipun pendaftaran balon ketua dibuka hingga 10

Februari lalu, yang daftar hanya Ali Hatta. Hingga proses pencalonan, nama Ali Hatta didukung 15 dari 19 suara yang menghadiri Muscab. Dia secara aklamasi akhirnya ditetapkan sebagai ketua terpilih periode 2012-2016. Kepada Waspada, Ali mengatakan akan melakukan pembaruan sesuai tupoksi yang ada dalam memimpin Pengcab PSSI kedepan, yakni memutar kompetisi dan turut mendo-

Waspada/Agusdiansyah Hasibuan

rong Liga Pelajar Indonesia. (c05)


Sport

A6

WASPADA Senin 13 Februari 2012

GOL kemenangan Manchester City ke gawang Aston Villa ditentukan oleh sepakan Joleon Lescott (6) di babak kedua saat kedua tim beradu di Villa Park, Minggu (12/2). -Reuters -

Senin, 13 Februari (GMT) Napoli vs Chievo 19:45 Siena vs AS Roma 19:45 *Indosiar live pkl 02:45 WIB

Minggu, 12 Februari Atalanta vs Lecce Catania vs Genoa Inter Milan vs Novara Parma vs Fiorentina Bologna vs Juventus

0-0 4-0 0-1 tunda tunda

Sabtu, 11 Februari Udinese vs AC Milan Cagliari vs Palermo

1-2 2-1

GELANDANG Novara Filippo Porcari (kiri) menjatuhkan bek Inter Cristian Chivu di Stadion San Siro, Milan, Minggu (12/2). -AP-

Inter Gagal Penuhi Janji

City Balik Bertahta LONDON (Waspada): Joleon Lescott mencetak gol yang menentukan kemenangan Manchester City 1-0 atas Aston Villa dalam lanjutan Liga Premier di Villa Park, Minggu (12/2). City kini mengoleksi 60 poin dan mengganti Manchester United yang memiliki 58 poin di puncak klasemen. Di partai ini, City turun dengan mengusung formasi 4-5-1. Bomber Sergio Aguero diplot sebagai ujung tombak tunggal. Sementara itu, barisan gelandang ditempati David Silva, James Milner, Adam Johnson, Gareth Barry, dan Nigel De Jong. Adapun, tuan rumah menggunakan skema 4-3-3 mengandalkan Emile Heskey, Robbie Keane, dan Darren Bent sebagai trio penyerang. Villa yang bermain di hadapan publiknya menciptakan peluang di menit 18. Stylian Petrov melepaskan umpan silang ke kotak terlarang disambut tandukan Richard Dunne yang masih mengarah tepat ke pelukan Joe Hart. Peluang terbaik City tercipta di menit 28. Adam Johnson melepaskan sepakan keras dari luar kotak 12 pas.

Sial, bola yang telah melewati Given masih dihadang tiang gawang. Di penghujung paruh pertama, City terus berupaya membongkar rapatnya pertahananVilla. Namun, TheVillans juga tak jarang membuat lini belakang City kerepotan melalui duet Heskey dan Bent. Gol Lescott tercipta pada menit 62. Dengan sundulan kepalanya, Gareth Barry mengirim bola hasil tendangan sudut James Milner ke depan gawang. Bola disambar Lescott dengan tendangan kaki kanan dan mengubah papan skor menjadi 0-1. Setelah kedudukan berubah menjadi 1-0 untuk City, Villa memperbaiki koordinasi lini belakang. Usaha ini membuat City semakin sulit menuntaskan serangan dengan eksekusi. Menit 83, Milner melepaskan umpan silang dengan

AP

DUET Stephan El Shaarawy (kanan) dan Maxi Lopez memupus ketergantungan Milan terhadap Zlatan Ibrahimovic.

Lopez-Shaarawy Ubah Rossoneri ROMA (Waspada): Allenatore AC Milan Massimiliano Allegri memuji duet striker Maxi Lopez dan Stephan El Shaarawy, yang masing-masing menyumbang satu gol saat menaklukkan Udinese 2-1 pada giornata 23 Liga Seri A. Lopez dan El Shaarawy sekaligus mengubah gaya main I Rossoneri, tanpa mesin golnya Zlatan Ibrahimovic yang sedang menjalani hukuman skorsing tiga partai karena pekan lalu menampar pemain Napoli. “Ketika tidak ada Ibrahimovic, pemain menampilkan karakteristik berbeda, seperti ditunjukkan malam ini (lawan Udinese). Maxi Lopez memberi kami motivasi dan telah melakukan pekerjaan besar,” ujar Allegri. “Saya tidak tahu apakah itu bisa menentukan. Tapi yang jelas dan yang terpenting, kini kami mesti berkonsentrasi pada partai melawan Juventus,” katanya lagi, seperti dikutip dari Goal, Minggu (12/2). Lopez yang dikontrak dari Catania bulan lalu setelah I Rossoneri gagal mendapatkan Carlos Tevez dari Manchester City, menyarangkan gol pertamanya bagi sang juara bertahan menit 77 untuk menawarkan gol kapten Udinese Antonio Di Natale menit 19. Bomber belia berdarah campuran Italia-Mesir, El Shaarawy, ikut andil dalam terciptanya gol Lopez di Stadion Friuli, Udines, Sabtu (Minggu WIB). El Shaarawy kemudian menentukan kemenangan tim tamu lewat golnya sendiri usai bekerjsama dengan Lopez menit 85. Milan dengan koleksi nilai 47 pun meraih keuntungan penuh untuk unggul dua poin dari Juventus, yang gagal melakoni laga tandang lawan Bologna, Minggu (12/2), akibat badai salju yang lagi melanda Italia dan Eropa. “Saya pikir kami memainkan laga yang bagus. Kami memulai dengan baik, tapi dihukum selama paruh pertama. Di babak kedua kami membaik, menunjukkan keberanian dan mengambil risiko lagi,” beber Allegri. Lopez sendiri mengaku, sumbangan golnya bagi Il Diavolo merupakan mimpi yang menjadi kenyataan. “Sebuah mimpi bagi saya untuk bisa mencetak gol bagi Milan, dan malam ini mimpi itu menjadi kenyataan,” ungkapnya. “Saya gembira untuk diri saya sendiri, tetapi di atas itu semua adalah bagi tim. Karena kami mendapatkan hasil ini setelah hasil beberapa laga yang kurang menguntungkan,” tambah bomber berumur 27 tahun asal Argentina tersebut. Lopez juga sadar, dirinya punya potongan rambut yang sama dengan tandemnya El Shaarawy. “Terpisah potongan rambut, saya memiliki banyak kesamaan dengan El Shaarawy. Dia pemain yang sedang belajar dan saya yakin dia akan menjadi harta karun bagi Milan,” ujarnya lagi. (m15/goal/tf)

Adam Johnson sebagai sasarannya. Namun, Carlos Cuellar berhasil lebih dulu menjangkau bola dan membuangnya. City kembali terancam ketika Cuellar mengarahkan bola hasil tendangan sudut ke tengah gawang Joe Hart pada menit 88. Beruntung bola melesat tipis di atas mistar gawang The Citizens. Meski tipis, hasil ini sudah cukup untuk City merebut tahta klasemen. Sebelumnya, West Bromwich Albion membuat lonjakan besar dengan membantai tuan rumah Wolverhampton Wanderers 5-1 di Molineux Stadium. Peter Odemwingie menjadi bintang kemenangan tim tamu dengan hatrik golnya menit 34, 77 dan 88.

Minggu, 12 Februari Aston Villa vs Man City Wolves vs West Brom

0-1 1-5

Sabtu, 11 Februari Blackburn vs QPR Bolton vs Wigan Everton vs Chelsea Fulham vs Stoke City Man United vs Liverpool Sunderland vs Arsenal Swansea vs Norwich Tottenham vs Newcastle

3-2 1-1 2-0 2-1 2-1 1-2 2-3 5-0

Dua gol West Brom lainnya disumbangkan Jonas Olsson menit 64 dan Keith Andrews menit 85. Satu-satunya gol hiburan tim tuan rumah dicetak Steven Fletcher pada injury time babak pertama. (m15/m33/ap)

Klasemen Liga Premier Man City Man United Tottenham Arsenal Chelsea Newcastle Liverpool Norwich Sunderland Everton Swansea Fulham Stoke City West Brom Aston Villa QPR Blackburn Wolves Bolton Wigan

25 19 3 3 64-19 25 18 4 3 61-25 25 16 5 4 49-25 25 13 4 8 48-35 25 12 7 6 44-31 25 12 6 7 36-36 25 10 9 6 29-23 25 9 8 8 37-41 25 9 6 10 34-26 25 9 6 10 26-27 25 7 9 9 28-32 25 7 9 9 31-36 25 8 6 11 24-38 25 8 5 12 29-35 25 6 10 9 29-34 25 5 6 14 27-44 25 5 6 14 37-56 25 5 6 14 28-49 25 6 2 17 29-51 25 4 7 14 23-50

60 58 53 43 43 42 39 35 33 33 30 30 30 29 28 21 21 21 20 19

R O M A (Waspada): Inter Milan gagal memenuhi janji bangkit dari keterpurukan, setelah kalah lagi (0-1) melawan tim papan terbawah Novara pada giornata 23 Liga Seri A, Minggu (12/2). Kekalahan kandang di Stadion San Siro itu sekaligus menambah panjang rentetan hasil buruk I Nerazzurri sepanjang 2012 ini. Sebelumnya Inter disingkirkan Napoli di Coppa Italia, ditekuk Lecce 1-0, ditahan Palermo 4-4 dan dibantai AS Roma 0-4 di Seri A. Karenanya sebelumnya menjamu Novara, allenatore Inter Claudio Ranieri menjanjikan skuadnya segera bangkit. “Para fans sebaiknya tetap tenang. Sebelum laga melawan Roma segalanya berlangsung baik, namun mereka mengalahkan kami,” ucapnya. “Saya akan menghapus seluruh kenangan laga melawan Roma dalam ingatan kami. Penampilan itu tak bisa dibayangkan, benar-benar gelap. Juga hasil gila 4-4 melawan Palermo sebelum itu,” tambah Ranieri melalui TribalFootball. Hasilnya, La Beneamata be-lum juga mampu meme-

nangkan laga. Kendati mendominasi duel melawan Novara, Diego Milito cs tak kuasa membobol gawang kiper Samir Ujkani. Justru gawang Inter yang dikawal kiper Julio Cesar yang berhasil dijebol striker Andrea Caracciolo menit 56, menuntaskan serangan Novara yang sangat minim. Playmaker Wesley Sneijder, gelandang Dejan Stankovic serta penyerang Diego Forlan, yang digadang-gadang Ranieri bakal menginspirasi kebangkitan Si Ular Raksasa, ternyata tak mampu mengangkat performa tim tuan rumah. “Kembalinya Forlan, Stankovic dan Sneijder, dorongan besar bagi kami. Khususnya Sneijder yang sedang dalam kondisi sangat baik, tentu dia akan dipertimbangkan,” tutur mantan pelatih Juventus, AS Roma, Chelsea dan Valencia tersebut. Sneijder dan Ricky Alvarez berada di belakang striker tunggal Milito. Stankovic komando di lapangan tengah, sedangkan Forlan masuk sebagai pemain pengganti bagi Andrea Poli. Semuanya gagal memenuhi janji kebangkitan yang dicanangkan Ranieri, bahkan ketika Novara tempur dengan 10 pe-

Klasemen Liga Seri A AC Milan 23 14 5 4 45-20 47 Juventus 21 12 9 0 33-13 45 Lazio 23 12 6 5 37-24 42 Udinese 23 12 5 6 34-22 41 Inter Milan 23 11 3 9 34-30 36 AS Roma 22 10 5 7 36-26 35 Napoli 22 7 10 5 36-24 31 Palermo 23 9 4 10 33-34 31 Cagliari 23 7 9 7 22-24 30 Genoa 22 9 3 10 31-42 30 Fiorentina 21 7 7 7 23-19 28 Parma 21 7 6 8 27-34 27 Chievo 22 7 6 9 19-28 27 Catania 21 6 9 6 27-29 27 Atalanta* 22 7 9 6 25-27 24 Bologna 21 5 7 9 18-26 22 Siena 21 4 8 9 21-22 20 Lecce 23 4 6 13 22-38 18 Cesena 22 4 4 14 15-34 16 Novara 23 3 7 13 20-42 16 *Atalanta minus 6 poin karena judi. main sejak menit 80 akibat diusirkan gelandang Ivan Radovanovic. “Mereka (Inter) tentu ingin sebuah hasil dan berusaha menyingkirkan rasa pesimis secepat mungkin. Tapi Novara juga butuh poin, kami main dengan keberanian dan konsentrasi,” klaim Emiliano Mondonico, pelatih Novara. (m15/m33/tf/espn)

Redknapp Nikmati Sukses Spurs Tepis Rumor Gantikan Capello LONDON ( Waspada): Harry Redknapp mengaku menikmati sukses Tottenham Hotspur, yang pesta gol membantai Newcastle United 5-0 pada matchday 25 Liga Premier. “Saat ini saya sedang fokus seutuhnya pada Tottenham. Saya tidak akan meninggalkan mereka dalam kesulitan, apalagi segala sesuatu berjalan dengan sangat baik,” tegas Redknapp, seperti dilansir ESPN, Minggu (12/2). Dia menyatakan demikian untuk menepis rumor akan melatih Timnas Inggris pasca ditinggal Fabio Capello. “Jika itu terjadi dan tawaran datang, Anda mesti mempertimbangkan hal-hal benar untuk dilakukan,” dalih Redknapp. “Mereka (Spurs) sudah bagian dari saya dan saya menikmati setiap menit di Tottenham.

Kami semua saling menghargai,” tambah mantan pelatih Portsmouth tersebut. Redknapp sangat difavoritkan menggantikan posisi Capello dalam persiapan The Three Lions mengarungi Euro 2012 di Polandia-Ukraina. Peluangnya jauh di atas caretaker Stuart Pearce, arsitek Arsenal Arsene Wenger, pelatih Newcastle Alan Pardew, bos WBA Roy Hodgson, dan entrenador Real Madrid Jose Mourinho. Namun ayah mantan gelandang Liverpool Jamie Redknapp itu, sedang berbunga-bunga dengan The Lilywhites, yang mantap menghuni peringkat tiga klasemen Liga Premier. “Kami hanya harus terus fokus pada partai berikutnya. Kami punya beberapa laga hebat dalam beberapa pekan mendatang,” pungkas Redknapp.

Alan Pardew, kandidat pelatih Inggris lainnya, ikut mendukung keputusan Redknapp. “Fans menginginkan Harry Redknapp bertahan, sungguh suasana luar biasa. Tentu ini harinya Spurs, kami akan mendapatkan hari kami dan kami masih punya banyak waktu,” ucapnya. Pelatih The Magpies itu juga memuji kekuatan Spurs, yang menggunduli pasukannya lima gol tanpa balas di White Hart Lane, Sabtu (Minggu WIB). “Harus diakui Tottenham sulit dibendung. Penampilan mereka seperti bermain untuk hiburan,” puji Pardew melalui Sky Sports. “Permainan antar lini dan pergerakan mereka merepotkan para pemain kami atau tim manapun juga. Emmanuel Adebayor dan Louis Saha sung-

AP

PELATIH Newcastle Alan Pardew mengakui kehebatan manajer Spur Harry Redknapp (kanan). guh sulit kami bendung malam ini,” katanya menambahkan. Adebayor merupakan motor kemenangan LondonWhites dengan sumbangan empat assist bagi dua gol Saha menit lima dan 19 serta gol Benout Assou-Ekotto menit empat dan

Niko Kranjcar menit 34. Mantan striker Arsenal, Real Madrid dan Manchester City itu melengkapi kegemilangannya dengan gol pamungkas yang dicetaknya ke gawang Newcastle menit 63. “ Kami tidak mengira bisa

kalah setelak ini. Dua gol cepat Tottenham, materi yang mereka miliki, kemampuan tim mereka luar biasa. Mereka sanggup bersaing dengan Manchester United dan Manchester City,” papar Pardew. (m15/rtr/espn/sky)


Sport

WASPADA Senin 13 Februari 2012

A7

Alves Kecewa Wasit LPI SURABAYA (Waspada): Pelatih Persebaya Surabaya Divaldo Alves meminta kepada PSSI agar laga-laga berikutnya dalam lanjutan kompetisi Liga Primer Indonesia (LPI) memakai wasit asing. “Di sisa musim kompetisi ini, PSSI jangan ragu menggunakan wasit asing. Meski tidak semua, tapi kehadiran wasit asing diharapkan mampu menjadi panutan bagi wasit lokal dan pemain,” ujarnya usai laga Perse-

baya kontra Persema Malang di Surabaya, Minggu (12/2). Dalam duel yang berakhir 0-0 itu, Divaldo Alves mengaku geram dan kecewa terhadap keputusan-keputusan wasit Sulistyoko asal Jakarta. Dia pun

mengklaim, Bajul Ijo layak mendapat dua hadiah penalti setelah pemainnya dilanggar lawan di kotak terlarang. “Feri Ariawan dua kali dilanggar, tapi wasit tidak bertindak malah hanya menonton saja. Wasit sepertinya takut bertanggungjawab atas penalti,” kecam Alves. Pelatih asal Portugal itu juga curiga ada oknum-oknum yang tidak ingin Persebaya menang. Dia mengaku, tidak hanya kali ini saja merasa dikerjai wasit,

SMeCK Tamu Istimewa The Lan SIGLI ( Waspada): Kubu suporter PSMS Medan, SMeCK Hooligan menjadi tamu istimewa bagi pendukung PSAP Sigli, Laskar Aneuk Nanggroe (The Lan), saat kedua tim melakoni laga lanjutan Indonesian Super League (ISL) di Stadion Kuta Asan, Sigli, Sabtu (11/2) lalu. Kedua kelompok suporter fanatik ini terlihat berdiri berdampingan dan saling bertukar kesempatan memberi dukungan kepada tim kesayangannya yang sedang berjuang merebut kemenangan. Sebelum pertandingan, SMeCK yang datang dari Kota Medan disambut penuh haru oleh ratusan pendukung PSAP di Sekretariat The Lan, lantai II Café Arena, Sigli. Dalam pertemuan sarat persahabatan itu, kedua suporter tersebut saling berjabat tangan

dan berpelukan layaknya pertemuan saudara sekandung yang lama berpisah. “Mereka merupakan tamu istimewa The Lan. Kami sangat bangga dan senang hati dapat menjamu SMeCK yang datang langsung ke Sigli untuk memberi semangat dan dukungan penuh kepada PSMS,” kata Sekjen The Lan, T Muklis Benzema, didampingi T Berry selaku ketua panitia penyambutan, Minggu (12/2). Penyambutan ini dilakukan untuk menepis isu yang berkembang, bahwa publik Pidie tidak menerima suporter tim tamu. Muklis menegaskan bahwa pihaknya sudah membuktikan bahwa SMeCK dan The Lan adalah saudara serta publik PSAP menerima kehadiran suporter tim lain yang datang. Ketua Panitia Tur ke Sigli dari SMeCK, Banni Gultom, me-

ngungkapkan pihaknya sangat senang dan bangga bisa berdampingan dalam memberi dukungan secara sportif dan tanpa gangguan dari publik PSAP lainnya. “Ini sekaligus menepis keraguan kami selama ini bahwa The Lan tidak bisa menerima suporter lain. Sekarang terbukti The Lan adalah suporter yang anti-kekerasan dan tentunya kami akan terus menjalin hubungan baik dengan mereka. Kami juga siap menerima The Lan di Medan,” paparnya menambahkan kedua kelompok suporter juga saling tukar cenderamata. (b10)

namun dalam laga melawan Persijap dan Persiba Bantul juga dibuat kesal karena keputusan pengadil lapangan. “Bukan tidak mungkin kami akan melaporkan kepada PSSI. Kami masih akan berdiskusi dengan manajemen dan melaporkannya resmi,” paparnya lagi. Saat menjamu Persema, keputusan wasit Sulistyoko sempat memantik emosi Bonek Mania, julukan suporter Persebaya. Lemparan botol dari hampir semua sudut tribun pun melayang ke arah lapangan. Bahkan pemain kedua tim terpancing emosinya. Gesekangesekan yang mengarah kepada pertengkaran mewarnai laga yang disaksikan sekitar 25 ribu suporter itu. Duel juga sempat terhenti tiga kali, masing-masing menit 55, 58, dan 60, karena kedua tim terlibat adu mulut. Asmuri, Manajer Persema, tak kalah geram karena lemparan botol itu akibat ketidaksiapan panitia pelaksana pertandingan dan tim keamanan. “Sebenarnya pertandingan sangat enak ditonton, tapi keributan yang terjadi sedikit mengganggu. Syukurlah pertandingan bisa selesai sampai 90 menit dan tidak ada kendala. Hal ini tidak akan terjadi kalau panitia pelaksana lebih siap,” tu-

Senin, 13 Februari Persibo Bantul vs Persija PSM vs PSMS Medan

Minggu, 12 Februari Persebaya vs Persema

0-0

Sabtu, 11 Februari Persijap vs Persiba Arema vs Bontang

1-0 batal

Klasemen Sementara IPL Semen Padang Persibo Persebaya Persiba Persema Persija Persiraja Arema Bontang FC PSM Makassar Persijap PSMS

8 4 4 0 15- 6 16 7 4 1 2 11- 6 13 8 4 1 3 8- 5 13 8 4 1 3 7- 6 13 7 3 2 2 11-10 11 8 2 4 2 13-13 10 9 2 4 3 10-12 10 6 2 2 2 9- 9 8 8 1 4 3 5- 8 7 5 1 3 1 5- 6 6 6 1 2 3 4-10 5 6 1 0 5 5-12 3

turnya. Sedangkan Pelatih Persema Slave Radovski enggan berkomentar lebih jauh tentang kepemimpinan wasit. Menurut dia, bagus atau tidaknya wasit bukan dinilai dari berapa kartu yang dikeluarkan saat pemain berseteru. (m15/ant/ipl)

PT Inalum Paritohan Gelar Turnamen Voli KISARAN (Waspada): Menyambut HUT ke-36, PT Inalum Paritohan menggelar turnamen bola voli antarklub di sembilan kecamatan di Asahan dan Simalungun pada 31 Januari4 Februari lalu. “Pertandingan ini dibagi dalam lima rayon diikuti oleh sembilan kecamatan. Kegiatan ini juga ajang pembinaan atlet voli di sekitar jalur 275 KV Tranmisi Line PT Inalum,” ujar Manajer Humas PT Inalum Paritohan Ir Bambang Guritno, Minggu (12/2). Didampingi Koordinator Turnamen H Abdul Hakim, dia

Waspada/Sapriadi

WAKIL Ketua Pelaksana Yamaha Corsa RPM Gemilang Speed Promo Road Race seri II, Hery Koces, foto bersama juara MP5 bebek 4 tak standar 125 cc pemula), Minggu (12/2)

Road Race Kisaran Sukses Yamaha Corsa RPM KISARAN (Waspada): Yamaha Corsa RPM Gemilang Speed Promo Road Race seri II sukses dilaksanakan di Sirkuit Terminal Madya, Kisaran, Minggu (12/2). Kali ini, tuan rumah meraih tiga juara di peringkat lima dan empat. Event ini terbagi dalam delapan kelas meliputi MP1 (bebek 4 tak tune up 125 cc terbuka) yang dijuarai Agung Febri Ramdhan (Medan), sementara MP2 bebek 4 tak tune up 110 cc terbuka didominasi M Reza Ogex (Aceh). Kelas MP3 bebek 4 tak tune up 125 cc pemula dijuarai M Irvansyah Putra BB (Medan), sedangkan MP4 bebek 4 tak tune up 110 cc pemula dimenangkan Zefri Adi (Medan). Pada MP5 bebek 4 tak standar 125 cc pemula, juara pertama diraih M Ikram (Aceh) dan gelar juara MP6 bebek 4 tak standar 110 cc pemula direbut Zamed Pranata (Medan).

Khusus nomor ini, Aidil Mukhtar Siregar dan Bang Midi asal Kisaran menduduki posisi empat dan lima. Kelas Skuter Matic Satandart 130 cc pemula didominasi Afrizal Doni (T Tinggi) dan Budi (Kisaran) menempati posisi lima.Terakhir, kelas Jupiter MX STD 135 cc terbuka dijuarai Reza Fahlevi (Aceh) dengan Bang Midi harus puas pada urutan lima. Wakil Ketua Pelaksana Yamaha Corsa RPM Gemilang Speed Promo Road Race seri II, Hery Koces, mengatakan kegiatan itu salah satu ajang pembinaan bakat bagi pebalap agar bisa mengasah bakatnya untuk tampil lebih baik. “Alhamdulillah kegiatan berjalan lancar. Sekali lagi selamat bagi pemenang, semoga bisa mempertahankan dan tampil lebih baik demi menuju kejuaraan nasional,” ujar Hery. (a15)

15 Atlet Tembak Sumut Lulus Ujian Sertifikasi Perbakin Sumut

mengatakan, turnamen voli tahunan ini untuk mendukung program pemerintah dalam memasyarakatkan olahraga dan mengolahragakan masyarakat. Juga sarana interaksi perusahaan dengan masyarakat di sekitar lintasan jaringan tersebut. “Kegiatan ini disambut dan didukung masyarakat setempat. Bagi empat tim terbaik setiap rayon, kita berikan trofi dan uang pembinaan, sehingga bola voli terus eksis dan melahirkan atlet andal mengharumkan wilayah masing-masing,” beber Bambang. (a15)

Waspada/ist

MANAJER Humas PT Inalum Paritohan Ir Bambang Guritno didampingi Koordinato Turnamen Voli H Abdul Hakim dan Kapolsek Bandarpulo AKP Muslim Jaya foto bersama pemain baru-baru ini.

Waspada/Setia Budi Siregar

PEMAIN PS Kwarta (atas) dan Perskas Subulussalam foto bersama sebelum pertandingan di lapangan TD Pardede, Minggu (12/2).

PS Kwarta Juara Grup II Divisi II MEDAN ( Waspada): PS Kwarta menduduki posisi teratas, namun Perskas Subulussalam tidak terkalahkan dalam Grup II Divisi II Liga Amatir Indonesia di lapangan TD Pardede, Minggu (12/2). Dalam pertandingan terakhir, kedua tim membagi angka 1-1. Di laga lain, PSSD Dairi mengung-guli PS Serdang Bedagai (Ser-gai) 3-2. Kwarta dan Perskas, sudah memastikan lolos dari grup, menampilkan permainan ngotot di lapangan licin akibat hujan. Kwarta unggul pada menit 28 melalui Wisnu hasil umpan matang Indra Kembar Wungsu. Kemelut di depan gawang Perskas yang dikawal Rayali dimanfaatkan Wisnu dalam kondisi tidak terkawal melalui heading. Dalam laga ini, Perskas yang ditangani pelatih Legirin

menurunkan pemain lapis kedua dan menginstirahatkan striker andalan mereka yang telah mengoleksi tiga gol, Muksim Padang. Tertinggal satu gol, skuad Perskas yang turut disaksikan Sekda Kota Subulussalam yang juga Ketua Umum Pengcab PSSI setempat Damhuri SPd, berupaya menyamakan kedudukan. Namun Kwarta unggul dalam penguasaan bola dan memimpin babak pertama. Memasuki 45 menit kedua, Kwarta binaan Adrian Ahmad Gho dan M Arif Fadillah (Manajer Tim) konsisten menyerang. Perskas pun sempat kedodoran dan terpaksa melakukan rotasi pemain dengan memasukkan penjaga gawang Azwan dan Muksim Padang. Permainan Perskas mulai berkembang memasuki 20

menit terakhir. Melalui serangan balik, Ikhwan Arisandi langsung melepaskan tendangan keras melambung yang sulit dijangkau Jefri Setiawan di bawah mistar Kwarta. Gol Ikhwan spontan menambah kepercayaan diri tim asal Aceh ini. Namun kedua tim harus puas berbagi angka di penghujung laga. Dengan demikian, Kwarta menjuarai grup II dengan nilai 11 dari tiga kemenangan, dua seri, dan sekali kalah. Perskas berada di posisi runner-up dengan 10 poin hasil dua kemenangan dan empat seri. Sebelumnya, gol Supriadi pada menit 89 membawa PSSD Dairi unggul 3-2 atas Sergai yang mencetak gol melalui Dwi Cahyo dan Imam. Dua gol lain cetakan PSSD disumbangkan Dedi dan Joko. (m18)

MEDAN (Waspada): Sekira 15 atlet tembak reaksi Sumut lulus ujian sertifikasi di Lapangan Tembak Anugerah, Perumahan Cemara Asri Medan pada Jumat dan Sabtu (10-11/2). Sukses ini semakin membuka peluang penembak Sumut mengikuti berbagai kejuaraan di tingkat nasional maupun internasional. Selain itu, dengan sertifikasi tersebut, maka pengurus bidang tembak reaksi akan lebih mudah dibentuk. Menurut pemateri ujian dari PB Perbakin, Beni Sutanandika, untuk membuka bidang tembak reaksi harus memiliki setidaknya atlet bersertifikasi dilengkapi minimal tiga officer. “Hasil dari ujian sertifikasi ini cukup bagus. Kemampuan atlet tembak reaksi Sumut terlihat merata. Ini sangat baik karena akan menghadirkan persaingan sehat di antara atlet,” ujar Beni, Minggu (12/2). Menurut Beni, kelulusan ini merupakan bagian dari hasil pelatihan atlet pada November lalu. Beni mengatakan hasil itu terlihat jelas dengan kemampuan saat ujian berlangsung sekaligus

mengakui perkembangan cepat di wilayah Sumut. “Itu artinya, Sumut memang memiliki atletatlet berpotensi. Dilihat dari hasil ujian, yang diperlukan hanya meningkatkan volume latihan saja,” papar Beni. Ketua Harian Pengprov Perbakin Sumut, Musa Idishah, menyambut gembira hasil lulusnya atlet tembak Sumut. Terlebih lagi, tidak ada atlet didiskualifikasi selama penataran dan ujian, sehingga atlet Sumut benar-benar memahami aturan dan tata cara menggunakan senjata. Atlet Sumut, Wilson Hariyanto, mengaku ujian sertifikasi ini jelas menjadi picuan tersendiri bagi atlet untuk mendulang prestasi demi prestasi. Dikatakan, sertifikasi ini membuka lebar kesempatan atlet bertanding di nomor tembak reaksi. “Ini sangat baik untuk perkembangan olahraga menembak di Sumut. Terbukti, kami sebagai atlet mendapat banyak pelajaran tentang teknik menembak maupun peraturan dan pemahaman menggunakan senjata api,” kata Wilson. (m47)

Motivasi Berolahraga Jalan Santai 100 Tahun Bumi Putra MEDAN (Waspada): Ribuan peserta mengikuti olahraga jalan santai dalam rangka memeriahkan HUT Asuransi Jiwa Bersama (AJB) Bumi Putera 1912 ke-100 di Kota Medan, Minggu (12/2) pagi. Peserta yang mengambil start dan finish di depan Kantor AJB Bumi Putera, Jl Iskandar Muda Medan, dilepas langsung KepalaWilayah AJB Bumi Putera 1912 Sumut-Aceh, H Masnawi BS. Ruas jalan yang dilintasi adalah Jl Abdullah Lubis, Pattimura, Sudirman, Diponegoro, Zainul Arifin, S Parman, Hayam

Wuruk, dan kembali lagi ke Jl Iskandar Muda untuk berkumpul di pelataran kantor mengikuti pengundian lucky draw. “Kegiatan ini diharapkan menjadi motivasi kepada masyarakat untuk gemar berolahraga dalam menjaga kebugaran dan kesehatan,” ujar Kepala Wilayah AJB Bumi Putera 1912 Sumut-Aceh, H Musnawi BS, didampingi Kepala Cabang Asuransi Kumpulan Medan, Hairudin Harun. Selain jalan santai, pihaknya juga mengadakan acara donor darah, sedekah nasional, dan memberi bantuan 100 judul

Problem Catur Jawaban di halaman A2 8

7

6

5

4

3

2

1 B

C

D

E

buku kepada Perpustakaan Daerah Sumut. “Semoga itu bermanfaat bagi masyarakat yang telah turut mendukung eksistensi perusahaan,” katanya.

TTS TOPIK

Putih melangkah, mematikan lawannya dua langkah.

A

Waspada/Dedi Riono

RIBUAN peserta jalan santai HUT AJB Bumi Putera 1912 ke-100 dilepas Kepala Wilayah AJB Bumi Putera 1912 Sumut-Aceh, H Hasnawi BS, Minggu (12/2).

F

G

H

“AJB Bumi Putera merupakan perusahaan yang didirikan putra pribumi dan kini menjadi perusahaan raksasa di Indonesia. Komitmen kami

UMUM SERBA “POL”

ingin terus menjadikan perusahaan ini sebagai kebanggaan masyarakat Indonesia,” tekad Musnawi. (m42)

Mendatar

4. Mempunyai wawasan dan pengetahuan yang luas; Terjadi dari orang-orang atau unsurunsur yang berasal dari pelbagai bagian dunia. 7. Tulis dari belakang: tanda pangkat pada tentara yang dipasang pada bahu baju. (Baca dari depan berarti tayangan berupa tulisan di layar televisi, berupa imbauan, pengumuman, teks terjemahan dsb). 8. Negara republik di Eropa Tengah berbatasan dengan Jerman dan Ceko. 9. Jabatan tertinggi polisi. 12. Sistem; Corak batik atau tenun. 13. Radang zat kelabu sumsum tulang belakang, pada umumnya menyerang anak-anak (Kata pol sudah ditulis dalam satu kotak). 14. Raja Thailand _____ Adulyadej, kelahiran Amerika, disebut juga sebagai Raja Rama IX. 15. Kota di Libya. 17. Roman _____, sutradara terkenal filem Rosemary’s Baby dan Chinatown yang istrinya, Sharon Tate, dibunuh anggota Manson Family. 18. Penduduk metropolis, kota yang menjadi pusat kegiatan tertentu, baik pemerintah maupun industri dan perdagangan.

Menurun

1. Hal-hal yang bersangkutan dengan pengajaran keterampilan dan ilmu-ilmu terapan. 2. Tumor bertangkai yang melekat pada selaput lendir pada hidung. 3. Ibukota negara bagian Indiana, kota ke-12 terbesar di Amerika Serikat. 5. Permainan bola kecil dengan berkuda dan menggunakan pemukul dari kayu panjang. 6. Tulis dari bawah: tahanan politik (singkatan). 8. Bagian dari partai komunis yang mengurus dan memutuskan masalah politik. 10. Bintang di atas belahan bumi utara yang lurus searah dengan poros bumi. 11. Dibelah (Bugis): Alosi ___ Dua artinya pinang ____ dua (dua huruf pertama sudah ditulis dalam satu kotak). 12. Grup kepulauan melebihi 1000 pulau yang tersebar di Samudera Pasifik. 13. Singkatan Polisi Khusus Kereta Api (Huruf pol sudah ditulis dalam satu kotak). 16. Bersangkutan dengan kutub bumi atau kutub magnet, dari bahasa Inggris polar.

Sudoku Isi kotak kosong dengan angka 1 sampai 9. Tidak boleh ada pengulangan angka mendatar, menurun, maupun di dalam kotak 3x3 bergaris tebal. Tingkat kesulitan: sangat mudah (*), bisa diselesaikan dalam waktu lima menit. Jawabannya di halaman A2 kolom 1.

3 7 2 8 9 5 3 1 8 7 2 5 4 6 2 4 1 8 3 5 9 4 5 8 7 3 9 2 8 6 5 9 1 6 5 2 7 4 6 5 3 4 1 9 1 *219


Sport

A8

WASPADA Senin 13 Februari 2012

Clippers Persulit Laju Bobcats CHARLOTTE, AS (Waspada): Kemenangan Los Angeles Clippers saat dijamu Charlotte Bobcats dalam lanjutan kompetisi NBA di Arena Time Warner Cable, Minggu (12/2), kian menghadirkan petaka bagi tuan rumah. Bintang Clippers yang juga starter NBA All Star Wilayah Barat, Blake Griffin, tampil memukau dan mencetak 21 poin 10 rebound dalam kemenangan 111-86 tersebut. Rekan setimnay yang juga menjadi pemain inti All Star, Chris Paul, mendulang 18 angka 14 assist. Dominasi Clippers memang terlihat dalam pertandingan tersebut, di mana hal itu terbukti bukan hanya Griffin dan Paul saja yang menyumbang poin, melainkan pemain lainnya juga turut berperan. Caron Butler

AP

FORWARD LA Clippers, Blake Griffin, tampil produktif bagi timnya saat menang atas Charlotte Bobcats dalam laga NBA, Minggu (12/2).

FedEx Kalah, Swiss Tersisih

AP

FRIBOURG, Swiss (Waspada): Roger Federer (foto) harus menerima kenyataan pahit karena menelan dua kekalahan di ajang Piala Davis Grup Dunia di Fribourg, Sabtu (11/2) malam. Hasil ini membuat Swiss gagal akibat ditaklukkan Amerika Serikat 3-0. Federer, mantan pemain nomor satu dunia, dan Stanislas Wawrinka membutuhkan kemenangan untuk memelihara asa Swiss dalam mengejar ketertinggalan 0-2. Sayang, pasangan peraih medali emas Olimpiade

Beijing 2008 ini kalah 6-4, 3-6, 3-6, 3-6 dari Mardy Fish/Mike Bryan. Sebelumnya, baikWawrinka maupun Federer juga menyerah di sektor tunggal. Wawrinka kalah dari Fish 6-2, 4-6, 4-6, 61, 9-7, sedangkan Federer ditaklukkan John Isner 4-6, 6-3, 7-6 (4), 6-2. Dengan demikian, Federer harus menunggu tahun depan untuk mengakhiri penantiannya meraih gelar pertama di ajang Piala Davis. Juara bertahan Spanyol di bawah pimpinan kapten baru Alex Corretja mengikuti jejak AS ke perempatfinal. Melawan Kazakhstan, Negeri Matador menang 3-0 tanpa kehadiran Rafael Nadal dan David Ferrer. Runner-up tahun lalu, Argentina, dan Republik Ceko juga mendapatkan tiket babak delapan besar. Bila Argentina menyingkirkan Jerman 3-0, maka Rep Ceko juga menang dengan skor yang sama atas Italia. Di partai lain, tuan rumah Jepang untuk pertama kalinya tampil lagi di Grup Dunia setelah 26 tahun. Sayang, Kei Nishikori cs dikalahkan Kroasia 2-3. Kondisi berbeda dialami Australia yang menang telak

5-0 atas China. Selanjutnya, Australia bertemu Korea Selatan untuk penentuan laga playoff Grup Dunia. (m33/ap)

menyarangkan 16 poin, Randy Foye 12 angka, dan DeAndre Jordan 11 poin. Atas kemenangan ini, Clippers meraih kemenangan keempat dari lima laga away terakhirnya. Sementara itu, hasil ini membuat Bobcats menelan 14 kekalahan beruntun dan terpuruk di posisi terbawah klasemen Wilayah Timur. Di Dallas, Dirk Nowitzki tampil apik untuk membawa Mavericks mengandaskan perlawanan Portland Trailblazers 97-94 lewat dua kali overtime.

Permainan berjalan sengit dan kejar-kejaran poin terus terjadi sepanjang laga, khususnya di kuarter empat. Sementara itu, dongeng Jeremy Lin terus berlanjut. Pebasket berdarah China itu kembali mencuri perhatian setelah memimpin New York Knicks mengalahkan Minnesota Timberwolves 100-98.

Tampil tanpa Carmelo Anthony dan Amare Stoudemire, Lin memimpin Knicks dengan torehan 20 angka dan delapan assist. Namun, cerita indah sesungguhan bagi Lin terjadi sehari sebelumnya kala Knicks mengalahkan LA Lakers 92-85. Melawan Lakers, Lin secara mengejutkan membukukan 38 angka dan meredam kebinta-

ngan Kobe Bryant. Laga lainnya, San Antonio Spurs membungkam New Jersey Nets 103-89, Denver Nuggets menang atas Indiana Pacers 113-109, Cleveland Cavaliers dikalahkan Philadelphia 76ers 84-99, Orlando Magic menyihir Milwaukee Bucks 99-94, dan Phoenix Suns mengungguli Sacramento Kings 98-84. (m33/ap)


WASPADA Senin 13 Februari 2012

Medan Metropolitan

Buku Biografi Syekh HM Arsyad Thalib Lubis Diluncurkan

Ulama Yang Disegani Tokoh Agama Lain MEDAN (Waspada): Buku biografi tokoh Islam Sumatera Utara, Syekh HM Arsyad Thalib Lubis diluncurkan di Aula Kampus Unversitas Islam Sumatera Utara (UISU) Al Manar Jln Bakti Medan, Sabtu (11/2). “Kejayaan dakwah, pendidikan dan kemajuan perubahan di negeri ini tidak bisa dipisahkan dari para ulama.Peranan mereka sangat besar dalam menegakkan kebenaran dan melahirkan masyarakat yang memiliki ilmu pengetahuan serta taat beragama,” kata Prof. H. M. Hasballah Thaib MA pada peluncuran buku biografi Syekh HM Arsyad Thalib Lubis berjudul “Pemikiran dan Karya Monumental”. Sebagai penulis buku itu, Hasballah mengatakan, dengan menelusuri sisi kehidupan HM Arsyad Thalib Lubis dan para ulama lainnya, umat Islam bisa memahami kepribadian mereka dan mendorong semangat untuk mengikuti dan mencontoh jejaknya. Syekh HM Arsyad Thalib Lubis (1908-1972 M) merupakan seorang ulama terkemuka di Sumatera Utara. Lahir dan dibesarkan di lingkungan keluarga yang taat beragama dan mencintai ilmu pengetahun. Hampir seluruh hidup beliau dihabiskan untuk kepentingan pendidikan dan dakwah Islam. Sebagai ulama ahli bidang syariah dan perbandingan agama, HM. Arsyad Thalib Lubis sangat disegani oleh kelompok misionaris dan tokoh agama lain. HM. Arsyad Thalib Lubis mendirikan Al-Washliyah bersama teman-temannya dengan tujuan dakwah. Dia juga merupakan pendiri Fakultas Syariah UISU. Tujuannya untuk melahirkan ulama dan intelektual muslim, sarjana yang berguna

B1

PEMBERITAHUAN Yang bertanda tangan dibawah ini H. Bambang Suheri. M, SH., MH., dan Nurdianto, SH, Para Advokat dan Penasehat Hukum dari Law Offices of Wahana Prawira, yang berkantor di Jalan Timor No.: 95/10-V Medan, dalam hal ini bertindak berdasarkan Surat Kuasa Khusus dari dan oleh karena itu, untuk dan atas nama serta kepentingan klien kami Abu Bakar Zen Zubaidi disebut juga Abu Bakar Zen, Alamat Jalan Deli Tua No. 40, Kelurahan Pandu Hilir, Kecamatan Medan Perjuangan, Kota Medan, dengan ini Memberitahukan kepada Instansi Pemerintahan Republik Indonesia, dan militer, maupun swasta serta seluruh khalayak ramai tentang hal-hal sebagai berikut : 1. Bahwa klien kami (ABU BAKAR ZEN ZUBAIDI disebut juga ABU BAKAR ZEN) hingga saat ini adalah selaku pemilik yang sah atas 1 (satu) pintu rumah beserta pertapakannya yang terletak di Jalan Kereta Api No. 18-B, Kelurahan Kesawan, Kecamatan Medan Barat, Kota Medan. 2. Bahwa adapun dasar kepemilikan dari “klien kami (Abu Bakar Zen Zubaidi disebut juga Abu Bakar Zen)” adalah berdasarkan Sertipikat Hak Milik No. 358/Kesawan, yang diterbitkan secara sah oleh Kantor Pertanahan Kotamadya Medan. 3. Bahwa berkaitan dengan adanya klaim dari Saudari Hafsah Salim Baswel disebut juga Hafsah Binti Salim Baswel yang menyatakan dirinya adalah selaku pemilik atas tanah dan bangunan yang terletak di Jalan Kereta Api No. 18-B, Kelurahan Kesawan, Kecamatan Medan Barat, Kota Medan, yaitu berdasarkan Berita Acara Eksekusi Pengosongan (Ontruiming) No : 19/Eks/481/Pdt.G/2002/PN-Mdn tanggal 22 Juli 2010, Jo. Penetapan No : 19/Eks/2009/481/Pdt.G/2002/PN-Mdn tanggal 30 April 2010, dengan ini dapat kami sampaikan bahwa : -

Berkaitan dengan status kepemilikan yang sah atas tanah dan bangunan yang terletak di Jalan Kereta Api No. 18-B, Kelurahan Kesawan, Kecamatan Medan Barat, Kota Medan, Klien kami (Abu Bakar Zen Zubaidi disebut juga Abu Bakar Zen) telah mengajukan gugatan Perlawanan yang telah terdaftar di Pengadilan Negeri Medan dengan Reg. No. 57/Pdt.G/2010/PN.Mdn, dan terhadap perkara tersebut telah diputus pada tingkat Pengadilan Tinggi Medan dengan putusannya Nomor : 95/PDT/2011/PT-MDN tanggal 28 Juni 2011 yang inti amar putusannya berbunyi sebagai berikut :

-

Mengabulkan Perlawanan Pelawan untuk sebagian. Menyatakan Pelawan adalah Pelawan yang benar. Menyatakan demi hukum objek perkara khususnya tanah berikut dengan bangunan rumah yang terletak di Jalan Kereta Api No. 18 B, Kelurahan Kesawan, Kecamatan Medan Barat, Kota Medan, adalah milik Pelawan (i.c. Abu Bakar Zen Zubaidi disebut juga Abu Bakar Zen) sebagaimana diuraikan dalam Sertifikat Hak Milik No. 358/Kesawan yang diterbitkan tanggal 24 Agustus 1999. Menyatakan tidak berkekuatan hukum serta tidak mempunyai kekuatan Eksekusi (Non Eksekutabel/ Penetapan Nomor : 19/Eks/2009/481/ Pdt.G/2002/PN-Mdn tanggal 01 Februari 2010). ……dst.

MENGADILI SENDIRI

-

Waspada/M.Ferdinan Sembiring

PROF. HM. Hasballah Thaib, MA saat memberi sambutan pada peluncuran buku biografi Syekh HM Arsyad Thalib Lubis di Kampus UISU Al Manar Jln. Karya Bakti Medan, Sabtu (11/2). bagi generasi mendatang. Aktivitasnya tidak terbatas pada satu golongan saja, tetapi meliputi seluruh lapisan masyarakat mulai dari muslimin, non muslim hingga ke Semenanjung. Sementara itu, Rektor UISU Dr Ir Mhd Asaad mengatakan, tidak ada tokoh di Sumut yang tidak kenal dengan almarhum Syekh HM Arsyad Thalib Lubis. Beliau banyak meninggalkan karyanya. Hal ini menjadi sebuah tantangan bagi UISU, sebab apakah Fakultas Agama Islam UISU di masa mendatang mampu

melahirkan alumni sekaliber HM ArsyadThalibLubis?“Banyakpara ulama Sumut ikut mendirikan UISU, tapi belum ditulis biografinya. Karena itu, kita berharap Prof DrHMHasballahThaib,MAterus menulis sisi kehidupan mereka untuk menjadi teladan bagi para dosen fakultas agama dan mahasiswa,” harapnya. Menurutnya, dengan membaca sisi-sisi kehidupan para ulama, umat Islam dapat melakukan introspeksi diri, apakah perbuatannya sudah benar atau menyimpang. Sedangkan Ketua MUI Kota

Medan Prof DR HM. Hatta mengatakan, Syekh HM Arsyad Thalib Lubis merupakan seorang ulama paripurna tawadhu’ menggunakan ilmu dan segala kemampuannya untuk berdakwah menyampaikan risalah di tengah-tengah umat di manapun berada. “Dia sangat disegani oleh tokoh-tokoh agama lain. Sulit mencari sosok ulama seperti dia yang berdakwah dengan lisan ke majelis-majelis taklim dan juga menulis berbagai buku dan kitab dalam bahasa Arab dan Melayu,” ujar Hatta.(m49)

4. Bahwa untuk itu diberitahukan kepada : a. Instansi-instansi Pemerintah dan militer serta pihak-pihak terkait lainnya, agar tidak memberikan bantuan atau tindakan lainnya yang berbentuk apapun, guna menjual, menyewa, mengalihkan dan atau memindahkan hak atas tanah dan bangunan yang terletak di Jalan Kereta Api No. 18-B, Kelurahan Kesawan, Kecamatan Medan Barat, Kota Medan, dengan hanya berdasarkan Berita Acara Eksekusi Pengosongan (Ontruiming) No : 19/Eks/481/Pdt.G/2002/PN-Mdn tanggal 22 Juli 2010, Jo. Penetapan No : 19/Eks/2009/481/Pdt.G/ 2002/ PN-Mdn tanggal 30 April 2010, oleh karena Penetapan Pengadilan Negeri tersebut telah dinyatakan tidak berkekuatan hukum serta tidak mempunyai kekuatan eksekusi oleh putusan Pengadilan Tinggi Medan dalam perkara Reg. No. 95/PDT/2011/PT-MDN tanggal 28 Juni 2011; b. Para Notaris/PPAT, Pihak Perbankan atau Pihak-pihak lainnya agar tidak membuat akte, perjanjian atau dokumen yang berupa menjual, menyewa, mengalihkan, menerima sebagai agunan atas tanah terperkara, yang terletak di Jalan Kereta Api No. 18-B, Kelurahan Kesawan, Kecamatan Medan Barat, Kota Medan, dengan tanpa adanya dokumen kepemilikan Sertipikat Hak Milik No. 358/Kesawan, dan tanpa seizin dari klien kami (Abu Bakar Zen Zubaidi disebut juga Abu Bakar Zen) ; c. Masyarakat luas tidak terbatas pada instansi-instansi Pemerintah maupun perusahaan-perusahaan swasta agar tidak melakukan kegiatan, tindakan pengrusakan bangunan, upaya atau transaksi dalam bentuk apapun terhadap tanah yang terletak di Jalan Kereta Api No. 18-B, Kelurahan Kesawan, Kecamatan Medan Barat, Kota Medan, yaitu sebagaimana tersebut dalam Sertipikat Hak Milik No. 358/ Kesawan, tanpa seizin dari klien kami (Abu Bakar Zen Zubaidi disebut juga Abu Bakar Zen) ; d. Satu dan lain hal guna menghindari tuntutan hukum klien kami baik secara Perdata maupun Pidana. Demikian Pemberitahuan ini untuk dimaklumi. Medan, 13 Pebruari 2012.

Abu Bakar Zen Zubaidi disebut juga Abu Bakar Zen Kuasa Hukumnya

Law Offices of Wahana Prawira, Dto

Dto

H. Bambang Suheri. M, SH., MH.

Nurdianto, SH.

