Page 1

Berastagi 18-280C

Stabat 24-330C

Kisaran 24-330C

Binjai 24-340C

T. Tinggi 24-330C Hujan guntur

Berawan

WASPADA Demi Kebenaran Dan Keadilan

Prakiraan Cuaca Selasa Medan 24-340C

BMKG Polonia

http://epaper.waspadamedan.com

SELASA, Pahing, 28 Juni 2011/26 Rajab 1432 H

No: 23551 Tahun Ke-65

Harian Umum Nasional Terbit Sejak 11 Januari 1947 Pendiri : H. Mohd. Said (1905 - 1995) Hj. Ani Idrus (1918 - 1999) ISSN: 0215-3017

Terbit 24 Halaman (A1-8, B1-8, C1-8)

Harga Eceran: Rp2.500,-

Empat Lagi Korban Aek Latong Ditemukan

Balai Jalan Nasional Tak Peduli Kondisi Aek Latong

Polisi Buron Supir

MEDAN (Waspada): DPRD Sumatera Utara mengecam Balai Jalan Nasional yang tidak perduli dengan kondisi jalan di Aek Latong, Sipirok, Kab. Tapanuli Selatan. Padahal sudah banyak korban di sana akibat kerusakan jalan.Termasuk korban tewas kecelakaan bus ALS. Hal itu diungkapkan beberapa anggota Komisi D DPRD Sumut, Senin (276), terkait kondisi jalan Aek Latong dan kecelakaan bus Antar Lintas Sumatera (ALS), yang masuk ke telaga air di sana. Kalangan anggota dewan, adalah Ajib Shah, Palar Nainggolan, Jamaluddin Hasibuan dan Jhon Hugo Silalahi. Disebutkan Jamaluddin Hasibuan, faktor terbesar dari kecelakaan bus ALS karena kondisi jalan di Aek Latong, yang sangat parah. ‘’ Balai Jalan Nasional sebagai perwakilan pemerintah pusat sangat tidak perduli dengan kondisi jalan di kawasan Aek Latong itu,’’ katanya. DPRD Sumut, imbuhnya, berulang kali meminta kepada Balai Jalan Nasional, untuk memperbaiki jalan yang sudah rusak sejak belasan tahun lalu itu. ‘’Faktanya, permintaan itu tidak pernah disahuti,’’ kata Jamaluddin Hasibuan.

SIPIROK (Waspada): Tim pencari korban kecelakaan bus ALS yang terbenam di telaga Aek Latong, Kec Sipirok, Kab Tapanuli Selatan, kembali menemukan 4 korban tewas dari dalam bus, Minggu malam hingga Senin (27/6) siang. Penemuan para korban tersebut menambah jumlah korban tewas dari 14 orang menjadi 19 orang tewas. Sementara seorang lagi korban bernama Sri Rahayu, 30, warga Lubukpakam, Kab. Deliserdang, hingga Senin sore, belum ditemukan. Sedangkan bus ALS BK 7088 DL yang jatuh ke telaga air Aek Latong sedalam lebih 3 meter telah dievakuasi ke badan jalan sekitar pukul 16:00. Setelah diperiksa, korban ke-19, Sri Rahayu, tidak ditemukan. Sri diperkirakan masih berada di dasar telaga itu. Evakuasi bus tersebut disaksikan Plt Gubernur Sumatera Utara, Gatot Pudjonugroho, yang singgah di lokasi usai menemui korban gempa bumi di Pahae, Kab. Tapanuli Utara. Pantauan Waspada, Senin (27/6) pukul 19:30, tim karyawan PT ALS, personil Polres Tapsel, dan keluarga korban, Lanjut ke hal A2 kol. 1

Waspada/Sukri Falah

SUASANA evakuasi bus ALS dari telaga Aek Latong, Kec. Sipirok, Kab. Tapanuli Selatan, Senin (27/6). Beberapa petugas menarik korban dari dalam telaga.

Lanjut ke hal A2 kol. 1

5 Perambah TNGL Tertembak BESITANG (Waspada): Upaya relokasi dan okupasi oleh Balai Besar Taman Nasional Gunung Leuser (BB TNGL) bersama TNI/Polri terhadap perambah hutan TNGL SPTN IV Besitang, Resort Sekoci, Senin (27/6) berujung bentrok. Lima dari perambah tertembak dan dua polisi terkena lemparan batu.

Bentrok Dengan Aparat Saat Okupasi Untuk mengantisipasi agar tidak jatuh korban lebih banyak, 1.070 personil TNI/Polri dari satuan Yonif-8 Marinir Tangkahan Lagan, Raider 100, Brimobdasu, Satuan Polisi

Reaksi Cepat (SPORC), Kodim 0203 Langkat, dan personil dari Polres Langkat ditarik mundur. Korban yang terkena tembakan, Ismuddin Simbolon,

47, terkena tembakan di bagian paha kanan hingga tembus, Boisanto, 42, terkena pada bagian punggung, Supandi, 16, pelajar kelas II SMA itu terkena tembakan bagian dada kiri,

Aris Siregar, 37, peluru masih bersarang di kaki kiri, Lasimun, 50, luka tembak pada punggung bagian kanan. Sementara, yang menderita memar, Ngatiman, 50,

Muhammadiyah: 1 Agustus Awal Ramadhan SURABAYA (Waspada): Pengurus Wilayah Muhammadiyah Jawa Timur menentukan 1 Ramadhan 1432 Hijriah jatuh pada Senin 1 Agustus 2011 berdasarkan hasil musyawarah ahli hisyam Majelis Tarjih, PWM Jawa Timur. “Dengan menggunakan metode hisab hakiki maka 1 Ramadhan jatuh pada 1 Agustus mendatang,” kata Sekretaris PWM Jatim Nadjib Hamid, Senin (27/6). Nadjib menjelaskan, penentuan tersebut diperoleh setelah melakukan penghitungan dengan sistem hisab hakiki di Markas Tanjung Kodok, Lamongan, Jawa Timur. Dari perhitungan itu diperoleh bahwa akhir dari bulan Sya’ban 1432 Hijriah jatuh pada 31 Juli 2011 pada pukul 01, 39 menit 42 detik (01:39:42) sampai dengan pukul 01:41:09. “Saat matahari terbenam pada pukul 17:31:51, hilal sudah wujud 7 derajat 7 menit 36 detik sampai dengan 7 derajat 16 menit. Dapat disimpulkan 1 Ramadhan adalah 1 Agustus.” (okz)

Pembantaran Syamsul Arifin Diperpanjang Dua Minggu JAKARTA (Waspada): Pembantaran penahanan Gubsu Nonaktif Syamsul Arifin diperpanjang dua minggu, menyusul kondisi kesehatannya yang terlihat mulai membaik. Mantan Bupati Langkat inipun mulai dibesuk para keluarga dan sahabatnya. Sejak dipindahkan dari RS Jantung Harapan Kita ke RS Abdi Waluyo, kesehatan Syamsul Arifin mulai membaik meski belum diperoleh keterangan dari tim dokter tentang kondisi beliau. Sementara, kuasa hukum terdakwa masih memerlukan kelanjutan pembantaran yang seharusnya berakhir Minggu (26/6), mohon diperpanjang sampai Minggu (10/7). Hal ini guna kesembuhan yang lebih sempurna agar Syamsul Arifin dapat melanjutkan proses persidangan. Syamsul Arifin yang dibawa dari Rutan Salemba, Jumat (27/5) dengan kondisi kritis ke RS Harapan Kita dipindahkan ke RS Abdi Waluyo pada Kamis (9/6). Kuasa hukum Syamsul Arifin, Abdul Hakim Siagian SH, M.Hum mengatakan, secara kasat mata ada peningkatan kesembuhan tetapi belum bisa disimpulkan kondisi kesehatannya benar-benar sudah membaik atau belum. Hakim menyebutkan, pihaknya memerlukan medical record dari dokter ahli RS Abdi Waluyo untuk disampaikan kepada Majelis Hakim perkara APBD Pemkab Langkat di Peradilan Lanjut ke hal A2 kol. 6

Riadi, 61, Purmanta, 38. Para korban kini telah dievakuasi warga ke RSU PT Pertamina (Persero) P. Brandan untuk mendapatkan perawatan medis. Suasana di RS sampai menjelang malam tampak ramai dikujungi para keluarga korban. Pantauan Waspada yang turun langsung ke lapangan,

reaksi penentangan kelompok perambah sudah mulai kelihatan ketika aparat khususnya dari SPORC turun ke kawasan mencabuti pohon rambung yang baru ditanam di areal hutan eks rambahan yang pernah dieksekusi pada Operasi Hutan Lestaria II tahun 2007. Lanjut ke hal A2 kol. 6

Hari Ini, 113.639 Warga T. Tinggi Ikuti Pilkada Ulang

Waspada/Asrirrais

APARAT TNI/Polri dan SPORC yang hendak melakukan okupasi dan relokasi para perambah di TNGL terpaksa ditarik mundur untuk menghindari jatuhnya korban lebih banyak lagi.

Waspada/Asrirrais

ISMANUDDIN Simbolon, 47, perambah yang tertembak peluru aparat sedang dirawat di RSU PT Pertamina P. Brandan, Senin (27/6).

Rp100 Miliar Untuk Satgas TKI JAKARTA (Waspada): Menteri Tenaga Kerja dan Transmigrasi Muhaimin Iskandar mengatakan, pemerintah mengeluarkan dana Rp100 miliar untuk biaya operasional Satuan Tugas (Satgas) khusus yang akan menangani berbagai permasalahan tenaga kerja di luar negeri. Pembentukan Satgas

dipimpin Kementerian Tenaga Kerja dan Transmirasi, Kementerian Luar Negeri dan BNP2TKI ini, menindaklanjuti Presiden Susilo Bambang Yudhoyono, Rabu (24/6), merespon kasus 23 TKI yang saat ini terancam hukuman mati di Arab Saudi. “Nanti juga ada dari Kementerian Luar Negeri dan Kementerian Hukum dan HAM.

Ini semua sudah dimaksimalkan dan dihematkan. Dari tempat saya sebesar Rp 100 miliar,” ujar Muhaimin kepada wartawan di Kantor Badan Penempatan dan Perlindungan Tenaga Kerja Indonesia (BNP2TKI), Jakarta, Senin (27/6). Seperti diberitakan sebelumnya, dalam rapat konsultasi dengan Pimpinan DPR RI

Firasat Buruk Sudah Ada

LENTERA

Wali Negeri Menganiaya Oleh: Syahruddin Siregar DI ANTARA pejabat ada yang dengan mudah marah dan menyalahkan orang lain walaupun sebenarnya yang dipersalahkannya itu belum tentu salah. Parahnya lagi, pejabat tersebut bukan sekadar menuduh seseorang itu bersalah, bahkan ada yang sampai menganiayanya tanpa tahu juntrung kesalahannya. Jika yang dianiaya tanpa kesalahan itu hanya terluka, itu pun sudah dianggap biadab, apalagi yang teraniaya itu sampai tewas. Lanjut ke hal A2 kol. 6

Waspada/Hamdani

JENAZAH Desi indriani, 30,Yuni Cipiani, 9, Rendy, 5, dan Dimas, 3, korban kecelakaan bus di Aek Latong dikebumikan satu liang lahat di Perkuburan Pasar IV, Kec. Medan Denai, Senin.

PRIA itu tenggelam dalam suasana duka yang menghampakan hatinya dan memuramkan wajahnya. Hilir mudik para pelayat juga tak menghibur, tapi dia tetap menyambut tamu dengan tangan terbuka di kediaman Jl. Datuk Kabu Pasar III Tembung, Deliserdang. Kaki tak bertiang lagi, lutut lemas tak tertahankan. Dia mencoba bertahan melihat mayat istri dan tiga anaknya hingga akhirnya tersungkur dengan tangis menyesal.Seharusnya dia mengajak istri dan anaknya turun dari bus naas itu. Dia adalah Ciping, 30, salah satu penumpang yang turun dan selamat dari bus yang terjun ke telaga di Aek Latong. Badan Bus ALS bernomor polisi BK 7088 DL tenggelam di telaga setelah gagal menanjak di kawasan tebing Aek Latong Sipirok sekira pukul 03:00. Dia kehilangan istri dan tiga anaknya yang tak turun karena mengeluh kecapekan. Mereka adalah Desi, 30, Yuni, 9, Rendi,5, Dimas, 3. Lanjut ke hal A2 kol. 3

itu, Presiden Susilo Bambang Yudhoyono mengatakan, pembentukan Satgas khusus itu, dimaksudkan untuk menangani dan membela para warga negara Indonesia yang terancam hukuman mati di luar negeri. Saat ini, empat negara tujuan utama adalah Malaysia, Arab Saudi, China, dan Singapura. (kps)

TEBINGTINGGI (Waspada): 113.639 Pemilih dari 145 ribu penduduk Kota Tebingtinggi menggunakan hak pilihnya dalam pemungutan suara ulang pemilihan kepala daerah (Pilkada) yang digelar Selasa (28/6). Mereka akan memilih satu dari lima pasangan yang akan memimpin Tebingtinggi lima tahun ke depan, dan akan mencoblos pasangan yang mereka pilih di 374 tempat pemungutan suara (TPS). Ketua KPUD Tebingtinggi Wal Ashri, Senin (27/6) mengatakan, semua fasilitas untuk pencoblosan telah dipersiapkan, demikian pula dengan petugas pelaksana mulai dari PPK, KPPS hingga TPS di kelurahan. Surat suara yang didistribusikan 113.639 eksemplar ditambah 2,5 persen surat suara cadangan. Dengan jumlah itu, nantinya di setiap TPS akan ada dua hingga tiga eksemplar surat suara cadangan. Data di Humas KPUD

Richard Gere Ditawari Jadi Duta Wisata Indonesia MAGELANG (Waspada): Kementerian Kebudayaan dan Pariwisata saat ini menawarkan kesempatan kepada bintang Hollywood, Richard Gere, untuk menjadi duta wisata Indonesia. Sebagai seorang public figure , keterlibatan Gere diharapkan dapat meningkatkan gairah berwis ata ke Indonesia seperti yang telah dilakukan dua tokoh internasional yang telah ditunjuk sebagai duta wisata Indonesia, pendiri dan direktur utama perusahaan Microsoft, Bill Gates dan tokoh marketing dunia, Phillip Kotler. Lanjut ke hal A2 kol. 1

Tebingtinggi, untuk Kec. Rambutan jumlah suara keseluruhan 23.016 pemilih, Padang Hilir 23.130, Padang Hulu 21.179, T.Tinggi Kota 21.191 dan Bajenis 25.123 pemilih. TPS yang digunakan yakni di Kec. Rambutan 79 TPS, di Kec. Padang Hilir ada 75 TPS, di Kec. Padang Hulu 68 TPS, di Kec. Tebingtinggi Kota 78 TPS dan di Bajenis 81 TPS. Sejumlah kandidat calon walikota tidak ikut mencoblos, karena bukan warga asli Tebingtinggi. (a09)

Ada-ada Saja

ASI Bermorfin Karena banyak mengkonsumsi obat penenang, ASI wanita asal AS ini mengandung morfin dengan kadar tinggi. Akibat kebiasaannya mengkonsumi obat-obat terlarang ini, seorang bayi perempuan dilaporkan tewas karena minum air susu ibu (ASI) yang mengandung narkotika jenis morfin. Hal ini dikatakan pejabat berwenang Amerika Serikat, yang memastikan kematian bocah malang itu akibat morfin yang ada dalam ASI si ibu. Stephanie Greene, 37, pada Jumat lalu, didakwa dengan kasus pembunuhan atas tuduhan telah melakukan tindak kekerasan terhadap bayinya hingga tewas. Lanjut ke hal A2 kol. 3

erampang Seramp ang Antara

BINTANG film Hollywood Richard Gere berdialog dengan istrinya Carey Lowell usai melakukan meditasi di candi Borobudur, Magelang, Jateng, Senin (27/6).

- Danau Toba tidak kalah cantiknya, sir - He...he...he...


WASPADA Demi Kebenaran Dan Keadilan

Harian Umum Nasional Terbit Sejak 11 Januari 1947 Pendiri : H. Mohd. Said (1905 - 1995) Hj. Ani Idrus (1918 - 1999) ISSN: 0215-3017

http://epaper.waspadamedan.com

SELASA, Pahing, 28 Juni 2011/26 Rajab 1432 H z No: 23551 * Tahun Ke-65

Terbit 24 Halaman (A1-8, B1-8, C1-8) z zHarga Eceran: Rp 2.500,-

Waspada/Abdul Hakim

Tiga personel Polres Langkat dirawat di RSU Insani Stabat akibat menderita luka terkena lemparan batu saat relokasi ribuan warga dari kawasan TNGL Besitang Kab. Langkat berlangsung Senin (27/6).

Waspada/Abdul Hakim

Ismanuddin Simbolon, 47, perambah yang tertembak peluru aparat sedang dirawak di RSU PT Pertamina P.Brandan Aparat TNI/Polri dan SPORC yang hendak melakukan okupasi dan relokasi para perambah di TNGL terpaksa ditarik mundur untuk menghindari jatuhnya korban lebih banyak lagi. Gambar direkam, Senin (27/6)

Perambah TNGL Bentrok Dengan Aparat

Waspada/Abdul Hakim

Korban Aek Latong 19 Tewas Satu Belum Ditemukan Plt Gubsu Tinjau Lokasi

SIPIROK (Waspada): Tim pencari korban kecelakaan bus ALS yang terbenam di telaga Aek Latong, Kec Sipirok, Kab Tapanuli Selatan, kembali menemukan 4 korban tewas dari

dalam bus, Minggu (27/6) malam hingga Senin (27/6) siang. Penemuan para korban tersebut menambah jumlah korban tewas dari 14 orang Lanjut ke hal A2 kol 5

BESITANG (Waspada): Upaya relokasi dan okupasi oleh BB TNGL bersama TNI/Polri terhadap perambah hutan TNGL SPTN IV Besitang, Resort Sekoci, Senin (27/6) berujung bentrok. Lima dari perambah tertembak dan dua polisi terkena lemparan batu. Untuk mengantisipasi agar tidak jatuh korban lebih banyak, 1.070 personil TNI/Polri dari satuan Yonif-8 Marinir Tangkahan Lagan, Raider 100, Brimobdasu, Satuan Polisi Reaksi Cepat (SPORC), Kodim 0203 Langkat, dan personil dari Polres Langkat ditarik mundur. Korban yang terkena tembakan, Ismuddin Simbolon, 47, terkena tembakan di bagian paha kanan hingga tembus, Boisanto, 42, terkena pada bagian punggung, Supandi, 16, pelajar kelas II SMA itu terkena tembakan bagian dada kiri, Aris Siregar, 37, peluruh masih bersarang di kaki kiri, Lasimun, 50, luka tembak pada punggung bagian kanan. Sementara, yang menderita memar, Ngatiman, 50,

Riadi, 61, Purmanta, 38. Para korban kini telah dievakuasi warga ke RSU PT Pertamina (Persero) P.Brandan untuk mendapatkan perawatan medis. Suasana di RS sampai menjelang malam tampak ramai dikujungi para keluarga korban. Pantauan Waspada yang turun langsung ke lapangan, reaksi penentangan kelompok perambah sudah mulai kelihatan ketika aparat khususnya dari SPORC turun ke kawasan mencabuti pohon rambung yang baru ditanam di areal hutan eks rambahan yang per nah dieksekusi pada Operasi Hutan Lestaria II tahun 2007.

MUI: Orang Mampu Pakai Premium Hukumnya Dosa JAKARTA (Antara): Majelis Ulama Indonesia (MUI) berpendapat, masyarakat golongan mampu yang memakai premium merupakan perbuatan dosa. Ketua MUI Makruf Amien usai bertemu Menteri ESDM Darwin Saleh di Jakarta, Senin

(27/6)mengatakan, produk premium yang mendapat subsidi negara merupakan hak masyarakat tidak mampu. “Jadi, kalau masyarakat mampu memakai Lanjut ke hal A2 kol 3

Lanjut ke hal A2 kol 3

Hari Ini, 113.639 Warga T.Tinggi Ikuti Pilkada Ulang Waspada/Sukri Falah

Plt Gubernur Sumatera Utara, Gatot Pudjonugroho menyaksikan evakuasi bus ALS yang terbenam di telaga Aek Latong, Kec Sipirok, Kab Tapanuli Selatan.

Anggota DPRA Voting Hari Ini Soal Pasal Calon Perseorangan Ribuan Massa Akan Unjukrasa

BANDA ACEH (Waspada): Gerakan Mahasiswa Masyarakat Aceh (GMMA) memberi dukungan moral kepada KIP Aceh untuk tetap melaksanakan Pemilukada sesuai jadwal. Di pihak lain, ribuan masyarakat dari penjuru Aceh dila-

porkan, Selasa (hari ini) unjukrasa di halaman gedung DPRA dengan agenda utama menolak calon perseorangan (independen). Soal diterima atau ditolak calon perseorangan dalam Qanun Pilkada kini menyedok

Al Bayan

Menjelang Israk Oleh: H. Ameer Hamzah COBAAN iman yang paling berat pernah menimpa Rasulullah SAW, yakni tahun menjelang beliau di Israkmikrajkan oleh Allah SWT ke Sidratul Muntaha, sehingga tahun tersebut dikenal dengan Amul Hazan yakni tahun kesedihan. Pada tahun tersebut Rasulullah SAW kehilangan dua orang yang paling dicintainya. Yakni wafatnya pamanda, Abu Thalib bin Abdul Muthalib yang selama ini sebagai pelindungnya dari berbagai rencana makar kaum musyrikin Quraisy. Pada tahun yang sama, isteri tercintanya Khadijah binti Khuwailid meninggal pula. Padahal Khadijah-lah yang selama ini memberi dukungan, baik semangat juang maupun bekal materi.

Lanjut ke hal A2 kol 2

perhatian di Aceh. Terjadi pro kontra cukup tajam. Anggota DPRA sendiri, Selasa (28/6) akan memutuskan apakah pasal calon perseorangan dalam Qanun Pilkada 2011 Lanjut ke hal A2 kol 7

TEBINGTINGGI (Waspada): 113.639 Pemilih dari 145 ribu penduduk Kota Tebingtinggi menggunakan hak pilihnya dalam pemungutan suara ulang pemilihan kepala daerah (Pilkada) yang digelar Selasa (28/6). Mereka akan memilih satu dari lima pasangan yang akan memimpin Tebingtinggi lima tahun ke depan, dan akan mencoblos pasangan yang mereka pilih di 374 tempat pemungutan suara (TPS). Ketua KPUD Tebingtinggi Wa l A s h r i , Se n i n ( 2 7 / 6 ) mengatakan, semua fasilitas untuk pencoblosan telah dipersiapkan, demikian pula dengan petugas pelaksana

Anggota DPRD Tapteng Desak Pelantikan Bupati TAPTENG (Waspada): Sekretaris Komisi A DPRD Tapteng, Senin (27/6) membidangi Pemerintahan Mangatur Marpaung mendesak Ketua DPRD segera mengagendakan pelantikan Bupati dan Wakil Bupati Tapteng terpilih guna kelancaran roda pemerintahan. Mangatur mengatakan, putusan MK telah menguatkan kemenangan pasangan Bosur pada Pemilukada lalu dan tidak ada lagi alasan untuk menunda-nunda, karena bagaimanapun harus ada pimpinan Pemerintahan di Kabupaten Tapteng dalam mengambil keputusan. Mangatur mengakui, KPUD Tapteng merekomendasikan surat penetapan pasangan Bonaran-Syukran sebagai Bupati dan Wakil Bupati Tapteng terpilih, namun saat itu karena ada persoalan di MK pimpinan DPRD belum memparipurnakannya. Menurut Mangatur yang juga sebagai Sekretaris Fraksi PNI Plus ini, menurut UU nomor 32 tahun 2004 tentang Pemerintahan Daerah pasal 109 ayat 4 pasangan calon Bupati dan Wakil Bupati atau Walikota dan Wakil Walikota diusulkan oleh DPRD Kabupaten/Kota selambat-lambatnya dalam waktu tiga hari kepada Mendagri melalui Gubernur berdasarkan berita acara penetapan pasangan Calon terpilih dari KPU Kabupaten/Kota untuk mendapat pengesahan pengangkatan. “Maka dengan keluarnya putusan MK tersebut, Jumat (24/ 6) maka pada Kamis (30/6) Komisi A akan melakukan rapat komisi mendesak pimpinan DPRD segera mengagendakan rapat paripurna meneruskan surat KPUD pengusulan Bupati dan Wakil Bupati Tapteng terpilih”, jelas Mangatur. (a24)

mulai dari PPK, KPPS hingga TPS di kelurahan. “Kita mendistribusikan surat suara sehari sebelum pelaksanaan,” ujar Wal Ashri di sela-sela pembakaran surat suara yang rusak. Dikatakan, surat suara yang didistribusikan 113.639 eksemplar ditambah 2,5 persen surat suara cadangan. Dengan jumlah itu, nantinya di setiap TPS akan ada dua hingga tiga eksemplar surat suara cadangan. “Penggunaan surat suara cadangan itu hanya dibolehkan dua kali, jika ada warga yang salah atau kertas suaranya rusak,” ujar Lanjut ke hal A2 kol 1

Ada-ada Saja

ASI Ibu Mengandung Morfin KARENA banyak mengkonsumsi obat penenang, ASI wanita asal AS ini mengandung morfin dengan kadar tinggi. Akibat kebiasaannya mengkonsumi obat-obat terlarang ini, seorang bayi perempuan dilaporkan tewas karena minum air susu ibu

Lanjut ke hal A2 kol 5

Waspada/Abdul Mukthi Hasan

SATU SPBU di Bireuen yang kehabisan bensin dan solar sejak Minggu (26/6) malam hingga Senin (27/6) kemarin masih tutup.

BBM Langka Di Bireuen Dan Kualasimpang BIREUEN (Waspada): Kelangkaan Bahan Bakar Minyak (BBM) mulai terjadi di Bireuen dan kota Kualasimpang. Di Bireuen, dalam dua hari terakhir ini, BBM jenis premium atau bensin dan solar sulit didapatkan di sejumlah

Stasiun Pengisian Bahan Bakar Umum (SPBU). BBM hanya masih bisa didapat di kioskios, namun itupun dengan stok yang sangat terbatas, yang membuat para pengguna kendaraan kelabakan atau kalang kabut.

Polres Madina Kantongi Nama Dalang Kerusuhan PANYABUNGAN (Waspada): Kapolres Madina AKBP Fauzi Dalimunthe mengakui sudah mengantongi nama dalang kerusuhan massa yang melibatkan warga Desa Hutagodangmuda, Kecamatan Siabu dengan aparat PT SMM di Tor Sihayo, tepatnya di camp PT.SMM, pada 29 Mei lalu. Pihak Polres Madina mengetahui dalang kerusuhan berdasarkan pengakuan para tersangka yang kini ditahan. Tersangka wanita dititipkan di LP Sipaga-paga, dan tahanan laki-laki di Polres Madina. “Hanya saja pihaknya belum melakukan penangkapan karena ada beberapa alasan dan pertimbangan,” kata Kaplores saat berlangsungnya rapat dengar pendapat Polres Madina dengan Pansus PT SMM di DPRD Madina, Senin (27/6). Tim Pansus yang hadir yakni, Ketua DPRD Madina Roady Husnan,WakilWildan Nasution, Sekretaris Iskandar Hasibuan, dan anggota masing-masing Bahri Efendi, Jafar Siddiq, Arsidin Batubara, Abdul Kholil, dan Binsar Nasution. Dijelaskan Kaplores, pemegang remod kerusuhan terus dicari agar persoalan terkait kerusuhan bisa diselesaikan secara hukum sesuai perintah Kapoldasu. Tekait penahanan enam warga Desa Hutagodangmuda, Kapolres mengatakan penahanan para tersangka sesuai prosedur. “Jadi tak ada yang langsung ditangkap. Yang ditahan sebelumnya diperiksa penyidik dan terbukti melakukan tindakan pidana. Dan tersangka lainnya diserahkan langsung oleh LBH baru diperiksa, kemudian terbukti salah langsung ditahan,” ucap Kapolres. (c14)

Pantuan Waspada Senin (27/6) pagi, SPBU Simpang Reuleut ditutup demikian juga dengan SPBU di Jalan BireuenTakengon, SPBU Paya Meuneng, Peusangan. Di SPBU Simpang Reulet saat itu hanya terlihat beberapa karyawan nongkrong di dalam SPBU namun di depannya dipasang papan yang bertuliskan, Maaf Bensin Habis dan satu lagi Maaf Solar Habis. Kemarin hanya satu SPBU di Simpang Makmur yang ada menjual bensin dan saat itu banyak kendaraan mengantrinya. Para pengguna kendaraan kelabakan dan terlihat sangat kecewa melihat SPBU ditutup dan dipasang papan pemberitahuan BBM habis. “Kami tidak tahu kenapa minyak habis. dan kami juga tidak tahu kapan masuk lagi,” kata seorang karyawan di SPBU Simpang Reuleut. Informasi yang diperoleh Waspada, kehabisan stok BBM Lanjut ke hal A2 kol 1

Serampang - BBM langka siapa yang berdosa ....? - He.... he....he....


Berita Utama

A2 BBM Langka .....

di beberapa SPBU itu tidak diketahui penyebabnya. Namun, di antara SPBU itu sudah tutup dua hari lalu, karena tidak ada BBM yang tersedia, sehingga para pengendara terpaksa mencari kios-kios yang ada menjual BBM khususnya jenis bensin. “Kami terpaksa mengisi BBM di kios ini, karena tadi kami lihat di SPBU Paya Meuneng tidak ada BBM, walaupun hanya mendapat tiga liter saja,” kata seorang pengemudi Kijang Silver yang hendak ke Lhokseumawe. Hal senada juga dituturkan sejumlah pengemudi mobil minibus L-300, premium yang biasanya diisi di SPBU dengan harganya Rp4.500 per liter. Kemarin mereka terpaksa mengisi di beberapa kios yang menjual BBM walaupun harganya lebih tinggi dari harga SPBU. “Kami harapkan kepada pihak Pertamina untuk memasok BBM ke SPBU sesuai kebutuhan masyarakat sebagaimana selama ini, janganlah putus-putus begini, ini sama saja menyengsarakan rakyat,” kata Bukhari seorang sopir. Hingga berita ini diturunkan, Waspada sulit mengkonfirmasi para pemilik SPBU di Bireuen. Saat didatangi ke SPBU dikabarkan oleh pekerja pemiliknya tidak berada di tempat. Sebuah sumber Waspada menyebutkan, selama ini, jatah solar yang disalurkan untuk satu SPBU di Bireuen ada 26 truk tangki ukuran 24.000 liter per tangki, namun sekarang hanya 16 truk tangki per bulan. Sedangkan kebutuhannya semakin tinggi seiring semakin banyak kendaraan. Kalau bensin masih tetap 32 truk tangki ukuran 24.000 liter per tangki, namun solar dan bensin cepat habis karena kebutuhannya semakin tinggi,” ungkap seorang petugas SPBU di Bireuen. Mulai Panik Sementara, mulai menghilangnya BBM dari pasaran, masyarakat di Kab. Aceh Tamiang mulai tampak panik,

(amh/cb03/b16/b24)

Hari Ini ....

anggota KPUD Salmon Ginting. Data di Humas KPUD Tebingtinggi, untuk Kec. Rambutan jumlah suara keseluruhan 23.016 pemilih, Padang Hilir 23.130 pemilih, Padang Hulu 21.179 pemilih, T.Tinggi Kota 21.191 pemilih dan Bajenis 25.123 pemilih. Untuk Kec. Rambutan, jumlah pemilih terbesar terdapat di Kel. Karya Jaya 3.496 pemilih, di Kec. Padang Hilir terdapat di Kel. Tebingtinggi 4.285 pemilih. Di Kec. Padang Hulu terdapat Kel. Persiakan 4.519 pemilih, di T.Tinggi Kota ada di Kel. Rambung 4.094 pemilih dan di Kec. Bajenis ada di Kel. Durian 6.285 pemilih. Sedangkan TPS yang digunakan yakni di Kec. Rambutan 79 TPS, di Kec. Padang Hilir ada 75 TPS, di Kec. Padang Hulu 68 TPS, di Kec. Tebingtinggi Kota 78 TPS dan di Bajenis 81 TPS. Terkait pemungutan suara ulang Pilkada, diperkirakan sejumlah kandidat calon walikota tidak ikut melaksanakan hak mencoblos, karena bukan warga asli Tebingtinggi. (a09)

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur: 1. Mf5+, Re7 atau Re8 atau Rg8. 2. Mf8+mat.

Jawaban TTS: TTS Topik

Politik & Hukum

P A R I P U R N A

T A E M O K R A T A I R K L A M A S I I S B N P N U L G O J O T L R U D D I N A T E T I K A N K M G R A S I E N E P A N

A N C I U Y A U A R O I E S E P R U D M E L P N N S G U I L

U N G I D T I E A K I A L E S A P R N A Z A T B E S I N D A C U A D L O T I

Jawaban Sudoku:

8 4 2 7 6 1 9 3 5

3 1 6 5 8 9 2 4 7

7 9 5 4 3 2 8 6 1

9 2 8 6 1 7 4 5 3

4 5 7 3 2 8 6 1 9

Senin (27/6). Hasil pantauan Waspada, kemarin masih terlihat banyak warga pengendera kenderaan bermotor yang antri mengisi bahan bakar minyak jenis bensin (premium) dan solar di sejumlah SPBU yang ada di Kab. Aceh Tamiang. Pedagang eceran yang mencoba untuk membeli bensin dan solar dengan menggunakan jerigen serta drum juga tidak diberikan tanpa ada alasan yang jelas dari pengelola SPBU. Menjelang tengah hari, stok BBM yang tersedia di sejumlah SPBU yang ada di Kabupaten Bumi Muda Sedia itu terlihat sudah ludes. “Kelangkaan BBM menjadi pertanyaan bagi masyarakat di Aceh Tamiang, sebab minyak non subsidi baru akan diberlakukan oleh pemerintah pada tahun 2012. Tetapi kenapa pada saat sekarang minyak bensin dan solar sudah langka?,” kata Samsul Bahri yang juga salah seorang pengurus SIRA Kab. Aceh Tamiang itu kepada Waspada melalui telepon selularnya, Senin (27/6) Datok Penghulu Kampung Babo, Kec. Bandar Pusaka, M.Yusuf melalui telepon selularnya ,Senin ( 27/6) menyatakan, masyarakat Kec. Bandar Pusaka juga mulai panik karena harga premium di kios eceran mencapai Rp .9000,-/liter sampai dengan Rp 10.000,-/liter,sedangkan harga minyak tanah Rp 12 ribu/liter. “ Biasanya warga Bandar Pusaka membeli BBM pada orang yang menjajakannya pakai jerigen. Tetapi, sejak kemarin sudah tidak ada lagi pengecer yang menjajakan BBM menggunakan jerigen datang ke Babo,sebab menurut informasi yang saya terima, para pengecer tidak dibenarkan lagi beli BBM pakai jerigen di SPBU,” ungkap M.Yusuf. Pantauan Waspada, di Kota Kualasimpang dan sekitarnya, bensin dijual secara eceran di kios-kios dengan harga Rp 8000,-/liter.

1 6 3 9 4 5 7 2 8

5 8 4 2 9 3 1 7 6

6 3 9 1 7 4 5 8 2

2 7 1 8 5 6 3 9 4

Menjelang Israk ....

Dengan kehilangan dua “tulang punggung” dan pelindung tersebut, kaum Quraisy tidak segan-segan lagi menantang Muhammad SAW. Mereka sudah membuat rencana untuk membunuhnya. Karena tak tahan lagi tekanan kaum Quraisy, beliau hijrah ke Thaif ditemani anak angkatnya Zaid bin Hartsah dengan harapan di sana mendapat perlindungan dari kabilah Bani Shaqif. Keberangkatan Rasulullah diketahui oleh musuh-musuhnya, lalu mereka menyusul ke sana dan memfitnah, bahwa Muhammad itu biang keladi perpecahan masyarakat. Akibat fitnah tersebut, Bani Tsaqif mengusir Nabi Muhammad, mencaci maki

MUI: Orang Mampu ....

rakyat. Kalau tidak memenuhi aturan dan kesejahteraan rakyat maka itu perbuatan dosa,” katanya. Amidhan menambahkan, pihaknya akan terus membuat fatwa yang bertujuan efisiensi energi dan sumber daya alam sesuai ajaran agama. “Kami ingin masyarakat sejahtera melalui penghematan energi dan sumber daya alam,” ujarnya. Ia juga mengatakan, pihaknya berupaya mencegah orang mengambil sesuatu yang bukan haknya dan memakai energi secara berlebihan termasuk pencurian listrik, sehingga orang lain menjadi tidak terpenuhi. “Energi terutama tidak terbarukan merupakan produk yang terbatas dan menjadi kebutuhan dasar,” katanya. MUI, lanjutnya, meminta pemerintah membuat kebijakan agar energi dan sumber daya alam tidak dipakai secara berlebihan dan dapat memenuhi kesejahteraan masyarakat.