Halaman Masjid Agung Jadi Ajang Bisnis Pendapatan Parkir Rp36 Juta Per Bulan, Disetor Hanya Rp9 Juta MEDAN (Waspada): Halaman Masjid Agung di Jln. Diponegoro Medan telah dijadikan ajang bisnis perparkiran oleh pihak yayasan masjid tersebut sejak 2010. Meski memberikan dampak positif, namun sistem pembagian hasil dari bisnis perparkiran tersebut dinilai banyak kejanggalan. Berdasarkan penelusuran Waspada selama sepekan terakhir, setiap hari, halaman Masjid Agung tersebut selalu dipenuhi kendaraan roda dua dan roda empat. Pemilik kendaraan roda dua tersebut umumnya pengunjung dan pekerja di pusat perbelanjaan Sun Plaza. Sedangkan pemilik kendaraan roda empat adalah pengunjung Sun Plaza atau warga yang hendak melaksanakan shalat di Masjid Agung. Kejanggalan yang ditemukan Waspada yakni sistem bagi hasil dari bisnis perparkiran tersebut terkesan tidak transparan. Buktinya, pendapatan dari parkir mobil dan sepedamotor tersebut bisa mencapai Rp36 juta per bulan. Anehnya, pemasukan ke kas Yayasan Masjid Agung hanya berkisar Rp8-9 juta per bulan. Sebagaimana diungkapkan Fahmi, seorang anggota remaja masjid yang menjadi juru parkir kepada Waspada, Minggu (12/ 2). Menurutnya, setiap hari sekitar 800 sepedamotor dan 200 mobil parkir di halaman Masjid Agung. Tarif parkir yang diberlakukan yakni Rp1000 untuk sepedamotor dan Rp2000 untuk mobil. “Kalau hari biasa, sekitar delapan blok karcis parkir habis. Kalau weekend atau hari libur, bisa sampai 10 blok. Satu blok berisi 100 lembar karcis parkir. Sedangkan parkir mobil tidak menggunakan karcis,” jelasnya. Fahmi mengatakan, pihaknya lebih mengutamakan parkir kendaraan bagi umat Islam yang hendak melaksanakan ibadah dan tidak dipaksakan untuk membayar retribusi. “Biasanya, umat Islam yang beribadah memberi seikhlas hati. Bahkan menurut kawan-kawan, sering memberi lebih,” katanya. Menurut Fahmi, banyak dampak positif dari kebijakan pemanfaatan halaman Masjid Agung menjadi lokasi parkir umum. Misalnya, semakin banyak jumlah jamaah yang beribadah di masjid tersebut. Sebab, banyak pengunjung Sun Plaza menyempatkan diri shalat

di Mesjid Agung. Sementara itu, Pelaksana Harian Yayasan Masjid Agung Drs. Suriyono mengatakan, kebijakan pemanfaatan halaman masjid menjadi lokasi parkir umum, sudah dilakukan sejak 2010, ketika yayasan dipimpin Prof Dr Abdullah Syah, MA. Kebijakan itu diteruskan ketua yayasan saat ini Prof Dr Bachtiar Fanani Lubis. Uang dari hasil parkir itu, menurut Suriyono, disetor ke kas yayasan sebagai infaq parkir. Kemudian jumlahnya diumumkan kepada seluruh jamaah setiap bulan melalui papan pengumuman yang berada di depan pintu masuk Masjid Agung. Suriyono menjelaskan, pendapatan dari lahan parkir itu berkisar Rp8-9 juta per bulan. Petugas parkir sebanyak 12 orang terdiri dari remaja masjid dan masyarakat setempat dengan pendapatan berkisar Rp40-50 ribu per hari. Berdasarkan pengakuan juru parkir dan Pelaksana Harian Yayasan Masjid Agung tersebut, maka ditemukan kejanggalan yakni selisih antara total pendapatan parkir dan pemasukan ke kas masjid tersebut. Jika dirata-ratakan jumlah sepedamotor yang parkir sebanyak 800 unit per hari dengan tarif Rp1.000, maka pendapatan yang diperoleh berkisar Rp800 ribu per hari atau Rp24 juta per bulan. Sedangkan mobil yang parkir rata-rata 200 unit per hari dengan tarif Rp2.000, maka diperoleh pendapatan Rp400 ribu per hari atau Rp12 juta per bulan. Jadi, total keseluruhan pendapatan dari bisnis parkir tersebut mencapai Rp36 juta per bulan. Sedangkan sistem bagi hasil dari bisnis perparkiran tersebut yakni infaq parkir sebagai pemasukan ke kas Yayasan Masjid Agung sebesar Rp9 juta per bulan. Kemudian honor untuk 12 petugas parkir masing-masing Rp50 ribu per hari, maka dikeluarkan biaya Rp600 ribu per hari atau Rp18 juta per bulan. Jadi total pengeluaran secara keseluruhan berkisar Rp27 juta per bulan. Jika dilihat pendapatan parkir sebesar Rp36 juta per bulan dan pengeluaran sebesar Rp27 juta per bulan, maka ditemukan selisih Rp9 juta per bulan. Namun belum diketahui secara pasti kemana uang sebesar Rp9 juta per bulan itu digunakan sejak tahun 2010. Rumah dinas Selain membiayai operasional masjid, Pelaksana HarianYayasan Masjid Agung Drs. Suriyono mengatakan, infaq dari parkir tersebut saat ini digunakan

Waspada/Hamdani

AJANG BISNIS : Sekitar seribuan sepedamotor terlihat parkir di halaman Masjid Agung Medan, Minggu (12/2). Sejak tahun 2010, halaman masjid tersebut telah menjadi ajang bisnis. Setiap masyarakat yang memakirkan sepedamotor di halaman Masjid Agung ini, dikenakan biaya Rp1.000. Bahkan pada hari libur dan Jumat, oknum juru parkir mengutip Rp2.000 per sepedamotor. yayasan untuk membangun sebuah rumah dinas bagi imam masjid di halaman sebelah kiri. “Dana pembangunan rumah itu berasal dari kas yayasan, bantuan Bank Sumut Syariah Rp5 juta, PTPN III Rp5 juta dan PDAM Tirtanadi Rp1 juta,” jelasnya. Dengan demikian, Masjid Agung memiliki aset dua unit rumah dinas imam, serta satu unit rumah dinas muazzin. Infaq parkir tersebut juga digunakan untuk merehab Taman Kanak-kanak (TK) milik yayasan, serta memperbaiki menara masjid yang mengalami kerusakan. Kontroversial Kebijakan kontroversial yang dikeluarkan Yayasan Masjid Agung adalah menggusur

umat Islam yang berprofesi sebagai pedagang kaki lima di halaman masjid tersebut. Sebagaimana diketahui, pedagang kaki lima ini sudah beroperasi sejak berpuluh-puluh tahun dan menggantungkan hidup mereka dari berjualan di halaman Masjid Agung. Anehnya, pihak yayasan memberikan izin untuk penyelenggaran acara Gebyar Perbankan Syariah yang berlangsung pada 10 – 12 Februari 2012di halaman Masjid Agung tersebut. Kebijakan kontroversial ini dinilai tidak berpihak kepada rakyat kecil dan hanya mengutamakan kepentingan pemilik uang dalam hal ini perbankan. Dengan demikian, orientasi bisnis yang sedang dipertontonkan pengurus Yayasan Masjid

Agung, telah mengorbankan umat Islam yang berprofesi sebagai pedagang kaki lima. Terkait penertiban pedagang kaki lima, Suriyono mengatakan, hal itu dilakukan untuk memaksimalkan halaman parkir agar tidak semrawut. Kebijakan itu merupakan hasil keputusan dalam rapat pengurus yayasan pada akhir 2011. Selama ini, pedagang kaki lima tersebut tidak pernah dipungut biaya sewa halaman Masjid Agung. Mereka hanya dikenakan biaya kebersihan, yang digunakan untuk membayar lembur petugas dan sekuriti. “Jadi uang kebersihan dari pedagang kaki lima itu tidak pernah masuk kas yayasan,” katanya. Setelah penertiban itu, kata

Suriyono, ke depan pihak yayasan hanya akan meminjamkan halaman masjid untuk kegiatan-kegiatan bernuansa Islami seperti acara Gebyar Perbankan Syariah yang dilaksanakan Asosiasi Bank Syariah Indonesia. Status Masjid Terkait status Mesjid Agung, Suriyono menjelaskan, masjid yang mulai dibangun sejak 1963 itu adalah milik umat dan dikelola Yayasan Masjid Agung yang dibentuk para pendiri masjid. “Jadi bukan aset pemerintah daerah,” katanya. Sekitar tahun 1994, pemda pernah membentuk badan untuk mengurus Masjid Agung. Namun hal itu ditolak para pendiri Masjid Agung seperti Barnang Pulungan dan Arifin Pulungan yang menyatakan

bahwa masjid tersebut tetap dikelola yayasan. “Karena itu, ketika Pak Syamsul Arifin coba membentuk sebuah badan pengelola Masjid Agung, kembali ditolak yayasan. Apalagi, proses pembubaran yayasan juga tidak segampang itu, harus ada putusan pengadilan,” katanya. Terakhir, Masjid Agung mendapat bantuan Pemprovsu sebesar Rp200 juta pada 2010. Bantuan tersebut digunakan untuk pengecatan masjid dan dikerjakan langsung oleh orang yang ditunjuk Pemprovsu. “Rencananya, pada 2012 ini kami mencoba minta bantuan lagi kepada Pemprovsu,” katanya. Duduk Bersama Secara terpisah,Wakil Ketua DPRDSU dari Fraksi Partai Ke-

adilan Sejahtera Sigit Purnomo Asri mengatakan, sebaiknya Pemprovsu dan Yayasan Mesjid Agung duduk bersama untuk membicarakan persoalan halaman masjid tersebut. “Karena tidak enak juga, kalau orang yang masuk ke halaman masjid ternyata bukan umat Islam yang datang untuk beribadah. Tapi cuma untuk keperluan berbelanja ke pusat perbelanjaan yang ada di belakang Masjid Agung,” katanya. Selain itu, tambah Sigit, selama masih menyangkut ketertiban umum, maka Pemprovsu berhak ikut campur dalam mengurus Masjid Agung. “Yang pasti, Pemprovsu dan pihak yayasan sama-sama ingin berbuat yang terbaik untuk kepentingan umat,” demikian Sigit.(m48)


Medan Metropolitan

B2

Mengenang TD Pardede

Indonesia Butuh Orang Punya Semangat Dan Visioner MEDAN (Waspada): Suatu negara dapat bangkit dari keterpurukan, jika negara tersebut dipenuhi orang-orang yang memiliki semangat untuk maju.

“Banyak yang beranggapan bangsa yang maju karena bangsa tersebut kaya, anggapan ini bisa benar dan bisa tidak. Tapi yang pasti, tidak ada bangsa yang maju kalau tidak ada orang-orang yang bersemangat untuk maju,” kata mantanWakil

Pengemudi Betor Harus Sabar MEDAN (Waspada): Masyarakat harus tetap optimis dengan masalah yang sedang terjadi saat ini. Terutama yang sedang dialami para pengemudi becak bermotor yang ada di Kota Medan terkait masalah pajak dan pembatasan jalur dalam beroperasi. “Memang ada dua kali saya catat para pengemudi becak melakukan demo terkait masalah kejelasan pembayaran pajak,” kata Wakil Ketua DPRDSU Sigit Pramono Asri, SE di hadapan puluhan pengemudi becak bermotor saat melakukan reses di aula Kantor Lurah Kota Matsum 2, Sabtu (2/11). Yang menjadi pokok penting bagi pengemudi betor adalah masalah jalur serta kepastian dalam membayar pajak, kemudian lembaga atau yayasan yang menaungi betor ini juga belum memperlihatkan tanggungjawab atas kewajibannya. “Mereka mau membayar pajak, tapi justru terhambat karena belum optimalnya para pengelola lembaga-lembaga yang menaungi para pengemudi betor itu,” ujar Sigit sembari menambahkan dirinya akan meminta Komisi C segera memanggil lembaga yang menaungi para pengemudi betor itu sehingga masalah ini bisa cepat selesai.(rel)

Presiden RI Jusuf Kalla (JK) saat peluncuran buku ‘Ayahku Inspirasiku’ Mengenang Seorang Ayah TD. Pardede karya Mariska Lubis, di Convention Hotel Danau Toba, Jumat (10/2) malam. Selain memiliki semangat untuk bangkit, lanjut Jusuf Kalla, negara juga harus memiliki sang visioner yang bertindak, berbicara serta berpikir jauh ke depan. “Untuk menjadi sang visioner harus banyak menghadapi resiko. Dulu, orang yang visioner dianggap gila, karena apa yang dilakukannya dinilai tidak mungkinbisadilakukan,”ujarnya. JK menilai, sosok TD. Pardede mempunyai semangat yang tinggi, visioner, inspiratif, dan inovatif wajib dijadikan contoh oleh pengusaha-pengusaha Indonesia. “Saat ini kita rindu dengan tokoh-tokoh seperti beliau, sang visioner yang berbicara bertindak dan berpikir jauh kedepan. Maka dari itu, pemikiran-pemikiran TD Pardede patut kita puji dan hargai,” sebutnya. Ditambahkan JK, saat ini muncul ketidakseimbangan dan ketidakharmonisasian an-

tara pengusaha di Medan, sehingga akan muncul celahcelah perpecahan yang hebat. “Jagalah harmonisasi itu, dan jadilah pengusaha yang menambah pendapatan daerah, keseimbangan dan kebanggaan masyarakat Medan,” tuturnya. Sementara itu, Plt Gubsu Gatot Pujo Nugroho berharap akan muncul TD Pardede - TD Pardede baru di Sumut. “Buku ini tidak ada arti kalau tidak pernah kita baca, tidak ada arti kalau kita tidak pernah menapaktilasi. Kita berharap, buku ini menjadi inspirasi anak-anak muda, sehingga lahir TD. Pardede baru,” katanya. Wali kota Medan Rahudman Harahap dalam sambutannya yang dibacakan Sekda Medan Syaiful Bahri mengatakan, banyak kenangan, keteladanan, suri teladan serta sepak terjang DR. TD. Pardede yang perlu ditiru untuk pembangunan masa yang akan datang. Pasalnya, beliau seorang wirausaha yang kuat, tangguh dan disegani. “Selain itu, beliau adalah sosok pejuang kemerdekaan

dan pelopor pembangunan serta putra daerah yang membawa eksistensi kota Medan dan Sumut. Kedisiplinannya dalam bekerja patut kita contoh, sehingga bagi saya dia adalah guru dan ayah yang mendidik disiplin. Maka dengan ini, Pemko Medan memberikan apresiasi yang setinggi-tingginya,” ujarnya. Rahudman juga berharap, sepakterjang DR TD Pardede dapat menjadi panutan anakanak bangsa, dan keluarga dapat mencontoh apa yang dilakukannya. Pada kesempatan itu, Leo Nababan mewakili Menko Kesra mengatakan, Hotel Pardede adalah pertanda lambang ekonomi kerakyatan. Beliau bukan terkenal di dunia bisnis saja, tetapi seorang agamawan, olahraga, dan sang visioner. Hadir pada acara launching buku tersebut, yakni Plt Gubsu Gatot Pujo Nugroho, Jusuf Kalla, Tokoh Nasional Alwi Shihab, Meutya Hafid, Pangdam I/BB, Kapoldasu, unsur Muspida Sumut, DPRD Sumut dan Medan, penulis dan lainnya. (h02)

PORMIKI Gelar Seminar Dan Musda MEDAN ( Waspada): Dewan Pimpinan Daerah (DPD) Perhimpunan Organisasi Perekam Medis Informasi Kesehatan Indonesia (PORMIKI) Sumut menggelar seminar dan musyawarah daerah untuk pertama kalinya di Rumah Sakit Tk II Putri Hijau Kesdam I/BB, Sabtu (11/2). Hadir pada acara tersebut Ketua DPP PORMIKI Pusat Elise Garmelia. Dalam seminarnya, Elise Garmelia mengungkapkan tentang pentingnya peranan para profesional perekam medis dalam rangka meningkatkan mutu pelayanan kesehatan di fasilitas kesehatan, khususnya rumah sakit menuju akreditasi JCI (Joint Commission International). Sedangkan Ketua PORMIKI Sumut Prof. dr. Amri Amir, Sp.F, DFM, SH mengatakan, munculnya organisasi PORMIKI ini sejalan dengan perkembangan organisasi yang berwawasan kedokteran serta tenaga kesehatan lainnya dalam hukum kedokteran serta hukum kesehatan melalui Perhuki (Perhimpunan Hukum Kesehatan Indonesia). Menurut Prof. Amri, PORMIKI dan Perhuki berjalan beriringan sesuai visi dan misi dalam pengembangan berbagai pengetahuan tentang aspek hukum institusi pelayanan kesehatan dan aspekaspek lainnya seperti administrasi legal, finansial yang termuat dalam rekam medis. “Dengan adanya seminar dan Musda ini, kita harapkan muncul tenaga yang handal serta mampu mengelola sistem rekam medis dan informasi kesehatan secara profesional sesuai perkembangan ilmu pengetahuan untuk menuju akreditas JCI,” imbuhnya. Turut hadir pada acara tersebut Kepala Rumkit Tk II Putri Hijau Kol. CKM dr. Moch. Munif, perwakilan Dinkes Sumut, serta 315 orang perwakilan dari seluruh rumah sakit yang ada di Sumut. (h02)

Waspada/Ist

KETUA DPP PORMIKI Pusat Elise Garmelia (tengah) saat menerima ulos dari Ketua PORMIKI Sumut Prof. dr. Amri Amir, Sp.F, DFM, SH (kiri) usai acara seminar dan Musda di Rumah Sakit Tk II Putri Hijau Kesdam I/BB, Sabtu (11/2).

Waspada/Amir Syarifuddin

SEKDAPROVSU H Nurdin Lubis foto bersama Konsul Singapura Gavin Chay yang berkunjung ke Kantor Gubsu, Jumat (10/2).

Singapura Undang Gatot Pembicara Di Forum Dunia MEDAN (Waspada): Pemerintah Singapura mengundang Plt Gubsu H Gatot Pujo Nugroho, ST sebagai salah satu pembicara dalam acara World Cities SummitMayorsForumpadaawal Juli mendatang di Singapura. Undangan untuk menghadiri pertemuan yang sukses menarik 30 pemimpin daerah dari berbagai negara pada tahun lalu ini, secara resmi disampaikan Konsul Singapura Gavin Chay, di Kantor Gubsu, Jumat (10/2). Kehadiran Gavin Chay yang berkantor di Dumai, Riau diterima Sekretaris Daerah Provsu H Nurdin Lubis SH, MM, di ruang kerjanya. Gavin Chay dalam kesempatan tersebut menyerahkan undangan yang ditandatangani Menteri Negara Pembangunan Nasional, Perdagangan dan Industri Singapura Mr Lee Yi Shyan yang mengharapkan kehadiran Plt Gubsu H Gatot Pujo Nugroho, ST sekaligus sebagai salah satu pembicara dalam forum yang membahas praktik terbaik untuk tata kelola dan pembangunan perkotaan. Sekda Provsu Nurdin Lubis mengungkapkan terimakasih atas kesempatan dan keper-

cayaan Singapura, mengundang Gubernur Sumatera Utara sebagai salah satu panelis dalam forum yang diselenggarakan bersamaan dengan Singapore InternationalWaterWeektersebut. “Ini merupakan sebuah kepercayaan sekaligus peluang bagi Pemrovsu untuk mendapatkan informasi berharga berdasarkan pengalaman terbaik para pimpinan daerah dari berbagai penjuru dunia,” ujar Nurdin Lubis. Gavin Chay juga mengungkapkan keinginan pihaknya untuk membuka kembali kantor perwakilan Singapura di Kota Medan, setelah dipindahkan ke Riau beberapa tahun lalu. Dengan demikian kantor Konsulat Singapura di Medan menjadi yang ke tiga di Indonesia, setelah Riau dan Batam. Rencana tersebut didasari dengan pesatnya perkembangan volume perdagangan antara Sumatera Utara dan Singapura. Menurutnya, Sumatera Utara sangat potensial bagi Singapura, mengingat saat ini terdapat 32 investor asal Singapura yang menanamkan modalnya di Sumut. Lebih jauh lagi, prospek hubungan bisnis ke depan-

nya juga semakin terbuka luas dengan keberadaan proyek Masterplan Percepatan Perluasan Pembangunan Ekonomi Indonesia (MP3EI) koridor Sumatera, dengan berbagai proyek strategis di Sumatera Utara. Investor Singapura, menurutnya, akan sangat tertarik untuk dapat ambil bagian dalam Proyek MP3EI tersebut, di antaranya terkait industri hilir CPO yang akan dikelola dalam Kawasan Ekonomi Khusus (KEK) Semangke. World Cities Summit Mayors Forum merupakan acara tahunan yang diselenggarakan oleh Centre for Liveable City (CLC) Singapore, sebagai platform eksklusif dan internasional untuk para pimpinan daerah yang membahas praktik terbaik praktis untuk pembangunan perkotaan berkepadatan tinggi. Forum ini merupakan kesempatan bagi para pemimpin dari berbagai negara untuk membangun jaringan. Hadir juga dalam forum nantinya CEO lembaga publik Singapura, pimpinan berbagai organisasi internasional dan ahli perkotaan terkemuka.(m28)

WASPADA Senin 13 Februari 2012

Kantin Sekolah Akan Diwajibkan Miliki Sertifikat Halal MEDAN (Waspada): Kepala Dinas Pendidikan Kota Medan Dr Rajab Lubis mengatakan, dalam waktu dekat ini, seluruh sekolah akan diwajibkan memiliki sertifikat halal di kantin tempat jajanan siswa. Menurut Rajab, hal ini termasuk sebuah pendidikan kepada siswa untuk mengkonsumsi makanan yang halal dan aman. Sekolah, sebagai lembaga pendidikan, harus menjadi contoh. Makanan halal, erat kaitannya dengan kenyamanan mengkonsumsi dan manfaat yang akan dirasakan oleh anak selaku konsumen kantin di sekolah itu. “Dalam waktu dekat, akan ada pertemuan antara dinas pendidikan, badan ketahanan pangan, dinas kesehatan, pihak sekolah, dan MUI Kota Medan, untuk membahas tentang kantin sekolah terkait makanan yang dijual, apakah memenuhi standar kesehatan sekaligus memastikan kehalalannya,” katanya. Dia menyebutkan, idealnya jajanan atau makanan di kantin sekolah itu, harus bersih, sehat, tidak mengandung zat yang berbahaya, bahan pengawet dan pewarna yang merusak kesehatan. Untuk itu, kepala sekolah harus melakukan monitoring terhadap makanan yang dijual di sekolah maupun di lingkungan sekolah. “Akan ada penataan pedagang makanan di sekolah. Jika mereka berjualan di luar sekolah harus diberi ruang di halaman sekolah atau tempatnya disesuaikan, sehingga tidak ada pedagang yang tidak tetap, nyolonong begitu saja ke sekolah untuk berdagang. Seperti kasus siswa keracunan air nira di sekolah, setelah diselidiki ternyata pedagang itu baru pertamakali datang ke sekolah tersebut dan memberikan air nira secara gratis. Ini harus menjadi evaluasi oleh pihak sekolah,” kata

Rajab. Sementara itu, hasil pantauan di berbagai sekolah yang ada di Medan, Kamis (9/2), kantin atau tempat jajanan siswa di dalam lingkungan atau di luar sekolah, umumnya tidak mencantumkan label halal dengan sertifikat dari MUI pada tempat makanan yang mereka jual. Hal itu diakui Ketua MUI Prof HM Hatta yang mengatakan, sampai sekarang belum ada pihak kantin sekolah yang mengurus sertifikat halal ke Lembaga Penelitian Pengawasan Obat dan Makanan (LPPOM) MUI Medan. “Melalui Dinas Pendidikan Kota Medan, kita ingin ada kerjasama untuk memberikan sosialisasi dan pembinaan terhadap kantin sekolah agar menyediakan makanan yang halal serta mencantumkan sertifikat halalnya,” katanya sembari menyebutkan pihaknya siap menjadi fasilitator untuk sosialisasi ke sekolah terkait pengadaan sertifikat halal tersebut. Belum perlu Sedangkan guru agama SMPN 1 Tembung Ali Nurdin mengatakan, sertifikat halal di kantin sekolah belum diperlukan. Karena, makanan yang dijual umumnya adalah titipan dari pemasok makanan dari luar sekolah. Sementara pihak kantin hanya sebagai penjual dan mengambil sedikit keuntungan saja. Selain itu, kebanyakan yang mengelola kantin adalah muslim, sehingga dipercaya tidak akan memasukkan unsur haram ke dalam makanan, jika ada yang diolah sendiri. “Saya rasa belum perlu sertifikat halal untuk kantin sekolah. Saya pikir ini alasan pihak sekolah yang belum mengurus sertifikat halal ke MUI. Tetapi tetap diperlukan pengawasan secara berkala dari pihak dinas terkait ke sekolah, untuk memastikan apakah jajanan yang ada tidak terkontaminasi dengan yang membahayakan,” sebutnya. (m37)

Dikira Anggota Geng Kereta Kritis Dihajar Massa MEDAN ( Waspada): Maksud hati menghindari konvoi kelompok geng kereta, Julianes Tioputra, 18, warga Desa Helvetia, Kec. Labuhandeli, Deliserdang, kritis dihajar warga di Jalan Adam Malik, Kec. Medan Barat. Minggu (12/2) sekira pukul 01:00. Selanjutnya korban Julianes, pegawai perusahaan swasta, dibawa petugas Polsek Medan Barat ke Rumah Sakit Imelda Medan. Informasi yang diperoleh di kepolisian, malam itu korban bersama tiga temannya hendak menemui teman mereka anggota TNI yang bermukim di kawasan Jalan Sekata, Kel. Sei Agul. Namun, setelah beberapa jam mencari, orang yang hendak ditemui sudah pindah rumah. Karena gagal bertemu, korban dan temannya bermaksud pulang ke rumahnya. Saat keluar dari Jalan Sekata dan membelok ke Jalan Adam Malik, dari arah berlawanan tiba-tiba Julianes melihat puluhan anggota geng kereta sedang konvoi dari arah Jalan Adam Malik menuju Glugur Bypass dan Jalan Yos Sudarso. Takut akan kebrutalan massa geng kereta tersebut, Julianes dan dua lagi temannya

spontan berbalik arah untuk menghindar. Tapi, persis di Jalan Adam Malik dekat rel kereta api, ada sekelompok warga yang akan menghalau kelompok geng kereta melintas. Massa yang menduga korban dan dua temannya anggota kelompok geng kereta, langsung memukul Julianes dengan menggunakan kayu balok hingga korban terkapar, sedangkan sepedamotornya Jupiter MX ringsek. Melihat korban terkapar, ke dua temannya berbalik arah seketika menyelamatkan diri. Petugas Polsek Medan Barat yang melihat korban jadi sasaran amuk warga langsung mengevakuasinya ke Rumah Sakit Imelda, sedangkan sepedamotor korban terlihat ringsek akibat dipukuli dengan kayu balok. Kanit Reskrim Polsek Medan Barat AKP Anthoni Simamora menyebutkan, korban bukan kelompok geng kereta melainkan salah sasaran warga. “Selama ini, warga di Jalan Adam Malik sudah resah melihat aksi brutal geng kereta, sehingga mereka melakukan patroli untuk menghalau kalau ada konvoi geng kereta yang melintas. Warga menduga korban anggota geng kereta, padahal korban bermaksud menghindari aksi konvoi geng kereta tersebut,” sebutnya. (h04)

PMI Medan Denai Gelar Lomba Hafalan Takhtim MEDAN ( Waspada): Dalam rangka memperingati Hari Ulang Tahun (HUT) pertama Pimpinan Anak Cabang (PAC) Pemuda Muslimin Indonesia Kecamatan Medan Denai pada 5 Maret 2012, ormas berbasis Islam ini akan mengadakan perlombaan Hafalan Takhtim khusus bagi kaum ibu perwiridan dan kelompok bapak-bapak pengajian se-Kota Medan. Agenda ini dijadwalkan akan digelar pada Minggu, 4 Maret 2012 dan disusul perayaan HUT PMI sebagai acara puncak pada Senin, 5 Maret 2012. Perayaan puncak HUT PMI ini juga direncanakan akan diisi dengan perhelatan Tabligh Akbar di Lapangan Pusat Industri Kecil (PIK) Jalan Menteng VII, Kel. Menteng, Kec. Medan Denai. “Pendaftaran gratis, yang dimulai pada 1 hingga 25 Februari mendatang. Technical meeting akan dilaksanakan pada Minggu (26/ 2) mulai pukul 09:00, di kantor PAC PMI Denai Komplek Citra Menteng Jalan Menteng VII. Bagi ibu-ibu dan kaum bapak pengajian silahkan mendaftar,” kata Ketua PAC PMI Medan Denai Ahmad Fadhly didampingiWakil Ketua I M Hasan KSD, Sekretaris Ahmad Arifin, dan Ketua Pelaksana Aulia Rahman Harahap disaksikan jajaran pengurus PAC PMI Medan Denai kepada wartawan, Sabtu (11/2). Fadhly mengatakan, kegiatan ini digelar

untuk menunjukkan talenta dan nilai dakwah kaum pemuda terhadap syiar Islam di tengahtengah masyarakat. “Sekaligus menumbuhkan rasa cinta terhadap Islam itu sendiri, sebagai pemuda muslim yang menjunjung tinggi nilainilai dan norma agama. Hal ini juga kita laksanakan sebagai rasa menyambung tali silaturahim antara kaum pemuda dan orang-orang tua, yang seiman dan seakidah,” ujarnya. Pihaknya berharap kepada seluruh lapisan masyarakat muslim di kota Medan, dapat turut berpartisipasi menyemarakkan perlombaan ini. “Kiranya acara ini dapat sukses dan berjalan dengan lancar, untuk itu kami mengharapkan kaum-kaum pengajian dapat turut berperan mengikuti perlombaan ini,” katanya. Sebelumnya, PAC PMI Medan Denai sudah banyak menggelar kegiatan di tengah-tengah masyarakat, seperti bantuan sosial kaum dhuafa, korban kebakaran, dan pemberian bingkisan kepada sejumlah panti asuhan termasuk bantuan pembangunan masjid. Kesemuanya dilakukan untuk mengobarkan semangat kepedulian terhadap masyarakat, demi menghidupkan keutuhan beragama dan bernegara. Untuk pendaftaran, kelompok pengajian dapat berhubungan langsung dengan panitia di nomor 0852 9777 3839, atau datang langsung ke Kantor PAC PMI Medan Denai di Komplek Citra Menteng Jalan Menteng VII Medan. (cwan)


WASPADA Senin 13 Februari 2012

Medan Metropolitan

B3

Empat Wakil Rektor UMSU Dilantik

Waspada/Ist

REKTOR UMSU Drs Agussani, MAP memberikan arahan kepada empat wakil rektor usai dilantik Ketua Majelis Pendidikan Tinggi PP Muhammadiyah, Sabtu (11/2).

MEDAN (Waspada): Empat Wakil Rektor Universitas Muhammadiyah Sumatera Utara (UMSU) periode 2012-2016 dilantik Ketua Majelis Pendidikan Tinggi Pimpinan Pusat Muhammadiyah, di aula kampus UMSU, Sabtu (11/2). “Para wakil rektor diharapkan mampu memberikan dukungan terhadap rektor dalam memajukan UMSU kedepan. Kami yakin saudara mampu mengemban tugas itu,” kata Ketua Majelis Pendidikan Tinggi PP Muhammadiyah Chairil Anwar. Keempat Wakil Rektor yang dilantik masing-masing Wakil Rektor I Bidang Akademik sebelumnya dijabat Armansyah diganti dengan Muhyarsyah. Wakil Rektor II Bidang Keuangan sebelumnya dijabat Suhrawardi K Lubis digantikan Ahmad Sinaga. Wakil Rektor III H Muhammad Arifin Gultom SH, MHum danWakil Rektor IV Bidang Kerjasama dan Badan Usaha Suhrawardi K Lubis. Hadir dalam pelantikan itu Pimpinan Pusat Muhammadiyah Sumut, civitas akademika, serta Direktur PT Telkom yang bekerja sama dengan UMSU. Chairil Anwar mengingatkan, dari tujuh perguruan tinggi (PT) terbaik Muhammadiyah di Indonesia, UMSU berada di empat terbesar. Di mana jumlah mahasiswanya mencapai 20 ribu orang. Ini merupakan satu kebanggaan, baik bagi keluarga Muhamma-

diyah maupun Indonesia. “Prestasi ini terus ditingkatkan agar UMSU bisa menjadi yang terbaik. Untuk itu para wakil rektor dan rektor harus terus jalin kerjasama yang baik,” ujarnya. Kata dia, UMSU sebagai bagian dari amal usaha Muhammadiyah, berkembang baik sebagai aset bangsa dalam memajukan pendidikan tinggi di tanah air. Keberhasilan dan peningkatan sektor ekonomi 6,5 persen harus jadi motivasi bagi PT Muhammadiyah, terutama dalam menghimpun dana baik akademik maupun non-akademik.”Kerjasama, kebersamaan, dan kekeluargaan terus ditanamkan mendukung kebijakan universitas,” sebutnya. Sementara Rektor UMSU Drs Agussani MAP mengatakan, pemilihan keempat wakil rektor sudah melalui mekanisme yang digariskan PP Muhammadiyah. Mereka adalah kader – kader UMSU yang sudah puluhan tahun mengabdi. Dijelaskan Agussani, adanya penambahan jajaran wakil rektor yaitu Wakil Rektor IV khusus membidangi amal usaha yang baru pertama kali terbentuk. Tugasnya menciptakan lahan tidak produktif menjadi produktif dan menambah sumber pendapatan UMSU. “Wakil Rektor IV ini bukan sengaja diada-adakan, tetapi untuk bisa menciptakan yang tidak produktif menjadi produktif, karena UMSU memiliki lahan yang harus dioptimalkan dan dikelola menjadi sumber pendapatan bagi UMSU,” katanya. (m49)

Salah Identifikasi, Kuburan Dibongkar Lagi Sunita Yang Sempat Ditangisi, Dishalatkan Dan Dimakamkan, Ternyata Berada Di Kisaran MEDAN (Waspada): Keluarga Sunita alias Ita Boneng, 35, warga Jln. S. Parman Gg Soor bernafas lega. Ternyata mayat yang mereka tangisi dan mereka makamkan di Jln. Guru Patimpus, bukanlah Sunita. Mayat perempuan yang menjadi korban pembunuhan di Hotel Bukit Hijau Jln. Jamin Ginting pada 27 Desember 2011 itu adalah Elida boru Hasibuan. “Memang ini yang kami harapkan, mayat korban pembunuhan itu bukan Sunita,” kata Hasan, 50, abang ipar Sunita saat ditemui Waspada di kediamannya di Jln. S. Parman, Jumat (10/2). Kenapa mayat itu sampai ke tangan keluarga Sunita? Peristiwa itu berawal saat petugas Kepolisian Sektor Delitua mendatangi Hasan dan Siti Sundari, 48, di rumahnya, Selasa (27/12) malam sekira pukul 22:00. Saat itu, polisi membawa foto mayat perempuan yang sudah berada di Instalasi Jenazah RSUP H Adam Malik Medan. “Saat itu, polisi menunjukkan foto mayat perempuan kepada saya. Polisi yakin itu Sunita. Lalu saya bilang itu bukan adik ipar saya, karena bahu pada mayat itu besar, sedangkan adik ipar saya tidak. Istri saya (kakak kandung Sunita) yang melihat foto tersebut, juga bilang seperti itu. Meski wajah korban pembunuhan yang diperlihatkan itu mirip Sunita,” sebut Hasan. Setelah keduanya tidak mengakui mayat tersebut adalah Sunita, polisi-polisi itu kemudian pergi. Namun, pada Kamis (28/12) dinihari pukul 03:00, polisi kembali mendatangi Hasan dan Siti Sundari. “Jam tiga pagi polisi datang lagi. Mereka sangat yakin foto yang ditunjukkan itu adalah Sunita, karena mereka sudah mendatangi tempat Sunita bekerja dulu, yakni Hotel Duta. Polisi memperoleh keterangan dari teman Sunita yang membenarkan mayat tersebut adalah Sunita. Akhirnya, polisi balik lagi dan menyuruh kami melihat mayat di RSUP H.

Adam Malik,” kata Hasan. Atas dasar ingin membantu polisi dan melihat kebenaran apakah mayat tersebut Sunita, Hasan dan Siti Sundari bersama tetangganya pergi ke RSUP HAM. “Sampai di ruang jenazah itu, memang 90 persen mirip sekali dengan Sunita. Rambut dan wajahnya sangat mirip. Hanya bahunya saja yang berbeda, mungkin karena dia sudah gemuk. Tetangga-tetangga kami yang ikut ke RSUP H. Adam Malik juga meyakini itu Sunita,” jelasnya. Antara yakin dan tidak, Hasan dan Siti Sundari akhirnya membawa mayat tersebut ke rumahnya untuk disemayamkan. Sesampai di rumah, tetangga berdatangan dan mengucapkan belasungkawa. “Anehnya tidak ada satupun tetangga membantah kalau mayat itu bukan Sunita. Memang Sunita setiap bulan puasa saja datang kemari, tapi tetangga tahu wajah Sunita. Karena banyak tetangga yang mengatakan mayat itu adalah Sunita, kami juga meyakininya. Kemudian jenazah itu dimandikan, dishalatkan dan kami makamkan,” kata Hasan. Usai dikebumikan, pihak keluarga mengadakan tahlilan selama tiga hari. Tetapi alangkah terkejutnya Siti Sundari saat menerima telefon dari pihak kepolisian dan menyatakan mayat itu bukan Sunita, melainkan Elida boru Hasibuan. “Setelah mendapat telefon itu, saya bergegas ke kantor polisi atas permintaan mereka. Di kantor polisi, keluarga Elida menjelaskan seluruh buktibukti atau barang-barang yang dipakai mayat tersebut. Saat itulah saya baru yakin kalau mayat tersebut bukan adik saya,” kata Siti Sundari. Dia pun mengatakan, mayat tersebut sangat mirip dengan adik bungsunya yang jarang pulang ke rumah. “Kami jarang bertemu dengannya, paling setiap bulan puasa saja dia ke rumah saya. Pokoknya mirip kali lah, tapi saya sempat ragu-ragu juga saat mau membawanya ke rumah untuk disemayamkan, karena saya berfikir, kalau iya adik saya, kalau tidak gimana? Dan sebaliknya kalau tidak saya ambil, namun ter-

Waspada/Ismanto Ismail

Waspada/Andi Aria Tirtayasa

BEKAS kuburan Elida br Hasibuan yang sempat dinyatakan sebagai Sunita alias Ita Boneng di komplek perkuburan muslim Jln. Guru Patimpus, Medan, Minggu (12/2). Jenazah Elida kini sudah dimakamkan kembali oleh keluarganya di perkuburan muslim Jln. Bajak I, Medan.

Kuburan Elida Hasibuan,51, di komplek perkuburan muslim Jln.Bajak I Kelurahan Sitirejo II Kecamatan Medan Amplas, setelah dipindahkan dari komplek pekuburan muslim Jln Guru Patimpus, Kecamatan Medan Barat.

nyata memang benar adik saya, berdosa kali saya tidak mengakui adik saya,” terang Sundari. Empat minggu setelah kejadian itu terungkap, Sunita pun menelefon Siti Sundari. “Saat dia telefon, kami marahi dia. Gara-gara dia tidak pernah kasih kabar, makanya kejadiannya seperti ini. Ternyata Sunita yang kami kira meninggal, berada di Kisaran. Alasan Sunita tidak kasih kabar, karena handphone-nya rusak, nomor-nomor telefon hilang semua,” kata Sundari. Setelah diketahui mayat tersebut bukan Sunita, pihak keluarga berniat ingin mencabut nama pada batu nisan yang dipasang atas nama Sunita. Namun, karena keluarga Siti Sundari ada yang sakit, pencabutan belum dilakukan. “Mau kami cabut. Memang itu hak mereka mau menggali lagi kuburan dan memindah mayat tersebut. Tapi yakinlah, kami menshalatkan jenazah dan kami kebumikan layaknya keluarga kami sendiri,” kata Sundari yang mengaku tidak mengetahui kabar soal pembongkaran kuburan di Jln. Guru Patimpus.

korban untuk mengkonfrontir masalah itu, namun tidak ada kejelasan. Bahkan keluarga Sunita tetap bertahan dan menyatakan jenazah itu bukan Elida. Pada 19 Januari 2012, petugas Poldasu menangkap pelaku pembunuhan di Hotel Bukit Hijau dan mengakui mayat itu adalah Elida. Menurut pihak keluarga Elida, sejak pertama kali mayat ditemukan hingga pelaku ditangkap, tidak ada pendekatan yang dilakukan pihak keluarga Sunita dan Polsek Delitua terhadap mereka. “Karena itu, keluarga akan berembug untuk melakukan rencana penututan terhadap pihak-pihak terkait yang dari awal mempersulit jenazah itu dikembalikan kepada mereka,” ujar seorang keluarga Elida. Selanjutnya kuburan Elida br Hasibuan yang menggunakan nisan atas nama Sunita di tempat pekamanan umum (TPU) Jln. Guru Patimpus akhirnya dibongkar. Kemudian pihak keluarga memakamkan jenazah Elida br Hasibuan di TPU Marindal Jln. Bajak. Seluruh biaya pembongkaran kuburan dan

Rencanakan tuntutan Di tempat terpisah, Suryaman, 51, suami Elida br Hasibuan kepada Waspada mengatakan, pihaknya sudah berkalikali meyakinkan petugas Polsek Delitua bahwa jenazah korban pembunuhan itu adalah istrinya Elida Hasibuan Binti Mahidin, 51, warga Jln. Eka Rasmi, Medan Johor. “Tetapi polisi terlanjur menyerahkan jenazah tersebut kepada keluarga lain dengan identitas Sunita Binti Ponirin dan telah dikebumikan,” kata Suryaman didampingi M Toha Hasibuan, 45, adik korban saat ditemui di kediamannya Jln. Garu I Gg. Nangka, Sabtu (11/2). Setelah pelaku pembunuhan, tidak lain mantan adik ipar korban bernama Adi, 45, ditangkap di salah satu hotel kelas melati, akhirnya identitas mayat perempuan tersebut terungkap dan kuburan atas nama Sunita dibongkar oleh pihak keluarga Suryaman. Pembongkaran itu, menurut M Toha Hasibuan, dilakukan setelah ada surat izin dari Poldasu yang menyatakan bahwa mayat Sunita adalah Elida

Hasibuan. Pembongkaran disaksikan dua petugas dari Poldasu dengan pemberitahuan kepada lurah dan kepala lingkungan setempat, serta pengurus kuburan di Jln. Guru Patimpus. “Perjuangan panjang mengungkap kasus pembunuhan istri saya. Selama lebih 30 hari cukup melelahkan,” kata Suryaman. Identitas korban mulai terungkap setelah Suryaman dan sejumlah keluarga dan putranya Ipan,16, datang ke Polsek Delitua, Kamis (29/2), dengan berbekal foto korban dan beberapa lembar kliping suratkabar yang memberitakannya. Semula petugas tidak yakin korban pembunuhan itu bernama Elida, karena ada keluarga lain menyatakan korban adalah Sunita berusia 35. Tetapi setelah diperlihatkan barang bukti anting-anting, helm, sandal dan baju korban serupa dengan yang dimiliki ibunya saat terakhir kali pergi dari rumah, mereka yakin korban pembunuhan itu adalah Elida. Kemudian petugas Polsek Delitua, Jumat (30/12), mempertemukan kedua keluarga

pemakamannya kembali, ditanggung pihak keluarga Elida. “Ini merupakan amanah mendiang sebelum meninggal. Dia pernah mengatakan, kalau meninggal ingin dikubur di dekat rumahnya. Makanya kuburan ini dibongkar,” ujar Toha. Sementara itu, Kanit Reskrim Polsek Delitua AKP Semion Sembiring saat dikonfirmasi Waspada, Rabu (8/2) terkait pembongkaran kuburan mengatakan, kasus tersebut telah ditangani Poldasu sehingga dia tidak berwenang lagi menangani perkaranya. Tentang penyerahan mayat korban kepada keluarga Siti Sundari dengan nama Sunita, menurut AKP Semion, setelah ada surat pernyataan dari keluarga Sunita dan diperkuat beberapa saksi yang melihat tanda-tanda di tubuh jenazah. Sedangka pihak RSUP H Adam Malik telah melakukan autopsi terhadap mayat korban. Kabid Humas Poldasu Kombes Pol. Heru Prakoso membenarkan adanya kasus tersebut dan kini sedang ditangani Dit Reskrimum Poldasu. “Tersangka pelaku pembunuhan masih

dalam sel menunggu pengiriman ke kejaksaan,” kata dia. Sedangkan pembongkaran kuburan di TPU Jln. Guru Patimpus sudah dilakukan pada Selasa, 6 Februari 2012 pukul 14:00 dan diketahui kedua pihak keluarga yang bersangkutan. Heru juga mengatakan, saat pembongkaran disaksikan dua petugasdariReskrimumPoldasu. Hanya autopsi Di tempat terpisah, Kasubbag Humas RSUP HAM Sairi M Saragih, mengaku tidak mengetahui tentang kasus kesalahan penyerahan mayat tersebut. “Pihak kepolisian yang membuat pernyataan bahwa mayat itu Sunita, sehingga pihak rumah sakit menyerahkannya. Kalau tidak ada surat dari kepolisian, mana bisa kita berikan kepada sembarangan orang,” katanya. Menurutnya, pihak rumah sakit hanya melakukan autopsi, bukan menentukan identitas mayat. “Kami hanya autopsi, memeriksa sebab kematiannya saja. Kalau identitasnya, pihak keluarga bisa mendatangi kepolisian dengan membawa bukti-bukti,” ujar Sairi.(h02/h04/ m40/m27)

Waspada Terima Penghargaan GAN Indonesia

Waspada/Feirizal Purba

PARA penerima Penghargaan GAN Indonesia, di antaranya Wakil Penanggungjawab Harian Waspada Sofyan Harahap (paling kiri) diabadikan bersama H.M. Kamaludin Lubis (paling kanan).

MEDAN (Waspada): Harian Waspada yang dianggap konsern dan peduli terhadap pemberantasan penyalahgunaan narkoba serta atas kerjasama yang terbina selama ini, menerima penghargaan dari Gerakan Anti Narkoba (GAN) Indonesia. Penghargaan yang diserahkan Pendiri GAN Indonesia, Yasika HM Kamaludin Lubis, diterima Wakil Penanggungjawab Harian Waspada H Sofyan Harahap, dalam acara ulang tahun GAN) Indonesia ke-12, Yayasan Indonesia untuk Kemajuan Desa (Yasika) ke-27, dan pendiri Sibolangit Centre (rehabilitasi korban Narkoba) advokat HM Kamaluddin Lubis SH, DFM, di lokasi Sibolangit Centre, Kec. Sibolangit, Deliserdang, Sabtu (11/2) malam. Acara tersebut dihadiri Bupati Deliserdang Amri Tambunan, Ketua PWI cabang Sumut M Syahrir, Wadir Narkoba Mabes Polri Kombes Anjan Pramuka Putra, staf Badan Narkotika Nasional (BNN), anggota DPRD Deliserdang Rakhmadsyah, Dit Narkoba Poldasu mewakili Kapoldasu, anggota DPD RI Parlindungan Purba, pengacara kondang dari Jakarta Indra Sahnun Lubis, Ketua DPD Granat Sumut Hamdani Harahap, Dewan Penyantun GAN Indonesia, Musadad Nasution mewakili Wali Kota Medan, tokoh agama, tokoh masyarakat, ratusan masyarakat, serta puluhan peserta rehabilitasi narkoba dan lainnya. Selain itu, penghargaan juga diberikan kepada Radio Delta FM, Hj Siti Maryam T Rizal Nurdin (Penyantun), Kombes Anjan Pramuka Putra, Sriwati Bukit (relawan GAN), Direktur Yasika Surya Dharma (alm), Bekman Hutabarat, Fisipol USU, Hj Nanan Abdillah, Hj Anita Amri Tambunan, anggota DPR RI Nazli Bahar, anggota DPRD Deliserdang Rakhmadsyah, Bupati Sergai diwakili Humas Suriono dan lainnya. Disamping itu juga dilakukan penandatanganan Nota Kesepakatan PWI Cabang Sumut – GAN Indonesia oleh HM Kamaludin Lubis dan Muhammad Syahrir. Kamaludin Lubis dalam paparannya mengemukakan, saat awal mendirikan GAN Indonesia di tahun 2000 cukup banyak tantangan maupun cibiran serta berbagai tuduhan. “Bahkan mafia-mafia serta bandar-bandar narkoba pun memainkan berbagai trik dan upaya saat itu,” katanya. Mungkin saja, lanjutnya, saat ini pun para mafia itu masih memainkan dan melakukan berbagai upaya. “Bahkan sempat di antaranya mengkriminalisasi

keluarga saya. Akan tetapi meski demikian, ternyata cukup banyak pula dari berbagai kalangan yang memberikan dukungan atas aktivitas GAN Indonesia,” sebutnya. Dalam kesempatan itu Kamaludin menyampaikan apresiasi serta penghargaan sangat tinggi kepada sejumlah wartawan yang juga turut serta mendukung terwujudnya pondok rehabilitasi korban narkoba yang kini menjadi Sibolangit Centre. Sebelumnya, Sekjen GAN Indonesia Zulkarnain Nasution yang juga Direktur Pimansu mengatakan, GAN telah melihat penyalahgunaan dan peredaran narkoba sudah menjadi bencana nasional bagi bangsa Indonesia. Oleh karena itu, GAN Indonesia melaksanakan tugasnya guna melakukan pencegahan agar anak bangsa tidak terjerumus, dan bagi yang sudah sempat terjerumus dilakukan rehabilitasi. Sedangkan Wadir Narkoba Mabes Polri Anjan Pramuka Putra mengemukakan, Indonesia kini merupakan pangsa pasar narkoba, terutama jenis sabu-sabu. Hal tersebut disebabkan nilai ekonomisnya cukup tinggi, yakni mencapai miliaran rupiah. “Mayoritas korbannya adalah kalangan remaja, terutama mereka yang sangat mudah dipengaruhi dan terpengaruh,” ujarnya. Sementara, Parlindungan Purba maupun Amri Tambunan dalam sambutannya mengakui Kamaludin Lubis (Wak Kamal) adalah sebagai abang sekaligus guru yang patut ditiru dalam aktivitas serta perjuangannya demi anak bangsa. “Bang Kamal adalah contoh dan patriot bagi saya dalam melaksanakan tugas,” kata Parlindungan Purba. Amri Tambunan mengatakan, Kamaludin senantiasa konsisten melaksanakan aktivitas GAN Indonesia, meski begitu banyak tantangan sangat kuat. Juga dalam kegiatan Yasika sejak 27 tahun lalu guna kesejahteraan masyarakat. Oleh karena itu sangat wajar jika kita mendukung apa yang dilakukannya. Masih serangkaian peringatan HUT tersebut, Minggu (12/2) pagi diadakan peringatan Maulid Nabi Besar Muhammad SAW di Masjid Al-Kamal Sibolangit, sekaligus penerimaan 1 unit mobil ambulans bagi kepentingan masyarakat. (m34)


Medan Metropolitan

B4

WASPADA Senin 13 Februari 2012

Cabuli Mahasiswi Hingga Hamil Ditangkap

Tahanan Polsek Medan Baru Diberi Tausiyah Agama

MEDAN (Waspada):TersangkaWs alias Dewa, 34, yang mencabuli mahasiswi hingga hamil 19 minggu, dibekuk petugas Polsek Sunggal dari tempat persembunyiannya di Pematangsiantar, Jumat (10/2). Informasi Waspada peroleh di lapangan, tersangka Dewa, penduduk Jln. Voly, Desa Banjar, Pematangsiantar, yang telah memiliki istri dan tiga orang anak itu awalnya berkenalan dengan korban berinisial T, 19, masiswi salah satu perguruan tinggi swasta di Medan, melalui telefon selular. Dalam perkenalan itu, tersangka Dewa mengaku belum menikah. Setelah beberapa kali melakukan hubungan melalui HP, tersangka dan korban bertemu. Selanjutnya tersangka dengan bujuk rayu membawakorbankesalahsatuhotelmelatidanmelakukanhubungan layaknya suami istri. Terakhir mereka melakukan hubungan intim di hotel B Jln. Setiabudi, Kel. Tanjungrejo, Kec. Medan Sunggal. Melihat korban telah hamil, tersangka lari dari tanggung jawab dan tidak mau lagi menemui korban. Sedangkan korban memberitahukan kejadian tersebut kepada orangtuanya dan diteruskan ke Polsek Sunggal. Kapolsek Sunggal Kompol M Budi Hendrawan SH, SIK didampingi Kanit Reskrim AKPVictor Zuliwu SH, SIK mengatakan, berkat bantuan pihak keluarga korban dan warga, tersangka berhasil dibekuk. “Dia melakukan perbuatan cabul terhadap korban sebanyak delapan kali sehingga korban hamil 19 minggu,” ujarnya. (m36)

MEDAN (Waspada): Ustadz Drs H Nazaruddin Hasibuan dari PAMK (Pemuka Agama Mitra Kamtibmas) memberikan tausiyah agama kepada puluhan tahanan Polsek Medan Baru, Jumat (10/2). Kegiatan tersebut dihadiri Kapolsek Medan Baru Kompol Dony Alexander SH, SIK, M.Hum, Waka Polsek AKP Tris Lesmana Zeviansyah SH, SIK, M.Hum, Ustadz Drs Zulkifli Hasan Spdi, St Robertus Bukit, Panit Binmas Aiptu Ganefo Sembiring SH. Dalam tausiyahnya, Nazaruddin mengatakan, sebagai muslim kita memiliki kewajiban untuk terus mengingatkan masyarakat khususnya yang berada di ruang tahanan Mapolsek Medan Baru. Pada kesempatan itu, dia mengajak para tahanan untuk bertobat. “Marilah intropeksi diri atas perbuatan kita yang telah mempermalukan keluarga, bahkan menjadi sejarah buruk bagi diri kita dan anak-anak. Belum terlambat berbuat baik dan sesali semua perilaku yang bertentangan dengan hukum dan agama,” sebutnya. Dia juga mengajak para penghuni ruang tahanan a g a r berjanji pada diri sendiri tidak akan mengulangi lagi perbuatan yang melanggar norma-norma hukum dan agama. “Cukuplah ini yang terakhir kali kita lakukan,” imbau Nazaruddi. Tausiyah agama itu juga diisi dengan pembacaan ayat suci Alquran oleh Ustadz Drs Zulkifli Hasan. Usai acara tausiyah, Panit Binmas Polsek Medan Baru Aiptu Ganefo Sembiring mengatakan, kegiatan tausiyah agama kepada para tahanan itu sesuai instruksi Kapoldasu Irjen Pol Drs H Wisjnu Amat Satro SH, ditindaklanjuti Kapolresta Medan Kombes Pol Drs Monang Situmorang MSi. (m36)

Jadwal Penerbangan Di Bandara Polonia No. Penerbangan Ke Flight

Pukul

Tiba Dari

Flight

Pukul

GARUDA INDONESIA 1 Jakarta GA-181 2 Jakarta GA-183 3 Jakarta GA-185 4 Jakarta GA-187 5 Jakarta GA-189 6 Jakarta GA-191 7 Jakarta GA-193 8 Jakarta GA-147 9 Jakarta GA-195 10 Banda Aceh GA-142 11 Banda Aceh GA-14.6

05.30 08.40 10.45 11.55 13.55 15.45 18.35 18.30 19.50 09.40 14.50

Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Banda Aceh Banda Aceh

GA-180 GA-182 GA-184 GA-186 GA-146 GA-188 GA-190 GA-192 GA-196 GA-143 GA-147

07.55 08.55 11.10 13.00 14.05 15.10 17.50 19.05 21.35 12.25 17.45

CITILINK 1 Jakarta 2 Jakarta

09.45 19.00

Jakarta Jakarta

GA-040 GA-044

09.15 18.30

06.15 09.40 08.05 17.55 10.05 18.25 21.20 13.30 15.05 08.40 12.00

Kuala Lumpur Kuala Lumpur Kuala Lumpur Kuala Lumpur Penang Penang Kuala Lumpur Jakarta Bangkok (2,4,6) Bandung Surabaya

QZ-8051 QZ-8055 AK-450 AK-454 QZ-8073 AK-5836 AK-456 QZ-7502 QZ-8085 QZ-7986 QZ-7610

08.40 12.05 07.35 17.30 09.40 18.00 20.55 13.05 20.10 05.45 08.30

Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Penang Penang Jakarta Jakarta Jakarta Jakarta Jakarta Surabay Surabaya Banda Aceh Batam

JT-380 JT-300 JT-394 JT-302 JT-210 JT-200 JT-204 JT-398 JT-382 JT-384 JT-202 JT-212 JT-396 JT- 8289 JT-8287 JT-206 JT-208 JT-388 JT-308 JT-218 JT-971 JT-973 JT-397 JT-970

08.20 09.20 10.20 11.20 11.50 12.20 13.20 14.20 15.20 16.20 17.20 17.50 18.20 11.35 15.00 19.20 20.20 21.55 22.20 23.20 12.16 15.55 07.40 12.15

GA-041 GA-045

AIR ASIA 1 Kuala Lumpur QZ-8050 2 Kuala Lumpur QZ- 8054 3 Kuala Lumpur AK- 451 4 Kuala Lumpur AK-455 5 Penang QZ-8072 6 Penang AK-5937 8 Kuala Lumpur AK-457 9 Jakarta QZ-7503 10 Bangkok (1,4,6) QZ-8084 11 Bandung QZ-7487 12 Surabaya QZ-7611 LION AIR 1 Jakarta 2 Jakarta 3 Jakarta 4 Jakarta 5 Jakarta 6 Jakarta 7 Jakarta 8 Jakarta 9 Jakarta 10 Jakarta 11 Jakarta 12 Jakarta 13 Jakarta 14 Penang 15 Penang 16 Jakarta 17 Jakarta 18 Jakarta 19 Jakarta 20 Jakarta 21 Surabaya 22 Surabaya 23 Banda Aceh 24 Batam

JT- 211 JT- 381 JT- 397 JT- 207 JT- 301 JT- 395 JT- 303 JT- 213 JT-201 JT- 387 JT-399 JT-383 JT-205 JT-8288 JT-8286 JT-385 JT-203 JT-215 JT-309 JT-209 JT-972 JT-972 JT-396 JT 970

06.00 07.00 08.20 09.00 10.00 11.00 12.00 12.30 13.00 14.00 15.00 16.00 16.35 09.10 12.30 17.00 18.00 18.30 20,00 21.00 07.00 12.55 19.00 07.00

MALAYSIA 1 Kuala Lumpur MH-861 2 Kuala Lumpur MH-865

09.05 15.45

Kuala Lumpur MH-860 08.25 Kuala Lumpur MH-864 15.00

SILK AIR 1 Singapura 2 Singapura 3 Singapura (7)

MI-233 MI-237 MI-241

08.40 20.35 21.05

Singapura Singapura Singapura (7)

MI-232 MI-238 MI-242

07.50 19.50 20.00

VALUAIR 1 Singapura (4,7) VF-582 2 Singapura (1,3,6) VF-584

09.35 17.25

Singapura (4.7) VF-581 Singapura (1,3,6) VF-583

09.10 17.50

BATAVIA AIR 1 Jakarta 2 Jakarta 3 Jakarta 4 Batam

Y6-592 Y6-594 Y6-596 7P-568

10.10 16.15 20.00 13.00

Jakarta Jakarta Jakarta Batam

Y6-591 Y6-593 Y6-595 7P-567

09.55 18.30 19.20 11.05

SRIWIJAYA AIR 1 Jakarta 2 Jakarta 3 Batam 4 Pekanbaru 5 Pekanbaru 6 Banda Aceh 7 Penang 8 Padang

SJ-015 SJ-011 SJ-035 SJ-043 SJ-041 SJ-010 SJ-102 SJ-021

13.25 15.00 16.20 10.20 16.00 11.55 07.20 15.25

Jakarta Jakarta Batam Pekanbaru Pekanbaru Banda Aceh Penang Padang

SJ-010 SJ-016 SJ-034 SJ-042 SJ-040 SJ-011 SJ-103 SJ-020

11.20 18.35 15.45 12.50 15.25 13.25 10. 00 14.50

13.15 11.00

Subang Penang

FY-3412 FY-3402

12.56 10.40

SRIWIJAYA AIR 1 Subang FY -3413 2 Penang FY- 34.03

Jadwal Perjalanan Kereta Api No KA

Nama KA

Kelas

Dari

Tujuan

U.2 U.4 U.6 U.8 U.1 U.3 U.5 U.7 U.10 U.12 U.9 U.11 U.14 U.16 U.18 U.13 U.15 U.17 U.22 U.21 PLB 7000 PLB 7007 PLB 7014 PLB 7017 PLB 7002 PLB 7004 PLB 7008 PLB 7010 PLB 7012 PLB 7001 PLB 7006 PLB 7015 PLB 7003 PLB 7005 PLB 7009 PLB 7011 PLB 7013

Sri Bilah Sri Bilah Sri Bilah Sri Bilah Sri Bilah Sri Bilah Sri Bilah Sri Bilah Sri Bilah Sri Bilah Sri Bilah Sri Bilah Putri Deli Putri Deli Putri Deli Putri Deli Putri Deli Putri Deli Siantar Ekspres Siantar Ekspres Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa

Eks/Bisnis Eks/Bisnis Eks/Bisnis Eks/Bisnis Eks/Bisnis Eks/Bisnis Eks/Bisnis Eks/Bisnis Bisnis Bisnis Bisnis Bisnis Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonom Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi

Medan Medan Medan Medan Rantau Prapat Rantau Prapat Rantau Prapat Rantau Prapat Medan Medan Binjai Binjai Medan Medan Medan Tanjung Balai Tanjung Balai Tanjung Balai Medan Siantar Medan Medan Medan Medan Medan Medan Medan Medan Medan Tebing Tinggi Belawan Belawan Binjai Binjai Binjai Binjai Binjai

Rantau Prapat Rantau Prapat Rantau Prapat Rantau Prapat Medan Medan Medan Medan Binjai Binjai Medan Medan Tanjung Balai Tanjung Balai Tanjung Balai Medan Medan Medan Siantar Medan Tebing Tinggi Belawan Belawan Belawan Binjai Binjai Binjai Binjai Binjai Medan Medan Medan Medan Medan Medan Medan Medan

Berangkat Datang 08.00 10.30 15.00 22.50 08.00 14.45 17.10 23.00 04.50 20.15 09.20 21.40 06.50 12.50 17.10 07.15 11.55 19.25 11.25 07.00 18.00 07.30 16.50 12.00 07.30 05.00 09.50 12.15 14.40 06.20 08.40 17.50 08.55 06.30 11.00 13.30 15.50

13.21 15.25 20.28 03.52 13.22 19.59 22.01 04.24 05.42 21.07 10.12 22.32 11.17 17.27 22.15 11.54 16.28 22.47 14.50 10.45 20.04 08.17 17.37 12.47 08.22 05.52 10.42 13.07 15.32 07.21 09.27 18.27 09.47 07.22 11.52 14.22 16.42

Informasi Pemesanan -Stasiun KA Medan (061) 4514114, -Stasiun KA R. Prapat (0624) 21617.