Korban Aek Latong ....

menjadi 19 orang tewas. Sementara seorang lagi korban bernama Sri Rahayu, 30, warga Lubukpakam, Kab. Deliserdang, hingga Senin pukul 17:00, belum ditemukan. Sedangkan bus ALS BK 7088 DL yang jatuh ke telaga air Aek Latong sedalam lebih 3 meter telah dievakuasi ke badan jalan sekitar pukul 16:00. Setelah diperiksa, korban ke-19, Sri Rahayu, tidak ditemukan. Sri diperkirakan masih berada di dasar telaga itu. Pantauan Waspada, evakuasi bus tersebut disaksikan Plt Gubernur Sumatera Utara, Gatot Pudjonugroho, yang singgah di lokasi usai menemui korban gempa bumi di Pahae, Kab. Tapanuli Utara. Pantauan Waspada, Senin (26/6) pukul 19:30, tim karyawan PT ALS, personil Polres Tapsel, dan keluarga korban, menemukan korban ke-15, Dinda Pratiwi, 10, warga Medan Sunggal. Sekitar pukul

20:30 menemukan korban ke16, Rendy, 5, warga Pasar III Tembung, Percut Sei Tuan, Deliserdang. Kedua korban dievakuasi ke RSUD Sipirok untuk diidentifikasi. Kemudian dikafani dan dishalatkan di Masjid Raya Sri Alam Dunia Sipirok oleh masyarakat Kel. Bagas Godang dan Bagas Lombang. Setelah itu jenazah diserahkan kepada keluarga untuk dimakamkan di daerah asalnya. Terlihat beberapa mobil ambulan milik lima pemerintah daerah seTabagsel parkir di halaman masjid untuk membawa korban ke kampungnya masing-masing. Senin (27/6) sekitar pukul 08:00, tim D etasemen C Brimobdasu dan Polres Tapsel menemukan mayat korban ke-17, Rizki Anugrah, 5, warga Rao, Provinsi Sumatera Barat. Pada pukul 14:30 kembali menemukan korban ke-18 Poppy Mustika Rani, 10, warga Lubukpakam, Kab. Deliserdang. (a27)

Perambah TNGL ....

ketika itu cukup mencekam. Ka. Balai Besar TNGL, Andi Basrul, terlihat menghubungi Danyonif Marinir, Mayor Mar Arinto Benny Saran, untuk meminta bantuan pasukan. Guna membantu pengamanan, ratusan personil dari baret ungu ditambah kekuatan dari Raider 100 sebagai lapisan pengamanan kedua berjalan kaki sejauh tak kurang dari 3 km menuju titik konflik. Ribuan perambah tampak mundur beberapa ratus meter dan di lokasi bentrok terlihat tumpukan bambu runcing yang berhasil diamankan, kemudian dibakar aparat. Untuk meredam situasi yang sudah tidak kondusif, sejumlah perwira dari Polres Polres Langkat mengadakan pertemuan dengan perwakilan dari kelompok warga. Hasil pertemuan yang berjalan singkat itu disimpulkan kegiatan okupasi dibatalkan.Seluruh pasukan ditarik. Kapolres Langkat, AKBP Mardiyono, dikonfirmasi di

lapangan mengatakan, ditarik mundurnya seluruh aparat dari kawasan itu karena ia tidak menginginkan banyak jatuh korban. “Kita berupaya menghindarkan banyaknya jatuh korban,” ujarnya. Mardiyono menilai, BB TNGL tidak siap menjalankan rencana okupasi. “Sarana alat berat yang dijanjikan 10 unit untuk mendukung kelancaran okupasi nyatanya satu pun tidak ada terlihat,” ujarnya. Ditanya kapan operasi lanjutan digelar, Kapolres mengatakan pihaknya masih menunggu hasil konsolidasi antara TNGL dengan pengungsi. Secara terpisah, Ka. BB TNGL, Andi Basrul mengemukakan, pengungsi di kawasan itu hanya tersisa 40 kepala keluarga (KK) dan 400 KK lagi terdata sebagai perambah hutan. Terhitung sejak tahun 2000 sampai Maret 2011 sudah 282 KK pengungsi yang direlokasi ke Riau dan Sumatera Selatan. Pada kesempatan itu ia

mengungkapkan, ada seorang oknum dari LSM di Aceh yang mencari uang dari konflik ini. LSM tersebut pernah menyurati berbagai instasi tentang aksi perambahan di TNGL, namun sekarang dia pula yang mengadvokasi perambah dengan dalih hak asasi manusia (HAM). Seyogianya, relokasi dan okupasi dijadwalkan, Senin (3/6). Namun, berdasarkan laporan intelijen para pengungsi dan perambah sudah mempersiapkan diri dengan berbagai senjata seperti tombak, panah dan berbagai senjata tajam lainnya, kegiatan okupasi ditunda. Gagalnya rencana tersebut menjadi catatan sejarah buram bagi upaya penegakan hukum. Kalangan aktivis lingkungan menilai, pemerintah gagal menerapkan UU No. 41/ 1999 tentang Kehutan di TNGL. Padahal tingkat degradasi hutan hujan tropis dataran rendah di daerah ini diperkirakan lebih mencapai 23 ribu ha. (a02)

dan melemparkannya dengan batu sehingga berdarah tumitnya. Untuk menghindari lemparan batu, Rasulullah berlari hingga sampailah ia di sebuah kebun kepunyaan tokoh Thaif, yakni Uthbah dan Syaibah bin Rabi’ah. Tukang kebun yang bernama Addas melindungi Nabi. Rasulullah sangat sedih memikirkan bagaimana kejam dan bodohnya manusia. Beliau diutus oleh Allah untuk menyelamatkan mereka dari api neraka, tapi justru diusir dan ingin membunuhnya. Dalam sirah Muhammad SAW, tahun tersebut terkenal dengan Amul Hazan sehingga beliau sering menitikkan air mata dan berdoa: Ya Allah! Hanya kepada-Mu aku mengeluh lemahnya kekuatanku,

kurangnya dayaku, dan kehinaanku di mata orang-orang jahil. ya Allah! Engkaulah pemeliharaku, hanya kepada-Mu aku mengeluhkan diriku sehingga Engkau ridha”. Doa Rasulullah tersebut dikabulkan oleh Allah dengan turunnya ayat “Bersabarlah hai Muhammad, dan tiadalah kesabaran-Mu itu melainkan dengan pertolongan Allah, dan janganlah engkau bersedih hati terhadap kekafiran mereka dan janganlah kamu bersempit dada terhadap apa yang mereka tipu dayakan. Sesungguhnya Allah beserta orang-orang yang bertaqwa dan orang-orang yang berbuat kebaikan (QS. An-Nahlu:127, 128). Setelah itu Rasulullah selamat kembali ke Makkah.

ASI Ibu ....

tinggi dalam darah bocah malang tersebut. Pejabat berwenang mengatakan, obat bius itu masuk ke dalam ASI Stephanie setelah ia mengkonsumsi obatobatan penghilang rasa sakit itu sejak kelahiran si bayi. Pihak penyidik menyatakan, terdakwa mengkonsumsi morfin secara ilegal, sedikitnya 38 kali dalam dua tahun terakhir. (st/rzl)

premium berarti sama saja mengambil hak orang tidak mampu dan itu dosa,” katanya. Darwin mengatakan, hak masyarakat tidak mampu memakai premium telah diatur dalam UU yang merupakan produk hukum antara pemerintah dan DPR. Sesuai UU, lanjutnya, premium hanya diperuntukkan bagi golongan tidak mampu atau duafa. Kenaikan harga pertamax sekarang ini, menurut dia, juga tidak boleh menjadi alasan memakai premium. “Tingginya harga pertamax mesti disiasati dengan membatasi penggunaannya dan bukan dengan beralih ke premium,” ujarnya. Ketua MUI lainnya Hafizh Utsman menambahkan, MUI telah mengeluarkan Fatwa No 22 tentang Pertambangan Ramah Lingkungan tertanggal 26 Mei 2011. “Intinya, proses pertambangan mesti sesuai aturan dan untuk kesejahteraan

Namun, karena jumlah perambah di kawasan ini relatif kecil, perlawanan yang mereka lakukan tidak berarti apa-apa. Para perambah hanya melontarkan pernyataan yang bernada kritikan terhadap TNGL yang mereka tuding melakukan korupsi ketika melaksanakan Program Gerhan tahun 2008 yang menelan dana miliaran rupiah. Usai memusnahkan tanaman rambung di areal yang berbatasan dengan perkebunan PIR ADB, sebagian pasukan dari Polri dan SPORC merangsek masuk ke pemukiman perambah yang sebagian kecil dihuni para pengungsi korban konflik Aceh. Melihat kehadiran aparat., perambah langsung melakukan penyerangan. Akibat aksi perlawanan ini, dua polisi terkena lemparan benda keras. Untuk melindungi diri dari serangan tersebut, aparat melepaskan tembakan dan mengenai lima warga perambah. Suasana

***

(ASI) yang mengandung narkotika jenis morfin. Hal ini dikatakan pejabat berwenang Amerika Serikat, yang memastikan kematian bocah malang itu akibat morfin yang ada dalam ASI si ibu. Stephanie Greene, 37, pada Jumat lalu, didakwa dengan kasus pembunuhan atas tuduhan telah melakukan tindak kekerasan terhadap bayinya hingga tewas. Tim penyidik mengatakan, Alexis, bayi Stephanie yang baru berusia enam minggu ditemukan tergeletak tak bernyawa di rumah orangtuanya pada November 2010. Hasil otopsi menunjukkan adanya kadar morfin yang

WASPADA Selasa 28 Juni 2011

Muhammadiyah: Puasa 1 Agustus SURABAYA (Waspada): Pimpinan Wilayah Muhammadiyah (PWM) Jawa Timur telah menyepakati awal Ramadhan tahun 1432 Hijriyah jatuh pada tanggal 1 Agustus 2011. Kepastian dimulainya puasa itu setelah Majelis Tarjih PWM melakukan musyawarah. “Ya, itu sesuai hasil musyawarah para ahli hisab yang dilaksanakan 5 Juni di gedung PWM. Bahwa, awal Ramadhan 1432 Hijriyah jatuh pada 1 Agustus,” kata Sekretaris PWM Jatim, Nadjib Hamid, Senin (27/6). (vvn)

Anggota DPRA ....

masuk atau ditolak lewat mekanisme voting. Koordinator GMMA (Gerakan Mahasiswa Masyarakat Aceh) Khairul Rizal mendukung KIP Aceh dengan segala kegiatan. Selain itu, GMMA juga mendukung pelaksaan UUPA dan MoU Helsinki dan mereka tetap mendukung pelaksanaan Pemilukada sesuai jadwal. Pernyataan Koalisi Mahasiswa Masyarakat Aceh antara lain datang dari PEMA Unsyiah, IAIN Ar Raniry, UNAYA, LDK UMUHA, Pem PSIK Ubudiyah, Pem Harapan Bangsa (Kesehatan), AMPD Aceh dan P3A (Persatuan Pemuda Peduli Aceh saat melakukan audensi dengan KIP Aceh, di kantor KIP setempat, Senin (27/6). Ketua KIP Aceh, Abdul Salam Poroh yang menerima Koalisi GMMA didampingi Ilham Saputra (Wakil Ketua KIP Aceh), Zainal Abidin dan Robby Syaputra (keduanya anggota KIP Aceh) menyatakan, bahwa pembubaran lembaga KIP seperti disuarakan sementara pihak dinilai tindakan inkonstusional. “KIP Aceh akan tetap melaksanakan Pilkada sesuai jadwal,” tegas Salam Poroh, di hadapan pimpinan lembaga koalisi GMMA itu. Bila sidang paripurna yang dijadwalkan Selasa (hari ini) mentok alias pasal calon independen dipangkas, KIP Aceh melaksanakan Pilkada mengacu kepada Qanun No.7/2006, yang mengakomodir calon perseorangan. Wakil Ketua DPR Aceh, Drs Sulaiman Abda, M.Si yang dihubungi Waspada Senin (27/6) kemarin membenarkan kemungkinan voting lebih menguat dalam menentukan apakah pasal calon perorangan diakomodir atau sebaliknya ditolak. Pembukaan, kata Sulaiman, dimulai pukul 09:00, kemudian dilanjutkan mendengar pendapat fraksi-fraksi baru dibawah ke Panmus untuk selanjutkan dilakukan voting. Sikap Fraksi Golkar, kata Sulaiman Abda akan mengamankan keputusan Mahkamah Konstitusi (MK). Begitu juga Fraksi Partai Nasional lainnya, seperti F Partai Demokrat serta anggota DPRA dari Parnas lainnya yang

punya kursi di DPRA tetap mendukung adanya calon perseorangan. Namun, bila mekanisme voting yang kabarnya akan dilakukan secara terbuka itu dilakukan, koalisi Partai Nasional (Parnas) tetap kalah suara. Soalnya, ada sejumlah Parnas seperti PKPI, Patriot, termasuk Partai Daulat Aceh yang selama ini bergabung dengan Fraksi Partai Aceh, kemungkinan tetap satu sikap dengan PA. Anggota PA di DPRA ada 33 orang ditambah 4 anggota DPRA dari partai lain hingga berjumlah 37 orang dari 69 orang. Artinya, F PA sudah melebihi 50 + 1, dalam voting yang sudah dirancang oleh partai pemenang Pemilu Legislatif, untuk menolak calon perseorangan. Juru Bicara PA, Fachrul Razi menyatakan, untuk menolak pasal calon perseorangan pihaknya sudah melakukan konsolidasi. Berbagai pertemuan digelar, termasuk pertemuan dengan kader PA yang duduk di DPR se Aceh yang sejak minggu lalu sudah berada di Banda Aceh. Mereka menggelar rapat di sebuah hotel di Banda Aceh dengan satu tekad menolak calon independen. Kabarnya, selain mengundang anggota DPR dari Fraksi PA se Aceh, juga dimobilisasi ribuan masyarakat dari penjuru Aceh yang sejak kemarin sudah berada di Banda Aceh. Mereka akan melakukan unjukrasa menentang calon independen bisa ikut dalam Pemilukada yang telah ditetapkan pencoblosan oleh KIP Aceh, 14 November itu. Sejumlah kalangan menyebutkan aksi demo tolak calon perseorangan ini akan digelar bersamaan saat anggota DPRA pelaksanakan voting. Selain aksi tolak calon perseorangan, kalangan mahasiswa dan masyarakat Aceh yang bergabung dalam koalisi GAMA, juga akan menggelar unjukrasa di lokasi sama (gedung DPRA) dengan tuntutan berbeda dengan masyarakat simpatisan PA. Kata Khairul Rizal— mahasiswa FKIP Unsyiah sementer delapan, yang menjadi koordinator, GMMA akan mengerahkan 100 orang mahasiswa, pemuda dan masyarakat. (b02)


Berita Utama

A2 Empat Lagi ... menemukan korban ke-15, Dinda Pratiwi, 10, warga Medan Sunggal. Sekitar pukul 20:30 menemukan korban ke-16, Rendy, 5, warga Pasar III Tembung, Percut Sei Tuan, Deliserdang. Kedua korban dievakuasi ke RSUD Sipirok untuk diidentifikasi. Kemudian dikafani dan dishalatkan di Masjid Raya Sri Alam Dunia Sipirok oleh masyarakat Kel. Bagas Godang dan Bagas Lombang. Setelah itu jenazah diserahkan kepada keluarga untuk dimakamkan di daerah asalnya. Terlihat beberapa mobil ambulan milik lima pemerintah daerah se-Tabagsel parkir di halaman masjid untuk membawa korban ke kampungnya masing-masing. Senin (27/6) sekitar pukul 08:00, tim Detasemen C Brimobdasu dan Polres Tapsel menemukan mayat korban ke-17, Rizki Anugrah, 5, warga Rao, Provinsi Sumatera Barat. Pada pukul 14:30 kembali menemukan korban ke-18 Poppy Mustika Rani, 10, warga Lubukpakam, Kab. Deliserdang. Polres Tapsel Buron Sopir Kasat Lantas Polres Tapanuli Selatan AKP Widodo menyebutkan Unggul Syahputra Lubis, 28, warga Jalan Sudirman, Lubukpakam, Deliserdang sopir I bus ALS BK 7088 DL nomor pintu 90, melarikan diri, dan hingga kini belum diketahui keberadaannya. Hal itu dikatakan Widodo yang dikonfirmasi Waspada dari Medan via telefon,Senin(27/6). Menurut Widodo, kecelakaan lalulintas tersebut karena sopir tidak mampu lagi mengendalikan bus saat menaiki jalan

Balai Jalan ... Hal senada diungkapkan, Ajib Shah. Katanya, dari dulu DPRD Sudah mendesak pemerintah pusat, melalui Balai Jalan Nasional untuk memperbaiki jalan Aek Latong. Dari hitungan yang pernah dilakukan, biayanya tidak terlalu mahal. Diakui Ajib Shah, mengatasi jalan rusak di kawasan itu tidak bisa dengan memperbaiki jalan yang ada sekarang. Harus dengan membuat jalan baru. Tapi itupun tidak pernah dilakukan. ‘’Bayangkan, belasan tahun lalu sudah, jalan itu rusak, dan sampai sekarang belum juga diperbaiki. Aneh kan?’’ katanya. Diakui anggota Komisi D itu, tergelincirnya bus ALS ke telaga air di Aek Latong, disebabkan beberapa hal. Namun yang

Richard Gere ... Dirjen Pemasaran Kementerian Kebudayaan dan Pariwisata, Sapta Nirwandar, mengatakan, tawaran itu sudah disampaikannnya kepada Gere di sela-sela kunjungannya ke Candi Borobudur,KabupatenMagelang. “Kami sangat berharap Mr Gere bersedia. Namun, sementara ini, dia belum memberikan jawaban terhadap tawaran tersebut,” ujarnya, saat ditemui, Senin (28/6/2011). Gere, menurut Sapta, menjadi figur yang sangat tepat untu k mempromosikan Candi Borobudur. Sebab, selain sebagai seorang artis, kedatangan Gere sebagai seorang Buddhis dapat menginspirasi banyak orang, baik penggemarnya sendiri maupun seluruh umat Buddha untuk datang mengunjungi candi ini. Sapta mengatakan, Kementerian Kebudayaan dan Pariwisata merasa perlu untuk mengajak tokoh-tokoh dari

Jawaban Problem Catur, TTS Dan Sudoku Dari Halaman Sport. Jawaban Problem Catur: 1. Mf5+, Re7 atau Re8 atau Rg8. 2. Mf8+mat.

Jawaban TTS: TTS Topik

Politik & Hukum

P A R I P U R N A

T A E M O K R A T A I R K L A M A S I I S B N P N U L G O J O T L R U D D I N A T E T I K A N K M G R A S I E N E P A N

A N C I U Y A U A R O I E S E P R U D M E L P N N S G U I L

U N G I D T I E A K I A L E S A P R N A Z A T B E S I N D A C U A D L O T I

Jawaban Sudoku:

8 4 2 7 6 1 9 3 5

3 1 6 5 8 9 2 4 7

7 9 5 4 3 2 8 6 1

9 2 8 6 1 7 4 5 3

4 5 7 3 2 8 6 1 9

1 6 3 9 4 5 7 2 8

5 8 4 2 9 3 1 7 6

6 3 9 1 7 4 5 8 2

2 7 1 8 5 6 3 9 4

tanjakansehinggabusjalanmundur, kemudian masuk ke dalam telaga sedalam lebih 3 meter. ‘’ Sedangkan sopir I Unggul Syahputra Lubis masih diburon petugas Polres Tapanuli Selatan dan Satlantas Polres Tapanuli Selatan.Sopir II Rahmad Hidayat ,29, warga Jalan Karya Gang Mesjid II-B Kel. Karangberombak, Kec. Medan Barat telah dimintai keterangan,’’ kata Widodo dan menambahkan, petugas Brimob masih melakukan penyelaman di lokasi tenggelamnya bus untuk mencari satu korban lagi. Dari Medan dilaporkan, sepuluh jenazah tiba di pool bus ALS Jalan Sisingamangaraja Medan, Senin pukul 10:00. Kesepuluh jenazah tersebut langsung diantar ke rumah duka untuk dikebumikan oleh pihak keluarga. “Begitu sampai di kantor ALS, kesepuluh mayat tersebut langsungdiantarkerumahduka,”jelas Alwi Matondang, Humas PT ALS kepada Waspada, di Medan. Kesepuluh jenazah tersebut dibawa menggunakan enam mobil ambulans milik Rumah Sakit Sipirok, Kab. Tapanuli Selatan. Nama- nama sepuluh mayat tersebut yakni, Dahniar, 56, dan Assyifa, 7, warga Jl. Bhayangkara Kec. Medan Tembung, Desi Indriani, 30, Yuni Cipiani, 9, Rendy, 5, Dimas, 3, warga Datu Kabu Pasar III Tembung, Rohang Nurukkah, 40, Kemala Sari, 10, dan Husni Amelia, 8, warga Jl. Madio Santoso Kec. Medan Timur serta Rizki, 2, warga Pajak Tasbi Medan Tembung. Alwi Matondang menambahan, semua biaya pemulangan jenazah menjadi tanggungjawab pihak perusahaan termasuk biaya pemakaman dan rumah sakit. Selain itu, Alwi Matondang paling utama adalah karena kondisi jalan rusak. Kata Jhon Hugo Silalahi, badan jalan yang rusak sering ditimbun hingga menjadi tanjakan. Berkaitan dengan peristiwa ini, DPRDSumutmemintaPltGubsu Gatot Pujonugroho, untuk bertindak tegas. Yakni melakukan upayayangkuatuntukmendesak pemerintah pusat segera memperbaiki jalan di Aek Latong. Selain itu, menurut Ajib Shah, Plt Gubsu harus meminta pertanggungjawaban Kadis Perhubungan, yang memberikan izin operasional angkutan. Karena, dari media massa yang dibacanya, ada indikasi kecelakaan juga disebabkan faktor kendaraan yang tidak laik jalan. Sebelum kecelakaan, bus tersebut sudah mengalami kerusakan dan diperbaiki selama 12 jam. (m12) mancanegara untuk terlibat sebagai duta wisata, karena promosi dari mereka akan lebih efektif menggenjot kunjungan wisata dari masyarakat seluruh dunia. Gere dalam kesempatan itu, mengatakan, sangat senang untuk datang berkunjung ke Indonesia. Dengan semua kenyamanan dan keindahan berbagai obyek yang disaksikannya selama ku njungan, dia pun mengaku tidak keberatan untuk mempromosikan Indonesia ke seluruh pelosok dunia. Minggu (27/6), Gere diundang sebagai tamu khusus dalam pertunjukan sendratari mahakarya Borobudur.(kps)

mengimbau agar sopir I Unggul Syahputra Lubis segera menyerahkan diri ke Satlantas Polres Tapanuli Selatan atau di Medan agar kasus ini bisa diselesaikan secara hukum. Alwi Matondang menambahkan Unggul Syahputra Lubis sudah empat tahun menjadi sopir ALS. Saat ditanya tentang kondisi bus, Alwi Matondang menyebutkan masih laik jalan dan setiap enam bukan sekali dilakuan uji pemeriksaan. “Setiap 6 bulan sekali ada uji kelaikan yang dilakukan terhadap semua armada bus ALS” . Alwi mengatakan, jumlah penumpang bus ALS tersebut sebanyak 55 orang. 36 Penumpang membeli tiket resmi, namun seluruh korban yang meninggal dunia mendapat santunan jasa raharja. Penumpang yang selamat, sebagian melanjutkan perjalanan dengan bus lain menuju Bengkulu, sebagian lagi masih ada yang menetap sementara di perwakilan bus ALS Padangsidimpuan. Sekaitan dengan kecelakaan tersebut, pihak PT ALS mengharapkan kepada pemerintah Provinsi Sumatera Utara agar memperbaiki kerusakan jalan di kawasan Aek Latong, karena sudah bertahun-tahun kendisinya rentan kecelakaan lalulintas. Selain di Jalinsum Aek Latong, kondisi yang sama juga terdapat di Jalinsum via Sibolga dan via Rantauprapat-Kotapinang yang jalannya mirip seperti kubangan kerbau.

Nama-nama penumpang yang meninggal dunia: 1. Dahniar ,56, warga Jln Bhayangkara No 424, Kel. Indrakasih, Kec. Medan Tembung 2. Assyfah Azahra ,7, warga Jalan Bhayangkara No 424, Kelurahan Indrakasih, Kecamatan Medan Tembung 3. Maulinda Asmar,31, warga Jln. Bunga Raya, Medan Sunggal 4. Putri Balqis ,15, warga Jln Bunga Raya Medan Sunggal 5. Eka Santi ,31, warga Jalan Bunga Raya, Medan Sunggal 6. Desi Indriani ,30, warga Jln Pasar III, PajakTasbi,Tembung 7. Yuni Asti ,9, warga Jalan Pasar III, Pajak Tasbi, Tembung 8. Dimas ,3, warga Jalan Pasar III, Pajak Tasbi, Tembung 9. Rizki, 2, warga Jalan Pasar III, Pajak Tasbi, Tembung 10. Risnawati ,55, warga Desa Bandarsetia, Kec. Percut Seituan 11. Usni Amelia ,9, warga Jalan Gunung Krakatau Gang Baru No 47-A Medan 12. Kumala Sari ,11, warga Jalan Gunung Krakatau Gang Baru No 47-A Medan 13. Rohana ,46, warga Jalan Gunung Krakatau Gang Baru No 47-A Medan 14. Dedi ,40, warga Simpang Aru, Padang, dekat rel kereta api,(mayatnyadibawakePadang. 15. Desi/Neng ,5, warga Kampung Syahmad Gang Kato, Kecamatan Lubukpakam (mayatnya dibawa ke Bengkulu) 16. Popi Mustika Rani ,9, warga Jalan Bunga Asoka Raya, Kecamatan Medan Selayang

Ada-ada Saja ...

Pejabat berwenang mengatakan, obat bius itu masuk ke dalam ASI Stephanie setelah ia mengkonsumsi obat-obatan penghilang rasa sakit itu sejak kelahiran si bayi. Pihak penyidik menyatakan, terdakwa mengkonsumsi morfin secara ilegal, sedikitnya 38 kali dalam dua tahun terakhir. (st/rzl)

17. Adinda Pratiwi , 5, warga Jalan Bunga Asoka Raya, Kecamatan Medan Selayang 18. Rezki Anugerah ,5, warga Jalan Bunga Asoka Raya, Kecamatan Medan Selayang 19. Seorang lagi masih dalam pencarian Santunan Rp 500 ribu Secara terpisah, keluarga korban Ali Umar mempertanyakan keseriusan pihak ALS yang hanya mendatangkan perwakilan tanpa mengucapkan maaf atau belasungkawa terhadap keluarga. Perwakilan pihak ALS datang dan memberikan amplop berisi uang Rp 2 juta atau Rp 500 ribu perorang sebagai santunan anaknya Desi, dan 3 cucunya kepada seorang sanak saudara dan tidak menemuinya atau Ciping suami korban Desi. Sementara itu, Kabid Angkutan Darat Dinas Perhubungan Provinsi Sumatera Utara Darwin Purba menyebutkan, ada beberapa faktor penyebab bus ALS masuk ke telaga; mulai dari faktor manusia, cuaca, alam dan kondisi bus tersebut. Belum lagi uji kelaikan terhadap bus BK 7088 DL, apakah masih berlaku atau tidak. Darwin tidak mengetahui kondisi bus ALS BK 7088 DL tersebut dalam kondisi laik jalan atau tidak. “Untuk memeriksa laik jalan tersebut dilakukan oleh Dishub Kota Medan. Minimal 6 bulan sekali dilakukan uji kelaikan,” kata Darwin Purba dan menambahkan, untuk mengetahui penyebab kecelakaan bus tersebut, pihaknya masih menunggu hasil penyelidikan petugas Satlantas Polres Tapsel. Selainitu,tambahPurba, rambu-rambu lalulintas tidak terlihat di kawasan itu karena kondisi di sepanjang jalan tersebut tidak memungkinkan untuk dipasang rambu-rambu lalulintas karena infrastrukturnya kurang mendukung. (h04/h02/csf/a27)

ya hanya bisa meraih mereka dan memeluk tubuh mereka yang sudah bau minyak lampu,” ungkapnya. Dia menuturkan alasan pergi ke Padang untuk membawa keluarga pindah, karena di Medan tidak berhasil dengan usahanya. Mereka berniat mengadu nasib ke Padang dan ditawari jadi kuli bangunan. Maka berangkatlah mereka mengadu nasib yang lebih baik. Pulang ke kampung halamannya. “Namun nasib berkata lain, kalau sudah begini untuk apa lagi,” ungkapnya pasrah. Sementara itu, Ali Umar, 60, mertua Ciping mengungkapkan pilunya hati seorang ayah melihat anak perempuannya dan 3 cucunya terbaring kaku. Mayat mereka berbaris dengan kain kafan yang berdarah ketika diantarkan di rumah duka dari Sipirok. Teringatlah dia hari terakhir pertemuan mereka ketika anak dan cucunya pamit ke pasar tempat dia berjualan. Bus anak cucunya berangkat dari loket ALS pada Jumat (24/6) sekitar pukul 15.00. Mereka sempatkanlah pamit untuk menyalaminya sekitar jam 14.00-an. “Anak saya menyalami saya dengan pandangan sayu. Ada haru dan sedih yang tertahan. Begitu pula cucu-cucu saya yang memandang dengan tatapan

dalam seperti tak ingin pergi meninggalkan saya. Bahkan celoteh Dimas, si bungsu yang sudah pandai ngomong tak henti bilang da.. da.. da.. da.. Atok,” tuturnya. Dia mengungkapkan sempat mendengar cerita dari menantunya Ciping bahwa cucucucunya merengek minta kembali ke rumah neneknya dan tak ikut ke Padang.Tapi tangisan mereka tak dihiraukan dan perjalanan tetap dilanjutkan. “Saya merasa kehilangan karena sebelumnya mereka tinggal di rumah saya. Perpisahan yang sulit karena mereka akan ke Padang saja sudah berat, apalagi untuk selamanya. Terlebih istri saya Nurbima yang melahirkan Desi, anak ketiga kami dari 8 bersaudara. Dia masih gamang dan sulit menerima kenyataan,” ungkapnya. Jenazah Desi Indriani, 30, Yuni Cipiani, 9, Rendy, 5, Dimas 3 dikubur dalam satu liang lahat di pemakaman umum Pasar IV selepas Dzuhur 14.30 diwarnai isak tangis suami dan sanak keluarga. Langit mendung dan rintik hujan pun turun ikut jadi saksi duka keluarga meninggalkan perkuburan. Hujan kian lama kian deras, sederas isak Ciping yang harus melanjutkan hidup tanpa istri dan anakanaknya. (csf)

Tim penyidik mengatakan, Alexis, bayi Stephanie yang baru berusia enam minggu ditemukan tergeletak tak bernyawa di rumah orangtuanya pada November 2010. Hasil otopsi menunjukkan adanya kadar morfin yang tinggi dalam darah bocah malang tersebut.

Firasat Buruk ... Dia mengungkapkan firasat buruk sebelum keberangkatan telah ada, mulai dari becak yang mengangkut sangkut di rawa depan rumah mertua hingga tidak bisa jalan, digotong oleh beberapa orang baru bisa jalan. Hingga menaiki bus, yang rusak di Tebing, kemudian diperbaiki dan jalan lagi. Namun di kawasan Desa Bulu rusak lagi, diperbaiki lagi. Hingga puncaknya di Sipirok tak bisa jalan karena tanjakan yang tinggi.Para lelaki pun disuruh turun mendorong. Tapi bus bukannya maju malah mundur dan terjun ke telaga Aek Latong. “Saya berlari seperti terbang, mengejar teriakan anak istri saya yang terjebak dalam bus yang terus mundur. Hingga terhenti dalam kubangan air Aek Latong, tak henti nama istri dan anak saya panggil-panggil. Namun tak ada sambutan,” ungkapnya seperti menahan tangis kepada Waspada, Senin (27/6). Katanya, dia juga ikut melompat ke Aek Latong untuk menyelamatkan istri dan anaknya, namun apa daya kedalaman air cukup menenggelamkan badan bus tempat istri dan tiga anaknya terjebak dengan pintu tertutup. “Istri dan anak saya terlambat diselamatkan. Sa-

5 Perambah ... Namun, karena jumlah perambah di kawasan ini relatif kecil, perlawanan yang mereka lakukan tidak berarti apa-apa. Para perambah hanya melontarkan pernyataan yang bernada kritikan terhadap TNGL yang mereka tuding melakukan korupsi ketika melaksanakan Program Gerhan tahun 2008 yang menelan dana miliaran rupiah. Usai memusnahkan tanaman rambung di areal yang berbatasan dengan perkebunan PIR ADB, sebagian pasukan dari Polri dan SPORC merangsek masuk ke pemukiman perambah yang sebagian kecil dihuni para pengungsi korban konflik Aceh. Melihat kehadiran aparat., perambah langsung melakukan penyerangan. Akibat aksi perlawanan ini, dua polisi terkena lemparan benda keras. Untuk melindungi diri dari serangan tersebut, aparat melepaskan tembakan dan mengenai lima warga perambah. Suasana ketika itu cukup mencekam.

Pembantaran ... Tipikor PN Jakarta Pusat bagi penentuan kelanjutan persidangan kasusnya, juga untuk menentukan langkah lebih lanjut bagi perawatan Syamsul Arifin. “Untuk dapat mengikuti persidangan syaratnya seorang terdakwa harus sehat, karena itu bila sidang ingin dilanjutkan Pak Syamsul harus benarbenar sehat,” kata Abdul Hakim. Karena kondisi kesehatan Syamsul belum pulih benar, lanjut Abdul Hakim, izin pembantaran dari majelis hakim yang berakhir pada Minggu (26/6), telah diperpanjang sampai sidang kelanjutan pada Senin (11/7).

WASPADA Selasa 28 Juni 2011 Ka. Balai Besar TNGL, Andi Basrul, terlihat menghubungi Danyonif Marinir, Mayor Mar Arinto Benny Saran, untuk meminta bantuan pasukan. Guna membantu pengamanan, ratusan personil dari baret ungu ditambah kekuatan dari Raider 100 sebagai lapisan pengamanan kedua berjalan kaki sejauh tak kurang dari 3 km menuju titik konflik. Ribuan perambah tampak mundur beberapa ratus meter dan di lokasi bentrok terlihat tumpukan bambu runcing yang berhasil diamankan, kemudian dibakar aparat. Untuk meredam situasi yang sudah tidak kondusif, sejumlah perwira dari Polres Polres Langkat mengadakan pertemuan dengan perwakilan dari kelompok warga. Hasil pertemuan yang berjalan singkat itu disimpulkan kegiatan okupasi dibatalkan.Seluruh pasukan ditarik. Kapolres Langkat, AKBP Mardiyono, dikonfirmasi di lapangan mengatakan, ditarik mundurnya seluruh aparat dari kawasan itu karena ia tidak “Majelis Hakim telah memberi perpanjangan izin pembantaran Senin (27/6),” katanya. Pembesuk Sementara, mantan Kapolda Sumatera Utara Komjen Pol Nanan Sukarna terlihat datang membesuk Syamsul Arifin di RS Abdi Waluyo , Jumat (24/6). Juga para keluarga lainnya sudah tampak datang satu persatu membesuk meski Syamsul Arifin belum dibenarkan untuk berbicara karena dokter menganjurkan Syamsul Arifin untuk beristirahat. Sedangkan mantan Wakil Walikota Medan DR. Drs. H. Ramli, MM yang datang Sabtu (25/6) sempat diberi izin keluarga untuk langsung membesuk Syamsul Arifin. (j02)

LENTERA ... Khalid Muhammad Khalid dalam buku Rijal Haular Rasul, diterjemahkan oleh Mahyuddin Syaf dkk, (halaman 132-133) menceritakan kisah seorang wali negeri bernama Alhajjaj mengancam akan menganiaya tokoh terkenal Abdullah Ibnu Umar (w.72 H). Sumber lain menyebut Hajjaj menyuruh orang lain meracun anak khalifah kedua Umar Bin Khattab ra. itu. Ada pula yang menulis suruhan Hajjaj itu melukai Ibnu Umar dengan tombak, akhirnya Ibnu Umar meninggal dunia. Pasalnya hanya karena Ibnu Umar yang sudah tua waktu itu membantah pidato Hajjaj yang menuding Ibnu Zubair mengubah Kitabullah. Menurut Ibnu Umar, Ibnu Zubair tidak mengubah Kitabullah (Al-Quran). solihin87.abatasa.com, bersumber dari alWuzara, Hilal bin Muhsin al-Shabi’i mengisahkan peristiwa Hajjaj berbekam kemudian membalbal tukang bekam itu. Pasalnya begitu memulai pekerjaannya si tukang bekam dengan ramahnya membuka pembicaraan dengan menyebut, “Senang sekali seandainya Tuan mau menceritakan kepadaku tentang ceritamu dengan Ibnu alAsy’ats. Maksudku mengapa ia sampai berani menentangmu?” ”Selesaikan dahulu pekerjaanmu ini. Nanti pasti akan aku ceritakan padamu,” jawab alHajjaj. Permintaan tukang bekam berulang se-

menginginkan banyak jatuh korban. “Kita berupaya menghindarkan banyaknya jatuh korban,” ujarnya. Mardiyono menilai, BB TNGL tidak siap menjalankan rencana okupasi. “Sarana alat berat yang dijanjikan 10 unit untuk mendukung kelancaran okupasi nyatanya satu pun tidak ada terlihat,” ujarnya. Ditanya kapan operasi lanjutan digelar, Kapolres mengatakan pihaknya masih menunggu hasil konsolidasi antara TNGL dengan pengungsi. Secara terpisah, Ka. BB TNGL, Andi Basrul mengemukakan, pengungsi di kawasan itu hanya tersisa 40 kepala keluarga (KK) dan 400 KK lagi terdata sebagai perambah hutan. Terhitung sejak tahun 2000 sampai Maret 2011 sudah 282 KK pengungsi yang direlokasi ke Riau dan Sumatera Selatan. Pada kesempatan itu ia mengungkapkan, ada seorang oknum dari LSM di Aceh yang mencari uang dari konflik ini. LSM tersebut pernah menyurati berbagai instasi tentang aksi perambahandiTNGL,namunsekarang dia pula yang mengadvokasi perambah dengan dalih hak asasi manusia (HAM). Seyogianya, relokasi dan okupasi dijadwalkan, Senin (3/ 6). Namun, berdasarkan laporan intelijen para pengungsi dan perambah sudah mempersiapkan diri dengan berbagai senjata seperti tombak, panah dan berbagai senjata tajam lainnya, kegiatan okupasi ditunda. Gagalnya rencana tersebut menjadi catatan sejarah buram bagi upaya penegakan hukum. Kalangan aktivis lingkungan menilai, pemerintah gagal menerapkan UU No. 41/1999 tentang Kehutanan di TNGL. Padahal tingkat degradasi hutan hujan tropis dataran rendah di daerah ini diperkirakan lebih mencapai 23 ribu ha.(a02)

tiap tahap pekerjaannya selesai. Hajjaj juga tetap menjawab demikian. Begitu proses berbekamnya selesai, Hajjaj memanggil tukang bekam dan mengatakan akan memenuhi permintaan tadi. Tiba-tiba Hajjaj berteriak meminta ajudannya mengambil cambuk dan menyuruh tukang bekam membuka baju. Hajjaj menceritakan perseteruannya dengan al-Asy’ats sambil menyambuk tukang bekam itu 500 kali. “Nanti kalau kamu meminta kisahku dengan orang lain akan kupenuhi sama dengan kejadian ini,” katanya. Berkenaan dengan Sa’id Bin Zubair (Ibnu Zubair) yang dibela Ibnu Umar, diungkapkan oleh arrahmah.com, bersumber dari al-Sofwah bahwa dia ditangkap kemudian disiksa dan dibunuh oleh Hajjaj. Namun, Aun bin Abi Syidad berkata, “Berita yang sampai kepada kami adalah bahwa al-Hajjaj hanya hidup 15 hari setelah peristiwa ini. Ia diserang tumor perut. Dokter spesialis didatangkan guna mengoperasi perut dan mengangkat tumor tersebut. Tetapi mereka gagal karena daging yang dijahit lengket dengan darah setelah satu jam dari pelaksanaan operasi. Sadarlah ia bahwa umurnya tidak lama lagi. Hajjaj memanggil-manggil almarhum Ibnu Zubair dan dia minta tolong. Mudah-mudahan tidak ada Hajjaj di kita ini. Amin. Wallohu A’lam.


Nusantara

WASPADA Selasa 28 Juni 2011

Komisi I Bicarakan Masjid Al Ikhlas Dengan Pangdam I BB JAKARTA (Waspada): Komisi I menugaskan lima orang Tim Kerja Pertanahan dan Aset TNI Komisi I Kamis (30/6) mendatang ke Medan guna menindaklanjuti permasalahan Masjid Al Ikhlas Jalan Timor Medan. Penetapan kunjungan itu disampaikan dalam pertemuan Komisi I DPR RI dengan Pangdam I Bukit Barisan Leo Siegers di DPR RI Jakarta Senin (27/6). Ketua Komisi I Mahfudz Siddiq menjawab Waspada mengatakan, pertemuan dengan Pangdam I BB berkaitan pengaduan ormas-ormas Islam Sumut yang menyampaikan perubuhan Masjid Al Ikhlas. Bagi Komisi I DPR RI, kunjungan Tim Kerja ke Medan dalam

rangka membicarakan penyelesaian pasca pemindahan lokasi masjid yang telah disampaikan oleh pihak Pangdam. “Sebaiknya dicari solusi yang bagus bisa berupa win-win solution. Kalau nanti tidak tercapai kita ambil jalan tengah yakni digempuh melalui jalur hukum. Jika nanti masuk ke ranah hukum, apapun keputusannya harus diterima oleh semua pihak,”ujar Mahfudz Siddiq. Anggota Komisi I yang akan ke Medan nanti diantaranya, Tri Tamtomo, Mayasyak Johan akan membicarakan permasalahan Masjid Al Ikhlas dengan semua pihak, sehingga permasalahan dapat diselesaikan. Pangdam I BB bersama 32 Pemuka Agama Islam sebelum-

nya dalam pertemuan dengan Komisi I menjelaskan sejarah dan kronologis pembangunan masjid Al Ikhlas. Pangdam hadir bersama rombongan pemuka agama Islam Sumut yang berjumlah 32 orang. Jumlah itu lebih besar dan lebih banyak dari delegasi Ormas-Ormas Islam Sumut yang sebelumnya menyampaikan permasalahan perubuhan Masjid Al Ikhlas kepada Komisi I. “Sebenarnya Komisi I minta laporan dari pangdam tentang sejarah dan kronologis pendirian masjid Al Ikhlas. Kami menjelaskannya sesuai sejarah pendiriannya,” ujar Pangdam I BB menjawab Waspada seusai pertemuan kemarin. Menurut Leo Sigers, pihaknya sudah menjelaskan kepada

Komisi I tentang pemindahan lokasi masjid Al Ikhlas sudah dibicarakan sejak tahun 2004. “Kami menjelaskan sejarah sejak didirikan dan menjelaskan perihal pemindahan sudah dilakukan dengan pihak terkait sejak tahun 2004. Bahkan kami sudah menjelaskan masalah Undang-Undang yang terkait dengan masalah pemindahan lokasi masjid Al Ikhlas,”katanya. Dalam laporannya kepada Komisi I Leo Siegers menjelaskan perihal perundang-undangan yang menyangkut masalah tersebut termasuk permasalahan ruislagh tanah dan bangunan. Pemindahan lokasi masjid dilakukan dan diberikan dengan nama yang sama yakni Al Ikhlas. Mengenai lokasinya berstatus wakaf, sesuai sejarahnya

Panglima TNI maupun Pangdam I BB tidak punya hak wakaf terhadap lokasi tersebut. “Yang berhak menentukan lokasi itu tanah wakaf bukan Panglima maupun Pangdam,”katanya. Pangdam mengungkapkan sesuai sejarahnya, awalnya Masjid Al Ikhlas adalah Mushola yang didirikan personel Hubdam ketika itu. Lama kelamaan Mushola itu menjadi masjid karena jamaahnya semakin ramai khususnya kalau shalat Jumat. Namun perkembangan Kota Medan menjadi masjid Al Ikhlas hanya ramai pada shalat Jumat, sementara pemukim di sekitarnya tidak ada yang tinggal. Sedangkan lokasi sekitar masjid memang area perkantoran. (j07)

A3


A4 Malaysia Ingin Lebih Banyak Wanita Duduki Jabatan Penting KUALA LUMPUR, Malaysia (AP): Pemerintah Malaysia mengatakan para wanita harus memegang 30 persen jabatan penting di berbagai perusahaan pemerintah sampai 2016 mendatang dalam satu langkah menuju kesetaraan gender dalam berbagai lapangan. PM Najib Razak mengatakan kebijakan baru itu merupakan satu keputusan bersejarah oleh Kabinet yang akan meningkatkan peran serta kaum wanita berbagai lapangan. Dia mengatakan kaum wanita saat ini hanya 8 persen yang menduduki posisi penting di 200 perusahaan pemerintah dan 6 persen di lembaga finansial. Dia mengatakan pemerintah akan membantu berbagai perusahaan mengembangkan sejumlah program untuk melatih kaum wanita duduk di posisi pembuat keputusan. Najib mengatakan Senin (27/6) satu kebijakan yang serupa telah dilembagakan tahun 2004 untuk sektor publik yang telah meningkatkan partisipasi perempuan dari 19 persen menjadi 32 persen. Kaum wanita memegang beberapa jabatan penting pemerintahan di Malaysia yang berpenduduk mayoritas Muslim, termasuk jabatan Gubernur Bank Sentral dan beberapa posisi di Kabinet.(m10)

Pendukung Protes Malaysia Dituduh Komplotan Komunis KUALA LUMPUR, Malaysia (AP): Pihak berkuasa Malaysia menuduh 30 anggota oposisi yang ditahan berkomplot untuk menggulingkan pemerintah dan membangkitkan kembali ideologi komunis setelah para aktivis ditangkap menjelang rapat politik yang dilarang. Partai oposisi dan kelompok HAM menyatakan Senin (27/ 6), tuduhan itu ditujukan untuk menjelek-jelekkan para aktivis yang merencanakan unjukrasa jalanan besar-besaran 9 Juli mendatang untuk menuntut pemilihan yang lebih transparan. Penangkapan ke-30 orang itu dan tuduhan terhadap mereka menandai meningkatnya ketegangan antara pemerintah – yang didominasi koalisi Barisan Nasional berkuasa – dan saingan politiknya menjelang rapat politik itu, yang kemungkinan menjadi unjukrasa terbesar di Malaysia dalam kurun waktu empat tahun terakhir. Aksi tersebut dijadwalkan berlangsung menjelang polling nasional secara luas pada pertengahan 2012. Pemimpin oposisi Anwar Ibrahim mendesak polisi agar membebaskan mereka dan menyebut tuduhan komunis tersebut sebagai ‘dalih yang lemah’. Pejabat polisi Abdul Rahim Jaafar mengatakan Minggu, ke-30 orang itu – termasuk seorang anggota parlemen dari pihak oposisi – adalah penyebar keyakinan komunis. Dia mengatakan mereka menemukan satu bus berisi kaos bertuliskan nama dan gambar tokoh-tokoh penting yang mengibarkan pemberontakan komunis yang berakhir di Malaysia beberapa puluh tahun lalu.(m23)

Luar Negeri

WASPADA Selasa 28 Juni 2011

Taliban Ancam Segera Lakukan Serangannya ISLAMABAD, Pakistan (Waspada): Militan Taliban Pakistan mengancam untuk melakukan serangan terhadap negara-negara Barat. Sekutu terdekat al Qaida ini berencana untuk menyerang Amerika Serikat, Inggris dan Prancis. Serangan Taliban ini merupakan bentuk balas dendam atas kematian pemimpin jaringan terorisme Al Qaeda Osama bin Laden. “Sebentar lagi, kalian akan melihat serangan atas AS dan negara NATO lainnya. Prioritas utama kami di Eropa adalah Prancis dan Inggris,” ungkap deputi pimpinan TalibanWaliur Rehman dalam rekaman video yang ditayangkan oleh Al Arabiya seperti dikutip Reuters, Senin (27/6). Tahrik e Taliban (TTP) atau Organisasi Taliban Pakistan selama ini terus dianggap sebagai otak pelaku serangan bom bunuh diri di Pakistan. Kelompok ini masih dianggap berbahaya,

meskipun pasukan Pakistan terus menyerbu wilayah pertahanan mereka. Namun banyak pihak meragukan kemampuan TTP untuk melakukan serangan di negaranegara Barat. Sebelumnya TTP melakukan serangan yang gagal diTimes Square, NewYork tahun lalu. Insiden tersebut membuat dinas intelijen AS memasukan TTP ke dalam organisasi teroris internasional. Sementara mengenai serangan ini, Taliban Pakistan mengaku sudah memiliki 10 target serangan. “Kami sudah memiliki 10 target untuk membalas kematian dari Osama bin Laden,” tegas Rehman.

Rehman mengatakan operasi balas dendam atas kematian Osama sebenarnya sudah dilakukan sejak bulan lalu. Satu serangan yang mereka lakukan adalah di sebuah pangkalan militer di Karachi. TTP juga melihat Angkatan Darat Pakistan sebagai boneka dari Amerika. Menyusul ancaman ini, tekanan Pakistan untuk mengatasi pergerakan anggota militan di negaranya tentu makin keras. Sebelumnya AS mendesak agar negara tetangga India tersebut mengatasi militansi yang terjadi sejak Osama bin Laden ternyata berlindung dengan nyaman di Pakistan selama bertahun-tahun. Pisahkan diri Berita lain menyebutkan, seorang panglima seniorTaliban Pakistan mengatakan dia memisahkan diri dari kelompok itu untuk memprotes serangan terhadap warga sipil.

Fazal Saeed mengatakan kepada The Associated Press Senin bahwa dia membentuk satu kelompok baru sendiri, Tehrik-e-Taliban Islami, dan akan memfokuskan perjuangannya memerangi NATO di Afghanistan. Taliban Pakistan, atau Tehrik-e-Taliban Pakistan, terutama memfokuskan perjuangannya terhadap pemerintah Pakistan yang bersekutu dengan AS. Saeed dikenal sebagai pemimpin Taliban Pakistan di daerah kesukuan Kurram dekat perbatasan Afghanistan. Tidak jelas apakah langkah Saeed itu ada hubungan dengan operasi militer militer Pakistan mendatang di Kurram. Militer pada masa lalu telah membedakan antara militan Taliban yang memfokuskan perangnya di Afghanistan dengan di Pakistan. (bbc/m10)

ISLAMABAD, Pakistan (AP): Kedutaan Inggris mengatakan, Pakistan telah meminta kerajaan Inggris itu untuk menarik sebagian tim pelatih militernya dari negara tersebut. Jubir Kedutaan George Sheriff mengatakan Senin (27/6), penarikan itu bersifat sementara dan tim pelatih tersebut akan siap dikerahkan kembali secepatnya. Dia menolak memberi keterangan lebih rinci. Penarikan tersebut pertama kali dilaporkan oleh suratkabar The Guardian Minggu. Suratkabar itu mengatakan Pakistan mengusir sedikitnya 18 penasehat militer Inggeris, yang dikirim ke Pakistan sebagai bagian dari program berbiaya 23,9 juta dolar untuk melatih Korps Perbatasan paramiliter. Suratkabar itu mengatakan, program pelatihan itu dimulai Agustus lalu dan dijadwalkan berlangsung sampai setidaknya musim panas tahun 2013. Pakistan juga telah mengusir pelatih militer AS dari negara itu.(m23)

TOKYO, Jepang (AP): Satu polling menyatakan, sebagian besar warga Jepang menentang beroperasinya kembali reaktor nuklir yang ditutup sejak bencana tsunami. Sebelum tsunami 11 Maret lalu, sekitar 30 persen listrik Jepang dihasilkan 54 reaktor di seluruh penjuru negeri itu. Namun sejak krisis terjadi di PLTN Fukushima Dai-ichi, 35 reaktor nuklir lainnya ditutup setelah dilakukan pemeriksaan perawatan dan keselamatan. Satu polling yang disiarkan The Nikkei, harian bisnis konservatif, Senin (27/6), menyatakan hampir 70 persen warga Jepang menentang operasi kembali reaktor yang ditutup. 49 Persen mengatakan jumlah reaktor sebaiknya dikurangi dan 21 persen mengatakan semua reaktor harus ditutup. Polling terhadap 893 orang itu dilakukan The Nikkei dan TV Tokyo Corp lewat telepon akhir pekan lalu.(m23)

Anggota Parlemen: PM Jepang Mungkin Mundur Sebelun Agustus TOKYO, Jepang (AP): Seorang anggota parlemen senior dari partai berkuasa Jepang mengatakan PM kemungkinan mengundurkan diri sebelum Agustus. Katsuya Okada, orang No. 2 di dalam Partai Demokrat Jepang (DPJ), mengatakan kepada para wartawan Minggu (26/6) bahwa jika PM Naoto Kan mencapai tiga tujuan politiknya, dia kemungkinan akan mengundurkan diri sebelum akhir Agustus — hari terakhir sidang parlemen. Kan, yang dikecam atas penanganannya terhadap bencana tsunami Maret lalu dan krisis nuklir di pembangkit listrik tenaga nuklir Fukushima Dai-ichi, pada 2 Juni lalu telah menyatakan keinginannyauntukmengundurkandiri.Namundiabelummenjelaskan tentang tanggal spesifik dia meninggalkan kursi jabatannya. Okada mengatakan tiga sasaran Kan adalah diberlakukannya anggaran tambahan untuk rekonstruksi pasca-gempa, disahkannya satu RUU untuk mengeluar-kan obligasi untuk menutupi defisit dan dilakukan satu pe-mungutan suara pada RUU Energi yang diperbarui. (m10)

25 Tewas Dalam Serangan Di Maiduguri, Nigeria Utara KANO, Nigeria (Antara/AFP): Setidaknya 25 orang tewas pada Minggu (26/6) ketika kelompok Islamis diduga melemparkan bom dan menembaki sebuah taman bir di kota Nigeria utara, Maiduguri, kata para petugas keamanan dan saksi. Dua penyerang bersepeda motor, yang diduga anggota sekte Islam garis keras Boko Haram, melempar bom dan melepaskan beberapa tembakan tanpa pandang bulu pada sebuah kedai bir yang ramai di pinggiran kota, kata sumber tersebut. Serangan, yang ditargetkan terhadap para peminum di pub, puluhan juga terluka, kata polisi dan sumber-sumber militer yang tidak mau disebutkan namanya. “Para penyerang diyakini anggota Boko Haram melemparkan bom dan melepaskan tembakan membabi buta terhadap sebuah kedai di lingkungan Dala Kabompi, menewaskansedikitnya25orangdanmelukaiseriussekitar30oranglainnya,” kata seorang inspektur polisi. Para penyerang melarikan diri dari tempat kejadian perkara, kata pejabat polisi di telefon dari Maiduguri, ibukota Negara Bagian Borno timur laut.

TAIPEI, Taiwan (AP): Satu kawat diplomatik AS yang disiarkan situs anti rahasia WikiLeaks mengatakan, mantan Menteri Keuangan China Jin Renqing dipecat tahun 2007 karena terlibat skandal dengan seorang tersangka mata-mata Taiwan. Skandal tersebut dikatakan terjadi semasa pemerintahan Presiden Taiwan Chen Shui-bian, ketika ketegangan antara Taiwan dan China sedang tinggi karena Beijing marah pada kebijakan pro kemerdekaan Chen. Sejak itu hubungan kedua negara meningkat pesat, dengan dipandu pengganti Chen yang lebih berpihak ke China, Ma Ying-jeou. Ketika Jin meninggalkan jabatannya, dilaporkan dia mundur karena alasan pribadi. Kawat dari Konsul Jenderal AS di Shanghai baru-baru ini dinyatakan sebagai rahasia tertutup dan bertanggal 20 September 2007. Kawat tersebut menggambarkan seorang wanita tak dikenal sebagai ‘sosialita supel’ dan mengatakan pihak penyelidik China meyakini dia seorang mata-mata Taiwan. Badan intelijen Taiwan menolak mengomentari cerita tersebut Senin (27/6). Telefon di kantor utama Kementrian Keuangan China di Beijing tidak dijawab. Kawat diplomatik tersebut mengatakan di saat yang sama dia menjalin hubungan dengan beberapa tokoh penting China lainnya, termasuk Ketua Sinopec Group Chen Tonghai dan Sekretaris Partai Komunis Provinsi Sichuan Du Qinglin. Chen dikeluarkan dari perusahaan karena korupsi. Du sekarang pemimpin Departemen Kerja Front Bersatu, lembaga di bawah Komite Pusat Partai Komunis, dan wakil ketua Konferensi Konsultatif Politik Rakyat China. (m23)

China Dan Vietnam Segera Selesaikan Sengketa Maritim BEIJING, China (Antara/AFP): China danVietnam telah berikrar untuk menyelesaikan sengketa atas klaim-klaim kepemilikan Laut China Selatan dengan ‘secara damai’, kata media resmi China mengutip kedua pihak mengatakan setelah isu ketegangan memuncak. Dua negara bertetangga itu berjanji akan mencapai satu ‘pemecahan secara damai atas sengketa maritim antara kedua negara melalui perundingan-perundingan dan konsultasi-konsultasi persahabatan,” kata satu laporan Kantor Berita Xinhua Minggu (26/6). Kesepakatan bersama itu dibuat dalam perundingan di Beijing antara Penasehat Negara China Dai Bingguo, pejabat kebijakan luar negeri senior China, dan Wakil Menteri Luar Negeri Vietnam Ho Xuan Son. Mereka sepakat untuk sama-sama “melakukan tindakantindakan efektif guna menjaga perdamaian dan stabilitas di Laut China Selatan” dan mempercepat perundingan-perundingan yang bertujuan mencapai satu persetujuan untuk menangani sengketa-sengketa maritim, kata Xinhua. Selain ketegangan China-Vietnam baru-baru ini, Filipina juga mengeluhkan aksi agresif Beijing di perairan-perairan yang diklaim kedua negara d Laut China Selatan yang strategis dan kaya sumber-sumber alam itu termasuk minyak dan gas itu. Filipina dan China—bersama Brunei Darussalam, Malaysia, Taiwan dan Vietnam — mengklaim seluruh atau sebagian dari Laut China Selatan, dan wilayah itu dianggap salah satu dari kemungkinan titik rawan militer.

Pakistan Usir Pelatih Inggris

Polling: Warga Jepang Tolak Operasikan Lagi Reaktor Nuklir

AS: Pejabat China Dan Mata-mata Taiwan Terlibat Skandal

Garda Republik Iran Mulai Latihan Perang Rudal Reuters

MANTAN Menlu Khmer Merah Ieng Sary (kedua baris depan, kiri) dan mantan menteri urusan sosial Ieng Thirith (kedua baris

depan, kedua kanan) duduk di ruang sidang Pengadilan Luar Biasa Kamboja (ECCC) di pinggiran Phnom Penh, Kamboja, Senin (27/6).

Kaki Tangan Pol Pot Diadili PHNOM PENH, Kamboja (Waspada): Empat orang mantan petinggi rezim Khmer Merah di Kamboja mulai diadili Senin (27/6). Mereka didakwa atas pembantaian jutaan orang di Kamboja pada rentang tahun 1970-1979. Seperti disiarkan laman The Guardian, keempat tokoh itu adalah orang-orang dekat mantan diktator Kamboja, Pol Pot, yang meninggal 1998 lalu. Oleh orang-orang terdekatnya, peruntuh pemerintahan Kamboja pada revolusi ‘Tahun Nol’ ini disebut sebagai ‘Kakak pertama.’ Di antara yang diadili hari ini adalah tangan kanan mantan pemimpin Kamboja Pol Pot,

‘Kakak kedua’ Nuon Chea, mantan Presiden Khieu Samphan, mantan PM Ieng Sary dan mantan Menteri Sosial Ieng Tirith. Keempatnya didakwa atas kejahatan perang dan kejahatan terhadap kemanusiaan, serta dakwaan kekerasan lainnya. Para terdakwa merupakan aktor-aktor dibalik kematian 1,7 juta warga Kamboja pada pemerintahan rezim Pol Pot. Kebanyakan mereka tewas akibat penyiksaan, hukuman mati, dan kelaparan pada 1975-1979, ketika Pol Pot tengah merintis pemerintahan komunis Kamboja. Di pengadilan yang disponsori oleh PBB ini, keempat orang itu mengaku tidak bersa-

lah atas pembantaian. Salah satu yang menjadi bukti pengakuan mereka adalah film dokumenter yang belum diterbitkan. Pada film yang dibuat selama enam tahun itu, Noun Chea mengaku kepada wartawan yang mewawancarainya bahwa Khmer akan menghajar siapa saja yang dianggap ancaman terhadap rezim. Karena belum dipublikasikan, pembuat film menolak untuk memberikan rekaman kepada pengadilan. Rekaman baru akan diserahkan setelah film calon penyabet penghargaan ini disiarkan ke publik. Sebelumnya pada 2007, pengadilan di Kamboja telah men-

Pemimpin Palestina Upayakan Pengakuan Resmi PBB RAMALLAH, Palestina (Antara/Xinhua-0ANA): Para pemimpin Palestina menegaskan bahwa pihaknya akan mencari pengakuan negara Palestina dari Perserikatan Bangsa Bangsa (PBB) pada September depan. Keputusan itu diambil selama pertemuan yang dipimpin oleh Presiden Mahmoud Abbas di Ramallah Minggu (26/6), meski ditentang oleh Amerika

Serikat dan Israel. Palestina ingin mendeklarasikan negara mereka di tanah yang diduduki Israel pada tahun 1967, termasuk Yerusalem Timur sebagai ibu kota. Anggota Komite Eksekutif PLO,Yasser Abed Rabbo mengatakan keputusan PBB seharusnya setuju dengan resolusi internasional tentang Palestina dan hakbangsa-bangsa‘dalampenentuan nasib sendiri’. Para anggota

Komite Eksekutif dan anggota Komite Sentral Fatah Abbas ikut berpartisipasi dalam rapat. Satu pernyataan yang dikeluarkan setelah pertemuan mengatakan bahwa pengakuan kepada negara Palestina membantu membuat perdamaian abadi dan komprehensif di mana kehidupan negara Palestina dalam damai dengan tetanggatetangganya.

jatuhkan hukuman penjara selama 14 tahun terhadap sipir di rezim Pol Pot, Kaing Guek Eav. Dia didakwa atas tuduhan berada di balik kematian 14.000 orang di penjara S-21 di Phnom Penh. Hukuman ini jauh lebih ringan daripada tuntutan jaksa, yaitu 35 tahun penjara.(vvn)

TEHERAN, Iran (Antara/AFP): Pasukan elite Garda Republik Iran melancarkan latihan militer, Senin (27/6), dengan tembakan rudal-rudal balistik yang berbeda-beda jarak tembaknya, kantor berita negara IRNA melaporkan. Latihan itu, dengan nama sandi Great Prophet-6, dimulai Senin, kata komandan Garda, Jend. Ami Ali Hadjizadeh, seperti dikutip oleh IRNA. Dia tidak menyebutkan secara khusus berapa lama manuver itu akan berlangsung. “Rudal-rudal jarak pendek, sedang dan jauh akan ditembakkan, pada khususnya rudal-rudal Khalij-Fars, Sejil, Fateh, Ghiam, serta Shahab-i dan Shahab-2,” dia memerinci. Jendral itu, yang pasukannya melakukan latihan perang setiap tahun di kawasan Teluk, mengatakan bahwa latihan terakhir itu merupakan “pesan perdamaian dan persahabatan pada negara-negara di kawasan itu”. Pada akhir Mei lalu, Iran mengatakan negara itu telah memperlengkapi Garda Revolusi dengan rudal permukaan-ke-permukaan baru, Qiam-1, yang adalah buatan dalam negeri dan telah diuji coba pada Agustus tahun lalu. Iran mengatakan mereka memiliki serangkaian luas rudal, beberapa dari rudal itu mampu menyerang sasaran di dalam musuh lama Israel dan juga pangkalan-pangkalan Amerika Serikat di Timur Tengah.


Sport

WASPADA Selasa 28 Juni 2011

A5

Awal Positif Panser BERLIN (Waspada): Tuan rumah sekaligus juara bertahan Jerman membukukan kemenangan pertama pada Piala Dunia Wanita dengan mengalahkan Kanada 2-1 dalam laga penyisihan Grup A di Stadion Olimpiade Berlin, Senin (27/6). Setelah memenangi turnamen yang sama pada 2003 dan 2007, kini Jerman mencoba melakukan hatrik di kandang sendiri dan tidak memiliki banyak masalah ketika berhadapan dengan Kanada yang jarang me-

ngancam gawang mereka. Gol babak pertama yang dicetak gelandang Kerstin Garefrekes dan Celia Okoyino da Mbabi membuat tuan rumah semakin menguasai permainan, sebelum kapten tim Ka-

nada Christine Sinclair yang sempat cedera hidungnya memperkecil kekalahan lewat tendangan bebas. “Ini merupakan pertandingan pertama, jadi kami agak grogi. Masih ada waktu untuk melakukan perbaikan dan kami pasti akan membaik,” kata Garefrekes yang juga membangun serangan ketika lahir gol kedua tim Panser Putri. “Kami meraih dua gol itu pada babak pertama dan kami

tidak terlalu bagus bermain. Tapi kami semakin bagus dan terorganisasi dengan baik pada babak kedua,” kata pelatih Jerman, Silvia Neid. “Permainan semakin kencang pada akhir pertandingan. Saya kira angka akan menjadi 2-2, ternyata tidak dan tentu saya amat senang dengan hasil pertandingan pertama ini,” kata Neid lagi. Kemenangan itu membuat Jerman berada di urutan puncak

Grup A setelah Prancis sebelumnya menang 1-0 atas Nigeria berkat gol tunggal Marie-Laure Delie. Terakhir kali Jerman kalah terjadi pada Maret 2010 ketika tim Amerika Serikat (AS) menang 3-2 di Piala Algavre. Juara dua kali, Amerika Serikat, akan mengawali pertandingan mereka di Grup C melawan Korea Utara di Dresden, Rabu (29/6) besok. (m33/ant/afp)

AP

GELANDANG timnas Jerman, Kerstin Gareferekes (tengah), menanduk bola ke gawang Kanada untuk membawa tuan rumah menang 2-1 dalam laga Grup A Piala Dunia Wanita 2011 di Berlin, Senin (27/6).

TRIO striker Brazil, Robinho (kiri), Alexandre Pato, dan Neymar (kanan) bakal menjadi andalan skuad Samba pada Copa America 2011 nanti.

Brazil Langsung Pasang Tiga Striker

Barca Tolak Rp372 M Untuk Villa

AP

Copa America 2011

BARCELONA, Spanyol (Waspada): Raksasa La Liga Spanyol, Barcelona, mengumumkan telah menolak tawaran sebesar 27 juta pounds (Rp372 miliar) dari Chelsea untuk membeli David Villa (foto). Seperti dilansir The Mirror, Senin (27/6), klub asal Katalunya tersebut memberikan keterangannya kepada media-media lokal bahwa Chelsea telah mengajukan tawaran resmi kepada Direktur Olahraga Barca, Andoni Zubizarreta. Menurut kubu Nou Camp tersebut, tawaran Chelsea ditolak mentahmentah sembari memberitahukan nilai klausul penglepasan pencetak gol terbanyak Timnas Spanyol tersebut mencapai 178 juta pound (Rp2,4 triliun). Selain mengejar Villa, Chelsea juga ikut bersaing dengan Barcelona dan Manchester City untuk mendapatkan winger Timnas Chile dan Udinese, Alexis Sanchez. Meski Chelsea dan City mengajukan tawaran yang lebih besar dari Barca, pemain berusia 22 tahun tersebut tak tertarik pindah ke Liga Premier. Dari Manchester, saat semua orang sedang memperhatikan usaha United memburu Samir Nasri, diam-diam Sir Alex Ferguson justru mengajukan tawaran untuk pemain muda Barca. Setan Merah dikabarkan mengajukan tawaran sebesar 15 juta pound (Rp205,7 miliar) untuk Thiago Alcantara. Barca sendiri keberatan melepas bintang Timnas Spanyol di Piala Eropa U-21 tersebut, meski tawaran MU lebih besar dibandingkan klub peminat lainnya. Barca khawatir kekuatan MU di Liga Champions akan semakin bertambah seiring kedatangan Alcantara. (m33/ini)

Villas-Boas Pecat Asisten Pelatih LONDON (Waspada): Manajer baru Chelsea, Andre Villas-Boas (foto), diberitakan Telegraph telah memecat asisten pelatih, Paul Clements. Mereka menilai Villas-Boas bertindak demikian untuk menegaskan posisinya sebagai pemegang kekuasaan. Villas-Boas direkrut Chelsea dari FC Porto pekan lalu. Meski datang setelah membawa FC Porto menjuarai Primeira Liga, Taca de Portugal, dan Liga UEFA, sejumlah kalangan menilai Villas-Boas akan kesulitan memimpin The Blues. Pasalnya, sang pelatih baru berusia 33 tahun atau sebaya dengan sejumlah pemain senior Chelsea, semisal John Terry (30), Didier Drogba (33), dan Frank Lampard (33). Selain itu, mengacu pemberitaan di Inggris, pemain-pemain senior tersebut berpengaruh terhadap pertimbangan pemilik klub, Roman Abramovic, termasuk dalam soal pelatih. Sejumlah tokoh sepakbola Inggris, misalnya Ray Wilkins yang juga mantan asisten pelatih Chelsea, mengatakan Villas-Boas harus bisa menjadikan dirinya sebagai “Raja Kamar Ganti” sebelum bicara soal sukses atau gelar juara. (m33/telegraph)

AP

River Plate Turun Kasta, Penonton Rusuh BUENOS AIRES (Waspada): Salah satu klub terbesar di Argentina dan wilayah Amerika Selatan, River Plate, harus menerima kenyataan pahit setelah kena degradasi dari Primera Division, Senin (27/6). Ratusan fans klub tersebut langsung terlibat bentrok dengan polisi di luar stadion. River Plate terdegradasi setelah cuma bisa bermain 1-1 dalam laga playoff menghadapi Belgrano dalam perebutan tiket di Primera Division Liga Argentina. Hasil imbang tersebut membuat Los Millonarios dipastikan turun kasta ke Primera B Nacional karena kalah 0-2 di leg pertama. Ini menjadi pertama kali sepanjang 110 tahun sejarah perjalanan klub tersebut harus menerima pil pahit terlempar dari persaingan divisi teratas Liga Argentina. Sebuah kenyataan yang sulit diterima fans mengingat River Plate merupakan salah satu klub tersukses di Argentina dengan telah mengumpulkan 33 gelar liga, dua titel Copa Libertadores serta sekali kampiun Piala Interkontinental (cikal bakal Piala Dunia PENDUKUNG setia River Plate melampiaskan amarahnya setelah tim kesayangan mereka harus degradasi dari Primer Divison Liga Argentina di Monumental Stadium, Buenos Aires, Senin (27/6). -AP-

Antarklub). Bertanding di Stadion Monumental, River Plate sempat membuka harapan bertahan di kasta teratas setelah Mariano Pavone membuka keunggulan di menit keenam. Namun, Guillermo Farre mampu menyamakan kedudukan menjadi 11 menyusul blunder barisan pertahanan tuan rumah. Skor 1-1 bertahan hingga laga tuntas dan River Plate terdegradasi karena kalah agregat 1-3.

Hasil tersebut langsung menyulut kemarahan sekitar 60.000 fans yang memadati stadion. Bahkan sebelum peluit panjang dibunyikan wasit, penonton mulai bertindak rusuh dengan melempar berbagai benda ke dalam lapangan. Meski laga bisa diselesaikan hingga 2x45 menit, pemain kedua tim sempat tertahan untuk meninggalkan lapangan. Beberapa pemain River Plate, termasuk kiper Juan Pablo Carrizo,

AP

terpukul dengan hasil laga tersebut dan meneteskan air mata. Pemain kedua tim akhirnya bisa menuju ruang ganti dengan mendapat kawalan polisi. Sementara itu, di luar stadion kerusuhan yang lebih besar terjadi akibat fans dan polisi bentrok. Seperti dikutip dari Reuters, banyak fans mengalami cedera akibat kerusuhan itu kendati belum diketahui adanya korban jiwa dalam kejadian tersebut. (m33/goal)

BUENOS AIRES (Waspada): Pelatih Timnas Brazil, Mano Menezes, menyiapkan formasi 4-2-1-3 untuk menghadapi Copa America 2011. Menezes pun memberi sinyal Robinho, Neymar, dan Alexandre Pato akan didukung Ganso di lini kedua. Sang pelatih mengungkapkan, taktik ini akan digunakan sejak awal pada laga kontra Venezuela, 3 Juli mendatang. Pelatih berusia 49 tahun itu juga menjelaskan formasi 4-2-1-3 juga cocok dengan karakteristik pemain yang memperkuat tim Samba saat ini. “Kami baru menjalani latihan yang lebih komplet dalam hal taktik, formasi yang mirip sekali dengan yang akan kami gunakan pada debut nanti. Mulai dari sini kami akan mengembangkan idenya, mematangkannya, dan melakukan koreksi,” paparnya, Senin (27/6). “Kami sudah pernah bermain seperti ini, lawan Belanda contohnya. Kami gagal menang (berakhir 0-0), tetapi kami bisa menerapkannya dengan baik di babak kedua,” lanjutnya. Menezes juga pernah menempatkan Paulo Henrique Ganso di belakang Robinho, Neymar, dan Pato, Agustus lalu, saat raksasa Amerika Selatan tersebut menang 2-0 atas Amerika Serikat (AS).

Di lain pihak, Fabio Aurelio menilai Copa America 2011 yang digelar 1-24 Juli mendatang akan menjadi tolok ukur kualitas tim nasional Brazil untuk Piala Dunia 2014. Ini mengingat Brazil akan tampil di ajang tersebut tanpa melewati babak kualifikasi. “Aku pikir Copa America dilihat seperti Piala Eropa di sini. Tak banyak kesempatan menyiapkan diri (untuk Piala Dunia). Dengan begitu, Copa America adalah kesempatan baik melihat seberapa jauh tim bisa melangkah. Orang-orang sudah menatap Piala Dunia 2014, jadi Copa America sangat menarik dan aku sangat menantikannya,” ungkap Aurelio. “Sebagian besar pemain masih sangat muda, tetapi sangat berbakat. Mereka berpotensi menjadikan Brazil sebagai tim besar 2014 nanti. Jadi, aku pikir ini adalah alasan kami juga mengharapkan hasil positif di Argentina nanti sebagai ujian besar pertama bagi generasi baru Brazil,” pungkas mantan pemain Valencia tersebut. Di Copa America nanti, Brazil merupakan tim unggulan bersama dengan tuan rumah Argentina dan Uruguay. Robinho cs pun berada di Grup B bersama dengan Paraguay, Ekuador, dan Venezuela. (m33/rtr)


Sport

A6

WASPADA Selasa 28 Juni 2011

Kate-William Motivator Murray WIMBLEDON, Inggris (Waspada): Hadirnya Pangeran William dan Duchess of Cambridge, Kate Middleton ternyata melecut semangat petenis Inggris Raya, Andy Murray. Alhasil, Murray menyingkirkan petenis Prancis Richard Gasquet 7-6, 6-3, 6-2 untuk mencapai perempatfinal Wimbledon 2011, Senin (27/6). Unggulan keempat asal Skotlandia itu tampil cekatan menghadapi ancaman lawan. Andalan tuan rumah itu pun mengambil peluangnya pada kondisi yang sangat panas, sementara Gasquet yang memaksa Murray bermain lima set di Wimbledon 2008 menyianyiakan beberapa peluang dan

terlihat tidak pernah percaya diri. “Saya senang dengan servis saya. Saya dapat memukul bola dari belakang lapangan lebih bagus pada awal pertandingan, tapi senang cara menyelesaikan permainan tadi,” kata Murray yang selanjutnya akan menghadapi petenis non unggulan

asal Polandia, Lukasz Kubot, atau Feliciano Lopez (Spanyol). Sebelumnya, Bernard Tomic meneruskan langkah mengejutkan di Wimbledon tahun ini dengan lolos ke perempatfinal. Petenis kualifikasi asal Australia ini menjungkalkan Xavier Malisse (Belgia) 6-1, 7-5, 6-4 pada babak keempat. Tomic merupakan petenis kualifikasi pertama yang mencapai delapan besar di Wimbledon sejak Vladimir Voltchkov (2000). Selain itu, Tomic sudah menjadi petenis termuda yang mencapai babak keempat sejak Michael Chang pada 1990 dengan menumbangkan peringkat lima dunia, Robin Soderling. Menariknya, petenis remaja

tersebut akan menghadapi unggulan kedua yang juga jawara Australia Terbuka 2011, Novak Djokovic. The Djoker asal Serbia itu sendiri melangkah pasti ke babak delapan besar dengan menyingkirkan petenis Prancis Michael Llodra 6-3, 6-3, 6-3. Tomic, peringkat 158 dunia, mengatakan dirinya sangat menantikan pertandingan pertamanya di perempatfinal turnamen grand slam. Di babak pertama, petenis berusia 18 tahun itu juga mengalahkan pemain veteran dari Rusia, Nikolay Davydenko. Bahkan, calon bintang dunia itu telah memenangi gelar junior Australia dan AS Terbuka. (m33/ap)

Reuters

DUCHESS of Cambridge, Kate Middleton (kiri), didampingi suaminya yang juga Pangeran William menyaksikan duel petenis Inggris Andy Murray melawan Richard Gasquet (Prancis) di London, Senin (27/6).

Reuters

Nasibmu Wozniacki… WIMBLEDON, Inggris (Waspada): Kekalahan di babak keempat kembali menjadikan ratu tenis dunia, CarolineWozniacki (foto), pulang dengan tangan hampa dari Wimbledon 2011, Senin (27/6). Selain itu, juara bertahan Serena Williams bernasib serupa. Status sebagai petenis terbaik dunia tanpa satu pun gelar grand slam masih disandang Wozniacki menyusul kekalahan 6-1, 6-7 (5), 5-7 dari unggulan ke-24 asal Slovakia, Dominika Cibulkova. Ironisnya, Wozniacki harus menunggu setahun lagi untuk merasakan nuansa babak delapan besar di All England Club. Satu-satunya partai puncak di ajang grand slam yang pernah ditembus Si Ratu Tenis Denmark itu adalah final AS Terbuka 2009. Di final itu, Wozniacki pun harus kalah dari petenis Belgia Kim Clijsters. Sementara itu, Serena Williams sempat lolos dari empat match point sebelum akhirnya kalah 3-6, 6-7 dari petenis Prancis Marion Bartoli. Jagoan Amerika Serikat (AS) yang juga unggulan ketujuh itu sempat mengalami masalah kesehatan serius dan harus bersusah payah melawan Bartoli yang ditempati sebagai unggulan sembilan kali ini. “Mengalahkan Serena seperti mimpi yang menjadi kenyataan, dia salah satu juara terhebat di era Open. Secara mental ini tidak mudah, tapi saya berhasil melakukannya dan sangat senang,” kata Bartoli.