Waspada/Ismanto Ismail

USTADZ Nazaruddin Hasibuan (tiga) dari kiri didampingi St. Robertus Bukit (dua) dari kanan, Ustadz Zulkifli Spdi,Waka Polsek Medan Baru AKP Tris Lesmana Zeviansyah, Panit Binmas Aiptu Ganefo Sembiring, memberikan tausiyah, di ruang tahanan Polsek Medan Baru, Jumat (10/2)

69 Anggota Geng Kereta Diamankan 7 Orang Ditahan, 55 Sepedamotor Disita MEDAN (Waspada): Dalam razia yang digelar Polsek Medan Area, Polsek Medan Baru, dan Polsek Sunggal mengamankan 69 anggota geng kereta dalam penyergapan di beberapa lokasi berbeda, Minggu (12/ 2) dinihari. Selain itu menyita 55 sepedamotor, 2 kelewang dan lainnya. Polsek Medan Area sekira pukul 03:00 meringkus ketua geng kereta dan tiga anggotanya dari lokasi mangkal mereka di Jalan HM Jhoni Medan. Ke empatnya ditangkap karena menganiaya Martin Marpaung, 20, mahasiswa yang tinggal di Jalan Pasar Merah, Kec. Medan Denai. Ke empat komplotan geng kereta yang menamakan dirinya Pemuda Medan Bersatu (PMB) itu masing-masing ketua berinisial Ma, 30, HJ, 19, warga Jalan Raya Menteng Medan Denai, CSL, 18, warga Jalan Menteng VII Gang Nasional, Medan Denai, dan RB, 15, warga Jalan MentengVII. Dari mereka, polisi mengamankan empat unit sepedamotor sebagai barang bukti. Informasi yang diperoleh di kepolisian, ke empat anggota

geng kereta tersebut sebelumnya konvoi di Jalan Raya Menteng dan memukuli korban Martin Marpaung hingga kepala dan wajahnya lembamlembam. Selanjutnya, korban dibawa berobat ke Rumah Sakit Muhammadiyah. Kanit Reskrim Polsek Medan Area AKP J Banjarnahor menjelaskan, usai melakukan aksinya, kelompok geng kereta tersebut kembali ke poskonya di kawasan Jalan HM Jhoni. “Keempatnya masih menjalani pemeriksaan,” katanya. Sementara itu, razia antisipasi aksi geng kereta di wilayah Polsek Percut Seituan tidak membuahkan hasil karena tidak terlihat kelompok geng kereta yang melakukan konvoi di kawasan tersebut. Namun di tempat terpisah, kelompok Fron Pembela Islam (FPI) yang turut mengantisipasi aksi geng kereta sempat ‘mengamankan’ tiga orang yang diduga sebagai anggota geng kereta. Ketiga pemuda tersebut dipergoki oleh anggota FPI sedang mengendarai sepedamotor berbonceng tiga melintas di Jalan Cemara simpang Jalan Pancing. Saat dihentikan, ketiga pria tersebut diperiksa. Karena tidak membawa senjata tajam atau alat-alat lainnya yang selama ini acap dibawa oleh kelompok

Waspada/Ismanto Ismail

PULUHAN sepedamotor milik geng kereta yang diamankan, Minggu (12/2) sore.

geng kereta, ketiga pria tersebut kemudian dilepas. Kapolsek Percut Seituan Kompol Maringan Simanjuntak menjelaskan, razia rutin yang dilakukan tiap malam tersebut tidak menemukan aksi geng kereta yang melintas atau konvoi di kawasan Jalan Cemara, Pancing dan Williem Iskandar. “Tidak terlihat aksi konvoi geng kereta di wilayah Percut Seituan,” sebutnya. 51 Sepedamotor Sementara itu, Polsek Medan Baru dan Polsek Sunggal mengamankan 65 anggota geng kereta lagi ngumpul di empat lokasi berbeda, Minggu dinihari. Tiga di antaranya terpaksa ditahan karena membawa kelewang dan melakukan penganiayaan. Dari para anggota geng kereta tersebut, disita barang bukti 51 sepedamotor, dua bilah parang, dan lainnya. Informasi Waspada peroleh di lapangan, pukul 24:00 sampai 04:00 dinihari, Polsek Medan Baru dan Polsek Medan Sunggal melakukan patrol dan razia di beberapa titik yang dianggap rawan kejahatan jalanan dan khususnya geng kereta yang cukup meresahkan masyarakat. Patroli itu melintasi beberapa titik di antaranya Jln. Gatot Subroto, Titi Papan, Gajah Mada, Iskandar Muda, Mongonsidi, Patimura, S. Parman, Diponegoro, PWS, Pasundan, Jln. KH Wahid Hasyim. Ketika melintas di Jln. Gatot Subroto, petugas Polsek Medan Baru mendapat informasi dari masyarakat yang mengatakan, puluhan remaja sebagian besar berstatus pelajar SMA sedang ngumpul di Jln. Pabrik Kimia simpangJln.PabrikTenunMedan. Kapolsek Medan Baru Kompol Dony Alexander SH, SIK, Mhum bersama personelnya langsung menuju ke lokasi. Puluhan anggota geng kereta melihat kedatangan polisi langsung berhamburan membawa

sepedamotornya. Petugas kemudian melakukan penyisiran dan menemukan belasan sepedamotor keadaan parkir. Ketika ditelusuri para pemilik sepedamotor tersebut berada di salah satu rumah. Selanjutnya rumah itu digerebek dan puluhan anggota geng kereta yang berada di dalamnya diamankan bersama sepedamotornya ke Mapolsek Medan Baru. Dony Alexander mengatakan, pihaknya juga mengaman seorang tersangka diduga geng kereta di kawasan Pasar I Padangbulan. “Kita mengamankan 30 remaja diduga anggota geng kereta dan menyita 20 sepedamotor. Usai menjalani pemeriksaan, satu orang di antaranya ditahan, sedangkan 29 orang lainnya dibenarkan pulang setelah membuat surat pernyataan tidak mengulangi lagi perbuatannya,” katanya. Sedangkan Polsek Sunggal mengamankan 35 anggota geng kereta dan menyita 31 sepedamotor. Kapolsek Sunggal Kompol M Budi Hendrawan, SH, SIK mengatakan, pihaknya mendapat informasi melalui SMS, ada puluhan remaja diduga geng kereta ngumpul di dekat SPBU Jln. Gatot Subroto simpang Jln. Rajawali Medan, di antaranya ada membawa kayu, parang, dan lainnya. Polisi langsung menuju ke sasaran. Melihat kehadiran petugas, puluhan anggota geng kereta langsung kabur sambil menggeber-geber kendaraannya menuju ke Jln. Gatot Subroto dan Jln. Rajawali. Namun, 35 orang berhasil diamankan. Usai dilakukan pemeriksaan, dua di antaranya dari geng kereta Esto berinisial FA, 17, penduduk Jln. Diponegoro, Desa Cinta Rakyat, Kec. Percut Seituan dan SAI, 17, penduduk Jln. Trunojoyo, Desa Cinta Rakyat, masih berstatus pelajar SMA, ditahan karena membawa dua kelewang. (h04/m36)

BAP Perusakan Lapak Pedagang Ikan Segera Ke Jaksa MEDAN (Waspada): Berkas acara pemeriksaan (BAP) kasus perusakan lapak pedagang ikan di Pasar Simpang Limun, Medan segera dikirim ke kejaksaan. Kapolsek Medan Kota Kompol Sandy Sinurat kepada Waspada, Minggu (12/2) mengatakan, saat ini penyidik tinggal melengkapi berkas saja, setelah itu dikirim ke jaksa. Setelah kejaksaan menyatakan berkas itu lengkap, maka penyidik Polsek Medan Kota menyerahkan lima satpam PT Inatex yang menjadi tersangka kasus itu ke kejaksaan. “Dari keterangan saksi, bukti-bukti serta temuan yuridis, maka berkasnya sudah sangat pantas untuk diajukan,” kata Sandy. Ditanya tentang pemeriksaan kasus itu, kemudian menetapkan lima satpam menjadi tersangka, Sandy mengatakan, dilakukan secara proporsional dan profesional berdasarkan temuan di lapangan dan didukung berbagai bukti. Tentang kepemilikan meja, Sandy menjelaskan, dari keterangan pedagang dan penjelasan lima satpam yang dijadikan tersangka, juga adanya surat pernyataan dan pengumuman dan foto meja yang dirusak, maka dipastikan kepunyaan pedagang ikan. Ini disampaikan, karena setelah pengaduan para pedagang, PT Inatex mengklaim meja-meja yang dirusak itu milik perusahaan, bukan milik pedagang. Sandy menyebutkan, kasus ini sebenarnya dapat diselesaikan secara baik-baik antara kedua pihak (pedagang dan PT Inatex selaku pengelola pasar), karena dari keterangan pedagang, mereka mau berdamai asalkan komisaris PT Inatex datang dan menyampaikan pernyataan maaf. Sebenarnya, kata Sandy, penegakan hukum merupakan jalan terakhir. “Kita sudah mengupayakan kedua pihak berdamai dengan melibatkan pihak kecamatan, anggota DPRD Medan/Sumut, anggota DPD,Wali Kota dan Kapolresta Medan, yang saat itu dijabat Kombes Tagam Sinaga. “Tetapi belum ditemukan kesepakatan perdamaian, sehingga akhirnya hukum yang dikedepankan. Apa boleh buat, karena masing-masing tetap pada pendiriannya, maka penegakan hukum yang berlaku,” sebutnya. Kasus perusakan lapak pedagang ikan terjadi pasca eksekusi para pedagang ikan dari lahan PT Inatex, karena tidak ditemukan kesepakatan setelah pengelola pasar menaikkan harga sewa lapak selebar 2x1,5 meter seharga Rp9 juta setahun dari sebelumnya Rp7 juta. Eksekusi dilakukan, tetapi hasil kesepakatan bersama, peralihan pedagang ikan dari lokasi awal menunggu adanya lahan baru yang direncanakan tidak jauh dari lokasi pertama di Jalan Kemiri. Maka sebelum ada lokasi baru para pedagang masih bisa berjulan di lokasi awal hingga jangka waktu satu bulan. Tetapi esok harinya, sejumlah satpam PT Inatex melakukan pembongkaran lapak dengan menggunakan linggis, martil dan parang. Karenanya, para pedagang melaporkan kasus itu ke Polsek Medan Kota. (m27)

Tas Pemilik Salon Dirampok MEDAN (Waspada): Dua perampok mengendarai Honda Supra X merampas paksa tas milik wanita pemilik salon, di depan Swalayan Diamond Jalan Karya Wisata, Medan Johor, Sabtu (11/2). Akibatnya, korban Mori Nababan, 40, warga Jalan Sagu 12, Simalingkar, kehilangan tas berisi sejumlah perhiasan emas, dua unit HP Nokia, uang Rp750 ribu, kartu ATM, buku tabungan, dan surat penting lainnya. Seluruhnya diperkirakan bernilai Rp7 juta. Korban kepada wartawan di Mapolsek Delitua mengatakan, perampokan itu terjadi saat dirinya berboncengan sepedamotor dengan keponakannya hendak menuju komplek perumahan di Jalan Karya Wisata, untuk merias di satu acara keluarga. Ketika melintas di Jalan Karya Wisata, dua perampok memakai celana pendek mengendarai Honda Supra X mengikuti korban. Selanjutnya, saat berada di depan Swalayan Diamond, seorang di antara perampok itu menarik paksa tas yang dipegang korban. Seketika korban menjerit minta tolong dan mengejar pelaku yang tancap gas membawa tasnya, namun tidak berhasil menyusulnya. Kapolsek Delitua Kompol SP Sinulingga melalui Kanit Reskrim AKP Semion Sembiring saat dikonfirmasi wartawan membenarkan kejadian itu. “Kita masih melakukan penyelidikan terkait dengan pengaduan korban,” ujar Sembiring.(m40)

Monang Situmorang Mohon Dukungan Masyarakat Pimpin Polresta Medan MEDAN (Waspada): Kapolresta Medan Kombes Pol. Monang Situmorang, SH, MSi siap melanjutkan apa yang telah dijalankan pendahulunya Kombes Pol. Tagam Sinaga. “Kalau semua elemen masyarakat Medan mendukung, saya mampu melaksanakan tugas sebagai orang nomor satu di Polresta Medan seperti Kombes Tagam Sinaga,” kata dia pada acara pisah sambut Kapolresta Medan dari Kombes Pol. Tagam Sinaga SH, kepada Kombes Pol. Monang Situmorang SH, MSi, di Convention Hall Hotel Danau Toba Internasional, Sabtu (11/2) malam. Malam pisah sambut dihadiri Wali Kota Medan Drs Rahudman Harahap, Kajari Medan, Dandim 0201 BS Letkol Doni Hutabarat, Ketua MUI Kota Medan Prof M. Hatta, para Rektor PTN/PTS,seluruhMuspidaKotaMedanbesertaparapejabatPemko Medan, tokoh agama, tokoh masyarakat dan para undangan. Monang Situmorang juga mohon doa restu dan kehadirannya dapat diterima warga Medan. “Saya akan memberikan sumbangsih atau pemikiran bagi pembangunan masyarakat Kota Medan, khususnya dalam bidang keamanan dan ketertiban seperti apa yang diharapkan semua pihak, dimana polisi sebagai pelindung, pengayom dan pelayan masyarakat,” sebutnya. Menurut dia, menjabat Kapolresta Medan berkat dukungan Kombes Tagam Sinaga. “Pak Tagam asli orang Siantar, saya asli Tebing Tinggi. Jadi kemungkinan akan menurun, bisa saja nantinya jabatan Kapolresta Medan akan dijabat orang Sergai, Lubuk Pakam atau orang Medan sendiri,” ujar Monang. Monang yang mengaku barang baru tapi stok lama kemudian memperkenalkan diri mempunyai istri satu orang asal Palopo, Sulawesi Tengah, dan dua orang anak putra-putri masih kelas 3 SMA dan 2 SMA.

Terimakasih Sedangkan Kombes Pol.Tagam Sinaga, SH mengucapkan terima kasih kepada Wali Kota Medan Drs Rahudman dan seluruh unsur Muspida yang telah bekerja sama dengan baik selama ini dalam melaksanakan tugas, terutama tokoh agama dan lintas agama yang menjalin kerja sama untuk menciptakan suasana harmonis dan kondusif. Tagam juga memohon maaf kepada semua lapisan masyarakat kota Medan, apabila terdapat perilaku yang kurang menyenangkan dan kurang berkenan selama menjabat sebagai Kapolresta Medan. Wali Kota Medan Rahudman Harahap juga mengungkapkan terima kasihnya dan apresiasi yang setinggi-tinginya kepada Kombes Pol Tagam Sinaga, atas kerja sama yang dijalin bersama selama ini, terlebih saat membantu Pemerintah Kota Medan di bidang keamanan dan ketertiban yang sudah terbina dengan baik. Ruhudman mengaku salut dengan kinerja Tagam Sinaga, yang mempunyai dedikasi yang tinggi di dalam mengemban tugasnya selama ini, yang sering terjun langsung ke tengah masyarakat dan semua lapisan etnis, tanpa memandang status dan agama. Dia juga mendoakan Kombes PolTagam Sinaga SH karirnya mulus dan dapat meraih pangkat bintang. Wali Kota Rahudman merasa gembira pengganti Tagam merupakan figur polisi yang sangat teruji dan sudah pasti mengenal budaya karakteristik Kota Medan. “Kita yakin dibawa pimpinan Kombes Monang Situmorang, kota Medan bisa semakin lebih baik,” katanya. Acara pisah sambut Kapolresta Medan diisi pemberian ulos oleh Syeh Ali Marbun dan dari perkumpulan marga Sinaga kota Medan kepada Kombes Pol. Tagam Sinaga, serta pemberian kenangankenangan dari para sahabat dan rekan. Sedangkan Tagam Sinaga juga memberikan kenangan-kenangan berupa buku tentang dirinya selama menjalankan tugas sebagai Kapolresta Medan. (m39)

Waspada/Rudi Arman

KAPOLRESTA Medan Kombes Pol. Monang Situmorang memberikan cinderamata kepada Kombes Pol. Tagam Sinaga pada acara pisah sambut di Convention Hall Hotel Danau Toba Internasional, Sabtu (11/2) malam.


Sumatera Utara

WASPADA Senin 13 Februari 2012

B5

Perairan Nisel Rawan Pencurian Ikan Juliat Permadi Wibowo Kapolres Baru TELUKDALAM, Nisel (Waspada): Perairan di wilayah hukum Polres Nias Selatan (Nisel) rawan pencurian ikan oleh nelayan dari luar Nias. Polisi mengalami kendala dalam menjaga keamanan di perairan tersebut karena sarana dan prasarana untuk itu sangat minim bahkan hingga saat ini belum tersedia. “Selama ini, dalam hal pengamanan wilayah laut di Nias Selatan dari tindak kriminal pencurian ikan oleh kapal-kapal dari luar Kepulauan Nias, Polres Nias Selatan tidak dapat berbuat banyak karena terkendala sarana dan prasarana berupa kapal patroli belum tersedia. Namun atas kerjasama dengan masyarakat dengan menggunakan kapalkapal nelayan setempat, polisi dapat menekan angka tindak kriminal pencurian ikan bahkan beberapa di antaranya berhasil ditangkap,” ungkap AKBP L. Eric Bhismo. Hal itu disampaikan mantan Kapolres Nias Selatan, AKBP Leonardus Eric Bhismo, S.IK, SH padaserahterimajabatankepada Kapolres Nias Selatan yang baru, AKBP Juliat Permadi Wibowo, S.Ik, MH di Ruang PPDO Mapol-

res Nias Selatan, Jumat (10/2). Serah terima jabatan disaksikan Waka Polres, Kompol Masana SembiringKabag,Kasatsertapara Kapolsek jajaran Polres Nias Selatan. Kapolres Nias Selatan, AKBP Juliat PermadiWibowo, S.IK, MH kepada sejumlah wartawan mengatakan,memulaitugaspada jabatan barunya, dia akan melanjutkan apa yang telah dilakukan oleh pejabat lama sembari menyebutkan apabila ke depan dalam menciptakan kamtibmas yang kondusif di daerah itu perlu dilakukan pengerahan kekuatan secara full dan maksimal, maka pihaknya akan melakukannya. Ditanya mengenai kekurangan personil di Polres Nias Selatan yang hanya berjumlah 249 personil, Kapolres mengatakan, dalam melayani masyarakat, dia

akan menempatkan anggota berdasarkan ancaman kriminalitas yang selektif dan prioritas, di mana pengawasannya dilakukan kepada tingkat ancaman yang tertinggi. Pada tempat yang sama pejabat lama, AKBP Leonardus Erick Bhismo, S.IK, SH yang mendapat jabatan baru sebagai Kapolres Langkat mengungkapkan, selamamenjabatsebagaiKapolres di Kab. Nias Selatan, dia selalu menjaga kepercayaan dari masyarakat dalam hal penegakan hukum dengan cara semua laporan pengaduan terkait tindak kriminal tetap diproses tanpa pandangbulu,siapapunpelakunya.

Erick berpesan kepada masyarakatdiNiasSelatanuntuktidak takut melainkan taat terhadap hukum, karena masyarakat di matahukumadalahsama,artinya hukum bukan untuk orang berduit,berpangkatdanmempunyai jabatan. Pada kesempatan itu dia menyampaikan terimakasih kepada semua pihak yang telah memberikan dukungan selama menjabat Kapolres Nias Selatan sehingga Kamtibmas yang kondusif dapat tercipta di tengahtengah masyarakat. Selain itu, Erick Bhismo mengaku memiliki kesan tersendiri selamamenjabatsebagaiKapolres Nias Selatan di mana daerah ini

menyimpankeindahanalamdan menjadi surga bagi orang-orang yang suka berpetualang. Acara serah terima jabatan yang dirangkai dengan acara pelepasanmantanKapolresNisel, Leonardus Erick Bhismo dan Ketua Bhayangkari Polres Nisel Ny. Stevanni Bhismo terlihat seluruh personil sangat terharu disertai isak tangis karena merasa sedih berpisah dengan pimpinan yang selama ini dikenal sangat akrabdengananggota.Keberangkatan Erick Bhismo dan istri diwarnai dengan pelepasan sepasangburungmerpatikeudara sambil diiringi lagu Kapan Kau Kembali.(a25)

Jalan Provinsi Di Tinada Rawan Longsor Besar PAKPAK BHARAT (Waspada): Jalan Provinsi yang terletak di kawasan Kec. Tinada, Kab. Pakpak Bharat terjadi longsor dan diperkirakan berpotensi longsor besar jika tidak ada upaya pembangunan bronjong. Pantauan Waspada di lapangan, Sabtu (11/ 2),kinilokasilongsorsudahterlihatsemakinmelebar setelah beberapa hari lalu terjadi longsor yang nyaris menutup badan jalan. Sedangkan parit semen yang sebelumnya sudah dibangun di lokasi tersebut, kini tertutup total, akibatnya saat hujan lebat turun seluruh badan jalan menjadi aliran air sepanjang pemukiman Santar Julu. Warga mengharapkan kepada instansi terkait,

Kadistan Ajak Petani Serentak Berantas Hama Lalat Buah KABANJAHE(Waspada): Kepada Dinas Pertanian (Kadistan) Kab. Karo Agustoni Tarigan SP ajak masyarakat petani bersama melakukan pemberantasan hama lalat buah secara serentak, agar perkembangan hama yang menjadi permasalahan kita bersama dapat berkurang, baru-baru ini. Serangan hama lalat buah yang menjadi permasalahan para petani di Kab. Karo sejak tahun 2000, kini mulai meresahkan para petani, khususnya petani jeruk. Bebarapa cara yang dilakukan para petani dalam memerangi populasi lalat buah sepertinya kurang efisian, disebabkan karena kurangnya pengetahuan masyarakat petani jeruk tentang penanganan lalat buah secara benar. KepalaDinaspertanianAgustoniTariganSPyangditemui Waspada mengatakan, persoalan hama lalat buah yang terjadi di Kab. aro sebenarnya sudah menjadi maslah klasik, di mana pihak pertanian selalu menganjurkan kepada para patani agar bisa bersama sama memerangi populasi perkembangan hama lalat buah. Disebutkan, beberapa cara maupun tips telah disampaikan, seperti mengutip buah jeruk yang sudah jatuh lalu dimasukan dalam kantong plastik atau ditanam ke tanah minimal 50 cm, lalu melakukan perangkap lalat yang tersebut dari sisa botol air mineral dan selanjutnyamengoleskanperekatdiselembarkertasdengancaradigantungkan di batang pohon jeruk. Lanjut Agus juga mangatakan, ke depan para petani dalam melakukan budi daya jeruk secara benar, salah satunya dengan jarak tanaman 6x6 meter, di mana sirkulasi udara berjalan dengan baik. “Selanjutnya lakukan pemupukan dengan benar agar dalam pengaturan dapat lebih berimbang. Juga lakukan pemangkasan terhadap tanaman, agar hasil tanaman buah jeruk menjadi lebih besar dan udara yang masuk pun sempurna,” ujarnya.(c10)

Fisik Catam Harus Tangguh PEMATANGSIANTAR (Waspada): Seleksi kesamaptaan jasmani calon tamtama (Catam) prajurit karir (PK) gelombang I TA 2012 betul-betul dilaksanakan selektif sesuai petunjuk Danrem 022/PT Kolonel Inf Karsiyanto dengan harapan para Catam menjadi prajurit yang mempunyai fisik tangguh. “Dalam pelaksanaan tes, para Catam tidak asal melaksanakan, sebab kesamaptaan jasmani sangat berpengaruh kepada pelaksanaan seleksi selanjutnya,” sebut Kajasrem 022/PT Kapten Inf. Margana selaku penanggungjawab pelaksanaan tes kesamaptaan jasmani saat seleksi kesamaptaan jasmani Catam PK gelombang I TA 2012 dimulai, Rabu (8/2) dan direncanakan berlangsung sampai Kamis (16/2) di Makorem 022/PT. Kapenrem 022/PT Mayor Caj Drs. Prinaldi menambahkan, Catam yang mendaftar di Ajenrem 022/PT gelombang I TA 2012 mencapai 310 orang dan sesudah menjalani pemeriksaan administrasi dan lulus 294 orang. “Bagi yang lulus, menjalani tes kesehatan di Rumkit TNI AD Pematangsiantar. Untuk menjalani tes kesehatan ini dibagi beberapa gelombang dan bagi yang sudah dinyatakan lulus kesehatan berhak mengikuti tes kesamaptaan jasmani dan pelaksanaan tes kesamaptaan jasmani dilaksanakan di lapangan sepakbola Makorem 022/PT,” ujarnya. Menurut Kapenrem, dalam pelaksanaan tes kesamaptaan jasamani itu harus benar-benar dan sungguh-sungguh serta penuh percaya diri. “Jangan asal-asalan, karena tes kesamaptaan ini terdiri lari 12 menit, pull up, sit up, push up, shutle run serta ada tes renang. Dengan demikian, akan didapatkan Catam yang bisa andalkan serta baik fisiknya,” katanya. Kesegaran jasmani itu, lanjut Kapenrem, sangat penting dalam menunjang fisik dan mental dalam pendidikan nanti dan jangan mengambil resiko di hari kemudian. “Dalam rekrutmen prajurit, seleksi apa saja dan untuk apa saja, bila dilakukan dengan benar dan jujur, merupakan awal dari keberhasilan. Untuk itu berjuanglah pra Catam sekuat tenaga dan semampunya.” (a30)

AKBP Leonardus Eric Bhismo Kapolres Langkat STABAT (Waspada): Kapolres Langkat AKBP Mardiyono dimutasi ke Mabes Polri bidang SDM. Penggantinya AKBP Leonardus Eric Bhismo (foto) sebelumnya Kapolres Nias Selatan. Acara pisah sambut berlangsung di Lapangan Bhara Daksa Mapolres Langkat di Stabat, Kamis (9/2). AKBP Mardiyono yang telah bertugas di Langkat dua tahun lebih dalam sambutannya memohon maaf kepada masyarakat jika dalam memimpin banyak terdapat kesalahan. Sementara AKBP Leonardus Eric Bhismo, mohon dukungan dan masukan dari seluruh lapisan masyarakat utamanya agar dapat terus memelihara kekondusifan wilayah dan kerukunan umat beragama, sebagaimana terjalin selama ini. Sementara Bupati Langkat H. Ngogesa Sitepu yang turut hadir mengucapkan terima kasih atas pengabdian pejabat lama.(a03)

Karyawan Theme Park Diliburkan Setiap Rabu PANTAICERMIN (Waspada): Karyawan objek wisata Pantai Cermin Theme Park di Desa Pantai Cermin, Kec. Pantai Cermin, Kab. Serdang Bedagai yang dikelola PT. KawasanWisata Pantai Cermin (PT. KWPC), diliburkan setiap hari Rabu. Asisten Direktur Sales dan Marketing, Hj.T. Feria Aznita didampingi Ops Manager, Lee Beng Teik dan Supervisor Security, Ramdani mengatakan, Kamis (9/2), kebijakan Pantai Cermin Theme Park setiap hari Rabu, terhitung 8 Februari - 11 April 2012 diliburkan guna perawatan fasilitas, seperti, andaman Fast Food, Lobby Theme Park, Sandy Beach, Open Stage, Life Guard, Genset, dan Lansd Caping, kecuali resort hotelnya. “Kebijakan ini untuk menjaga kenyamanan bagi pengunjung yang menikmatifasilitasPantaiCerminThemePark,yangintinyauntukmenjaga fasilitas agar pengunjung lebih nyaman,” sambung Hj. T. Feria. Bagi pengunjung Pemerintahan Provinsi, lanjutT. Feria, kabupaten atau lainnya, Pantai Cermin Theme Park tetap dibuka, sehingga dipastikan tidak akan mempengaruhi kunjungan.(c03)

Waspada/Saut Boangmanalu

LOKASI longsor yang nyaris menutup badan jalan di Santar Julu Desa Silima Kuta Tinada Kec. Tinada Kab. Pakpak Bharat. Foto direkam, Sabtu (11/2).

Waspada/Bothaniman Jaya Telaumbanua

PEJABAT lama, AKBP Leonardus Erick Bhismo, S.IK, SH dan Kapolres Nias Selatan yang baru, AKBP Juliat Permadi Wibowo, S.IK, MH melakukan salam komando usai serah terima jabatan di Mapolres Nias Selatan.

Pangkostrad: Banyak Pejabat Masuk Penjara Karena Abaikan Kejujuran SIDIKALANG (Waspada): Panglima Komando Strategis Angkatan Darat (Pangkostrad) LetjenTNI AY. Nasution mengkritisikaraktermanusiayangbanyak tidak baik. “Banyak pejabat masuk penjara karena kejujuran diabaikan demi keuntungan pribadi, ujar Pangkostrad dalam ceramahnya di Balai Budaya Sidikalang Kab. Dairi, Sabtu (11/2). Begitu juga anak sekolah, lanjut Pangkostrad, di manamana terjadi tawuran. Pramugari danpilotmengkonsumsinarkoba ituterjadikarenasudahkehilangan karakter yang baik. “Mengatasi hal itu semuanya, sikap harus jujur tegas dan bersemangat sehingga ketahanan nasional dapat tercapai,” katanya. Ketahanan nasional tidak dapat dicapai apabila tidak didasari ketahanan keluarga, lingkungan, semangat dan kejujuran. Di hadapan ratusan warga, tokoh masyarakat, tokoh agama, OKP, unsur Muspida, jenderal bintang tiga itu mengatakan, ketahanan nasional hanya dapat tercapai apabila didasari ketahananpribadi,keluarga,lingkungan, kejujuran dan semangat. Sebab kemenangan selalu berpihak kepada orang yang bersemangat.

Tidak terkecuali apakah itu muda atau tua. Dikatakan, kedatangannya ke Sidikalang atas undangan Bupati Dairi untuk memberikan ceramah kepada masyarakat. Ia didampingi istri, Hanun Siregar, Kasdif 1 Kostrad, Brigjen Kam-

barin, Irkostrad, Kol Inf. Musa Bangun, Aster Kostrad, Kol Anjar. Rombongan Pangkostrad disambutWakil Bupati, Irwansyah Pasi ,SH,Dandim0206Dairi,LetkolInf. BennySatria,KapolresAKBPEnggarPareanon,Kajari,PendiSijabat, SH dan tokoh masyarakat. (a20)

Banyak Desa Pakpak Bharat Belum Punya Jaringan Listrik PAKPAK BHARAT (Waspada): Sejumlah kawasan di Kota Salak Ibukota Kab. Pakpak Bharat sampaisaatinimasihditemukanbelummendapat jaringan listrik, Bahkan sejumlah warga di berbagai desa belum menikmati aliran listrik. “PLN Salak diminta bersinergi dengan pihak Pemkab Pakpak Bharat untuk menuntaskan kebutuhan listrik tersebut,” ujar Dosma Anakampun, Sekretaris DPC Partai Demokrat Kab. Pakpak Bharat di Salak, Minggu (12/2) menanggapi kondisi beberapa desa, bahkan sejumlah kawasan ibukota Kab. Pakpak Bharat, yanghinggasaatinimasihadakawasanpemukiman warga yang belum menikmati aliran listrik PLN untuk kebutuhan sehari-hari. Sejumlah kawasan tersebut dikatakan Dosma harus segera mendapat perhatian Pemkab Pakpak Bharat dan terutama PLN selaku pengelola listrik. “Sejak lama kita telah mendorong Pemkab Pakpak Bharat untuk menuntaskan kebutuhan listrik tersebut dan ternyata hingga saat ini masih kita temukan di sejumlah kawasan,” ungkapnya. Ia berharap dalam dua tahun kepemimpinan Remigo Yolando Berutu, MBA Bupati Pakpak Bharat dan Ir. H. Maju Ilyas Padang Wakil Bupati

Pakpak Bharat kebutuhan listrik tersebut sudah diselesaikan. Di beberapa kawasan yang dimaksud antara lainDusunPealagatDesaSalakI,DusunLaeCilum DesaSalakI,DusunLaeMbalnoDesaBoangmanalu dan Dusun Napatolong Desa Boangmanalu. Sementara di sejumlah desa dan kecamatan lain di Kab. Pakpak Bharat yang hingga saat ini belum dialiri listrik antara lain sekitar tiga desa di Kec. pagindar, Desa Sibongkaras Kec. Salak, Desa Simerpara Kec. Pergetteng-getteng Sengkut (PGGS), Desa Siempat Rube Empat Pangkalen, Desa Kuta Laki, Desa Gorat Kec. Siempat Rube dansejumlahdusunlain yangtersebardisejumlah kecamatan Kab. Pakpak Bharat.Warga berharap listrik yang merupakan salah satu kebutuhan vital dapat segera dipenuhi. “Rasanya kami belum merdeka, belum menikmati pembangunan dari negara ini saat kami secara nyata nikmatnya hidup dengan penerangan listrik seperti warga lain yang ada di Kab. Pakpak Bharat ini,” ungkap Kosman Boangmanalu yang bermukim di sekitar kawasan Lae Mbalno Kuta Jojong Desa Boangmanalu Kec. Salak. (csb)

Wali Kota Dukung Penegakan Hukum Terhadap Berbagai Kasus Waspada/Natar Manalu

PANGKOSTRAD Letjen TNI AY.Nasution dan istri Hanun Siregar setelah mendapat ulos dari tokoh masyarakat diapit Wakil Bupati, Irwansyah Pasi, SH (kiri) dan anggota DPRD Pisser Simamora.

Masyarakat Lalang Dukung Fadly Jadi Gubsu TEBINGTINGGI (Waspada): Masyarakat Kelurahan Lalang, Kec. Rambutan, KotaTebingtinggi meminta kepada anggota DPRD Sumut Daerah Pemilihan (Dapil) III yang juga Ketua DPW PPP Sumut, H. Fadly Nurzal, SAg untuk bersedia menjadi calon Gubernur Sumatera Utara (Gubsu) pada Pilgubsu 2013. Alasan dukungan, karena dinilai Fadly adalah sosok yang peduli dengan masyarakat kecil hingga mau mendengar dan menyampaikan aspirasi masyarakat ke tinggkat provinsi. Hal itu disampaikan tokoh masyarakat Abdul Rahman dalam kegiatan reses di Jalan Bukit Bundar, Ling. III, Kel. Lalang, Kec. Rambutan, Tebingtinggi, Kamis (9/2) siang. Hadir dalam kegiatan reses tersebut, Sekretaris Camat Rambutan Surya Darma, Kapolsek Rambutan AKP M Simarmata, Ketua DPC PPP Tebingtinggi, Syahbuddin Abduh Hasibuan, SHI,Wakil Ketua Arham, Bahrian Saragih, Sekretaris Asnawi Mangkualam, SHI, Bendahara Muhammad Zakwan, SAg, tokoh masyarakat, agama dan tokoh adat serta ratusan pengurus PPP mulai tingkat cabang hingga tingkat ranting se- Kota Tebingtinggi Dalamkesempatanitu,Abdul Rahman juga menyampaikan beberapa keluhan warga, seperti pembuatanjalanpenyeberangan di Simpang Takari, Jalan KLYosudarso, Kel. Lalang, karena banyak sudah memakan korban jiwa karena kecelakaan lalulintas. Ke-

yakni Pemprov Sumatera Utara , untuk segera melakukan peninjauan ke lokasi longsor dan segeramelakukanpembangunanlokasiterjadinya longsor sebelum terjadinya longsor yang lebih besar. Dengandilakukannyapembangunantembok penahan pada lokasi longsor diharapkan badan jalanakantetapbertahansertamenghindariresiko kecelakaan saat terjadi longsor pada kawasan tersebut. Bukan hanya pada titik longsor, hampir sepanjang jalan Tinada yang terdiri dari tebing tanah dan jurang berpotensi longsor, untuk itu diharapkan kepada pihak terkait untuk segera melakukan pembenahan. (csb)

mudian, masalah jalan Pasar Kebun yang terletak di Ling. IV, Kel. Lalang ada jalan tembus sepanjang 1300 meter ke Jalan Gunung Lauser, karena pihak perkebunan PTP Nusantara III pernah berjanji setelah warga mengumpulkan tanda tangan sebanyak 100 orang jalan tersebut akan diberi pihak perkebunan. “Tetapi, setelah tanda tangan masyarakatterkumpul,pihakPTP Nusantara III malah mengorek perbatasan dengan membuat parit sedalam dua meter dan ini sudah berlangsung dari tahun 2007 lalu,” papar Rahman. Menjawab pertanyaan masyarakat, dalam reses anggota DPRD Sumut, H. Fadly Nurzal akan menindaklanjuti dengan

berkordinasi dengan pimpinan perkebunan yang berada di Kota Medan. Dia menyatakan siap membantu warga demi kemaslahatan umat di Kota Tebingtinggi. “Semua itu butuh proses, akan kita tindaklanjuti dengan memanggilpimpinanPTPNusantara III, dan warga agar menyerahkan copy tanda tangan yang sudah diperbuat permohonannya,” tandasnya. Menanggapi permintaan masyarakat untuk maju menjadi calon Gubsu mendatang, Fadly Nurzal mengatakan ibarat air yang mengalir. Dan apabila permintaan itu datang dari seluruh masyarakatSumut,diasiapuntuk membawa amanah masyarakat tersebut. (a11)

Waspada/Ist

KETUA DPW PPP Sumut, H. Fadly Nurzal menerima aspirasi masyarakat Kelurahan Lalang, Tebingtinggi.

PEMATANGSIANTAR (Waspada): Wali Kota Hulman Sitorus, SE menyatakan sangat mendukungpenegakanhukumterhadapberbagai kasus di Kota Pematangsiantar dan sangat mengharapkanhukumdikotaitudijalankan seadiladilnya. Wali Kota menyatakan itu saat temu pisah Kajari Pematangsiantar antara pejabat lama Katar Ginting, SH, MH dengan pejabat baru Rudi Haryanto Pamenan, SH di Convention Hall International & Restaurant, Jalan Gereja, Kamis (9/2) seperti dikutip Kabag Humas dan Protokoler Pemko Drs. Daniel H Siregar, Sabtu (11/2). Seraya mengucapkan selamat datang dan selamat bertugas, Wali Kota mengharapkan pejabat baru melakukan seperti yang dilakukan pejabat lama, agar dapat menjadi pembimbing dan pengarah yang baik guna membangun Pematangsiantar,pelayankepentinganmasyarakat dan sesuai visi dan misi kota itu, pejabat baru diajak bersama bergandeng tangan untuk membangun kota hingga menjadi kota yang mantap, maju dan jaya. Kepada pejabat lama,Wali Kota mengucapkan terimakasih selama bertugas di Pematangsiantar, meski terasa singkat atas kemitraan yang dijalin selama ini antara Kejari dengan Muspida serta Pemko. “Mudah-mudahan menjadi awal yang baik untuk menciptakan pemerintahan yang bersih (clean government) untuk perbaikan sistem

penyelenggaraan pemerintahan di Pematangsiantar.” Senada dengan itu, Ketua DPRD Marulitua Hutapea, SE menyebutkan selama pejabat lama di Pematangsiantar, banyak pengetahuan tentang hukum diperoleh di kota itu hingga dengan kedatangan Kajari yang baru diharapkan kemajuan Pematangsiantar dapat ditingkatkan khususnya dengan adanya kasus-kasus yang ada agar ditegakkan dengan seadil-adilnya. Sementara, Kajari yang baru menyatakan siap melanjutkan kebijakan yang sudah dilaksanakan Kajari sebelumnya. “Saya berharap, pemerintah dan masyarakat memberikan dukungan hingga dapat menambah warna bagi pembangunan di Pematangsiantar untuk menciptakan good government dan clean government.” Malam pisah sambut itu dihadiri Wakil Wali Kota Drs. Koni Ismail Siregar, Wakil Ketua DPRD ZainalPurbasertaanggotaDPRDlainnya,Danrem 022/PT Kolonel Inf Karsiyanto, Dandim 0207/ Simalungun Letkol Arh Edi Setiawan,Waka Polres Kompol Anggi N Siregar, S.Ik, tokoh masyarakat, para SKPD jajaran Pemko, berbagai organisasi masyarakat dan para pegawai Kejari. Pisah sambut Kajari itu berlangsung penuh kekeluargaan dan diwarnai penyerahan ulos kepada Kajari yang baru dari Ketua PMS Pematangsiantar DR. HC. Minten Saragih. (a30)

Pemuda Muhammadiyah Harus Kritis SIMALUNGUN (Waspada): Ketua Pimpinan Wilayah Pemuda Muhammadiyah (PWPM) Sumatera Utara, Ikhsan Rambe, SE, MSi, menegaskan, gerakan Pemuda Muhammadiyah akan selalu konsisten kepada gerakan dakwah amar makruf nahyi munkar serta meningkatkan kaderisasi. “Pemuda Muhammadiyah sebagai kader umat, kader bangsa harus berperan aktif dalam menjalani kehidupan berbangsa dan bernegara serta menjadi patner pemerintah dalam melaksanakan pembangunan, namun tetap kritis,” kata Ikhsan Rambe pada acara pelantikan Pimpinan DaerahPemudaMuhammadiyahKab.Simalungun periode 2010-2014 di gedung MUI Jalan Sangnaualuh, Pematangsiantar, Sabtu (4/2). Dikatakan, tugas Pemuda Muhammadiyah ke depan semakin berat, seiring dengan perkembangan zaman. Pemuda Muhammadiyah juga merupakan kadernya muhammadiyah yang akan melangsungkan tongkat estafet Muham-madiyah di masa-masa mendatang. “Untuk itu, kepada seluruh unsur Pimpinan Daerah Pemuda Muhammadiyah Simalungun

yang telah dilantik, benar-benarlah berbuat, tunjukkan karya nyata, sehingga kader Pemuda Muhammadiyah bermanfaat di tengah-tengah masyarakat. Sedangkan untuk pemerintah, Pemuda Muhammadiyah harus bisa menempatkan diri sebagai patner, tetapi tetap kritis, bukan sebagai tukang stempel,” harap Ikhsan. KetuaPimpinanDaerahPemudaMuhammadiyah Simalungun, Edy Suryadi Sinaga menyatakan pihaknya beserta pengurus lainnya akan berupaya secara maksimal menjalankan amanah sesuaidenganyangtelahdigariskandalamgerakan dakwahdanperjuanganPemudaMuhammadiyah. Selain Ketua PWPM Sumatera Utara, hadir juga pada acara tersebut Sekretaris PWPM, Adrizal, SH, Bupati Simalungun diwakili Kepala KesbangpolLinmas, Ir. JadiamanPurba,Kadispora Simalungun, Jarinsen Saragih, SH, Ketua KNPI Simalungun, Elkananda Shah, Wakil Ketua PD Muhammadiyah Simalungun, Bahrum Saragih, PD Aisyiah, Pimpinan Alwasliyah, Ketua PPP Simalungun Pardi Nasution, PDPM Siantar, M. NasirSiregardanparaPimpinanCabangMuhammadiyah se-Simalungun. (a29)


Sumatera Utara

B6 WASPADA

Pemimpin Umum Dr. Hj. Rayati Syafrin Pemimpin Redaksi/Penanggung Jawab H. Prabudi Said Wakil Pemimpin Umum/Wapemred H. Teruna Jasa Said Wakil Penanggung Jawab H. Sofyan Harahap Redaktur Senior H. Azwir Thahir Pemimpin Perusahaan: Dr. Hj. Rayati Syafrin. Wakil Pemimpin Perusahaan: H. Bahtiar Tanjung. Iklan: Hj. Hilda Mulina (Kabag), Rumondang Siagian (Medan), Lulu (Jakarta). Redaktur Pelaksana Berita: Armin Rahmansyah Nasution. Redaktur Pelaksana Opini & Artikel: Dedi Sahputra. Redaktur Minggu & Akhir Pekan: Muhammad Thariq. Redaktur Berita: H. Halim Hasan, Hendra DS. Redaktur Medan: David Swayana. Redaktur Sumatera Utara: H.T. Dony Paridi. Redaktur Aceh: M. Zeini Zen. Redaktur Luar Negeri: H. Muhammad Joni. Redaktur Nusantara: Edward Thahir. Redaktur Olahraga: Jonny Ramadhan Silalahi. Redaktur Ekonomi: Armin R. Nasution. Redaktur Agama: H. Syarifuddin Elhayat. Litbang: H. Akmal AZ (Kabag). Humas: H. Erwan Effendi (Kabag), Aidi Yursal. Sekretaris Redaksi: Hj. Hartati Zein. Pemasaran: H. Subagio PN (Medan), Zultamser (Sumatera Utara), Sinur Manik (Aceh). Asisten Redaktur: Irwandi Harahap (Medan); Irham Hagabean Nasution (Sumatera Utara); Armansyah Thahir (Sumatera Utara, Otomotif); Diurna Wantana (Aceh); Austin Antariksa (Olahraga, KMS Kreasi); Syafriwani Harahap (Luar Negeri, Popular, Pariwisata); Rudi Faliskan (Berita); Erwin Siregar (Opini); Hj. Hoyriah Siregar (Ekonomi); T. Junaidi (Hiburan); Hj. Erma Sujianti Tarigan (Agama), Hj. Neneng Khairiah Zen (KMS Remaja, Mode); Anum Purba (Keluarga); David Swayana (Infotainmen); Hj. Ayu Kesumaningtyas (Kesehatan); Dedi Riono (Budaya); Denny Adil (Pelangi). Wartawan Kota Medan: Umum: Zulkifli Harahap, Amir Syarifuddin, Ismanto Ismail, Rudi Arman, Zulkifli Darwis, H. Abdullah Dadeh, H. Suyono, Ayu Kesumaningtyas, Feirizal Purba, Gito AP, M. Ferdinan Sembiring, M. Edison Ginting, Anum Purba, Sahrizal, Sulaiman Hamzah, Sugiarto, Rustam Effendi, Mursal Alfa Iswara, Andi Aria Tirtayasa, Maini Anggita, Silfa Humaira. Olahraga: Austin E. Antariksa, H. Syahputra MS, Setia Budi Siregar, Dedi Riono. Fotografer: Muhammad Faisal, Hang Tuah Jasa Said, Surya Effendi, Hamdani. Otomotif: Armansyah Thahir. Koran Masuk Sekolah/KMS: Dedek Juliadi, Hajrul Azhari Ritonga. Wartawan Jakarta: Andi Yanto Aritonang (Koordinator Liputan), Hermanto, H. Ramadhan Usman, Hasriwal AS, Nurhilal, Edi Supardi Emon, Agus Sumariyadi, Dian Warastuti, Aji K, Yuslan Kisra. Wartawan Sumatera Utara: Binjai: H. Riswan Rika, Nazelian Tanjung. Deli Serdang: H.M. Husni Siregar, Hotma Darwis Pasaribu, Rizaldi Anwar, M. Suhandi Nasution. Serdang Bedagai: Eddi Gultom, Edi Sahputra. Stabat: H. Ibnu Kasir, Abdul Hakim. Pangkalan Brandan: Chairil Rusli, Asri Rais. Kabanjahe/ Berastagi: Dickson Pelawi, Basita Bukit, Dedek Mohan Basri Hasibuan, Micky Maliki. Tebing Tinggi: Muhammad Idris, Abdul Khalik. Pematang Siantar: Mulia Siregar, Edoard Sinaga. Simalungun: Ali Bey, Hasuna Damanik, Balas Sirait. Aek Kanopan: Indra Muheri Simatupang, Syahril Ilham. Rantau Prapat: H. Nazran Nazier, Armansyah Abdi, Neirul Nizam, Budi Surya Hasibuan. Kota Pinang: Hasanuddin Harahap, Deni Syafrizal Daulay. Pangururan: Edison Samosir. Balige: Jimmy Sitinjak. Sidikalang: Natar Manalu. Pakpak Bharat: Arlius Tumanggor. Tarutung: Parlindungan Hutasoit, Marolop Panggabean. Sibolga/Tapanuli Tengah: Zulfan Nasution, Alam Satriwal Tanjung. Padangsidimpuan: H. Syarifuddin Nasution, Sukri Falah Harahap, Ahmad Cerem Meha. Gunung Tua: Sori Parlah Harahap. Sibuhuan: Idaham Butarbutar, Syarif Ali Usman. Panyabungan: Munir Lubis, Sarmin Harahap, Alpin Lubis. Gunung Sitoli: Bothaniman Jaya Telaumbanua. Kisaran: Nurkarim Nehe (Koordinator Liputan Asahan, Batubara & Tanjungbalai), Bustami Chie Pit, Sapriadi. Batubara: Helmy Hasibuan, Agus Diansyah Hasibuan, Sahril, Iwan Hasibuan. Tanjung Balai: Rahmad Fansur Siregar, Rasudin Sihotang. Wartawan Aceh: Banda Aceh: Aldin Nainggolan (Ka Perwakilan), Iskandarsyah (Koordinator Liputan), Muhammad Zairin, Munawardi Ismail, Zafrullah, T. Mansursyah, T. Ardiansyah, Jaka Rasyid, Gito Rollies. Lhokseumawe: Bustami Saleh (Ka Perwakilan/Koordinator Liputan), M. Jakfar Ahmad, Zainal Abidin, Zainuddin Abdullah, Maimun, Arafat Nur. Kuala Simpang: Muhammad Hanafiah, Hasanul Hidayat. Langsa: H. Syahrul Karim, H. Ibnu Sa’dan, H. Samsuar. Lhoksukon: Musyawir, Mustafa Kamal. Idi: Muhammad H. Ishak. Bireuen: HAR Djuli, Amiruddin, Abdul Mukti Hasan. Takengen: Bahtiar Gayo, Irwandi. Sigli: Muhammad Riza, H. Rusli Ismail. Sabang: T. Zakaria Al-Bahri. Subulussalam: Khairul Boang Manalu. Tapaktuan: Zamzamy Surya. Blangpidie: Sudarmansyah Putra. Kutacane: Mahadi Pinem, Ali Amran. Blangkejeren: Bustanuddin, Wintoni. Bener Meriah: Khairul Akhyar, Irham Hakim. Singkil: Tarmizi Ripan, Mansurdin. Sinabang: Muhammad Rapyan.

� Semua wartawan Waspada dilengkapi dengan kartu pers. Tidak dibenarkan menerima uang dalam bentuk apapun. Jangan layani dan segera laporkan ke pihak berwajib atau ke Sekretaris Redaksi bila ada oknum yang mengaku wartawan Waspada tetapi tidak bisa menunjukkan kartu pers yang sah, ditandatangani Pemimpin Redaksi �

Hubungi kami Penerbit: PT Penerbitan Harian Waspada Komisaris Utama: Tribuana Said Direktur Utama: dr. Hj. Rayati Syafrin, MBA, MM SIUPP: 065/SK/MENPEN/SIUPP/A.7/198 tanggal 25 Februari 1988 Anggota SPS No. 13/1947/02/A/2002 KANTOR PUSAT Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 4150858, Faks Redaksi: (061) 4510025, Faks Tata Usaha: (061) 4531010. E-mail Redaksi: redaksi@waspadamedan.com KANTOR PERWAKILAN DAN BIRO � Perwakilan dan Biro Jakarta: Jalan Siaga II No. 6 C Pejaten Barat, Pasar Minggu Jakarta Selatan. Tel: (021) 79197052, Faks: (021) 79199874. � Perwakilan dan Biro Banda Aceh: Jalan Ratu Syafiatuddin No. 21 C, Banda Aceh. Tel & Faks: (0651) 22385. � Perwakilan dan Biro Lhokseumawe: Jalan Iskandar Muda No. 65, Lhokseumawe. Tel: (0645) 42109. � Biro Asahan, Batubara & Tanjungbalai: Jalan Sutami No. 30 Kisaran. Tel: (0623) 41412. Harga iklan per mm kolom: Hitam-putih Rp. 11.000,-, berwarna Rp. 30.000,Halaman depan: hitam-putih Rp. 33.000,-, berwarna Rp. 90.000,Ukuran kolom: 40,5 mm. E-mail Iklan: iklan@waspadamedan.com Pencetak: PT Prakarsa Abadi Press, Jalan Sidorukun Medan. Isi di luar tanggung jawab percetakan

34 Pria Ikuti KB Medis Operasi LIMAPULUH (Waspada): Sebanyak 34 peserta terlayani dalam akseptor KB Medis Operasi Pria (MOP), kegiatan bulan bakti Ikatan Bidan Indonesia Keluarga Berencana (IBI-KB) Kesehatan Tahun 2012 yang berlangsung di lapangan Indrapura Kec. Air Putih, Kab. Batubara, Rabu (8/2). ‘’Ini mencerminkan tingginya kesadaran masyarakat untuk mengikuti program KB,’’ tukas Kepala Badan Pemberdayaan Perempuan Anak dan Keluarga Berencana (PPAKB) Kab. Batubara, MaslindaWansari kepada Waspada terkait kegiatan tersebut. Batubara katanya mendapat target MOP 30 orang, namun ternyata dapat terlayani akseptor sebanyak 34 orang. KegiatanitudidukungBKKBNProvsudenganmenurunkanMopen (Mobil Pelayanan) bersama tim medis dan Dokter Spesialis Urologi bekerja sama dengan PPAKB dan Organisasi IBI Batubara dan turut dihadiri Asisten I, H. Zulhendri, SH beserta dinas terkait. (a13)

Waspada/Iwan Has

TIM medis sedang melayani peserta kontap pada kegiatan bulan bakti IBI KB Kesehatan Batubara.

WASPADA Senin 13 Februari 2012

Pemulung Ratakan Puing Kebakaran Pasar Kisaran KISARAN (Waspada): Kurang lebih selama empat hari pasca kebakaran, para pemulung memanfaatkan puing sisa bangunan Pasar Inpres Kisaran, di mana hasilnya dijual untuk menyambung hidup. Para pemulung mengambil potonganbesipondasibangunan, walaupun berbahaya dan telah memakan korban jiwa, kegiatan itutetapmerekalakukan.Dengan kerja sama yang baik, bangunan 403 pintu itu rata dengan tanah. “Kamimemecahkanbatudan merobohkan bangunan hanya untuk mengambil besi pondasi yangdijualdenganhargaRp4ribu per kilogram, walaupun berbahaya tapi tetap kami lakukan untuk mendapatkan uang,” ujar Paino, 35, salah pemulung asal Airjoman, ditemui Waspada,

Sabtu (11/2) saat memeriksa potongan bisa yang tersisa dari lokasi bangunan yang sudah rata dengan tanah. Menurutnya, dalam menghancurkan bangunan mereka hanya menggunakan alat seadanya yaitu martil dan gergaji besi dan bekerja secara kelompok. “Selama satu hari, kami berhasil mengumpulkanbesilebihkurang 10 kilogram, dan itu sudah cukup memenuhi kehidupan keluarga selama satu hari,” ujar Paino, Sebelumnya, Pasar Inpres Kisaran Jalan Diponegoro - Jalan

Dr. Sutomo d/h Listrik hangus terbakar, 403 kios dan dua ruko hangusterbakar,tidakadakorban jiwa namun kerugian diperkirakan mencapai miliaran rupiah, Sabtu (4/2) sekitar pukul 03:30. Bupati AsahanTaufan Gama Simatupang, saat pertemuan dengan para pedagang korban kebakaran Pasar Inpres Kisaran, Senin (6/2), di Gedung Serbaguna, Kisaran, menuturkan, akan membangun kembali Pasar Kisaran. Dan untuk menunggu hal itu pihaknya telah merancang bangunan pasar darurat sebanyak 403 kios di Jalan Sutomo - Teuku Umar, Jalan Cipto-Sutomo, Jalan T. Umar-Sutomo dan Jalan CiptoSM Raja, dengan tujuan agar roda perekonomian masyarakat tetap berjalan. (a15)

Waspada/Sapriadi

SEORANG pemulung sedang memotong besi pondasi sisa bangunan Pasar Inpres Kisaran yang terbakar belum lama ini.

Alumni MTsN Damuli Pekan Gelar Seminar Anti Korupsi AEKKANOPAN (Waspada): Korupsi adalah salah satu musuh bersama yang harus diperangi, karena korupsi merupakan salah satu musuh terbesar di negara ini. Karenanya, alumni MTsNDamuli Pekan yang menimba ilmu di Jakarta ikut terpanggil untuk memerangi korupsi tersebut. Para alumni MTsN Damuli Pekan yang aktif di beberapa universitas di Jakarta pulang ke kampungnya dan menggelar seminar sehari yang berthema, ‘Negeriku, Negerimu, Negeri Kita bebas dari korupsi’. Acara digelar di gedung MTsN Damuli Pekan Kec.KualuhselatanLabura,Kamis (9/2), mendatangkan narasumber anggota KPK dari Jakarta. Acara yang dihadiri Kakan Kemenag Labuhanbatu Drs. H.A. Zaman Harahap, Sekretaris Dinas Pendidikan Labura Drs. Dwi Prantara dan Kepala Sekolah MTsN Damuli Pekan Drs. H. MaraposanRambesertaparapeserta seminar terdiri dari pelajar dan guru, membahas tentang bahaya korupsi dan contoh contoh korupsi dalam kejadian sehari hari. Kakan Kemenag Labuhan-

batu Drs. H. A. Zaman Harahap mengaku salut dan bangga melihat para alumni MTsN Damuli Pekan yang telah memprakarsai terselengggaranya acara ini, inisiatif yang mereka lakukan merupakan anak yang mengingat orangtuanya, katanya.

Kepala Dinas Pendidikan Labuhanbatu Utara diwakili Sekretarisnya Drs. Dwi Prantara mengatakan atas nama pemerintah khususnya Dinas Pendidikan memberikan apresiasi yang setinggi tingginya kepada para alumni. (c08)

Waspada/ Syahri Ilham Siahaan

KAKAN Kemenag Labuhanbatu Drs. H. A Zaman Harahap, anggota KPK Yudi Purnomo, S.Hum, Sekretaris Dinas Pendidikan Drs. Dwi Prantara dan Kepsek MTsN Damuli Pekan Drs. H. Maraposan Rambe, saat acara seminar sehari Negeriku, Negeri Kita bebas dari Korupsi.

Gugat Direktur PDAM Tirta Silaupiasa LIMAPULUH (Waspada): Direktur PDAM Tirta Silaupiasa Kab. Asahan digugat melalui PTUN Medan, terkait pemberhentian dengan tidak hormat Syahriadi Nasution sebagai karyawan PDAM setempat. Dirinya terakhir bertugas sebagai KepalaUnitPDAMLabuhanruku dan Limpuluh, (Batubara) sebagaimana surat gugatan didaftarkan pada 6 Januari 2012. SuratditujukankepadaKetua PTUN Medan ditandatangani SyahriadiNasution,38,penduduk Jalan Bacang, Dusun IV Desa

Benteng Kec. Talawi, Batubara. Disebutkan, Direktur PDAM Tirta Silaupiasa melalui surat keputusan No: 880/1275/PDAMT/2011 tentang pemberhentian dengan tidak hormat sebagai karyawan perusahaan, karena tidak disiplin dalam melaksanakan tugas tertanggal 12 Desember 2011, dan tertera dalam objek gugatan. Sesuai dengan pasal 53 ayat 1 Undang-undang No.5 1986 jo Undang-undang No.9 Tahun 2004, Undang-undang 51 Tahun 2009 tentang Peradilan Tata

Usaha Negara (PTUN), maka penggugat mempunyai kepentingan untuk mengajukan gugatan karenadirugikanolehPDAMTirta Silaupiasa, karena tidak bekerja lagi sebagaimana terbitnya surat keputusandirekturdimaksuddan surat itu baru diterima penggugat tanggal 13 Desember 2011 melalui Kades. Penggugat disebutkan sudah bekerjaselama17tahunterhitung sejakTahun1994s/d1997pegawai honorer, 1997 s/d 2001 calon pegawai tetap, dan 2001 s/d 2011 pegawai tetap. (a13)

Pemkab Batubara Dongkrak Kunjungan Wisatawan SEISUKA (Waspada): Pemkab Batubara terus berupaya mendongkrakjumlahkunjungan wisatawan ke berbagai objek wisata yang ada di daerah hasil pemekaran Kab. Asahan ini. “Baik wisatawan lokal maupun regional. Jumlahnya akan terus kita upayakan untuk meningkat dari waktu ke waktu,” ujar Kadis Kebudayaan, Pariwisata, Pemuda dan Olahraga (Budparpora) Kab. Batubara H. Helman Herdadi, SH MAP dalam arahannya pada acara pembukaan sosialisasi Sadar Wisata di aula Buffet Mangga Simpang Kopi, Kec. Seisuka, Rabu (8/2). Untuk itu, lanjut Helman, diperlukan sikap dan prilaku warga Batubara dalam upaya meningkatkanjumlahkunjungan wisatawan itu. Warga, terutama pelakupariwisatadaerahiniharus

mampu memiliki sikap prilaku yang dapat membuat wisatawan betah, nyaman dan terkesan berkunjung di berbagai objek wisata Batubara. Sikap prilaku 5 S, senyum, salam, sapa, sopan dan santun harus dimiliki dan dikembangkan warga khususnya pelaku pariwisata, ujar Helman. Menurutnya, Batubara telah memiliki modal dasar sebagai daerah tujuan wisata. Panorama dan keindahan alam pariwisata Batubara, tak kalah dengan objek wisata daerah lain. Diantaranya pantaiPerjuangandiDesaLalang, Kec. Medangderas. “Hamparan pasirputihnyayangluas,takkalah indahnya dengan pantai di Bali. Hanya saja infrastrukturnya saja, seperti hotel yang minim,” ujar Helman. “Namun, jika jumlah kunjungan wisatawan terus mening-

kat, investor diharapkan datang berinvestasi membangun infrastruktur pariwisata di Batubara ini,” tegasnya. Meningkatnya kunjungan wisatawan ke Batubara otomatis akan meningkatkan perekonomian sekaligus pendapatan warga. Hal ini merupakan program Bupati Batubara H. OK Arya Zulkarnain,SH,MMdalamupaya mewujudkan Batubara Sejahtera Berjaya, ungkap Helman lagi. Kabid Pariwisata Disbudparpora Batubara, Semi Suharto dalam laporannya mengatakan, sosialisasisatuharipenuhinidiikuti 20 peserta. Berasal dari berbagai objek wisata yang ada di Batubara. Kepada peserta tidak hanya diberikanteori,tetapijugapraktek langsung yang dipandu staf Disbudparpora Batubara. (c04)

Waspada/Iwan Has

BUPATI Batubara H. OK Arya Zulkarnain, SH, MM didampingi Ketua TP PKK, Hj. Khadijah Arya, meninjau pelaksanaan operasi bibir sumbing.

TP PKK Batubara Gelar Operasi Bibir Sumbing LABUHANRUKU (Waspada): PKK salah satu unsur yang mempunyai visi dan misi mulia, baik membangun keluarga, masyarakat dan daerah. Bupati Batubara yang juga selaku dewan peyantun PKK, H. OK Arya Zulkarnain, SH, MM mengatakan hal itu ketika membuka pelaksanaan bakti sosial operasi bibir sumbing diselenggarakan Tim Penggerak PKK setempat di Puskesmas Rawat Inap, Labuhan Ruku, Kec Talawi, Sabtu ( 11/2). ‘’Kegiatan ini jangan dinilai dari jumlah peserta mengikuti, namun lebih bermakna membesarkan jiwa mereka (masyarakat),’’ tukas bupati. Dirinya tidak lupa mengajak komponen masyarakat bersama membangun Batubara dalam upaya mewujudkan harapan mengejar ketertinggalan selama ini. ‘’Jangan banyak bicara, namun diperlukan masyarakat adalah kenyataan,’’ ujarnya sembari mengingatkan kembali awal pemekaran APBD BatubaraberjumlahRp250miliar,namunbertahap terdongkrak berkat dukungan bersama mencapai

Rp633miliardanhampirmenyamaiAsahanselaku kabupaten induk. ‘’Marilahkitabangunsebaik-baiknya‘Batubao’ (Batubara),’’ pintanya kepada tokoh agama dan masyarakat beserta undangan yang hadir, terdiri jajaran SKPD, Camat Talawi/Tg. Tiram, Abdul Lufthi, S.Sos, M. Nasir Yuhanan, S.Sos, Kepala Puskesmas,DRBuangSuwardi,KapolsekLabuhan Ruku, AKP H Matondang, Danramil 04, Kapten Inf, S Siregar, kades dan terkait. Ketua TP PKK Kab Batubara, Hj. Khadijah Arya, mengatakan, organisasi kepemimpinannya merupakan mitra pemerintah menggerakan pembangunan sebagaimana dalam pilar utama sampai membina kehidupan keluarga dan masyarakat. ‘’Ini sesuai visi dan misi organisasi berdayakan kaum wanita dalam membangun baik di keluarga dan masyarakat. Mudahmudahan kita semakin eksis melakukan,’’ ujar kak Ijah akrab dipanggil. (a13)

Penggunaan KUHP Dalam Sengketa Pers Kriminalisasi LIMAPULUH (Waspada): Pengaduan empat anggota DPRD Batubara yang tak senang dengan pemberitaan tentang Rp80 miliar ke Polsek Limapuluh, jika ditanggapi polisi dan gunakan KUH Pidana dalam pemrosesan sengketa pers, adalah kriminialisasi terhadap pers. Demikian disampaikan anggota Dewan Kehormatan Daerah PWI Sumut Nurhalim Tanjung Kepada Waspada, Minggu (12/2). Menurutnya, anggota DPRD yang terhormat harus melakukan hak jawabnya di media yang bersangkutan. Jika masih tidak puas, dapat mengadukan ke Dewan Pers Daerah. “Tidak bisa bantahan atau hak jawab itu dilakukan di media yang lain. Anggota DPRD yang terhormat itu juga tidak bisa mengadu ke polisi sebelum melakukan hak jawabnya. Polisi juga tidak bisa menggunakan KUHPidana dalam sengketa pers. Mahkamah Agung RI telah mengeluarkan surat edaran ke seluruh institusi hukum untuk gunakan UU Pers dalam sengketa pers,” kata Nurhalim. Lebih lanjut dikatakannya, wartawan yang diadukan oleh DPRD ini dapat mengadukan persoalaninikeDewanPersmaupunPWIsehingga dapat difasilitasi. Secara terpisah juru bicara Lintas Elemen Masyarakat Batubara (LEM-BB) Arsyad Nainggolan mengecam keras sikap DPRD Batubara yang terganggudenganpemberitaanyangmengungkap kas Pemkab Batubara Rp80 miliar yang hilang mengalir ke DPRD untuk membentuk angket wakil bupati.

Sebab, sejak dana itu dinyatakan hilang oleh PPATK, DPRD Batubara tidak melakukan tindakan apapun, baik untuk mencari fakta keberadaan dana itu, apalagi meminta pertanggungjawaban Bupati Batubara. Malahan, DPRD Batubara turut mengamini dana itu, semula dinyatakan piutang kemudian dikatakan sebagai deposito Pemkab Batubara di Bank Mega. Meskipun Pemkab Batubara tidak dapat menunjukkan dokumen yang menyatakan bahwa dana Rp80 miliar yang hilang itu adalah deposito atau piutang, atau apapun namanya. “DPRD Batubara seharusnya malu kepada rakyat dengan kelemahan mereka menghadapi Bupati Batubara, sehingga tidak mampu berbuat apapun meski dana yang seharusnya digunakan untuk pembangunan hilang. Tapi hari ini mereka mengadukan wartawan yang terus menyoroti keberadaan dana itu ke polisi, sehingga rakyat yang semula mendapatkan informasi tentang dana itu terancam tidak menerima informasi itu lagi,” terang Arsyad. Sebelumnya anggota DPRD yang juga Ketua Komisi A DPRD Batubara Al As’ari mengatakan, kedatangan mereka ke Polsek Limapuluh adalah konsultasi mengenai pemberitaan yang dilakukan oleh J. Siahaan. Kapolsek Limapuluh mengatakan, kalaukedatangananggotaDPRDitumaumengadu, namun harus melengkapinya lebih dulu. Sejumlah wartawan yang berada di Batubara merencanakan, Senin (13/2) akan mengadakan aksi solidaritas dan keprihatinan atas sikap DPRD Batubara yang dinilai anti kebebasan pers. (c05)

Bupati Asahan Beri Hadiah Kepada Desa/Kelurahan KISARAN (Waspada): Bupati Asahan Drs. H. Taufan Gama Simatupang akan memberi hadiah kepada desa/kelurahan atas keberhasilan mengelola dana bantuan keuangan desa/kelurahan. Kabag Humas Pemkab Asahan Rahman Halim, AP kepada Waspada, Kamis (9/2) menyatakan, sebanyak 131 desa/kelurahan akan menerima hadiah dari Bupati Asahan atas keberhasilan mengelola dana bantuan keuangan desa yang telah diberikan Pemkab Asahan kepada setiap desa/kelurahan antara Rp100 juta hingga Rp300 juta. Hadiah yang akan diberikan Bupati Asahan kepada desa/kelurahan adalah berbentuk

penambahansatukalilipatdanabantuankeuangan desa/kelurahan. “Misalnya, bila desa tersebut menerima dana pada tahun 2011 sebesar Rp150 juta, maka Pemkab akan menyalurkan dana tersebut menjadi Rp300 juta untuk tahun ini,” ujar Halim. Halim menambahkan, desa yang mendapatkanhadiahituselainmampumemanfaatkandana denganbaik,danadesatersebutdigunakandengan tepat sasaran serta mampu menggali potensi dan keunggulan yang terdapat di desa/kelurahan tersebut. “Hal itu diutarakan Taufan Gama Simatupang saat menghadiri Musrenbang Kec. Teluk Dalam, Rabu (8/2),” ungkap Halim. (a31)

Polisi Tangkap Pengedar Ganja TANJUNGBALAI ( Waspada): Petugas Kepolisian Resort Kota Tanjungbalai berhasil menangkap lelaki diduga pengedar narkoba yang menyimpan 10 paket kecil (amp) ganja kering, Rabu (9/2) siang. Informasi dihimpun Waspada, penangkapan tersangka DW, 20, warga Jalan Sipori-pori, Kel. Kapias Pulau Buaya, Kec. Teluknibung, Kota T. Balai berawal dari informasi masyarakat. Petugas kemudian melakukan pelacakan dan pengintaian terhadap rumah korban. Polisi kemudian menyergap rumah tersangka. Benar saja, dari tangan DW ditemukan ganja 10 amp siap edar. Selain itu ada pula kertas tiktak

(khusus ganja) disimpan dalam kotak bekas rokok 10 lembar. Tersangka berikut barang bukti kemudian dibawa ke kantor polisi untuk dimintai keterangan. Dari pengakuannya, barang haram itu dibeli dari seorang warga Tanjungbalai berinisial K seharga Rp80 ribu. Kapolres Tanjungbalai AKBP Edward P Sirait melalui Kasubbag Humas AKPY Sinulingga ketika dikonfirmasi Waspada, membenarkan penangkapan bandar ganja. Sinulingga mengimbau kepada masyarakat agar menjauhi segala bentuk narkoba karena akan merugikan diri sendiri, keluarga, dan masyarakat. (a32)

Kisrus Yayasan Islamiyah Londut AEKKANOPAN (Waspada): Terkait kisruh Yayasan Islamiyah Londut, Pembina Yayasan H. Ilham Sagala, SH menyayangkan sikap Pemkab Labura yang dalam hal ini dilakukan Asisten I yang memberikan dukungan kepada pengurus yayasan yang bermasalah. Hal itu diungkapkan Ilham kepada Waspada, Sabtu (12/2) menanggapi keberpihakan Asisten I Pemkab Labura kepada pengurus yayasan yang bermasalah. Dikatakannya, seharusnya Pemkab melalui Dinas Pendidikan dan bukan Asisten I, bisa memberikan solusi untuk menyelesaikan

permasalahan di Yayasan Pendidikan Islamiyah Londut. Menurutnya, jika Asisten I ingin membantu pihak pengurus seharusnya dia menyarankan agar pengurus membuat pertanggungjawaban keuangan dan bukannya membuat akte baru di mana hal itu tentunya menyalahi peraturan yang berlaku tentang yayasan. Ketua Yayasan Islamiyah Londut H. Muhammad Basir Mathaeran ketika dihubungi melalui ponselnya tidak diangkat. Begitu juga ketika Waspada mengkonfirmasikanhalitumelalui pesan singkat ke ponsel, juga tidak dibalas. (a16)


Sumatera Utara

WASPADA Senin 13 Februari 2012

B7

30 Anggota DPRD Paluta Ramai-ramai Ke Bandung GUNUNGTUA (Waspada): Sejumlah kalangan kaget, begitu mengetahui 30 anggota Dewan Perwakilan Rakyat Daerah (DPRD) Kab. Padanglawas Utara (Paluta), ramai-ramai berangkat ke Bandung. “Mereka berangkat ke Bandunguntukmengikutibimbingan teknis (Bimtek) tentang sosialisasi pedoman penyusunan R-APBD tahun2012,termasukdidalamnya terkait arah kebijakan PP. nomor 24tahun2004tentangkedudukan protokolerdankeuangananggota DPRD dan perubahan-peruba-

hannya,” ujarKetuaDPRDPaluta, Muklis Harahap SHi kepada Waspada, Jumat (10/2). Muklis mengatakan, Bimtek diikuti 30 anggota DPRD ini berlangsungtigahari,mulai11sampai 13 Februari. Bimtek tersebut, kata Muklis, sebenarnya bisa diikuti secara bergelombang,

Pengangkutan Sampah Di Madina Terkendala PANYABUNGAN (Waspada): Akibat sarana dan prasarana yang sangat terbatas, pengangkutan sampah di Kab. Mandailing Natal (Madina), khususnya dari kawasan jalan protokol berada di kota Panyabungan terkendala. Sejauh ini sampah yang bisa diangkut setiap hari hanya sekitar 30 kubik atau 5 kali truk pengangkut memuat sampah tersebut. Hal tersebut diungkapkan Kepala Badan Lingkungan Hidup, Kebersihan dan Pertamanan Ir. Miswar Erfendi didampingi Kepala Bidang Kebersihan dan Pertamanan Rahmadsyah Lubis di Panyabungan Minggu (12/2). “Pemkab Madina, dalam hal ini Badan Lingkungan Hidup, Kebersihan dan Pertamanan saat ini hanya memiliki lima unit truk sampah. Dari jumlah itu, truk –truk tersebut hanya bisa sekali saja mengangkut sampah setiap harinya. Artinya volume sampah yang bisa diangkut setiap harinya tidak sampai setengah,” ujarnya. Sementara petugas kebersihan yang ada, katanya, hanya 34 orang, terdiri dari empat orang ditambah satu sopir setiap truk, dan sisanya tukang sapu di beberapa titik. Sementara bak sampah yang dimiliki Madina sekarang ini sebanyak 30 unit, 6 unit ambrol dan 8 unit tempat pembuangan sampah (TPS). Ia juga menuturkan, bahwa sampah-sampah yang diangkut dari beberapa titik pembuang sampah di sekitar kota Panyabungan itu dibawa ke Tempat Pembuangan Akhir (TPA) berlokasi di Bukit Kemuning, Kec. Panyabungan Barat. “Sampah-sampah itu dibuang ke Bukit Kemuning, namunTPA itu juga sangat minim fasilitas seperti alat berat excavator maupun loder. Lain lagi jalan menuju tempat pembuangan itu yang sudah sangat memprihatinkan, jika musim hujan truk pembawa sampah sulit sekali melintasinya,” paparnya. Untuk mengatasi kekurangan sarana dan prasarana tersebut, Miswarmenyebutkansudahdiajukanpihaknyasetiaptahunanggaran. Namun,sejauhinibelumbisaditampungakibatbelummencukupinya dana APBD untuk kebutuhan itu. Begitu juga halnya dengan penambahan tenaga kerja yang jumlah standarnya 200 orang, juga belum dapat diatasi. Menjawab pertanyaan tentang upah pekerja kebersihan di daerah itu, Miswar menjawab bahwa baru tahun ini naik menjadi Rp1,5 juta per bulan dari Rp800.000 hingga Rp900.000 per bulan setiap orangnya. (a28)

Polisi Minta Warga Bantu Berantas Togel, Miras Dan Narkoba GUNUNGTUA (Waspada): Kapolres Tapsel, AKBP Subandriya, SH,MHmelaluiKapolsekPadangBolak,AKPJWSijabat mengharapkan kepada seluruh elemen masyarakat Padanglawas Utara (Paluta) agar membantu Polri terutama dalam memberantas segala bentuk penyakit masyarakat, seperti masalah judi, togel, minuman keras (miras), narkoba, serta usaha-usaha ilegal lainnya. Menurutnya,penyakitmasyarakatinimerupakantindakkejahatan yang harus dibasmi secara bersama-sama. “Supaya semuanya tidak menjadi masalah di tengah-tengah masyarakat, semua pihak harus ikut mendukung, dan tidak hanya polisi. Masyarakat merupakan ujung tombak pemberantasan tindak pidana kejahatan. Nah, di sinikelihatanperanmasyarakatuntukberperandalampemberantasan penyakit masyarakat di bumi Paluta,” ujar Kapolsek, AKP JW Sijabat menyikapi tuntutan Gerakan Mahasiswa Peduli Paluta terkait pemberantasan judi di Paluta, Rabu, (8/2) di Gunungtua. Kapolsek menyebutkan, pemberantasan perjudian bukan semata tugas kepolisian, tetapi juga memerlukan peran serta masyarakat untuk melaporkan langsung kepada pihak kepolisian apabila ada permainan judi di kawasan tempat tinggalnya. “Dengan masyarakat yang kritis, maka pemberantasan segala penyakit masyarakat di Paluta dapat maksimal, bahkan bisa hilang dengan sendirinya apabila pemberantasannya atas dasar dukungan kesadaran masyarakat itu sendiri,” jelasnya. Ia juga berharap seluruh elemen masyarakat untuk melaporkan bila melihat praktik perjudian. Sehingga pihaknya dapat bergerak cepat melaksanakan fungsinya sebagai pengayom masyarakat. “Apabila melihat aksi perjudian, hendaknya warga langsung dapat melapor kepada Babinkantibmas setempat. Dengan adanya kerjasama yang baik, kami akan langsung dapat bergerak dan melaksanakan kewajiban kami sebagai polisi,” ucap Kapolsek. (a35)

Mara Datuk Menjadi Anggota DPRD Paluta GUNUNGTUAWaspada): Mara Datuk Tanjung resmi menjabat sebagai anggota DPRD Kab. Padanglawas Utara, setelah dilantik Ketua DPRD Muklis Harahap, Kamis (9/2) di aula Gedung DPRD Paluta, Jalan Lintas Gunungtua-Padangsidimpuan. Politisi Partai Amanat Nasional ini dilantik sebagai Pengganti Antar Waktu (PAW) DPRD Paluta yang menggantikan H. Wildan Tanjung yang sekarang menjabat sebagi Bupati Labuhanbatu Selatan (Labusel). Prosesi acara pelantikan anggota DPRD pergantian antar waktu (PAW), masa jabatan 2009-2014 itu, dilaksanakan dalam rapat paripurna istimewa di Gedung DPRD Paluta. Bupati Padanglawas Utara, Drs. H. Bachrum Harahap dalam sambutannya mengucapkan selamat kepada anggota DPRD yang baru dilantik. Diharapkan kepada anggota PAW yang telah dilantik, agar dapat mengemban tugas anggota DPRD sebaik mungkin, serta mengemban tugas masing-masing, karena DPRD berperan dalam keberhasilan pemerintahan daerah. “Sebagai wakil rakyat, kita harus bisa menerima aspirasi masyarakat, dan saya yakin dengan PAW ini jalannya kinerja dewan akan semakin baik,” sebut Bachrum. Dia berharap anggota DPRD yang baru dilantik dapat melakukan kerjasama yang baik dengan para anggota DPRD, utamanya dalam membangun citra baik DPRD dan mengemban tugas sebaik mungkin dan siap melaksanakan tugas-tugas sebagai wakil rakyat untuk memperjuangkan kepentingan masyarakat Paluta. Di tempat terpisah, Mara Datuk Tanjung yang juga politisi asal Kec. Simangambat ini juga mengucapkan terimaksih kepada Bupati Paluta, Drs. H. Bachrum Harahap yang juga turut hadir dalam pelantikannya. “Saya juga akan mengemban tugas sebaik mungkin dan siap melaksanakan tugas-tugas sebagai wakil rakyat untuk memperjuangkan kepentingan masyarakat Paluta,” kata Datuk. Turut hadir dalam pelantikan tersebut, Bupati Paluta, Drs. H. Bachrum Harahap, Ketua DPRD Paluta, Muklis Harahap, Wabup Paluta, H. Riskon Hasibuan, Plt Sekda, Husni Afgani Hutasuhut, unsur pimpinan daerah Paluta, anggota DPRD serta pejabat pemerintah, sanak keluarga dan para undangan lainnya. (a35)

namun karena mengingat padatnya jadwal sidang, maka dilakukan satu kali dan semua anggota DPRD mengikutinya. Muklis menegaskan, Bimtek tersebut penting, agar DPRD dapat memiliki pemahaman bagaimana menggunakan hak budgetDPRDterkaitregulasibaru yang ada, agar pembahasan RAPBD nantinya dapat berlangsung secara profesional dan proporsional. Selain sosialisasi pedoman penyusunan R-APBD, lanjut Muklis, materi penting lainnya dalam Bimtek itu, termasuk bagaimana arah kebijakan PP. nomor24tahun2004.“Inikitapelajari atau dilakukan pendalaman agar tidak terjadi kesalahan dan kekeliruan,” tandas Muklis. Ditanya apakah ada baiknya

pemateri dari Bandung yang datang ke Paluta dibandingkan ramai-ramai anggota DPRD ke Bandung, Muklis menjelaskan, itu sebenarnya cara yang baik, tetapi akan menjadi pertimbangan, sebab seharusnya hal ini dikoordinasikan sejak awal. Apalagi, lanjut Muklis, kegiatan inibukanhanyakabupatenPaluta saja, tetapi juga ada dari kabupaten dan kota yang lain. Disinggungsoalpemborosan anggaran, Muklis mengatakan, memang dari segi jumlah anggaran terkesan besar, tetapi DPRD merupakan representasi rakyat yang perlu dibekali agar dapat membahasataumengawasipenggunaan anggaran secara baik. Disinggung juga, apabila ada anggota DPRD yang tidak ikut berangkat baik yang berhalangan

ataupun memang benar-benas malas untuk berangkat seperti kejadian beberapa tahun sebelumnya, Muklis mengatakan bagi siapa yang tidak ikut berangkat gelombang ini, maka dia harus berangkat pada gelombang kedua bergabung dengan daerah kabupaten/kota lain. Dengan demikan, Muklis berharap kepada semua anggota DPRD yang berangkat mengikuti Bimtek ini supaya dapat mengikutinya dengan bersungguhsungguh dan serius, pasalnya ini merupakanbekalkitauntukdapat memakmurkan masyarakat kabupaten Padanglawas Utara. “Dengan dilaksanakan Bimtekiniselamatigaharipenuh,diharap kinerja anggota DPRD Kabupaten Padanglawas Utara semakin baik,” harap Muklis. (a35)

“Tidak Ada Alasan Yuridis Nonaktifkan Sekda Madina” PANYABUNGAN(Waspada): JabatanSekdamerupakanjabatan karir tertinggi di lingkungan birokrat Pemprov dan Pemkab/ Pemko. Jabatan Sekda bukan jabatan politis, sehingga untuk memberhentikan seorang PNS dari jabatan Sekda harus mengacu pada peraturan perundangundangan, bukan karena alasan politis. Karena itu tidak ada alasan yuridis untuk menonaktifkan Sekda Madina, M.Daut Batubara. DemikiandisampaikanKetua DPC PERADI Tabagsel, Ridwan Rangkuty, SH.MH, kepada Waspada, Minggu (12/2) di Panyabungan terkait unjukrasa Gerakan Masyarakat Madina Care dan DPP IM3 beberapa hari lalu yang meminta Bupati Madina, Hidayat Batubara, menonaktifkan Sekda Madina, Daud Batubara. Katanya, desakan tersebut terlalu prematur dan terkesan pemaksaan kehendak. Jika alasannya karena M.Daud Batubara terkait dugaan kasus korupsi Rp4,5 miliar yang bersumber dari dana APBD Kota Padangsidimpuantahun2007,sebaiknyakasus dugaan KKN tersebut dicek ulang apabenardugaankorupsisebesar

itu, untuk mengetahui duduk perkara yang sebenarnya. Ridwan Rangkuty, Dosen FakultasHukum UMTS yang juga penasehat hukum tetap Pemko Padangsidimpuan ini menambahkan, untuk diketahui publik, ia terus memantau perkembangan kasus tersebut. Walaupun M.DaudBatubarabersamabeberapa pejabat Pemko Padangsidimpuan telah diperiksa Kejatisu. Namun, pemeriksaan tersebut masih dalam tahap pengumpulan bahan dan keterangan (PULBAKET), sehingga status M.Daud Batubara dalam pemeriksaan itu masih sebagai saksi,danbukantersangkaseperti kabar yang banyak beredar Dengan demikian secara yuridis, M.Daud Batubara tidak bisadihakimisecarapolitisdengan menonaktifkannyasebagaiSekda Madina. Kecuali suatu saat nanti M.DaudBatubaraditetapkanbersalah oleh pengadilan, dan putusannyaberkekuatanhukumtetap. “Saya meminta kepada semuapihakuntukdapatmenghormati proses hukum yang sedang berjalan, dan berpegang teguh kepadaasashukumpradugatidak

bersalah,” ucap Ridwan. Ketua LSM Harapan Madina ini juga mengatakan, sangat mendukung setiap gerakan yang tujuannya untuk penegakan hukum dan perbaikan Madina kedepan,sesuaivisidanmisiyang dilontarkannya dulu termasuk penegakan hukum untuk menciptakan pemerintahan Madina yang bersih dan bermartabat. Ia yakin,Bupati dan Wakil Bupati akan mengambil sikap menurut hukum jika M.Daud Batubara sudah dinyatakan bersalah secara hukum. Untuk itu ia mengajak semua pihak memberikan apresiasi dan dukungan kepada Kejatisu untuk melakukan tugas dan wewenangnya secara hukum tanpa intervensi dan muatan politis. Ia berharap semua pihak memberikankesempatankepada duet Tri Batu (M.Hidayat Batubara, Dahlan Hasan Nasution alias Batu, dan .M.Daud Batubara), untuk melakukan reformasi total di Madina, ke arah positif sesuai visi dan misi yang disampaikan kepada masyarakat dan DPRD saat kampanye. (c14)

Bank Sumut P.Sidimpuan Bantu Modal Usaha 8.000 Perempuan AEKBADAK (Waspada): PT Bank Sumut Cabang Padangsidimpuan melalui program SumutSejahtera(SS),telahmembina dan membantu modal usaha 8.000kaumperempuandiwilayah Kab. Tapanuli Selatan, Padanglawas, Padanglawas Utara, dan Kota Padangsidimpuan. “Program pemberdayakan usaha ini dikhususkan bagi kaum perempuan, dengan tujuan agar bisa membantu suami dalam meningkatkan kesejahteraan keluarga,”kataDirutBankSumut, H. Gus Irawan Pasaribu, Minggu (5/2). Ini diutarakaannya saat peringatan Maulid Nabi Muhammad SAW 1433 H/2012 M tingkat Kab. Tapsel di lapangan bola kaki Desa Aekbadak Jae, Kec. Sayurmatinggi. Kehadirannya juga atas nama Ketua Masyarakat Ekonomi Syariah (MES) Sumut. Programinidijalankanbukan hanya di wilayah Bank Sumut Cabang Padangsidimpuan saja, tapi di seluruh wilayah Sumatera Utara. Hingga kini sudah ada 65.000 lebih kaum perempuan peserta program SS 1 dan 2 di Sumut,dengandanayangdigulirkan mencapai Rp230 miliar. Berbicara mengenai keislaman, kata Gus Irawan, di dalam agama yang diajarkan Rasulullah ini juga ada konsep pemberdayaanekenomi.SepertiZakat,Infak,

Sadakah (ZIS) dan wakaf tunai yang diberdayakan untuk membantu modal usaha para mustahak atau yang berhak menerima ZIS.“Bazis Nasional menyebutkan bahwa warga Indonesia sebagai penduduk paling banyak pemelukagamaIslamdalamsatu negara di dunia, memiliki potensi ZIShinggaRp217triliun,”ujarGus Irawan. Namun ZIS yang terkumpul higga kini baru Rp1,3 triliun. Hal ini mungkin dikarenakan belum semuaumatmuslimdiIndonesia membayarkan zakat, infak, dan sadakahnya ke Badan Zakat Infak Sadakah (Bazis). Sementara di Bank Sumut sendiri, katanya, setiap tahun zakat produktif yang terkumpul dari karyawan Bank Sumut mencapai Rp1,8 miliar. Dana itu telah diberdayakan sebagai pinjaman bergulir untuk memodali usaha para mustahak. Bantuan dana bergulir itu disalurkan tanpa bunga dan agunan. “Hingga kini 5.000 mustahik (yang berhak menerima zakat) telah memanfaatkannya. Kita berharap usaha mereka berjalan lancar, sehingga dua atau tiga tahun ke depan mereka bukan lagi sebagai mustahik tapi muzakki (pemberi zakat),” harapnya. Bantu Gapura Pada kesempatan itu Gus

Irawan menyerahkan bantuan PT Bank Sumut sekitar Rp500 juta lebih untuk pembangunan dua gapura perbatasan ke Pemkab Tapsel.Yakni gapura perbatasan Kab. Tapsel dengan Tapanuli Tengah di Desa Garoga, Kec. Batangtoru. dan perbatasan Kab. Tapsel dengan Tapanuli Utara di Desa Luat Lombang Hutaimbaru, Kec. Sipirok. “Semua pemerintah daerah di Sumut adalah pemegang saham PT Bank Sumut, dan Pemkab Tapsel pemilik saham terbesar kedua setelah Pemprovsu. Tiap tahun kita berikan deviden atau bagi hasil ke pemegang saham,” ujarnya. Tahun ini Pemkab Tapsel mendapat bantuan pembangunan dua gapura perbatasan, dan tahun lalu menerima mobil double cabin. Semua pemerintahan daerah mendapat bantaun, tapi tidak sekaligus dalam setahun. “Perlu saya tegaskan, Bank Sumutbukanhanyamemberikan bantuan kepada Pemkab Tapsel tapi juga kepada daerah lainnya. Jangan sempat timbul prasangka karena Tapsel tanah kelahiran saya, maka hanya daerah ini saja yang menerima bantuan Bank Sumut,” ujarnya dan disambut tawa ribuan warga. (a27)

Waspada/Sukri Falah Harahap

BUPATI Tapsel, Syahrul M. Pasaribu, bersama anggota DPRD-SU, Mulkan Ritonga, dan lainnya meninjau jembatan gantung yang dibangun dari PNPM-MP di Desa Silaiya, Kec. Sayurmatinggi.

PNPM-MP Atasi Penderitaan Warga SAYURMATINGGI (Waspada): Program Nasional Pemberdayaan Masyarakat Mandiri Pedesaan (PNPM-MP) berhasil mengatasi penderitaan warga Desa Silaiya, Kec. Sayurmatinggi, Kab. Tapanuli Selatan. Jembatan gantung yang rubuh beberapa tahun lalu, kini telah dibangun kembali lewat PNPM-MP. Penggunaan jembatan gantung sepanjang 60 meter dan lebar 1,8 meter yang baru selesai dibangun dengan biaya Rp242 juta dari PNPMMP tahun anggaran 2011 itu, diresmikan Bupati Tapsel, Syahrul M. Pasaribu, Rabu (8/2). “Terimakasih kepada Pemkab Tapsel dan pengelola PNPM-MP yang sudah menjawab keinginan kami. Yakni dengan mengucurkan anggaranPNPM-MP2011untukkamimanfaatkan membangun jembatan gantung,” kata Tamriah Siregar, 45, tokoh masyarakat setempat. Menurut Siregar, rambin (jembatan gantung) itu praktis tidak dapat dilalui setelah rubuh beberapa tahun lalu dan telah mengakibatkan warga Desa Silaiya menderita. Jika turun hujan, airsungaiBatangangkolameluapdansangatsusah untuk dilalui. “Tiap hujan deras, semua warga desa ini berdiam di rumah. Padahal hampir semuanya bersumber mata pencaharian dari pertanian.Warga sangat merugi akibat hasil panen tidak bisa diangkut hingga berhari-hari,” ujarnya. BupatiTapsel, Syahrul M. Pasaribu menyebut,

secara umum dana pembangunan dari PNPMMPuntukKec.SayurmatinggimencapaiRp3miliar. Telah diperuntukkan bagi pembangunan sarana danprasanadasardesa,sepertipembangunanjalan rabat beton, pipanisasi, jalan aspal, tempat mandi, cuci, dan kakus (MCK), serta jembatan gantung. Di samping itu sejak 2008 sudah ada kegiatan simpan pinjam kelompok perempuan (SPP) di Kec. Sayurmatinggi. Jumlahnya Rp1,2 miliar dan telah digunakan 106 kelompok beranggotakan 613 kepala keluarga. SPP ini berjalan lancar, karena tingkat pengembaliannya mencapai 98 persen. Untuk tahun ini direncanakan Kec. Sayurmatinggi menerima alokasi dana PNPM-MP Rp3 miliar. “Semoga termanfaatkan dengan semaksimal mungkin,” harap Bupati Tapsel. Mengenaijembatangantungyangmerupakan aksesutamapenghubungarealpemukimanwarga ke lokasi pertanian, diharap keberadaannya saat ini dapat meningkatkan kesejahteraan masyarakat sekitar. HadirWakil Sekretaris PG DPRD-SU Mulkan Ritonga, Kepala Bapemmas dan Pemdes Tapsel Rustam Efendi Hasibuan, anggota DPRDSU PasiruddinDaulaydanParluhutan,anggotaDPRD Tapsel Asgul Idihan Dalimunthe dan Ali Imran, Muspida, pimpinan SKPD, Ketua TP PKK Hj. Syaufia Lina, tokoh adat, agama, pemuda, dan ratusan warga. (a27)

Jalan Ke Pantai Barat Memprihatinkan PANYABUNGAN (Waspada): Tokoh masyarakat Kec. Batahan Kab. Mandailing Natal (Madina) H. Amran Nasution mengungkapkan persoalan infrastruktur jalan yang rusak parah di kawasan pantai barat sudah meresahkan masyarakat. Pasalnya, kerusakan sudah berlangsung lama, namun belum juga mendapatkan perhatian serius dari pemerintah. “Dana perbaikan kerusakan jalan di kawasan pantai barat Madina perlu diperjuangkan agar bisa ditampung di APBD Sumut. Kondisi yang sangat parah dijumpai di Kec. Batahan, karena sudah lama tidak disentuh pembangunan. Jika kemarau debu akan datang mengumpal, apabila musim hujan jalan yang masih kondisi tanah itu tidak bisa dilewati kenderaan,” katanya di hadapan anggota DPRD Sumut dari PPP H. Ahmad Hosen Hutagalung yang melakukan reses pertama tahun 2012 ke Madina, dipusatkan di sekretariat PPP Madina Desa Parbangunan, Kec. Panyabungan, Jumat (10/2). Amran menjelaskan, kerusakan jalan ke Batahan sudah lama dikeluhkan masyarakat, sehingga sangat diperlukan perhatian serius dari pemerintah untuk memperbaikinya. “Kami

bermohon kepada Bapak Hosen Hutagalung untuk dapat memperjuangkan nasib masyarakat di sana, yang sudah lama mendambakan adanya pembangunan jalan tersebut,” ungkapnya. Saatdialognyadenganmasyarakat,jugabanyak aspirasidanpengaduanlainyangditerimaanggota DPRD-SU ini, yang harus segera ditindaklanjuti ke pemerintah. Ahmad Hosen Hutagalung mengatakan kedatangannyakeMadinauntukmenjaringaspirasi berkembang di tengah-tengah masyarakat yang akan menjadi acuan bagi dewan dalam memperjuangkan hak-hak konstituen dalam penyusunan berbagai program pembangunan kepada pemerintah ke depan. Menurutnya,resesbukanberartimasaistirahat melainkan masa bertugas untuk dekat dengan rakyat. Karenanya, reses merupakan kewajiban yang harus dilaksanakan dan bagian dari tugas selaku wakil rakyat. AnggotakomisiBDPRD-SUitumenyebutkan, banyak masalah yang dihadapi rakyat, dan reses menjadi moment bagi dewan untuk duduk bersama rakyat memahami apa yang sedang mereka hadapi. (a28)

Pemkab Madina Launching LPSE PANYABUNGAN (Waspada): Pemerintah Kabupaten Mandailing Natal melalui Bagian Layanan Jasa dan Barang, Rabu (8/2) di aula hotel Rindang Panyabungan melakukan launching Layanan Pengadaan Secara Elektronik (LPSE). Kepala Bagian Layanan Jasa dan Barang Setdakab Madina Jufri Anthoni ST, MSi, Kamis (9/2), mengatakan, lewat kegiatan ini diharapkan dapatmenyempurnakansistempemilihanpenyediaan barang dan jasa pemerintah yang dilakukan selama ini. “Agar dapat lebih meningkatkan transparansi, akuntabilitas, efektivitas, dan efisiensi. Selain itu juga pengadaan barang dan jasa secara elektronik dapat mewujudkan pasar pengadaan nasional sehinggameningkatkanaksespasardanpersaingan usaha yang sehat serta mampu memberikan akses informasi yang real time,” ungkapnya. Menurutnya, layanan pengadaan secara elektronik adalah praktik pengadaan barang dan jasa secara elektronik yang diatur oleh pemerintah yang nantinya akan memfasilitasi Unit Layanan Pengadaan (ULP) yang saat ini masih sebagai panitia pengadaan barang dan jasa dalam melaksanakan pengadaan barang dan jasa pemerintah. “Pengadaan barang dan jasa secara elektronik bertujuan memperbaiki transparansi dan akuntabilitas,meningkatkanaksespasardanpersaingan usaha yang sehat, memperbaiki tingkat efisiensi

proses pengadaan, mendukung proses monitoring, audit dan memenuhi kebutuhan akses informasi,” ujarnya. Jufri mengungkapkan, peresmikan LPSE di Madina merupakan yang kesembilan di Sumut dengan situs www.lpse.madina.go.id sebagai salah satu media wajib untuk penayangan rencana umum pengadaan, penayangan pelelangan dan juga penayangan pemenang lelang. Pada kesempatan ini nantinya akan dimulai penayangan rencana umum pengadaan dari setiap Satuan Kerja Perangkat Daerah ( SKPD). “Langkah berikutnya yang akan kita buat berupapersiapanSDMaparaturdenganpelatihan, ujian sertifikasi bagi para kepala SKPD selaku pejabatpembuatkomitmen,panitiadankemudian aplikasi bagi setiap SKPD serta kita akan mulai menerima pendaptaran dari pihak penyedia barang/jasa untuk pelatihan tersebut,” jelasnya. Iamenuturkan,pelaksaaanpengadaanbarang secara elektronik bukanlah hal baru di Madina karenapada2011sudahmelaksanakanpelelangan secara eletronik 27 paket dengan total Rp18.531.990.172. “Kehadiran LPSE tidak hanya digunakan untuk Pemkab Madina tetapi bisa digunakan instansi vertikal lainnya dan bisa juga digunakan kabupaten/kota terdekat apabila belum memiliki LPSE sehingga kita menawarkan kerjasam pemanfataan sarana itu,” terangnya. (a28)

Partai Hanura Terbuka Untuk Balon Wali Kota P.Sidimpuan

Waspada/Sukri Falah Harahap

DIRUT Bank Sumut, H. Gus Irawan Pasaribu (kiri) menyaksikan Bupati Tapsel, Syahrul M. Pasaribu, menandatangani berita acara serah terima bantuan pembangunan dua gapura perbatasan daerah.

P. SIDIMPUAN (Waspada): DPC Partai Hati Nurani Rakyat (Hanura) yang memiliki dua kader di DPRD Kota Padangsidimpuan, terbuka untuk siapapun warga Indonesia yang ingin mencalonkan diri menjadi bakal calon (Balon) Wali Kota atauWakilWali Kota Padangsidimpuan pada Pemilukada 2012. “Tidak ada batasan harus politisi, pejabat, mantan pejabat, militer, atau pengusaha. Asalkan memenuhi persyaratan wajar yang ditentukan, Hanura akan mengusung dan mendukungnya diPemilukadananti,”kataKetuaDPCPartaiHanura Kota Padangsidimpuan, Hj. Henny Herlina SE, Kamis (9/2). Syarat paling utama, katanya, harus sehat jasmani dan rohani, memiliki visi dan misi jelas dan terukur untuk memajukan Kota Padangsidimpuan. Cakap dan terampil, memiliki SDM dan wawasan memadai, tidak cacat hukum, dan tidak terganjal peraturan perundangan.

“Kita tidak membatasi jenjang usia bakal calon wali kota dan wakil wali kota yang ingin menggunakan ‘perahu’ Hanura di Pemilukada. Meski demikian kita tetap memprioritaskan figur energik,” ujarnya. Ditanya apakah sudah ada bakal calon yang melakukan komunikasi intensif dengan mereka, atau sudah adakah pembahasan internal partai tentang figur yang akan diusung Hanura. Henny Herlina menyatakan, sejumlah figur sudah berkomunikasi intensif dengan mereka. Tapi itu belum jadi jaminan Hanura akan mendukungnya. Sedangkan sosok figur yang dibahas di internal partai, hingga kini belum ada. “Ada sejumlah nama yang datang bersilaturahim sekaligus komunikasi politik terkait Pemilukada. Hanya saja belum seorangpun yang dengantegasmenyatakanakan‘meminang’perahu Hanura sebagai kendaraan politiknya di Pemilukada nanti,” ujarnya. (a27)


Sumatera Utara

B8 Kota Medan B. Aceh Binjai Bireuen B. Pidie G. Sitoli K. Jahe Kisaran Kutacane Langsa

Zhuhur 12:41 12:54 12:42 12:49 12:48 12:45 12:42 12:37 12:44 12:44

‘Ashar 16:03 16:16 16:03 16:10 16:10 16:06 16:03 15:59 16:06 16:05

Magrib 18:41 18:52 18:42 18:47 18:48 18:48 18:43 18:38 18:45 18:43

‘Isya

Imsak

Shubuh Syuruq

Kota

19:52 20:03 19:53 19:58 19:58 19:58 19:53 19:49 19:55 19:54

05:12 05:27 05:13 05:22 04:21 05:14 05:12 05:08 05:15 04:16

05:22 05:37 05:23 05:32 05:31 05:24 05:22 05:18 05:25 05:26

L.Seumawe 12:47 L. Pakam 12:40 Sei Rampah12:39 Meulaboh 12:51 P.Sidimpuan12:39 P. Siantar 12:40 Balige 12:40 R. Prapat 12:36 Sabang 12:54 Pandan 12:41

06:39 06:54 06:40 06:48 06:47 06:41 06:39 06:35 06:42 06:42

Zhuhur ‘Ashar 16:09 16:02 16:01 16:13 16:00 16:01 16:01 15:58 16:16 16:02

WASPADA Senin 13 Februari 2012

Magrib

‘Isya

Imsak

Shubuh Syuruq

Kota

Zhuhur ‘Ashar

Magrib

‘Isya

Imsak

Shubuh Syuruq

Kota

18:46 18:41 18:40 18:51 18:41 18:40 18:41 18:38 18:52 18:43

19:56 19:51 19:50 20:01 19:52 19:51 19:52 19:49 20:03 19:53

05:20 05:11 05:11 05:23 05:07 05:10 05:09 05:06 05:28 05:10

05:30 05:21 05:21 05:33 05:17 05:20 05:19 05:16 05:38 05:20

Sibolga Sidikalang Sigli Singkil Stabat Takengon T.Balai Tapaktuan Tarutung T.Tinggi

12:41 12:42 12:52 12:45 12:42 12:48 12:37 12:47 12:40 12:39

18:43 18:43 18:50 18:46 18:42 18:48 18:38 18:48 18:42 18:40

19:53 19:54 20:01 19:57 19:52 19:58 19:48 19:58 19:52 19:50

05:10 05:12 05:25 05:14 05:13 05:20 05:07 05:18 05:09 05:10

05:20 05:22 05:35 05:24 05:23 05:30 05:17 05:28 05:19 05:20

Panyabungan 12:37 Teluk Dalam12:44 Salak 12:42 Limapuluh 12:38 Parapat 12:40 GunungTua 12:37 Sibuhuan 12:37 Lhoksukon 12:47 D.Sanggul 12:41 Kotapinang 12:35 AekKanopan 12:37

06:47 06:38 06:37 06:50 06:34 06:37 06:36 06:32 06:54 06:36

16:02 16:03 16:13 16:06 16:03 16:10 15:58 16:08 16:01 16:01

Dihisab oleh: Tim Ahli Badan Hisab dan Rukyat (BHR) Sumut

06:36 06:39 06:51 06:41 06:40 06:47 06:34 06:44 06:36 06:37

Zhuhur ‘Ashar 15:58 16:05 16:04 15:59 16:01 15:58 15:58 16:08 16:02 15:56 15:58

Magrib

‘Isya

Imsak

Shubuh Syuruq

18:41 18:48 18:44 18:39 18:41 18:40 18:40 18:45 18:42 18:37 18:38

19:51 19:59 19:54 19:49 19:52 19:50 19:50 19:55 19:53 19:48 19:49

05:06 05:12 05:12 05:09 05:10 05:06 05:05 05:19 05:10 05:05 05:07

05:16 05:22 05:22 05:19 05:20 05:16 05:15 05:29 05:20 05:15 05:17

06:32 06:39 06:39 06:35 06:37 06:33 06:32 06:46 06:37 06:31 06:34

Truk Galian C Resahkan Warga Laut Dendang PERBAUNGAN(Waspada): Masyarakat Desa Laut Dendang,Kec.Perbaungan,Kab.Serdang Bedagai merasa resah akibat truk pengangkut tanah galian C milik pengusaha berinitial R, warga Desa Jati Mulya, Kec.Pegajahan yang setiap hari lalu lalang mengangkut tanah sehingga menimbulkan debu. “Bukanhanyamenimbulkan debu berterbangan saja, tetapi jalan di desa itu juga turut hancur. Diduga galian C tersebut belum memiliki izin,” ujar Adi,34,warga

setempat kepada Waspada Sabtu(11/2) sore. Menurut Adi, setiap harinya tidak kurang seratusan dam truk melintas mengangkut tanah

Pulang Belanja Tewas Lakalantas STABAT (Waspada): Kecelakaan lalulintas (Lakalantas) di Jalinsum Wampu Kab. Langkat mengakibatkan seorang warga tewas di lokasi kejadian, sekira pukul 05:00, Sabtu (11/2). Keterangan dihimpun, korban Hermansyah, 26, warga Kebun Balok Kec. Wampu awalnya belanja sayuran di Pasar Baru Stabat untuk dijual kembali di desanya. Dalam perjalanan pulang di ruas jalan Dusun Ampera Desa Stabatlama, korban mengendarai sepedamotor Suzuki Smash BK 3023 OP bersenggolan dengan mobil (belum diketahui identitasnya) mengenai keranjang bawaan korban hingga mengakibatkan dia terjatuh dan langsung tewas di lokasi kejadian. Jenazah kemudian dibawa Polantas ke RSU Insani Stabat untuk keperluan medis dan penyelidikan lebih lanjut. Kasat Lantas Polres Langkat AKP Faidil Zikri mengatakan kasusnya masih dalam penyelidikan. ’’Mobil yang menubruk belum diketahui identitasnya karena langsung kabur,’’ katanya. Sementara itu kecelakaan lalulintas juga terjadi di ruas jalan DesaNamoEmbelinKec.KualamenujuBukitLawang,mengakibatkan seorang pelajar SMU tewas. Korban tewas, Reza S, 16, warga Tanjung Keliling Kec. Salapian akibat mendahului kendaraan lain mengendarai Suzuki Spin BK 6652 RAH tanpa memperhatikan pengendara sepedamotor di depannya hingga bertubrukan dan korban terseret, kemudian tewas. (a03)

galian C dari Dusun I Desa Laut Dendang dibawa ke berbagai pengusaha batu bata yang ada di Kec.Perbaungan dan Pegajahan. Kegiatan itu berlangsung sejak pertengahan Januari 2012. “ Kami sangat sengsara Pak. Orangmendapathasil,sementara kami warga di sini hanya menghirup debu yang setiap hari beterbangan. Sementara kepala desa kamisepertitidakmempedulikan keluhan masyarakat.Yang ironisnya lagi, kami menduga galian C itu belum memiliki izin operasional dari Pemkab Serdang Bedagai. Karena, sejauhini belum pernah pihak pengelola meminta

tanda tangan persetujuan masyarakat tentang pembuatan izin,” katanya. Camat Perbaungan Akmal dihubungi Waspada Sabtu(11/ 2) seputar dugaan galian C belum memilikiizinoperasionalviahand phone, anehnya bukan camat yang mengangkat,tetapi suara seorang perempuan yang mengatakan ini bukan nomor Camat Perbaungan. “Di sini tidak ada camat, kami semua keluarga petani,” katanya. Padahal nomor camat tersebut Waspada minta melalui Kabag Humas Pemkab Sergai H.Maryono SP. Roy selaku pengusaha galian

Bimbingan Bupati Sergai Membuahkan Hasil SEI BAMBAN (Waspada): Penghargaan KecamatanTerbaik Tingkat Provinsi Sumatera Utara Tahun 2011 yang diraih Kec. Perbaungan, Kab. Serdang Bedagai adalah berkat bimbingan dan arahan Bupati Serdang Bedagai, HT. Erry Nuradi. Untuk itu, diharapkan semua PNSjajaranDisdikdanPNSlainnya disiplin dan loyal kepada bupati, sebab tanpa disiplin yang baik, visi dan misi menjadikan Serdang Bedagai salah satu kabupaten terbaikdiIndonesiasulitterwujud. Hal itu ditegaskan Kadisdik Drs. H. Rifai Bakri Tanjung, MAP saat memberi bimbingan pada apel pagi gabungan, di halaman

kantor Camat Sei Bamban, kemarin. Hadir Sekretaris Disdik EddiSyahputra,KabidSaranadan Prasarana H. Asrul Sani, KCD Sei Bamban Preddy, Camat Sei Bamban Roy S.Pane, para Kepala Sekolah SD, SMP, SMA, PS Tk/ SD dan lainnya. Dikatakan Kadisdik, selain mendapat prestasi sebagai kecamatanterbaiktingkatSumut,Bupati HT. Erry Nuradi belum lama ini juga menerima Penghargaan Ani Idrus Award Harian Waspada, diserahkan Mendikbud Prof. Dr. Ir.H.MuhammadNuh,DEAdiHotel Aryaduta Medan. Anugerah itu diberikan kepada Bupati Serdang Bedagai

Penjual Tuak Tertangkap Berjudi SEIBAMBAN (Waspada): Tim buser Polisi Sektor (Polsek) Firdaus mengamankan tersangka pemain judi jenis kim, MPS, 40, warga Dusun XI, Martebing, Desa Sukadamai, Kec. Sei Bamban, Sabtu (11/2) malam sekira pukul 21:30. Dari tangan tersangka yang kesehariannya berjualan tuak di warung miliknya , diamankan barang bukti uang tunai Rp134 ribu, satu telepon seluler berisi nomor tebakan judi kim. Kapolsek Firdaus, AKP HelmiYusuf ketika dikonfirmasi Waspada, Minggu (12/2) membenarkan mengamankan tersangka bersama barang bukti.(c03)

PLN Binjai Lakukan Pemadaman BINJAI (Waspada): PLN Cabang Binjai melakukan pemadaman karenapembangunanHantaranUdaraTeganganMenengah(HUTM). Juga dilakukan penambahan feeder baru untuk manuver beban antara G1 Paya Geli dengan G1 Binjai. Humas PLN Binjai Sofwan Wajdi menjelaskan, Sabtu ( 11/2), PLN Binjai juga melakukan bongkar dan pasang tiang HUTM dan pasang konstruksi modifikasi. Akibat pekerjaan itu, dilakukan pemadaman aliran listrik mulai Selasa (14/2) sampai Jumat (17/2) di daerah Jalan Medan-Binjai km 11 s/d km13 (Jalan Sukabumi). Pemadaman juga dilakukan di Jl.Masjid, Merpati, Pardede, Sukabumi, Kompos, Pembangunan,Orde Baru,Sejati dan Pasar Kecil. Pemadaman dimulai pukul 09.00 sampai 16.00. (a04)

Polisi Ringkus Pemilik Sabu BINJAI (Waspada): HG, 33, penduduk Jalan Gajah Mada Km 19 Lingkungan V Kel. Tunggurono, Kec. Binjai Timur, Rabu (8/2) sekitar pukul 23:00 malam diringkus anggota Serse Narkoba Polres Binjai karena memiliki narkoba jenis sabu-sabu yang disimpang di kantong celana tersangka. Kini, tersangka HG bersama barang bukti satu paket sabu, diamankan di sel Polres Binjai guna pengusutan. Kasat Narkoba Polres Binjai AKP Achiruddin Hasibuan, SH, Mhum ketika dikonfirmasi Waspada, Jumat (10/2) membenarkan, dan menurut Kasat kasus ini masih dalam pengembangan dari mana barang haram tersebut didapatnya. Keterangan yang berhasil dikumpulkan di lapangan dan di Kepolisian menyebutkan, sebelumnya pihak Serse Narkoba Polres Binjai mendapat informasi dari masyarakat kalau tersangka baru HG memiliki sabu yang baru dibelinya. Petugas begitu mendapat informasi tersebut langsung mengadakan pengembangan dan terjun langsung ke lokasi. Begitu melihat tersangka, petugas langsung mendatangi, dan tersangka sempat mencoba untuk melarikan diri. Namun, berkat kesigapan petugas, tersangka berhasil diamankan dan ketika diperiksa petugas di dalam kantong celana tersangka ditemukan satu paket sabu. (a05)

Sekwan T. Tinggi Ketua ASDEKSI Sumut TEBINGTINGGI (Waspada): Sekretaris DPRD Kota Tebingtinggi Ismail Budiman, SH, SE, terpilih sebagai Ketua Asosiasi Sekretaris DPRD Kabupaten/Kota Seluruh Indonesia (ASDEKSI) Sumatera Utara. Sekwan Tebingtinggi itu, menggantikan H. Erwin, SH, MM, yang tidak lagi menjabat Sekwan Medan. Penetapan Ismail Budiman, SH, SE sebagai Ketua ASDEKSI Sumut, dilakukan melalui rapat Sekwan Kab/Kota se Sumut pada 26Januari2012diMedan.Rapattimperumuspembentukanpengurus, dilaksanakan berdasarkan surat pengurus ASDEKSI Pusat No.044/ DP-ASDEKSI/XII/2011 tanggal 9 Desember 2011. Hasil rapat tim perumus, memutuskan pengurus ASDEKSI Sumut tediri dari, Penasehat Drs. H. Randiman Tarigan, MAP (Sekwan Prov. Sumut), Ketua Ismail Budiman, SH, SE (SekwanT.Tinggi),Wakil Ketua, Drs. Mangihut Sinaga, MM (Sekwan Kab. Samosir), Suren Situmorang, SH (Sekwan Kab. Labura), OK Azmi, SH (Sekwan Medan). SekretarisDrs. H.Suprin,MM(SekwanKab. Sergai),Wakil Sekretaris Poster, SH (Sekwan Kab. Humbahas), Sahat ML Simangunsong, SH (Sekwan Kab. Simalungun), Kumar Tanjung, SH (Sekwan Binjai), Bendahara, Zuhri, SE, MSi (Sekwan Labusel),Wakil Bendahara, Faisal, SE (Sekwan P. Sidimpuan) dan Sorayana Zebua, SE (Sekwan Gunungsitoli). “Setelah mendapatkan SK penetapan kepengurusan ASDEKSI akan melakukan rapat konsolidasi di Sergai,” tandas Ismail Budiman di ruang kerjanya, Jumat (10/2). (a09)

C itu ketika dihubungi Waspada mengatakan, usaha galian C tersebut sudah memiliki izin kalau tidak dia mengaku tidak berani melakukan pengorekan. “SudahadaizinnyaPak,kalau tidak mana kita berani mengerjakannya,”ujarnyaserayamengatakan “Senin(13/2) saja kita jumpa Pak,” kata Roy kepada Waspada. Menurut sumber di desa itu, Senin(6/2)timdariPemkabSergai sudah datang menanyakan tentang izin galin C, namun rombongan tim dibawa ke kafe Sonia di Perbaungan. Apa motif pertemuan tersebut tidak diketahui pasti ,kata sumber.(a08)

Waspada/Eddi Gultom

BUPATI Sergai HT. Erry Nuradi bersama Plt. Gubsu Gatot Pujo Nugroho, ST setelah menyerahkan tunggul Kecamatan Terbaik Tingkat Sumut tahun 2011, kepada Camat Perbaungan di lapangan sepakbola Kel. Batang Terap,Kec.Perbaungan, Kab. Serdang Bedagai.