Tragisnya, kakak Serena yang tengah mengincar gelar keenamnya, Venus, juga harus angkat koper dari Wimbledon. Melawan petenis Bulgaria Tsvetana Pironkova, Venus tumbang 6-2, 6-3 yang juga skor sama tahun lalu saat dirinya pun tumbang dari lawan serupa. Sebaliknya, unggulan keempat Victoria Azarenka menjadi petenis putri pertama yang berhasil meloloskan diri ke babak perempatfinal. Azarenka menang atas petenis Rusia, Nadia Petrova yang menyamai prestasi gemilangnya di All England Club lolos ke babak delapan besar. Melawan Petrova, petenis Belarus ini menang straight set 6-2, 6-2. Selanjutnya, unggulan keempat itu akan menanti tantangan dari petenis Austria, Tamira Paszek. Tiket perempatfinal digapai Paszek dengan menumbangkan Ksenia Pervak (Rusia) 6-2, 2-6, 6-3. Keberhasilan menapak ke babak delapan besar juga digenggam Maria Sharapova. Petenis cantik asal Rusia ini menjaga asa merengkuh gelarWimbledon keduanya ketika menundukkan Peng Shuai (China) 6-4, 6-2. Adapun kemenangan Sharapova sedikit banyaknya dipengaruhi dukungan dari sang tunangan, Sasha Vujacic. Hasil lainnya, Petra Kvitova (Rep Ceko) mengalahkan petenis Belgia Yanina Wickmayer 6-0, 6-2. Sementara itu, petenis muda Jerman Sabine Lisicki sukses menghempaskan Petra Cetkovska (Rep Ceko) 7-6 (3), 6-1. (m33/ap)

Jalan Santai HUT DS, Bhayangkara Meriah LUBUKPAKAM (Waspada): Sekira 6.000 peserta terdiri dari kalangan PNS jajaran Pemkab Deliserdang, TNI/Polri, BUMN/ BUMD, pelajar serta masyarakat Lubukpakam dan sekitarnya mengikuti gerak jalan santai, senam bersama, lomba joget balon serta pemusnahan Narkoba dan Miras di Lapangan Alun-alun Pemkab Deliserdang di Lubukpakam, Minggu (26/6). Kegiatan dilaksanakan dalam rangka HUT Kabupaten

Deliserdang ke-65 dan HUT Bhayangkara ke-65 yang diperingati setiap 1 Juli serta peringatan Hari Anti Narkotika Internasional (HANI). Peserta dilepasWabup Deliserdang H Zainuddin Mars didampingi Ketua DPRD Hj Fatmawati Takrim, dan lainnya. Gerak jalan santai menempuh rute 10 Km diawali dari Lapangan Alun-alun mengelilingi kompleks kantor bupati, perumahan Pemda, Kelurahan Syahmad, jalan lintas Medan-Lubuk-

Problem Catur

pakam dan finish di Alun-alun Pemkab Deliserdang. Pada kesempatan itu, Wabup juga mengunjungi pelaksanaan khitan masal yang dilaksanakan pemerintah Kecamatan Lubukpakam bekerja sama dengan Perwiritan Akbar dan Vihara Dharma Shanti di Gedung PKK Lubukpakam. Camat Lubukpakam, Drs Citra Efendy Capah MSP, menjelaskan sebanyak 263 anak mengikuti khitanan massal tersebut dan berasal dari beberapa desa/

TTS TOPIK

kelurahan di wilayah Kecamatan Lubuk Pakam dan Kecamatan Beringin. Anak-anak yang dikhitankan bukan hanya berasal keluarga kurang mampu, tapi juga dari keluarga mampu. “Jadi tidak ada perbedaan, karena kegiatan ini kita utamakan adalah kebersamaan,” kata Citra seraya menyampaikan apresiasi kepada semua pihak yang mendukung kegiatan tersebut. (a06)

Sudoku

POLITIK & HUKUM Mendatar

Putih melangkah, mematikan lawannya dua langkah.’

Jawaban di halaman A2.

1. Penggal; Bentuk hukuman mati di Arab Saudi. 6. Partai yang terus dikritisi oleh media massa yang pemiliknya dari partai lain. 8. Nama wanita Indonesia yang dieksekusi pancung di Arab Saudi baru-baru ini. 10.Pernyataan setuju secara lisan dari seluruh peserta rapat dsb tanpa melalui pemungutan suara. 11. Pandangan politik sempit, picik, terbatas. 13.Partai Nahdlatul Ummat. 14.Masa peristirahatan dari kegiatan bersidang (parlemen). 15.Pelaksana eksekusi mati. 17.Nama mantan bendahara umum Partai Demokrat yang dikabarkan menikmati kebebasan di Singapura. 19.Ilmu tentang apa yang baik dan yang buruk dan tentang hak dan kewajiban moral. 21.Nama mantan karyawati Citibank yang dihebohkan bukan karena kasusnya, tapi payudaranya yang besar. 24.Pengampunan terhadap terhukum dari Presiden. 25.Alat pemenggal kepala yang digunakan dalam revolusi Prancis, ide seorang dokter (Dr. Joseph

Ignace Guillotin). 26.Partai Amanat Nasional.

Menurun 1. 2. 3. 4.

Lengkap. Sidang __. Central Intelligence Agency. Negara Islam Indonesia. Pengelompokan kekuasaan negara atas kekuasaan eksekutif, legislatif dan yudikatif (dua kata, tulis tanpa spasi). 5. Tanda kelengkapan setiap angkatan di lingkungan TNI; Lambang: ____ keadilan ialah pedang dan timbangan. 6. Perjanjian; Transaksi (Inggris populer). 7. Pencuri. 9. Putusan hakim yang diikuti oleh hakim lain dalam memutuskan perkara serupa. 12.Case/kasus (bahasa Malaysia). 15.Negara yang melaksanakan eksekusi pancung terhadap pelaku pembunuhan. 16.Hak perlindungan kepada seseorang dari peniruan, pembajakan dsb. 18.Gelar bangsawan Bugis. 20._____ Rais, tokoh reformasi. 22.Panggilan akrab Abu Rizal Bakrie, ketum Golkar. 23.Papua New Guinea.

Isi kotak kosong dengan angka 1 sampai 9. Tidak boleh ada pengulangan angka mendatar, menurun, maupun di dalam kotak 3x3 bergaris tebal. Tidak ada keterlibatan matematika, hanya membutuhkan pertimbangan dan logika. Tingkat kesulitan: mudah (**), bisa diselesaikan dalam waktu tak sampai tujuh menit. Jawabannya lihat di halaman A2 kolom 1.

4

3

5 6 8 9 3

7

4 2 5 6 3 5 8 4 2 2 8 4 7 5 1 2 9

6

7 4 2 1 7 5 3 4 1 9 2 e210


Sport

WASPADA Selasa 28 Juni 2011

A7

Amura Sumut Raih Perak Kejurnas Karate Junior Dan Kadet MEDAN (Waspada): Pengurus Perguruan Amura Karate-Do Indonesia Sumatera Utara bersyukur atas prestasi atletnya, Donny Satria, yang sukses mempersembahkan satu medali perak pada Kejurnas Junior/Kadet Piala Mendagri dan Mendiknas di Kalsel, 23-25 Juni lalu. “Prestasi yang dicapai Donny harus menjadi motivasi bagi karateka Amura Sumut lainnya

untuk turut berprestasi di eventevent nasional mendatang,” ujar Ketua Harian Pengprov Amura

Sumut, Letkol Kav Sutrisno Wibowo, saat menyambut kepulangkan Donny di Bandara Polonia Medan, Senin (27/6). Didampingi Sekretaris Umum Fachrur Rozi, Sutrisno mengatakan Donny merebut medali perunggu pada nomor kumite 35 kg junior putra. “Kini, Donny menjadi aset potensial yang harus dibina lebih lanjut agar kelak menjadi kebanggaan

PB Diponegoro Kisaran Siapkan 12 Atlet KISARAN(Waspada): PB Diponegoro Kisaran mendaftarkan 12 pebulutangkis pelajar mengikuti Kejuaraan Bulutangkis Pelajar dan Mahasiswa seSumatera Utara “Potensi Utama Open 2011” di GOR PB Griya, Jl T Amir Hamzah Medan, 4-8 Juli mendatang. Kejuaraan yang akan diikuti pelajar dan mahasiswa se-Sumut ini mempertandingkan

Kelompok Umur (KU), tunggal, dan ganda. Pelatih PB Diponegoro Kisaran, Drs Ady Hasan, menyatakanpersiapananakdidiknya sudah prima menuju kejuaraan saat liburan sekolah itu. Ady berharap pemainnya dapat memperoleh hasil maksimal sekaligus memperlihatkan hasil latihan selama ini di hall Perguruan Diponegoro Kisaran. Dikatakan, pemain yang di-

Waspada/Nazelian Tanjung

KAPOLRES Binjai, AKBP Dra Rina Sari Ginting, melepas peserta sepeda santai dalam rangka HUT Bhayangkara ke 65, Minggu (26/6).

Ratusan Peserta Ikut Sepeda Santai Binjai BINJAI (Waspada): Ratusan masyarakat di Kota Binjai ikut kegiatan sepeda santai yang digelar Polres Binjai dalam rangka HUT Bhayangkara ke-65 di lapangan Mapolres Binjai, Minggu (26/6) lalu. Peserta dilepas Kapolres Binjai, AKBP Dra Rina Sari Ginting. Dalam sambutannya, Rina Sari menyampaikan ucapan terima kasih kepada peserta yang antusias turut serta bersepeda santai memeriahkan HUT Bhayangkara ke-65. Menurut Kapolres, bersepeda santai dapat membina kebugaran dan menghilangkan polusi udara, menekan penggunaan bahan bakar minyak serta sarana menjalin keakraban antarinstansi dengan masyarakat. Mewakili panitia, Ipda AP Sitepu SH menyebutkan rute peserta diawali dari Mapolres Binjai menuju Jalan Samanhudi, Jl Rambutan, Jl Jamin Ginting, Jl Diponegoro, Jl Ir H Juanda, Jl Imam Bonjol, dan finish di lapangan Mapolres Binjai. (a05)

daftarkan adalah Hudy, Willy Chandra, M Adlin, Ibnu Anggara, Frans, Anas Azura (putra), Luvita, Sheila Malisa, Awalia Sucianti, Cut Nada Syifa, Tasya Juwita, dan Meilita Yulceria S (putri). (a31)

daerah dan nasional,” katanya. Fachrur Rozi menambahkan, selain Donny, Amura Sumut juga diwakili atlet junior Anggoro Tyas Anggodo yang belum mampu mempersembahkan prestasi. Keduanya tampil di Kejurnas membela Perguruan Amura. “Prestasi ini sangat membanggakan seiring tekad Amura Sumut untuk terus mengembangkan pembinaan di daerah kabupaten/kota,” ucapnya. Donny sendiri mengaku bersyukur atas prestasi yang telah dicapai. “Ini gelar pertama saya di tingkat nasional. Kekalahan saya di final membuat saya semakin termotivasi untuk bisa merebut juara di event mendatang,” ucap putra pasangan Alamsyah dan Sri Hartati ini. (m42)

Waspada/Bustami Chie Pit

PEMAIN SSB Dispora Hoki Asahan dan SSB PTPN IV Bah Jambi Simalungun diabadikan bersama di Stadion Mutiara Kisaran, Asahan, Minggu (26/6).

SSB Dispora Hoki Siap Tarung Jelang Piala Summer Inalum KISARAN (Waspada): SSB Dispora Hoki Asahan mempersiapkan diri jelang Piala Summer Inalum 2011 dengan menggelar laga ujicoba melawan SSB PTPN IV Bah Jambi, Simalungun, di Stadion Mutiara Kisa-

ran, Asahan, Minggu (26/6). Pembina SSB Dispora Hoki Asahan, HM Syafei SSos yang juga Kadis Porabudpar Asahan, menyatakan ujicoba dilakukan agar anak-anak menampilkan permainan terbaiknya saat ter-

jun di Piala Summer Inalum, 810 Juli mendatang. Di kategori U-10 tahun, Dispora Hoki yang diasuh Sukimin menang 1-0 dan bermain imbang 1-1 pada U-11. Sementara itu, SSB PTPN IV Bah Jambi U-

12 mengalahkan Dispora Hoki 4-0 dan 4-1 di kelompok U-14. Kepada Waspada, pelatih PTPN IV Bah Jambi, Surya, menyatakan puas dengan hasil yang diraih anak-anak didiknya tersebut. (a31)


A8

Sakti Pilih PSMS

MEDAN (Waspada): Kiprah Saktiawan Sinaga yang semakin beken di kancah sepakbola nasional membuat banyak klub kepincut. Tak terkecuali klub Liga Premier Indonesia (LPI), Bintang Medan, yang tengah melakukan pembenahan menyambut putaran kedua. Sakti sendiri memang sangat ingin kembali ke berkiprah di SALAH satu aksi selebrasi gol dari Saktiawan Sinaga (kanan). -Waspada/Austin Antariksa-

Medan, kampung halamannya. Namun pemain yang kini membela Semen Padang ini menolak jika membela Bintang Medan. Alasannya, ia memilih bermain untuk PSMS Medan karena lebih cinta Ayam Kinantan. Sakti memang pemain yang dibesarkan PSMS. Namanya beberapa tahun belakangan

memang kerap dihubunghubungkan dengan PSMS,

Sport khususnya musim lalu. Namun, ia gagal kembali karena tak melihat keseriusan pengurus. “Harapan aku buat PSMS, lebih baiklah dari sebelumnya. Malu kita sama nama besar PSMS tapi mainnya di Divisi

Utama,� ujarnya sembari mengaku belum ada kontak dengan klub lain, Senin (27/6). Sakti terakhir memperkuat PSMS di Liga Indonesia 2007. Ketika itu, PSMS sukses menjadi runner-up. (m33)

WASPADA, Selasa 28 Juni 2011

Pasang Iklan

Telp. 4528431 HP. 081370328259 Email: iklan_waspada@yahoo.co.id


Medan Metropolitan

WASPADA Selasa 28 Juni 2011

B1

Sampah Pantai Belawan Akan Dibersihkan BELAWAN ( Waspada): Pemko Medan bekerjasama dengan HNSI segera melakukan pembersihan sampah-sampah di Pantai Belawan sekaligus menggelar arung pantai di Kampung Kurnia, Kelurahan Belawan Bahari, Kecamatan Medan Belawan. Ketua penyelenggara acara sekaligus Wakil Ketua DPC Himpunan Nelayan Seluruh Indonesia (HNSI) Kota Medan Alfian MY mengatakan, Gerakan Bersih Pantai dan Arung Pantai Belawan 2011 itu akan diikuti sekitar 500 peserta dari nelayan serta sejumlah instansi terkait di antaranya Polair dan Lantamal I. Walikota Medan Rahudman Harahap akan melepas peserta. Kegiatan itu diadakan dalam bentuk perlombaan dengan mengumpulkan sampah plastik terbanyak dengan mengarungi Sungai Deli mulai dari kawasan Kampung Kurnia hingga pantai laut Belawan yang merupakan alur perlombaan. “Peserta terbanyak mengumpulkan sampah akan mendapat hadiah berupa piala tetap, piala bergilir dan dana tunia,” kata Alfian MY didam-

pingi sekretarisnya Awal Yatim, kemarin. Dikatakan, acara digelar dalam rangka menyambuat HUT Kota Medan Ke-421 guna melindungi Sungai Deli dan laut Belawan dari pencemaran dan tumpukan sampah yang belakangan ini semakin banyak di sepanjang alur sungai dan pantai. Rencananya, seluruh sampah plastik yang terkumpul akan dijual untuk menambah biaya pendidikan anak nelayan berprestasi dan dari keluarga kurang mampu yang selama ini telah dibina DPC HNSI Kota Medan. “Allahamdulillah saat ini HNSI Kota Medan telah membina 24 pelajar SLTP anak nelayan berprestasi dari keluarga kurang mampu,” timpal Ketua DPC HNSI Kota Medan Zulfahri Siagian. Gerakan Bersih Pantai dan Arung Pantai Belawan diadakan kerjasama DPC HNSI Kota Medan dan Pemko Medan. Acara itu akan digelar tiap tahun agar alur sepanjang Sungai Deli dan pantai Belawan bersih serta menjadi kawasan bebas dari limbah dan sampah mulai tahun 2012. (h03)

Izin Diskotek Super Dicabut Polisi Tetap Usut Jika Bripka Simbolon Tewas OD

Waspada/Rustam Effendi

SAMPAH menumpuk di pantai laut Belawan kawasan TPI Bagan Deli. Sampah-sampah ini akan dibersihkan dari Pantai Belawan. Foto diambil Senin (27/8)

Jelang Vonis, Terdakwa Teguk Pemutih MEDAN (Waspada): Seorang terdakwa kasus narkoba jenis sabu-sabu seberat 3,2 gram, Arief Pirmansyah, 26, meneguk cairan pemutih jenis Bayclean di ruang sidang Pengadilan Negeri Medan, Senin (27/6). Dalam kondisi sekarat, Arif dilarikan petugas tahanan ke Rumah Sakit Umum (RSU) Malahayati Medan. Terdakwa

meneguk cairan tersebut beberapa saat menjelang sidangnya dengan agenda putusan. Menurut keterangan di PN

KOWRI Kunjungi Waspada MEDAN (Waspada): Dewan Pimpinan Cabang KorpsWartawan Republik Indonesia (DPC KOWRI) Medan mengunjungi Harian Waspada di Jalan Letjen Suprapto Medan, Senin (27/6). Rombongan DPC KOWRI Medan dipimpin Ketum Mangasi Tua Felix Sidabutar, Sekum Donald Christian Sipahutar serta Wakil KetuaYahya Payungan Lubis, Robensopn Sidabariba, Ketua Bidang Peranan Wanita Marwina Sannova, Chandra Siregar, bidang kaderisasi Thamrin Samosir. Rombongan diterima Ka. Humas Waspada H.Erwan Effendi dan wartawan H. Suyono di ruang rapat lantai 4. Kata Mangasi, kunjungan ke Waspada karena koran ini sebagai surat kabar nasional dan tertua di Sumatera Utara yang terbit di daerah dan diangap paling senior, di samping memiliki eksistensi dalam dunia jurnalistik. KOWRI sebagai wadah wartawan baru seumur jagung ingin menimba ilmu dan mencari masukan positif tentang profesi jurnalistik ke depan. Kunjungan ini juga untuk mensosialisasikan pelantikan dan pengukuhan pengurus DPC KOWRI Medan di Hotel Candi Jalan Darussalam No. 124 Medan, Sabtu (9/7) mendatang. Visi dan misi KOWRI antara lain secara moral ingin mengawal sekaligus melakukan monitoring terhadap kinerja pemerintah yang selama ini dianggap sebagai mitra. “KOWRI perlu saran masukan dari para senioren termasuk Waspada dan perlu mengadopsi apa yang telah dilakukan oleh Persatuan Wartawan Indonesia (PWI) yang telah diakui kredibiltasnya di Indonesia,” ujarnya. Ka. Humas Waspada H. Erwan Effendi meminta agar KOWRI dapat menjaga amanah, dalam menyampaikan sesuatu berita jangan beropini, tapi harus benar (siddiq) karena kepercayaan dan kebenaran itulah yang objektif. Diimbau agar KOWRI gencar melakukan dialog untuk mengup date ilmu jurnalistik sebagai bekal tugas-tugas wartawan. Apalagi, media massa cukup berperan membentuk karakter bangsa. (m24)

Pemprovsu Terus Tuntut DBH MEDAN (Waspada): Pemerintahan Provinsi Sumatera Utara terus memperjuangkan Dana Bagi Hasil yang ditetapkan untuk komoditas perkebunan, khususnya perkebunan kelapa sawit yang merupakan andalan Sumut dan nasional. “Perjuangan ini memang terus kami sampaikan pada forumforum resmi maupun secara informal kepada pejabat terkait di pusat,” kata Plt Gubsu Gatot Pujonugroho pada acara seminar tentang perimbangan keuangan dana bagi hasil di Hotel Arya Duta Medan yang diselenggarakan KAHMI, kemarin. Gatot menegaskan, kontribusi besar Sumut khususnya sebagai salah satu daerah terbesar penghasil CPO di Indonesia menjadi dasar agar Sumut bisa memperoleh DBH Perkebunan. Hal ini, jelasnya, mengingat banyaknya devisa yang disumbangkan Sumut atas peran selama ini yang mengekspor CPO secara rutin dalam jumlah yang banyak. Dari hasil ekspor tersebut, pemerintah pusat telah menarik Bea Keluar (BK) ekspor CPO yang jumlahnya diperkirakan sudah mencapai Rp60 triliun sejak BK yang dulunya bernama Pungutan Ekspor (PE) tersebut diberlakukan. Sebelumnya, Ketua KAHMI Sumut Rusdi Lubis dalam kesempatan tersebut mengatakan seminar ini diharapkan menjadi momentum untuk menampung aspirasi dari perwakilan stakeholder yang hadir pada acara tersebut untuk menyatukan tekad meminta DBH yang dialokasikan ke Sumut.(m28)

Reuni Akbar Alumni UISU MEDAN (Waspada): Satu UISU, Satu Hati adalah agenda penting dalam upaya menyukseskan acara Reuni Akbar Alumni Universitas Islam Sumatera Utara (UISU) yang akan digelar di salah satu hotel berbintang di Medan pada 3 September 2011. “Menjalin silaturahim untuk meningkatkan ukhuwah dan rasa persaudaraan itu amat penting. Panitia dalam hal ini hanya memfasilitasi tempat dan acara seakrab mungkin,” kata Ketua Panitia Reuni Akbar Alumni UISU Khairun Nazirin didampingi Sekretaris Panitia Raden Deni Admiral, Mara Sakti, Riady, Zulfikri, Muhammad Syah, Sutiran, Ilham Candra, Samsul Bahri Pane kepada wartawan belum lama ini. Dikatakan, rencana reuni akbar ini bermula dari aspirasi yang berkembang di jejaring sosial (face book) Grup UISU (Zero To Hero) yang dikunjungi sekitar 750 anggota grup yang merupakan alumni UISU dari berbagai stambuk (angkatan).“Melalui aspirasi lewat jejaring sosial itu juga kita pilih saudara Khairun ST sebagai ketua panitia,” kata Samsul Bahri Pane yang dipercaya sebagai SC. Fokus acara, lanjut Raden, silaturahim antara alumni. Bayangkan berapa jumlah alumni UISU sekarang sejak berdirinya UISU pada tahun1952.AlumniUISUadadimana-mana,tapihariinikitamengajak mereka untuk ada di Satu UISU, Satu Hati. Karena itu, kita berharap alumni UISU menghadiri reuni alumni dari seluruh angkatan ini. Bagi alumni yang membutuhkan informasi dapat mengunjungi (face book)diGrupUISU(ZeroToHero)dankontakpersonpanitiapelaksana Hp 081396249428, 081376438098, 085361313220.(m21)

Medan, peristiwa bermula saat Arief dipanggil pegawal tahanan untuk keluar dari ruang sel sementara PN Medan untuk mengikuti persidangannya di ruang Kartika. Saat berada di ruang sidang, Arif didampingi ibunya, Dewi Yanti. “Begitu keluar dari ruang sel sementara , anak saya duduk di sebelah saya sambil menunggu persidangan. Namun, tiba-tiba, ia mengambil sesuatu dari kantongnya dan meminumnya,” terang Dewi. Semula, katanya, mengira anaknya minum air mineral. Setelah meneguk cairan itu,

tambahnya, anaknya langsung kejang-kejang dengan mulutnya berbuih. “Ia sempat diberikan pertolongan pertama di PN. Tapi, tubuhnya tetap kejang-kejang sehingga dievakuasi ke RS Malahayati,” tutur Dewi. Menurutnya, pasca menjalani sidang pada 8 Juni 2011, kejiwaan Arief memang terganggu. Bahkan, lanjutnya, anaknya pernah menjalani perawatan dengan keadaan diikat di rumah sakit Bhayangkara Poldasu. “Anak saya sakit, seperti orang stres. Situasi ini semakin parah setelah pembacaan tun-

tutan lima tahun. Mungkin semakin takut berlebihan mendengar akan divonis lima tahun juga oleh hakim,” kata Dewi. Terkait kasus itu, Arief masih mendapatkan perawatan intensif dari tim medis. Sebelumnya dalam kasus tersebut, Arief dituntut jaksa penuntut umum ( JPU) Oki Permana penjara selama lima tahun dikurangi selama dalam tahanan dan denda Rp 800 juta. Ia dinilai terbukti mengonsumsi sabu-sabu dan ganja seberat 3,2 gram. Akhirnya majelis hakim memutuskan sidang digelar setelah terdakwa sehat. (m49)

MEDAN (Waspada): Polda Sumut bersama Dinas Pariwisata Medan akan memeriksa kembali izin operasinal Diskotek Super di Jalan Nibung I Medan Petisah tempat meninggalnya Bripka Beni Simbolon, anggota Provos Polsek Percut Seituan. “Akan diperiksa izin operasionalnya karena ketentuan dari Dinas Pariwisata izinnya sampai pukul 02:00, sementara waktu korban ditemukan terjatuh dan meninggal sekitar pukul 04:00,” kata Kabid Humas Poldasu AKBP Heru Prakoso di Mapoldasu, Senin (27/6). Dia mengatakan, akan bertindak tegas terhadap tempat-tempat hiburan yang menyalahi aturan itu, terutama pada jam kerja. “Tindakan tegas merupakan pencabutan izin, dan diproses hukum jika ditemukan tindak pidana sebagai penyebab kematian korban,” katanya. Namun Heru belum dapat memastikan penyebab kematian korban. Karena hasil autopsi dari rumah sakit belum diperoleh. “Jika dikarenakan over dosis (OD) penggunaan narkoba, maka pihak kepolisian akan memproses kasusnya. Akan diselidiki darimana korban memperoleh narkoba tersebut,” tandasnya. Tetapi, kata Heru, jika penyebabnya karena penyempitan jantung, maka proses hukum tidak dilakukan. Dia menambahkan, berdasarkan keterangan

dari Polsekta Percut Seituan, tempat korban berdinas, sebelum meninggal korban sempat melakukan razia di wilayah hukumnya. Setelah itu korban pulang ke rumah dan berpamitan kepada istrinya menemui temannya. “Korban hanya bilang sama istrinya mau menemui temannya, tapi tidak dikasi tahu tempatnya, hingga akhirnya ditemukan di diskotik super,” sebut Heru. Pihak kepolisian, sebutnya, telah mengambil keterangan enam saksi; tiga pekerja diskotek dan tiga petugas kepolisian dari Polsek Medan Baru dan Polsek Percut Sei Tuan. Sementara di sekitar lokasi korban terjatuh tidak ditemukan zat atau benda terlarang. Di meja korban hanya ditemukan minuman kaleng dan mineral. Kadis Pariwisata Medan Busral Manan ditanya terpisah mengatakan, pihaknya akan memberikan teguran tertulis kepada manajemen Diskotek Super karena beroperasi menyalahi izin waktu tayang. “Karena batasannya sampai pukul 02:00. Karena itu kita akan memberikan teguran tertulis,” kata Manan. Sebelumnya, Bripka Beni Simbolon jatuh dan tidak sadarkan diri di arena Diskotik Super, Minggu (26/6) sekira pukul 04:00. Diduga korban kebanyakan mengkonsumsi narkoba.(m27/m36)

Ajarkan PancasilaKewarganegaraan Di PT MEDAN (Waspada): Sebagai bangsa yang memiliki identitas khas di antara bangsabangsa di dunia, sudah selayaknya mata kuliah Pancasila dan Kewarganegaraan yang tergabung dalam mata kuliah kepribadian tetap diajarkan di Perguruan Tinggi. “Yang penting kedua mata kuliah ini harus mampu merubah sikap anak bangsa (khususnya mahasiswa) yang sudah tidak sesuai dengan filosofi Pancasila menjadi kembali ke karakter Pancasila. Mahasiswa dituntut untuk cinta tanah air dan hidup dalam kebersamaan yang harmonis serta saling menghormati dan menghargai dalam hidup di keberagaman

tersebut, untuk terus membangun bangsa dalam Negara Kesatuan Republik Indonesia,” kata Koordinator mata kuliah kepribadian pada Lembaga Ilmu-Ilmu Dasar (LIDA) Universitas Sumatera Utara Prof. Dr. Muhammad Yamin, SH, kemarin. Dia mengatakan, USU sudah siap menjalankan kuliah berkarakter bangsa dengan menempatkan mata kuliah ini sebaiknya pada semester 1, ketika pemikiran mahasiswa baru belum terkontaminasi dengan pemikiran yang serba hedonisme yang selama ini diberikan oleh alam berbangsa saat di tingkat SMA. “Kesiapan LIDA USU me-

laksanakan kuliah kepribadian ini, karena banyak dosen-dosen di USU yang dapat dijadikan contoh teladan dalam hidup bermasyarakat, kalaupun metode ajarnya tidak seperti P4 dulu namun kita yakin berhasil bila pengajarnya itu adalah orang yang pernah jadi dosen teladan dan mempunyai wawasan bernegara yang baik,” tegasnya. Ketua LIDA USU Hamonangan Nainggolan didampingi Kepala Bidang Ilmu-Ilmu Umum Humaizi menyatakan, pendidikan ini sudah harus dimulai dari sekarang di USU, tidak harus menunggu ada surat keputusan dari Dikti pun pendidikan Pancasila dan Kewarganegaraan ini harus ditingkatkan. (h02)

Waspada/Hamdani

NIKAH MASAL : Sepasang peserta nikah massal Dian Dharma Putera, 28, dan Elisa Yosepi, 25, menunjukan surat nikah seusai menjalani ijab kabul pada acara nikah massal di Lapangan Pulau Rengas, Kecamatan Medan Marelan, Senin (27/6). Sebanyak 120 pasangan mengikuti nikah massal Kota Medan kali ini.


Medan Metropolitan

B2

WASPADA Selasa 28 Juni 2011

DPRDSU Tunda Bahas Interpelasi MEDAN (Waspada): Rapat pimpinan DPRD Sumut dengan pimpinan fraksi-fraksi untuk menindaklanjuti persetujuan 16 anggota Dewan melakukan interpelasi terhadap Plt Gubsu ditunda. Penundaan itu disebabkan beberapa anggota Dewan memintamasalahinterpelasidibahas dahulu di internal fraksi. Selain itu, ketika rapat dipimpin oleh Wakil Ketua DPRDSU Sigit PramonoAsridariFraksiPKS,seluruh peserta rapat me-ninggalkan ruangan rapat. Kemudian, pimpinan sidang menutup dan menunda rapat tersebut. Sigit Pramono Asri mengatakan rapat ditunda dan akan dijadwalkan kemudian. Ka-rena beberapa peserta rapat meminta masalah interpelasi dibahas dahulu di internal fraksi. “Kalau disetujui, baru kemudian fraksi

mengaju-kan usulan resmi ke pimpinan dewan,” ujarnya. Menanggapi interpelasi adalah hak yang melekat pada diri masing-masing anggota dewan, karenanya usulan interpelasi tidak perlu mendapat persetujuan fraksi, Sigit Pramono Asri hanya menyebutkan hal itu permintaan peserta rapat. “Makanya pertemuannya kita tunda.’’ Seharusnya sesuai jadwal rapat, kemarin, agenda pertemuan membahas surat Fraksi Gerindra Bintang Bulan Reformasi. Isinya mengusulkan agar dewan menggunakan hak inter-

Perguruan Bina Santri Sambut Ramadhan MEDAN (Waspada): Perguruan Bina Santri Jalan Pasar III Medan menggelar zikir akbar, tausiyah dan doa sekaligus memperingati Israk Mikraj Nabi Besar Muhammad SAW dan penyambutan bulan suci Ramadhan di halaman sekolah itu, besok (Rabu, 29/6). Kegiatan ini juga dirangkaikan dengan syukuran satu tahun dan wisuda santri Perguruan Bina Santri, kata PembinaYayasan perguruan Bina Santri Sotar Nasution di Medan, Minggu (26/6). Tampil selaku pemimpin zikir serta penceramah Israk Miktaj Nabi Besar Muhammad SAW Ustazd KH Amiruddin MS. Dan kegiatan ini akan dihadiri Walikota Medan Rahudman Harahap dan Direktur Nasional LPPS BKPRMI Tasrifin Karim, Kemendepag Medan, dan Kadisdik Medan. Sotar mengharapkan, kegiatan ini dapat memperkokoh nilainila keimanan dan ketaqwaan baik bagi para santri yang diwisuda maupun bagi kalangan muslimin dan muslimat yang hadir. Pada kesempatan itu Sotar juga menyatakan rasa bangganya karena rata-rata anak didiknya yang akan diwisuda sudah memiliki kemampuan membaca Alquran dan membaca latin, serta berhitung dengan benar (m26)

Waspada/Amir Syarifuddin

PLT Gubsu Gatot Pujonugroho berfoto bersama pengurus IKA FH USU seusai membuka Mubes IKA FH USU, Jumat (24/6).

Indra Sahnun: Gatot Jangan Takut MEDAN (Waspada): Ketua Ikatan Keluarga Alumni (IKA) Fakultas Hukum Universitas Sumatera Utara (FH USU) periode 2008-2011 Indra Sahnun Lubis menyatakan, Plt Gubsu Gatot Pujonugroho harus berani membuat terobosan di Sumut. Sebab, katanya, seorang pemimpin harus mewariskan sesuatu hal yang berbeda ketika kelak tampuk kepemimpinan sudah berpindah kepada pemimpin lainnya. Hal ini dikatakan Indra Sahnun Lubis pada pembukaan Musyawarah Besar (Mubes) IKA FH USU di Kampus USU Medan, Jumat (24/6). “Khusus kepada Plt Gubsu saya menyarankan untuk berani membuat terobosan, jangan ada ketakutan berlebihan yang bisa berdampak pada kinerja yang hanya normatif saja,” kata Sahnun. Indra Sahnun menegaskan, terobosan-terobosan itu tentunya yang bertanggungjawab dan memberikan arah baru bagi pembangunan Sumut dan peningkatan kesejahteraan masyarakat dengan reformasi pelayanan publik di masa datang. Menanggapi hal itu, Gatot Pujonugroho menegaskan dirinya tidak pernah ragu mengambil keputusan terbaik untuk membangun Sumut, selagi keputusan tersebut tidak bertentangan dengan peraturan perundang-undangan yang berlaku. “Ini menjadi komitmen yang saya pegang teguh dalam melaksanakan tugas,” lanjutnya.(m28)

Waspada/Zulkifli Darwis

DIREKSI Pelindo I ketika menyerahkan bantuan kepada tokoh agama di daerah itu.

Pelindo I Bantu Masjid Di Bagan Deli MEDAN (Waspada): PT Pelabuhan Indonesia I (Persero) Cabang Pelabuhan Belawan memberikan material bangunan senilai Rp52 juta lebih untuk pembangunan Masjid Nurul Hilal, di Kelurahan Bagan Deli Belawan, Jumat (24/6). Penyerahan bantuan diserahkan melalui Direktur Utama PT Pelabuhan Indonesia I Harry Sutanto, disaksikan Direktur Personalia Dan Umum Paroroan Herman Harianja dan Direktur Teknik dan Operasi Iman S serta General Manager Pelabuhan Cabang Belawan Syahputra S kepada kenaziran Masjid Nurul Hilal. Direktur Utama Pelabuhan Indonesia I (Persero) Harry Susanto dalam kata sambutannya mengatakan, penyerahan bantuan ini merupakan bentuk peduli perusahaannya kepada masyarakat. Serta tanggung jawab sosial kepada rumah Allah. Direktur bersama General Manager Pelabuhan Belawan beserta seluruh karyawan mengharapkan kepada warga Belawan agar mendoakan Pelindo I ke depan semakin baik lagi, sehingga dapat meningkatkan bantuannya. Ustadz H Zainal dalam kata sambutannya mengucapkan terimakasih atas bantuan Pelindo I. Bantuan ini sangat berguna bagi pembangunan masjid Nurul Hilal yang satu satunya di daerah ini. Masyarakat merencanakan membangun baru Masjid Nurul Hilal ini dengan ukuran 25 x 15 m dan membutuhkan dana Rp1,3 miliar, namun dana yang diperoleh masih jauh dari yang dibutuhkan.(m35)

pelasinya terhadap kebijakan Plt Gubsu dalam mengangkat 110 pejabat eselon III di lingkungan Pemprovsu, belum lama ini. Selain itu, 16 anggota dewan juga telah me-nandatangani surat usulan hak interpelasi dan telah menyerahkannya kepada pimpinan dewan yang diterima Wakil Ketua DPRDSU Kamaluddin Harahap. Sementara itu, Sekretaris Fraksi PAN Irwan-syah Damanik dan Sekretaris Fraksi Partai Gol-kar Mulkan Ritonga senada mengatakan rapat ditunda karena beberapa faktor. ‘’Salah satunya memang adanya permintaan untuk dibahas dahulu di internal fraksi,’’ kata Irwansyah Damanik. Penyebab lain rapat ditunda, tambah Mulkan Ritonga, karena minimnya peserta rapat yang hadir. Pimpinan Dewan saja hanya Sigit Pramono Asri yang hadir. Sementara beberapa orang lainnya sedang berada di luar kota. Begitu juga pimpinan fraksi yang hadir hanya pimpinan Fraksi PAN, Partai Golkar, Partai Demokrat, PPRN, PDS

dan Hanura. ‘’Makanya diminta dijadwal ulang,’’ kata Irwansyah Damanik. Dinamika tinggi Sementara Waspada memperoleh informasi, sejak 16 anggota DPRD Sumut secara resmi mengajukan usulan hak interpelasi atas kebijakan Plt Gubsu kepada pimpinan dewan, dinamika politik di gedung dewan semakin tinggi. Karena masih sangat banyak anggota dewan yang tidak setuju interpelasi dilakukan. Seorang anggota DPRD Sumut mengatakan meski interpelasi merupakan hak setiap anggota Dewan, tapi dalam konteks ini permasalahannya masih terlalu kecil. Dari sejak dahulu pengang-katan pejabat eselon IV dan III memang seperti itu. ‘’Malah yang lalu lebih ngeri lagi. Kok baru sekarang dipermasalahkan,’’ kata anggota yang tidak bersedia disebutkan namanya. Anggota Dewan ini mensinyalir ada sesuatu di balik mutasi yang dilakukan terakhir ini, yakni karena merasa tidak senang dimutasi, pejabat ter-

sebut meminta ‘perlindungan’ kepada oknum-oknum anggota Dewan. ‘’Bukan karena murni ingin melaksanakan fungsi kontrolnya,’’ tambahnya. Sebelumnya, Plt Gubernur Sumatera Utara Gatot Pujonugroho dan Badan Pertimbangan Jabatan dan Kepangkatan (Baperjakat) meng-klaim pelantikan 110 Pejabat eselon III, Jumat lalu, sudah sesuai prosedur. Proses tersebut berawal dari usulan pimpi-nan Satuan Kerja Perangkat Daerah (SKPD) yang kemudian diberikan pertimbangan oleh Baperjakat dan diserahkan kepada Plt Gubsu untuk ditetapkan. “Saya tegaskan pelantikan tersebut sudah mematuhi ketentuan dan pro-sedur yang berlaku,” kata Gatot kepada wartawan Kamis lalu. Menanggapi sikap DPRDSU menilai pelantikan yang mendadak dilakukan tanpa melalui Baperjakat Pemprovsu sehingga produk yang dihasilkan tidak kapabel dan tidak menguasai bidangnya, Gatot mengucapkan terima kasih atas kritikan yang muncul terkait pelantikan tersebut. (m12)

Polisi Aniaya Ustadz Akan Diadukan Ke Mabes Polri MEDAN (Waspada): Dewan Pimpinan Pusat Ikatan Mahasiswa Muhammadiyah (IMM) meminta Kapoldasu untuk segera memecat oknum polisi yang melakukan penganiyaan terhadap ulama Muhammadiyah di Tapanuli Selatan. Hal itu dikatakan Ketua Lembaga Pemberdayaan Masyarakat DPP IMM Amirullah Hidayat, kemarin. “Kita sangat menyesalkan tindakan yang dilakukan oknum Bripda AHL yang melakukan penganiyaan berat, tetapi sampai dengat saat ini oknum tersebut masih bebas berkeliaraan tanpa ada tindakan dari pimpinannya. Kita tidak akan membiarkan kasus ini didiamkan begitu saja, karena tindakan sudah menjadi pelanggaran berat bahkan telah melanggar HAM seseorang. Maka Kapolda

sumut untuk mengusut tuntas kasus ini dan memecat oknum polisi tersebut, karena sudah merusak citra kepolisian,” tegas Amirullah Amirullah mengatakan, akan membawa kasus ini ke Mabes Polri dengan langsung menjumpai Kapolri jika aparat kepolisian Sumatera Utara membiarkannya saja. Kita memberi waktu ke Poldasu untuk mengusut tuntas kasus ini secepatnya. Sementara itu, Ketua Dewan Pimpinan Daerah Ikatan Mahasiswa Muhammadiyah Sumatera Utara Qahfi Romula Siregar juga mengutuk keras tindakan yang dilakukan oleh oknum polisi yang berinisial AHL. “Tindakan yang terjadi pada (17/8/10) malam, ustadz Ahmad Nazari Nasution diberlakukan tidak seperti manusia

lagi, dipukul, ditendang, hingga sampai dengan saat ini beliau lumpuh.” Sesuai dengan UU RI No. 2 Tahun 2002 tentang Kepolisian RI, Pasal 2 bahwa Fungsi kepolisian adalah salah satu fungsi pemerintahan negara di bidang pemeliharaan keamanan dan ketertiban masyarakat, penegakan hukum, perlindungan, pengayoman, dan pelayanan kepada masyarakat, jadi tindakan oknum polisi tersebut telah melanggar UU Kepolisian. “Maka tidak ada alasan Kapoldasu untuk menindak tegas dengan memecat oknum polisi tersebut,” tegas Qahfi Siregar. Pihaknya, telah memerintahkan kepada Pimpinan Cabang Tapanuli Selatan untuk mengawal kasus ini hingga selesai. (m05)

TB Silalahi Dan AGP Kirim Bantuan Ke Taput MEDAN (Waspada): Bantuan korban gempa untuk masyarakat Tapanuli Utara (Taput) terus mengalir dari tokoh masyarakat dan pengusaha di Jakarta. Salah satunya datang dari TB Center dan Arta Graha Peduli (AGP). Mereka mengirim bantuan tersebut kepada warga di sana, Sabtu (25/6). “Kalau Sembako mungkin sudah banyak yang membantu. Kali ini kami meringankan beban orang tua dari lebih kurang 1.000 anak-anak pengungsi di tenda-tenda darurat,” kata tokoh masyarakat Tapanuli TB. Silalahi didampingi Budi Amal kepada wartawan di VIP room

Bandara Polonia Medan saat transit dari Jakarta menjelang bertolak ke Silangit, Taput, Sabtu (25/6). Menurut Silalahi, ada lima titik tempat penyaluran bantuan 4.000 paket sekolah lengkap untuk anak-anak SD. Selain itu paket obat-obatan, 400 paket susu bubuk pendamping ASI dan 3.600 botol susu untuk anak-anak dan bayi. “Saya perlengkapan yang dikirim itu penting sebab Taput dingin dan cepat sekali terserang penyakit saluran pernafasan atas bagi anak-anak, sehingga sejumlah dokter lepasan Soposurung 16 tahun lalu sudah

berada di lokasi untuk membantu pengobatan,” kata Silalahi. Sementara lima titik tempat penyaluran bantuan antara lain di Kompleks HKBP, depan Masjid Aek Botik, Pasar Sarulla, MIN dan SD Sarulla. Kata Silalahi, sebenarnya bantuan yang sama sudah diberikan kepada masyarakat Aceh dan Nias saat gempa beberapa tahun lalu. “Kali ini kami kembali kembali menggugah untuk member bantuan.” Sebelumnya, gempa menggoncang Luat Pahae, Taput, sejak Sabtu (18/6) hingga Minggu (1/6), memporak-porandakan rumah dan jalan. (m32)

Waspada/Hamdani

MENGISI LIBURAN: Masyarakat memadati tempat hiburan dan rekreasi untuk mengisi liburan sekolah hingga 10 Juli. Waterpark Aeros di Jalan Djamin Ginting Medan ini salah satu tempat yang ramai dikunjungi masyarakat dari Kota Medan dan sekitarnya sebab untuk bepergian ke daerah-daerah di Sumut terkendala dengan buruknya jalan dan kerap terjadi kemacetan. Foto diambil Minggu (26/6).