HT. Erry Nuradi karena dinilai sangat berhasil membangun Pendidikan di Kab. Serdang Bedagai, yang merupakan kabupatenbarudiSumutdengan moto Tanah Bertuah Negeri Beradat, kata Kadisdik. “Walau banyak prestasi telah diraih, t api saya mengharapkan kita semua harus terus meningkatkan kinerja, etos kerja yang tinggi dan disiplin, mengacu kepada Peraturan Pemerintah (PP)No.23Tahun2010,yangisinya apabila seorang PNS tidak melaksanakan tugas selama 46 hari, sudah bisa dikenakan sanksi pemberhentian dengan hormat. Mengapa kita harus disiplin? Bupati HT. Erry Nuradi sangat gigih membangun segala sektor yang menyentuh kepentingan masyarakat. Untuk membalas kegigihan Bupati tersebut, kita hanya dituntut disiplin,” katanya. Coba bayangkan, lanjut Kadisdik,sebelumnyadisaatSerdang Bedagai baru dimekarkan dari Kab. Deliserdang pada 2005, SMA Negeri hanya ada tujuh unit dari 17 kecamatan yang ada. Tapiselamalebihkurangtujuh tahun kepemimpinan Bupati HT. Erry Nuradi, sekarang sudah menjadi 18 unit ditambah 8 unit gedung SMK Negeri yang baru dibangun. Selain itu sudah merenovasisemuagedungSDyang jumlahnyalebihkurang400-anunit, sehingga proses belajar mengajar saat ini bejalan lancar. Usai melaksanakan apel pagi dilanjutkan rapat koordinasi di aula pertemua kantor Camat Sei Bamban, juga dipimpin Kadisdik Drs. H. Rifai Bakri Tanjung, MAP. Rapat membahas tentang pelaksanaan pembangunan baik yang sudah dilaksanakan, sedang dilaksanakandanyangakandilaksanakan.(a08)

Sedikit Perusahaan Di Besitang Peduli Masyarakat Sekitar BESITANG(Waspada):Sekretaris Koperasi Serba Usaha (KSU) Karya Bangsa, Imam Wibowo mengatakan,hanyasedikitpelaku usaha yang peduli dan tetap konsisten menjalin hubungan kemitraan dengan masyarakat di sekitar perusahaan. “Tak banyak perusahaan di Besitang yang peduli dengan masyarakat,” ujar ImamWibowo didampingisejumlahrekannyadari organisasi pemuda di antaranya, Ahsani, Khairudin, Syahrial ChaniagokepadaWaspadadiBesitang, Rabu (8/2) . Ia mengatakan, perusahaan yang peduli dengan masyarakat seperti PT Sawit Jaya Makmur Sentosa (SJMS) pantas didukung karena keberadaannya dapat mengurangiangkapengangguran dannyatamemberikankontribusi

buat masyarakat termasuk pelaku usaha kecil. Kehadiranpabrikkelapasawit (PKS)inilanjutnyacukupmemberikanmanfaat.“LimbahCPOyang diberikanperusahaandapatkami olah menjadi pupuk NPK organik yang tidak kalah bersaing dengan kualitas pupuk kimia,” ujarnya. Imam mengungkapkan, kontribusi perusahaan tak hanya menguntungkan koperasi, tapi jugamanajemenitusendiri.Bagaimana tidak, limbah yang bagi kebanyakan perusahaan sering memunculkan problem lingkungan, kini justru dapat menjadi sumber rezeki bagi banyak orang. PKS mini ini, menurut dia, banyak menyerap tenaga kerja lokal termasuk tenaga bongkar muat. Keberadaan pabrik dapat mengurangi jumlah angka pe-

ngangguran di tengah sulitnya mendapatkan lapangan pekerjaan. “Kami merasa sangat bersyukur,” ucapnya. Kepala Personalia PT SJMS, Dayat, ditemui mengatakan, setiap bulan menajemen memberikan bantuan beras untuk 180 KK masing-masing 1 karung ukuran 15 kg. Selain itu, lanjutnya, perusahaan juga memberikan Rp300 ribupertahununtuk400KK.Bantuaninisebagaiwujudkepedulian manajemen terhadap masyarakat. “Kami tetap berupaya menjaga hubungan baik dengan masyarakat sekitar,” ujar Dayat seraya menambahkan, perusahan sedang menambah jumlah kolam penampung limbah, dari sebelumnya empat unit, kini menjadi sembilan unit. (a02)

Waspada/Eddi Gultom

DAM Truk sedang mengangkut tanah galian C melintas di Dusun I, Desa Laut Dendang, Kec.Perbaungan, Kab.Serdang Bedagai.

Wali Kota Binjai Lantik Direktur PDAM Tirtasari BINJAI (Waspada): Wali Kota Binjai HM Idaham, SH, MSi diwakili Sekda Drs. H. Iqbal Pulungan SH, MAP melantikYusmansyah, MBA, MT sebagai Direktur Perusahaan Daerah Air Minum (PDAM) Tirtasari Binjai periode 2012 - 2016, Jumat (10/2) di pendopo Umar Baki. Yusmansyah sebelumnya bertugas sebagai Kepala Divisi Zona I PDAM Tirtanadi Medan. Wali Kota HM Idaham melalui Sekdako Iqbal Pulungan mengemukakan, pengangkatan Direktur PDAM Tirtasari jangan dilihat dari aspek atau muatan lain yang dapat menimbulkan persepsi negatif. Pengangkatan Direktur PDAM Tirtasari menurut Wali Kota sudah melalui fit and propertest dan seleksi ketat dari tim. DirekturPDAMTirtasariyangbaru,diharapkan dapat mengemban amanah dan memberikan

warna baru bagi PDAM Tirtasari dan meningkatkan kinerja. Harapan sangat besar kepada Direktur PDAM Tirtasari yang baru, terutama memberikan pelayanan optimal meningkatkan kualitas air kepada masyarakat. Di sisi lain penyediaan air harus benar-benar menjadi prioritas sehingga tidak ada keluhan pelanggan. SelainmelantikDirekturPDAMTirtasariBinjai, Sekdako Iqbal Pulungan juga melantik penjabat eselon III dan IV, diantaranya Camat Binjai Kota Dedy Iskandar Hasibuan, SSTP, Muhammad Yusrizal sebagai Sekcam Binjai Barat, AhmadYani SSTP sebagai Lurah Bandar Senembah, Kec. Binjai Barat, Amin, SH (Lurah Mencirim) Kec. Binjai Kota, Zulkaidi (Lurah Setia) Kec. Binjai Kota, dan NepiYanti (Lurah Damai) Kec. Binjai Utara. (a04)

Waspada/Riswan Rika

SEKDAKO Iqbal Pulungan saat melantik Direktur PDAM Tirtasari dan penjabat eselon III dan IV di Pendopo Umar Baki.

Majelis Zikir SBY Nurussalam Sumut Konsolidasi Ke T. Tinggi TEBINGTINGGI (Waspada): Ketua Yayasan Majelis Zikir SBY Nurussalam Sumut, H. Marahalim Harahap, SH, M.Hum melakukan kunjungan silaturahmi dengan jajaran pengurus dan anggotaMajelisZikirSBYNurussalamTebingtinggi. Kunjungan silaturahmi yang dilanjutkan dengan rapat konsolidasi itu berlangsung di kediaman Ketua Majelis Zikir SBY Nurussalam Tebingtinggi, Drs. Rachmad Suud, BA di Jalan Letda Sujono, Payakapar, Kel. Pinang Mancung, Minggu (12/2). Ketua Majelis Zikir SBY Sumut, H. Marahalim Harahap, SH, M.Hum didampingi Sekretaris Drs. H. Jasman menjelaskan, Majelis Zikir SBY Nurussalam merupakan organisasi keagamaan, bukan organisasi politik. “Tak ada kepentingan politik dalam organisasi ini.Walau pun ada orang politik di dalamnya, tetapi organisasi ini sematamata untuk ibadah, memotivasi orang untuk berzikir, mencari ridho Allah,” ucapnya. Marahalim yang juga anggota DPRD Provinsi Sumut dari Partai Demokrat daerah pemilihan Kab. Deliserdang ini menegaskan, tidak akan membawa-bawa politik dalam ibadah. Apalagi menjadikan organisasi ini menjadi ajang untuk dukung-mendukung calon legislatif atau calon kepala daerah. “Majelis ini dibentuk bukan untuk kemenanganSBY,melainkanhanya untuk ibadah, mengajak orang beribadah adalah ibadah,” tegasnya di hadapan puluhan jamaah Majelis Zikir SBY Nurussalam Tebingtinggi. Tujuan kita, sambungnya, mengaktifkan zikir

di masjid-masjid, mengingat dan bermunajad bersama-sama untuk meminta kepada Allah serta mendoakan agar bangsa ini selamat dan maju. Diharapkan pengurus majelis ini juga merupakan pengurus masjid. Karena itu, dalam rangka konsolidasi ke daerah-daerah ini perlu dilakukan reposisi pengurus untuk mengaktifkan zikir di masjid-masjid. “Masalah keuangan, itu datang dari Allah. Terkadang kedua tangan kita tak cukup tenaga untuk menafkahi beberapa orang, kecuali kita mengharap Ridho Allah. Masalah rezeki itu rahasia Allah. Ada saja pengusaha atau donatur yang menjadi pengurus dalam majelis ini. Kalau kita berbuat baik kepada orang, Allah akan berbuat baik kepada kita,” tandasnya. Ketua Majelis Dzikir SBY Nurussalam Tebingtinggi, Drs. Rachmad Suud, BA kepada Waspada mengatakan, majelis zikir ini masih solid di 5 kecamatan se Kota Tebingtinggi. Pengurus dan anggota sudah dilengkapi seragamuntukibadahzikirmengingatAllah.Dalam kesempatan ini, katanya akan dilakukan pembenahan-pembenahan dalam organisasi karena beberapa orang pengurus sudah dipanggil menghadap sang khalik. Zikir untuk membersihkan hati, katanya, perlu dilakukan secara bersama-sama, berkumpul dengan orang soleh. Sedangkan acuan pelaksanaan bisa diserahkan kepada alim ulama setempat atau dilaksanakan menurut acuan dari Majelis Zikir SBY Nurussalam.(a11)

Guru SD Batangkuis Peringati Maulid Nabi BATANGKUIS (Waspada) : Para guru dan Kepala Sekolah SD di wilayah Kec. Batangkuis Deliserdang, Sabtu (11/2) melaksanakan Peringatan Maulid Nabi Besar Muhammad SAW di halaman SDN 106826 Desa Sidodadi Kec. Batangkuis. Selain dihadiri guru serta para kepala sekolah, acara itu juga turut dihadiri Camat Batangkuis TM.Zaki Aufa,S.Sos dan Kades Sidodadi Edy Suardi. Tampil sebagai penceramah (mubalighred) dalam acara itu Al Ustadz Drs H Bahron Saleh Hasibuan. Camat Batangkuis TM Zaki Aufa,S.Sos dalam sambutannya di hadapan para guru dan undangan lainnya mengatakan sangat terharu dan bangga dapat hadir di tengah-tengah guru dan

kepalasekolahwalaupunpadasaat yang sama ia banyak kegiatan. Menurutnya,tugasyangdiembanolehgurusangatlahberatdan penuh tanggungjawab baik itu kepadapimpinanataupunatasan selaku manusia maupun kepada Tuhan YME. Oleh karena itu di tanganparagurulahseoranganak manusiaitubisaberhasilatautidak. Ditambahkannya, dalam mendidik anak didik hendaknya para guru lebih mengdepankan kasih sayang kepada para siswa yang diajarinya. “Timbulkan semangat kasih sayang terhadap anak didik dalam melaksanakan tugas” ujar Camat Diakuinya, saat ini seiring berkembangnya kemajuan zaman ditambah semakin menjamurnya internet menandakan

bahwa dunia ini sudah tua dan semakin gila dengan hadirnya berbagai informasi yang bisa dihasilkan dari berbagai media itu. Jika hal ini dibiarkan tanpa adanya tindakan maka akan merusak generasi muda yang merupakan harapan bangsa di masa depan. Oleh sebab itu, disinilah guru berperan dalam melakukan pendekatan dalam hal mendidik siswanya untuk tidak terjerumus dan melakukan perbuatan yang tak terpuji serta sia-sia Al Ustadz Drs H Bahron Saleh Hasibuan dalam tusyiahnya antara lain mengatakan bahwa tugas seorang guru merupakan tugas yang sangat mulia di sisi Allah SWTasalkan segala sesuatu yang dikerjakan dilakukan dengan penuh keikhlasan. (crul)

Waspada/Muhammad Idris

KETUA Yayasan Majelis Zikir SBY Nurussalam Sumut, H. Marahalim Harahap, SH, M.Hum (duduk di tengah) bersama Ketua Majelis zikir SBY Nurussalam Kota Tebingtinggi, Drs. Racmad Suud, BA beserta pengurus lainnya.


Aceh

WASPADA Senin 13 Februari 2012

C1 Terkait Pemberondongan Kediaman Jubir KPA

Pernyataan Kapolda Dibantah PEUREULAK (Waspada): Ketua Regional II Timses Cagub/Cawagub Aceh Irwandi – Muhyan, Tgk Asnawi Abdurrahman membantah pernyataan Kapolda Aceh ke publik pekan lalu. Asnawi merasa dirugikan, karena kasus pemberondongan rumahnya oleh komplotan bersenjata api (senpi) dianggap bermotif dari persoalan utang-piutang. “Kapolda Aceh dalam Rapat Koordinasi (Rakor) masalah keamanan dengan Pangdam IM mengatakan, rumah saya Asnawi Abdurrahman (Asnawi—red) ditembak karena utang. Padahal saya tidak pernah berhutang kepada siapapun, kecuali utang dengan Allah,” papar Asnawi Abdurrahman yang juga Juru Bicara Komite Peralihan Aceh (KPA) Wilayah Peureulak kepada Waspada Minggu (12/2) di Peureulak. Asnawi mengaku, pernyataan yang disampaikan Kapolda Aceh sama tidak benar, karena dia mengaku hanya rakyat kecil yang tak pernah berutang kepada siapapun. “Tapi saya juga malas berbalas pantun di media. Semua ini dan musibah ini saya serahkan kepada Allah yang Maha Adil dan Bijaksana,” sebutnya. Mantan anggota Gerakan Aceh Merdeka (GAM) itu menambahkan, selama ini dirinya merasa sama sekali tidak memiliki masalah pribadi dengan siapapun, apalagi dituding memiliki utang. Namun kasus penyerangan rumahnya di kawasan Peureulak (Aceh Timur) dinilainya bernuansa politis, sebab pilihan politiknya yang mendukung Irwandi-Muhyan. “Saya tidak mengetahui kenapa rumah saya yang menjadi sasaran pemberondongan. Semoga pelaku insyaf dan tidak ada lagi kejadian-kejadian seperti ini di Aceh. mari kita bersama menciptakan demokrasi di negeri ini dengan baik,” sebut Asnawi lagi. Asnawi menyebutkan, dirinya kini dipercayakan sebagai Ketua Timses Pemenangan Irwandi-Muhyan untuk Wilayah Regional II yang meliputi Bireun, Lhokseumawe, Aceh Utara, Aceh Timur, Langsa, Aceh Tamiang hingga ke Aceh Singkil. “Senin besok (hari ini—red) saya dipanggil ke Polres Aceh Timur. Tapi semua ini saya serahkan kepada Allah SWT, karena Allah Maha Adil dengan keputusanNya,” tandasnya. (b24) Waspada/Muhammad H. Ishak

TERPEROSOK: Satu unit backhoe Hitachi EX200 yang mengerjakan proyek pengerukan normalisasi sungai di Dusun Kuta Batee, Desa Gampong Aceh, Kecamatan Idi Rayeuk, Kab. Aceh Timur, terperosok ke sungai. Jatuhnya alat berat itu menjadi tontonan warga sekitar hingga Minggu (12/2). Terperosoknya backhoe ke dalam lumpur dengan kedalaman mencapai 2 meter itu terjadi Sabtu (11/2) sekira pukul 17:30.”Operator masih melakukan perbaikan di bagian mesin yang mulai rusak, sebab saat jatuh operator sempat mencoba naik kembali ke atas, tapi tidak mampu. Sehingga kedalaman rantai bertambah,” papar Nurdin alias Din Bayak asal Idi Cut, pemilik backhoe kepada Waspada, Minggu (12/2) di lokasi.

Warga Usir Po Meurah Dengan Petasan LHOKSUKON (Waspada): Dusun Lubok Tilam, Desa Cot Girek, Kecamatan Cot Girek, dikenal sebagai salah satu wilayah paling rawan gangguan gajah liar atau po meurah, di Aceh Utara. Namun sejauh ini belum ada upaya serius pemerintah mengantisipasi gangguan hewan berbadan bongsor itu secara permanen. “Selama ini masyarakat hanya mampu menghalau kawanan gajah dengan membakar petasan atau menyalakan obor. Upaya ini tidak efektif. Kawanan gajah hanya hilang dua-tiga pekan, setelah itu mareka balik lagi ke pemukiman penduduk,”kata Imum Mukim Bandar Baro, Cot Girek, Abdullah, kepada Waspada, Minggu (12/ 2). Kadus Lubok Tilam, Wagimin, 45, secara terpisah menambahkan, teranyar kawanan po meurah masuk ke Dusun Lubok Tilam, Jumat (10/2) malam. Sebelum sempat merusak tanaman, kawanan gajah ini langsung dihalau warga dengan menyalakan obor dan mereka bergerak pindah ke arah hutan pedalaman Pirak Timu dan pedalaman Langkahan, Aceh Utara. “Kami harap pemerintah maupun badan terkait lainnya turun tangan mengatasi masalah ini, sehingga warga tak lagi resah karena terus-terusan berurusan dengan kawanan gajah liar. Bila perlu, buat tempat khusus untuk mereka,”pinta Wagimin. (b19)

Ratusan Murid Dan Siswa Ikuti Lomba Berhitung BIREUEN (Waspada): Sekira 750 murid SD, pelajar SMP dan siswa SMA se-Kabupaten Bireuen dan sebagian dari Kota Lhokseumawe dan Aceh Utara, mengikuti Lomba Berhitung Pelajar Islam (LBPI) yang diselenggarakan Pengurus Daerah Pemuda Pelajar Indonesia (PII) Bireuen, di SKB kabupaten setempat, Minggu (12/2). Ketua panitia Fauzan Nur, kepada Waspada, Minggu (12/2), di sela-sela pelaksanaan lomba mengatakan, lomba dibuka Ketua MPD Bireuen, Abdullah Amin, berlangsung sehari penuh dibagi dalam 3 kategori atau 3 kelompok, SD, SMP dan SMA. “Para peserta pertama mengikuti babak penyisihan, kemudian masing-masing kategori maju ke babak semifinal sebanyak 40 orang, lalu 10 orang akan dipilih untuk masuk final dan di babak final juga masing-masing kelompok akan dinilai siapa yang berhak menjadi juara,” katanya. Selanjutnya, kata Fauzan Nur, kepada para pemenang masingmasing kategori akan diberi piala dan uang pembinaan. (cb02)

Ikram Gelar Aneka Lomba Se Aceh Tamiang KUALASIMPANG (Waspada) : Ikatan Remaja Masjid Aceh Tamiang ( Ikram) menggelar aneka lomba Ajang Kreasi Remaja Islam ( Akri) 7-11 Februari di Lapangan Pemuda,Kota Kualasimpang, Kabupaten Aceh Tamiang. Acara yang berakhir Sabtu (11/2) malam mendapat sambutan hangat dari masyarakat Aceh Tamiang. Kadis Syariat Islam Aceh Tamiang, Effendi pada kesempatan itu menyatakan, pelaksanaan kegiatan ini merupakan agenda rutin Pimpinan Pusat Ikram yang dilaksanakan setiap tahunnya memeriahkan peringatan hari besar Islam . Adapun kegiatan yang dilombakan yaitu nasyid, Lomba Latarda, Syahril Quran dan Marhaban. Acara yang diikuti oleh berbagai grup tari, nasyid, Syahril Quran dan Rebana se Kabupaten Aceh Tamiang itu juga turut dihadiri Joni Evita,SE dan sejumlah undangan lainnya. Selain ada perlombaan juga ada acara pelantikan Pimpinan Daerah Himpunan Grup Marhaban Aceh Tamiang ( HIGMAT) dan ceramah memperingati Maulid Nabi Besar Muhammad SAW. (b23)

Waspada/Muhammad Hanafiah

TIM tari dari Kecamatan Rantau yang tampil sangat memikat dan akhirnya Tim Tari Saman yang syairnya bernuansa religius Islami ini meraih juara I pada lomba yang diselenggarakan oleh Ikram di Lapangan Pemuda,Kota Kualasimpang,Kabupaten Aceh Tamiang, Sabtu (11/2) malam.

Gepeng Kembali Resahkan Warga Kota Bireuen Ada Suami Beristrikan 3 Pengemis BIREUEN (Waspada): Warga Kota Bireuen mengaku resah dengan kembali banyaknya berkeliaran gelandangan dan pengemis (gepeng) di wilayah kota ini. Beberapa waktu lalu para gepeng pernah ditertibkan dan diancam tangkap bila mereka kembali beraksi. Keterangan yang dihimpun Waspada, Minggu (12/2), para gepeng mangkal di kawasan Simpang IV dan beberapa kawasan ramai pengendara kendaraan bermotor, sehingga selain merusak pemnadangan juga mengganggu ketertiban lalulintas. “Sekarang ini pengemis sudah banyak lagi di Kota Bireuen, ini sangat memalukan, namun di sisi lain sangat memilukan,” kata Rukma, seorang pedagang. Menurut Rukma, para gepeng di Bireuen sekarang ini, tiap hari mencapai puluhan orang, di antaranya ada yang mangkal di depan toko atau kantor-kantor, bank dan ada juga yang beroperasi di kawasan kota sambil berkeliling mengadahkan tangannya. Ada juga di antara mereka cacat anggota tubuhnya, ada

juga yang terlihat sehat, namun yang perempuan sambil menggendong anak kecil, dia mengemis ke seluruh toko yang ada di wilayah Bireuen. “Beberapa waktu lalu sempat sepi, namun sekarang ini mereka kembali berkeliaran di Bireuen ini,” tambahnya. Razali, warga Kota Bireuen lainnya, mengatakan, sebenarnya warga Kota Bireuen, serba salah, tidak memberi sumbangan kasihan dan kalau diberikan selalu wajah-wajah itu yang datang meminta sedekah.“Yang agak berat kita melihat ada pengemis fisiknya kuat, namun masih mau menjadi pengemis, kami rasa hal ini perlu mendapat perhatian kepada pihak terkait, supaya jangan mengesankan Bireuen ini adalah kota pengemis atau kota lahan menjajikan bagi pengemis,” ujarnya. Suami Beristrikan 3 Pengemis Sementara itu, informasi yang diperoleh Waspada secara terpisah, warga Kota Bireuen, menduga ada seorang warga yang menetap di Bireuen beberapa waktu lalu beristrikan tiga orang pengemis. Suaminya siangnya tidak nampak batang hidungnya, namun keluar rumah malam hari. “Kami belum kenal benar orangnya, namun dari kabar dari mulut ke mulut

ada seorang lelaki beristrikan dengan 3 pengemis. Hasil mengemis istrinya disetor kepadanya tiap hari,” ungkap seorang warga Kota Bireuen. Kabar tersebut menurut warga, terus berkembaang, bahkan saat ini warga sedang mengintainya. “Saya kita lihat ke isterinya tiap hari disuruh mengemis, sedangkan suaminya hanya tidur-tidur rumah,” sambung seorang warga kota lainnya, seraya menambahkan, di Bireuen dulu juga pernah tertangkap seorang suami tinggal di sebuah hotel bersama suaminya, kini ada cerita lain versi berbeda ada suami‘sengaja’ beristrikan tiga pengemis supaya tidak perlu kerja banting tulang mencari nafkah. Kepala Dinas Sosial, Tenaga Kerja, dan Transmigrasi (Kadinsoskertrans) Bireuen, Akmal yang dikonfirmasi Waspada secara terpisah, mengatakan, masalah pengemis masalah bersama. Pihaknya sudah pernah melaporkan kepada DPRK, karena untuk menertibkan atau menangani pengemis atau gepeng yang tersebar di kabupaten itu membutuhkan dana. “Sekarang ini kita sedang data pera pengemis yang berkeliaran di Bireuen ini. Saat ini kami belum bisa turun ke lapangan untuk mener-

singan yang sangat menganggu proses belajar mengajar. Relokasi SMAN 1 Idi Rayeuk yang harga lahannya ditaksir mencapai Rp9 miliar tersebut diwacanakan Kepala Dinas Pendidikan Aceh Timur, Agussalim, sejak tahun 2010. Bahkan, Agusalim mengklaim rencana itu juga telah mendapat restu dari 80 persen masyarakat Idi Rayeuk. Samsul menceritakan, lokasi sekolah yang dibangun pada awal tahun 70-an itu, digagas oleh beberapa tokoh Idi, seperti mantan Camat Idi Rayeuk, Budiman Ahmad (alm) dan Djakfar Shalihin (alm), yang menjabat sebagai Kepala sekolah pertama SMA Idi. “Jadi, aneh rasanya kalau tiba-tiba ada yang mengaku sebagai pendiri sekolah dan ingin memindahkan (relokasi) sekolah tersebut,” ujarnya heran. Apalagi alasannya karena terlalu dekat dengan jalan negara dan sangat mengganggu proses belajar mengajar, Samsul menyebutkan alasan itu tidak masuk akal dan terkesan dibuat-

buat. Masih banyak sekolah lain di perkotaan yang dekat dengan jalan negara, tapi tidak pernah terdengar hanya gara-gara itu sekolahnya direlokasi. “Relokasi bukan merupakan hal yang krusial untuk memajukan dunia pendidikan di Aceh Timur. Yang benar, SMAN 1 Idi Rayeuk membutuhkan sarana dan fasilitas yang memadai untuk mendukung proses belajar mengajar, sehingga menghasilkan lulusan yang baik. Jadi, tidak dibutukan relokasi demi memuaskan kepentingan pihak-pihak tertentu,” ujar Samsul Rizal. Alumni SMA Idi Tolak Relokasi Sebelumnya Forum Alumni SMA Idi memprotes rencana relokasi bangunan sekolah mereka oleh Dinas Pendidikan Aceh Timur. Bahkan, mereka akan menggalang dukungan agar rencana tersebut dibatalkan. “Alasan kebisingan yang mempengaruhi mutu lulusan

Hari ini Sertijab Di Polres PEUDAWA (Waspada): AKBP Iwan Eka Putra resmi menjadi Kapolres Aceh Timur menggantikan AKBP Drs Ridwan Usman. Proses Serah Terima Jabatan (Sertijab) akan berlangsung di Mapolres setempat, Senin (13/2) hari ini. “Sertijab internal sebagaimana rencana akan berlangsung Senin, hari ini. Dalam prosesi ini hanya dilibatkan seluruh jajaran Polres dan Polsek,” kata Wakapolres Aceh Timur, Kompol Doni Wahyudi, SH.SIk menjawab Waspada Minggu (12/2). Sebagaimana diketahui, pelantikan AKBP Iwan Eka Putra sebagaimana Kapolres Aceh Timur berlangsung di Mapolda Aceh di Banda Aceh, Selasa (7/2) pekan lalu. Sementara AKBP Ridwan Usman yang lama bertugas di Aceh Timur dan tergolong Kapolres paling senior di Aceh kini menempatkan posisi dan jabatan Wadir Reskrimsus di Mapolda Aceh. (b24)

Kapolda Perintahkan tibkan pengemis, karena belum ada dana untuk biaya makan dan biaya tranportasi, khususnya bagi pengemis yang berasal dari luar daerah. Jumlah pengemis sudah terdata tahun lalu dan akan didata lagi,” tambahnya. Didampingi Kabid Pelayanan dan Rehabilitasi Sosial, Wardi Usman, Akmal, mengatakan, dalam penertiban para Gepeng, pihaknya, akan bekerjasama dengan, Satpol PP, Dinas Syariat Islam, bidang Kesra dan pihak-pihak terkait lainnya termasuk pihak aparat kemanan. “Untuk menertibkan dan membina pengemis itu perlu kerjasama semua pihak, karena mereka ada yang berasal dari luar Bireuen, namun kita berharap para pengemis hendaknya yang kuat fisik janganlah lakukan yang dilarang agama atau yang menyusahkan orang lain bila mereka benar-benar mampu dan kepada warga juga menyeleksi memberikan kepada pengemis-pengemis yang meminta-minta,” imbaunya. Data Dinas Sosial Bireuen 2009 jumlah pengemis di Bireuen sebenyak 152 orang yang berasal dari sejumlah kecamatan di wilayah kabupaten setempat. “Makanya akan kita pantau para pengemis di Bireuen dalam waktu dekat ini,” pungkas Akmal. (cb02)

SMAN 1 Idi Rayeuk Perlu Diselamatkan BANDA ACEH (Waspada): Penasehat Forum Alumni SMA Idi (FORAMDI), Prof DR Ir Samsul Rizal, M.Eng, menilai SMA Negeri 1 Idi Rayeuk memiliki nilai historis yang cukup tinggi, karena merupakan gedung SM pertama di wilayah Aceh Timur, selain di Kota Langsa yang sebelum pemekaran menjadi ibukota Aceh Timur. “Dulunya, SMA Idi itu bernama SMA I LangsaFilial Idi. Karena memiliki nilai historis yang cukup tinggi, lokasi SMA Negeri I Idi perlu diselamatkan dari segelintir pihak yang mengaku dirinya sebagai pendiri sekolah,” ungkap Samsul Rizal yang juga Pembantu Rektor I Universitas Syiah Kuala, di Banda Aceh, Sabtu (11/2). Sebagaimana diberitakan, Dinas Pendidikan Kabupaten Aceh Timur berniat menjual lahan SMA Negeri 1 Idi Rayeuk yang berlokasi di Desa Tanoh Anoe, dan merelokasinya ke daerah lain. Alasannya, lokasi sekolah terlalu dekat dengan jalan negara Medan-Banda Aceh, sehingga menimbulkan kebi-

AKBP Iwan Eka Putra Kapolres Aceh Timur

SMA Idi, sama sekali tidak masuk akal. Apalagi tidak ada ruang belajar yang terlalu dekat dengan jalan raya. Kami menduga ada agenda terselubung bermotif ekonomi yang menguntungkan sejumlah pihak di balik wacana itu ,” kata Aftahurriza, selaku juru bicara Forum Alumni SMA Idi, Jumat (10/2). Untuk itu Forum Alumni SMA Idi akan melakukan upaya advokasi menolak rencana itu. Mereka juga akan menggalang dukungan yang lebih luas dari seluruh alumni maupun masyarakat Idi Rayeuk yang ada di Aceh, Jakarta dan beberapa daerah lainnya, serta meminta dukungan dari DPRK maupun ang-gota DPRA yang berasal dari Aceh Timur untuk menolak rencana itu. “Kami juga akan menyerahkan bukti penolakan warga Idi atas rencana relokasi itu kepada pemerintah Aceh Timur dalam waktu sesingkat-singkatnya,” kata Aftahurriza yang juga ketua Ikatan Pemuda dan Pelajar Aceh Timur (IPPAT), itu. (b04)

Kapolres Aceh Timur Proses Pemukulan Wartawan BANDAACEH (Waspada): Kapolda Aceh Irjen Pol Iskandar Hasan menegaskan, pihaknya telah memerintahkan Kapolres Aceh Timur untuk memproses pemukulan terhadap wartawan yang dilakukan oknum kontraktor di Mapolsek Banda Alam. “Saya sudah perintahkan Kapolres dan sekarang sedang di proses di Polres Aceh Timur. Saya bilang proses, tidak ada alasan,” tegas Irjen Pol Iskandar Hasan menjawab pers terkait pemukulan wartawan di Aceh Timur,” Jumat (10/2) di Banda Aceh. Kapolda mengatakan tidak dikhawatirkan karena kasus pemukulan terhadap wartawan itu akan diproses secara hukum. “Tadi saya juga ditelepon Kadiv Humas Mabes Polri, saya katakan benar dan sedang diproses di Polres Aceh Timur,” ujarnya. Iskandar Hasan mengatakan, sejak awal kehadirannya di Aceh telah ia tegaskan, hukum harus ditegakkan. “Saya datang ke Aceh, saya tunjukkan bahwa hukum ada di Aceh. Jadi sekecil apapun pasti kita akan tindak termasuk Polri,” ungkapnya. Pemukulan terhadap Basri, wartawan Radar Nusantara itu, dilakukan oknum kontraktor yang menangani pengaspalan jalan Idi-Keude Geureubak. Setelah korban mengkonfirmasi tentang belum diaspalnya jalan itu kepada Kadis PU Aceh Timur. Saat korban sedang berurusan di Mapolsek Banda Alam, dua oknum dari kontraktor datang. Korban menyebutkan, saat ia berada di ruang Kapolsek, oknum kontraktor itu memukulnya dan dilerai Kapolsek serta salah satu Kanit di Polsek itu. Merasa tidak mendapat tanggapan dari Polsek Banda Alam, korban akhirnya melaporkan kejadian yang menimpa dirinya tersebut ke Polres Aceh Timur. (b06/b05)

Grup Zikir Almuhajirin Meriahkan Maulid Di Komplek BTN Buket Teukueh BIREUEN (Waspada): Grup zikir maulid Almuhajirin yang terdiri para santri pengajian di Meunasah Komplek BTN Buket Teukueh, Kota Juang, Bireuen, yang baru dibentuk, memeriahkan perayaan Maulid Nabi Besar Muhammad SAW yang dilaksanakan warga dan di meunasah setempat, Minggu (12/2). Penampilan anak-anak yang umumnya masih pelajar tersebut sempat menjadi perhatian warga dan undangan yang hadir, karena dinilai walaupun mereka baru saja dilatih oleh Teungkunya (Ustadz), namun sudah lumayan bagus. “Grup d zikir anak-anak ini baru saja kita bentuk dan dilatih, namun alhamdulillah penampilannya sudah lumayan bagus, walaupun mereka baru tampil pertama, sengaja kita tampilkan mereka dalam maulid kali ini, selain memberi motivasi kepada anak-anak Islam juga untuk menujukkan kebolehan mereka dalam berzikir, sedangkan sebelumnya kami undang grup zikir dari desa lain,” kata Ketua Dusun Azhar kepada Waspada, Minggu (12/2). Menurut Azhar, acara maulid yang mereka adakan tahun ini mengundang ratusan warga dari desanya juga warga tetangga Desa Cot Gapu, dan Geulanggang Baroe serta menyantuni anak yatim. Untuk maulid kali ini menyantuni puluhan anak yatim dari desa kami sendiri dan dari desa tetangga. “Kami tiap tahun melaksanakan kenduri maulid dan alhamdulillah dengan kerja kompak sesama warga acara berlangsung sukses dan lancar,” pungkasnya. (cb02)

Waspada/Abdul Mukthi Hasan

SEJUMLAH bu kulah (bungkus khas Aceh) dipersiapkan warga Desa Komplek BTN Bukte Teukueh, Kota Juang, Bireuen, Minggu (12/2), untukmenjamumakanudangandananakyatimyangmerekaundang dalam perayaan maulid yang diadakan di desa setempat.


Aceh

C2

Mahasiswa Lhokseumawe Dari Banda Aceh Bantu Korban Kebakaran LHOKSEUMAWE (Waspada): Ikatan Mahasiswa Pemuda Kota Lhokseumawe (IMPKL) bekerja sama dengan Dinas Sosial Provinsi Aceh membantu berbagai kebutuhan korban kebakaran Batuphat Timur, Kecamatan Muara Satu, Pemko Lhokseumawe, Minggu (12/2). Bantuan disalurkan berupa pakaian, kebutuhan dapur, makan dan berbagai jenis kebutuhan lainnya yang dinilai sangat dibutuhkan para korban. Sebanyak 21 keluarga yang menjadi korban kebakaran awal Februari lalu belum memiliki tempat tinggal, setelah rumah-rumah mereka rata dengan tanah. Ketua umum IMPKL, Muhammad Nashir kepada Waspada menjelaskan, bantuan merupakan hasil kerjasama para mahasiswa dan pemuda dengan Dinas Sosial Provinsi Aceh. Sebelumnya, mahasiswa dan pemuda yang saat ini tinggal di Banda Aceh, juga mengadakan bakti sosial. “Kami berharap dengan adanya bantuan ini, masyarakat tidak terlalu lama larut dalam kesedihan dan secepatnya bangkit dari kesedihan itu untuk hari esok yang lebih baik,” tambah Ketua Paniti Pelaksana, Nanda Satria. (b15)

Senin 13 Februari 2012

Desakan ‘Pencekalan’ Bupati Abdya Menguat

20 Personil Wilayatul Hibah Bireuen Dikukuhkan BIREUEN (Waspada) : Kadis Syariat Islam Kabupaten Bireuen DR Saifullah, SAg.MPd mengukuhkan 20 personilWilayatul Hisbah (WH) dalam berbagai posisi di kantor Dinas Syariat Islam setempat Kamis (9/2) lalu. Pengukuhan itu ditandai dengan pemakaian baret kepada Komandan WH, Wakilnya serta Kepala Unit Provost. Kadis Syariat Islam dalam pengarahannya antara lain menegaskan, setiap anggota WH diharapkan akan mampu mengemban tugas penegakkan Syariat Islam dengan baik kendati mengalami banyak tantangan WH dalam bertugas harus tetap santun. Keberadaan WH jangan sampai menjadi bumerang bagi WH sendiri maupun masyarakat. Saifullah menjelaskan, jumlah personil WH Dinas Syari’at Islam Kabupaten Bireuen saat ini sebanyak 70 personil, 18 WH Wanita, 52 WH pria. Sebanyak 16 WH di antaranya sudah PNS dan 54 orang lainnya masih berstatus honorer. Dalam kesempatan itu juga diungkapkan, salah satu program yang dicanangkan Bupati Nurdin Abdul Rahman “ tentang “magrib mengaji”. Pihaknya bersama WH akan terus melakukan sosialisasi ke masjid-masjid dan meunasah-meunasah desa untuk menghidupkan kembali mengaji malam hari bagi putra-putri di masjidmasjid, meunasah-meunasah dan rumah penduduk di setiap desa. Soal magrib mengaji di Aceh kata Saifullah sebenarnya bukan barang baru, sejak zaman dulu secara turun temurun kalangan orang tua sangat memperketat mengaji bagi putra-putrinya, namun sekarang mulai pudar akan terus dilestarikan kembali, ujar Kadis Syariat Islam. (b12)

WASPADA

BLANGPIDIE (Waspada) : Adanya dugaan keterlibatan orang ‘nomor satu’ di Kabupaten Aceh Barat Daya (Abdya) terkait kasus perusakan lingkungan di Kawasan Ekosistem Leuser (KEL) dan juga hutan lindung negara yang telah ditetapkan tiga tersangkanya oleh Polres Abdya beberapa waktu lalu, kini mendapat perhatian dan sorotan tajam dari sejumlah pihak. Seperti dalam siaran pers yang diterima Waspada, Minggu (12/2) dari Koordinator Badan Pekerja Solidaritas Untuk Anti Korupsi (SuAK) Aceh yang secara tegas meminta pihak kepolisian segera ‘mencekal’ Bupati Abdya Akmal Ibrahim. “Kita bermohon kepada Bapak Presiden Susilo Bambang Yudhoyono supaya segera memberikan izin pemeriksaan untuk kasus (ling-kungan) yang ikut melibatkan Bupati Akmal Ibrahim tersebut, sehingga proses hukum Waspada / Sudarmansyah

KAWASAN Ekosistem Leuser (KEL) dan hutan lindung di Kabupaten Aceh Barat Daya (Abdya) saat ini terlihat rusak parah akibat sejumlah kebijakan yang dilakukan Bupati setempat yang disebutsebut sejumlah aktifis LSM sebagai bentuk pelanggaran atas Undang-undang nomor 32/2009 tentang lingkungan, bahkan penyidik Polres Abdya yang sedang mengusut kasus tersebut juga telah menyiapkan surat izin pemeriksaan Bupati Akmal Ibrahim ke Presiden melalui Kapolda Aceh. dalam foto yang direkam beberapa waktu lalu di daerah pegunungan Lembah Sabil yang juga areal KEL kini terlihat rusak parah, sejumlah kalangan minta aparat hukum bertindak tegas dan konsisten mengusut kasus tersebut hingga tuntas.

Hentikan Jual Beli Saat Azan Berkumandang SIGLI (Waspada) : Satuan Polisi Pamong Praja dan Wilayatul Hisbah (Satpol PP dan WH) Kabupaten Pidie dan Pidie Jaya harus berperan aktif untuk mendorong tegaknya Syariat Islam dengan menggelar razia malam hari di sejumlah kafé remang-remang yang kian menjamur di Kota Sigli. Pasalnya, di malam hari banyak warga memilih nongkrong di sejumlah kafé di seputaran Kota Sigli. Jadi ini memang tugas dari dari Satpol PP danWH dibentuk saat Aceh diterapkan Syariat Islam dulunya. Jadi tugas Satpol PP dan WH itu bukan jaga-jaga tempat keramaian dan menertibkan pedagang kaki lima se-

perti jelang berbuka saja. Karena fungsi Satpol PP dan WH tidak pada penertiban lalulintas, penertiban pasar, pedagang kaki lima. Tetapi lebih bagaimana mendorong masyarakat agar tidak melanggar Syariat Islam. “WH lembaga resmi yang dibentuk Pemerintah Aceh untuk menegakkan Syariat Islam secara kaffah, “tegas Ridwan, warga Kota Sigli kepada Waspada, Minggu (12/2). Menurutnya,WH harus aktif dengan razia karena itu satusatunya cara pembinaan bagi masyarakat yang sudah tidak memiliki lagi rasa malu. Apalagi bagi mereka para pedagang baik toko minuman maupun pakaian, serta para pedagang kaki lima di seputar kota tidak mengindahkan lagi suara azan di masjid. Buktinya, saat azan shalat

magrib dan isya di masjid atau mushalla, warung kopi dan toko-toko terus melayani para pembelinya. Bahkan warungwarung dan toko-toko yang dekat dengan masjid pun terus terbuka, “ujarnya seraya menambahkan warga sepertinya tidak peduli lagi dengan suara azan mengumandang. Menyahuti hal itu, Ketua Majelis Permusyawaratan Ulama (MPU) Kabupaten Pidie Jaya, Drs. Tgk HM Nur Hasballah menyatakan sependapat apa yang disampaikan Ridwan. “Satpol PP dan WH perlu secara rutin menggelar razia ke sejumlah kafé di malam hari . Begitu juga menjelang magrib, warung dan toko di-minta tutup dan bergegas ke masjid atau mushala,’’ katanya. (b09)

dapat segera berjalan demi percepatan penegakan hukum di daerah,” ujar Koordinator SUAK Aceh Teku Neta Firdaus. SUAK Aceh juga telah menyurati Pj Gubernur Aceh Tarmizi Karim terkait kasus tersebut sehingga diharapkan proses perizinan sebagai prosedur pemeriksaan pejabat bupati aktif dapat segera berjalan. “Terkait persoalan ini, kita juga ikut menyurati gubernur sehingga prosesnya dapat berjalan sesegera mungkin, sehingga jangan sampai hanya orang tertentu yang menjadi tumbal dalam kasus tersebut,” sebut Teuku Neta Firdaus. Sementara itu AKBP Eko Budi Susilo,SIk yang baru saja menjabat sebagai Kapolres Abdya menggantikan pejabat sebelumnya AKBP Drs Subakti, kepada Waspada menyatakan, komitmennya untuk melanjutkan kasus yang telah menjerat dua kepala dinas dan satu mantan Sekda Abdya hingga tuntas ke pengadilan. (cb05)

Unsyiah Buka Prodi Pertambangan BANDA ACEH (Waspada): Universitas Syiah Kuala (Unsyiah) Banda Aceh tahun akademik 2012 mebuka program studi baru. Hingga kini, Unsyiah sudah memiliki 49 prodi yang tersebesar di sembilan fakultas dengan jumlah mahasiswa 27 ribu orang. Rektor Unsyiah Prof DR Darni M Daud, MA mengatakan prodi baru yang dibuka dalam upaya meningkatkan daya tampung penerimaan mahasiswa di kampus itu. “Tahun ini kita membuka Prodi Pertambangan,” katanya usai wisuda sarjana, Sabtu (11/2). Kata dia, pihaknya akan menerima mahasiswa perdana pada awal tahun akademik 20122013. “Kami berharap dengan pengembangan prodi itu akan mampu memperluas akses pendidikan tinggi bagi masyarakat,” kata rektor. Pada sisi lain, Darni menyebutkan, pengembangan program studi yang dilakukan pihaknya menjadi salah satu upaya meningkatkan jumlah daya tampung mahasiswa paru yang saban tahun mengalami peningkatan. “Minta adek-adek lulusan SMA sederajat

di Aceh yang ingin melanjutkan pendidikan di perguruan tinggi—khususnya Unsyiah sangat tinggi, sehingga kita melihat perlu pengembangan prodi,” tuturnya. Pada tahun ini, kata dia, pihak Rektorat Unsyiah memprediksikan jumlah lulusan SMA sederajat yang akan mendaftar sebagai calon mahasiswa melalui Seleksi Nasional Masuk Perguruan Tinggi Negeri (SNMPTN) di panitia lokal di Banda Aceh akan tinggi. “Bisa mencapai 18 ribu orang,” Ditambahkan, pada tahun ini, Unsyiah akan menerima sekitar 5.071 mahasiswa baru pada tahun akademik 2012 melalui berbagai jalur masuk antara lain, SNMPT, UMB, USMU, Bidik Misi dan Jalur Mandiri. Kecuali menambah prodi, Unsyiah menurut Darni juga akan terus meningkatkan kualitas lulusan supaya mampu bersaing dengan alumni Perguruan Tinggi lain di tanah air. “Upaya ke sana tak akan berhenti, kita terus membenahi kualitas kita,” papar Prof Darni M Daud. (b07)

H Abdullah Rasyid Di Pengajian Rutin Ulama - Umara Waspada/Zainal Abidin

PARA mahasiswa yang tergabung dalam IMPKL sedang menurunkan bantuan untuk korban kebakaran Batuphat Timur, Kecamatan Muara Satu, Lhokseumawe, Minggu (12/2).