Besok, Mubes BM-3 Sumut MEDAN (Waspada): Segenap masyarakat Minang perantauan di Sumatera Utara agar berpartisipasi menghadiri Musyawarah Besar Badan Musyawarah Masyarakat Minang (BM3) Sumut yang digelar besok, Rabu (29/6), di Convention Hall Hotel Garuda Plaza Jalan Sisingamangajara Medan. Imbauan ini disampaikan Ketua Panitia Pelaksana (OC) Mubes VI BM-3 Sumut Ahmad Arif didampingi Ketua Panitia Pengarah (SC) Prof Zainuddin dan Bendahara OC Syahruddin Ali saat berbicara kepada wartawan di Medan, kemarin. “Kita sangat berharap kehadiran segenap komponen masyarakat Minang perantauan,” katanya. Tokoh muda Minang di Sumut ini mengatakan, seandainya ada undangan dari panitia yang belum sampai ke luhak-luhak, puak-puak dan BM-3 kabupaten/kota Se-Sumut, maka pihaknya berharap imbauan ini dapat ditindaklanjuti untuk menghadiri Mubes tersebut. Ahmad Arif berharap dalam Mubes nanti

akan melahirkan kepemimpinan dan kepengurusan BM-3 Sumut periode 2011-2016 yang dapat menyatukan segenap masyarakat Minang perantauan di Sumut, sehingga mampu “mambangkit batang tarandam” dan keberadaan BM-3 Sumut bisa memberikan kontribusi yang berarti bagi pemerintah dan masyarakat Minang sendiri. Ketua SC Prof Zainuddin menambahkan Mubes VI BM-3 Sumut ini dijadwalkan akan dilaksanakan pukul 09.00. “Kita jadwalkan dimulai pukul sembilan pagi dan direncanakan hanya berlangsung selama satu hari saja,” ujarnya. Ia juga mengungkapkan bagi para peserta di daerah yang ingin mendapatkan informasi lebih lanjut bisa menghubungi pihak panitia melalui nomor handphone : 08126091285 (an. Besri Nazir-Serkretaris SC), 0813807244226 (an. Adrizal) dan 085275849936 (an. Thendry). Untuk informasi lebih lanjut dapat menghubungi nomor tersebut. (m49)

Masjid Nurul Muslimin Rampung Walikota Bantu Rp100 Juta MEDAN (Waspada): Pembangunan Masjid Nurul Muslimin di Jalan Karya Tani, Kecamatan Medan Johor, akhirnya selesai dikerjakan. Pengerjaanya hanya membutuhkan waktu tidak kurang sembilan bulan.. Demikian diungkapkan tokoh masyarakat yang juga Ketua DPD Partai Golkar Medan HM Syaf Lubis dalam sambutannya pada acara peresmian Masjid Nurul Muslim oleh Walikota Medan Rahudman Harahapdi Jalan Karya Tani, Medan Johor, Minggu (26/6). Masjid Nurul Muslimin, menurut Syaf Lubis, dibangun dari sebuah mimpinya beberapa tahun lalu itu. Dia melihat bangunan Masjid Nurul Muslim lama akan roboh karena keadaan tanah yang terus mengalami erosi. “Berangkat dari mimpi itu, saya mengumpulkan sesepuh dan tokoh masyarakat di lingkungan ini untuk membicarakan pembangunan masjid tersebut. Walau pada awalnya ada sedikit perbedaan pendapat, namun, akhirnya Masjid Nurul Muslim terbangun seperti ini ,” kisah Syaf Lubis. Walikota Medan Rahudman Harahap memberikan bantuan untuk pembangunan

masjid tersebut sebesar Rp 100 juta. Bulan Suci Ramadhan sudah semakin dekat, tentu kegiatan di masjid semakin banyak. Dana bantuan itu, ujarnya, agar difungsikan untuk merampungkan kamar mandi Masjid Nurul Muslimin. “Semoga bantuan ini berguna bagi jamaah Masjid Nurul Muslim,” ujarnya. Harahap menuturkan, Masjid Nurul Muslimin tersebut mempunyai sejarah bagi dirinya karena dia yang meresmikan peletakan batu pertama pembangunan masjid itu. “Saat itu, saya baru saja terpilih menjadi Walikota Medan tapi belum dilantik,” kenangnya. Masjid Nurul Muslimin inilah, kata dia, pertama ia resmikan ketika baru terpilih menjadi Walikota Medan. Ia berharap Masjid Nurul Muslim nantinya tidak hanya untuk sekadar tempat shalat saja melainkan harus dimakmurkan dengan berbagai kegiatan keagamaan. Ketua Badan Kenaziran Masjid (BKM) Ustadz Said Amar menyampaikan akan memberikan pelayanan yang terbaik bagi Masjid Nurull Muslim. Kegiatan keagamaan akan terus dilaksanakan di masjid ini, seperti, perwiritan, pengajian (m49)

Medan Dominasi Juara Siswa SMK Berprestasi MEDAN (Waspada): Siswasiswi dari kota Medan mendominasi sebagai juara dalam ajang siswa berprestasi Sekolah Menengah Kejuruan (SMK) se Sumut 2011. Dalam even yang digelar pada 20-24 Juni di Asrama Haji tersebut, siswa Medan mampu meraih 10 juara pertama dari 17 bidang yang diperlombakan. Sepuluh bidang perlombaan yang berhasil diraih siswi SMK Kota Medan sebagai juara pertama yaitu, bidang Matematika Non Teknologi diraih Santi Oktariani, bidang Kimia Terapan diraih Sri Wahyuni Lubis, Kemahiran Bahasa Inggris diraih Melda Risdayanti, Debat Bahasa Inggris diraih tim siswa dari Medan, Kemahiran bahasa Indonesia diraih Tabitha , Debat Bahasa Indonesia diraih tim

siswa Medan, bidang Jambore Kepemimpinan diraih tim siswa dari Medan, begitu juga bidang Seni tari, futsal putra dan bidang Basket Putra yang diraih tim siswa dari Medan. Sedangkan untuk juara pertama tujuh bidang lainnya yakni bidang Matematika Teknologi diraih Bayu Diraga (Deli Serdang), bidang ICT diraih Fazri Alhadi (Deli Serdang), Karya Ilmiah Siswa diraih Lidiya Sinaga (Binjai), Fisika Terapan diraih A Ridho (Tebing Tinggi). Biologi Terapan diraih Anderson Sihombing (Tapanuli Utara), Volli Putra diraih tim siswa dari Labuhan batu dan Volli Putri diraih tim siswa dari Deli Serdang. Kabid Pengendalian Mutu Pe n d i d i k a n d a n Te n a g a Kependidikan (PMPTK) Sumut

Eduard Sinaga mewakili Kadis Pendidikan Sumut menyampaikan, kegiatan lomba ini merupakan satu even yang sangat penting untuk memotivasi agar siswa berprestasi. “Makanya kegiatan lomba-lomba seperti ini harus rutin digelar,” ujarnya Ketua Panitia Pelaksana kegiatan, Hariyati Elida menyebutkan, kegiatan tersebut memperlombakan 17 bidang, yakni Volli Putra, Volli Puteri, Futsal Putra, Basket Putra, Seni Tari, Kemahiran Bahasa Indonesia, Kemahiran Bahasa Inggris, Karya Ilmiah Siswa, Jambore Kepemimpinan Siswa, Debat Bahasa Inggris, Debat Bahasa Indonesia, Matematika Non Teknologi, Matematika Teknologi, Fisika Terapan, Biologi Terapan, Kimia Terapan dan ICT. (m41)

Waspada/Sugiarto

PARA pemenang juara pertama dalam ajang Seleksi Siswa Berprestasi Sumut 2011 foto bersama dengan Kabid PMPTK Sumut Eduard Sinaga dan Kabid Dikmenti Latifah Hanum Daulay, usai penyerahan hadiah di Asrama Haji Medan, Jumat (24/6).

Waspada/ist

KEGIATAN praktek langsung mahasiswa dengan fasilitas mesin lengkap yang tersedia di Kampus Politeknik Negeri Media Kreatif.

PoliMedia Siapkan Tenaga Terampil POLITEKNIK Negeri Media Kreatif (PoliMedia) PSDD di Medan didirikan di Medan dalam rangka menindaklanjuti pidato Presiden Susilo Bambang Yudhoyono saat membuka Pekan Produk Budaya Indonesia (PPBI) di Jakarta Convention Center, 4 Juni 2008, yakni: “..... We now must look at the creative future.” Pernyataan ini menyiratkan industri kreatif yang berbasis kreativitas dan budaya perlu secara sistematis mendapat dukungan pemerintah, baik dari aspek industri maupun dukungan SDM-nya. Disamping itu, industri kreatif telah menjadi peluang pekerjaan dan penyokong kehidupan yang mandiri, bahkan akhir tahun 2009 pemerintah telah “memproklamirkan” untuk mendukung industri kreatif. Pasalnya, industri kreatif ini telah mampu menyokong pembangunan di Indonesia dengan cukup besar yaitu mencapai 6,7 persen dari Produk Domestik Bruto (PDB). PoliMedia PSDD di Medan lahir untuk mendukung pertumbuhan industri kreatif yang pesat. PoliMedia PSDD di Medan merupakan pengembangan dari PoliMedia di Jakarta yang telah memiliki reputasi yang baik dalam pengembangan dan pembinaan industri kreatif nasional. PSebagai institusi pendidikan, PoliMedia PSDD merupakan kampus yang memiliki peran penting dalam menyediakan pendidikan di bidang industri kreatif nasional. Pada tahun 2011, PoliMedia memiliki dua program Studi. Kedua Program Studi tersebut adalah Desain Grafis D-III dan Teknik Grafika D-III yang hanya menerima masing-masing 32 mahasiswa setiap program studi. Sedangkan kompetensi lulusan mampu

menciptakan dan mengangkat kekayaan kreasi lokal melalui desain grafis untuk aplikasi industri, penerbitan, percetakan, periklanan, film, video, gambar, televisi, fesyen, dan lain-lain untuk mengangkat jati diri dan citra seni budaya di Indonesia. Mampu merencanakan dan mengelola wirausaha di bidang usaha/ industri desain grafis. Lulusan program studi desain grafis dapat menjadi ahli desain grafis, direktur seni, penulis kreatif, dan wirausaha desain grafis. Sedangkan peluang kerja menjadi desainer grafis di graphic house, advertising penerbitan agency, perusahaan penerbitan buku, majalah, surat kabar, berbagai lembaga /instansi pemerintah maupun swasta, event organizer, media televisi, percetakan, hotel dan sebagai wirausaha desain grafis tentunya. Fasilitas memiliki ruang kelas yang nyaman dan modern. Begitu juga lulusan Studi Teknik Grafika, peluang kerja di perusahaan percetakan buku, percetakan koran, percetakan tabloid, biro setting dan Iklan. Selain itu, wirausaha percetakan mandiri, agen mesin cetak dan bahan grafika. Penanggung jawab PoliMedia PSDD Nasrudin mengatakan, Polimedia PSDD adalah lembaga PTN vokasi pertama di Indonesia yang dirancang secara khusus untuk menyediakan tenaga terampil tingkat madya guna memenuhi kebutuhan sektor industri kreatif. Selanjutnya, Polimedia secara terbuka kepada lulusan terbaik dari SMA/MA/SMK di Sumut untuk menjadi mahasiswa Polimedia PSDD di Medan yang beralamat Jalan Guru Sinumba No 6 Medan Helvetia. Untuk Pendaftaran calon mahasiswa baru setiap hari senin – Jumat sampai dengan 4 Juli 2011. (rel/adv)


Medan Metropolitan

WASPADA Selasa 28 Juni 2011

Korban Perampokan Lahirkan Bayi Perempuan MEDAN (Waspada): Karena kondisi Sri Wahyuni, 30, kritis setelah dirampok, tim dokter RSU Dr. Pirngadi Medan terpaksa mengeluarkan bayi dari dalam kandungannya melalui tindakan operasi caesar, Minggu (26/6) malam. Sebelumnya, warga Jln. Perjuangan Gg. Tunggal No. 62 Kecamatan Medan Perjuangan itu dirampok dua pemuda saat menumpang becak bermotor (betor) dan melintas di Jln. Ibrahim Umar, Minggu (26/6) sore. Bayi perempuan tersebut dalam kondisi sehat dan dirawat di inkubator Ruang Perinatologi RSU Dr. Pirngadi Medan. Sedangkan, kondisi Sri Wahyuni masih kritis dan menjalani perawatan intensif di ruang ICU RSU Dr. Pirngadi Medan. Orang tua Sri Wahyuni, Rosmawati, 55, menjelaskan, selain menjalani operasi caesar, anaknya juga menjalani operasi pada bagian kepala karena mengalami benturan setelah terjatuh dari betor. “Anak saya masih kritis, dia sudah dua kali menjalani operasi. Pertama operasi caesar, karena kondisinya kritis maka bayi harus dikeluarkan. Kemudian, dilakukan operasi pada bagian kepala,” kata Rosmawati. Baru satu hari di RSU Dr. Pirngadi, lanjut Rosmawati, Sri telah menghabiskan lima kantong darah saat operasi. “Dia sedang hamil delapan bulan dan ini anak keduanya. Kejam kali perampok itu, saya minta aparat menangkap pelakunya,” ujar Rosmawati. Sementara itu, ayah Sri Wahyuni, Rustam, 70, mengaku telah melaporkan kasus ini ke Polresta. “Kejadian ini sudah saya laporkan ke Polresta. Daerah itu memang rawan perampokan. Saya juga dapat kabar dari warga setempat, kejadian serupa terjadi di wilayah itu,” katanya. Sedangkan Humas RSU Dr. Pirngadi Edison Perangin-Angin menjelaskan, Sri Wahyuni sedang menjalani perawatan intensif di ruang ICU. “ Bila keadaannya sudah membaik, maka akan dipindahkan ke ruang rawat inap,” jelas Edison.(h02)

Jadwal Penerbangan Di Bandara Polonia No. Penerbangan Ke Flight

Pukul

Tiba Dari

Flight

Pukul

GARUDA INDONESIA 1 Jakarta GA-181 2 Jakarta GA-183 3 Jakarta GA-185 4 Jakarta GA-187 5 Jakarta GA-189 6 Jakarta GA-191 7 Jakarta GA-193 8 Jakarta GA-147 9 Jakarta GA-195 10 Banda Aceh GA-142 11 Banda Aceh GA-14.6

05.30 08.40 10.45 11.55 13.55 15.45 18.35 18.30 19.50 09.40 14.50

Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Banda Aceh Banda Aceh

GA-180 GA-182 GA-184 GA-186 GA-146 GA-188 GA-190 GA-192 GA-196 GA-143 GA-147

07.55 08.55 11.10 13.00 14.05 15.10 17.50 19.05 21.35 12.25 17.45

CITILINK 1 Jakarta 2 Jakarta

09.45 19.00

Jakarta Jakarta

GA-040 GA-044

09.15 18.30

06.15 09.40 08.05 17.55 10.05 18.25 21.20 13.30 15.05 14.30

Kuala Lumpur Kuala Lumpur Kuala Lumpur Kuala Lumpur Penang Penang Kuala Lumpur Jakarta Bangkok (2,4,6) Hongkong (1,3,5,7)

QZ-8051 QZ-8055 AK-450 AK-454 QZ-8073 AK-5836 AK-456 QZ-7502 QZ-8085 QZ-7431

08.40 12.05 07.35 17.30 09.40 18.00 20.55 13.05 20.10 23.15

Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Jakarta Penang Penang Jakarta Jakarta Jakarta Jakarta Jakarta Surabay Surabaya Banda Aceh Batam

JT-380 JT-300 JT-394 JT-302 JT-210 JT-200 JT-204 JT-398 JT-382 JT-384 JT-202 JT-212 JT-396 JT- 8289 JT-8287 JT-206 JT-208 JT-388 JT-308 JT-218 JT-971 JT-973 JT-397 JT-970

08.20 09.20 10.20 11.20 11.50 12.20 13.20 14.20 15.20 16.20 17.20 17.50 18.20 11.35 15.00 19.20 20.20 21.55 22.20 23.20 12.16 15.55 07.40 12.15

GA-041 GA-045

AIR ASIA 1 Kuala Lumpur QZ-8050 2 Kuala Lumpur QZ- 8054 3 Kuala Lumpur AK- 451 4 Kuala Lumpur AK-455 5 Penang QZ-8072 6 Penang AK-5937 8 Kuala Lumpur AK-457 9 Jakarta QZ-7503 10 Bangkok (1,4,6) QZ-8084 11 Hongkong (1,3,5,7) QZ-7.430 LION AIR 1 Jakarta 2 Jakarta 3 Jakarta 4 Jakarta 5 Jakarta 6 Jakarta 7 Jakarta 8 Jakarta 9 Jakarta 10 Jakarta 11 Jakarta 12 Jakartaa 13 Jakarta 14 Penang 15 Penang 16 Jakarta 17 Jakarta 18 Jakarta 19 Jakarta 20 Jakarta 21 Surabaya 22 Surabaya 23 Banda Aceh 24 Batam

JT- 211 JT- 381 JT- 397 JT- 207 JT- 301 JT- 395 JT- 303 JT- 213 JT-201 JT- 387 JT-399 JT-383 JT-205 JT-8288 JT-8286 JT-385 JT-203 JT-215 JT-309 JT-209 JT-972 JT-972 JT-396 JT 970

06.00 07.00 08.20 09.00 10.00 11.00 12.00 12.30 13.00 14.00 15.00 16.00 16.35 09.10 12.30 17.00 18.00 18.30 20,00 21.00 07.00 12.55 19.00 07.00

MALAYSIA 1 Kuala Lumpur MH-861 2 Kuala Lumpur MH-865

09.05 15.45

Kuala Lumpur MH-860 08.25 Kuala Lumpur MH-864 15.00

SILK AIR 1 Singapura 2 Singapura 3 Singapura (7)

MI-233 MI-237 MI-241

08.40 20.35 21.05

Singapura Singapura Singapura (7)

MI-232 MI-238 MI-242

07.50 19.50 20.00

VALUAIR 1 Singapura (4,7) VF-582 2 Singapura (1,3,6) VF-584

09.35 17.25

Singapura (4.7) VF-581 Singapura (1,3,6) VF-583

09.10 17.50

BATAVIA AIR 1 Jakarta 2 Jakarta 3 Jakarta 4 Batam

Y6-592 Y6-594 Y6-596 7P-568

10.10 16.15 20.00 13.00

Jakarta Jakarta Jakarta Batam

Y6-591 Y6-593 Y6-595 7P-567

09.55 18.30 19.20 11.05

SRIWIJAYA AIR 1 Jakarta 2 Jakarta 3 Batam 4 Pekanbaru 5 Pekanbaru 6 Banda Aceh 7 Penang 8 Padang

SJ-015 SJ-011 SJ-035 SJ-043 SJ-041 SJ-010 SJ-102 SJ-021

13.25 15.00 16.20 10.20 16.00 11.55 07.20 15.25

Jakarta Jakarta Batam Pekanbaru Pekanbaru Banda Aceh Penang Padang

SJ-010 SJ-016 SJ-034 SJ-042 SJ-040 SJ-011 SJ-103 SJ-020

11.20 18.35 15.45 12.50 15.25 13.25 10. 00 14.50

13.15 11.00

Subang Penang

FY-3412 FY-3402

SRIWIJAYA AIR 1 Subang FY -3413 2 Penang FY- 34.03

Eksekusi Perumahan Jati Indah Ricuh Beco Ratakan 7 Rumah MEDAN (Waspada): Proses eksekusi tujuh rumah di kompleks perumahan Jati Indah Jln Jati Lingkungan X, Kelurahan Pulo Brayan Bengkel, Kecamatan Medan Timur, Senin (27/6), berlangsung ricuh. Kericuhan terjadi saat petugas juru sita akan membacakan amar putusan Pengadilan Negeri (PN) Medan untuk membongkar perumahan mewah tersebut. Kemarahan penghuni kompleks mengiringi pembacaan amar putusan yang dilakukan juru sita. Seorang warga terpaksa diamankan petugas diduga sebagai provokator dan menghasut massa melakukan tindakan anarkis. Sebelumnya kedatangan petugas juru sita PN Medan bersama ratusan petugas kepolisian dan Brimob langsung dihadang puluhan warga penghuni kompleks perumahan Jati Indah. Selain melakukan sem-

bahyang sebagai bentuk minta perlindungan, para warga juga membuat blokade untuk menghadang petugas masuk. Kericuhan terjadi saat penghuni rumah yang memilih tetap mempertahankan haknya, berusaha menghalangi petugas juru sita membacakan amar putusan nya. Situasi sempat tak terkendali. Aksi saling dorong dengan petugas kepolisian dan Brimob bertameng tak terelakkan. Bahkan petugas terpaksa mengamankan seorang warga yang diduga sebagai provokator kericuhan. Meski terus ditentang, petugas tetap tidak bergeming. Satu demi satu rumah mewah sehingga berjumlah tujuh rumah yang berdiri di atas areal kompleks itu dihancurkan menggunakan dua beco/escavator. Zulham selaku kuasa hukum warga mengatakan, eksekusi atas lahan seluas 70.500 m2

Nama KA

Kelas

Dari

Tujuan

U.2 U.4 U.6 U.8 U.1 U.3 U.5 U.7 U.10 U.12 U.9 U.11 U.14 U.16 U.18 U.13 U.15 U.17 U.22 U.24 U.21 U.23 PLB 7000 PLB 7007 PLB 7014 PLB 7017 PLB 7002 PLB 7004 PLB 7008 PLB 7010 PLB 7012 PLB 7001 PLB 7006 PLB 7015 PLB 7003 PLB 7005 PLB 7009 PLB 7011 PLB 7013

Sri Bilah Sri Bilah Sri Bilah Sri Bilah Sri Bilah Sri Bilah Sri Bilah Sri Bilah Sri Bilah Sri Bilah Sri Bilah Sri Bilah Putri Deli Putri Deli Putri Deli Putri Deli Putri Deli Putri Deli Siantar Ekspres Siantar Ekspres Siantar Ekspres Siantar Ekspres Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa Sri Lelawangsa

Eks/Bisnis Eks/Bisnis Eks/Bisnis Eks/Bisnis Eks/Bisnis Eks/Bisnis Eks/Bisnis Eks/Bisnis Bisnis Bisnis Bisnis Bisnis Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi Ekonom Ekonomi Ekonomi Ekonomi Ekonomi Ekonomi

Medan Medan Medan Medan Rantau Prapat Rantau Prapat Rantau Prapat Rantau Prapat Medan Medan Binjai Binjai Medan Medan Medan Tanjung Balai Tanjung Balai Tanjung Balai Medan Medan Siantar Siantar Medan Medan Medan Medan Medan Medan Medan Medan Medan Tebing Tinggi Belawan Belawan Binjai Binjai Binjai Binjai Binjai

Rantau Prapat Rantau Prapat Rantau Prapat Rantau Prapat Medan Medan Medan Medan Binjai Binjai Medan Medan Tanjung Balai Tanjung Balai Tanjung Balai Medan Medan Medan Siantar Siantar Medan Medan Tebing Tinggi Belawan Belawan Belawan Binjai Binjai Binjai Binjai Binjai Medan Medan Medan Medan Medan Medan Medan Medan

MEDAN (Waspada): Tas milik pengendara sepedamotor Sari, 29, warga Jalan Gaharu Medan, dijambret dua pemuda yang juga menaiki sepedamotor di simpang Jln. Bambu II dan Gaharu, Senn (27/6) sore. Korban menderita kerugian ditaksir mencapai jutaan rupiah yakni tiga handphone, kartu ATM, KTP, dan surat berharga lain yang berada di dalam tasnya dilarikan pelaku. Informasi di Polresta Medan

menyebutkan, peristiwa terjadi sekira pukul 15:00. Korban yang mengendarai sepedamotor bermaksud mengunjungi neneknya di Jalan Gaharu Komplek Asrama Singgasana III, Medan. Tanpa disadari korban, kedua penjambret mengendarai sepedamotor tanpa plat nomor polisi memepet dan merampas tas miliknya. Menyadari dirinya dijambret, korban mengejar pelaku sambil berteriak minta tolong. Warga

M E D A N ( Wa s p a d a ) : Henriati, seorang Tenaga Kerja Indonesia (TKI) yang ditempatkan di perusahaan Western Digital Malaysia, meninggal dunia akibat suatu penyakit pada pada 29 April 2011. Karena itu, Nurlela selaku ahli waris dan ibu kandung almarhumah menerima pembayaran klaim asuransi sebesar Rp 67 juta dengan perincian Rp 27,855 juta dari Pemerintah Malaysia dan Rp40 juta dari pemerintah Indonesia melalui PT. Mitra Dhana Athmareksa. Klaim asuransi tersebut diserahkan Syahrul Miza mewakili perusahaan Western Digital Malaysia dan Direksi PT. Mutiara Karya Mitra selaku Perusahaan Jasa Tenaga Kerja Indonesia (PJTKI) serta disaksikan Kepala Balai Pelayanan Penempatan dan Perlindungan Tenaga Kerja (BP3TKI) Sumut Haris Nainggolan dan anggota DPD RI Parlindungan Purba, SH, MM di kantor PT. Mutiara Karya Mitra Jln. Kapten Muslim Medan, Sabtu (25/6). Direktur Utama PT. Mutiara Karya Mitra Irwanto Tampubolon menjelaskan, Henriati merupakan salah satu TKI yang ditempatkan di perusahaan

Western Digital Malaysia sejak 21 Juli 2010. Akibat penyakit TB paru yang dideritanya, Henriati sempat dirawat di Pusat Perobatan Universiti Malaya Kuala Lumpur dan akhirnya meninggal dunia pada 29 April 2011. “Kabar meninggalnya Henriati langsung kami beritahukan kepada pihak keluarga sini dan juga ke BP3TKI Sumut. Karena saat itu merupakan hari libur, maka berdasarkan informasi dari KBRI jenazah tiba di Indonesia pada 1 Mei 2011,” katanya kepada wartawan. Selain menerima pembayaran klaim asuransi dari pemerintah kedua negara, ahli waris Henriati juga menerima uang sumbangan dari PT Mutiara Karya Mitra sebesar Rp2 juta dan uang pendahuluan asuransi dari Malaysia sebesar RM2.000. “Kami juga telah menghapus utang uang pemberangkatan almarhumah sebesar RM1.800,” ungkapnya. Sementara itu, Nurlela mengatakan klaim asuransi atas kematian anaknya akan diberikan kepada kedua cucunya yang merupakan anak dari Henriati masing-masing berusia 8 tahun dan 3 tahun. “Anak saya telah bercerai dengan suaminya,

12.56 10.40

Berangkat Datang 13.21 15.25 20.28 03.52 13.22 19.59 22.01 04.24 05.42 21.07 10.12 22.32 11.17 17.27 22.15 11.54 16.28 22.47 14.44 22.47 10.15 18.51 20.04 08.17 17.37 12.47 08.22 05.52 10.42 13.07 15.32 07.21 09.27 18.27 09.47 07.22 11.52 14.22 16.42

Informasi Pemesanan -Stasiun KA Medan (061) 4514114, -Stasiun KA R. Prapat (0624) 21617. (m32)

yang mendengar teriakan korban berusaha mengejar pelaku tapi tidak berhasil. Selanjutnya korban melaporkan kasus jambret tersebut ke Polresta Medan. Kepada polisi, korban menjelaskan cirriciri kedua pelaku yakni tinggi 160 cm, rambut sedikit gondrong, dan memakai kaos warna putih. Petugas Polresta Medan segera melakukan penyelidikan di lokasi kejadian dan memburon pelaku jambret. (m39)

TKI Meninggal Di Malaysia, Ahli Waris Terima Rp67 Juta

(m32/m41)

08.00 10.30 15.00 22.50 08.00 14.45 17.10 23.00 04.50 20.15 09.20 21.40 06.50 12.50 17.10 07.15 11.55 19.25 11.00 19.25 06.30 15.20 18.00 07.30 16.50 12.00 07.30 05.00 09.50 12.15 14.40 06.20 08.40 17.50 08.55 06.30 11.00 13.30 15.50

yang dilakukan atas gugatan Abdul Karim ini cacat hukum. Dia menilai seluruh warga memiliki sertifikat tanah sah yang dikeluarkan Badan Pertanahan Nasional (BPN) Sumut. “Semua pemilik rumah punya sertifikat kepemilikan dari BPN. Hingga saat ini kasusnya masih di tingkat banding,” katanya. Pihak juru sita PN Medan Abdurrahman mengaku eksekusi dilakukan berdasarkan keputusan yang sudah ditetapkan. Apalagi sejumlah warga sudah menerima ganti rugi. Sedangkan untuk bangunan rumah lainnya masih dalam proses hukum. Menurut Abdurrahman, ketujuh rumah itu sudah diberi ganti rugi dan sisanya lagi masih dalam proses hukum di pengadilan. Menjelang pukul 16:00, puluhan petugas kepolisian dan Provost Polresta Medan meninggalkan lokasi setelah perubuhan tujuh rumah tersebut. (h04)

Pengendara Sepedamotor Dijambret

Jadwal Perjalanan Kereta Api No KA

B3

Waspada/ist

NURLELA selaku ahli waris Henriati, TKI yang meninggal dunia di Malaysia ketika menerima pembayaran klaim asuransi di kantor PT. Mutiara Karya Mitra, Sabtu (24/6), disaksikan anggota DPD RI asal Sumut Parlindungan Purba, SH, MM.

karena itu dia memilih bekerja di luar negeri untuk membiayai kebutuhan anak-anaknya. Jadi, dengan uang yang diberikan ini akan digunakan membiayai pendidikan mereka,” ujar Nurlela, warga Jln. TM Pahlawan, Belawan ini. Sedangkan, anggota DPD RI Parlindungan Purba, SH, MM mengatakan, pembayaran klaim asuransi dari pemerintah Malaysia dan Indonesia ini membuktikan perlunya memberangkatkan TKI secara benar melalui PJTKI yang resmi. “Pemilihan PJTKI yang resmi sangat diperlukan karena sesuai prosedur pemerintah dan dipekerjakan pada sektor formal,” tambahnya. Meski pembayaran klaim asuransi tersebut terkesan lambat, karena dari pihak asuransi PT Mitra Dhana Athmareksa belum mengeluarkan dana dengan alasan sudah tidak beroperasi lagi, namun PT. Mutiara Karya Mitra tetap memperjuangkannya. “Kita terus perjuangkan klaim dana ini kepada perusahaan asuransi di Indonesia. Atas desakan yang kita lakukan, dana langsung diberikan kepada PT Mutiara Karya Mitra sebesar Rp 40 juta untuk diserahkan kepada ahli waris,” ungkap Parlindungan. Sebelumnya, Kepala BP3TKI Sumut, Haris Nainggolan mengatakan, masih ada perusahaan asuransi yang terkesan lambat merespon pencairan klaim terhadap TKI yang mendapat musibah seperti kecelakaan hingga meninggal dunia.“Masih ada TKI yang meninggal dunia, tapi belum dapat klaim dana ausransi karena proses pencairan yang begitu lama,” katanya. Melihat kondisi ini, lanjut Haris, pada Oktober 2010 pemerintah telah menetapkan perusahaan asuransi tunggal yakni PT Paladin untuk TKI yang diberangkatkan oleh PJTKI resmi. “Penyeleksian TKI baik secara dokumen, keterampilan dan pendidikan sangat perlu dilakukan PJTKI sebelum memberangkatkannya ke luar negeri. Ini sebagai bentuk perlindungan kepada TKI selama bekerja di negara lain,” pungkasnya. (m25)

Waspada/Hamdani

PETUGAS kepolisian lengkap dengan tameng anti huru hara mengawal alat berat merobohkan sebuah rumah pada eksekusi tanah di Jln Jati Medan, Senin (27/6). Eksekusi tanah seluas 70.506 meter persegi itu diprotes warga karena prosesnya dinilai cacat hukum.

Kapolresta Perintahkan Intel Selidiki Kelangkaan BBM MEDAN (Waspada): Kapolresta Medan Kombes Tagam Sinaga menginstruksikan jajaran intel di wilayah hukum Polresta Medan melakukan penyelidikan tentang kelangkaan Bahan Bakar Minyak (BBM) di sejumlah SPBU. “Saat ini, jajaran intel di Polresta Medan termasuk Polsek sudah kita instruksikan melakukan penyelidikan terhadap kasus kelangkaan BBM,” jelas Tagam saat dikonfrmasi Waspada melalui telefon selular, Senin (27/ 6) sore. Ketika ditanya apa ada kerjasama Polresta Medan dengan Pertamina untuk melakukan penyidikan tentang langkanya BBM, Tagam menjelaskan, sampai saat ini belum ada surat dari Pertamina untuk melakukan penyelidikan tentang langkanya BBM di Medan. “Jika ada surat dari Pertamina, Polresta Medan siap melakukan kerjasama,” tegasnya. Mengenai langkanya BBM di Medan, kata Tagam, Polresta Medan akan mempertanyakannya kepada Pertamina tentang penyebab kelangkaan BBM tersebut. “Apakah pasokan

Polisi Tangkap Pengedar Sabu MEDAN (Waspada): Petugas Polsek Percut Seituan menangkap seorang pengedar sabusabu dari kawasan Jalan Benteng Hulu, Kec. Medan Tembung, Sabtu (25/6).

Waspada/Andi Aria Tirtayasa

TERSANGKA RP alias Amran (tertunduk) saat dibawa petugas Reskrim Polsekta Percut Seituan untuk menjalani pemeriksaan.

buat pengaduan ke Polresta Medan yang tinggal di Yayasan Kasih Bunda, peristiwa berawal saat dirinya baru tiba di Stasiun Pinang Baris dari Peurlak Aceh, Kamis siang, dan bertemu dengan pelaku sebagai penarik beca motor (betor). Dengan berbagai bujuk rayu dan dijanjikan akan diberi pekerjaan, korban bersedia mengikuti ajakan pelaku ke salah satu hotel di kawasan Ring Road. Pelaku beralasan ke tempat penginapan tersebut untuk beristirahat dan mandi. Namun setibanya di hotel, korban diperkosa pelaku. Usai melepaskan hawa nafsunya, pelaku mengambil handphone

milik korban. Pelaku kemudian mengantarkan korban ke Yayasan Kasih Bunda milik Muhammad Daniel, di kawasan Jalan Medan Sunggal, sekitar pukul 19:00. Aksi bejat pelaku terbongkar saat Muhammad Daniel dan istrinya curiga melihat korban seperti depresi. Ketika ditanyai korban mengaku telah diperkosa dan HPnya diambil pelaku. Muhammad Daniel yang mengenali pelaku menghubunginya dan meminta agar datang ke yayasannya. Pelaku kemudian datang dan ketika diinterogasi mengaku telah memperkosa korban. Dia meminta kepada Daniel agar

Dari kantongi baju tersangka RP alias Amran, 24, warga Jalan Bantan, Kec. Medan Tembung, polisi menemukan 4 paket sabu-sabu. Penangkapan Amran bermula saat petugas Polsek Percut Seituan melintas di Jalan Benteng Hulu, melihat gelagat tersangka dan beberapa orang rekannya mencurigakan. Ketika didekati, Amran berusaha kabur sehingga ditangkap. Polisi lalu menggeledah tersangka dan menemukan 4 paket shabu-shabu dari kantong bajunya. Sedangkan beberapa orang teman tersangka langsung melarikan diri saat polisi menggeledah Amran. Tersangka Amran mengaku narkoba itu titipan dari A (buron) yang akan dijual kepada pelanggannya. “Sabu ini dititipkan si A. Nanti kalo udah laku, aku dapat uang Rp200 ribu,” kata pria yang badannya dipenuhi tato ini. Kapolsek Pecut Seituan Kompol Maringan Simanjuntak, SH, MH, mengatakan, asal usul sabu-sabu tersebut sudah diketahui dan pengedarnya berinisial A masih dilacak. “Tersangka dan barang bukti telah kita amankan. Sedangkan pemilik sabu-sabu masih diburon,” ujarnya. (h04)

Pencuri Gagal Boyong Rp250 Juta Milik PT Alumex MEDAN (Waspada): Kawanan maling yang membobol kantor PT Alumex di Jalan SM Raja Simpang Marindal Medan, terpaksa meninggalkan uang Rp250 milik perusahaan aluminium itu karena kepergok petugas security saat mau kabur, Senin (27/6) sekira pukul 04:00. Uang Rp 250 juta hasil kejahatan itu ditinggalkan pencuri di semak-semak depan PT Alumex berikut sepedamotor Honda Revo dan sepasang sepatu. Informasi di Polresta Medan menyebutkan, kawanan pencuri masuk ke dalam perusahaan itu dengan cara merusak pintu belakang. Saat berada di dalam, pencuri membobol brankas dan mengambil uang Rp250 juta. Namun, saat kawanan pencuri hendak kabur, di luar gedung kepergok petugas security. Takut dihajar massa dan petugas security, kawanan pencuri melarikan diri

Wanita Asal Aceh Diperkosa Dan Dirampok MEDAN (Waspada): Seorang wanita asal Peurlak, Aceh, yang mencoba mencari pekerjaan di kota Medan, menjadi korbanpemerkosaandanperampokan yang dilakukan penarik becak motor (betor) di salah satu tempat penginapan Jalan Ring Road, Sunggal, Kamis (23/6). Kasus tersebut baru dilaporkan korban N, 17, ke Polresta Medan, Senin (27/6). Didampingi pemilik Yayasan Kasih Bunda Muhammad Daniel dan istrinya Yulinar Sembiring, warga Jalan Medan Sunggal, korban mengadukan penarik beca bermarga Aritonang, warga Jalan Sei Mencirim Medan. Menurut korban usai mem-

ke SPBU yang kurang atau ada sebab lain,” jelas Tagam. “Tidak mungkin kita langsung mengambil tindakan atas langkanya BBM di Medan. Kita tanya dulu ke Pertamina apa penyebab langkanya BBM. Kalau Pertamina minta bantuan, Polresta Medan siap,” katanya. Ditanya antisipasi pihak kepolisian jika terjadi gejolak akibat kelangkaan BBM, Tagam mengimbau agar seluruh warga tidak anarkis. “Disini perlunya kesadaran hukum masyarakat,” tegasnya. Sementara itu, seorang pekerja di SPBU Jln. Sudirman Medan mengatakan, SPBU mereka tidak pernah kehabisan stok BBM apalagi jenis solar. “Tidak pernah kehabisan stok BBM. Bahkan kalau stok sudah menipis, kami bisa mengorder ke Pertamina dan besoknya langsung diantar,” kata petugas di SPBU tersebut tanpa menyebutkan namanya. “Tapi kalau mau data lebih jelas, datang saja besok karena sore ini manejer sudah pulang. Besok pukul 10:00 sudah ada manajernya,” jelasnya. (m39)

kejadian itu jangan dilanjutkan ke polisi dan mau berdamai dengan korban. Namun, ajakan damai pelaku ini ditolak Daniel dan melanjutkan kasusnya ke Polresta Medan. Menurut Daniel, dirinya sempat mendapat ancaman dari orang yang mengaku kerabat pelaku yang diduga oknum polisi. Setelah membuat visum dan bertemu Kanit Judi Sila Polresta Medan AKP Hartono, laporan korban diterima pihak Polresta Medan dan segera ditindaklanjuti dengan melakukan pengejaran terhadap pelaku yang identitasnya telah diketahui. (m39)

dan meninggalkan uang tersebut disemak-semak. Reskrim Polresta Medan dan Polsekta Patumbak yang menerima laporan segera turun ke lokasi dan melakukan identifikasi di lokasi kejadian. Setelah dilakukan olah TKP, polisi menemukan uang Rp250 juta yang terletak di semak-semak depan PT Alumex berikut sepedamotor Honda Revo dan sepasang sepatu. Semua barang bukti diamankan polisi. Petugas Reskrim Polresta Medan bermarga Sibarani saat dikonfirmasi wartawan mengaku, pihaknya masih melakukan penyelidikan kasus pencurian tersebut. “Masih dilidik dan uang tersebut masih utuh tanpa ada yang hilang,” katanya. (m39)


Opini

B4 TAJUK RENCANA

Inpres Narkoba Takkan Jalan Hanya Sporadis & Tak Serius

E

nam Instruksi Presiden (Inpres) Susilo Bambang Yudhoyono (SBY) untuk mengajak masyarakat Indonesia lebih serius lagi melakukan pencegahan penyalahgunaan Narkoba dinilai tak mampu untuk membendung peredaran barang haram itu. Sehingga tidak hanya orang dewasa yang jadi korban Narkoba, melainkan juga anak-anak. Bahkan, anak setingkat SD pun sudah banyak kedapatan memakai Narkoba. Peredaran Narkoba semakin meluas, jumlah korbannya pun semakin banyak. Kalau yang terdata/tertangkap misalnya 10 kasus, sebenarnya di lapangan jumlahnya bisa 10 kali lipat. Oleh karena itu, masalah Narkoba ini tidak boleh dianggap kasus biasa saja. Kita harus satu kata untuk melakukan upaya pencegahan dan pemberantasannya. Tidak boleh hanya slogan. Mari kita jadikan Narkoba musuh bersama dengan motto: berantas sampai tuntas ke akar-akarnya. Jika tidak berhasil maka kitalah yang akan binasa nantinya. Melihat jalannya puncak peringatan Hari Anti Narkoba Internasional (HANI) di lapangan silang Monas Jakarta, Minggu (26/6), Presiden SBY bersama Wapres Boediono turun langsung ke lapangan meluncurkan Gerakan Indonesia Bebas Narkoba 2015 terkesan masih seremonial. Tema peringatan: Pedoman Pemberantasan Penyalahgunaan Pengedaran Gelap Narkoba Menuju Indonesia Negeri Bebas Narkoba, sekaligus dilakukan Ikrar Pelajar dan Mahasiswa Serta Pemuda-Pemudi Anti Narkoba. Berbagai atraksi pun dilakukan, seperti seni budaya berdurasi 30 menit dilakoni oleh 3.800 penari dan 1.000 pelajar berprestasi yang merupakan perwakilan dari berbagai wilayah di Indonesia. Atraksi itu menggambarkan bentuk keprihatinan, keresahan, dan kewaspadaan masyarakat dunia terhadap kondisi penyalahgunaan Narkoba yang sudah semakin mengkhawatirkan. Narkoba telah merusak kehidupan manusia, terutama generasi muda sebagai penerus bangsa. Publik pantas tertarik dengan sejumlah Inpres yang disampaikan langsung Presiden SBY. Selain menginstruksikan sanksi yang berat, SBY juga menyampaikan sejumlah langkah lainnya dalam rangka pencegahan dan pemberantasan narkoba. Inpres terkait bahaya Narkoba itu wajib kita sahuti dengan serius, dengan melakukan koordinasi antarpihak terkait. Jangan hanya sekadar seremonial lagi, selesai acara hilang tak berbekas. Peringatan HANI akan percuma jika dilakukna sporadis, tanpa konsep jelas, dan tanpa tindak lanjut pasca acara usai, sehingga Inpres SBY diabaikan begitu saja. Kita mencatat dan publik perlu tahu Intisari Inpres SBY sbb: Pertama, meningkatkan intensitas pemberantasan dan pencegahan peredaraan gelap Narkoba Bersama kita bisa me- penyalahgunaan di seluruh tanah air. Kedua, meningkatkan lakukan upaya penegakan kerjasama regional dan internasional yang hukum sekaligus pence- lebih efektif lagi agar sindikat kejahatan Narkoba tidak mudah mengobok-obok gahan penyalahgunaan Indonesia. Ketiga, mengimbau kepada penNarkoba didik, orangtua dan pemuka agama agar lebih aktif dalam membimbing dan mengawasi generasi muda agar tidak tersesat di jalan yang salah. Keempat, mengimbau masyarakat di seluruh tanah air agar memiliki kepedulian yang tinggi. Di RT/RW, di kelurahan atau desa harus ada kepedulian masyarakat lokal tentang bahaya ini. Tidak boleh terjadi ada sebuah rumah yang dijadikan untuk memproduksi obat-obat itu, tetangganya tidak tahu.Kelima, pemerintah akan mengalokasikan sumber daya dan anggaran yang lebih besar untuk pemberantasan dan pencegahan Narkoba di tahun-tahun mendatang. SBY pun mengajak dunia usaha yang memiliki kemampuan untuk bersama-sama meningkatkan kapasitas pusat rehabilitasi Narkoba agar mereka bisa kembali ke masyarakat luar. Untuk menyukseskan upaya BNN memberantas sindikat Narkoba semestinya Inpres SBY dijabarkan lagi sehingga semua pihak terkait sebagaimana disebut langsung oleh SBY memahaminya. Jangan hanya dibuat dan dikeluarkan menjelang peringatan HANI saja. Harus menyeluruh dan semua pihak terkait bertanggung jawab menjalankan Inpres tersebut. Selama ini betapa banyak Inpres yang tidak dijalankan oleh lembaga terkait, tak sampai ke bawah sehingga kelihatannya sia-sia. Di sinilah kita semua wajib menindaklanjuti Inpres yang terkait dengan pencegahan dan pemberantasan Narkoba mengingat dampaknya sangat buruk bagi generasi muda dan bagi masa depan bangsa dan negara tercinta. Lihat saja penjabaran dari Gories Mere berikut data Badan Narkotika Nasional (BNN). Mereka memperkirakan prevalensi (angka kejadian) penyalahgunaan narkoba di Indonesia akan mencapai 2,8 persen atau setara dengan 5,1 juta orang di 2015. Data BNN menyebutkan, korban penyalahgunaan Narkoba sebagian besar adalah lulusan SLTA. Sedangkan data Pusat Penelitian Kesehatan (Puslitkes) Universitas Indonesia, prevalensi penyalahgunaan Narkoba mengalami kenaikan sejak tahun 2009. Pada tahun tersebut, prevalensi penyalahgunaan Narkoba mencapai 1,99 persen atau setara dengan 3,6 juta orang. Angka tersebut naik menjadi 2,21 persen pada 2010. Untuk itulah kita harus tanggap dan bersungguh-sungguh. Pemerintah Indonesia melalui BNN harus tegas, jangan ‘’kongkalikong’’ dengan para pemakai, apalagi bandar dan sindikat Narkoba internasional. Jika BNN serius diharapkan masyarakat pun serius untuk menjalankan kebijakan strategi nasional mensukseskan visi Indonesia Negeri Bebas Narkoba pada 2015. Berat memang bagi Indonesia dengan segala macam permasalahannya saat ini untuk bisa bebas dari penyalahgunaan Narkoba, tapi semuanya harus dicoba, termasuk memperberat hukuman bagi pihak-pihak terlibat, sembari mencari tahu akar masalahnya untuk dilakukan therapy jitu, apakah dengan cara ‘’hard approach’’ atau pendekatan yang ‘’soft approach’’ dll.+

APA KOMENTAR ANDA SMS 08974718101

Faks 061 4510025

Email komentar@waspada.co.id

+6281361655570 Stop penggusuran masjid. Jangan sampai Allah murka dan kita kena bencana, karena rumah-Nya kalian hancurkan. Ingat Allah tidak pernah tidur. Awas kena Rahasia Ilahi. +6285261616845 Saya sangat senang membaca berita berita luar negeri cuma tulisan judulnya maunya yang agak besarlah. Jadi tidak payah mbolak mbalik nya +6285261616845 Tidak semua bid’ah itu dibenci Allah saudara memahaminya dengan pikiran yg luas +6285762987136 Ass wr wab.Saya Arif Rahman Nasution, mahasiswa IAIN-SU Medan pengen memberi imbauan kepada masyarakat agar memilih pemimpin yg bertanggungjawab,mampu menjalankan amanah dan mau mendengarkan pendapat,jujur dan terbuka,satu lagi bagi pemimpin yang beragama Islam agar menjalankan kepemimpinannya sesuai syariat Islam seperti yang dicontohkan Nabi Muhammad SAW. +6281973300784 Kami para guru mau tanya kepada Bapak dan Ibu, bagaimana kabar sertifikasi guru yang belum dibayar sampai saat in.mereka janji pada smestr pertama,hingga hari ini kami belum dapat kabar dengan kepastian kapan dicairkan. Kami butuh untuk biaya sekolah,biaya pengobtn,serta biaya lainnya.kami juga dapat kabar bahwa duit untuk sertifikasi sudah dikirim awal bln Juni dari Jakrta.tapi hingga kini kami tak tau kapan duit itu bisa cair. Kami mohon kepada Bpk & ibu wartawn supaya mencari tau kapan kepastian duit itu cair. Kami para guru merasa dibohongi. +6285262823624 Kritik (kecaman) adalah bunga api yg berbahaya,bunga api yang bisa meledakkan gudang mesiu rasa bangga seseorang.peledakan yang kadang - kadang bisa mengakibatkan kematian.

WASPADA Selasa 28 Juni 2011

Indonesia Banjir PNS Oleh Bachtiar Hassan Miraza Jika belanja pegawai tidak dibatasi maka jumlah PNS akan naik secara drastis setiap tahun.

I

ndonesia memiliki terlalu banyak pegawai negeri sipil. Jumlahnya melebihi kebutuhan tenaga di pemerintahan. Tiap tahun dilakukan penambahan PNS tanpa perencanaan yang jelas. Rekrut PNS tidak berdasarkan kebutuhan tetapi berdasarkan upaya untuk memperkecil jumlah tenaga kerja menganggur ataupun karena faktor kesempatan. Berdasarkan data Badan Kepegawaian Negara jumlah PNS tahun 2010 sebesar 4.598.100 yang terdiri dari pria 2.460.283 dan wanita sebesar 2.137.817. Jumlah ini diisi sebagian besar oleh lulusan SMA sebanyak 1.602.209 dan sarjana S1 sebanyak 1.426.215. Selebihnya diisi oleh lulusan SD (98.376),SLTP (138.105),D1 (79.537),D2 (691.686),D3 (433.302),D4 ( 17.359) ,S2 ( 103.401) dan S3 (7.910). Saat ini jumlah pembayaran gaji PNS sudah memberatkan anggaran belanja negara. Pemerintah sudah mengeluh atas besarnya jumlah pembayaran gaji untuk PNS aktif dan pensiunan PNS. Pembayaran ini mengurangi kesempatan pemerintah untuk membangun infrastruktur yang merupakan kebutuhan pokok masyarakat banyak dan kepentingan perekonomian bangsa. Menurut Wakil Menteri Keuangan, dalam APBN 2011 ini dana yang ditransfer ke daerah sebesar Rp 393 triliun. Namun jika dihitung total dengan dana pos lainnya yang juga ditransfer ke daerah maka sebenarnya dana anggaran belanja negara yang mengalir ke daerah sebesar 70 %. Hanya sayangnya sebagian besar dipakai untuk pembayaran gaji pegawai negeri sipil daerah (PNSD). Wakil menteri sangat setuju dengan usul pembatasan belanja pegawai dan menetapkan batas minimal alokasi belanja modal pada setiap daerah. Dengan cara ini anggaran belanja negara menjadi sehat dan effektif. Jika belanja pegawai tidak dibatasi maka jumlah PNS akan naik secara drastis setiap tahun. Bayangkan di Indonesia ada lebih kurang 450 daerah kabupaten dan kota. Jika tiap kabupaten meminta kepada pemerintah pusat jatah 200 tenaga PNSD baru jumlahnya sama dengan 90.000. PNSD baru. Jangan jangan nantinya anggaran belanja pemerintah daerah habis hanya untuk membayar

gaji PNSDnya saja. Oleh sebab itu pembatasan belanja pegawai perlu dilakukan supaya daerah tidak secara terus menerus menambah pegawai dan menjadikan anggaran belanja daerah menjadi tidak sehat. Kenaikan PNSD itu be-lum tentu berimbang dengan kenaikan PAD di daerah ataupun pelayanan bagi masyarakat. Saat ini, pemerintah se-dang mempelajari bagaimana cara mengatasinya, baik untuk pembayaran gaji PNS aktif maupun para PNS pensiun. Karena Menteri Keuangan dan para menteri terkait lainnya berasal dari sektor swasta maka mereka akan menyusun peraturan tentang tata cara rekrutmen PNS baru. Pikiran mereka tertuju pada cara rekrutmen sektor swasta. Seleksi akan dilakukan secara ketat berdasarkan ke-mampuan dan keahlian serta rencana kebutuhan. Calon PNS terbuka untuk siapa saja sepanjang memenuhi kreteria yang ditentukan. Tidak seperti saat ini, terbuka tanpa kreteria terkecuali kepemilikan ijazah. PNS yang tidak memenuhi kompetensi akan menjadikan birokrasi berjalan tidak effisien. Mengingat pada beban negara masa mendatang, yang akan dipegang oleh anak cucu bangsa, pemikiran pembatasan belanja pegawai dianggap tepat. Jangan kita meninggalkan beban berat kepada anak cucu yang memerintah masa depan. Di luar gaji PNS aktif, jumlah pembayaran pensiun tahun 2011 diperkirakan sebesar Rp51,5 triliun. Jumlah ini akan mengalami kenaikan pada tahun 2012 jika diperkirakan pertambahan PNS pensiun sebesar 10% dan kenaikan pensiun pokok 10%. Dana pembayaran pensiun akan bertambah Rp 7,5 triliun sehingga pada tahun 2012 diperkirakan dana pembayaran pensiun meningkat menja-di Rp 59 triliun. Jika sekarang saja jumlah tersebut sudah sedemikian besar apalagi nanti pada tahun tahun berikutnya dan akhirnya pasti menekan anggaran belanja negara. Kesempatan untuk pembiayaan proyek proyek penting menjadi terbengkalai karena pengeluaran yang membengkak ini. Belanja pegawai dengan belanja modal menjadi tidak berimbang. Pemerintah harus menang-gung biaya kehidupan PNS dalam jangka yang terlalu panjang, sejak seorang PNS di-

terima. Seorang PNS pensiun setelah 25 tahun bekerja (menerima gaji selama 25 tahun). Lalu 5 tahun kemudian ia meninggal maka hak pensiun jatuh pada isteri yang masih hidup. Lima tahun kemudian isteri juga meninggal maka hak pensiun jatuh pada anak yang masih masuk dalam daftar tanggungan. Lima tahun kemudian anak tersebut sudah dewasa. Sejak itu barulah habis tanggung jawab pemerintah membayar gaji dan pensiun seorang PNS. Jika dihitung waktu pertanggungan itu selama 25 ditambah 5 dan ditambah 5 dan ditambah lagi 5 tahun total 40 tahun pembayaran. Inilah yang barangkali yang menjadi daya tarik mengapa anggota masyarakat beramai ramai mengejar status PNS. Maka seorang calon mertua juga bangga jika calon menantunya seorang PNS. Kehidupan anak dan cucunya ditanggung negara. Di samping daya tarik diatas, sebab lain mengapa tenaga tenaga muda Indonesia mengejar sebagai PNS karena mereka kurang memiliki kemandirian. Ini merupakan gambaran kegagalan lembaga pendidikan didalam mengembangkan sumberdaya manusia Indonesia. Lembaga pendidikan lebih menekankan pada pendidikan akademik tidak pada pendidikan keahlian. Teori yang diberikan tidak diiringi dengan contoh contoh visual ataupun implementasi teori yang berjalan ditengah masyarakat. Biaya membangun sebuah laboratorium terlalu mahal. Demikian juga dengan

disiplin ilmu ilmu sosial dimana para pengajar dan dosen tidak mampu memberikan contoh contoh nyata yang ada ditengah masyarakat. Anak didik hanya dicekoki ilmu tanpa praktek dan setelah lulus anak didik merasa kurang percaya diri. Maka menjadilah mereka komunitas PNS yang tidak menuntut keahlian seperti jika mereka bekerja pada sektor swasta ataupun membuka lapangan kerja sendiri. Apa yang terjadi ini harus menjadi perhatian para orang tua. Saat ini masanya anak anak memilih fakultas mana yang akan dimasukinya. Semua fakultas dan semua ilmu adalah baik tapi cari fakultas yang bisa menciptakan kemandirian anak sesuai dengan bakatnya. Masa mendatang tak mungkin lagi pemerintah bisa menerima para lulusan (SMA atau perguruan tinggi dsb) sebagai tempat berlindung. Tenaga muda Indonesia yang masih dalam proses pendidikan perlu diarahkan pada penciptaan kemandirian. Kemandirian dan keahlian akan dituntut oleh dunia kerja. Dunia kerja masa mendatang adalah sektor swasta. Sektor ini mempunyai masa depan yang cerah dan yang akan menyerap banyak tenaga kerja. Atau arahkan anak didik mampu menciptakan lapangan kerja sendiri melalui pelatihan kewiraswastaan atau dengan membangunkan usaha mikro bagi anak didik sejak awal menjadi seorang mahasiswa. Penulis adalah Pemerhati Ekonomi.

Gunakan Nurani Pada PilwakoTebingtinggi Oleh Drs H. Done Ali Usman, MAP Masyarakat Tebingtinggi tentu bisa menilainya ternyata “yang muda yang berkarya”.

P

ada 28 Juni 2011, Pemilihan Ulangan Walikota Tebingtinggi dimulai, memenuhi Keputusan Mahkamah Konstitusi (MK) yang menggugurkan pasangan calon Walikota Syafri Chap – Hafaz Fadhillah walaupun sudah memenangkan Pemilihan Walikota (Pilwako) Tebingtinggi 12 Mei 2011 lalu. Keputusan MK yang kurang tegas bahkan memiliki multi tafsir untuk senantiasa membuka peluang “adanya komplain” peserta yang kalah, bahkan membuka peluang untuk masuk pada putaran ke tiga. Sebagaimana diketahui, Pilwako Tebingtinggi tetap diikuti 5 pasang balon Walikota yang telah direstui KPU, KPU Provinsi dan KPU Tebingtinggi yakni: 1) pasangan Umar Zunaidi – Irham Taufik yang di usung perahu-perahu rakitan berbagai merk, terdiri dari 19 Parpol; 2) Adi Harianto – Sarabintang memanfaatkan jalur independen; 3) Amril Harahap – Irwandi dengan perahu terbaru (PPIB/PKBN); 4) Eddi Syofyan – Hafaz Fadhillah dengan perahu bermesin turbo (Golkar – Patriot); 5) Syahril Hafzein – Gunadi dengan perahu bermesin standar (PDIP – Republikan). Majunya Eddy Syofian menggantikan Syafri Chap yang dibatalkan MK memancing polemik di masyarakat termasuk para calon Walikota yang bersaing. Inilah peluang komplain kalau nantinya pasangan Eddy Syofian - Hafaz Fadhillah memenangkan Pilwako karena keputusan MK yang kurang tegas tadi menimbulkan multi tafsir. Harus dimaklumi bahwa tafsiran sebuah keputusan bisa sebanyak otak orang yang menafsirkan. Oleh karena itu pergunakanlah nurani yang menurut Anda yang terbaik untuk dipilih, jangan terkontaminasi pengaruhpengaruh “orang-orang tertentu”, yang akhirnya kota indah ini menjadi tidak kondusif. Jangan pula karena isu-isu sah tidak sah masyarakat Tebingtinggi menjadi Golput. Yang menentukan mana calon Walikota yang terbaik adalah masyarakat konstituen, oleh karena itu pilih calon yang menurut hati nurani Anda yang terbaik. Hindari menerima “sogokan” untuk memilih balon tertentu, yang akhirnya melahirkan Walikota Koruptor, untuk mengembalikan harga pokok menjadi Walikota sogokan itu bisa berupa uang, dan bisa pula berupa janji-janji manis. Kini terdengar isu pada kesempatan penerimaan murid baru, pada sekolah favorit, Rintisan Sekolah Bertaraf Internasional (RSBI) seperti SMA Negeri I, SMK 2, bagi orang tua pemilih balon tertentu akan

mendapat “prioritas” untuk diluluskan/diterima di sekolah RSBI tersebut, ini sudah pasti adanya “kolaborasi” antara pejabat pendidikan dan Kepala Sekolah. Ini tugas Pengawas Pilwako, DPRD, dan Dewan Pendidikan untuk mencermatinya. Dan jangan pula masyarakat Tebingtinggi menjadi “Golput” karena timbulnya keraguan. Jika dari calon walikota mereka nilai layak untuk dipilih, maka rakyat memiliki keberanian untuk bersikap tegas, memilih atau tidak memilih. Mereka berani dan secara rasional berkata tidak kepada semua calon yang ada. Ini merupakan kemajuan demokrasi yang cukup berarti. Golput menjadi makin eksis dan diakui keberadaannya sebagai bagian dari demokrasi di Indonesia. Golput juga bisa disebabkan oleh jeleknya penyelenggaraan pemilihan walikota yang buruk dan penuh kecurangan. Sudah bukan rahasia lagi bahwa kecurangan-kecurangan banyak terjadi di daerah-daerah. Penggelembungan suara calon pasangan Pilwako tertentu dan ada calon yang suaranya dibajak sudah jadi berita. Publik sudah tahu bahwa Pilwako hanya untuk memenangkan pasangan tertentu untuk menyisihkan calon-calon lainnya. Otomatis pendukung pasangan tersisih, tidak ada gairah lagi untuk mengikuti Pilwako pada tahapan berikutnya, seandainya Pilwako terjadi tiga putaran. Orang mengatakan bahwa Golput pasti terjadi, itu menjadi tamparan bagi para politisi. Tapi bagi masyarakat yang tingkat kedewasaan berpikirnya sudah tinggi, Golput harus dilihat sebagai ekspresi politik. Artinya sebenarnya orang yang memilih dengan yang tidak memilih itu dengan kesadaran yang sama di mata politik. Dengan tujuan bahwa mereka yang tidak memilih itu sebetulnya mendewasakan elit politik. Kita harus melihat Golput sebagai fenomena yang baru dalam berdemokrasi. Orang yang telah memilih untuk Golput, berarti dia itu harus siap pula untuk diam, dan harus bisa menghormati serta menerima seluruh hasil pemilihan itu dengan tanpa ada rasa menyesal. Untuk tidak menjadi pemilih Golput karena keraguan, memang diperlukan indikator tipe yang bagaimana yang seharusnya menjadi pilihan utama. Untuk itu perlu rekam keberhasilan (track record) dari masing-masing calon Walikota Tebingtinggi yang akan bertarung dalam Pilwako 28 Juni 2011. ini penting disampaikan sebagai ba-

gian dari pendidikan politik kepada masyarakat dan juga agar masyarakat tidak salah pilih yang berujung penyesalan. Track record tersebut harus dijadikan sebagai salah satu kriteria dalam menjatuhkan pilihan. Masyarakat harus bisa mencermati dan mempelajari apa yang sudah dilakukan para calon selama ini. Kalau selama ini si calon sering melakukan hal-hal yang menciderai masyarakat dan berbuat curang dalam berbagai hal, baik di bidang pendidikan maupun saat memimpin, berarti orang seperti itu harus dihindari. Sebab, memimpin itu sebenarnya harus dimulai dari diri sendiri dan mendapatkan sesuatu itu juga harus dengan jalan yang sah dan halal. Semua yang diperoleh itu harus sah dan halal, baik soal ijazah, harta kekayaan, biaya kampanye, dan lainnya. Kalau tidak sah dan tidak halal berarti track recordnya tidak bagus/cedera. Jika dikaitkan dengan komunikasi politik, orang-orang yang menciderai masyarakat dan mendapatkan sesuatu dengan cara yang tidak sah dan tidak halal akan sulit membangun hubungan dengan masyarakat untuk mewujudkan kebersamaan membangun kota Tebingtinggi, karena masyarakat akan tetap curiga bahkan yang muncul adalah sikap apatisme. Menyinggung soal kriteria lainnya, calon pemimpin Kota Tebingtinggi juga seharusnya orang yang dikenal kuat dengan agama, tegas, dan konsisten dengan tugas yang diberikan kepadanya. Tidak punya penyakit fisik dan penyakit sosial, seperti terindikasi korupsi, dekat dengan dunia malam dan asusila. Kemudian, kuat memegang amanah, adil terhadap semua lapisan masyarakat, dengan kata lain tidak mengutamakan elit, pengusaha, dan golongannya. Selain itu, calon pemimpin itu juga harus sederhana, bukan miskin tapi bukan juga glamour dan hidup bermewah-mewahan, paham untuk mewujudkan kepemerintahan yang baik (good governance). Mencermati track record para Balon Walikota, sebenarnya tak perlu diragukan lagi, masing-masing punya kelebihan dan juga punya kekurangan. Tetapi berdasarkan pengalaman dari mulai Walikota Tebingtinggi Kantor Tarigan, Syamsul Sulaiman, Sanggup Ketaren, Amiruddin Lubis, Ripai Perangin-angin, Rohani Darus, sampai dengan Hafiz Hasibuan yang mampu mengubah Kota Tebingtinggi dan mempunyai keunggulan komparatif adalah Amiruddin Lubis. Tokoh muda dengan usia 31 tahun ketika menjabat Walikota berhasil menata kota dengan prestasi menakjubkan yakni perluasan kota, mendapat penghargaan Repelita Tahap II, berupa Para Samya Purna Karya Nu-

graha. Partisipasi masyarakat dengan memotong sendiri kaki lima pertokoan untuk jalan, investor lokal membangun tanah-tanah Pemda yang tak bermanfaat, menyisihkan sebagian Pendapatan Asli Daerah untuk pembangunan (Public saving), membangun kantor Walikota dan DPRD kembar/ tepak sirih kembar tanpa beban APBD. Tidak seperti Walikota berikutnya hanya berkutat pada masalah “grand design” rakyat tidak lapar, rakyat tidak bodoh, rakyat tidak sakit, rakyat punya masa depan dan rakyat yang bertakwa, toh income per kapita masyarakat Tebingtinggi masih setara dengan Upah Minimum Regional Sumatera Utara (UMRSU) seputar Rp. 1.100.000,- per bulan. Masyarakat Tebingtinggi tentu bisa menilainya ternyata “yang muda yang berkarya”. Penulis adalah Staf Pengajar Pascasarjana UMA/UISU Medan

Pengumuman Redaksi menerima kiriman karya tulis berupa artikel/opini, surat pembaca. Kirim ke alamat redaksi dengan tujuan ‘Redaktur Opini Waspada’ dengan disertai CD atau melalui email: opiniwaspada@yahoo. com. Panjang artikel 5.000-10.000 karakter dengan dilengkapi biodata penulis dan kartu pengenal (KTP). Naskah yang dikirim adalah karya orisinil, belum/tidak diterbitkan di Media manapun.Tulisan menjadi milik Waspada dan isi tulisan menjadi tanggungjawab penulis.

SUDUT BATUAH * Perlu gerakan satu hari tanpa nasi - Rajin aja puasa Senin-Kamis! * Rumah dinas Gubsu tak berpenghuni - Asal jangan dihuni mahluk lain * Bupati Sergai antusias laksanakan pembangunan - Mantap kali, he...he...he

oel

D Wak


Opini

WASPADA Selasa 28 Juni 2011

B5

Isu Strategis Bidang Kesehatan TKWI Bukan Budak Mencermati berbagai pemberitaan yang dilansir sejumlah media beberapa hari terakhir tentang penderitaan sejumlah Tenaga Kerja Indonesia (TKI) dan Tenaga Kerja Wanita Indonesia (TKWI) di luar negeri, kok rasanya hati kita menjadi sangat ‘panas’. Darah seperti mendidih. TKI, khususnya yang bekerja di sektor informal misalnya menjadi pembantu rumah tangga di luar negeri, memang sering terdengar diperlakukan sangat tidak manusiawi. Tidak jarang diperlakukan seperti budak. Kemerdekaannya dirampas. Haknya dikebiri. Sepertinya, majikan boleh berbuat apa saja. Tentu saja, tidak semua majikan berperilaku sadis seperti itu. Tapi rasanya sudah sangat sering kita mendengar TKWI yang diperlakukan semena-mena. Desakan agar pemerintah menghentikan pengiriman TKI khususnya yang akan dipekerjakan menjadi pembantu rumah tangga, sudah menggelinding sejak beberapa tahun lalu. Kenapa mereka harus ke luar negeri untuk menjadi pembantu? Tentu saja, fenomena ini adalah salah satu buntut dari kegagalan pemerintah menciptakan lapangan kerja yang layak di tanah air. Mustahil mereka mau jauh-jauh meninggalkan keluarga untuk mencari makan di luar negeri, kalau di sini lapangan kerja tersedia. Kenyataannya, angka pengangguran terus melonjak, sangat tidak sebanding dengan lapangan kerja yang tersedia. Ketika kesulitan hidup terus menghimpit, tidak sedikit yang bersedia menjadi TKI walaupun harus menjadi babu di negeri orang. Astagfirullah. Namun, kendati tak enak didengar, itulah faktanya. Dengan kemampuan seadanya, mereka meninggalkan tanah air dengan satu tekad untuk memperbaiki ekonomi keluarga. Mereka pun menjadi tenaga kerja informal dengan status pembantu rumah tangga. Kendati tetap ada yang pulang ke tanah air dengan senyuman, setelah berhasil mengumpulkan sekian banyak uang dari hasil jerih-payah di negeri orang, tapi yang pulang dalam kondisi memprihatinkan juga tidak sedikit. Ada yang disiksa sampai cacat, diperkosa, gaji tak dibayar. Bahkan ada yang dipulangkan dalam kondisi sudah tidak bernyawa. Na’udzubillah. Makanya, jangan heran, jika mereka yang didzolimi ini ada yang berusaha membela diri. Ketika sudah tidak tahan disiksa terus-menerus, ada yang melawan. Tapi, jika si majikan terbunuh karena pembantu berusaha menyelamatkan diri dari siksaan demi siksaan, apa komentar Anda? Tak banyak yang dapat diperbuat ketika Ruyati dihukum pancung di Arab Saudi. Pelaksanaan eksekusi itu saja tak diketahui pemerintah RI. Makanya banyak yang menyesalkan, dan menuding pemerintah RI gagal melakukan pembelaan terhadap pahlawan devisa. Lihat saja, sejumlah tokoh lintas agama menggelar acara doa bersama di depan Istana Kepresidenan. Mereka mengatakan, satu pahlawan dibunuh di Arab Saudi karena keteledoran pemerintah yang tidak membela. Melihat begitu banyaknya persoalan yang dihadapi TKI di luar negeri, kini muncul desakan agar menghentikan pengiriman tenaga kerja ke luar negeri. Soalnya, seharusnya TKI berhak mendapat perlindungan sejak sebelum keberangkatan, dalam masa penempatan, hingga saat bekerja di negeri orang. Kabarnya, pemerintah akan menghentikan pengiriman tenaga kerja Indonesia ke Arab Saudi per 1 Agustus ini. Kemudian, Satgas dibentuk untuk menangani TKI yang terancam hukuman mati di luar negeri. Bahkan, DPR mendesak pemerintah untuk menyuruh pulang Duta Besar Indonesia dari Arab Saudi. Selesaikah masalah sampai di sini? Tentu saja, sejumlah TKI tidak hanya menghadapi masalah di Arab Saudi. Dikabarkan, sekarang ini 216 warga negara Indonesia terancam hukuman mati di luar negeri. Mereka tengah menjalani proses pengadilan di berbagai negara. Dalam rentang 2009-2011, warga Indonesia yang terancam hukuman mati di luar negeri berjumlah 303 orang, 29 di antaranya berhasil dibebaskan dan dibawa pulang ke tanah air. Sedangkan 55 orang lainnya, bebas dari hukuman mati tapi masih harus menjalani hukuman. Tak ayal, Wakil Ketua DPR Proyo Budi Santoso mendorong pemerintah untuk menghentikan pengiriman tenaga kerja Indonesia ke Arab Saudi; khususnya yang dijadikan pembantu rumah tangga. Mungkin ini langkah yang dianggap upaya antisipasi agar kita tak lagi terus dijejali dengan cerita miris tentang kenestapaan yang dialami TKWI. Tapi upaya untuk mengatasi ledakan pengangguran di tanah air juga harus jadi perhatian ekstra-serius. Nayyara Nasution Medan

Listrik Mengulah Lagi Dalam beberapa hari terakhir ini, aliran listrik di Kota Medan dan sekitarnya kembali mengulah. Saya tak tahu persis, apakah ini dilakukan secara bergilir atau tidak, tapi yang jelas, kondisi ini sangat mengganggu kenyamanan dan mengganggu aktivitas. Saya tinggal di kawasan Tanjung Gusta, Sunggal, Deliserdang. Tentu saja, aliran listrik padam pada siang hari atau malam hari, ya... sama saja, sama-sama mengganggu kenyamanan. Jika terjadi siang hari seperti yang terjadi Kamis (23/6), dari sekira pukul 12.00 sampai pukul 17.00, aktivitas terhenti. Apalagi, dalam cuaca Kota Medan dan sekitarnya yang panas terik luar biasa belakangan ini. Jika listrik padam pada malam hari, juga sangat mengganggu. Anak-anak praktis tak bisa belajar. Atau kita kembali seperti zaman doeloe, anak-anak belajar di bawah cahaya lampu teplok. Pokoknya, jika listrik padam, sangat tidak nyaman. Siang atau malam. Saya sempat berbincang dengan tetangga saya. Ternyata, kekhawatiran dia sama dengan yang saya khawatirkan. Jangan-jangan akan kembali terjadi pemadaman listrik secara bergilir seperti tempo hari, yang sangat meresahkan itu. Tapi saya tetap saja berusaha menenangkan dia, juga tentu saja sekaligus menenangkan kegelisahan saya, dengan mengatakan mungkin pemadaman ini hanya karena perbaikan jaringan di kawasan tertentu. Bukan pemadaman bergilir seperti yang terjadi beberapa waktu lalu. Kalau dulu saya sering membaca di media tentang pengumuman kawasan mana saja yang mengalami pemadaman listrik. Tapi, sekarang ini, kendati pemadaman beberapa kali terjadi, saya tidak menjumpai pengumuman serupa di media. Tolonglah para petinggi PLN, jangan lagi kami disusahkan dengan pemadaman listrik secara bergilir, yang dulu pernah seperti minum obat: bisa pemadaman terjadi tiga kali sehari. Membayangkannya saja kami takut. Kami bayar tagihan tak pernah telat, lho. Budi Hermanto Tg Gusta, Sunggal

Musuh Kita Mafia Hukum Mantan Wakil Presiden Jusuf Kalla menegaskan, para advokat bersama-sama aparat penegak hukum lainnya secara bersungguh-sungguh memerangi korupsi, penyuapan, dan praktik-praktik tercela lainnya yang dapat merusak kewibawaan hukum dan lembaga peradilan. Peranan dan fungsi advokat sebagai profesi yang bebas, mandiri dan bertanggung jawab menjadi hal yang sangat penting, disamping lembaga peradilan dan instansi penegak hukum yang berwibawa di mata rakyat. Peranan advokat atau pengacara dalam menegakkan hukum sangat diperlukan, sehingga masyarakat butuh advokat yang benar-benar professional dalam menjalankan tugasnya yang berat namun mulia dalam mendampingi kliennya di sidang pengadilan, pengacara memang bertugas membela kliennya, pengacara dibayar untuk tugasnya itu, namun pengacara yang baik hendaknya rasional dalam meberikan advokasi di pengadilan sehingga bukan yang salah menjadi di bebaskan, tetapi yang salah tetap salah. Namun berkat kejelian pengacara menampilkan saksi, barang bukti dan halhal yang meringankan hukuman kliennya menjadi minimal. Sejak lama masyarakat sudah kesal dengan lemahnya penegakan hukum dinegeri tercinta ini. Hemat kita permasalahan besar yang dihadapi bangsa kita adalah lemahnya penegak hukum. Kalau Mantan Wapres Jusuf Kalla mengatakan, hingga kini masih terjadi krisis kepercayaan dalam penegakkan hukum karena penyelenggaraan penegakan hukum belum berjalan dengan baik. Tentunya kita harapkan rendahnya tingkat kepercayaan masyarakat kita terhadap aparat penegak hukum tidak boleh di biarkan berlama-lama. Harus ada upaya untuk memperbaikinya sehingga terciptanya keadilan terhadap seluruh warga negara. Caranya tentunya dengan meningkatkan sanksi hukuman terhadap aparat penegak hukum yang melakukan pelanggaran hukum, seperti menjadi mafia peradilan dll. Kalau yang melakukan kesalahan itu warga biasa hukumannya setahun, maka kalau pelakunya orang yang tahu hukum maka hukumannya diperberat menjadi dua tahun. Urwatun Wusqa Jl. Slamat Pulau

Oleh dr Candra Syafei, Sp.OG Akselerasi pembangunan kesehatan di masa depan memerlukan lingkungan strategis yang kondusif, pembangunan berwawasan kesehatan sebagai strategis pembangunan nasional.