Terkait Pencemaran Limbah, PT PIM Belum Bertanggungjawab LHOKSEUMAWE(Waspada): Sampai hari ini PT Pupuk Iskandar Muda (PIM) belum bertanggungjawab terhadap korban pencemaran limbah di Sungai Ujung Pacu, Kecamatan Muara Satu dan sekitarnya, Minggu (12/2) serta enggan memberi keterangan lanjutan kepada pers. Salah seorang korban pencemaran limbah Apadin Desa Blang Naleung Mameh menilai PT PIM terkesan tidak bertanggung jawab dan plin-plan ketika dipertanyakan tanggungjawabnya terhadap korban pencemaran limbah Apadin mengaku tindakan PT PIM ini akan memperkeruh hubungannya dengan masyarakat lingkungan. Padahal bukti secara otentik sudah ada dengan positif adanya Amoniak hasil temuan uji sample dari BLHK dan Dinas Perikanan dan Kelautan Kota Lhokseumawe. Bahkan dalam keterangan persnya kepada Waspada, PT PIM pernah berjanji siap bertanggung jawab bila hasil uji sample terbukti positif. Karena pasca pencemaran limbah yang terjadi di Sungai Ujung Pacu mengakibatkan banyak ikan mati termasuk ikan dalam tambak petani dan masyarakat banyak mengalami kerugian besar. Namun hingga hari ini belum juga ada upaya ganti rugi dari pihak PT PIM selaku pihak yang mencemarkan limbah dan belum ada titik terang atau itikad baik apa pun dai PT PIM. Apadin menegaskan PT PIM untuk segera bertanggungjawab dan mengganti kerugian yang dialami masyarakat lingkungan yang terkena dampak pencemaran limbah.”Kalau PT PIM belum juga bertanggungjawab, maka kami akan kerahkan massa,” ancam Apadin. Sementara itu Kabag Humas PT PIM Mustafa Thahir yang dikonfirmasi Waspada kemarin mengaku tidak bisa memberikan keterangan lebih lanjut. Mustafa menyebutkan soal penyelesaiannya kasus pencemaran limbah nantinya akan dijawab pihak Kecamatan Muara Satu, seraya menunggu kepulangan atasan PT PIM. “Kami tidak bisa menjawab lebih lanjut, coba hubungi camat setempat dia tahu. Kalau kami sedang menunggu atasan kami pulang. Nanti dia yang akan bicara langsung soal itu,” tutur Mustafa seraya memutuskan hubungan telepon. (b16)

Penerbangan Di Bandara SIM Banda Aceh Tiba (flight, asal, waktu) Garuda Indonesia

Berangkat (flight, tujuan, waktu)

GA 142 Jakarta/Medan GA 146 Jakarta/Medan

10:40 15:50

GA 143 Medan/Jakarta GA 147 Medan/Jakarta

11:25 16:45

Y6 555 Jakarta * Y6 537 Jakarta/Medan

19:05 12:30

Y6 556 Jakarta** Y6 538 Medan/Jakarta

07:05 12:30

JT 304 Jakarta JT 396 Jakarta/Medan

11:35 20:00

JT 397 Medan/Jakarta JT 307 Jakarta

06:40 12:15

SJ 010 Jakarta/Medan

12:55

SJ 011 Medan/Jakarta

13:25

Batavia Air Lion Air

Sriwijaya Air Air Asia

AK 305 Kuala Lumpur *** 12:20

AK 306 Kuala Lumpur*** 12:45

FY 3401 Penang ****

FY3400 Penang ****

Fire Fly

14:10

* Setiap Selasa, Kamis, Minggu. ** Setiap Senin, Rabu, Jumat. *** Setiap Senin, Rabu , Jumat dan Minggu. **** Setiap Selasa, Kamis dan Minggu.

14:30

Meski Mirip Babi, Binatang Laut Halal PEUREULAK BARAT (Waspada): Meski menyerupai babi atau anjing atau binatang haram lainnya, namun semua jenis binatang dan hewan yang hidup di dalam laut dihalalkan untuk di makan umat Islam. Demikian dikatakan Tgk H Abdullah Rasyid dalam pengajian Ulama-Umara se Aceh Timur di Desa Alue Bu, Kecamatan Peureulak Barat, Sabtu (11/2). Hal itu ditegaskannya menyusul pertanyaan salah seorang jamaah yang meminta ketegasan hukum syar’i dari guru besar pengajian di Balai Pengajian Ulama – Umara yang

diikuti ratusan pimpinan Ponpes/Dayah dan Balai Pengajian (BP) se Aceh Timur. Na m u n d e m i k i a n , H . Abdullah Rasyid menegaskan, binatang atau hewan yang menyerupai babi ataupun anjing halam dimakan dengan catatan binatang tersebut hanya bertahan hidup di laut. “Semua ada di laut halal di makan. Tapi jika ada hewan ataupun binatang yang hidup di dua tempat, maka itu haram di makan. Itu perlu digarisbawahi,” katanya. Selain itu juga, lanjut H. Abdullah Rasyid, sayuran dan tanaman serta buah-buahan

awal batangnya diberikan pupuk yang berasal dari kotoran babi juga halal di makan, seperti tomat yang dipupuk dengan kotoran manusia ataupun kotoran babi dan anjing, hukum makan tomat itu halal sebab prosesnya alami. “Begitu juga dengan ikan lele ataupun ikan gabus serta ikan yang hidup di air tawar lainnya juga halal dimakan, meskipun makanannya berasal dari kotoran babi ataupun binatang najis lainnya, sebab yang di makan itu ikannya, bukan kotorannya,” tegas H Abudllah Rasyid. (b24)

Murid PAUD Diperkenalkan Cara Menabung Di Bank BNI Syariah SEBANYAK 60 murid, guru bersama perwakilan orang tua melakukan kegiatan Outing ke bank BNI Syariah Cabang Banda Aceh. Murid-murid PAUD Terpadu Tauhid dan Entrepreneurship Khalifah Banda Aceh ini mendemokan langsung cara menabung di bank. “Kami harus menjelaskan dari awal proses pembukaan rekening, sekaligus bagaimana melakukan penyetoran uang di counter bank. Sehingga para anak-anak usia dini dapat langsung menabung dan mengetahui proses kegiatan di sebuah bank,” ujar Drs H Zul Irfan, MM. Pejabat Penganti Sementara (Pgs) Pemimpin Cabang BNI Syariah Banda Aceh yang menerima rombongan cilik ini, mengatakan sangat berterimakasih atas kepercayaan pimpinan PAUD Khalifah terhadap Bank BNI Syariah sebagai tempat outing. “Kegiatan outing dengan demo langsung ini salah satu upaya untuk mengenalkan bank kepada anak-anak sejak usia dini dan menciptakan budaya gemar menabung,” tutur Zul Irfan, kepada Waspada, Kamis (9/2) di Banda Aceh. Pimpinan PAUD Terpadu Khalifah (franchise milik Trainer Ipoh Santoso dengan bukunya 7 Keajaiban Rezeki), Fachrul Farosa menambahkan pengenalandariusiadinibagiseoranganak adalah cara positif pembelajaran menabung, menghemat dan mengatur keuangan sendiri. Fachrul mengatakan kegiatan outing kepada anak-anak

Waspada/ist

KETUA Divisi Organisasi AJI Indonesia (duduk No 2) dari kiri, foto bersama Ketua, Sekretaris Yusmandin Idris dan Desi Saifan, anggota AJI Kota Bireuen usai konfrensi ke-1 yang digelar di Hotel Meuligoe Cot Gapu Bireuen Sabtu (11/2) petang.

Yusmandin Dan Desi, Ketua Dan Sekretaris AJI Kota Bireuen BIREUEN (Waspada) : Yumandin Idris dan Desi Saifan Ketua dan Sekretaris AJI Persiapan Bireuen secara aklamasi kembali terpilih sebagai Ketua dan Sekretaris Aliansi Jurnalis Independen (AJI) Kota Bireuen definitif periode 2012-2015 dalam konfrensi-I yang digelar di Hotel Meuligoe Cot Gapu, Sabtu (11/2). Konfrensi ke-1 dan seminar sehari yang digelar AJI Kota Bireuen turut dihadiri Kepala Divisi Organisasi AJI Indonesia Mujib Rahman, Waka Polres Bireuen KompolW Eko Sulistiyo, Dandim0111/Bireuen diwakili Pasi Ter Kapten Inf Panaha, H AR Djuli, seorang tokoh pendiri AJI Kota Lhokseumawe pertama kali di Aceh, Ketua AJI Kota Lhokseumawe Saiful , Ayi Jufrida AJI Kota Lhokseumawe sebagai pemateri Konfrensi, Ketua AJI Persiapan Langsa Ivo Lestari , 16 anggota AJI Bireuen, Takengen dan Bener Meriah yang bergabung ke AJI Kota Bireuen. Dari kalangan pejabat Kadis PU Ismunandar,

Kadinkes dr Amir Addani, MKes, Kabag Humas dan Protokoler Setdakab Bireuen Salahuddin,SH, Kabag Kepegawaian Bob Miswar, Wakil Ketua III STIE Kebangsaan Bireuen Agus Irwanto,SE, Athailah Dosen STAI Al Azziziyah Samalanga, Muazzimah, BSc, PDRI Bireuen dan sejumlah undangan lainnya. Ketua AJI Kota Persiapan BireuenYusmandin Idris dalam sambutannya antara lain menyampaikan, AJI Persiapan Bireuen sejak awal Desember 2011 telah disahkan menjadi AJI defenitif dalam kongres AJI di Makasar bersama delapan AJI Kota lainnya di Indonesia. Aji Kota Bireuen tercatat sebagai AJI Kota ke-34 di Indonesia. Konfrensi perdana AJI Kota Bireuen yang digelar, Sabtu (11/2) sebagai tindak lanjut dari hasil kongres dengan agenda kegiatan, rapat kerja, pemilihan pengurus defenitif untuk periode 2012-2015 . (b12)

PWI Aceh Minta Semua Pihak Menghargai Profesi Wartawan

Waspada/Muhammad Zairin

SALAH SEORANG murid PAUD Terpadu Tauhid dan Entrepreneurship Khalifah Banda Aceh melakukan transaksi langsung di teller yang disaksikan Pgs. Pimpinan Bank BNI Syariah Cabang Banda Aceh,H Zul Irfan,dalam kegiatan Outing mendemo langsung bertransaksi di bank. PAUD tersebut, mendapat dukungan para orang tua murid sehingga peran serta orang tua untuk menabung juga cukup antusias. Di akhir kunjungan para murid-murid PAUD Khalifah ini mendapat souvenir berupa celengan ekslusif dan makanan ringan sebagai tanda mereka telah menjadi tamu istimewa BNI Syariah Banda Aceh. Pada bagian lain, Drs H Zul Irfan, MM menjelaskan perkembangan BNI Syariah di Banda Aceh saat ini mendapat respon yang baik dari masyarakat Serambi Mekah. Sehingga meningkatkan pengumpulan dana pihak ketiga cukup menggem-

birakan. BNI Syariah Banda Aceh memilki jaringan kemitraan ke sejumlah PAUD dan TK di Banda Aceh, dengan sistem pickup dana langsung ke sekolah. Produk TabunganKu telah diluncurkan Bank Indonesia kepada perbankan agar mampu menghimpun dana retail dan murah. “Sebagai ucapan terima kasih atas kepercayaan nasabah, BNI Syariah memberikan hadiah gift baik pada saat pembukaan rekening maupun Undian Tabungan Cahaya Rejeki Hasanah berupa Mobil Honda Freed dan Toyota Avanza serta ratusan hadiah menarik lainnya,” ungkap Zul Irfan. (b06)

BANDAACEH (Waspada) : PersatuanWartawan Indonesia (PWI) Cabang Provinsi Aceh menyesalkan kasus pembunuhan wartawan di KabupatenAcehTenggara(Agara)yangditemukan sudah menjadi mayat beberapa waktu lalu. Hal itu disampaikan Wakil Ketua Bidang Organisasi PWI Aceh, Drs HT Anwar Ibrahim kepada Waspada di Kantor PWI setempat Jalan T.Angkasah No.3 Simpang Limong, Kuta Alam, Kota Banda Aceh, Sabtu (11/2). Karena itu, HT Anwar Ibrahim meminta semua pihak untuk menghargai profesi wartawan. Bila terjadi kekeliruan dalam pemberitaan, diminta untuk menggunakan jalur-jalur hukum yang berlaku, seperti diatur dalam undangundang pokok pers, bukan bertindak kasar apalagi membunuh. “Kepada pihak yang merasa dirugikan dengan pemberitaan di media dapat menggunakan hak jawab, sesuai telah diatur dalam UU Nomor 40 tahun 1999 tentang Pers. Jangan main hakim sendiri dan kasar ala premanisme apalagi membunuh,” pinta HT Anwar Ibrahim. Di usia pers Indonesia yang sudah memasuki ke 66 tahun, masih ditemukan wartawan yang mati sia-sia karena karya tulisnya dan tugasnya. Padahal semua pihak setuju, pers Indonesia harus merdeka tanpa intervensi dari pihak manapun.”Kita sangat menyesalkan kejadian-kejadian seperti yang dialami seorang wartawan Koran Monitor terbitan Medan bernama Darma S, yang dimukan tewas menjadi mayat yang diduga karena dibunuh pada, Minggu 5 Februari 2012 lalu di Aceh Tenggara, “sesal HT Anwar. “Apalagi kasus kekerasan dan pembunhan yang dilakukan pihak tertentu ini justru terjadi di saat-saat menjelang detik-detik peringatan Hari Pers Nasional (HPN) ke- 66, “sesal wartawan Medan Bisnis itu.

Menurut HT Anwar, kekerasan terhadap kuli tinta di Aceh tak mengenal waktu dan tempat. Misalnya kasus yang terjadi di Aceh Tenggara yang menimpa seorang wartawan ditemukan telah menjadi mayat di sebuah parit. Pihak kelurga meyakini, korban meninggal karena dibunuh. Kasus hampir sama juga dialami seorang wartawan di Kabupaten Aceh Timur terpaksa harus “menikmati” bogem mentah oleh pengusaha konstruksi yang bertepatan dengan puncak peringatan HPN ke 66, kata HT Anwar. Apa yang terjadi terhadap Basri, seorang wartawan Radar Nusantara Jakarta itu sangat kita sesalkan. Apalagi kejadian itu berlangsung di Mapolsek Banda Alam, di mana Basri dikeroyok oleh kontraktor di depan aparat penegak hukum. Penyebabnya, kontraktor kecewa kepada wartawan karena menindaklanjut keluhan masyarakat terkait jalan yang dibiarkan berdebu oleh pemborong itu. “Melihat serangkaian kekerasan yang dilakukan terhadap para kuli tintan (wartawan) itu, apapun alasannya PWI tidak terima perlakuan keji seperti itu, premanisme terhadap wartawan harus dihentikan,” cetus pria yang akrap disapa pak haji itu. Selanjutnya HT Anwar juga berharap kepada rekan-rekan wartawan untuk terus menimba ilmu dan pengetahuan. “Kami harapkan agar kawan-kawan terus meningkatkan SDM. PWI sendiri akan membekali para wartawan dengan pendidikan. Semoga dengan bekal itu, kita kembali dihargai,” pintanya. Meskipun demikian HT Anwar kembali mengingatkan para wartawan yang tak berkemampuan untuk introspeksi diri. “Kalau kirakira tak mampu menjadi wartawan, sebaiknya segera mengundurkan diri, jangan paksakan kehendak,” sarannya lagi.(b09)


Aceh

WASPADA Senin 13 Februari 2012

Tarmizi, Saya Milik Semua Golongan

Harga Beras Di Bireuen Melambung BIREUEN (Waspada) : Memasuki musim paceklik, harga beras di Bireuen dan sekitarnya makin melambung. Akibatnya, warga kalangan kurang mampu terpaksa membeli beras kualitas rendah dalam bentuk eceran. Meski beras kualitas rendah harganya terus melonjak Rp 13 ribu per bambu. Hajidin, salah seorang pedagang kebutuhan pokok di Pasar Sabtu Bireuen kepada Waspada mengatakan mereka terpaksa menjual beras dengan harga tinggi karena harga beli dari pengusaha kilang padi pada musim penceklik dengan harga tinggi. Dikatakan, musim panen baru lalu hasil panen padi di Kabupaten Bireuen secara merata cukup bagus. Stok gabah untuk bagi para pengusaha kilang padi di Kabupaten Bireuen melimpah. Menurut Hajidin, saat panen pertengahan Desember 2011 harga beras masih stabil, beras lokal kualitas nomor satu cap panah, cap UB Juli Keude Dua, masilh dijual kepada konsumen dengan harga Rp 105 ribu per karung (ukuran 15 kg) terus melonjak hingga Sabtu (11/2) harganya Rp 128 ribu per karung, naik drastis mencapai Rp 23 ribu per karung. Sementara beras kualitas nomor dua cap JK dan beberapa merek lainnya dari harga Rp 95 ribu per karung (ukuran 15 kg) sekarang harga melonjak naik Rp 123 ribu per karung. Sedangkan beras kualitas rendah setara beras raskin dari harga sebelumnya Rp 80 ribu per karung melonjak Rp 115 ribu per karung. Pengamatan Waspada di pasar tradisional Bireuen, Sabtu (11/ 2) warga kurang mampu terpaksa membeli beras kualitas rendah karena harga beras di Bireuen terus melonjak. Kalangan keluarga kurang membeli beras kualitas rendah dalam jumlah eceran Rp 13 ribu per bambu. (b12)

Pasar Ayam Bireuen Semraut BIREUEN (Waspada) : Pasca digusurnya pasar ayam di depan Meunasah Kota Bireuen puluhan tahun silam hingga saat ini belum ada lokasi pasar ayam pengganti. Yang sudah ada hanya pasar tempat penjualan ayam potong yang sudah disembelih bersebelahan dengan pasar daging sapi dan kambing. Akibat belum adanya pasar Muge Manok (pedagang ayam) memasarkan ayam dan itik dengan sepedamotor dalam keranjang selama ini terpaksa mengelar dagangan ayam di sepanjang ruas jalan masuk pasar ikan. Pengamatan Waspada, Minggu (12/2) para Muge Manok menggelar penjualan ayam dan itik di sepanjang ruas jalan masuk pasar ikan sangat semraut mengganggu lalu lintas warga masuk berbelanja di pasar ikan. Abdul Latif, salah seorang muge manok mengatakan, puluhan muge manok dan itik berasal dari kecamatan memasarkan ayam dan itik ke Bireuen lantaran belum ada pasar ayam. Diakui ruas jalan pasar ikan dijadikan lokasi pasar ayam sangat tidak layak, selain mengganggu arus lalu lintas warga yang berbelanja ke pasar ikan warga juga sulit untuk membeli ayam dan itik yang digelar di ruas jalan pasar ikan yang sempit. Para muge manok sangat berharap kepada Pemkab Bireuen untuk menyediakan lokasi pasar ayam yang sangat dibutuhkan para muge manok maupun masyarakat, pinta Abdul Latif. (b12)

Keprok Gayo Dikembangkan Petani Linge TAKENGEN (Waspada): Selain kapulaga yang telah ‘berbiak’ di atas lahan seluas 130 hektare, kini giliran jeruk keprok Gayo akan dikembangkan petani di Kecamatan Linge, Aceh Tengah, dengan areal mencapai 100 hektare. “Meningkatkan penghasilan para petani di Linge, Aceh Tengah selain kapulaga, kedepan akan dikembangkan jenis jeruk keprok Gayo. Karena itu, dari seratus hektare lahan layak tanam yang tersedia, 12 hektare di antaranya akan segera dijadikan lokasi ujicoba di tahun ini,” ucap Nasrun Liwanza, Camat Linge, menjawab Waspada, Minggu (12/2) sore. Untuk itu, katanya, dari 12 hektare lahan ujicoba, dibutuhkan sekitar 277 batang bibit per hektare atau dalam tahap awal dibutuhkan sebanyak 3.324 batang bibit.”Melihat prospek itu, saya mencoba membantu petani di Linge, dengan berupaya mengembangkan bibit jeruk keprok Gayo.” Menurut mantan penyuluh pertanian Aceh Tengah ini, kendati pengembangan jeruk keprok Gayo di Kec.Linge itu merupakan program Dinas Pertanian kabupaten setempat, namun langkanya bibit, membuat ia mencoba mengembang-kannya. “Saat ini dibutuhkan bibit varietas unggul. Karena itu saya langsung mengambil bibit dari Celkung Malang. Dimana bibitbibitnya telah dinyatakan seteril dari virus seperti jamur phytoptora,” ungkapnya sembari memaparkan bagaimana tehnis mengokulasi jeruk tersebut di lokasi penangkaran bibit miliknya di Kuyun Uken, Kec. Celala, Aceh Tengah. Dikatakan, idealnya jeruk keprok Gayo akan berkembang dengan baik bila ditanami di ketinggian berkisar 1.200-1.300 dari permukaan laut (DPL). Selain itu, supaya lebih cepat berbuah hendaknya dilakukan tehnis okulasi (menyambung/menempel batang jeruk berlainan jenis).(cb09)

Waspada/Muhammad Zairin

HARI kedua di Banda Aceh, Pj Gubernur Aceh, Tarmizi A.Karim (kanan) didampingi Kepala LPPRRI Banda Aceh, Muliono, ST, mengikuti acara talk show di Radio RRI, Sabtu (11/2) yang disiarkan langsung.

20 Persen Desa Di Aceh Timur Berbalut Masalah Tapal Batas IDI (Waspada): 20 Persen desa dari 511 desa (gampong— red) di Kabupaten Aceh Timur, Provinsi Aceh, berbalut masalah tapal batas. Persoalan batas mulai terjadi ketika pemekaran Aceh Timur dari Kota Langsa. “Kita rasa persoalan tapal batas terjadi pasca pemekaran, dimana harga tanah naik secara mendadak dan bangunan terjadi dimana-mana,” papar Kepala Bagian (Kabag) Pemerintahan Mukim Gampong (PMG) Setdakab Aceh Timur, Usman, S.Sos.I kepada Waspada, Sabtu (11/2) di Peureulak. Menurut Usman, pihaknya terus berencana untuk penye-

lesaian dengan melibatkan semua pihak, termasuk unsur Muspika setempat. Tetapi dalam proses itu pihaknya tidak mendapatkan alokasi anggaran, meski selalu diusulkan setiap tahun. “Sehingga mengakibatkan pihak PMG terkendala dalam proses penyelesaian tapal batas desa, karena dalam hal ini nantinya akan dilibatkan unsur,” sebut Usman seraya menyebutkan, unsur yang dilibatkan antara lain dari Badan Pertanahan Nasional (BPN), Dinas Kehutan dan Perkebunan (Dishutbun), Bagian Pemerintah Umum, aparatur desa dan ke-

mukiman serta unsur Muspika. Ketika disinggung desa (gampong—red) yang bermasalah tapal batas, Usman menyebutkan antara lain dari puluhan desa yang bermasalah Tapal Batas yakni Desa Bangka Rimung dengan Kumuneng, Kecamatan Peureulak Kota. “Sebelum dibangun Gedung Madrasah Aliyah Negeri (MAN) 1 Peureulak dan sebelum dibangun SPBU Peureulak tidak pernah terjadi persoalan itu. Pasca adanya pembangunan tersebutlah muncul persoalan antara dua desa ini. dan hingga kini belum tuntas,” tandas Usman yang juga mantan Camat Peureulak Barat itu. (b24)

Pemkab Pidie Tak Peduli Perawatan Drainase SIGLI (Waspada) : Banyak jalan utama dalam Kota Sigli yang terendam banjir genangan disaat hujan mengguyur kawasan Ibukota Kabupaten Pidie itu. Genangan air hujan bisa mencapai hingga setengah meter meski hanya hujan sebentar saja. “Setiap musim penghujan beberapa kawasan Kota Sigli selalu tergenang sehingga membuat suasana ibukota kabupaten itu tampak semakin kumuh. Genangan air tidak hanya terjadi di jalan tapi juga sebagian pemukiman penduduk dan rumah warga,“ungkap beberapa tokoh masyarakat setempat kepada Waspada, Minggu (12/2). Kondisi itu terjadi salah satu faktor sebagian besar drainase (saluran-red)yangadadalamKota Sigli sejak lama sudah tersumbat sehingga air yang turun dari langit itu tak bisa mengalir dan menggenangi sejumlah jalan. Ketua LSM Yapmalsof Kabupaten Pidie, Asnawi Ali kepada Waspada menyebutkan, setiap musim penghujan semua ruas jalan di Kota Sigli sering kali tergenang karena saluran tersumbat yang membuat air tak bisa mengalir.

Asnawi minta dinas terkait pro-aktif membenahi dan membersihkan sekaligus memperbaiki saluran yang sudah berkalang tahun dibiarkan tersumbat, namun tak ada yang mempedulikannya. “Genangan air di badan jalan akibat hujan dan drainase tersumbat sering mengganggu pengguna jalan dan sejumlah pedagang karena pertokoan mereka terancam genangan air di Jalan Iskandar Muda, “sebutnya. Disebutkan Asnawi, penyumbatan drainase sudah terjadi sejak pascatsunami menimpa Aceh pada 26 Desember 2004. Amatan Waspada, genangan air terparah terjadi di Jalan Iskandar Muda, persisnya di persimpangan antara bundaran Beringin menuju ke Simpang Rawa dan Alun-Alun dan persis di depan warung Dua berlian serta sejumlah ruas jalan padat lainnya. Padahal seperti yang terjadi di depan warung Dua Berlian, genangan air hingga berharihari saat hujan dan pasca hujan terjadi, lokasi tersebut tidak jauh dari sungai yang hanya berjarak

sekira 20 atau 30 meter itu. Hal yang sama juga terjadi di jalan depan Pos Satlantas Polres Pidie kawasan bundaran beringin. Genangan air di jalan itu hingga berhari-hari lamanya meski hujan tak turun lagi. Selain itu, genangan air juga terjadi akibat dampak pembangunan toko baru di sejumlah titik lokasi yang tidak disertai dengan pembangunan drainase yang juga menyebabkan saluran telah ditutupi dengan beton. Kondisi itu otomatis air tidak bisa dengan leluasa mengalir ke saluran pembuangan selanjutnya ke sungai, yang akhirnya tumpah ruah ke badan jalan. Kepala Dinas Bina Marga dan Cipta Karya (BMCK) kabupaten Pidie, Anwar Ishak kepada wartawan sebelumnya menyebutkan, Pemkab Pidie tak mampu memperbaiki drainase yang tersumbat dengan menggunakan dana APBK maupun otsus karena membutuh dana besar. Karenanya untuk menangani persoalan yang sudah menahun itu, saat ini sedang berupaya mencari dana bersumber dari APBN melalui Dirjen PU di Jakarta. (b09)

Penderita Sakit Berharap Bantuan Waspada/Irwandi MN

NASRUN LIWANZA, Camat Linge, Aceh Tengah sedang mengembangkan bibit jenis jeruk keprok gayo dilokasi penangkaran miliknya di Kampung Kuyun Uken, Kec.Celala.

Tanaman Kakao Di Pidie Dan Pijay Diserang Hama SIGLI (Waspada) : Ribuan tanaman kakao (coklat-red) milik masyarakat di Kecamatan Padang Tiji dan sejumlah kawasan kecamatan lainnya dalam daerah Kabupaten Pidie diserang hama. Akibatnya, petani coklat dibuat resah karena buah coklat tidak berkembang normal dan berwarna keputih-putihan. Selain di Kabupaten Pidie, serangan hama coklat juga terjadi di Paru, Luengputu, Kecamatan Bandar Baru, Trienggadeng, Ulee Gle dan Ulim di kabuapetn Pidie Jaya (Pijay), yang terjadi sejak beberapa tahun terakhir ini, ungkap beberapa petani setempat kepada Waspada, Minggu (12/2). Di Kabupaten Pidie khususnya dilaporkan, dari luas tanam 8.247 hektare areal kebun kakao rakyat setidaknya tersebar di hampir 20 kecamatan dalam 23 kecamatan dalam daerah Kabupaten Pidie, sedikitnya sekira 30 persen atau setara 2.500 hektare di antaranya diserang hama penyakit. Kepala Dinas Kehutanan dan Perkebunan (Dishutbun) Kabupaten Pidie, Ir HM HasanYahya menjawab Waspada membenarkan sebagian tanaman kakao rakyat di daerahnya saat ini mendapat serangan hama penyakit. “Sekira 30 persen kebun kakao di Pidie diserang hama, kita sudah imbau petani kakao supaya bisa menjaga senitasi lahan, “katanya. Ditanya jenis hama yang sering menyerang tanaman kakao rakyat di Pidie itu, Hasan Yahya menyebutnya, hama yang kerap menyerang itu adalah Perusak Penggerek Kualitas Buah atau disebut PPK. “Hama mengakibatkan buah busuk, kalau hidup kualitas kurang bagus kecil, “jelas Hasan.(b21)

C3

SUBULUSSALAM (Waspada): Dua orang warga Desa Pegayo, Kec. Simpang Kiri, Subulussalam yang menderita penyakit berbeda berharap bantuan. Riska, 4, putri kedelapan pasangan Rustam, 45, dan Sarinah, 35, menderita kaki membesar dan Suti, 25, terancam buta. Ditemui Waspada didampingi DKR Subulussalam, Kamis (9/2) di kediamannya, Sarinah menuturkan kalau kaki kiri putrinya terus membesar.Walau sewaktu-waktu bisa bermain, idealnya anak seusianya, Riska diakui tak bisa pakai sandal. “Kalau badannya panas, apapun nggak bisa dia lakukan, termasuk berdiri,” tutur Sarinah miris didampingi putri tertuanya berusia 22 tahun. Walau belum didiagnosa medis sebagai sakit ‘Kaki Gajah’, faktanya kaki Riska terus membesar. “Disuruh ke Rumah Sakit Rimo, tapi kami nggak punya uang,” cerita Sarinah. Dia juga mengaku anaknya sempat diperiksa ke Puskesmas terdekat beberapa tahun silam namun tidak memperoleh hasil yang memuaskan. Sarinah mempunyai suami hanya seorang petani dan pencari ikan. Sementara Suti terancam buta karena sejak usia lima tahun mengalami sakit mata. Kini

BANDA ACEH (Waspada) : Malam lepas sambut mantan Gubernur Aceh Irwandi Yusuf danWakil Gubernur Muhammad Nazar dengan Pj Gubernur Aceh Tarmizi A Karim berlangsung dalam suasan sederhana dan santai di Anjung Mon Mata kompleks Pendopo, Banda Aceh, Jumat (10/2) malam (10/2). Pada kesempatan itu Pj Gubernur Aceh Tarmizi Karim menegaskan, dia merupakan milik semua golongan masyarakat yang ada di Provinsi Aceh. Sementara mantan Gubernur Aceh Irwandi Yusuf dan Wakil Gubernur Muhammad Nazar menyampaikan keberhasilan selama lima tahun masa kepemimpinannya di Aceh. Sementara itu prosesi malam lepas sambut yang diawali dengan penyematan lencana Pancacita Kelas Satu untuk Irwandi dan Nazar dilakukan Pj Gubernur Tarmizi Karim. Dilanjutkan dengan penyerahan cinderamata dilakukan Sekretaris Daerah (Sekdaprov) Teuku Setia Budi, Panglima Kodam Iskandar Muda Mayjen Adi Mulyono, Kapolda Irjen Iskandar Hasan, dan sejumlah unsur muspida lainnya. Bersikap Netral Di hadapan unsur Muspida Aceh dan para undangan lainnya Pj Gubernur Aceh Tarmizi A Karim berjanji akan bersikap netral dan berlaku adil terhadap semua kandidat dalam Pemilukada Aceh 2012. “Penegasan ini saya sampaikan untuk menetralisir tudingan-tudingan politis yang ada dibalik penunjukkan dirinya sebagai pejabat sementara kepala pemerintahan Aceh, “sebut Tarmizi. Karenanya, sebut Tarmizi, Pak Irwandi, Pak Nazar, percayalah saya tetap akan berlaku adil dan netral dalam Pemilukada nanti. Apalagi Pak Menteri (Mendagri-red) sambil pura-pura membetulkan baju saya, beliau berbisik: berlaku adillah di Aceh,” ujarnya mengutip kembali amanah dari Mendagri, Gamawan Fauzi. Ditegaskan, sebagai terobosan awal, ia akan menertibkan semua atribut calon yang diduga bisa menyalahgunakan fasilitas negara, seperti pemasangan foto Irwandi pada kartu Jaminan Kesehatan Aceh (JKA). “Yang kita tarik bukan hanya kartu JKA, tapi semua atribut calon yang bisa diduga menggunakan fasilitas negara akan kita tertibkan,” tegas mantan bupati Aceh Utara dan mantan Pj Gubernur Kalimantan Timur ini. “Tindakan tersebut sebagai bentuk netralitas dan asas keadilan dalam memfasilitasi terselenggaranya pemilihan secara fair. Ini salah satu cara untuk membantu pilkada berjalan sesuai aturan dan hukum yang berlaku” ujarnya lagi. Bahkan Tarmizi menyebutkan, saat ia menghadiri penutupan persidangan pertama di DPRA pada Jumat (11/2) sore, sejumlah anggota Parlemen meminta untuk menarik semua kartu JKA yang bergambar Irwandi. Keberhasilan Sementara itu Irwandi menyebutkan, malam lepas-sambut itu terbilang istimewa karena dihadiri oleh dua mantan gubernur. “Malam mini kita sangat berbahagia karena dihadiri oleh dua mantan gubernur senior, Pak Syamsuddin Mahmud dan Pak Abdullah Puteh,” kata Irwandi yang disambut tawa dan tepuk tangan riuh dari para tamu yang hadir. “Kami berdua sejak tanggal 8 Februari juga sudah menjadi gubernur dan wakil gubernur senior,” ujar Irwandi. Menurut Irwandi, selama lima tahun masa kepemimpinannya di Aceh telah dicapai sejumlah keberhasilan, seperti bidang kesehatan, pengentasan kemiskinan, dan pengurangan angka pengangguran. Disebutkannya, persentase angka pengangguran di Aceh pada tahun 2005 mencapai 9,84 persen, secara perlahan turun menjadi 7,4 persen di tahun 2011. Begitu juga dengan sektor kesehatan, jika di tahun 2005 jumlah bayi yang meninggal tiap 1.000 kelahiran 42 orang, kini hanya menjadi 26 per 1.000 kelahiran. “Demikian halnya dengan angka kematian ibu melahirkan juga menurun. Dari seratus ribu yang melahirkan di tahun 2005, meninggal 354

orang turun menjadi menjadi 190 orang di tahun 2011,” kata Irwandi. Menurut Irwandi semua keberhasilan yang telah diperoleh itu merupakan hasil kerja semua pihak di Aceh. “Namun kami akui target pembangunan belum semuanya tercapai. Masih banyak potensi alam yang belum dioptimalkan,” ujarnya. Karenanya Irwandi berharap Pj Gubernur Aceh dan siapa pun yang terpilih dalam pemilihan April nanti bisa mengoptimalkan sumberdaya alam untuk kesejahteraan masyarakat. Selain itu Irwandi dan Nazar juga berharap Pj Gubernur tak mengubah program yang dianggap berhasil pada masa pemerintahan mereka.”Yang dianggap sukses baiknya terus ditingkatkan,” harap Irwandi didampingi Muhammad Nazar. Menyangkut Pemilukada Aceh 2012 Irwandi minta Pj Gubernur bersikap adil dan netral dalam memfasilitasi pelaksanaannya nanti. “Kami sangat berharap netralitas ini. Semoga menjadi fasilitator yang bijaksana untuk menyukseskan pilkada,” ujarnya. Disebutkan Irwandi, Pj Gubernur akan dianggap gagal jika pilkada tidak berlangsung dengan baik atau bahkan molor lagi dari jadwal yang telah ditetapkan sekarang. Sedangkan Muhammad Nazar yang menyampaikan kata perpisahan setelah Irwandi juga berharap Tarmizi Karim untuk berperilaku adil dalam memfasilitasi pemilihan kepala daerah di Aceh. Ia mengajak masyarakat dan semua elemen di provinsi ini untuk mendukung kepemimpinan Tarmizi Karim meski hanya beberapa bulan. Proporsionalitas Hal yang sama juga kembali diulanginya dalam wawancara dengan LPP-RRI Banda Aceh, Sabtu (11/2). Sebagai Pj Gubernur Aceh, Tarmizi A. Karim menegaskan, dirinya adalah milik semua golongan. Karena itu, ia meminta semua pihak tidak perlu khawatir akan independensinya dalam memimpin Aceh. “Tidak perlu khawatir saya akan independen, proporsionalitas dan tidak berpihak kepada salah satu calon gubernur dan wakil gubernur,” sebut Tarmizi A. Karim. Menjawab seorang pendengar yang mengikuti siaran langsung itu, Tarmizi yang pernah menjadi Bupati Aceh Utara dua periode ini, juga menyampaikan agar semua pihak di bumi Serambi Makkah meminimalisir intensitas saling curiga. “Mari kita menghilangkan rasa saling curiga dan menjaga kesucian hati, karena kesucian hati itu adalah salah satu alasan Allah SWT menurunkan rahmat kepada rakyat Aceh,” cetus mantan Penjabat Gubernur Kalimatan Timur 2007. Tarmizi A. Karim menjelaskan kepulangannya ke Aceh sebagai Pj. Gubernur adalah sematamata dalam rangka mensukseskan masa transisi sampai terpilihnya gubernur dan wakil gubernur definitif pada pilkada yang akan dilaksanakan 9 April 2012 ini. “Kita akan fasilitasi penyelenggaraan pilkada Aceh 2012 yang berkualitas, dan jurdil (jujur dan adil) serta akan mengayomi semua pihak,” tegas Tarmizi yang dalam wawancara tersebut turut didampingi Kepala LPP RRI Banda Aceh, Muliono, ST. Kabag Humas Pemerintah Aceh, Usamah El Madny menambahkan kehadiran Pj Gubernur Tarmizi A. Karim dalam wawancara di radio dan televisi nasional mendapat apresiasi masyarakat pendengar dan pemirsa yang luar biasa. “Banyak informasi penting yang dapat disampaikan langsung kepada Pj Gubenur. Karena itu kita akan coba agendakan secara berkala agar Pj Gubernur bisa berkomunikasi langsung dengan rakyat dengan berbagai media lainnya,” cetus Usamah. Hingga hari kedua kepulangan Pj. Gubernur ke Aceh, agenda Tarmizi A. Karim masih sangat padat. Terutama dalam menerima tamu dari berbagai lapisan masyarakat yang hendak bertemu dengan Kepala Badan Diklat Kemendagri. (b06/b09)

Allah Rido Asal Tidak Syirik SUBULUSSALAM (Waspada): Allah rido dan mengampuni dosa-dosa umat Nabi Muhammad SAW, asalkan tidak syirik. Lalu tiga hal perlu dicontoh dari Rasulullah adalah keyakinan, ibadah dan akhlaknya. Ustadz Ansufri Idrus Sambo pada tausiyah Maulid Nabi Muhammad SAW, Rabu (8/2) di Masjid Assilmi Subulussalam mengatakan, salah satu keistimewaan umat Nabi Muhammad, kelak akan dimasukkan Allah SWT ke dalam syurga jika benar-benar meneladani sunah Rasulullah, dan terpenting tidak mensekutukan Allah SWT (syirik). Dikisahkan, Nabi Muhammad pernah menangis hanya karena mengetahui betapa kuatnya Nabi Isa AS memohonkan ampun kepada Allah atas umatnya meski mereka banyak ingkar. Mengetahui hal yang disedihkan itu, melalui

Malaikat Jibril, Allah sampaikan kepada Nabi Muhammad kalau Allah rido dan mengampuni dosa-dosa umatnya jika tidak syirik dan menjalankan sunah Rasulullah. Kepada ratusan jamaah, dihadiriWali Kota, Sakti dan wakilnya Affan Bintang serta sejumlah Kepala SKPK, Ansufri berpesan melakukan yang terbaik untuk mendapatkan yang terbaik. Di akhir tausiyahnya, Ansufri menguraikan sejumlah keistimewaan orang yang suka berinfak, seperti balasan 10 kali lipat, diselamatkan dari bencana, disembuhkan dari penyakit (lakukan juga berobat) dan dimudahkan rezeki dari jalan yang tak disangka-sangka. Dalam kesempatan itu Wali Kota, Sakti menyerahkan secara simbolis santunan kepada anak yatim setempat. (b28)

Tolak Wartawan Yang Tidak Jelas Media

Waspada/Khairul Boangmanalu

RISKA, mengalami kaki membesar dalam gendongan ibunya, Sarinah. diperkirakan berusia 25 tahun, meski Suti dan kakaknya, Senah tidak mengetahui pasti berapa usia mereka. “Dari enam bersaudara, Suti anak keempat dan sejak kecil matanya tak bisa melihat,” kisah Senah yang mempunyai enam orang anak, Kamis (9/2) di kediamannya. Meski begitu, Suti yang lahir di Desa Oboh, Kec. Rundeng mengaku bisa memasak, dapat berjalan di dalam rumah tanpa dituntun dan melaksanakan

aktivitas lain di dalam rumah. Jika digerakkan sesuatu benda berjarak sekira 20 centimeter persis di depan matanya, Suti bisa melihat walau berupa bayangan. Pemilik Kartu JKA Nomor 3000048478558 ini mengaku pernah coba ikut pengobatan “katarak” gratis. “Katanya nggak bisa karena sudah parah,” tukas Senah dibenarkan Suti yang berharap ada dermawan atau pemerintah yang mau membantu pengobatannya. (b28)

BIREUEN (Waspada): Pengurus Aliansi Jurnalis Independen (AJI) Indonesia, Mujiburrahman menegaskan, para narasumber harus berani menolak wartawan yang tidak jelas medianya. Karena wartawan seperti itu selain dapat mencoreng korps wartawan atau oraganisasi kewartawanan yang diakui legalitasnya oleh negara juga perbuatannya itu bukan kerja wartawan. “Narasumber harus berani menolak wartawan yang tidak jelas atau tidak ada medianya,’ tegasnya dalam acara seminar yang diselenggarakan AJI Bireuen di Hotel Meuligoe, kota setempat, Sabtu (11/2) bertema, pers mitra atau musuh, diikuti sejumlah LSM, perwakilan ormas, AJI Kota Lhokseumawe dan sejumlah elemen masyarakat lainnya. Menurut Mujiburrahman, kekerasan kepada wartawan selama ini masih juga kerap terjadi dimana-mana, namun AJI selalu hadir untuk mengadvokasi wartawan yang mengalami kekerasan walaupun dia bukan anggota AJI. Namun, Mujiburrahman, juga mengingatkan kepada masyarakat jangan pernah layani wartawan yang hanya mewawancarainya saja sedangkan medianya tidak jelas atau jangan layani wartawan yang jadi ‘pemeras’. “AJI ingin mengembalikan pers yang sesungguhnya yang yaitu kepada harkat dan martabatnya, supaya wartawan dapat bekerja profesional, jujur dan bertanggungjawab,

sebegai khitahnya seorang jurnalis” tegasnya. Jadi, sambung Mujiburrahman, sekarang ini, bukan saatnya lagi, narasumber terlalu takut kepada wartawan apalagi kepada oknum wartawan yang tidak jelas medianya. Namun, bila wartawan yang jelas medianya, diharapkan untuk melayani sesuai dengan ketentuannya untuk konfirmasi dan jangan lakukan kekerasan, ulangnya. (cb02)

Waspada/Abdul Mukthi Hasan

PENGURUS AJI Indonesia, Mujiburrahman, menjelaskan kepada peserta fungsi dan tugas pers di Hotel Meuligoe, Bireuen, Sabtu (11/2).


Opini

C4 TAJUK RENCANA

Tolak Dan Katakan Tidak, ‘Valentine’s Day’ = Haram

S

emua ulama kiranya sepakat bahwa ikut merayakan hari kasih sayang (valentine’s day) hukumnya haram karena meniru-niru budaya dan akidah agama lain (non-Islam). Sehingga imbauan Ketua Umum Pengurus Wilayah Nahdlatul Ulama (PW-NU) Aceh Tgk H Faisal Ali agar umat Islam, khususnya generasi muda, tidak merayakan valentine’s day yang jatuh pada Selasa 14 Februari 2012 (besok) dinilai tepat. Saya hakkul yakin kalau imbauan serupa juga disampaikan para ulama di seluruh Indonesia, bahkan di dunia Islam. Mereka memberi tahu para pengikutnya agar menjauhi budaya kebarat-baratan yang menyimpang dari ajaran Islam. Apalagi terkait dengan hari kasih sayang ala velentine’s day merupakan cukilan sejarah dari tokoh agama lain (non-Islam). Wajar saja kalau para ulama mengeluarkan seruan untuk umatnya agar menjauhi dan harus berani menolak ajakan merayakan valentine’s day tanpa kecuali, siapa pun yang mengundang tegas katakan: tidak!. Sayangnya, fakta di lapangan menunjukkan ajakan para ulama masih kurang ditanggapi oleh sebagian masyarakat sehingga perayaan valentine’s day tetap berlangsung di berbagai tempat, dari mulai hotel berbintang, restoran/rumah makan, di rumah-rumah dan perkumpulan atau komunitas tertentu. Harga tiket atau biaya yang dikeluarkan pun bervariasi. Dari ratusan ribu karena hidangannya sederhana hingga jutaan rupiah lengkap dengan penginapan dll. Mengapa para ulama melarang dan mengharamkan umat Islam ikut merayakan valentine’s day? Pertama, itu bukan budaya kita dan bukan ajaran Islam. Hukumnya menjadi haram. Jangankan ikut terlibat secara langsung merayakannya, mengucapkan selamat natal, selamat hari valentine saja dapat dianggap sebuah kekafiran karena sudah termasuk perbuatan dosa besar menyekutukan Allah SWT. Kedua, sangat banyak dampak negatif dan mudaratnya, seperti pergaulan bebas. Sehingga banyak kasus dan di sejumlah tempat berlangsung pesta seks, pesta narkoba, dan minuman keras. Justru itu, kita menilai positif putusan/ fatwa MUI pusat dan MUI daerah melarang Intisari umat Islam ikut merayakan valentine’s day. Sekalipun artinya hari kasih sayang, di mana orang yang sedang kasmaran saling Merayakan valentine’s day dua mencurahkan isi hati dan kasih sayangnya, haram karena terkait ritual namun di lapangan yang terjadi sungguh di luar norma-norma ketimuran. agama lain sehingga ja- menjijikkan Dalam Islam mencurahkan kasih sayang ngan mencari-cari alasan bisa dilakukan kapan saja, kalau mungkin hari dalam keluarga maupun dalam dan jauhi pola hidup keba- setiap kehidupan bermasyarakat, bahkan dalam berbisnis pun diperlukan kasih sayang serat-baratan hingga tidak terjadi penipuan dan penzaliman. Oleh karena itu, Islam tidak mengenal kasih sayang yang hanya sehari dalam setahun dan cenderung disalahartikan dan dijadikan jebakan sehingga banyak remaja putri yang jatuh korban. Perselingkuhan semakin marak di mana-mana. Apalagi kalau momentum hari kasih sayang ala barat itu dipergunakan untuk tujuan maksiat. Di sinilah peranan keluarga dan orang tua menjadi penting dalam memberikan pengetahuan kepada anak-anaknya. Jangan sampai terlambat, karena pasti akan menyesal nanti. Hemat kita, tidak cukup hanya MUI dan Ormas Islam yang mengeluarkan imbauan berupa larangan merayakan valentine’s day. Perlu dilakukan sosialisasi lebih intens oleh pihak terkait lainnya, seperti dunia pendidikan (sekolah dan kampus), sehingga masyarakat, khususnya kawula muda, berani menyatakan tidak dan menolak keras ajakan ‘’maksiat’’ dari teman-temannya. Jangan sampai ada anggapan kalau remaja tidak ikut valentine’s day berarti kampungan, kurang pergaulan. Mereka yang terperosok dalam lumpur maksiat atau pergaulan bebaslah yang bakal merugi. Apalagi kalau pasangannya sampai hamil dan tidak ada pria mau bertanggung jawab. Masa depan mereka pun hancur berantakan akibat tidak menggunakan akal sehatnya dan mudah terpengaruh rayuan setan terkutuk. Maraknya pernak-pernik menjelang hari kasih sayang ala pendeta di masa lalu kini sudah menjalar di kalangan masyarakat kita, khususnya generasi muda yang imannya kropos akibat kurang mendapat pendidikan agama di rumah dan sekolah, tentunya degradasi moral itu dipengaruhi semakin terbukanya arus informasi sejalan dengan kemajuan teknologi saat ini. Sehingga kehidupan masyarakat luar yang tidak cocok untuk diterapkan dalam budaya kita (ketimuran) langsung diadaptasi menjadi tren modernisasi akibat terobsesi pola hidup kebarat-baratan. Di sinilah pemerintah, para ulama, tokoh pendidikan, tokoh adat, dan seluruh elemen masyarakat/komunitas Islam perlu memperkuat filter dengan cara menyaring mana-mana yang positif boleh ditiru, sementara yang negatif, seperti halnya perayaan valentine’s day harus tegas ditolak.+

APA KOMENTAR ANDA SMS 08974718101

Faks 061 4510025

Email komentar@waspada.co.id

+6285275533775 Musibah diTugu Tani, Prop.Dki Jakarta, dimaknai dgn Sangat Lebai. Mereka Mengadakan Tahlilan dr mulai 2,3,7,40,100 hari, dll.Mereka yg BerAgama Islam harusnya mengert Bahwa; Bila Mati Anak/Cucu/Keturunan Nabi ADAM As. maka putus lah amalan mereka, Kecuali: Sedekah Jariah, Ilmu yg Bermanfaat, Doa Anak yg Shaleh.Jadi Saya kira tak perlu_lah NabuR2 Bunga segala d_daerah tugu tani yg Notabene Tdak ada Manfaatnya. +628566238659 Assalamu’alaikum.W.W. Umat Islam dikota Medan harus cepat sadar dengan kenyataan yang terjadi pada saat ini, karena sudah banyak bangunan Masjid dikota Medan yang dihancurkan demi pembangunan yang katanya Medan akan menjadi kota metropolitan & masih banyak lagi Masjid yang menyusul akan dihancurkan pihak kapitalis. Gubernur & Walikota orang pribumi asli tetapi tega-teganya mengabaikan & membiarkan penghancuran MasjidMasjid yang ada ditengah kota Medan & sadarlah wahai para pemimpin saat lagi berkuasa untuk dapat mempertahankan Masjid-Masjid yang merupakan Rumah Allah dipermukaan bumi ini & ingatlah wahai pemimpin Masjid adalah simbol Tertinggi Agama Islam yang harus “TETAP DIPERTAHANKAN KEBERADAANNYA” sampai dunia ini dikiamat kan ALLAH SWT. Wassalam. +6285261172936 Waktu/ruang terlebih dahulu ada karena manusia lahir didalam waktu_dunia kiamat masih didalam waktu _ sholat ada waktunya _ diluar waktu sholatnya tidak diterima kecuali ada izin Allah karena sebab (syafari) _ sholat ied ada waktunya- puasa ada waktunyazakat ada waktunya _ Haji ada waktu nya _ Qurban ditentukan waktunya _ Aqeqah ada waktunya yaitu anak waktu umur 7 hari (hadits shohih) _hari 14_ 21 hadits hasan _ anak laki laki dua kambing dan anak perempuan satu kambing_ daging yg telah masak diantar kerumah rumah bukan diadakan undangan _ kalau ahli kita didatang kan itu bukan sebagai undangan tapi sebagai kerabat (keluarga) _ undangan dapat memunculkan amplop _ dan penerima aqeqah adalah ja maah bukan objek pengembalian dana _ jika hendak melaksanakan ibadah _ wajib didalam waktu _ jika melaksanakan ibadah diluar waktu yg telah ditentukan seba gai ketetapan peraturan _ mau ikut peraturan siapa Umat ini _karena ada pendapat boleh aqeqah diluar waktu (karena belum pas ada dana maka dipakailah hadits lemah,umur berapapun boleh aqeqah) maka diAqeqahkan lah anaknya setelah berumur 35 thn _ ditempahlah ayunan yg besar_dengan marhaban karangan orang India be rmazhab Syiah _ Wassalam. +6283199245177 AMANG NA BASKORO THE FACTOR * Berkibarlah Bendera Par.Pol. setelah dibentuk Pembentuk nya dan mendapat .idzin r e s m i dari Kemen.kum.&HAM • Sewindu lebih sedikit , telah berkibar Bendera Par.Pol. yang bertajuk P.D .• Andaikan Par .Pol. ini tidak pernah dibentuk dan Amangna Baskoro menunggang Perahu Politik yang lain , sudah tentu Angelina Sondakh ; “Duwit- nye tidak sebanyak sekarang ini ”• Sudah tentu Anas Urbaningrum ; “Belum pernah menyimpan se-abreg Daun Jambu ”• Dan Amang na Baskoro , menjadi Pres. R.I. yang k e 6 • Beliau berhasil duduk di Kursi Number One of R.I. karena Kharisma Diri • Bukan karena kharisma P.D. # Dari Tepi Barat Medan City ; Dato^MNSejok. +6282165293457 Dan sesungguhnya Kami jadikan isi neraka Jahannam kebanyakan dari jin dan manusia.Mereka mempunyai hati, tetapi tiada memahami dengan hatinya itu.Dan mempunyai mata,tetapi tidak mereka gunakan untuk melihat(jalan yang lurus).Dan mempunyai telinga,tetapi tidak mereka gunakan untuk mendengar. Mereka laksana binatang ternak,bahkan mereka kebih sesat.Mereka orang yang lalai.

WASPADA Senin 13 Februari 2012

Dinamika Etno-Religius Sumatera Utara Oleh M Ridwan Lubis Pemilihan,hendaklah masyarakat melihatnya sebagai peristiwa politik biasa dan tidak dikaitkan dengan persaingan etno-religius

S

umatera Utara memiliki keragaman etnis yang sangat kentara dengan memiliki tipologi masingmasing. Suku Batak Toba, Karo, PakpakDairi,Simalungunpadaumumnya menempati kawasan pemukiman yang bergunung-gunung. Sehingga mereka lebih menikmati sumber penghidupan yang umumnya bersifat tanaman hortikultura. Selain dari itu, daerah yang mereka huni juga menjadi lokasi wisata yang didatangi oleh para pengunjung baik domestik maupun mancanegara. Masyarakatnya hidup dalam suasana kultur dinamis yang kemudian membentuk keseimbangan baru dengan masyarakat dinamis yang lain yaitu Minang dan Tionghoa. Dari sudut aktualisasi keberagamaan kelompok masyarakat ini pada umumnya menganut Kristen. Pada masyarakat di lapisanakarrumputberpandanganbahwa tradisi etnis Batak memandang bahwa etnisitas ke-Batak-an identik dengan kekristenan. Dalam pandangan politik pada masalalu,umumnyamerekamengikatkan diri kepada partai yang bernuansa kekristenan seperti Parkindo atau juga partai nasionalis semacam PNI. Pada sisi yang lain, penduduk Sumatera Utara secara umumnya disebut Melayu karena identitas ke-melayu-an juga sekaligusdipahamiolehmasyarakatdiakar rumput menyatu dengan keberagamaan yaitu Islam. Sebutan Melayu dalam tulisan dipahamisebagaigugusankesukuan yang terdiri dari Melayu sendiri, Mandailing, Pesisir, Padanglawas, Angkola Sipirok ditambah lagi dengan etnis Jawa, Minang, Banjar,Acehdansebagainyatermasukjuga etnisBatakyangturungunungdariBandar Pulau kemudian bermigrasi ke pesisir Asahan. Dari sudut pandangan politik, pada mulanya mereka dahulu hampir bisa dikatakansebagaipengikutMasyumi—setelah NU memisahkan diri dari Masyumi tahun 1952 pada Muktamar Palembang yang menghasilkan bahwa NU memisahkan diri dari Masyumi dan menjadi partai

sendiri. Kalanga n Muslim dari pesantren kemudian sebagian besar beralih kepada Partai NU. Demikianlah dikhotomi yang memisahkan antara masyarakat akibat dari komitmenetno-religiusyangmemisahkan mereka. Pada sisi lain, hal itu juga dapat dilihat sebagai bukti kuatnya idiologi yang mengkaitkan antara etnisitas dengan religiositas yang kemudian melahirkan pilihan-pilihan politik. Sepintas terkesan ada persaingan pengatuh akan tetapi apabila didalami begitulah format dinamika etnoreligius di Sumatera Utara. Setelah orde baru, pemerintah mengambil kebijakan fusi terhadap berbagai idiologipolitikitudisederhanakanmenjadi tiga yang berakibat terjadinya penurunan kadar komitmen idiologis yang lahir dari integrasi etnisitas dengan relidiositas. Sesungguhnya dari satu sisi, kebijakan fusi ituadalahberdampakpositifyaitupenumpulan polarisasisasi etno-religiius di Indonesia. Sehingga terjadilah penurunan kadar kefanatikan itu yang kemudian beralih menjadi cara pandang yang lebih pragmatis. Dampak sikap pragmatis itu adalah munculnyacarapandangbaruberwawasan sesaat dan bersifat jangka pendek yaitu politik kepentingan. Kehadiran tokoh agama dan budaya pada masa orde lama begitu kuat karena mereka ditempatkan masyarakat sebagai primus interpares yang menjadi sumber referensi sosial namun kemudian mengalami kemunduran peranan apalagi apabila mereka terikut arus perebutan jabatan politik yang bersifat jangka pendek. Program de-idiologisasi etnis dan agama di satu sisi membawa akibat positif yaituterhindarnyamasyarakatyangsemula tajam dalam perbedaan pandangan politik keagamaan yang dikhawatirkan menjadiletupankonflikyangmempertentangkan politik keagamaan. Akan tetapi yang terjadi kemudian berubah dengan terbentuknya cara pandang positif yaitu sekalipun terdapat perbedaan teologis antara agama-agama yang dianut masyarakat tetapi bukankah wacana keber-

agamaan itu bisa bertemu pada konsep humanitas yaitu semua agama adalah bertujuan untuk kepentingan hidup umat manusia. Sistim ikatan kekerabatan masyarakat yang sudah terjalin selama ini dapat menjadi alternatif kekuatan perekat sosial. Akan tetapi, harus diakui juga pada sisi yang lain de-idiologisasi etnis dan agama berakibatlahirnyacarapandangpragmatis yang mengakibatkan pemuka agama dan budaya tidak lagi dominan menjadi pengendali kehidupan masyarakat. Karena di samping mereka telah muncul kelompok profesionalitas baru seperti ahli kesehatan, pertanian, pertukangan dan sebagainya yang memaksa pemuka agama berbagi wibawa dengan kelompok profesionalitas baru itu. Atas dasar itu, diperlukan upaya penguatan nilai-nilai etno-religius yang berlangsung dalam suasana keserasian antarakelompokmasyarakatyangberbeda etnis dan agama. Kuatnya kesadaran terhadap etnis dan religiositas tidak harus dipahami sebagai pertentangan di antara masyarakat. Akan tetapi justru keragaman itu menumbuhkan kesadaran saling me-

ngakui, menghormati dan mendukung keberadaan masing-masing. Potensi kekuatan yang pada masingmasingkelompoketno-religiushendaknya dapat diarahkan kepada semangat kompetisi baik pemikiran, dana dan tenaga dalam memberikan kontribusi bagi pembangunan daerah dan nasional. Oleh karena itu, pemilihan kepala daerah baik provinsi maupun kabupaten/kota hendaklah masyarakat melihatnya sebagai peristiwa politik biasa dan tidak dikaitkan dengan persaingan etno-religius. Dasar pertimbangannya adalah terletak pada penilaian terhadap integritas, profesionalitas dan kualitas kepemimpinan. Oleh karena itu, kandidat yang akan tampiljugaselayaknyatidakmempertajam perbedaan etno-religius tersebut. Sudah terlalulelahmasyarakatdisibukkandengan berbagai persaingan memperebutkan jabatan politik itu. Demikianlah harapan kita terhadap masa depan dinamika etnoreligius di Sumatera Utara. M Ridwan Lubis, Dosen UIN Syarif Hidayatullah Jakarta

Prahara Padanglawas Oleh Ansor Harahap Yang dulunya berapi-api menjanjikan kesehatan,keadilan, kesejahteraan, kecerdasan dan keberbudayaan di Padanglawas ternyata cek kosong.