K

eberhasilan dan kegagalan pembangunan bidang kesehatan,tidakterlepasdaribanyak sedikitnya dukungan lintas program dan lintas sektoral untuk hal tersebut. Maka para pemegang amanah/ SKPD kesehatan seharusnya sering melakukan advokasi dalam rangka mendapatkan dukungan. Pekerjaan advokasi akan sangatditentukanolehseberapakematangan dalam men-design isu strategis dan langkah-langkah pelaksanaaannya. Langkah awalnya yang sangat menentukan. Bagi mereka yang berpengalaman dalam melakukan advokasi selama ini, selalu mengatakan: Jika anda sudah menetapkan dan merumuskan dengan baik isu strategis yang akan diadvokasikan, maka sesungguhnya separuh dari seluruh pekerjaan advokasi sudah selesai. Karena isustrategis,merupakanperumusanjawaban terhadap sejumlah pertanyaan atau masalah kebijakan paling mendasar yang mempengaruhi pekerjaan advokasi selanjutnya. Tetapi apakah yang dimaksud dengan isu strategis? Atau bagaimana menentukan suatu isu strategis? Memang strategis atau tidak untuk diadvokasikan? Tolok ukur Selain faktor aktualitas (sedang hangat atausedangmanjadiperhatianmasyarakat), pada dasarnya suatu isu dapat dikatakan sebagai isu yang strategis jika :1.Relevan dengan masalah-masalah nyata dan aktual yang dihadapi masyarakat, khususnya lapisan yang menjadi konstituen utama dari kerja-kerja advokasi tersebut. 2.Mendesak dan sangat penting diberi perhatian segera, jika tidak dicoba untuk diatasi segera akan berakibat fatal di masa depan (misal: masalahnya makin gawat dan rumit atau membawa akibat kerusakan yang lebih parah. 3.Pengaruh serta dampaknya cukup besar dan meluas, jika diadvokasi. Apalagi jikanantinyaberhasil,isutersebutdiperkirakan berdampak positip pada perubahan kebijakan publik lainnya dalam rangka perubahan sosial yang lebih besar dan lebih luas. Tidak ada satu rumusan baku, yang ada adalah sebatas garis-garis besar langkahlangkah advokasi, yang boleh dijadikan sebagaipanduandasarnya.Dalamkenyataannya, ada kalanya isu strategis sudah ditetapkan terlebih dahulu, dan baru belakangan membentuk tim inti. Kalau terjadi praktek sepertiini,makatimintiyangtelahterbentuk sebaiknya duduk dan membahas bersama isustrategisyangtelahterumuskantersebut. Yaknidenganmelakukanpenilaiankembali (review): apakah isu yang telah dipilih dan ditetapkan itu memang benar-benar strategis atau tidak, menurut tim inti? Dalam proses perumusan isu strategis, sering ditemukan perbedaan bahkan bisa mengarahkepertentangandiantaraanggotatimintiataudenganparapelaksanaadvokasi lainnya. Perbedaan atau pertentangan itu bisa terjadi. Maka, sebagai dasar untuk pemufakatannya adalah sebaiknya dikembalikan pada pertanyaan mendasar: apa, bagaimana, mengapa, dimana, kapan, dan siapaorang-orangataukelompokyangnantinya akan memperoleh manfaat atau se-

baliknya dirugikan. Langkah-langkah pokok Dalam rangka menyusun isu strategis maka ada beberapa langkah yang dapat kita jadikan pedoman, yakni :1).Tim inti mencari dan memilih orang yang berkemampuan untuk melakukan kajian kebijakan (policy study) bidang kesehatan.Tim inti mengorganisir mereka menjadi suatu kelompok kerja khusus yang membantu dan bertanggungjawab langsung kepada tim inti. 2).Kelompok kerja kajian kebijakan (K4) tersebut segera melakukan tugas utamanya, yaitu: mengumpulkan dan menganalisa semua data dan informasi yangberkaitandengankebijakankesehatan pada semua aras (dari lokal sampai nasional, jika perlu juga sampai kearas internasional. 3).K4 tersebut merumuskan kesimpulan dan reklomsendasinya tentang isu stategis kebijakan kesehatan yang akan diadvokasi, dan menyajikan kepadaTim inti untuk dibahas dan disepakati. Pada tahap ini, dilakukan penilaian berdasarkan tolok ukur isu strategis diatas tadi. 4). Jika telaahan disepakati, maka tim inti kembali menugaskan kepada K4 tersebut untuk menyusun“Kertas Posisi“berdasarkan hasil kajiankebijakantersebut,Kertasposisiyang menjadi dokumen dasar yang melandasi seluruh rangkaian kegiatan advokasi berikutnya, karena berisi alasan-alasan. konteks permasalahan, tujuan, visi dan misi, sasaran, strategi dan cara-cara pelaksanaan advokasi terhadap isu yang telah ditetapkan. Untuk menetapkan sejumlah isu strategis, tolok ukur isu yang dinilai strategis.adalah:a).Jikamasalahitudimunculkan akan menjawab beberapa persoalan kesehatan sekaligus. b).Jika ditangani dan berhasil, akan berdampak positip. c).Umumnya tidak ditolak oleh pendapat umum setempat, masyarakat umumnya sependapat atau setuju bahwa memang masalah. d).Sesuai kebutuhan dan aspirasi masyarakat luas selama ini. e).Tidak dapat diabaikan, sangat penting dan mendesak bagi masyarakat. Isu-isu strategis Akselerasi pembangunan kesehatan di masa depan memerlukan lingkungan strategis yang kondusif, pembangunan berwawasan kesehatan sebagai strategis pembangunan nasional—belum dapat dilaksanakan sesuai yang diharapkan. Globalisasi merupakan tantangan, masalah, dan potensi untuk pembangunan. Pengaruh globalisasi dan liberalisasi perdagangan dan pelayanan melalui berbagai kesepakatan internasional, akan mempengaruhi berbagai aspek penyelenggaraan upaya kesehatan dan memerlukan, persiapan dari pemerintah dan masyarakat. Peraturan Daerah nomor 2 tahun 2008 tentang Sistem Kesehatan Provsu telah

memberikandukungandasarhukumyanag kuatakanpentingnyaupayapembangunan kesehatandiSumateraUtara.Perdainiharus diterjemahkan dalam beberapa keputusan Gubernur yang mengatur semua fungsi dan penyelenggaraanpembangunankesehatan secara lerbih rinci.Terbitnya keputusan Gubernur akan menentukan kesinambungan dan keberhasilan penyelenggaraan pembangunan kesehatan dimasa mendatang. Kecenderungan kriminalitas yang meningkat,peredaranNAPZAyangsemakin merajalela, kemiskinan, pengangguran, dan sebagainya akan menyebabkan masalah yang serius terhadap pembangunan yang berwawasan kesehatan. Kemudahan transportasi,komunikasidanpenyebarluasan berbagai informasi berpengaruh juga terhadap penyalahgunaan narkotika, obat psikotropikadanzatadiktiflainnya,penyakit, perilaku seks bebas dan gaya hidup tidak sehat lainnya. Hal ini akan mempengaruhi derajad kesehatan masyarakat. Keberhasilanpenanggulanganberbagai penyakit sudah terbukti harus memperhitungkan faktor budaya masyarakat.Pendekatan budaya dalam memberdayakan masyarakatmerupakanunsurutama.Selain aspek budaya, aspek agama juga sangat mempengaruhi perilaku masyarakat, termasuk perilaku yang berkaitan dengan kesehatan yang akhir-akhir ini mempunyai kecenderungan sangat menurun kualitasnya. Disamping itu tingkat pemahaman dan membaca dari masyarakat pada umumnya masih rendah, sehingga menyebabkan kurang lancarnya upaya promosi kesehatan. Transisi demografi,denganterusbertambahnya jumlah penduduk telah dapat diprediksi sebagai dampak dari pembangunan baik dalama bidang ekonomi, keluarga berencana dan kesehatan, serta gizi.Dalampiramidakependudukan,terlihat adanya kecenderungan mengecilnya jumlah penduduk usia muda/balita dan meningkatnya jumlah segmen angkatan kerja dan usia lanjut secara bermakna di tahuntahun mendatang. Peran ilmu pengetahuan dan teknologi sangat menentukan keberhasilan berbagai program pembangunan termasuk pembangunan bidang kesehatan. Bebagai penemuan yang merupakan hasil penelitian dan pengembangan sangat mendukung pelaksanaan program pembangunan kesehatan. Dalam merespon perkembangan ilmu pengetahuan dan teknologi tersebut, upaya penapisan belum dilaksanakan secara efektif. Sehingga penggunaan ilmu pengetahuan dan teknologi canggih justru menyebabkan mahalnya biaya kesehatan. Lingkungan fisik dan biologi berubah sangat cepat akibat berbagai pembangunan yang dilaksanakan. Terlihat kecenderungan bahwa pembangunan seringkali diterjemahkan pada perubahan fisik yang cenderung mudah terlihat. Di Pedesaan, implikasinya adalah eksploitasi lingkungan yang berlebihan yang berakibat rusaknya ekologi alam. Eksploitasi alam yang semakin tidak terkendali dan perubahan; lingkungan mengarah pada perusakan alam yang berakibat fatal. Selain itu faktor perubahan iklim. perubahan keseimbangan ekologi, eksloitasi

alam yang berlebihan, meningkatnya bencana alam dan sebagainya akan membawa dampak negatif yang makin serius pada kesehatan masyarakat dimasa mendatang. Pencemaran udara, air dan tanah serta perubahan lingkungan biologis, penggunaan pestisida. insektisida, dan fungisida yang berlebihan menyebabkan masalah kesehatan yang serius.Perubahan lingkungan biologis juga menyebabkan rangsangan patogenesis terhadap beberapa jenis bakteri, virus dan jasad renik lainnya yang akan mengancam kesehatan masyarakat dimasa mendatang. Mencermati perkembangan pembangunan kesehatan serta lingkungan strategis yang mempengaruhi pelaksanaan penyelenggaraan pembangunan kesehatan maka dilaksanakan pencermatan dan analisis lingkungan internal dan eksternal sehingga tergambar kekuatan dan kelemahan penyelenggaraan pembangunan kesehatan di Sumatera Utara. Mencermati analisis situasi dapat disimpulkan adanya kekuatan dan kelemahan dalam rangka meningkatkan derajad kesehatan dan untuk mencapai tujuan yaitu : 1) Kekuatan (strenght); a).Ditetapkannya Peraturan daerah Nomor 2 Tahun 2008 tentang Sistem Kesehatan Provinsi Sumatera Utara. b) Ditetapkannya bidang kesehatan sebagai salah satu prioritas dalam pembangunan daerah. c)Tersedianya sarana pelayanan kesehatan mulai dari tingkat desa sampai ke tingkat provinsi. 2) Kelemahan (weakness); a.) Upaya pemerataan, keterjangkauan dan pelayanan kesehatan yang bermutu belum optimal khususnya dusara(na pelayanan kesehatan pemerintah. b) Pemerataan dan peningkatan kualitas sumber daya manusia kesehatan belum sepenuhnya menunjang penmyelenggaraan pembangaunan kesehatan. c) Lemahnya koordinasi dalam penyelenggaraan pembangunan kesehatan dalam era desentralisasi. d) Manajemen kesehatan yang meliputi administrasi kesehatan, sistem informasi, pengembangan ilmu pengetahuan dan teknologi di bidang kesehatan belum sepenuhnya dapat menunjang pembangunan kesehatan. 3).Peluang (Opportunities); a).Ditetapkannya RPJM Sumatera Utara 2009 – 2013, merupakan acuan bidang kesehatan dalam perencanaan sampai tahun 2009. b).Adanya globalisasi dan kemajuan ilmu pengetahuan dan teknologi (IPTEK) bidang kesehatan. c).Digalakannya prinsip Good Governance untuk mengacu peningkatan kemitraan antara masyarakat, pemerintah dan dunia usaha. d).Ditetapkannya Sumatera Utara sebagai pusat regional I dalam penanggulangan bencana untuk sektor kesehatan. 4).Ancaman (Threats) a).Munculnya krisis ketidakpercayaan dan ketidakpuasan masyarakat terhadap pelayanan kesehatan. b).Adanya perbedaan kepentingan (vested intersested) dalam penyelenggaraan pembangunan kesehatan terutama sejak dalam pelaksanaan otonomi daerah. c).Melemahnya partisipasi masyarakat dalam penyelenggaraan pembangunan kesehatan. d).Belum terciptanya pembangunan yang berwawasan kesehatan. e).Meningkatnya jumlah penduduk miskin, rentan dan beresiko tinggi serta penangan bencanaa belum memadai. Penulis adalah Kepala Dinas Kesehatan Provinsi Sumatera Utara

Kesehatan Bagi Semua Orang Oleh Dr dr Umar Zein Kesehatan dapat dianggap sebagai bahan konsumsi sekaligus sebagai bahan investasi.

S

emua orang ingin sehat, karena itu semua orang tentulah ingin mendapatkan layanan kesehatan sesuai yang diinginkannya. Dalam membahas konsep demand sector kesehatan,perlu diketahui bahwa ada pembedaan mengenai demand for health dan demand for health care. Terdapat berbagai hal dalam sektor kesehatan yang berbeda dengan sektor lainnya. Untuk itu beberapa pertanyaan perlu dijawab. Mengapa orang ingin sehat? Apa yang menentukan demand seseorang untuk menjadi sehat? Apa pengaruh pelayanan kesehatan dalam meningkatkan status kesehatan? Mampukah seseorang membeli sebuah layanan kesehatan? Adakah kepastian biaya dalam layanan kesehatan? Kesehatan merupakan modal untuk bekerja dan hidup untuk mengembangkan keturunan. Keinginan ini bersumber dari kebutuhan hidup manusia. Tentunya demand untuk menjadi sehat tidak sama antar manusia.

demand untuk layanan kesehatan memiliki beberapa hal yang membedakan dengan pendekatan tradisional demand dalam sektor lain, yaitu: 1.Yang diinginkan masyarakat atau konsumen adalah kesehatan bukan pelayanan kesehatan. Pelayanan kesehatan merupakan derived demand sebagai input untuk menghasilkan kesehatan. Kebutuhan penduduk meningkat, penyakit semakin kompleks, dan teknologi kedokteran serta perawatan yang semakin tinggi menuntut tersedianya dana untuk investasi, operasional, dan pemeliharaan. 2.Masyarakat tidak membeli kesehatan dari pasar secara pasif, masyarakat menghasilkannya, menggunakan waktu untuk usaha-usaha peningkatan kesehatan, di samping menggunakan pelayanan kesehatan. 3. Kesehatan dapat dianggap sebagai bahan investasi karena tahan lama dan tidak terdeprisiasi dengan segera. 4.Kesehatan dapat dianggap sebagai bahan konsumsi sekaligus sebagai bahan investasi.

Faktor memengaruhi sehat Hubungan antara demand terhadap kesehatan dengan demand terhadap layanan kesehatan harus dibedakan. Pengertian tentang keinginan (wants), permintaan (demands), dan kebutuhan (needs) tentunya berbeda. Menurut teori Blum, kesehatan dipengaruhi oleh beberapa faktor, yaitu: 1. Keturunan, 2. Lingkungan hidup, 3. Perilaku, 4. Pelayanan kesehatan. Akan tetapi konsep ini sulit untuk menerangkan hubungan antara demand terhadap kesehatan dan demand terhadap layanan kesehatan. Untuk menerangkan hubungan keduanya digunakan konsep yang berasal dari konsep ekonomi. Menurut teori Grossman (1972),

Faktor memengaruhi demand pelayanan kesehatan 1.Kebutuhan berbasis fisiologis. Kebutuhan berbasis keputusan petugas medis yang menetukan perlu tidaknya seseorang mendapat pelayanan medis sehingga memengaruhi penilaian seseorang akan status kesehatannya. 2.Penilaian pribadi akan status kesehatan. Secara sosio-antropologis, penilaian pribadi akan status kesehatan dipengaruhi oleh kepercayaan, budaya, normanorma sosial di masyarakat. Indonesia memunyai pengobatan alternatif dalam bentuk pelayanan dukun atau tabib, dapat dilihat bahwa demand terhadap pelayanan pengobatan alternatif ada dalam jiwa masyarakat kita.

3.Variabel-variabel ekonomi tariff. Hubungan antara tarif dengan demand terhadap pelayanan kesehatan adalah negatif. Semakin tinggi tarif maka demand akan semakin rendah. Hubungan negatif ini secara khusus terlihat pada keadaan pasien yang memunyai pilihan. Pada pelayanan rumah sakit, tingkat demand pasien sangat dipengaruhi oleh keputusan dokter. Keputusan dari dokter memengaruhi length of stay (lama rawatan), jenis pemeriksaan, keharusan untuk operasi, dan berbagai tindakan medis lainnya. Pada keadaanyangmembutuhkanpenanganan medis segera, maka faktor tarif mungkin tidak berperan dalam memengaruhi demand, sehingga elastisitas harga bersifat inelastic. Masalah tarif rumah sakit merupakan hal yang kontroversial. Pernyataan normatif di masyarakat memang mengharapkan bahwa tarif rumah sakit harus rendah agar masyarakat miskin mendapat akses yang mudah, akan tetapi tarifyangrendahdengansubsidiyangtidak mencukupi dapat menyebabkan pelayanan turun bagi orang miskin dan hal ini menjadimasalahbesardalammanajemen rumah sakit. 4.Penghasilan masyarakat. Kenaikan penghasilan keluarga akan meningkatkan demand untuk pelayanan kesehatan yang sebagian besar merupakan barang normal.Akantetapiadapulasebagianpelayanan kesehatan yang bersifat sebagai barang inferior,yaituadanyakenaikanpenghasilan masyarakat justru menyebabkan penurunankonsumsi.Haliniterjadipadarumah sakit pemerintah. Mereka yang memunyai penghasilan tinggi tidak menyukai pelayanan yang menghabiskan waktu banyak karena kesibukan yang tinggi, hal ini ditangkap oleh rumah sakit swasta yang memunyai segmen pasar golongan mampu.Waktu tunggu dan antrian mendapatkan pelayanan harus dikurangi dengan menyediakan layanan rawat jalan dengan perjanjian. 5.Asuransi kesehatan dan jaminan kesehatan. Hubungan antara demand pelayanan kesehatan dengan asuransi kesehatan bersifat positif. Asuransi bersifat

mengurangi efek faktor tarif sebagai hambatan untuk mendapatkan pelayanan kesehatan pada saat sakit. Semakin banyak masyarakat yang tercakup dalam asuransi maka demand akan pelayanan kesehatan termasuk rumah sakit akan semakin tinggi. Peningkatan demand ini dipengaruhi pula oleh faktor moral hazazd. 6.Jenis kelamin, umur, dan tingkat pendidikan.Wanita lebih banyak menggunakan pelayanan kesehatan dari pada pria. Dari segi pedidikan, semakin tinggi pendidikan seseorang cenderung meningkatkan kesadaran akan status kesehatannya sehingga demand terhadap layanan kesehatan juga besar. 7.Faktor lain (promosi, kepiawaian dokter/spesialistik dan fasilitas kesehatan). Sektor pelayanan kesehatan dilarang melakukan pengiklanan, karena bertentangan dengan etika. Hanya dalam bentuk informasi jenis pelayanan rumah sakit boleh dilakukan. Padahal, aspek promosi dan kualitas layanan berkaitan erat dengan sosialisasi dan bisnis. Aspek bisnis layanan kesehatan tidak bisa dipungkiri. Layanan spesialis dan subspesialis saat ini sudah menjadi keharusan suatu rumah sakit, dengan konsekwensi, rumah sakit harus menyediakan sarana yang dibutuhkan oleh para spesalis dan sub spesialis tersebut. Kesenjangan antara kebutuhan pasien dengan paralatan yang tersedia dan kebutuhan yang sesuai dengan spesialis tertentu menjadi kendala terlaksananya layanan yang berkualitas di rumah sakit, terutama rumah sakit pemerintah. Peralatan medis yang 5 – 10 tahun yang lalu merupakan alat canggih dan mahal, kini menjadi peralatan yang standar yang mesti dipunyai oleh rumah sakit. Disamping itu sistim teknologi informasi mutlak dimiliki setiap rumah sakit untuk menunjang layanan, utamanya dari segi kecepatan pemberian pelayanan kepada pasien. Penulis adalah Praktisi, Pemerhati Kesehatan.


B6 1 CM 2 CM

WASPADA

Rp. 12.000 Rp. 24.000

3 CM Rp. 36.000 4 CM Rp. 48.000

BURSA

AUTOMOTIVE Informasi Pembaca

Bursa Automotive

AC : Air Condition BR : Ban Radial CL : Central Lock ND : Nippon Denso DB : Double Blower

PS : Power Stearing PW : Power Window RT : Radio Tape VR : Velg Racing EW : Electric Window

DAIHATSU PAKET MURAH MERIAH

- New Xenia Li VVT-I DP 12 Jt-an angs. 3 Jt-an - Pick Up Granmax DP 7 Jt-an Angs. 2 Jt-an DP bisa min. 10%, data dijemput ke rmh Hub. TEDDY CAPELLA 0812 632 5656 / 77884663

DAIHATSU PROMO, DP 15% B. Tukar Tambah, Data dijemput Hub. HENDRA CAPELLA 0821 6135 0161 DAIHATSU Feroza Thn ‘93 Dijual, Biru Metalik, Mobil orisinil, AC, CL, Alarm, R/T, Ban baru, Remote Hub. 0813.9730.8787

DAIHATSU Zebra MB 1.3 Dijual. Krs. Karisma Thn. 95. BK Mdn asli, T. Pertama. Mbl cantik. Harga 25 Ngo. Hub. 0812 6393 235 - 0852 4600 0061 DAIHATSU Espass 1600cc. Thn. 96 merah. Rolling Door Pajak Full 1 tahun. Tape, Power, Sub Wofer, Mesin sehat, sgt mulus. Hub. 0812 6047 4010

KIA

NEW PICANTO - CITY CAR DP 20 Jt/Angs. 2,3 Jt.

Bonus BB Gemini + BELAJAR MENGEMUDI

Mobil Hub. PINTA BUTAR2: 6852 6021 8698

ISUZU Panther Bravo Cruiser thn. 94. Asli Medan, aC, Tape, VR, BR, PS, PW, Mulus, tinggal pakai. Harga 39Jt damai. Hub. 0812 650 8819

MITSUBISHI 100% BARU

T120PU DP 10 Jt-an Ang. 2,6 Jt-an 1300PU DP 26 Jt-an Ang. 3,6 Jt-an Colt Diesel Hub. 0813.9799.0818 MITSUBISHI Kuda “Super Exceed” Thn 2000 Dijual, Hitam Metalik, AC double, Alarm,CL, DVD + Sound system, Remote, Mobil orisinil/ terawat sekali Hub. 0813.9730.8787

MITSUBISHI Lancer thn. 83. AC, TV, CD, MP3, PW, CL, BK Mdn. W. Abu2. Hrg. 22 Jt Nego. Hub. 0812 6377 9410 - 061.7785 2115

DEALER RESMI SUZUKI MOBIL

Carry PU 1.5 FD Rp. 8 Jt-an ..Angs. 2.489.000,APV Rp. 12Jt-an ...........Angs. 3.705.000,New Karimun Rp. 9 Jt-an..Angs. 3.302.000,Splash GL RP. 13 Jt-an ...Angs. 3.744.000,Swift ST DP 16 Jt-an ...Angs. 4.354.000,SX4 DP 19 Jt-an ........Angs. 5.357.000,Hub. 0812 654 0809 / 77722121

SUZUKI Forsa 89/90 Dijual. BK Medan, merah, Original/terawat (cantik). Komplit. Hub. Jl. Jatayu 98. Komp. TNI, AU, Kr. Sari. 0852 6134 0601 / 0857 6023 0133

5 CM 6 CM

Rp. 65.000 Rp. 78.000

SUZUKI Minibus Carry Futura, 93. Abu2 metalik, Tape, VR, BR, Mbl. Mulus, mesin sehat. BK Medan. Hub. Pak Agus. Jl. Selambo 5 No. 3 Medan Amplas TP.

TOYOTA Starlet 1.3 SEG Dijual. Tahun 1996 (kapsul) warna abuabu tua metalik, tangan pertama. Harga Rp. 67 Juta. Hub. HP. 0811 602076 Tanpa Peranara TOYOTA 2011 100% DP RINGAN MULAI 0% BARU BUNGA PREDY: 0852 6128 1181

7 CM 8 CM

1 Hari Cair Bunga Rendah, Dan Terjamin (Dlm/Luar Kota). Spesialis Leasing BPKB Mobil, Truk, Spd. Mtr. Terima Mobil yang masih kredit, over leasing. Dan Bantu Pelunasan BPKB. Hub. S8F Finance 061-8445716 - 0813 7044 6633

DANA EXPRESS SHM, SK Camat 1 Hari Clear Tanpa usaha 0813 6229 0001 0812 6095 5531 (Henrik)

JUAL CEPAT/BU

Toyota Kijang Commando 90, Abu-abu, VR, BR, Tape, AC, BK Mdn, Cat asli Harga 43Jt/Nego. Daihatsu Charade G Salon Thn. 94, masih asli, BK Mdn, AC, Tape, VR, BR, P. Steering, P. Window. Warna biru muda, jarang pakai, Harga 34Jt/Nego. Panther Challenger 93, VR, BR, AC, Tivi, PS, P. Window, lengkap, Plat Tapsel, Biru gelap. Harga 39Jt/Nego. Hub. 0811 645 684. Ridwan Hsb.

TOYOTA Kijang Kapsul LGX 1,8cc. 2003. Bensin, BK Medan. W. Hitam, Hrg. 148Jt Nego. Hub. 0812 6377 9410 - 0852 7606 0011 TOYOTA Starlet 96 Jumbo W. Merah maron, BK Mdn, Komplit, Hrg. 68Jt. Nego. Hub. 0812 6377 9410 061.7785 2115

TOYOTA Kijang Commando Thn. 90 Asli Medan, AC, Tape, VR, BR, Tinggal pakai. Harga 41 Jt damai. Hub. 0812 650 8819

BURSA

ALAT BERAT

ALAT BERAT

Beko Hitachi Ex 200-1 Landy. Super Prima. Siap pakai. Jl. Sunggal disamping Masjid Al Jihad. 0813 1661 0999 / 0821 6645 0806

BURSA

SEPEDA MOTOR YAMAHA Vixion, Thn. 2007. Hitam, Ban Tubless Rp. 14,8 Jt Nego. Hub. 0813 6131 4188

BURSA BUTUH DANA BUTUH DANA Jaminan Apa Saja. Sertifikat Tanah Mobil & Sp. Motor. Segala tahun. Hub. 061.8222 774 HP. 0853.6199.1500-0816 314 1807

Rp. 91.000 Rp. 104.000

BUTUH DANA CEPAT

BURSA

ELEKTRONIK JUAL & BELI AC, TV, LCD, PS, Ampli, SPK, Kulkas, Projector, Handycam Camera, Laptop & Keyboard, dll. UD SENANG HATI 4517509 - 69677449, Jl. Sekip 67 A

JUAL - BELI

TV LED, LCD, Kulkas, M. Cuci, Handycam DSLR, Laptop, LCD, Projector, PS 1, 2, & 3 H. Theater, Sound System, dll. Hub. CV. MARKET. Tel. 7632 4682 - 0812 6539 3000, S. Budi Tj. Sari No. 424 B, Psr IV dkt BNI

9 CM Rp. 126.000 10 CM Rp. 140.000

BURSA

PERCETAKAN

Promo Laptop Murah Terdahsyat 2011 TOSHIBA HP DELL ACER

Merk terkenal, built in Jepang, tidak diragukan lagi kwalitasnya, desain elegant, mantap & bergengsi. Koneksi Internet Cepat, wireless available, komplit Program & siap pakai. sdh terjual ribuan unit. Buruan Miliki Segera di Cabang terdekat kami. Harga terjangkau & Dijamin anda Puas. Cari info, Konsultasi dengan ahlinya & coba-coba, oke2 saja. dll. Terjamin & Digaransi, No. Charge !! Hub. Medan Mall Lt Dsr. 0812 6455 7274, 0812 6498 7006

Harga Rp.

2

Jt-an

Millenium Plaza : 0852 1090 7422, 0812 888 21068 Aksara Plaza : 0813 9742 2213, 0812 6582 2006 Binjai Super Mal l : 0813 6125 4113, 0813 9798 3820 Siantar Plaza : 0813 9650 7030, 0812 6022 4423 Pajus Sumber : 0812 6341 8789 Ringroad Asrama 9B: 8442015

Gratis Modem Internet Kecepatan 7,2 Mbps, Setiap Pembelian. Buruan.......!!! - Toshiba - 2,2Jt Diperpanjang 5 Hari lagi - HP - 2,3Jt Sebelum Kehabisan - Lenovo - 2,95Jt Jl. Ringroad 9A - Dell - 2,3Jt Hub & Miliki Segera: 0852 6076 2430

BURSA

ALAT MUSIK

DIJUAL

Alat Musik Keyboard SX KN2400, KN2600 & KN7000 Kondisi 95% (2nd). Mulus seperti baru. Hub. 0821 6621 1302 / 0878 6932 2762

PER GI MENINGGALKAN PERGI RUMAH

Pria Umur +/- 58 th. Nama: POLTAK HAHOLONGAN PURBA Ciri-ciri: Rambut Pendek, Ikal, Kulit Sawo Matang, badan gemuk. Meninggalkan Rumah +/- 20 tahun Bagi yang menemukan atau bagi yang melihat Hub. 0857 6203 3130 (Rinaldi Purba)

BURSA

KONSTRUKSI

WC 0812 60444275 WC 0813 6147 0812 WC 0813 7035 7291 WC JL. SETIA BUDI

Hub. TUMPAT / SEDOT WC/GRANSI

CUCI GUDANG LAPTOP

Khusus Medan Deli, Marelan, Labuhan, Belawan Hub. 0812 6390 660 Iklan Anda Dijemput

PERGI DARI RUMAH

BURSA

PELUANG BISNIS

PELUANG USAHA

061-4576602. Terimakasih

AC, KULKAS, M. CUCI, TV, CCTV, PARABOLA, INSTALASI LISTRIK, B. PASANG, BERGARANSI Hub. 061-77913537 0813 7553 3375

BURSA

PHOTO COPY

silahkan hubungi kami di

ELEKTRONIK

KOMPUTER

HARGA BELUM TERMASUK PPN 10%

BURSA

Segala akibat yang terjadi diluar tanggujawab PT. Harian WASPADA. Apabila anda mencurigai sesuatu,

MEDAN BARU SERVICE

MASTER TV RIDWAN - 77621674 0812 6303 4400 Siap ditempat. Bergaransi

FAX.4561347

HA TI-HA TI terhadap penipuan yang mengatas HATI-HA TI-HATI namakan PT. Harian WASPADA, kami dari PT. Harian WASPADA tidak pernah mengirim sms TI-HA TI untuk membeli produk anda, dan HA HATI-HA TI-HATI apabila anda ingin melakukan transaksi jual beli melalui transfer.

AHLI FUJI, DIGITEC,TCL, AIWA, SANYO TOSHIBA, SONY, POLYTRON, LG, LCD,DLL.

TV

IKLAN KHUSUS 6x1,5 kolom Rp. 120.000

Pelanggan Yang Terhormat

SERVICE

AC

11 CM Rp. 165.000 12 CM Rp. 180.000

Selasa, 28 Juni 2011

Setia Budi

TUMPAT/SEDOT

Jl. Setia Budi

TUMPAT/ SEDOT

77442112

Jl. Gatot Subroto Medan Ada Garansi

WC 0812 642 71725 MOBIL SEDOT

PAK ADI

Jl. BRAYAN MEDAN

HP.

BURSA

Pemasangan Depot Air Minum Isi Ulang paling murah Sesuai kemampuan anda 1. Depot RO 40 s/d 400 Galon/ hari 2. Depot Air Mineral/ Pegunungan 3. Jual alat-alat depot isi ulang Terima siap untuk jualan

UD. RIZKY ABADI JAYA

Jl. Veteran Psr. 10 (dpn Mesjid Al-Hidayah) Helvetia Telp. (061) 685.7558 HP. 0813.7580.8866

HILANG/TERCECER TERCECER

Tercecer Akte Notaris, A/n. Alm. Elim Srg Sihotang No. 43 Tanggal 21 Oktober Albinus yang dikeluarkan oleh Notaris Albinus Panggabean, SH. Yang terletak di Jl. Pembangunan Gg. Sosial, tercecer sekitar Jl. Perkutut - Jl. Pembangunan Kel. Helvetia Timur, Kec. Medan Helvetia Hub. 0813.7556.2522 TERCECER Asli Surat Akte Camat No. 384/MT/1973. Tgl. 28-10-1973. a/n. Dra. Aimar Rachman. Luas +/- 712,80m2. Terletak di Jl. Damar II Lingk. XIV. P. Brayan Darat II Medan

HILANG DOMPET

Berisi: SIM A, SIM C, STNK a/n. STEVEN. Alamat Jl. Pukat III No. 60 Mandala. Bagi yang menemukan harap dikembalikan dan akan diberi hadiah sepantasnya. Hub. 0857 6340 8567 (Steven). Tercecer di daerah Lumban Surbakti

BURSA

HILANG/TERCECER HILANG

BPKB Sepeda Motor Honda MCB BL-2162 T. MR: RR 096-4733. NM: CB 100E 1552855. No. BPKB: 7347654-A. A/n. Direktorat Pembangunan Dista Aceh Selatan. Alamat Tapak Tuan

TERCECER 1 (Buah) BPKB Asli BK 9051 TD. No. BPKB H. 1 1 1 0 8 4 6 6 - N o . R a n g k a : M R O AW 12G6A0019528. a/n. HOTMAN PARULIAN SIPAYUNG. Alamat Saribudolok Kec. Silimakuta. Kab. Simalungun.

TERCECER

BPKB Motor BK 4929 XA, an. Drs. Suyanto. Bagi yang menemukannya Hub. 0813 9662 1930. Tidak akan dituntut dan diberi hadiah sepantasnya.

Training Center Ingin Trading Futures : Forex, (42 Currency), Index, Commoditi, Metals, Cfd Stock US, CFD Indices, CFD Financial Gold, Silver. Currency terbaru USDSGD (Singapura Dolar) !! Spread Mulai dari 2 Point, Tanpa Biaya (Swap Dan Cash Komisi)

Telah Hadir Di MasterForex Meta Trader

Kami memiliki Solusi Trading yang Nyaman dan menghasilkan minimal 100 pips / hari. Metode CHAOS TRADING Biaya Training Rp 18.500.000,-

MasterForex Sumatera Training Center Mandiri Building Lt.6, Jl. Imam Bonjol No. 16D Medan 20112 Sumatera Utara – Indonesia Tel. +62-61-3000 33 00 Fax. +62-61-3000 33 84 www.medan.masterforex.org e-mail : medan@masterforex.org

MINI & EFEKTIF IKLANKAN PRODUK ANDA

Ingin Promosikan Produk Anda Harian

WASPADA Media yang Tepat untuk Iklan Anda


Ekonomi & Bisnis

WASPADA Selasa, 28 Juni 2011

B7

Pemerintah : Tak Ada Kenaikan Harga Elpiji 12 Kg Dan 50 Kg JAKARTA (Waspada): Pemerintah belum memiliki niatan untuk menaikkan harga elpiji 12 kilogram (kg) dan elpiji 50 kg, untuk mengantisipasinya pemerintah akan memberikan tambahan dana untuk menghindari disfaritas harga dengan elpiji tiga kg.