M

enurut penulis, judul di atas merupakan frasa yang tepat untuk menunjuk potret terkini Padanglawas. Alias menunjuk betapa berkuasanya praktek-praktek atau prilaku yang bertentangan dengan nilai-nilai pancasila maupun demokrasi.Terjadinya intrik-intrik yang jauh dari rasa membangun. Tidak hanya dilakukan para elit Padanglawas, terutama pejabat elit, tetapi juga sekelompok masyarakat telah ikut melakoninya. Tidak lagi peduli Padanglawas sebagai Kabupaten baru, berkembang, menuju daerah yang sejahtera, berdaulat dan berwibawa.Yang ada, tukar menukar kepentingan. Menggadaikan moral luhur. Dan berjamaah mencakar sumber-sumber yangdapatmemperkayadiridanmempertahankan kekuasaan. “Hajar terus”, begitulah mungkin dalam alam pikiran yang jadi teriak semangat mereka. Kekuasaan pun dimanfaatkan sedemikian rupa. Potensi anggaran. potensi sumber daya alam. Potensi di tengah kemiskinan dan kebodohan masyarakat. Adalah deretan yang tidak henti-hentinya dijarah.Tidak hanya itu. Para pejabat, provokator atau penjarah beserta pengikut, lewat sarana pemerintahan melakukan penipuan, pemalsuan, pengabaian prosedur serta pembohongan publik. Aksi yang merugikan keuangan negara, merugikan masyarakat,danmasadepanPadanglawas semakin berkembang. Realitas ini semakin terkukuhkan ketikaparaaktivisGerakanMahasiswaPadanglawas (Gema Padanglawas) dan Ikatan Mahasiswa Sosa Sekitarnya (IMSS) serta aktivis organisasi mahasiswa lainnya kerap mendapat intimidasi. Dan sekarang PemerintahPadanglawassibukmengumpulkanpernyataandukunganmasyarakatdan elemen-elemen yang ada untuk mendukung Kepemimpinan Bupati hingga periodesasi berakhir. Padahal, sesungguhnya KepemimpinanPemerintahanPadanglawasmengalami krisis kepercayaan yang dalam.Tapi, sekali lagi, kekuasaan dimanfaatkan untuk memaksakan kehendak. Para kepala desa diperintahkan untuk menandatangani pernyataan dukungan yang sudah diformat sedemikian rupa dan menyebarkannya ke tengah-tengah masyarakat. Tidak peduli apa yang sudah diperbuat. Arogansi kekuasaan pun semakin menjadi. Dampak pecah kongsi Sebagaimanaterjadihampirdiseluruh pemerintahandaerah,pecahkongsiantara kepala derah dan wakilnya sudah menjadi sesuatu yang lazim. Tidak hanya sebatas karena faktor bagi-bagi porsi kekuasaan yangtidaksesuai,tapisudahmenjaditrend. Jarang sekali terjadi di antara mereka mengambil langkah yang lebih terhormat seperti yang dilakukan Dicky Chandra dan Prijanto.Pecah kongsitelahmenjadialasan

dan wahana untuk membuktikan atau mengadu kekuatan masing-masing. Setidaknya inilah yang terjadi pada kepemimpinan Padanglawas. Antara bupati dan wakilnya mengalami pecah kongsi. Bulan madu politik pasangan ini hanya mesra dan berlangsung selama dua kali tahun anggaran. Selebihnya masa sikutmenyikut. Saling mengintip. Saling menuduh sebagai dalang di balik gerakan-gerakan di Padanglawas. Prihatinnya, tidak hanya mahasiswa yangdikorbankan.Menuduhgerakanmahasiswa ditunggangi kepentingan politik. Atauberupayauntukmenunggangigerakan mahasiswa.Tetapi, hingga masyarakat bawahpunikutterpolakekuasaan.Masyarakat digiring untuk membela dan mengawal blok-blok kepentingan kekuasaan. Dengan memberikan dan menjanjikan sesuatu yang bersifat pragmatis, masyarakat dikerahkan untuk mengambil posisi dan barisan kepentingan politik blok kekuasaan.Sehinggaperbedaanposisipolitik ditengah-tengahmasyarakatsemakinjelas. Padaakhirnyarasasensitifitasdiantara blok kepentingan semakin tinggi. Dengan situasi begini, maka sangat gampang tersurut konflik dan benturan fisik. Maka suasana Padanglawas pun semakin tidak kondusif. Amarah dan dendam antara pendukungbloksemakinmenumpukdanberpotensi menjadi api dalam sekam. Sungguh memprihatinkan.GemaPadanglawasdan IMSS juga merasakan seakan menjadi bagian dari korban blok kepentingan politik kekuasaan. Prihatinnya lagi, mereka tetap ingin menikmati kekuasaan politik masingmasing.Tidak pernah terpikir untuk melakukan rekonsiliasi. Atau setidaknya, membuktikan siapa yang paling bertanggungjawab menjalankan amanah, meski dengan kewenangan yang berbeda. Padahal, posisi bupati dan wakilnya sama-sama potensial untuk berbuat baik di tengahtengah kehidupan rakyat yang semakin tidak menentu dan membutuhkan pertolongan. Bukankankah tidak hanya instrumen pemerintahan yang menjadi satusatunya jalan untuk memberdayakan dan mencerahkanrakyat?Seharusnyainimenjadibagiandarisemangatbupatidanwakil. Ketidakkondusifan Padanglawas semakin diperparah mengingat tahun 2013 akan dilakukan kembali Pemilihan Kepala Daerah (Pilkada). Bupati dan wakil bupati serta beberapa tokoh Padanglawas akan berjuang merebut kekuasaan. Intrik politik dipastikan semakin menyala mewarnai dinamika Padanglawas. Sehingga tidak ada lagi tahun-tahun kekuasaan yang benar-benar memperhatikan kondisi dan kebutuhan rakyat. Fase-fase kehidupan yang demikian akan terus bergulir mengabaikan harapan rakyat. Artinya, pemekaran Padanglawas hanya dinikmati elit dan mereka yang punya dan memanfaatkanakseskekuasaan.Padaakhirnyajuga,

kesejahteraandankeadilanhanyamenjadi mimpi abadi bagi rakyat. Karena elit pemerintah tidak henti-hentinya memanfaatkan kekuasaan untuk mengeksploitasi sumber daya yang ada. Sejumlah masalah tak kunjung selesai Bagi mahasiswa, khususnya Gema Padanglawas dan IMSS, gerakan mengkritisi pemerintahan semakin menjadi-jadi akibat sejumlah persoalan tidak kunjung tuntas penyelesaiannya dan prilaku kotor birokrat semakin menggunung dan merajalela. Di antaranya, kantor pemerintahan (kantor bupati, dinas, DPRD, dan lain-lain) hingga sekarang belum terbangun, padahal sudah pernah mendapat alokasi anggaran. Dugaan korupsi kasus multiyears yang telah menetapkan Bupati PadanglawassebagaitersangkaolehKepolisian Daerah Sumatera Utara. Pengadaan meubiler kecamatan, dan lain-lain. Selanjutnya, proyek yang dikerjakan tahun 2009 -2010 mengalami kerusakan di tahun 2011. Kemudian, masih terjadi pungutan di sekolah-sekolah, pemaksaan membeli buku dan kelengkapan belajar siswa, dan terbatasnya sarana penunjang pendidikan seperti komputer/laptop, padahal sudah dianggarkan. Konflik lahan antara masyarakat dengan perusahaan masih terus berlanjut, konflik dengan PT.SRL/SSL, PT.ANJ, MAI, EVI GROUP, PTPN IV, PT.VAL, dan lain-lain. Masih maraknya illegal logging (perambahan hutan tidak sah), seperti di beberapa desa Kec. Sosopan, Desa Marenu Kec. Aek NabaraBarumun,diKec.BatangLubuSutam, & Kec. Ulu Barumun. Bantuan bibit karet yang seharusnya didapatkan masyarakat sesuai haknya, namun ternyata tidak sesuai. Hal itu semua merupakan wujud kegagalan kepemimpinan pemerintahan Padanglawas dan merupakan bentuk prilaku korup.Terakhir masalah putusan Mahkamah Agung (MA) yang menetapkan Bupati Padanglawas selaku terpidana karena melakukan pemalsuan akte tanah semasa menjabat Camat Barumun tahun 2004, tidak direspon secara serius oleh pihak berwenang. Dalam putusan ini penegakan hukun berkaitan dengan kriteria dan keabsahannya menjabat Kepala Daerah sebagaimana diatur dalam Undang-Undang No.32 Tahun 2004 tentang Pemerintahan Daerah. Anehnya, dari banyaknya masalah di Padanglawas, penegakan hukum tidak hadir. Intitusi yang seharusnya bertindak mengusut segenap persoalan yang terjadi, diduga berbaur dengan tindak tanduk pejabat pemerintah. Mereka telah mengukuhkan eksistensinya sebagai penjaga kekuasaan.Soalbenar-tidaknyaketerlibatan pejabat Padanglawas dalam tindakan korupsi, tentu harus menunggu langkah dari Kepolisian, Kejaksaan maupun KPK atau pembuktian secara hukum. Sayangnya,upayaitutidakkunjungdatang.Sekalipun, sebagaimana disampaikan di atas bahwa beberapa waktu lalu Polda Sumatera Utara menetapkan Bupati Padanglawas bersama empat orang lainnya sebagai tersangka, namun hal itu belum menjadi ukuran dalam penegakan hukum di

Padanglawas. Penutup Kita (mahasiswa) pun semakin kehilangan kepercayaan dan respek terhadap kepemimpinan pemerintahan Padanglawas beserta segenap jajarannya. Yang dulunya berapi-api menjanjikan kesehatan, keadilan, kesejahteraan, kecerdasan dan keberbudayaan di Padanglawas ternyata cek kosong. Semuanya fakta, bukan semata-mata opini yang dibentuk. Penulis sendiri tetap berharap, agar pemerintahan Padanglawas kembali ke jalan yang lurus. Menyelesaikan segenap persoalan yang ada. Menunaikan harapan rakyat. Agar pembangunan dirasakan rakyatdanmahasiswakembalikonsentrasi pada studinya. Namun, sepertinya hal ini sudah utopi. Kita lihat saja tindakan PemerintahPadanglawasselamasisaperiodesasi masa jabatannya, masih mencerminkan kegagalandantindakankorup.Olehkarena itu,ketidakkondusifanPadanglawasselama ini adalah bermula dan berkembang dari ketidakseriusan Bupati menjalankan pemerintahan. Sehingga Padanglawas termasukkabupatenyangmemilikiintensitas tinggi diberitakan, tapi dari sisi kegagalannya karena menurut penulis memang tidak ada kesuksesan pembangunan yang wajar dipuji.Yang jelas apa yang terjadi di Padanglawas, benar-benar prahara politik pragmatis yang mengguncang semangat luhur pemekaran. Penulis adalah Ketua Umum Gerakan Mahasiswa Padang Lawas (Gema Padang Lawas)

Pengumuman Redaksi menerima kiriman karya tulis berupa artikel/opini, surat pembaca. Kirim ke alamat redaksi dengan tujuan ‘Redaktur Opini Waspada’ dengan disertai CD atau melalui email: opiniwaspada@yahoo. com. Panjang artikel 5.000-10.000 karakter dengan dilengkapi biodata penulis dan kartu pengenal (KTP). Naskah yang dikirim adalah karya orisinil, belum/tidak diterbitkan di Media manapun.Tulisan menjadi milik Waspada dan isi tulisan menjadi tanggungjawab penulis.

SUDUT BATUAH * Jusuf Kalla: Jangan terlalu banyak bicara - Karena membosankan! * Partai Demokrat kantongi kader bakal dipecat - Ai...ai siapa dia, he...he...he * Anggota DPRD-SU kaget, anak gizi buruk di Madina - Apa kabar Pak Bupati?

oel

D Wak


Opini

WASPADA Senin 13 Februari 2012

Momen Beracun Valentine’s Day

Birahi Untuk Korupsi Korupsi bagaikan gadis cantik berjilbab dalam tertunduk malu minta diipinang.Kulitnya yang putih halus mulus menambah kecantikan membuat kita tergila-gila. Mata indahnya selalu menghindar ketika ditatap membuat kita mabuk kepayang.Tutur katanya satu-dua dengan sopan berjatuhan dari bibir indahnya menambah hasrat kita untuk menjadikannya istri kedua. Korupsi ini teramat menggoda mengiurkan.Tak bertemu sebulan rasanya sewindu, rindunya tak tertahankan. Kita menoleh seketika saat namanya dibisikkan teman. Ada debar di dada membayangkan pertemuan yang mengasyikkan.Terbayang bercumbu dengan uang korupsi menginap di hotel berbintang pelesiran keluar negeri. Ketika korupsi belum datang kita kecarian kemana, dimana…?Hidup terasa hampa tanpa korupsi, makan tak sedap tidur tak nyenyak. Berbagai tipu daya dilakukan. Direkayasa pendataan ulang atau pembaharuan administrasi atau terpaksa berbagai sarana perasarana harus ditukar agar menjadi urusan, agar menuai pelicin,agar menimbulkan korupsi…? Istri tersipu malu dibelikan kalung berlian dari uang korupsi. Anak pertama kegirangan dibelikan mobil warna silver. Anak bungsu keponakan diberikan ATM tanpa batas. Semua menikmati uang korupsi. Anak istri tak pernah menanyakan dari mana ayah dapat uang sebegitu banyak. Semua larut menikmati uang haram, semua tak mau ditinggal, mereka minta ikut serta jika sang ayah pergi ke neraka jahanam. Innalilahi wainnalillahirojiun.Terdengar kabar sebuah keluarga masuk jurang dalam perjalanan pulang dari rekreasi. Konon kabarnya keluarga kepala instansi pemerintaha mengenderai mobil mahal model terbaru. Papa, mama mati di tempat. Ketiga anaknya dapat diselamatkan. Sang kakak hanya patah tangan. Lelaki anak nomor dua hanya luka ringan, dan si bungsu sekedar pingsan. Dua puluh tahun kemudian. Kakak yang tertua mengikuti jejak ayahnya menjadi kepala dinas. Anak lelaki yang nomor dua, masih dalam penyelidikan terseret masalah tukar guling Pembanguan Bandar udara. Dan si bungsu sedang pelesiran ke luar negeri menikmati uang korupsi. Ketiganya menjadi koruptor mengikuti jejak ayah. Kenapa anak yang ditinggalkan menjadi koruptor juga..?Karena ketiga anaknya telah dititiskan gen koruptor. Gen sebagai zat pembawa sifat yang dimiliki sang ayah akan diturunkan pada anak cucunya. Jika ayah koruptor maka anak cucunya akan jadi koruptor juga. Untuk itu berhentilah korupsi……..agar kau tak memiliki gen koruptor. Jika kau tak mau berhenti korupsi, maka kau bukan orang tua yang baik. Karena kau sengaja menyimpan gen korupsi yang kelak akan kau titipkan buat anak cucumu. Kau berharap anak cucumu jadi pencuri juga. Sama artinya kau akan menjerumuskan anak cucumu. Cukuplah kau saja yang penjahat,jangan anak cucumu kau bawa turut serta…?

Oleh Siti Akhiriah Nasution PerayaanValentine sebagai perayaan bisnis yang bermuara pada perusakan akidah dan akhlak pemuda Islam (khususnya).

1

4 Februari adalah hari yang sangat istimewa bagi para pendewa Valentine’s Day. Pada hari itu mereka mengungkapkan rasa cinta dan kasih sayang kepada orang yang diinginkan. Ada yang menyatakan perasaannya kepada teman, guru, orang tua, kakak atau adik, dan yang paling banyak adalah yang menyatakan kepada kekasihnya. Pada hari itu pula mereka mengirimkan kartu atau hadiah bertuliskan “Be my Valentine” (jadilah Valentine-ku) atau artinya “Jadilah kekasihku”. Di Indonesia, sejak era 1980-an, perayaan Hari Valentine ini makin semarak hingga memprihatinkan. Jika kita masuk toko buku atau semisalnya di bulan Februari, akan tampak rakrak yang berjajar berisikan beragam kartu ucapan Valentine’s Day. Tak mau kalah, toko-toko souvenir pun mulai menjajakan aneka kado bertema Valentine’s Day. Mall dan supermarket juga menghias seluruh ruangan dengan warna-warni pink dan biru lembut, dengan hiasan-hiasan berbentuk hati dan pita di mana-mana. Dengan berpikir sedikit saja kita dapat mengetahui bahwa perayaan aneh ini tidak lepas dari trik bisnis para pengusaha tempat hiburan, pengusaha hotel, perangkai bunga, dan lainnya. Akhirnya jadilah perayaan Valentine sebagai perayaan bisnis yang bermuara pada perusakan akidah dan akhlak pemuda Islam (khususnya).

Nada Sukri Pane Guru SMA Negeri 16 Medan

Wassalam, Dra.Siti Khalifah,M.Pd dosen FKIP Univ.Asahan, Kisaran. +6287818873911

Foliopini

Dedi Sahputra dedisahputra@yahoo.com

Niat & Kepentingan Semua rencana-rencana itu berakhir di Cisarua, Bogor. Pembawa pesan itu adalah sebuah bus yang melabrak semua yang ada di hadapannya. Ada ibu muda yang sedang berjuang menghidupi keluarganya, ada remaja yang punya cita-cita mendapat pekerjaan layak demi hidup lebih baik, dan ada pedagang es yang bermimpi menyekolahkan semua anaknya. Anda mungkin menyebutnya trend yang menulari. Masih basah bibir menghibahkan tabrakan maut Tugu Tani,—”sekali tepuk sembilan nyawa”—gujuk-gujuk bus Cisarua unjuk gigi. Kali ini lebih dahsyat lagi, ada empat belas orang yang tewas saat itu. Tapi rencana-rencana itu kekal. Dia terbang menuju alam abadi, dalam sebuah catatan yang rinci. Inilah romantika hidup itu, ketika engkau dipenuhi niatan-niatan tulus dalam hidupmu, maka engkau jadi begitu berharga ketika matimu. Tak peduli betapa jauhnya niatan itu bertemu wujudnya. Kontradiksi. Ketika di suatu masa ketika Hitler mengacungkan tangannya dan ratusan ribu orang menemui ajalnya dihabisi di kamar gas, atau dilindas mesin-mesin perang. Sama seperti ketika Bush junior menunjuk hidung Afghanistan dan Irak, maka ribuan orang pun meregang nyawa. Mereka pasti mengira, bahwa merekalah yang menentukan hidup orang-orang itu, bahwa merekalah yang membinasakan. Tapi mereka keliru, karena sejatinya mereka cuma memberi catatan kelam bagi hidupnya sendiri. Kalau romantisme hidup membutuhkan cinta sebagai syarat utamanya, tapi mereka membuang semuanya. *** Benarkah kebenaran itu kekal? Benarkah sebuahentitasitu—denganniatan-niatansebagai variannya—memiliki eksistensinya? Lantas mengapa dia seperti semakin kabur dan tak terlihat. Mungkinkah seperti itu? Itulah ketika dinamika hidup dipenuhi kepentingan-kepentingannya sendiri. Dia mendominasikebenarandanniatan-niatanyang semakin terpendam itu. Memang. Tapi lihatlah ini. Ketika bus Karunia Bakti itu menghantam apa saja dan menewaskan orang-orang yang tak pernah menduganya— ketika mobil Afriliyani melindas orang-orang itu—maka akan selalu saja ada kepentingankepentingan melingkupi di sana. Dia akan menyelimuti eksistensi kebenaran itu. Kebohongan akan segera diperagakan.

Tapi ketika belasan korban itu berjatuhan pula, dia mengundang perhatian lebih. Dia menjadi sorotan dimana-mana. Saat itu orang mulaitertarikmencaritahumengapakecelakaan itu bisa terjadi. Dari mulai melacak kondisi kendaraan, adakah rem yang blong, baik-kah kondisi ban-nya, bagaimana keadaan supir saat menyetir, bagaimana pula kondisi badan jalan, berlobangkah ia, seperti apa tata ruang di sekitar lokasi kecelakaan dan lain sebagainya. Seperti biasa, di negeri ini, wujud sesuatu punya banyak alias. Ukurannya selalu dianggap relatif. Kalau berdasarkan vonis hakim engkau disebut koruptor, tapi engkau bisa juga dijuluki sebagai orang yang dikorbankan, dijebak atau dijadikan target. Makaketikaperusahaanbusitumengatakan bahwa bus layak operasi dan sudah diperiksa sebelum berangkat, maka ini juga mengandung sifat relatif itu. Sekedar dilihat atau cumaditekan-tekanpedalnya,sudah bisadisebut“diperiksa”kelayakannya sebelum berangkat. Sama seperti Afriliyani. Dari manakah engkau sebenarnya datang sebelum menabrakorang?Darisebuahdiskotik,atau dari sebuah hotel? Ini seperti mengingkari jumlah dari suatu kepastian. Kalau 2x3 sama dengan 6, tapi kita juga harus memberi ruang bagi jumlah yang lain, bahwa 2x3juga sama dengan 7-1, atau sama dengan 3+3. Namun ingatlah, bahwa 6 itu tak akan pernah hilang, dialah kebenaran itu. Kelak ia akan menunjukkan eksistensinya dengan melabrak apa saja yang menyerupainya. *** Sekarang marilah kita tatap perjalanan sekian ratus tahun dan sekian dasawarsa dengan ap yang terjadi di Amerika, China, Prancis, ataupun di Kuba. Fidel Castro memimpin Kuba dengan gegap gempita dan dipenuhi cerita heroisme, tapi setelah hampir setengah abad dia masih belum juga menyelesaikan pekerjaannya itu. Apa lacur? Itulah wujud kepentingankepentingan itu. Dia tak berujung memang. Seperti yang coba digambarkannya dengan singkat oleh politisinya Inggris, Disraeli, tentang salahsatubentukkepentinganitu;politik.“Finality is not the language of politics,” katanya. Ini mungkin yang disebut orang-orang bahwa dunia ini fana. Dia tak berwujud nyata, sebenarnya.Diahanyaakanmenjadientitasyang kekalkalauadaniatmutulusdalamdirimukarena alam semesta yang kemudian akan merawatnya.(Vol.290, 13/2/2012)

Kolom foliopini dapat juga diakses melalui http://epaper.waspadamedan.com

Sejarah Valentine’s Day Ribuan literature yang menyebutkan sejarah hari Valentine masih berbeda pendapat. Ada banyak versi tentang asal-usul perayaan Valentine ini. Yang paling popular adalah kisah Valentinus (St. Valentine) yang diyakini hidup pada masa Claudius II yang kemudian menemui ajal pada 14 Februari 269 M. Namun kisah ini ada beberapa versi lagi. Yang jelas dan tidak memiliki silang pendapat adalah kalau kita menilik lebih jauh lagi ke dalam tradisi dewadewi Romawi Kuno. Pada waktu itu ada sebuah perayaan yang disebut Lupercalia. Di dalamnya terdapat rangkaian upacara penyucian di masa Romawi Kuno. Dua hari pertama dipersembahkan untuk Dewi Cinta, Juno Februata. Pada hari ini, para pemuda mengundi nama-nama gadis dalam kotak. Lalu setiap pemuda mengambil secara acak dan gadis yang namanya keluar harus menjadi pasangannya selama setahun untuk bersenang-senang dan menjadi objek hiburan. Mereka meminta perlindungan Dewa Lupercalia terhadap gangguan srigala. Selama upacara ini, kaum muda memecut orang dengan kulit binatang dan wanita berebut untuk dipecut karena menganggap pecutan itu akan membuat mereka menjadi lebih subur. Di antara pendukungnya adalah Kaisar Konstantine St. Valentine yang kebetulan mati pada 14 Pebruari. Jati diri St.Valentine sendiri masih

diperdebatkan para sejarawan. Saat ini, sekurang-kurangnya ada tiga nama Valentine yang meninggal pada tanggal 14 Februari. Di antaranya ada kisah menceritakan bahwa kaisar Claudius II menganggap tentara muda bujangan lebih tabah dan kuat dalam medan peperangan dari pada yang menikah. Kaisar lalu melarang para pemuda menikah. Tindakan Kaisar itu mendapatkan tantangan dari St.Valentine yang secara diam-diam menikahkan banyak pemuda sehingga ia pun ditangkap dan di hukum gantung pada 14 Februari 269 M. Valentine’s Day adalah salah satu maker orang-orang Yahudi yang diseludupkan ke dalam tubuh umat Islam supaya diikuti. Jadi, perayaan Valentine’s Day adalah salah satu upacara yang diadakan orang kafir dan orang-orang bergelimang dosa dalam rangka berbuat maksiat, mengumbar syahwat dan memenuhi hawa nafsu belaka. (Valentine’s Day, Rizki Ridyasmara, pustaka Al-Kautsar, cet.ke-4, Februari 2008). Menyoroti Valentine’s Day Setiap Pebruari menjelang, banyak remaja Indonesia yang notabene mengaku beragama Islam ikut-ikutan sibuk mempersiapkan perayaan Valentine. Bisakah dibenarkan sikap dan pandangan sperti itu? Dalil-dalil yang jelas dari Alquran dan Sunnah serta kesepakatan ulama telah menegaskan bahwa perayaan dalam Islam hanya ada dua, Idul Fitri dan Idul Adha. Adapun perayaan-perayaan lainnya yang berkaitan dengan tokoh, kelompok, atau kejadian tertentu adalah perayaan yang diada-adakan. Tidak boleh umat Islam merayakannya, menyetujuinya, menampakkan kegembiraan

padanya, atau membantu kelancarannya karena hal itu berarti melanggar hukum Allah yang merupakan suatu tindak kedzaliman. sedangkan Allah dalam Alquran telah melarang kaum Mukminin menyerupai orang-orang kafir dan loyal kepada mereka. Perayaan Valentine’s Day termasuk perayaan penyembah berhala. Maka tidak boleh umat Islam yang beriman kepada Allah dan hari akhir ikut merayakannya, menyetujuinya, dan mengucapkan selamat untuknya. Bahkan yang wajib adalah meninggalkannya dan menjauhinya sebagai ketaatan kepada Allah dan Rasul-Nya serta menjauhi menghindari kemurkaan Allah. Sebagaimana pula diharamkan membantu semaraknya acara ini atau perayaan-perayaan haram lainnya baik dalam jual beli, mengirim kartu, mencetak, mensponsori, dan sebagainya karena semua itu termasuk tolong-menolong dalam dosa. Alhasil, hendaklan kaum Muslimin sekarang ini mengetahui dan berhatihati terhadap propaganda yang diserukan oleh orang-orang kafir yang berusaha menjauhkan kaum muslimin dari ajaran Islam dan melegalkan ajarannya yang sesat lagi menyesatkan. Kesimpulan Valentine’s Day merupakan hari raya orang kafir yang penuh kesyirikan. Tidak boleh umat Islam ikut-ikutan merayakannya, mengucapkan selamat kepada yang merayakannya dan membantu memeriahkannya dengan memperdagangkan alat-alat yang digunakan. Wajib umat Islam menghindari kemurkaan Allah. Allahu A’lam Penulis adalah Alumni Darul Mursyid Simanosor Julu.

Memaknai Kasih Sayang

Mengenai Gelar Bangsawan Melalui surat ini saya akan menjelaskan mengenai gelar bangsawan tengku,teungku dan teuku . Pada orang Aceh mudah saja dapat gelar teungku karena berprofesi sebagai guru ngaji, penjaga mesjid bahkan di Medan orang Aceh yg punya warung kopi juga dipanggil teungku, sedangkan keturunan aristokrat Aceh mendapat gelar teuku. Pada semua orang Melayu gelar tengku hanya dapat diwarisi bila zuriyat kesultanan, misalnya dari kesultanan Serdang, misalnya: Tengku Sylvana, Tengku Syafic Sinar dll. Kalau dari kerajaan kecil apalagi berupa konfederasi kedatukan seperti Batubara, zuriatnya hanya mewarisi gelar lebih rendah “wan” atau datuk bila keturunan langsung lelaki. Demikian semoga bermanfaat

C5

Oleh Nurchaili Kasih sayang dalam VD dipersepsikan sebagai hari di mana pasangan-pasangan kencan boleh melakukan apa saja.

S

etiap Pebruari, tepatnya tanggal 14, menjadi tanggal istimewa dan penuh cinta bagi sebagian besar remaja di seluruh dunia. Di hari ini, jutaan remaja merayakanValentine’s Day (VD) atau HariValentine.VD telah membudaya hampir di seluruh pelosok bumi ini. Tak pandang bulu, apakah kaum Kristen di dunia Barat dan Eropa, Hindu di India, Budha di Indocina dan bahkan kaum Muslim, termasuk di Indonesia. Banyak orang, bahkan sebagian besarnya adalah remaja Islam telah menyanjung dan mengistimewakan VD ini. VD dipahami sebagai perayaan untuk mengungkapkan rasa cinta, romantika dan segala ketulusan dari sepasang kekasih. Pesta dan hura-hura tidak asing lagi di hari ini, mulai dari yang romantis hingga berbau erotis. Ini semua tidaklah mengherankan, karenaVD memang berasal dari budaya Barat yang bersifat permisif (serba boleh) dan hedonis (menurutkan hawa nafsu) sebagai histeria masa muda. Sebagai umat Islam, kita patut khawatir dan prihatin dengan perayaan VD, lebih-lebih kekhawatiran terhadap para remaja yang masih bersifat labil dan tidak mengerti makna kasih sayang sesungguhnya, sehingga bisa terjerumus dalam hal-hal negatif. Lebih-lebih terjerumus dalam perbuatan zina yang sangat dibenci oleh Allah Swt. Sebagaimana firman-Nya dalam Alquran Surat Al-Israa ayat 32 yang artinya, “Dan janganlah kamu mendekati zina, sesungguhnya zina itu adalah suatu perbuatan yang keji dan suatu jalan yang buruk”. Sangat disayangkan, jika kita sampai terseret dalam sebuah budaya atau ritual agama lain tanpa pernah ingin tahu tentang sejarah dan permulaannya. Hal ini menjadikan remaja Islam sebagai generasi pengekor dan gemar mengikuti trend walau bertentangan dengan ajaran Islam. Belakangan ini “virus” VD tidak hanya menyerang kaum remaja semata, namun juga telah menginfeksi kaum dewasa. Sejarah VD Banyak versi yang menjelaskan asal muasalVD. Namun pada prinsipnya perayaan VD adalah untuk mengenang pendeta Saint (St) Valentine di masa Romawi yang tewas sebagai martir karena menolak untuk meninggalkan agamanya dan memengaruhi orang lain untuk memeluk agama itu. Akhirnya St. Valentine ditangkap oleh orang-orang Romawi dan dimasukkan ke dalam penjara. Kaisar Romawi saat itu Raja Claudius II (268-270) memerintahkan untuk menghukum mati St. Valentine dengan cara dipukuli dan dipenggal kepalanya di Palatine Hill (Bukit Palatine) dekat altar Juno (Tuhan Wanita). Dalam kaitannya dengan VD, sebelum kepalanya dipenggal, St. Valentine sempat mengirim surat kepada para putri penjaga penjara dengan mendoakan semoga bisa melihat dan mendapat kasih sayang tuhan dan kasih sayang manusia. “Dari Valentinemu” demikian tulis Valentine pada akhir suratnya itu. Surat itu tertanggal 14 Februari 270 M, sehingga tanggal tersebut ditetapkan sebagai hari valentine. Versi yang lain menyebutkan Raja Claudius II menganggap para bujangan lebih tabah dalam berperang dibandingkan yang telah menikah, yang dari awal telah menolak untuk ikut berperang.

Oleh karenanya raja mengeluarkan perintah yang melarang pernikahan. Namun St. Valentine menentang perintah itu dan secara diam-diam ia terus mengadakan pernikahan sampai akhirnya diketahui dan ia dipenjarakan. Dalam penjara dia berkenalan dengan putri seorang penjaga penjara yang terserang penyakit. Ia mengobatinya hingga sembuh dan jatuh cinta kepadanya. Sebelum dihukum mati, dia mengirim sebuah kartu yang bertuliskan “Dari yang tulus cintanya, Valentine.” Hal itu terjadi setelah anak tersebut memeluk agamanya beserta dengan para sahabatnya. Di samping kedua versi ini, ada beberapa versi lain yang menjelaskan lahirnyaVD. Namun yang perlu dicamkan, VD adalah budaya non muslim yang terkait erat dengan dunia para dewa dan mitologi sesat di masa Romawi. St. Valentine diabadikan sebagai seorang tokoh yang hebat dalam mempertahankan cinta dan dianggap sebagai simbol ketabahan, keberanian dan kepasrahan dalam menghadapi cobaan hidup. Jadi VD sama sekali tidak berkaitan dengan budaya dan peradaban Islam. Ketika seorang Muslim telah ikutikutan merayakan VD, maka disadari atau tidak ia telah terjerumus dalam budaya agama lain. Dalam Islam perbuatan ini sangat dilarang dan termasuk dalam perbuatan musyrik. Rasulullah SAW bersabda, “Barang siapa meniru suatu kaum, maka ia termasuk dari kaum tersebut” (H.R. Tirmidzi). Allah SWTsendiri dalam Alquran surat Al-Maa-idah ayat 51 melarang umat Islam untuk meniruniru atau meneladani kaum Yahudi dan Nasrani,“Hai orang-orang yang beriman, janganlah kamu mengambil orangorang Yahudi dan Nasrani menjadi pemimpin-pemimpin(mu); sebagian mereka adalah pemimpin bagi sebagian yang lain. Barangsiapa di antara kamu mengambil mereka menjadi pemimpin, maka sesungguhnya orang itu termasuk golongan mereka. Sesungguhnya Allah tidak memberi petunjuk kepada orangorang yang zalim”. Kasih sayang dalam Islam Dalam Islam tidak dikenal hari kasih sayang, karena kasih sayang dalam Islam tidak terbatas pada ruang dan waktu tertentu. Kasih sayang dalam Islam berlaku setiap saat dan dimanapun berada, baik kasih sayang terhadap keluarga, kerabat, dan seluruh makhluk ciptaan Allah SWT lainnya. Dalam Islam, cinta dan kasih sayang begitu dihargai dan ditempatkan pada posisi terhormat, suci dan sakral. Islam mengakui fenomena cinta dan kasih sayang yang tersembunyi dalam jiwa setiap manusia. Namun demikian Islam tidak menjadikan cinta dan kasih sayang sebagai komoditas yang rendah dan murahan. Islam memandang cinta dan kasih sayang sebagai rahmat. Maka seorang Mukmin tidak dianggap beriman sebelum dia berhasil mencintai saudaranya laksana dia mencintai dirinya sendiri (H.R. Muslim). Perumpamaan kasih sayang dan kelembutan seorang Mukmin adalah laksana kesatuan tubuh, jika salah satu anggota tubuh terasa sakit, maka bagian tubuh lainnya juga akan merasakannya (H.R. Bukhari Muslim). Kita dianjurkan untuk saling menjaga dan menghargai antar sesama, sebagai tanda kasih sayang yang mesti

dihormati. Hal ini untuk menghindari berbagai keburukan serta untuk mengenal antar sesama, disamping untuk memperkuat silaturrahmi dan menjaga tali persaudaraan. Makna kasih sayang yang diusung dalam perayaan VD berbeda jauh dengan makna kasih sayang dalam Islam. Kasih sayang dalam VD dipersepsikan sebagai hari di mana pasangan-pasangan kencan boleh melakukan apa saja, sebagaimana sesuatu yang lumrah di negara-negara Barat. Kencan di hari Valentine sering ditafsirkan sebagai permulaan dari suatu hubungan yang serius. Ini membuat perayaan Valentine lebih bersifat “dating” yang sering diakhiri dengan tidur bareng (perzinaan) ketimbang pengungkapan rasa kasih sayang yang penuh ketulusan, seperti kasih sayang orang tua ke anak. Dalam semangat VD, ada semacam kepercayaan bahwa melakukan maksiat dan larangan-larangan agama seperti berpacaran, bergandeng tangan, berpelukan, berciuman, bahkan hubungan seksual di luar nikah di kalangan remaja itu menjadi boleh. Bahkan ada oknum orang tua yang merelakan dan memaklumi putera-puteri mereka saling melampiaskan nafsu biologis dengan teman lawan jenisnya, hanya sematamata karena beranggapan bahwa hari Valentine itu adalah hari khusus untuk mengungkapkan kasih sayang. Realitas kehidupan remaja menunjukkan, 63% remaja Indonesia (usia SMP/SMA) telah melakukan seks bebas (www.anandyah.com). Di samping itu survei Komnas Perlindungan Anak terhadap 4.500 remaja di 12 kota besar di Indonesia tahun 2007 terungkap sebanyak 93,7 % responden pernah ciuman, petting, dan oral seks, 62,7 % remaja yang masih SMP mengaku pernah berhubungan seksual, dan 21,2 % siswi SMA pernah menggugurkan kandungan (www.doktertomi.com).

Fenomena di atas hendaknya menjadi pelajaran sekaligus meningkatkan kewaspadaan kita, lebih-lebih bagi orang tua, untuk terus mengawasi dan membentengi putra-putrinya terhadap berbagai pengaruh budaya Barat. Kecintaan terhadap anak terkadang membuat kita ”buta mata”, sehingga memberikan kebebasan kepadanya tanpa kontrol dengan dalih mereka anak baik, jadi tidak perlu terlalu protektif. Sudah seberapa jauhkah remaja kita terjerumus dalam mengelu-elukanVD? Mulai sekarang marilah kita sadari agar tidak terperosok ke lembah yang lebih dalam. Tidak perlu cemburu dan iri hati dengan bentuk perayaan kasih sayang dalam agama lain. Kasih sayang itu bukan hanya sehari untuk setahun, bukan juga disertai dengan syahwat, tapi kasih sayang itu berjalan sepanjang waktu dan penuh ketulusan. Perayaan VD hanya menumbuhsuburkan praktik-praktik maksiat dan perbuatan-perbuatan yang bertentangan dengan norma-norma Islam, yang akan membawa bencana ke dalam masyarakat kita. Mari kita tinggalkan budaya kufur yang mengumbar hawa nafsu duniawi dan tradisi menyesatkan yang menjadi senjata orang-orang kafir dalam merusak akhlak dan akidah umat Islam. Semoga Allah SWT senantiasa menjadikan hidup kita penuh dengan kecintaan dan kasih sayang yang tulus, yang menjadi jembatan untuk menuju ke dalam Surga yang hamparannya seluas langit dan bumi yang disediakan bagi orang-orang yang bertakwa. “Kecintaan-Ku adalah bagi mereka yang saling mencintai karena Aku, yang saling mengunjungi karena Aku dan yang saling berkorban karena Aku.” (AlHadits). Penulis adalah Guru MAN Darussalam Aceh Besar.


C6 1 CM 2 CM

WASPADA

Rp. 12.000 Rp. 24.000

3 CM Rp. 36.000 4 CM Rp. 48.000

BURSA

AUTOMOTIVE Informasi Pembaca AC BR CL ND DB

Bursa Automotive

: Air Condition : Ban Radial : Central Lock : Nippon Denso : Double Blower

PS PW RT VR EW

: Power Stearing : Power Window : Radio Tape : Velg Racing : Electric Window

*TANDA CINTA DARI DAIHATSU* -Grand Max Pick Up Angs. Rp. 2 Jt-an -All New Xenia Angs. Rp. 3 Jt-an Proses Cepat, DP Murah. Data Dijemput Hub. Ahmad Arif Nst. 0812 60052 465 (Astra 24 Jam) SUPER PROMO DAIHATSU

Xenia DP 23 Jt-an ........................Angs. 3 Jt-an Pick Up DP 7 Jt-an........................Angs. 2 Jt-an Terios DP 33 Jt-an, Luxio DP Nego, All New Sirion DP Murah Full Discount, Ready Stock, data dijemput Hubungi: IRNANDA 0813 75802895 / 69950232

DAIHATSU Espass Minibus Thn. ‘97 Dijual. Warna merah, BK Medan, AC DB, Tape, Velg Racing. Hrg. 37,5Jt. Bisa Nego. Hub. 0813 6101 8855 DAIHATSU CAPELLA Xenia DP 10% Pick Up DP 15% Terios DP 15% 0852 6132 2043

* DAIHATSU 100% BARU *

Terios.........DP 20 Jt-an...........Angs. 4 Jt-an Xenia........DP 22 Jt-an...........Angs. 3 Jt-an Pick Up..... DP 7 Jt-an............Angs. 3 Jt Luxio......... DP 18 Jt-an..........Angs. 3,9Jt

Hub. PT Capella Medan (JOSUA) 0812 6311 0820 ISUZU Panther Miyabi Thn ’94 BK Medan asli, AC CD, PW, Remote, PR, BR, W. Merah Maron Silver, Lihat dulu baru menawar, Jok kulit Hub. 0813.6007.5306 ISUZU Panther Hi Grade LV Thn 2001, W. Merah, AC double blower, CL, PW, Remote, PR, CD, BR, Hrg 113 Jt/nego Hub. 0813.6007.5306

ISUZU 100% BARU

GrandTouringTypeJ,LS,LV,PickUpPanther,Turbo Diesel,Kuat,Hemat,Dijaminuntung,Terimatukar tambahsemuamerk, Info:Astra,Isuzu:(061) 68444.8554 / 0813.7591.5420 MITSUBISHI Lancer Evo-4 Thn ‘98 AC, Tape, VR, BR, W. BIru Met, BK Medan, Sehat, Body sgt mulus, Tinggal pakai aja, Harga 92 Jt/damai Hub. 0853.6018.2414 MITSUBISHI Baru, Cash/Kredit, Dalam/ Luar kota, DP Ringan Proses cepat. Pajero, L300, +120, Colt diesel, Triton. Hub. 0853 6091 6586 (Alvin Nst)

MITSUBISHI BARU DISKON KANDAS T120ss, L300 FD, Colt Diesel, Dakar. Harga mulai 0%. DP kecil. Proses cepat. Hub. Anggun 0812 6477 8869 NISSAN Grand Livina 1.5 XV A/T Thn 2008 W. Hitam, Paling lengkap, Jok kulit, BK Mdn asli, Sehat, Sgt mulus, Jarang pakai, Harga 155 Jt/ damai Hub. 0813 7618 8118

SUZUKI BALENO W. Merah Met Thn ‘98/99 Mobil mulus, Cat original, BK Mdn, 72 Jt/nego HP. 0813.6168.1655 JUAL CEPAT/BU

Suzuki Baleno Thn. 98. Hijau metalik, tangan pertama BK 23 WW, jarang pakai, Orisinil, AC, Tape, Power, VR, PW, BR, sangat mulus, Harga 69Jt/Nego. Mau pindah Hub. 0811 645 684

5 CM 6 CM

Rp. 65.000 Rp. 78.000

TOYOTA Kijang Super G 1.8 Long Thn ’95 Warna Abu-abu Tua Metalic, BK Medan asli, Pajak panjang mobil original, Harga 67 Jt Hub. 0812.7069.3555

Rp. 91.000 Rp. 104.000

BURSA

PHOTO COPY

9 CM Rp. 126.000 10 CM Rp. 140.000

11 CM Rp. 165.000 12 CM Rp. 180.000

IKLAN KHUSUS 6x1,5 kolom Rp. 120.000

Pelanggan Yang Terhormat

HA TI-HA TI terhadap penipuan yang mengatas HATI-HA TI-HATI namakan PT. Harian WASPADA, kami dari PT. Harian WASPADA tidak pernah mengirim sms untuk membeli TI-HA TI apabila anda ingin produk anda, dan HA HATI-HA TI-HATI melakukan transaksi jual beli melalui transfer. Segala akibat yang terjadi diluar tanggujawab

TOYOTA Avanza G Thn. 2004. W. Merah met, BK Mdn, Cat kilat seperti baru. Hrg. 115Jt Nego. HP. 0811 652506

TOYOTA Avanza G Th. 2005. BK Binjai W. Biru met. Hrg. 115Jt. Cat dan mesin mulus. HP. 0852 7650 6242 TOYOTA Altis Th. 2002. W. Hitam, sehat, mulus, orisinil, Asuransi All risk 2 thn. BK Asli Mdn, Tgn pertama (1) Hrg. 135Jt/ damai. Hub. 061-7773 1399

PT. Harian WASPADA. Apabila anda mencurigai sesuatu, silahkan hubungi kami di

BURSA BUTUH DANA

061-4576602. Terimakasih

BUTUH DANA Jaminan Apa Saja. Sertifikat Tanah Mobil & Sp. Motor. Segala tahun. Hub. 061.8222 774 HP. 0853.6199.1500-0816 314 1807

BURSA

SERVICE/ASESORIS MOBIL

‘MULIA JAYA’ POWER STEERING

- Ganti Oli - Pasang Power Steering - Service Power Steering Jln. Sisingamangaraja No. 5 A.B. Medan Telp. (061) 7369224 (061) 7344954

PROMO SARUNG JOK MOBIL

SPESIALIS ALAS DASAR, DOORTRIM, LANGIT-LANGIT, AUDIO, ASESORIES MOBIL & KACA FILM

TYPE MOBIL TYPE PROMO SEDAN PROMO 1 Rp. 600.000 PROMO II Rp. 900.000 PROMO III Rp. 1.000.000 PROMO IV Rp. 1.400.000

MINI BUS Rp. 700.000 Rp. 1.000.000 Rp. 1.100.000 Rp. 1.600.000

MINI & EFEKTIF IKLANKAN PRODUK ANDA

www.amanahumrohmedan.com UMROH REGULER 9 HARI 23 MARET/ 1, 4, 16, 25 APRIL UMROH REGULER 14 HARI 18 MARET/ 8, 18, 25 APRIL UMROH 20 HARI (ARBAIN) 6 APRIL, 16 MEI UMROH PLUS CAIRO 14 HARI 21 APRIL HOTEL MADINAH : AL-HARAM (5*) HOTEL MAKKAH : MAKARIM AJYAD (5*) HOTEL JEDDAH : AL AZHAR (5*) Penerbangan Via Singapore * Khusus bagi jama’ah dari luar kota nginap di Hotel Madani Gratis DAFTAR SEGERA Kantor: Gedung Gelora Plaza Lt. 1 Jl. S. M. Raja No. 4/18 Medan Telp. 061-7326981, 0813 7503 1889, 0852 6213 3488

Minuman Kesehatan Selain Obat

MANFAAT: 1. Meningkatkan stamina & vitalitas, 2. Mengatasi gangguan jantung, 3. Mengatasi nyeri sendi, 4. Mengatasi ashma/ sesak nafas, 5. Mengatasi stroke, 6. Meningkatkan sirkulasi darah, 7. Menyuburkan produksi sperma, 8. Melawan tumor & kanker, 9. Mengatasi lemah syahwat, 10. Mengencangkan otot perut serta payudara, dll

SERVICE

AC

AC

ELEKTRONIK

(Izin Din.Kes.P-IRT No. 113121281563, LP.POM.MUI. No. 09120003920511 dan sudah mendapat sertifikat HALAL)

Cuci + B. Pasang Kulkas, Dispenser Hub. MAJU TEKNIK 0813 6244 4913 - 061-7030118

WILAYAH : SUMATERA UTARA, SUMATERA BARAT, SAMARINDA & ACEH, MENCARI DISTRIBUTOR RESMI SEBAGAI:

1. PENYALUR KECAMATAN 1 ORANG PER KECAMATAN 2. PENYALUR KABUPATEN 1 ORANG PER KABUPATEN 3. PENYALUR PROVINSI 1 ORANG PER PROVINSI SELURUH INDONESIA

REPARASI AC, KULKAS, MESIN CUCI

Keuntungan: bila anda berhasil mensuplay product kami ke Toko grosir, kios atau apotik, maka selama ada pembelian dari tempat tersebut akan menjadi omset anda selamanya dan dapatkan REWARD MOBIL

Kompor Gas, Dispenser H & C TV, M. Pompa Air Sanyo

Hub. SURYA TEKNIK SERVICE Telp.66482216 - 0813 7589 8757 Siap Ketempat

BERGEGASLAH, KESEMPATAN TERBATAS….!!!

SERVICE

KONSTRUKSI

WC Hp.0812.64271725

Jl. P. Brayan Medan

ADI

WC

ADA GARANSI

TUMPAT/ SEDOT

77442112

0813 6147 0812

Jl. Gatot Subroto Medan Ada Garansi

BURSA

Yang berminat segera hubungi & datang ke alamat kantor kami:

HILANG/TERCECER HILANG Tas berwarna hitam yang berisikan Surat-surat Penting - Surat Tanah SK Camat Medang Selayang yang terletak di Jl. Setia Budi Gg. Mesjid a/n. LINGGEM S. DEPARI - BPKB & STNK Spd. Motor Honda BK 1453 FB a/n. LUTHER SUPIANTO. Yang tercecer disekitar Jl. Dr. Mansyur s/d Jl. Simp. Pemda. Bagi yang menemukan Hub. 0812 6351 2095

BURSA

PELUANG BISNIS

ELEKTRONIK

TV LCD 22” LG=1,5Jt. 32”LCD/LG/ Sharp Aquos=2,8JT, 32” LED Samsung, =3,2Jt, Shrp =3 Jt, 34 “Sony = 2 Jt, 29” Flat Baru LG =2 Jt, 29” Bekas 900rb - 1,7 Jt. 14 - 21=300rb - 650rb, LCD Monitor 22”=800rb. PS1=400rb, PS 2=800rb, PSP.GO=1,3Jt, DVD 200rb, Vortable = 700rb. Ampli Cina=400rb, Technics H. KARDON , Spk. BMB= 1,450 Jt - EQ - TV Mobil=500rb LAPTOP, HANDYCAM, CAMERA, PROJECTOR Handicam Sony Hi-8=1Jt, Mini DV =1,5Jt, DVD=2Jt, Canon Lageria=1,5Jt, Camera 5 Mp - 12 Mp 500rb - 1,2Jt. Fax= 600rb, Printer HP=450rb

AC

SPLIT BEKAS MODEL BARU DIJUAL MURAH 1 Pk Rp. 1.200.000

DIOBRALAC,KULKAS,M.CUCI,P.AIR,GENSET

Jual AC Baru/Bekas 1/2, 3/4, 1 1/2, 2 Pk 1,2Jt. AC Window 1 Pk=800rb. Kulkas 1 Pt-2Pt-600rb - 1,2Jt, 2 Pt. Super Jumbo=1,9Jt. f.5rAK=1,2 Jt M. Cuci 1 Tb-2 Tb=600rb - 1,2Jt. M. Cuci baru=1,2Jt (2 Tb. 9 Kg) Genset 3000w 8000W= 4,5jT. 2 Jt, Pompa Air, Sanyo - P. Cliner

UD. SENANG HATI

Hub. 4517509 - 0821 6322 4343 Jl. Sekip 67 A

PT. USBI, PENYALUR RESMI, Jl. Rajawali No.

BURSA

Ingin Trading Online Forex, Index Commodity, CFD, Metal??? Cukup Dengan Modal $ 5 US Dolar Anda Sudah Bisa Bertransaksi di Pasar Bursa Dunia Spread Mulai dari 2 Point, Tanpa Biaya Cash Komisi Ingin Tau Strategi dan Cara Menganalisa Market Forex, Index & Commodity secara Mudah Temukan Solusinya dan Segera Kunjungi Kantor Resmi Master Forex Area Sumatera

JUAL- BELI

ELITE MOTOR

AMANAH UMROH

“JUICE PINANG MUDA” GOLDGREEN

TV, LED, LCD, Kulkas, M. Cuci, Handycam DSLR, Laptop, LCD Projector, PS1, 2, & 3. H. Teater, Sound System, dll. HUB. CV. MARKET Tel. 7632 4682, 0812 6539 3000. S. Budi Tj. Sari No. 424 B Psr. IV dkt BNI

Hub. Jl. Nibung II No. 114 Medan (Samping Medan Plaza) Telp. (061) 4566884 (Hunting) dekat Carrefour.

HARGA BELUM TERMASUK PPN 10%

KAMI PERUSAHAAN PENYALUR RESMI PRODUCT

BUTUH DANA CEPAT...!

PENCAIRAN 1 JUTA - 1 MILYAR, PROSES 1 HARI JAMINAN: SK CAMAT, SHM, SKT, HGB, BPKB MOBIL, SPD MTR, TRUK (BANTU PELUNASAN BPKB) HUB. 0813.7044.6668 - 0813.7044.6633

FAX.4561347

KESEMPATAN EMAS…!!!

ANDA Pusing atau tidak punya waktu untuk mengurusi semua tagihan Kartu Kredit anda??? Kamilah solusinya, Hubungi Asiong 0878 6711 1983 Dijamin Aman dan Terpercaya !!!

TOYOTA Kijang Kapsul “SX” Dijual. Wrn. Silver BK Medan Thn. 2001. Hrg. 87Jt. Hub. 0813 6101 8855 TOYOTA BARU 100% 2012 Ready Stock Innova, All Tipe. Yaris, Fortuner, Hilux, Rush, Avanza, Proses Cepat. Cash/Kredit. Hub. 0813 61201719 / 68783325

7 CM 8 CM

TOYOTA Kijang Commando Thn ’89 W. Biru Met, Mobil mulus, 43 Jt/nego HP. 0821.6461.6552

Senin, 13 Februari 2012

DEPOT AIR MINUM CASH & CREDIT

Kami Akan Memberikan Informasi Dan Pemahaman Secara Gratis Kepada Anda!!!

Pemasangan Depot Air Minum berkualitas dengan

Telah Hadir Di Master Forex Meta Trader untuk: BlackBerry, Iphone, Ipad, Android

Ultra Violet Tanwing (Australia) * Depot Mineral, RO dan HEXAGONAL * Menyediakan Mobil Tangki Air Pegunungan * Menyediakan Segala perlengkapan Depot * Menyediakan Teknisi Depot * Melayani pemindahan Depot

Master Forex Area Sumatera Mandiri Building Lt.6, Jl. Imam Bonjol No. 16 D Medan 20112 Sumatera Utara – Indonesia Tel. +62-61-3000 33 00 Fax. +62-61-3000 33 84 www.medan.masterforex.com e-mail : medan@masterforex.com

UD. PANDAN PUTIH

Jl. Jemadi 67 Medan HP. 0813 6130 9280 - 0852 1369 9288

Harian WASPADA Media yang Tepat untuk Iklan Anda

15, 844.7545 Medan, Contact Person, 0852.7673.9135 – 0852.6258.1494 INFO: Kec. Yang sudah ada penyalur: Siantar Barat: Zulkifli 0813.9704.9000, Tanjung Pura: Dra Suarti 0852.6210.4013, Siantar Kota: Kamra 0852.6162.5499, Amplas: Deppin 0812.6330.0966, Medan Barat: Ayu 0813.7034.1212 & Novi 0878.6886.2164, Medan Petisah: Kamra 0852.6162.5499, Medan Timur: Nurjani 0813.7609.5206, Brandan Kota: Drs. Suhada 0813.6113.9573, Kec. Kota Takengon: Armita Jaya 0852.6233.1738, Bener Meriah: Ir. Sahida 0852.7614.9957, Gayo Lues: Johansyah 0821.6260.6585, Percut Sei Tuan: Bolot 0852.7682.9533 *Toko-toko penyalur setiap bulan akan kita iklankan di Media dan hanya toko yang ditunjuk oleh subdealer yang boleh memasarkan product ini

BURSA

LOWONGAN

Khusus Medan Deli, Marelan, Labuhan, Belawan Hub. 0812 6390 660 Iklan Anda Dijemput

Ingin Promosikan Produk Anda Harian

WASPADA Media yang Tepat untuk Iklan Anda

DIBUTUHKAN SEGERA

Butuh segera P/W usia 17 thn keatas (semua kalangan) untuk diposisikan dikantor sebagai MITRA KERJA (Bukan Sales), syarat KTP + Surat lamaran lengkap Penghasilan: Rp. 1.500.000 – Rp. 2.500.000 HUB: IBU INDAH, Amd HP: 0853.7131.6855 (No SMS) Alamat: Jl. Iskandar Muda (Prapatan lampu merah Medan Plaza) Informasi dari Pukul 10.30-16.00 WIB

INCOME EXTRA

PERUSAHAAN AMERIKA Membutuhkan orang-orang dinamis dan bermotivasi tinggi sebagai: KONSULTAN INDEPENDENT (P/F/ 5 - 10 Juta) Serius hubungi: Tengku Rahmah S.Ag 0812.6056.2302 Yanuarlin Lubis, SE 0812.6477.875

LOWONGAN MENDESAK

Untuk pembukaan kantor baru, Perusahaan Industri dan Managemen Bisnis buka cabang di Medan, membutuhkan tenaga² potensial untuk berbagai posisi: ADM/ STAFF, GUDANG, PEMBUKUAN, SUPERVISOR, WAKIL & KEPALA CABANG Syarat: - P/W single, usia max. 27 thn - Pend. min SMU/ SMK sederajat, tidak sedang kuliah - Pengalaman tidak diutamakan, tidak sedang bekerja - Mengikuti pelatihan (ada karir, bukan kerja kontrak) - Bagi pelamar dari luar kota disediakan mess Segera datang langsung, bawa lamaran lengkap ke:

DIBUTUHKAN

Tukang pangkas di Jl. Letda Sujono depan RS. Martondi, 4 orang Hub ke: 0821.6712.2834 Jaminan 60.000

BURSA

PROPERTY

Informasi Pembaca Bursa Property

G R : Garasi LB KM : Kamar Mandi LT KP : Kamar Pembantu RM KT : Kamar Tidur RT SHM: Sertifikat Hak Milik

: Luas Bangunan : Luas Tanah : Ruang Makan : Ruang Tamu

RUMAH Dijual cepat/ B.U Komp. Sunggal Mas - Type 75, LB. 6x17 (sdh tambah 2 lt), 4 KM, 1 KM, Jemuran, Canopy & Pagar muat 2 mobil, Kitchen Set, Lt. keramik 40x40m, Lux, SHM, Hrg Rp. 325 Jt/ nego jadi Hub. 0852.7516.0222 Ibu Hanum

DIJUAL CEPAT

TANAH KOSONG DAERAH STM JL. SUKA INDAH LUAS: 1010M² (SHM) HUB. 0812.6500.0963

DIJUAL 2 RUMAH BARU

KOMP. PESANGGRAHAN JL. SEROJA, MEDAN PERMAI, DEKAT KAMPUS UNIKA, 5 MENIT KE RSU. ADAM MALIK, 2 MENIT KE PAJAK MELATI, HARGA Rp. 200 JT/NEGO HUB: 0812.635.2376

MADANI GROUP

Jl. M. Nawi Harahap No. 23 B Medan (dekat Simpang Limun), Tgl. 13 s/d 15 Februari 2012. Pukul 10.30-14.00 WIB CEPAT & TERBATAS ...!!!

MAGANGKEJEPANG2–3THN

INTERNSHIF VISA PROGRAM

Sebuah Restoran yang akan dibuka membutuhkan: 1. BARISTA : 4 Orang 2. BAKER : 4 orang 3. COOK : 4 orang 4. CASHIER : 4 orang 5. WAITER/ TRESS : 4 orang 6. SECURITY : 2 orang 7. KEBERSIHAN : 2 orang Syarat-syarat: Pria/ wanita, usia 19 s/d 30 tahun, minimal lulusan SMA, diutamakan berpengalaman Lamaran diantar langsung ke:

Di Perush. Prod. Elektronik Syarat: Pria/ wnt, Sehat 22 – 34 thn, Min. Tamat SLTA Pendaftaran: 20 – 28 Februari Bagi yg lulus Verifikasi utk Daftar ulang: 5 – 9 Feb WISMA USU 0857.468.5432

Jl. Eka Warni Gg. Setia, Sertifikat Uk. 17x31 Hub.0821.6621.3844

Jl. K.H. Zainul Arifin No. 164-166 Medan 20112 Selambatnya seminggu setelah iklan ini dimuat

Harian WASPADA

Berbagai Model dan Warna Jl. Prof. H.M. Yamin SH. No. 344/Jl. Serdang Depan Gg. Sado Medan, HARI MINGGU TETAP BUKA

DIBUTUHKAN SEGERA

PT. SUSTAINABLE LIFESTYLE

TANAH

TANAH DIJUAL

BURSA

BUSANA/ ACCESORIES

PECI MAHKOTA MENJUAL PECI TEMPAHAN


Agenda

WASPADA Senin 13 Februari 2012

07.00 Doraemon 07.30 Dahsyat 11:00 Infotainment INTENS 12:00 Seputar Indonesia Siang 12:30 Sinema Siang Little Thing Called Love 14.30 Kabar Kabari 15.30 Tom & Jerry 16.00 Silet 17.00 Seputar Indonesia 17.30 RHS (Rahasia Hidup Selebriti) 18.00 Mega Sinetron : Binar Bening Berlian 22.00 Box Office Movie: Final Destination 3

CATATAN

07.00 SCTV Pagi 09.00 Halo Selebriti 10.00 SCTV FTV Pagi 11:00 SL Liputan 6 Terkini 12:00 Liputan 6 Siang 12.30 SCTV FTV 14:00 Liputan 6 Terkini 14:30 Status Selebriti 15.00 Uya Emang Kuya 16.00 Liputan 6 Petang 16.30 Serial Istimewa Anak Kaki Gunung 17.30 Reality Istimewa : Cenat Cenut One Day With SMASH 19.00 SCTV Sinetron : Putih Abu Abu 21.00 SCTV SInetron : ALiya 22.00 Liputan 6 Terkini 22.03SCTVMUsikSpesial: The 54th Grammy Awards 2012

07:30 Wooow…! 08:00 Friends (Live) 09:00 Mister Laper 09:30 Segeeerr 10:30 Catatan Sang Dai 11:30 Topik Siang (Live) 12:00 Klik ! 13:00 Sinema Siang 15:00 Indonesia Super League 2011-2012 17:30 Topik Petang (Live) 18:00 Pesbukers (Live) 19:00 Catatan Si Olga 20:00 Layar Lebay 22:00 Most Incredible Moments 23:00 Dokumenter Dangerous Encounter IV 00:00 Topik Kita 00:30 Topik Malam (Live) 01:00 Lensa Olah Raga Malam (Live) 01:30 Sinema Legenda

07:00 Disney Club 08.00 Cerita Pagi 10.30 Di Antara Kita 11.00 Sidik 11:30 Lintas Siang 12:00 Layar Kemilau 13.30 Cerita Siang 15.00 Starlite 15:30 Lintas Petang 16:00 Animasi Spesial 17.45 Animasi Spesial The Owl 18:00 Filler Didi Tikus 18.10 Shaun The Sheep 19:00 Fathiyah 20.00 Tendangan Si Madun 21.00 Si Miskin Dan Si Kaya 22.00 Cerita Cinta 23.30 Lintas Malam 00.00 Premier Highlights 00.30 Cerita Dinihari

07:00 - KISS Pagi 07:30 - FTV Pagi: Cinta Artika 09:30 - Hitzteria 11:30 - Patroli 12:00 - Drama Asia (Korea): Dong Yi 13:30 - Drama Asia (Korea): Pink Lipstick 15:00 - KISS 16:00 - Fokus 16:30 - Drama Asia (Korea): 49 Days 18:00 - Drama Asia: Pendekar Pemanah Rajawali 19:00 - Satria 20:00 - Tutur Tinular 22:00 - Buaya Show 23:00 - Mega Asia: Infernal Affairs

07.05 Editorial Media Indonesia 08.05 Eleven Show 09.05 Eleven Show 10.30 Metro Xin Wen 11.05 e Lifestyle 13.05 Zero to Hero 14.30 Metro Sore 15.30 Public Corner 16.05 Discover Indonesia 16.30 Metro Highlights 17.05 Metro Hari Ini 18.05 Metro Hari Ini 19.05 Suara Anda 20.30 Prime Interview 21.05 Top Nine News 22.05 Economic Challenges 23.05 Metro Realitas 23.00 Metro Sports

Jadwal acara TV di atas bisa diubah sewaktu-waktu oleh stasiun TV yang bersangkutan tanpa pemberitahuan

07:00 Riwayat 07:30 Kuliner Pilihan 08:00 Gula Gula 08:30 Koper Dan Ransel 09:00 Ceriwis Pagi Manis 10:00 Ala Chef 11:00 Insert 12:00 Benu Buloe 12:30 Ngulik 13:00 Online 14:00 Bosan Jadi Pegawai 14:30 Peppy The Explorer 15:00 Ethnic Runaway 16:00 Gaul Bareng Bule 16:30 Insert Sore 17:00 Reportase Sore 17:30 Jika Aku Menjadi 18:00 Pengabdian 18:30 Termehek Mehek 19:30 Super Trap 20:30 Cinta Cenat Cenut 2 22:00 Bioskop TransTV 00:00 iND!GO 01:00 Bioskop TransTV

“Sudah resiko kalau peran saya sebagai calo Jantung, dicap tak manusiawi. Pasalnya, denganiming-iminguangjumlah besar - dia bertugas mencari calon pendonor yang bersedia mengorbankan nya-wanya untuk menolong Resi-pien atau calon penerima Jan-tung. Tapi, Mindset atau pola pikir sejatinya dari peran ter-sebut - semuanya

Agus Kuncoro BURSA

06.30 Apa Kabar Indonesia 09.30 Kabar Pasar Pagi 10.00 Coffee Break 11.30 Kisah Sukses UMKM 12.00 Live News Kabar Siang 13.30 Satu Jam lebih Dekat 14:30 Live News Kabar Pasar 15.00 Best Match La Liga 17.00 Live News KAbar Petang 19.30 Apa Kabar Indonesia Malam 21.00 Live News Kabar Malam 22.00 Live News KAbar Arena 23.30 The Legend

08:00 Penguin Of Madagascar 08:30 Pat & Stan 09:00 Super Hero Kocak 10:00 Obsesi 11:00 Hot Spot 12:00 Awas Ada Sule 2 13:00 Sketsa Tawa 13:30 Main Kata 14:30 Petualangan Panji 15:00 Berita Global 15:30 Fokus Selebriti 16:00 Top Banget 16:30 Tamu Gokil 17:00 Pat & Stan 17:30 Spongebob Squarepants 18:45 Indonesian Premier League 21:00 Big Movies 23:30 Movies

07:30 Selebrita Pagi 08:00 Ups Salah 08:30 Hitam Putih 09:30 Spotlite 10:30 Warna 11:30 Redaksi Siang 12:00 Selebrita Siang 12:30 Si Bolang 13:00 Laptop Si Unyil 13:30 Opera Van Java 15:00 Raja Gombal 16:00 Jejak Petualang 16:30 Redaksi Sore 17:00JejakPetualang:Sur... 17:30 Orang Pinggiran 18:00 Hitam Putih 19:00 On The Spot 20:00 Opera Van Java 22:00 Bukan Empat Mata 23:30 Jam Malam 00:00 Mata Lelaki 00:30 Sport7 Malam 01:00 Redaksi Malam 01:30 THEATER7 Malam **m31/G

Agus Kuncoro Calo Pendonor Jantung BERAKTING memukau dan meyakinkan dalam film Malaikat Tanpa Sayap (MTS) , justru membuat aktor Agus Kuncoro, 39 berpotensi menuai kecaman tak manusiawi dari penonton. Pasalnya, dalam film terbaru produksi Starvision Plus dan dibesut sutradara Rako Prijanto, pria kelahiran Jakarta, 11 Agustus 1972 ini berperan sebagai calo Jantung – yang menggiring tokoh Vino (Adipati Dolken), mendonorkan Jantungnya kepada Mura (Maudy Ayunda) – sang kekasih.

MATERIAL

C7

Anda Butuh Perabot Jepara Asli?

MALIOBORO PERABOT Hubungi: Jl. Bilal No. 90 P. Brayan Medan Telephone Toko : 661.6285 Rumah : 661.1540 Fax : 661.6285 (061) Jl. K.L. Yos Sudarso depan SMA Negeri 1 Tebing Tinggi Telp. (0621) 24243

LIHAT JEPARA DENAI !!! MODEL TERBARU KUALITAS BERMUTU SEKARANG ADA DI JL. DENAI NO. 205 HP: 0852.9708.6572 MEDAN

TEMPAHAN MURAH - Lemari pakaian 3 pintu Sungkai asli Rp. 1.500.000 tempahan - Kitchen set atas bawah Sungkai asli Rp. 1,5 Jt/mtr Hub Telp. (061) 661.8116 - (061) 661.6802- 7653.2188

BURSA

KUSUK & LULUR NIATI

JL. BAHAGIA BY PASS NO. 15 HUB. 0812.2822.4745

KESEHATAN

KUSUK & LULUR TERAPY MBAK ALIN

BERSEDIA DIPANGGIL HUB. 0813.7739.9508

TERAPI ALAT-VITAL DI TANGANI LANGSUNG

A. AMRIL PAJARRUDIN

gaveta) – adikVino.“Dengan uang dari saya sebagai calo Jan-tung, Vino tanpa sepengeta-huan papanya bisa membiayai operasi Wina – sang adik. Bah-kan, mendapatkan kembali ru-mah keluarganya yang disita pi-hak bank. Jadi, semua masalah jadi beres walau Vino harus mengorbankan nyawanya,” terang Agus Kuncoro yang diakhir cerita filmMTS mulaidiputardibioskop kota besar mulai 9 Februari 2012. Dia menyebutkan, dirinya selamat dari kecaman tak manusiawi lantaran, Pak Amir yang

kritislantarantertembakdibagian perut oleh selingkuhan sang istri – Mirna (Kinaryosih), tiba-tiba bersedia mendonor-kan Jantungnya untuk Mura. “Walau awalnya peran saya terkesantakmanusiawi,tapiMind Set cerita film MTS pada akhirnya benar-benar demi ke-baikan bersama,” tandas aktor yang pertama mengorbit lewat film Saur Sepuh IV dan V tahun 1991 – 92. * (AgusT)

Tim Bui Drama Seri Tentang Resolusi Konflik Sebuah drama seri mempromosikan kekuatan tim olahraga menghadapiperbedaandan resolusi konflik segera ditayangkan di Indonesia. Menggabungkan kecintaan masyarakat pada olahraga sepakbola dan drama televisi, serial 13 episode dengan judul Tim Bui ini membawa toleransi beragam, kerjasamatimdanresolusikonflik di masyarakat. Organisasi non pemerintah Search for Common Ground (SFCG) bekerjasama dengan SET Film memproduksi serial dengan

dana dari United King-dom’s Departement for Inter-national Development (DFID) dan pemerintah Australia me-lalui AusAID. Menurut Direktur Asia SFCG Brian D. Hanley, Tim Bui melakukan revolusi drama televisi di Indonesia dengan menawarkan kepada penonton sebuah alternatif mendidik dari pada program sinetron yang mendominasi pasar televisi. WalausangatmenghiburTim Bui ini mempromosikan model positif dari interaksi sosial yang

juga ditulis, diproduksi dan ditayangkan orang Indonesia sendiri.Serialiniakantayangmulai 19 Februari pukul 13.30 di Metro TV. Dalam serial tersebut, kekerasan, hubungan saling bertentangan antar geng berubah menjadi satu kerjasama dan saling menguntungkan. Pembentukan tim sepakbola menjadi kekuatan pemersatu dalam membantu anggota geng mengatasi perbedaan dan bekerjasama meraih keberhasilan di lapangan. Menurut Direktur SET Film

Garin Nugroho, penjara selalu dianggap sebagai muara dari beragam bentuk nilai yang bertentangan dengan demokratisasi. Justru yang menarik lewat dramaini,beragamnilai-nilaiyang penting untuk dikonsumsi penontonkhususnyadiwila-yahwilayah penuh konflik menjadi nilai dari drama seri ini. Drama seri ini perlu ditonton, justru di tengah transisi demokrasi yang dipenuhi konflik kekerasan, ketimpanan ekonomi dan dilema dalam hukum.(rel/m19)

Serial Korea Boys Before Flowers Tayang Di Indonesia

Terapie Kejantanan Dengan cara di Totok di bagian, saraf alat vital/ minum ramuan alami (jamu) 100% alami Mengobati. besar + panjang, impotensi, kurang keras, lemah syahwat, diabetes dan tidak punya keturunan Tanpa efek samping, bebas pantangan dan agama

Alamat: Jl. SM. Raja No. 60 Simpang Limun, Medan (depan SDN 100) HP. 0812.6350.4441

demi ke-baikan,” kilah Agus Kuncoro ke-pada Waspada selepas preview film “MTS” di

bioskop Planet Hollywood Jakarta, baru-baru ini. Menurut aktor popularitasnyamembumbunghebatan-tara lain lewat Sinetron Para Pencari Tuhanini,dirinyamenggiringVino untukmenjadipendonorJantung bagi Mura – putri kesayangan Levrand (Ikang Fauzi), lantaran golongan darahnya sama dan langka yakni A Rhesus Negatif. Sementara, Vino dan Amir (Surya Saputra) sang papa berprofesi supir taksi, membutuhkan uang tunai untuk membiayai operasi Wina (Geccha Qhea-

Harian WASPADA

Stasiun televisi ANTV akan menayangkan Boys Before Flowers, sinetron berseri paling populer di Korea. Presiden Direktur ANTV, Dudi Hendrakusuma. mengatakan keputusan menayangkan kisah drama romantis itu didasarkan pada kenyataan bahwa remaja Indonesia saat ini sedang dilanda demam Ko-rea. Sinetron ini diadaptasi dari cerita manga Hana Yori Dango karya Kamio Yoko. Serial bertema cinta dan

persahabatan paling populer di Korea ini dibintangi Koo Hye Sun sebagaiGeumJanDi,LeeSiYoung sebagai Oh Min Ji, Lee Min Ho sebagai Goo Joon Pyo, Kim Hyun Joong sebagai Yoon Ji Hoo, Nam Da Reum sebagai Ji Hoo muda, Kim Bum sebagai SoYi Jung, dan Kim Joon sebagai SongWoo Bin. Cerita Boys Before Flowers berawal dari Geum Jan Di, seorang gadis biasa yang keluarganya mempunyai toko dry cleaning di dekat sekolah Shin Wa terkenal dan mewah. Jan Di

bertemu dengan empat pemuda paling kaya dan manja terkenal dengan sebutan F4. Setelah menyelamatkan seorang pemuda yang meloncat dari atas atap gedung sekolah Shin Wa, dia diberikan kesempatan menjadi pelajar di sekolah itu dengan beasiswa renang. Jan Di mencoba untuk menghindarikonfrontaside-ngan F4 dalam bentuk apapun, karena dia tahu apa yang akan terjadi jika berhadapan dengan mereka. Namun, ketika teman-nya yang

bernama Oh Min Ji se-cara tidak sengaja menumpah-kan es krim ke sepatu pemim-pin F4, Goo Joon Pyo, perang pun tidak terhindarkan. “Boys Before Flowers dijadwalkan tayang hari Senin-Jumat, setiap pukul 10.00, mulai 13 Februari 2012. Kami sengaja memilih waktu berdekatan dengan Valentine Day (Hari Kasih Sayang) dengan harapan bisa menambah suasana romantis di kalangan kaula muda,” kata Dudi. (ant)

Titi Sjuman Terus Asah Kepiawaian Akting MEDAN: Jl. Serdang Gg. Sado 43B, Tempuling Medan, Sumatera Utara Telp. (061) 6634.2201 KLINIK TRADISIONAL ALAT VITAL DARI PELABUHAN RATU CISOLOK BANTEN DITANGANI LANGSUNG

A. AMARUDIN

TERAPI KEJANTANAN DENGAN MENGGUNAKAN TOTOK SYARAF DAN DIBERIKAN RAMUAN/ JAMU HASILNYA PERMANEN. TANPA EFEK SAMPING BEBAS USIA, BEBAS PANTANGAN DAN AGAMA REAKSI LANGSUNG DI TEMPAT MEMILIH UKURAN YG SUDAH DI SIAPKAN DARI NO (1) S/D (3)

MENGOBATI PRIA

+ BESAR : 3, 4, 4, 4, 4, 5, 5, 5, 6 CM + PANJANG : 13-14-15-16-17-18-19-20 CM - IMPOTENSI - LEMAH SYAHWAT - KURANG KERAS/ LOYO - MANI ENCER/ EJAKULASI DINI - DIABETES/ KENCING MANIS - TDK PNYA KETURUNAN - MENANGANI PROBLEM ASMARA, DSB ALAMAT: JL. SM. RAJA DEPAN GARUDA PLAZA GG. KELUARGA SAMPING KLINIK BUNDA NO. 31A HP. 0812.6057.6444

SPESIALIS TERAPI ALAT VITAL N NYAI RATU ENDANG ASTARI + ANDA G A G A L DI TEMPAT L A I N ? ? DITANGANI LANGSUNG

izin kejari: no. B.78/N.4.3/DSP.4/12/2008

Kami memberi bukti bukan janji alat vital besar dan panjang ditempat No. suntik No. silikon, murni tradisional ramuan alami dan Do’a. dijamin paten dan permanen, tanpa ada efek samping bebas pantangan untuk semua usia, ras dan agama.

Mahar terjangkau dan BERGARANSI.

BURSA

PERABOT SPRING BED DIJUAL MURAH Spring Bed 6 kaki 2 lapis Rp. 1.150.000 Spring Bed 5 kaki 2 lapis Rp. 1.075.000 Spring Bed 4 kaki 2 lapis Rp. 1.000.000 Spring Bed 3 kaki 2 lapis Rp. 900.000 Spring Bed 3 kaki Dorong Rp. 1.000.000 Garansi Per 10 tahun

Hub Telp. (061) 661.8116 - (061) 661.6802 - 7653.2188

Menjadikan alat vital keras kuat, tahan lama, menyembuhkan impotensi, ejakulasi dini, lemah syahwat, loyo dan kurang gairah kembali perkasa. Menangani bekas suntik/ silikon, mani encer, plek cur, mati total, spilis, mandul, ingin punya keturunan dan menangani yang gagal di tempat lain.

Untuk Wanita: (Bisa Berdarah Lagi)

Terapi perawan/ virgin bisa langsung cek ke dokter. Menyembuhkan keputihan bau tidak sedap, ingin terasa gigit, payudara montok padat dan kenyal.

BUKTIKAN DISINI...!!!

Sanggup atasi problem al: Ekonomi, bangkruk, terlilit utang rumah tangga sering cekcok, bubarkan perselingkuhan, buka aura, pelaris, berbagai macam susuk pengasihan pelet, dll. Praktek/ Alamat:

Praktek tetap Jl. SM. Raja depan Kampus UISU Gg. Khotib No. 3 Praktek mulai jam 08.00-12.00 Telp. 0812.6880.7666 - 0878.6767.6333

KLINIK TERAPY ALAT VITAL MAK EROT YANG TERUJI DAN TERBUKTI

Dengan H. TEJA SAEFUL Cucu Asli Mak Erot Bersama

A. Ust OTONG

BILA anda ingin perkasa ingat jangan sampai salah masuk carilah yang benar-benar pewaris ilmu Mak Erot Sejati, karena keahlian H. Teja Saeful sudah tidak diragukan lagi dalam menangani keluhan seputar alat vital bahkan pengobatan H. Teja Saeful, sudah terkenal Indonesia dan kota-kota besar di Indonesia, sudah ribuan pasien tertolong dipengobatan Mak Erot ini yang aman tanpa efek samping, bahkan dimanca negara sekalipun pengobatan Mak ERot sudah tidak diragukan lagi keberhasilannya. INGAT untuk Kaum Pria jangan sampai Anda terhina Kaum wanita karena kondisi alat vital yang kurang sempurna Izin Dinkes No. 448 Hak Paten No. 00.2004.09965.10041 KONSULTASI UMUM: KHUSUS PRIA: - Buka Aura - Ejakulasi dini - Cari Jodoh - Impotensi - Sesama jenis - Memperbesar “Alvit” - Pelaris - Memperpanjang “Alvit” - Memikat lawan jenis - Keras dan tahan lama dll - Besar PYDR KHUSUS WANITA: - Ingin punya keturunan - Memperkencang & memperbesar payudara - Mengobati keputihan dll

DIJAMIN 100% Hanya Tempat Kami Klinik Mak Erot Jl. Laksana No. 55J masuk dari Jl. Amaliun Yuki Simpang Raya Medan (Praktek Tetap) HP. 0 8 1 2 . 4 0 3 8 . 3 3 3

KLINIK TRAPI ALAT VITAL MAK HJ. ICOT Ditangani langsung

H. UST. YUSUF/ H. ABIDIN

Setelah sukses di propinsi di Papua, kini hadir di kota Medan, pengobatan nyata luar biasa, bila anda ingin perkasa, ingat jangan salah informasi disini yang pasi ±30 menit kami akan buktikan alat vital menjadi besar dan perkasa. Dengan metode pengurutan disekitar alat vital melalui totok urat-urat kejantanan. Kami tidak mengumbar janji belaka. Tdk ada efek samping, bebas utk semua agama. Bukan janji tapi bukti ditempat Penanganan khusus pria: - Memperbesar, panjang, keras, kuat dan tahan lama - Kencing manis, diabetes, L. syahwat - Ejakulasi dini/ impotensi Khusus Wanita: - Memperbesar/ kencang payudara - Ingin punya keturunan/ gurah vagina - Ingin kembali perawan/ keputihan Konsultasi umum - Ajian semar mesem/ buka aura - Penglaris/ penghasihan/ cari jodoh - Pasang susuk, karir/ jabatan

DIJAMIN 100% Alamat Jl. Halat / Masuk Jl. Senam No. 19C. Belakang Makam Pahlawan H P. 0 8 2 1 . 6 6 5 5 . 1 2 2 2

AKTRIS peraih Piala Citra FFI 2009 lewat film Mereka Bilang, SayaMonyet -TitiSjuman,31 punyakiattersendiri terusmengasah kepiawaian berakting. Salah satunya, istri musisi Wong Aksan ini rajin membidik peran-peran menantang dalam film yang mengangkat cerita dari kearifan budaya lokal lengkap dengan keindahan alamnya. Setelah tahun lalu membintangi film Serdadu Kumbang mengeksplorasi alam Sumbawa yang eksotik, kini wanita juga piawai menabuh drum ini, siap berperan sebagai Pariban Anggiat dalam film mengenalkan budaya Batak berjudul Mursala besutan Sutradara Viva Westy. “Saya aslinya berdarah Minang. Nah, dengan memerankan perempuan Batak Tapanuli – selain wawasan saya tentang adat istiadat dan kearifan lokal suku lainnya bertambah, kepiawaian akting saya pun otomatis kian terasah dari waktu kewaktu,” papar Titi Sjuman kepada Waspada di Jakarta, baru-baru ini. Diakui wanita kelahiran Jakarta, 10 Februari 1981 ini, sempat mengalami sedikit kendala dalam berbicara dalam logat Batak. “Tapi, semua kendala tersebut segera teratasi berkat rasa penasaran dan rasa ingin tahu tinggi saya tentang tradisi Pariban yakni sepupu yang boleh dinikahi. Toh, meski saya bukan asli Tapanuli, tapi tutur bahasanya sudah tak asing lagi bagi saya. Bisa dibilang, gaya bahasanya sama dengan Minang, hanya dialeknya Batak,” kilah Titi Sjuman yang bakal beradu akting dengan aktor Rio DewantodansudahtaksabarmenikmatikeindahantanahTapanuli tempat lokasi syuting film Mursala, awal Maret 2012 mendatang. “Air Terjun Mursala pernah menjadi lokasi syuting film Hollywood - King Kong. Saya sudah tak sabar lagi berakting di sana sambil menikmati keindahan panorama alamnya,” tandas aktris pemeran utama wanita terbaik Indonesia Movie Awards 2011 ini. Film Mursala diproduksi RAJS Produktion mengisahkan hubungan antara sosok Anggiat (Rio Dewanto), Tiur dan Clarisa Turnip. Permasalahan muncul, karena perbedaan marga yang tidak memungkin mereka untuk menikah. Selain mengambil lokasi syuting di Tapanuli ada juga scene diambil di Jakarta. Jika semua proses produksi dan pascaproduksi berjalan dengan lancar bulan Mei 2012 film ini akan mulai tayang di bioskop seluruh Indonesia. * (AgusT)

Titi Sjuman


C8

Ekonomi & Bisnis

WASPADA Senin 13 Februari 2012

Jumlah Penerima Raskin Sumut Akan Berubah MEDAN (Waspada): Jumlah penerima dan harga raskin akan berubah menyusul perubahan data dari BPS hasil sensus terbaru dan kenaikan Harga Pembelian Pemerintah (HPP) terhadap gabah dan beras petani. Menurut informasi, Sabtu (11/2), sudah dapat dipastikan perubahan jumlah penerima raskin menyusul diberlakukannya data baru hasil sensus penduduk Badan Pusat Statistik (BPS). Sedangkan data yang dipergunakan saat ini merupakan hasil sensus lama. Selain perubahan jumlah penerima juga terjadi perubahan harga tebus raskin yang selama ini Rp1.600 per kg diperkirakan akan segera naik setelah pemerintah menaikkan HPP gabah dari harga patokan selama ini. Humas Perum Bulog Divre Sumut Rusli membenarkan kemungkinan terjadi perubahan jumlah keluarga penerima raskin karena pemerintah akan memberlakukan data baru hasil sensus penduduk dari BPS. Sedangkan perubahan harga tebus beras untuk keluarga miskin karena adanya usulan menaikkan HPP dari yang berlaku saat ini. Berapa besar perubahan itu akan dikeluarkan secara resmi dari pemerintah dalam waktu dekat, jelas Rusli. Namun diperkirakan hingga Mei pemerintah masih memberlakukan data lama dimana jumlah penduduk miskin Medan yang menerima raskin saat ini mencapai 79.136 Rumah Tangga Sasaran (RTS). Keluarga ini mendapat bantuan beras dari pemerintah setiap bulannya sebanyak 1.870 ton, dengan masing-masing keluarga mendapat raskin setiap bulannya Rp15 kg, dengan harga murah

Rp1.600 per kg. Berdasarkan data yang diumumkan BPS beberapa waktu lalu saat selesainya sensus penduduk memang terjadi perubahan mengarah penurunan jumlah keluarga miskin. Penurunan jumlah keluarga miskin ini merupakan dasar dari pemerintah untuk menetapkan jumlah penerima raskin. Dalam data BPS yang diumumkan secara resmi terlihat jumlah penduduk miskin di perkotaan Sumatera Utara bertambah 2.100 orang, di tengah golongan itu pada Maret 2011 mengalami penurunan menjadi 1.481.300 orang atau 11,33 persen dari jumlah penduduk provinsi tersebut. Kepala Badan Pusat Statistik (BPS) Sumut Suharno di Medan saat itu mengatakan posisi Maret 2010, jumlah penduduk miskin di daerah itu masih 1.490.900 orang atau 11,31 persen dari total jumlah penduduk, tetapi pada Maret 2011 berkurang 9.600 orang atau tinggal 1.481.300 orang. Meski berkurang, kata dia, jumlah penduduk miskin sebaliknya bertambah di perkotaan yakni sebanyak 2.100 orang atau menjadi 691.100 orang. “Dengan bertambahnya jumlah penduduk miskin di perkotaan membuat persentase jumlah golongan itu dengan di daerah pedesaan hampir berimbang, yakni 11,89 persen di pedesaan dan perkotaan 10,75 persen.’’ Dia menjelaskan, pada Maret 2011, garis kemiskinan Sumut sebesar Rp246.560 per kapita per bulan, untuk perkotaan Rp271.713 dan pedesaan Rp222.226 per kapita per bulan. (m35)

UMKM Tetap Kena Pajak SUKABUMI (Waspada): Direktorat Jenderal Pajak (DJP) akan terus mengusahakan agar kewajiban membayar pajak dapat mulai diterapkan kepada para pelaku Usaha Mikro, Kecil dan Menengah (UMKM). Direktur Jenderal Pajak Fuad Rahmany mengatakan, usulan tersebut diharapkan tidak diartikan secara negatif oleh kalangan pelaku usaha UMKM, lantaran prinsip dasar dari penerapan pajak tersebut justru menggunakan azas keadilan. “Banyak pihak menuding kami tidak berpihak terhadap pelaku UMKM. Dipikirnya, masak usaha kecil masih dikenai pajak juga. Tolonglah jangan dipersepsikan begitu. Kami tidak ada maksud lain selain masalah keadilan. Coba ditelaah kembali,” kata Fuad dalam media gathering di Lido Lakes Resort, Sukabumi Minggu (12/2). Menurut Fuad, karyawan pabrik dengan gaji Rp2,5 hingga Rp3 juta per bulan juga tak lepas dari pajak oleh perusahaannya. “Itu artinya gaji mereka Rp30 juta-Rp36 juta setahun. Padahal UMKM ada yang omsetnya Rp50-an juta per tahun, masak mereka dibebaskan dari pajak,” tambahnya Dengan pendekatan tersebut, pihaknya berharap seluruh wajib pajak yang berpeng-

hasilan di atas Penghasilan Tidak Kena Pajak (PTKP) diharuskan membayar pajak tanpa memilah-milah lagi jenis pekerjaan maupun usahanya. “Dalam draft usulan Ditjen Pajak yang kini masih dalam pembahasan, kami mengusulkan agar nilai pajak bagi UMKM dengan omzet Rp300 juta sampai Rp4,8 miliar adalah satu persen untuk Pajak Pertambahan Nilai (PPN) dan satu persen Pajak Penghasilan (PPh),” tegasnya. Sementara untuk pelaku UMKM yang beromset di bawah Rp300 juta akan dikenakan pajak 0,5 persen untuk Pajak Penghasilan (PPh) tanpa dikenai PPN. “Ini semua masih dibahas, jadi belum jadi keputusan. Tapi harapan kami bisa segera diterapkan.Kami juga sudah berikan berbagai fasilitas kemudahan untuk pajak UMKM. Diantaranya perhitungan nilai pajak yang tidak didasarkan pada keuntungan melainkan langsung secara garis besar dari omset tiap akhir tahun,” urainya. “Lalu juga pembayaran yang bisa dilakukan via ATM. Ke depan kami akan terus berusaha untuk memudahkan, toh ini untuk kepentingan kita bersama. Untuk pembangunan negara,” tambah Fuad. (okz)

Sidomuncul Kembali Raih Top Brand 2012 JAKARTA (Waspada): Bertempat di Hotel Mulia Jakarta, empat produk unggulan Sidomuncul yaitu Kuku Bima, Kuku Bima Energi, Tolak Angin dan Kopi Ginseng Kuku Bima (Kopi Tubruk) kembali meraih penghargaan Top Brand 2012. Produk tersebut telah meraih penghargaan Top Brand untuk kelima kalinya kecuali Kopi Ginseng Kuku Bima dari Majalah Marketing bekerjasama dengan Fronitier Consulting Group, pekan lalu. Waspada/Ist Masing-masing produk menerima penghargaan berdasar- SUASANA penerimaan Top Brand Award yang diterima oleh kan kategori ‘vitality enhancer perwakilan Sidomuncul pekan lalu. for man’, ‘energy drink powder’, ‘herbal medicine against cold’, dan‘ginseng coffee’. ekuitas yang tinggi bagi perusahaan, image dan Untuk Kopi Ginseng yang baru diluncurkan loyalitas jangka panjang. Merek terkuat adalah lima tahun lalu itu, penghargaan yang diterima merek yang mampu menempatkan diri pada ini untuk kedua kalinya. Produk ini telah posisi puncak. Banyak merek yang hanya kuat selama satu mendapatkan tempat dari konsumennya. Terbukti selama dua tahun telah mendapatkan sampai dua tahun pada posisi puncak, namun kemudian semakin melemah pada tahunpenghargaan Top Brand. Penghargaan diserahkan oleh PJ Rahmat tahun berikutnya. Kuku Bima, Kuku Bima EnerSusanta Pempimpin Umum Majalah Marketing gi dan Tolak Angin telah terbukti sebagai produk didampingi Handi Irawan D Chairman Fron- yang memiliki merek yang kuat dengan diteritier Consulting Group dan akan diterima oleh manya berbagai penghargaan dari tahun ke Linawati Suteja Group Product Manager Kuku tahun yaitu Merek Terpopuler, Indonesian CusBima, Retna Widawati Group Product Manager tomer Satisfaction Index (ICSA), Indonesian Tolak Angin, danYana Kusuma Anggraeni Hidayat Best Brand Award (IBBA), Golden Best Brand Award, Platinum Best Brand Award, The Word Product Manager Kopi Ginseng Kuku Bima. Top Brand Award sendiri merupakan peng- of Mouth Marketing (WOMM), Cakram Award, hargaan tertinggi di bidang merek dan hanya Marketing Award, The Indonesia Herbal Mediberikan kepada merek yang meraih posisi dicine Award, The Indonesian Original Brands puncak. Penghargaan diberikan berdasarkan Apreciation, dan Indonesia Most Popular Brand hasil riset nasional oleh Frontier Consulting In Social Media, dan Indonesian Original Brand Group di enam kota besar (Jakarta, Bandung, Apreciation. Penghargaan ini dapat menjadi tolak ukur Semarang, Surabaya, Medan dan Makassar) dengan melibatkan 3600 responden, menggu- bagi Sidomuncul dalam menjaga kualitas pronakan metodologi pengumpulan data yang duk dan melakukan inovasi untuk pengembadilakukan adalah wawancara langsung (face ngan produk. Tahun lalu Sidomuncul baru saja meluncurto face interview) dengan menggunakan kuesioner sebagai instrumen pengumpulan data. kan produk terbaru Alang Sari Plus dengan dua Merek menjadi salah satu kekuatan perusa- rasa yaitu jeruk manis dan jeruk nipis dan mehaan terbesar saat ini. Merek bukan hanya ngeluarkan varian dari Kopi Ginseng yaitu kopi sekadar identitas tetapi mampu menciptakan jahe ginseng RG (rendah gula).(rel)

Selat Hormuz Ditutup, Pertamax Bisa Rp15.000 Per Liter JAKARTA (Waspada): Jika Iran benar-benar memblokade Selat Hormuz maka seperlima suplai Bahan Bakar Minyak (BBM) dalam negeri akan terganggu. “Hampir semua ahli minyak di Dunia memberikan asumsi, jika Selat Hormuz tidak apa-apa, maka harga sepanjang 2012 akan tetap 110 dolar AS per barel. Apalagi jika Selat Hormuz terjadi apa-apa maka akan melejitlah subsidi BBM,” ungkap Pengamat Perminyakan Kurtubi yang ditemui dalam acara seminar “Opsi dan Harga BBM” di Gedung DPD RI, Jakarta akhir pekan lalu. Menurutnya, kenaikan harga minyak kemungkinan tipis dan tidak signifikan selama selat Hormuz belum diblok. “Ancam-mengan-

cam antara Iran dan Amerika Serikat (AS) itu yang menaikkan dikit, Eropa krisis, demand tetap tumbuh, tambahan ini yang direspon dari pasar,” tegasnya. Sementara untuk pasar dalam negeri, Kurtubi mengungkapkan adanya potensi penuunan lifting jika memang Selat Hormuz diblokade. Hal ini dikarenakan kilang Cilacap milik Pertamina mengolah banyak minyak mentah dari Timur Tengah. “Kalau tidak ada minyak dari Timur Tengah maka operasi akan down. Bisa kemungkinan seperlima atau sepertiga dari sulai BBM dalam negeri tidak ada, maka akan terjadi antrian dimana-mana,” katanya. (vvn)

Waspada/Sugiarto

DIREKTUR Utama Bank Sumut Gus Irawan Pasaribu (kiri) saat melakukan dialog dalam acara talk show Gebyar Perbankan Syariah di Masjid Agung Medan, Minggu (12/2).

Market Bank Syariah Masih Kecil MEDAN (Waspada): Pimpinan Bank Indonesia Medan Nasser Atorf menyebutkan, market (pasar) bank syariah di Sumatera Utara dinilai masih terlalu kecil jika dibandingkan dengan bank konvensional. Padahal, masyarakat Sumut didominasi umat Islam yang berpotensi mengembangkan ekonomi syariah. “Pasar bank syariah masih relatif kecil bila dibandingkan dengan bank konvensional,” kata Nasser Atorf dalam acara talk show Gebyar Perbankan Syariah yang digelar BI bekerjasama dengan Asosiasi Bank Syariah Indonesia (Asbisindo), di Masjid Agung Medan, Minggu (12/2). Dalam talk show yang diikuti ratusan peserta yang sebelumnya mengikuti zikir dan tausyiah tersebut, juga menghadirkan narasumber Direktur Utama Bank Sumut Gus Irawan Pasaribu, dari Bank Muamalat Chairul Fattah dan Prof Amiur Nurudin selaku pakar ekonomi syariah dari Institut Agama Islam Negeri (IAIN) Sumut.

Nasser menyebutkan dalam kegiatan Gebyar Perbankan Syariah yang digelar Asbisindo bekerjasama dengan BI tersebut, berlangsung selama tiga hari untuk melakukan sosialisasi, edukasi, perbankan syariah kepada masyarakat. “Di bank syariah tidak mengenal bunga, namun ada bagi hasil. Harapan saya ibu-ibu anggota majelis memiliki tabungan di bank syariah dengan berbagai produk yang ditawarkan,” ujarnya. Berdasarkan data yang dikeluarkan BI Regional SumutAceh, aset perbankan di Sumut sebesar Rp160,05 triliun dimana Rp153,41 triliun merupakan aset bank konvensional sedangkan aset bank sya-

KPK Berikan Pencerahan Peserta Radin Pelindo I MEDAN (Waspada): Petugas Direktorat Pendidikan dan Pelayanan Masyarakat Komisi Pemberantasan Korupsi (KPK) melakukan pencerahan kepada peserta Rapat Dinas (Radin) 2012 PT Pelabuhan Indononesia I (Persero), BUMN yang mengoperasikan 24 pelabuhan umum di Aceh, Sumut, Riau Dan Kepulauan Riau. Humas PT Pelabuhan Indonesia I (Pelindo) M Taufik Fadillah menjelaskan, Radin berlangsung tiga hari berakhir Sabtu (11/2). Petugas KPK Erif Hilmi saat itu memberikan pencerahan kepada peserta Radin yang merupakan Pejabat Struktural Pelindo I Kantor Pusat dan para pimpinan seluruh cabang pelabuhan yang berada di empat provinsi serta ibuibu Perispindo. Taufik menjelaskan rapat dinas ini bertujuan memantapkan kebijakan, strategi dan program yang sudah disahkan pada RKAP 2012 sehingga dapat diimplementasikan secara cepat dan tepat. Rapat Dinas dipimpin Direktur Utama Pelindo I Alfred Natsir yang menjelaskan Radin ini untuk menyatukan kesamaan pandangan dan sikap manajemen dalam merealisasikan RKAP 2012 yang telah disahkan, serta menguatkan komitmen bersama dalam melaksanakannya. Sesuai kesepakatan Direksi, Rapat Dinas ini bertema spirit kebersamaan melalui kerja keras dan kreatifitas, kita lampaui target laba RKAP tahun 2012 dan mewujudkan pelayanan yang prima. “Tema ini bukan sekadar penghias backdrop di belakang saya ini, namun semangat dari tema ini harus menginternalisasi dalam setiap jiwa insan Pelindo I. Kita bangun teamwork yang kuat, sikap kreatif dan inovatif dalam mengembangkan bisnis perusahaan, kita berikan pelayanan terbaik yang melampaui harapan pelanggan dan akhirnya kita akan berhasil melampaui target RKAP 2012 yang telah ditetapkan,” tegas Alfred memberi semangat. Alfred mengingatkan ancaman bila perusahaan terus merosot bisa saja ada rasionalisasi berupa pengurangan pegawai, bonus menurun bahkan bisa hilang, kesulitan membayar gaji bulanan dan pada akhirnya akan menurunkan kesejahteraan pegawai dan dampak bagi perusahaan adalah citra negatif perusahaan. “Kita bekerja untuk perusahaan, karena perusahaan ini menghidupi kita dan keluarga kita. Bila kita memberikan yang terbaik untuk perusahaan, maka perusahaan akan memberi yang baik juga untuk kita,” tutur Alfred. Alfred sengaja mengundang ibu-ibu Perispindo untuk turut hadir dalam acara tersebut. Menurutnya, para ibu Perispindo perlu mengetahui kondisi dan perkembangan perusahaan. “Ibu-ibu mempunyai peran yang besar dalam mendukung kemajuan perusahaan melalui penciptaan keluarga harmonis di rumah masing-masing sehingga menciptakan suasana hati yang nyaman para suaminya ketika bekerja. Serta jangan lupa untuk senantiasa mendoakan perusahaan, pengelola perusahaan dan seluruh karyawan agar perusahaan terus tumbuh,” pinta Alfred. Setelah rapat, para peserta diajak outbond yang dipandu instruktur dari Jakarta Parlindungan Marpaung. Permainan dalam outbond nantinya ditujukan untuk membangun kebersamaan (teamwork), motivasi, kepercayaan diri, kreativitas, tanggung jawab, komunikasi, rasa saling percaya, dll yang dilakukan secara fun dan menyenangkan. Diharapkan dengan outbond ini, nilai-nilai tersebut mampu menginternalisasi pada setiap peserta sehingga muncul antusiasme dalam mencapai bahkan melampaui target yang telah ditetapkan di tahun ini.(m35)

riah hanya Rp6,64 triliun. Sedangkan dana pihak ketiga (DPK) yang berhasil dihimpun bank syariah hanya Rp4,48 triliun, sangat kecil jika dibandingkan dengan bank konvensional yang mencapai Rp122,92 triliun. Pada kesempatan itu, Ketua Masyarakat Ekonomi Syariah (MES) Sumut Gus Irawan Pasaribu mengatakan ekonomi syariah salah satu sistem perekonomian yang mampu bertahan terhadap krisis ekonomi dan bisa menjadi solusi untuk membuat perekonomian global, perekonomian Indonesia, perekonomian Sumatera Utara akan terjaga dengan baik dan tidak akan terjadi krisis. “Sejarah membuktikan perbankan syariah mampu bertahan di kala krisis. Syariah itu pokoknya saling mendoakan dan ekonomi syariah menjadi solusi bagi berbagai permasalahan perekonomian global,” kata Gus Irawan.

Pada kesempatan itu, Gus Irawan mengajak masyarakat umat Islam bergabung dengan perbankan syariah sebagai upaya membangun perekonomian Sumatera Utara dan nasional tahan terhadap krisis ekonomi. “Karena, kita sebagai umat muslim-lah yang seharusnya berada di garda terdepan dalam pengembangan ekonomi syariah ini,” ujarnya. Hal senada juga disampaikan Chairul Fattah dari Bank Muamalat Medan yang menyebutkan bank syariah lebih tahan terhadap krisis ekonomi, karena bank syariah tidak mengenal negative spread. “Bank syariah mengenal prinsip jual beli dan bagi hasil. Jika pendapatan debitur menurun maka bagi hasil kepada pemilik uang juga lebih kecil, demikian pula sebaliknya,” ujarnya. Mengenai deposito yang ada di Bank Syariah , Chairul Fattah mengatakan, deposito tabungan merupakan mediasi

simpanan yang dikeluarkan oleh bank syariah seperti Muamalat itu berbeda dengan deposito di bank konvensional. “Deposito di bank syariah tidak memberikan bunga tapi bagi hasil dari pengelolaan dana-dana masyarakat yang dikumpulkan bank syariah, kemudian ada pendapatannya itulah yang dibagi kepada pemilik dana yang ada di bank syariah,” ujarnya. Pada kesempatan itu, Prof Amiur Nurudin menegaskan dalam melakukan aktivitas ekonomi jangan lupa untuk selalu ingat kepada Allah dan mengikuti prinsip-prinsip yang dijalankan Rasulullah Muhammad SAW. “Rasulullah SAW dulunya adalah pengusaha yang hidupnya kalau tidak di masjid ya di pasar. Orang-orang yang berdagang di pasar itu mengikuti sunnah Rasul dan mengikuti prinsipprinsip yang dijalankan Rasul, jujur dan amanah,” ujarnya. (m41)

Kisruh FLPP Disepakati 7 Persen JAKARTA (Waspada): Kisruh suku bunga Fasilitas Likuiditas Pembiayaan Perumahan (FLPP) diperkirakan akan menemui titik temu di level tujuh persen, setelah Menteri Perumahan Rakyat (Menpera) Djan Faridz memahami adanya biaya tambahan terutama untuk asuransi. “Karena ada biaya tambahan, jadi bisa berkisar tujuh persen,” ungkap Djan Faridz di Jakarta, akhir pekan lalu. Pada perjanjian pertama sejak 2009-2011, suku bunga Kredit Pemilikan Rumah (KPR) bersubsidi skema FLPP disepati 8,15 persen. Kemudian Menpera ingin diperjanjian yang baru tahun ini KPR FLPP turun berkisar lima persen-enam persen. Bunga FLPP sekitar tujuh persen tersebut sesuai dengan keinginan Bank Tabungan Negara (BTN) sebagai bank penyalur kredit FLPP terbesar, yang berarti skema dana penyertaan pemerintah di bank

dengan komposisi baru 50:50. Pada tahun sebelumnya, komposisi antara pemerintah dengan bank penyalur FLPP 60:40. Djan optimis persoalan bunga FLPP akan menemukan titik temu dalam pembahasan berikut dengan bankbank penyalur. “Bank penyalur pasti akan mengikuti keinginan kementeriannya dalam penetapan bunga. Untuk negosiasi bunga FLPP sendiri lebih murah akan menguntungkan masyarakat karena ada pengurangan biaya angsuran dan biaya yang timbul atas KPR,” paparnya. Direktur Konsumer dan Ritel Bank Negara Indonesia (BNK) Tbk, Darmadi Sutanto menyatakan kredit FLPP diturunkan menjadi lima persen-enam persen sulit dilaksanakan. “Setidaknya untuk kredit FLPP di kisaran tujuh persen,” katanya di sela peluncuran kartu kredit Affinity BNIILUNI FE UI di kantor pusat

BNI. BNI sebagai bank komersial (go public), lanjut Darmadi, dituntut harus memberikan keuntungan bagi pemegang sahamnya. “Tapi kita pasti dukung program rumah rakyat ini. Dan saya yakin, persoalan bunga FLPP ini nanti bisa tercapai titik temunya,” tuturnya optimis. Dalam skema FLPP bank harus memperhitungkan risiko kredit, diantaranya biaya dana 4,14 persen, giro wajib minimum 0,41 persen, biaya overhead 1,5 persen, biaya risiko 0,3 persen, biaya premi asuransi 0,37 persen, dan profit 1,5 persen. Dari komposisi tersebut, maka masyarakat berpenghasilan rendah (MBR) harus mencicil KPR FLPP sebesar Rp893 ribu selama 15 tahun. Cicilan ini didasarkan atas perhitungan harga rumah Rp80 juta, dengan uang muka 10 persen dan nilai KPR (loan to value) Rp72 juta. (j03)

Pertanian, Ekonomi Dan Industri Konsentrasi Pertaki PAKPAK BHARAT (Waspada): Gerakan Bangkit Pertaki (Pertanian Tangguh Agribisnis, Komersial dan Industri) yang sedang digerakkan Pemkab Pakpak Bharat di bawah kepemimpinan Remigo Yolando Berutu, sebagai Bupati Kab. Pakpak Bharat hingga tiga tahun ke depan memiliki konsentrasi program pada sektor pertanian, ekonomi dan industri. Hal tersebut disampaikannya pada acara sosialisasi Bangkit Pertaki yang dilaksanakan di Singgabur Kecamatan Sitellu Tali Urang Julu (STTU JULU) Kabupaten Pakpak Bharat, Jumat (10/2). Setelah Kecamatan Tinada, Siempat Rube dan Singga-

bur STTU JULU Bupati Pakpak Bharat bersama Wakil Bupati Maju Ilyas Padang beserta jajarannya terus mensosialisasikan Bangkit Pertaki dengan harapan di bawah kepemimpinanya Kabupaten Pakpak Bharat maju meninggalkan ketertinggalan. Selain upaya peningkatan pembangunan infrastruktur dengan bantuan dana pemerintah pusat, Remigo Yolando Berutu juga menyampaikan akan terus melakukan upaya lain dengan memastikan sumber daya manusia aparatur akan mampu melaksanakan amanat Pemekaran Kabupaten Pakpak Bharat delapan tahun yang lalu. “Kita harus bangkit dari segala ketertinggalan dan ke-

terbatasan kita secara signifikan, jauhkan segala Duhul (red-sifat negatif masyarakat lokal) terutama dari aparatur pemerintahan Pakpak Bharat,” tegasnya. Dia katakan lagi konsep Bangkit Pertaki tidak akan pernah tercapai dan hanya sebatas wacana jika tanpa dukungan dan kerja keras semua pihak. Sekaitan itu seluruh komponen masyarakat Pakpak Bharat harus benar-benar memahami dan melakukan seluruh konsep itu sehingga pertumbuhan maupun kemajuan daerah yang hendak dicapai dapat terlaksana secara nyata dan merata di wilayah kabupaten Pakpak Bharat. (csb)

Waspada, Senin 13 Februari 2012  

waspada daily

Read more
Read more
Similar to
Popular now
Just for you