Hal tersebut diungkapkan Menteri BUMN, Mustafa Abubakar saat ditanyai wartawan di Kantor Kementerian Koordinator Perekonomian, Jakarta, Senin (27/6). "Penambahan angggarannya belum tahu berapa masih dalam proses, saat ini sudah sampai proses akhir dan akan diajukan dalam APBNP akan dimulai pada 4 Juli nanti," ujarnya. Mustafa menjelaskan, untuk saat ini belum ada keputusan menaikkan, Pertamina baru meminta tambahan ang-

garan dana agar kerugiannya tidak mencapai Rp3,7 triliun. "Makanya minta tambahan dana, untuk mengurangi subsidi tersebut," ujarnya. Selain itu, sektor pertamina juga perlu perhatian besar, dari segi tambahan kuota BBM akan mencapai 45 juta kiloliter (kl) yang seharusnya 38 juta kl. Untuk saat ini Pemerintah memastikan belum ada opsi untuk kenaikan tarif dasar listrik (TDL), elpiji dan BBM. "Akan dibicarakan ulang

agar defisit anggaran negara tidak jauh dari dua persen kalau lebih, dua koma sekian lah. Tidak ada kemungkinan menaikan TDL, BBM dan gas," ujarnya. Walaupun sebelumnya Pertamina sudah siap menaikkan elpiji 50 kg, menurutnya itu merupakan aksi korporasi tidak perlu minta ijin, hanya konsultasi. "Di dalam (Kementrian BUMN) juga belum mantap, jadi belum ada kejutan tentang hal itu," tutupnya. (okz)

Jelang Puasa, Harga Barang Bakal Naik 10 Persen JAKARTA (Waspada): Mesti bulan puasa masih sekitar satu bulan lagi, pemerintah mulai bersiap untuk menjaga ketersediaan bahan makanan serta memastikan distribusi berjalan untuk meredam gejolak peningkatan harga. Alasannya, pemerintah memperkirakan harga barang kebutuhan pokok menjelang puasa dan lebaran bakal naik 5 hingga 10 persen. Namun, tidak menutup kemungkinan, kenaikan harga bisa melebihi perkiraan tersebut akibat adanya gangguan distribusi dan spekulasi. "Dari sisi stok kami tidak khawatir. Ini menjelang rapat koordinasi yang harus diintensifkan untuk memastikan pada saat mulai puasa, barang sudah

cukup," kata Menteri Perdagangan, Mari Elka Pangestu, di Kementerian Koordinator Perekonomian, Jakarta, Senin, (27/6). Mari Elka mengatakan, harga beras pada Juli-Agustus pada tahun ini dipastikan naik. Kondisi itu terjadi karena faktor musiman yang tiap tahun kerap terjadi. Selain beras, Kementerian Perdagangan juga memberi perhatian khusus pada daging. Sebab, stok daging yang aman sebelum lebaran biasanya akan berkurang setelah perayaan hari besar bagi umat Islam tersebut. "Jika barang tidak tahan lama biasanya H minus 3-5 hari itu pasti naik. Cabai, daging ayam, dan daging itu pasti naik," kata Mari. "Itu normal, biasanya

habis lebaran barang-barang akan turun lagi. Yang harus dipastikan pola perkiraan stok setelah lebaran bukan hanya sebelum lebaran." Beruntung selama puasa maupun lebaran, pemerintah memperkirakan harga gula relatif stabil. Kalaupun terjadi penurunan harga, tidak akan tajam. Hal sama terjadi pada harga minyak goreng kemungkinan sedikit lebih murah. Selain persoalan stok dan harga barang, pemerintah akan mengintensifkan pengawasan barang kadaluarsa. Bekerja sama dengan Badan Pengawas Obat dan Makanan (BPOM), Badan Karantina, Ditjen Bea Cukai, dan perusahaan retail modern, pemerintah akan menyiapkan tim terpadu pengaRUMAH 228 JT/ NEGO

Luas 10x23m, Permanen, Sertifikat, 3 K. Tidur, K. Mandi, R. Tamu, R. Makan, Dapur, L. Makan, PLN, PAM, Garasi Jl. Srikandi Gg. Terusan No. 10 Kec. Medan Denai H. Lukman 0813.70500.890 - (061) 735.2345

RUMAH DIJUAL

L. Tanah 14x25m, Bangunan 8x12m, SK Camat, 3 Km Tidur, 2 Km Mandi, Dibangun Thn 2008, Lokasi Jl. Utomo No. 92 Desa Bakaran Batu Kec. Batang Kuis, Lewat Tembung Hub. 0813.6171.5656

RUMAH DIJUAL

Jl. Krakatau/ Jl. Pendidikan Gg. Mesjid No. 2 depan SD negeri, Ukuran 10x18m² Hub HP. 0813.7641.7390 0813.9605.9065

RUMAH DIJUAL DEKAT UNIMED

KOMP. SURYAHAJI No. 1 LAUT DENDANG, LT. 169M², 2 TINGKAT, 3 KM, 5 KT, SHM, ±2 KM DARI UNIMED DAN IAIN, 265 JT/NEGO (KHUSUS DOSEN UNIMED & IAIN DISKON 20%) HUB. 0813.9680.3777

wasan barang beredar secara berkala. "Sejak tiga tahun lalu misalnya, jika konsumen menemukan barang kadaluarsa, itu bisa dikembalikan dan uang diganti dua kali lipat," kata Mari. Pemerintah juga mengimbau agar konsumen lebih cerdas dalam memilih barang-barang dikonsumsi dan meningkatkan kesadarannya. Karena hal itulah paling ampuh untuk menghindari meluasnya peredaran produk kadaluarsa. Mengantisipasi kemungkinan kenaikan harga akibat ulah spekulan, Mendag menyatakan satu-satunya jalan untuk mengurangi spekulasi adalah menjamin stok cukup dan menggelar operasi pasar. (vvn)

Waspada/Hamdani

SEMAKIN NAIK : Seorang pedagang tampak menyusun telur ayam di salah satu pemukiman grosir telur, Jalan Medan Area Medan, Senin (27/6).Berkurangnya stok telur merupakan faktor utama pada peningkatan harga telur di pasaran. Harga telur bervariasi, mulai dari Rp 870 hingga Rp. 950 perbutirnya, sebelumnya sempat Rp 830 hingga Rp 900 perbutir.

Persaingan Usaha, Malaysia Belajar Dari RI JAKARTA (Wasapda): Indonesia dan Malaysia saling bertukar pikiran mengenai pengembangan industri waralaba atau franchise. Setelah beberapa produk franchise asal Malaysia dipasarkan di Tanah Air, kini giliran Malaysia yang tertarik mengembangkan franchise asal Indonesia di negeri jiran.

MARI SUKSESKAN REUNI AKBAR SMAN 2 BINJAI

UMR OH MUL TAZAM UMROH MULT Sahabat Anda menuju Baitullah 1.UMROH REGULER 9 HR/13 HR JULI

2. UMROH RAMADHAN 1 BLN, AWAL, PERTENGAHAN, AKHIR 3.UMROH PLUS MESIR JULI 4.UMROH PLUS TURKEY JULI 5.UMROH PLUS AQSHO JULI 6.UMROH PLUS RAMADHAN PLUS MESIR

Tgl. 23 September 2011

BURSA

BURSA

TRAVEL/WISATA

PERABOT TEMPAHAN MURAH - Lemari pakaian 3 pintu Sungkai asli Rp. 1.500.000 tempahan - Kitchen set atas bawah Sungkai asli Rp. 1,5 Jt/mtr Hub Telp. (061) 661.8116 - (061) 661.6802- 7653.2188

Jl. Sumbawa Raya No. 6 Pasar III Barat Marelan, SHM, LT. 14x25m: 350m² 1½ tingkat, KM 3 buah, KT 6 buah, Garasi Buka Harga Rp. 350 Jt/nego Hub. 0852.6121.4878 - 0888.7589.053

BURSA

“PRIVATE DINO TODO”

Membuka Paket Private Liburan Perorangan & Group (Max 5 org) Utk SMP (1, 2, 3) & SMA (1) Bid. Std: MM, Fis, Kimia, Hafalan Jam belajar (Kesepakatan) Staf Pengajar Alumni & Mhs USU Yang sdh berpengalaman Hub Kami: (061) 7630.1403 - 7630.1407 “Kami ada utk masa depan Anda”

SEKOLAH TINGGI ILMU KESEHATAN

SITI HAJAR MEDAN

PROGRAM STUDI: 1. D III FISIOTERAFI 2. S1 FISIOTERAFI (REG & EXT) 3. DIV ELEKTROMEDI (REG & EXT) Informasi lebih lanjut:

HUBUNGI KAMPUS UTAMA SITI HAJAR

Jl. Jamin Ginting No. 2 Medan Telp. 822.3030 - 3008.4600 website: akfissitihajar.org email: akfissitihajarmedan@yahoo.co.id Mau cepat dapat kerja MASUK AJA ke D-III

BURSA

LOWONGAN

DIBUTUHKAN SEGERA

Pendidik untuk mengajar di TK - SD - SMP di Kota Medan Hub. 0821.6883.3590 DIBUTUHKAN

Beberapa Penjahit wanita muslim dan Tk Bordir. Bagi yang berminat hubungi: 0813.6176.2111 0852.7522.6663 (Jam kerja) LOWONGAN

Dibutuhkan segera beberapa orang P/W untuk kerja di “POSISI BAGIAN KANTOR”, 100% Bukan Sales (Terbuka bagi Mahasiswa/ yang baru tamat SLTA sederajat S1, Penghasilan: Rp. 1.500.000 - Rp. 2.500.000 + Harian Alamat: Jl. Brigjen. Hamid No. 8B arah Delitua (Ruko pertama lewat jembatan kanal) Pukul 09.30-16.00 Wib HUB: IBU MARNI HP. 0812.6550.4283 IBU RAHAYU HP. 0852.6136.9034 NB: Bagi yang baru tamat, dapat melampirkan SKHU

DIBUTUHKAN SEGERA

Beberapa TSenaga Doorsmeer, syarat: 1. Jujur disiplin bertanggung jawab 2. Bisa kerja full time Berminat datang langsung ke: Jl. Thamrin No. 55 Medan (Bengkel Dunia Mobil depan Jl. Flores)

DIBUTUHKAN

Tkg Pangkas Muslim Hub. Pangkas Laksana Full AC, Jl. Laksana 43 Medan Ada jaminan 0853.6092.2288

TUKANG PANGKAS

Dibutuhkan 10 Orang, Disiplin, Rapi, Pengalaman (diutamakan dari T. Tinggi, Kisaran, R. Prapat, Siantar, Stabat) Hub. 0852.7562.0202

DIBUTUHKAN

Mendesak !!! Sekolah Baru membutuhkan guru TK min lls SMA, kreatif & suka dunia anak Hub: Jl. KH. Wahid Hasyim 92 Medan Tp. 7623.5314 - 9158.3487 / 453.3875 - 456.9269

nomian, Jakarta, Senin (27/6). Dalam pertemuan tersebut, Menteri Perdagangan Malaysia juga tertarik mempelajari beberapa program dari Indonesia antara lain mengenai perusahaan dibina pemerintah melalui Permodalan Nasional Madani. Selain itu, Mereka juga pelajari mengenai Komisi Pengawas Persaingan Usaha (KPPU). (vvn)

MINI & EFEKTIF

6 THN AHLI TOTOK SYARAF TANPA ALAT

SYARAF TERJEPIT RINGAN/ KRONIS

PAK HERY 0852.6114.7129 PENGALAMAN D/L NEGERI

Harian

IKLANKAN PRODUK ANDA

WASPADA

TELAH DIBUKA PENGOBATAN ALTERNATIF

OLEH BAPAK TABIB H. IBRAHIM S.

(CABANG DARI DESA GURU SINGA/ BRASTAGI TANAH KARO) MENGOBATI SEMUA JENIS KANKER:

1. 2. 3. 4. 5. 6.

7. SAKIT LEVER 8. SAKIT GINJAL 9. SAKIT BAT UDALAM EMPEDU 10. SAKIT GULA/ DIABETES 11. SAKIT SESAK NAPAS 12. SAKIT AMBEYEN, DLL

KANKER PAYUDARA KANKER RAHIM KANKER LEHER KANKER OTAK KANKER PROSTAT KANKER KISTA

Ingin Promosikan Produk Anda Harian

WASPADA

BAGI PASIEN KAMI YANG MASIH BEROBAT/ YANG BELUM SEMBUH PENYAKITNYA BAIK DARI BANDA ACEH, BIREUN, SIGLI, TAKENGON, LOKSEUMAWE, KUALA SIMPANG, LANGSA, BESITANG DAN LAINNYA SUDAH BISA DATANG DAN HUBUNGI KAMI DI JALAN JAMIN GINTING NO. 226 BINJAI

HP. 0813.9652.3410

Media yang Tepat untuk Iklan Anda

SPRING BED DIJUAL MURAH Spring Bed 6 kaki 2 lapis Rp. 1.150.000 Spring Bed 5 kaki 2 lapis Rp. 1.075.000 Spring Bed 4 kaki 2 lapis Rp. 1.000.000 Spring Bed 3 kaki 2 lapis Rp. 900.000 Spring Bed 3 kaki Dorong Rp. 1.000.000 Garansi Per 10 tahun

DIBUTUHKAN

Hub Telp. (061) 661.8116 - (061) 661.6802 - 7653.2188

Gaji/ Janda utk dipekerjakan di Medan, Jaga anak umur 2 tahun, Gaji Rp. 700.000/ bulan bersih Hub. Pak Jouli Telp. (061) 7636.3421 0812.6553.5559 Medan

BURSA

KESEHATAN

ANDA BUTUH

BURSA

ANTU DEN GAR ? ALAT B BANTU DENG

PROPERTY

HUB.

MEL TRA HEARING AID MELTRA

Pasang Iklan Mini

Informasi Pembaca Bursa Property

GR : Garasi LB : Luas Bangunan KM : Kamar Mandi LT : Luas Tanah KP : Kamar Pembantu RM : Ruang Makan KT : Kamar Tidur RT : Ruang Tamu SHM: Sertifikat Hak Milik

JL. KEDIRI NO. 36 MEDAN TELP. 451.6161

“WASPADA”

RUMAH DIJUAL

LT. 358 M2 LB. 258 M2. 4 KT, RT, RK, RM, Grasi. Perumahan Famili Asri N o . F M 1 G e d . J o h o r . Te l p . 7881978 HP. 0813 6151 7239

KLINIK TRADISIONAL ALAT VITAL DARI PELABUHAN RATU CISOLOK BANTEN DITANGANI LANGSUNG

A. AMARUDIN

Telp: 061 - 4576602

RUMAH DIJUAL CEPAT/ B.U

TERAPI KEJANTANAN DENGAN MENGGUNAKAN TOTOK SYARAF DAN DIBERIKAN RAMUAN/ JAMU HASILNYA PERMANEN. TANPA EFEK SAMPING BEBAS USIA, BEBAS PANTANGAN DAN AGAMA REAKSI LANGSUNG DI TEMPAT MEMILIH UKURAN YG SUDAH DI SIAPKAN DARI NO (1) S/D (3)

BURSA

Jl. Menteng 7 Komp. Citra Menteng A08, Hrg 600 Jt/nego Khusus MUslim, Type 160, 2 Lantai, 4 KT, 3 KM, List. 1300 Watt, Satpam Hub. 0852.7773.7004 (Maaf TP)

MENGOBATI PRIA

MATERIAL ATAP & DINDING EURODEK ALUMINIUM ZINC - AZ - 150

RUMAH DIJUAL LT. 28x20m, Jl. Sei Muara No. 36 Hub. 0857.1483.2658

PAGAR EURO

DIJUAL MURAH (B.U)

1. RUMAH KOMPLEKS PT. IRA INTI GRAHA Blok D No. 3 Medan Krio - Medan Uk. 38/105m² Harga 45 Jt (nego) 2. RUMAH - KOMPLEKS PT. IRA Blok A No. 67 Hamparan Perak - Medan, Harga 140 Jt/nego Uk. 54/ 233m² 3. R U M A H K O M P L E K S B U N G A PARIAMA PERMAI Blok A No. 7 Medan Tuntungan - Medan Uk. 46/150m² Harga 120 Jt/nego Hub. 0852.7720.1635 (Sari)

nesia antara lain produk spa dan kecantikan, sebagaimana Malaysia yang sukses mengembangkan franchise di bidang makanan, seperti Roti Boy. "Dari segi jumlah, produk spa dan beauty jauh lebih banyak dibandingkan Malaysia," kata Mari di kantor Kementerian Koodinator Bidang Pereko-

DI JALAN JAMIN GINTING NO. 226 BINJAI

Alumni ‘86 Hubungi: 1. Frans Suranta - 0812 6373 6108 2. T. Matsyah - 0813 7643 6499 3. M. Darwis Sitepu - 0813 6220 0075

Hub. MULTAZAM Jl. Titipapan/Pertahanan 10Sei Sikambing Medan Telp. 061-4576116 - 061.4512319 HP. 0813 6137 2321 - 0812 6495 8456 0813 7017 1508 - 0813 7696 4857

RUMAH DIJUAL CEPAT (B.U)

PENDIDIKAN

Menteri Perdagangan, Mari Elka Pangestu, mengungkapkan, beberapa waktu lalu Menteri Perdagangan Dalam Negeri dan Perlindungan Konsumen Malaysia datang ke Indonesia untuk menghadir i acara tahunan franchise fair. Beberapa produk franchise yang siap dikembangkan Indo-

+ BESAR : 3, 4, 4, 4, 4, 5, 5, 5, 6 CM + PANJANG : 13-14-15-16-17-18-19-20 CM - IMPOTENSI - LEMAH SYAHWAT - KURANG KERAS/ LOYO - MANI ENCER/ EJAKULASI DINI - DIABETES/ KENCING MANIS - TDK PNYA KETURUNAN - MENANGANI PROBLEM ASMARA, DSB ALAMAT: JL. SM. RAJA DEPAN GARUDA PLAZA GG. KELUARGA SAMPING KLINIK BUNDA NO. 31A HP. 0812.6057.6444

R

BALAI PENGOBATAN TRADISIONAL

GALVANIS

ALAT VITAL

DITANGANI OLEH AHLINYA: M. SUHERDI

DARI PELABUHAN RATU SUKABUMI JABAR

EUROMESH

TANAH

BAJA U-50

TANAH DIJUAL

Uk. 12x30m, SHM Jl. Sudirman (blk Ktr Imigrasi) Hub. 0831.9605.9240 Tanjung Balai

DIJUAL TANAH

KOLOM PRAKTIS EURO R BAJA U-50 SIAP PAKAI LEBIH PRAKTIS & HEMAT DARI BESI BETON

TANAH

Dapatkan Tanah dgn Harga spesial Gratis biaya surat SHM, Rp. 17 Jt dgn Uk. 6x16m², Bisa dicicil 3x (bayar I Rp. 5 Jt), Padat penduduk, Siap bangun, Disamping Komp. Johar, Lok Jl. Pala Sei Mencirim Diski (3 Km dr Jl. Medan Binjai) Hub. 0811.653.755 - 0813.6112.2791 (061) 7707.0611

Terapi keperkasaan seksualitas Pria hasil permanen tanpa efek samping, alami, bebas pantangan, untuk semua usia Hasil langsung reaksi ditempat, cukup satu kali berobat

R

PRODUKSI:

PT. REZEKI PRIMA JAYA ABADI

Jl. Sutomo No. 436 Medan 20231 (samping Bank Maspion) Telp. (061) 452.2588 - 415.7504 - 455.7204 - 455.71494 Fax. (061) 415.7504 SUMUT - INDONESIA

TERAPI VITALITAS PRIA

Dijual Tanah SHM, Luas 21x20m² Lok: Jl. Darussalam Kpg. Jawa Baru dekat dg. Mesjid Raya Klinik dan Psr. Tradisional Hub. Langsung: 0813.7036.4425

-

ALAMAT KELINIK TETAP: Jl. SM. Raja Masuk ke Jl. Utama No. 18 Medan Dari Toko Roti Majestik ±100meter Izin Kejaksaan: B/DSP.5/12/2008 Izin Dinkes: No. 448/0649/I/2008 HP. 0812.6388.7999 Buka setiap hari

SANGGAR SUPRANATURAL ILMU HIKMAH & KEBATINAN OLEH: MASTER GENDAM

USTADZ AGENG PANGESTU

1. 2.

Jl. Setia/ Gaperta Ujung No. 2 T. Gusta

3. 4. 5. 6. 7.

CALL CENTER: (021) 9862000 0878 8200 0020

Panjang: 13, 14, 15, 16, 17, 18, 19, 20 cm Besar: 3,5. 4,5. 5. 5,5. 6 diameter Memperkeras, Tahan lama Ejakulasi dini, Mani encer Impotensi, Lemah syahwat Diabetes, kencing manis/ batu

Juga melayani problem asmara, mempercepat jodoh, pengasihan, penglaris, buka aura, pasang susuk, dll

Jadikan Pria Jadi Idaman Para Wanita

Di Jl. Klambir 5 Gg. Makmur, Luas 476m² Kampung Lalang Hub. 0813.7684.2494

LHOK SEUMAWE

MENANGANI KELUHAN: MENAMBAH UKURAN

8. 9.

FORUM KOMUNIKASI PARANORMAL DAN PENYEMBUHAN ALTERNATIF INDONESIA IZIN DEPKES. 448/15830 - IZIN KEJATI No. B270/DSP5.08 Gendam Asmaradhana (Solusi Kilat) Problem asmra dan rumah tangga Gendam pedotshih (pemutus hubungan asmara dan perselingkuhan PIL dan WIL) Puter Giling (menarik/ memanggil orang yang minggat, kabur) Insya Allah, Suami, Istri atau Pacar dalam waktu singkat akan kembali dengan cepat Asmara Gay/ Lesby/ Hypersex Susuk aura, pemikat, pemanis, pengasihan, kecantikan dan ketampanan Penglarisan dagang, kedai, rumah makan/ restoran GARANSI jual beli tanah dgn cepat TUNAS Penyembuhan segala macam penyakit medis - non medis (kutukan, keturunan, bawaan dan guna-guna) Keluhan khusus pria (ejakulasi dini dan impotensi) Pengobatan/ penyembuhan alternatif bisa jarak jauh

BUKA TIAP HARI DARI PUKUL 08.00 Wib s/d 23.00 WIB Kantor: Jl. Sisingamangaraja masuk jalan Puri (200M dari RM. Family) No. 57F Medan Telp. (061) 7678.1087/ 0813.6246.7777 - 0813.7040.5888

KLINIK TRAPI ALAT VITAL MAK HJ. ICOT Ditangani langsung

H. UST. YUSUF/ H. ABIDIN

Setelah sukses di propinsi di Papua, kini hadir di kota Medan, pengobatan nyata luar biasa, bila anda ingin perkasa, ingat jangan salah informasi disini yang pasi ±30 menit kami akan buktikan alat vital menjadi besar dan perkasa. Dengan metode pengurutan disekitar alat vital melalui totok urat-urat kejantanan. Kami tidak mengumbar janji belaka. Tdk ada efek samping, bebas utk semua agama. Bukan janji tapi bukti ditempat Penanganan khusus pria: - Memperbesar, panjang, keras, kuat dan tahan lama - Kencing manis, diabetes, L. syahwat - Ejakulasi dini/ impotensi Khusus Wanita: - Memperbesar/ kencang payudara - Ingin punya keturunan/ gurah vagina - Ingin kembali perawan/ keputihan Konsultasi umum - Ajian semar mesem/ buka aura - Penglaris/ penghasihan/ cari jodoh - Pasang susuk, karir/ jabatan DIJAMIN 100% Alamat Jl. Halat / Masuk Jl. Senam No. 19C. Belakang Makam Pahlawan HP. 0821.6655.3222 - 0821.6655.1222

KLINIK

PUTRA PASUNDAN RAJANYA PENGOBATAN ALAT VITAL ANDA GAGAL DITEMPAT LAIN...???

N

Kami memberi bukti bukan janji, alat vital besar dan panjangditempat, no suntik, no silikon dan bukan bahan kimia, murni tradisional, ramuan alami dan Do’a, dijamin paten dan permanen tanpa ada efek samping bebas pantangan. Untuk semua usia, ras dan agama. Untuk Pria: Besar dan panjang disesuaikan dengan ukuran yang di inginkan, dijamin joss, menjadikan alat vital keras, kuat, tahan lama, menyembuhkan impotensi, ejakulasi dini, lemah syahwat, lemah karena diabetes dan mengatasi ereksi, loyo dan kurang gairah, kembali perkasa menangani bekas suntik/ silikon, mani encer, plek cur, mati total, spilis, mandul, ingin punya keturunan, dan menangani yang gagal ditempat lain. Untuk Wanita: (Bisa berdarah lagi) menghilangkan keputihan becek, bau tidak sedap, ingin menceng-kram, wangi. Buktikan disini (Bergaransi) HP. 0812.8481.8889 Alamat praktek: Jl. SM. RAJA SAMPING UISU MASUK JL. SEMPURNA 300M NO. 49 MEDAN

KLINIK TERAPY ALAT VITAL MAK EROT YANG TERUJI DAN TERBUKTI

Dengan H. TEJA SAEFUL

Cucu Asli Mak Erot Bersama

A. Ust OTONG

BILA anda ingin perkasa ingat jangan sampai salah masuk carilah yang benarbenar pewaris ilmu Mak Erot Sejati, karena keahlian H. Teja Saeful sudah tidak diragukan lagi dalam menangani keluhan seputar alat vital bahkan pengobatan H. Teja Saeful, sudah terkenal Indonesia dan kota-kota besar di Indonesia, sudah ribuan pasien tertolong dipengobatan Mak Erot ini yang aman tanpa efek samping, bahkan dimanca negara sekalipun pengobatan Mak ERot sudah tidak diragukan lagi keberhasilannya. INGAT untuk Kaum Pria janga nsampai Anda terhina Kaum wanita karena kondisi alat vital yang kurang sempurna Izin Dinkes No. 448 Hak Paten No. 00.2004.09965.10041 KONSULTASI UMUM: KHUSUS PRIA: - Buka Aura - Ejakulasi dini - Cari Jodoh - Impotensi - Sesama jenis - Memperbesar “Alvit” - Pelaris - Memperpanjang “Alvit” - Memikat lawan jenis - Keras dan tahan lama dll - Besar PYDR KHUSUS WANITA: - Ingin punya keturunan - Memperkencang & memperbesar payudara - Mengobati keputihan dll

DIJAMIN 100% Hanya Tempat Kami Klinik Mak Erot Jl. Laksana No. 55J masuk dari Jl. Amaliun Yuki Simpang Raya Medan (Praktek Tetap) HP. 0812.4038.333


Agenda B8 James Bond Menikah

Rachel Weisz dan Daniel Craig/popcrunch.com Berita mengejutkan datang dari Daniel Craig dan Rachel Weisz, publisis pemeran James Bond itu mengonfirmasi pasangan itu sudah menikah. Seperti diberitakan Daily Mail, Robin Baun dari Slate PR, yang mewakili Craig mengatakan Craig danWeisz sudah menikah,

tetapi tidak menawarkan detail lebih lanjut. Laporan mengatakan aktor berusia 43 tahun itu menikahi Weisz dalam upacara rahasia di NewYork State Rabu (22/6) yang hanya dihadiri empat orang. Menurut kabar kedua tamu itu adalah putri Craig berusia 18

tahun dan putra Weisz, Henry, berusia 4 tahun, ditambah dua teman keluarga yang bertindak sebagai saksi. “DanieldanRachelmengisyaratkan mengadakan upacara pernikahan kecil dan diam-diam. Mereka sedang mabuk cinta dan tidak sabar untuk menjadi suami

Aura Kasih Di Barcelona

Aura Kasih saat tampil di Barcelona Aura Kasih menghentak panggung Barcelona Lounge di Jalan Pancing Medan sekaligus

turut memeriahkan dua tahun keberadaan tempat hiburan ini. Mantan finalis Miss Indo-

nesia2007 ini menggulirkansingle Mari Bercinta yang terus menyuguhkan sejumlah tembang populer lainnya seperti Di Dadaku AdaKamusambil merangkulpria berkumis di panggung. Aura Kasih tampil sangat mengasyikkan serta mampu melakukan interaksi dengan penggemarnya dibarengi juga menyapa para pengunjung disertai senyum manisnya. Tidak cuma itu, bersama Clasmild Menthol juga mendatangkan artis ternama Indonesia lainnya seperti Rahma Azhari. Di Barcelona, Rahma Azhari tidak sendiri, dia berkolaborasi bersama DJ Ricky Chattway, ujar Hotman Siagian selaku Operational Manager Barcelona. Dengan tetap mengusung Clasmild Menthol cool n’ smooth persembahan akhir bulan Juni ini mendapat apresiasi positif dari para clubbers di Kota Medan, bukan hanya clubbers semata, namun juga khususnya untuk masyarakat kota Medan. Sementara Sulianto-branch manager PT NTI Indonesia menambahkan, penampilan Aura Kasih memang menjadi ajang terakhir untuk Smester satu ini, namun menurut Clasmild telahmenyiapkanbeberapaevent baik ourdoor dan indoor sampai dengan akhir Smester dua. (m19)

TRIAD Getarkan Publik Medan AhmadDhanibersamagrupnya TRIAD menghentak Kota Medan Sabtu (25/6) malam, membawakan tembang-tembang popularnya untuk mengobati kerinduan penggemarnya di kota ini. Penontonyangsudahmemenuhi lapangan Benteng Medan tampak semakin tak sabar menunggu penampilan Bos-nya Republik Cinta Management ini bersama pasukannya yang memangsudahlamatidaktampil. Konser bertajuk “Galan MildThe Art of Party” diawali penampilan band pembuka yang terus menghangatkan suasana melantunkantembang-tembang yangmemangsudahterasaakrab di telinga pendengarnya. Suasana kian panas ketika Ahmad Dhani bersama TRIAD naik panggung membawakan sekitar 10 lagu didukung pencahayaan cukup mewah, mereka mampu menghipnotis penonton hingga ikut bernyanyi setiap lirik lagu dibawakannya. Diawali lagu‘Mustafa”,TRIAD

07.00 Film Keluarga Shrek 2 08.15 Dahsyat 11:00 Infotainment INTENS 12:00 Seputar Indonesia Siang 12:30 Mega Sinema Tangkuban Perahu Love Story 14.15 Cek & Ricek 15.15 Barbie Thumbelina 17.00 Seputar Indonesia 17.30 Silet 18.00 Mega Sinetron : Putri Yang Ditukar 19.30 Mega Sinetron : Anugerah 22.30 Mega Sinema

CATATAN

Ahmad Dhani bersama TRIAD tampil di Lapangan Benteng Medan Sabtu (25/6) malam terus menggebrak bersama lagulagu lainnya diantaranya Hancur Hatiku,DuaSejoli,sambilmenyapa para panggemarnya. “Senang bisa tampil kembali di Medan”, tuturnya. Di sela-sela konser berlangsung, penonton dibuat terpesona oleh solo drumming dimainkan Ikmal Tobing dengan dentuman double beat drumnya yang kemudiandilanjutkan lagu‘Manusia

07:00 Inbox 09:00 Liputan 6 Terkini 09:03 Halo Selebriti 11:00 SL Liputan 6Terkini 12:00 SL Liputan 6 Siang 12.30 SCTV FTV 14:00 SL Liputan 6Terkini 14:30 Status Selebriti 15:00 Uya Emang Kuya 16:00 SL Liputan 6Terkini 16:03 Cinta juga Kuya 16.30 Sensasi Artis 17:30 Sorga Di Depan Mata 18:30 Islam KTP 20.30 Calon Bini 21.30 Pesantren & Rock n Roll 23.00 SCTV FTV Utama Keluarga Penuh Cinta

Paling Sexy, Madu Tiga dan Aku Rela. Dhani juga berharap bisa datang lagi ke Medan bersama Mahadewa, Virgin dan Mulan Jamela sambil melanjutkan membawa lagu Munajad Cinta danSedangInginBercintasebagai lagu terakhir. “Selamat Malam Medan sampai jumpa lagi”, ujarnya yang terus turun panggung.(m19)

07:00 Disney Club : Stich 07.30 Upin & Ipin 08:00 Layar Pagi 09:00 Cerita Pagi 11:00 Sidik 11:30 Lintas Siang 12:00 Cerita Siang 13.00 Layar Spesial 16:00 Lintas Petang 16.30 Aksi Juara 17:30 Zona Juara 18.00 Animasi Spesial 19.30 Upin & Ipin Dkk 20.00 Sinema Utama Bollywood 00.00 Musik Malam

dan istri, tetapi mereka menginginkankehebohanminumum,” kata seorang sumber kepada NewsOfTheWorld,sepertidikutip Daily Mail. Keduanya terakhir terlihat bersama di London pada Maret, saat Craig terlihat menemani aktris berusia 41 tahun itu belanja di toko Louis Vuitton di Mayfair. Keduanya bekerja keras untuk menjaga hubungan mereka dari sorotan media sejak pertemuan keduanya dalam film “The Dream House.” Mereka berperan sebagai suami istri dalam film yang akan dirilis September. Meskipun, keduanya sudah berteman selama bertahun-tahun, mereka pertama kali berhubungan pada November tetapi saat itu mereka berusaha keras menyangkal kebersamaan mereka. Sebelum mereka bersama, Weiszmemilikihubungandengan sutradara Black Swan, Darren Aronovsky, selama sembilan tahun dan Craig bertunangan dengan pacar lamanya Satsuki Mitchell selama lima tahun. Hubungan mereka menjadi jelas saat keduanya terlihat bergandengan tangan saat merayakan Natal di Somerset. Craig meraih popularitas saat dia menjadi aktor keenam memerankan James Bond tahun 2006. Dia akan kembali berperan sebagai agen rahasia bersandi 007 itu untuk ketiga kalinya dalam film Bond ke-23. Film itu akan dirilis Oktober tahun depan. Weisz bermain dalam film termasuk The Mummy dan About A Boy. Dia meraih Oscar sebagai pemeran pembantu wanita terbaik tahun 2005 lewat filmThe Constant Gardener.(ant)

WASPADA Selasa 28 Juni 2011

Progressif Band saat tampil mengiringi Margie Segers

Sukses Di Medan Jazz Night, Progressif Band Menuju NSJF Alunan manisnya musik jazz dibawakan Progressif Band berhasil membius ratusan penontondalampenampilannya di Medan Jazz Night Jumat (24/ 6) malam di Deli Lounge Dharma Deli Hotel menampilkan bintang tamu penyanyi Jazz ternama ibukota Margie Segers. Medan Jazz Night yang diprogramkan menjadi agenda mingguan diprakarsai Progressif Band diharapkan akan lebih menyemarakkan lagi konser musik Jazz di Medan yang selama ini kurang mendapat tempat. Medan Jazz Night selain menampilkanMargieSegers,juga ikut meramaikan suasana diantaranya Maxi, Faisal dan Lisa

mampu memikat pengunjung juga dirangkaikan talk show menampilkan seniman ternama asal kota ini. Sukses digapai Progressif Band menggelar Medan Jazz Night, menjadi modal kuat kelompokinidalampersiapannya menjadi penampil di ajang jazz lebih bergengsi yaitu North Sumatra Jazz Festival digelar 12 Juli mendatang di Hotel Danau Toba Medan. Di konser Medan Jazz Night, ratusan penonton memadati Deli Lounge Dharma Deli Hotel terlihat menikmati permainan jazz dimainkan Progressif Band dengan personel Totok-drum, Dr Candra Safei,Sp.OG-gitar,

Yusri-keyboard, Johan-piano dan Emil-Bassit. Penonton tidak hanya orang dewasa, tetapi juga anak muda reladudukdimejaseakanterpaku menikmati lagu-lagu dibawakan Maxi, Lisa, Faisal dan tentu saja merekapun terbius alunan jazz dari Margie Segers yang kemampuan vokalnya masih tetap tak berubahmembawakanlagu-lagu milik George Benson bahkan

milik The Mercy’s ‘Semua Bisa Bilang’. Setiap kali Margie Segers usai memainkan lagunya, mendapat sambutan dan tepukan meriah daripenontonyanghadir.Bahkan dia menawarkan ke penonton ingin musik jazz blues ataupun jazz mengarah ke pop dengan mengusung satu lagu asal kampung halamannya Manado.(m19)

Ligro Band

LIGRO Tampil Beda dan Eksploratif Salah satu magnet utama band penampil pada malam pertama perhelatan North Sumatra Jazz Festival 2011, Jumat malam (1/7) adalah trio LIGRO . Band dimotori Gusti Hendy (drum), Agam Hamzah (gitar) dan Adi Darmawan (bas), berani tampil beda dengan memainkan komposisi Jazznya dengan “gila”. Maklum seperti nama band ini yang bila dibaca balik berarti orgil atau orang gila, diambil sebuah komposisi ditulis Jose Haryo Suyoto. Tak pelak, album mereka bertajuk “Ligro Dictionary I” ini pun memberikan nuansa baru dalam blantika musik Jazz kontemporer Indonesia melalui Jazz Rock. Trio Ligro terbentuk pada tahun 2004 saat membentuk ini sepakat memainkan sesuatu yang berbeda dan gila. “Dalam konsep band ini kami menawarkan musik jazz yang lebih eksploratif dan konsepsi musik yang kami mainkan secara improv merupakan kegilaan kami dalam mengeksplorasi,” ujar Agam Hamzah, belum lama

07.00 Curious George 07.30 Sinema Pagi 09.30 SInema Pagi 11.30 Topik Siang 12.00 Klik! 13.00 Mantap (live) 14.00 Rayuan Gombal 17.25 Topik Petang 17.35 Kuis Siapa Paling Berani 18.35 Dokumenter 19.30 Total Black Out Indonesia 21.00 Penghuni Terakhir Season 22.00 Ekspedisi Merah 23.00 World Most Amazing Video 00.00 Topik Malam

07.00 Sensasi Artis 07.30 FTV Pagi 09.30 FTV Drama 11.30 Patroli 12.00 Dong Yi, Jewel In The Crown 13.30 Pasta 15.00 KiSS Sore 15.30 Fokus 16.00 Cruel Temptation 17.00 Arti Sahabat 18.00 Dia Anakku 19.00 Nada CInta 20.00 Antara CInta Dan Dusta 21.00 Cahaya Cinta 22.00 Mega Asia 00.00 Pejantan Cantik 01.00 Fokus Malam

Jadwal acara TV di atas bisa diubah sewaktu-waktu oleh stasiun TV yang bersangkutan tanpa pemberitahuan

berselang. Debut album trio Ligro antara lain bermaterikan lagu Bliker I, Green Powder, Radio Aktif dan Orgil, proses rekamannya dikerjakan Indra Lesmana dan diproduseri Gusti sendiri ini telah menambah jejeran Jazz kontemporer yang sebelumnya telah lahir band-band seperti Tomorrow People Ensemble, Simak Dialog, Discuss dan Java Jazz. Dengan fusi jazz-rock yang banyak memuat komposisi eksperimental itu dihasilkan secara bebas dari ketiga musisi tersebut. Dalam proses pembuatan lagu, kami sengaja merekam secara Live dan penuh improvisasi, karena dari situ justru lebih mudah dalam menyampaikan aransemen yang kita inginkan, tutur Gusti yang juga drummer dari Gigi ini. Sebelum di Gigi, Gusti mengawali sebagai drummer profesional melalui Ligro yang baginya berperan penting dalam mengasah kemampuannya.”Pertemuan bersama Agam dan Adi yang juga merupakan senior saya, memberikan banyak pandangan terhadap musik

07.05 Editorial Media Indonesia 08.05 Eleven Show 09.05 Eleven Show 10.05 Eleven Show 11.30 Metro Siang 13.05 Archipelago 13.30 Jakarta Jakarta 14.30 Metro Sore 15.05 Bisnis Hari Ini 16.30 Metro Realitas 17.05 Metro Hari Ini 18.05 Metro Hari Ini 19.05 Suara Anda 20.30 Metro 10 21.05 Top Nine News 22.05 Today’s Dialogue 22:30 Auto Zone 23.05 Newsmaker 23.30 Metro Sports

Jazz, dan ternyata saya menemukan penjelajahan musikal dari Ligro,” tambahnya. Dalam perjalanan kariernya, Gusti menjadi anak emas setelah pernah bergabung dengan Big City Blues bersama bassis Mates dan gitaris Donny Suhendra di umur 19 tahun dan membawanya sebagai drummer pada Kantata Takwa, konser ‘Dekade’ alm Chrisye, dan konser Krisdayanti hingga digandeng Gigi band. Dia mengatakan, jazz yang diusungnya memang sulit untuk dicerna karena memiliki banyak nada dan ketukan yang ganjil, namun dalam penampilannya yang selalu atraktif justru menjadi sajian utamanya. “Keinginan kami memang lebih mengapresiasikan musik Jazz dengan warna musik ini tanpa perlu kuatir dengan keinginan pasar hingga pendengar jazz sekalipun. Di album berikutnya kami akan tetap dalam konsep dan cara yang sama yaitu dengan live dan penuh improvisasi,” katanya. *(AgusT/Berbagai Sumber).

07.30 Rangking 1 08.30 Dering s 10.00 Fun Games 11.00 Insert 12.00 Reportase Siang 12.30 Jelang Siang 13.00 Bingkai Berita 13.30 Kamu Pasti Bisa 14.30 Police 86 15.00 Keluarga Minus 17.00 Reportase Sore 17.30 Investigasi Seleb riti 18.00 Jika Aku Menjadi 19.00 Big Brother 20.00 Super Trap 21.00 Bioskop Indonesia 23.00 Bioskop TRANS TV 01.00 Reportase Malam

06.30 Apa Kabar Indonesia 09.30 Kabar Pasar Pagi 10.00 Coffe Break 11.30 Kabar Keadilan 12.00 Kabar Siang 13.30 Mutumanikam 14.00 Yang Terlupakan 14:30 Jendela Usaha 15.00 Kabar Pasar 16.00 Kabar & Wanita 16.30 Tahukah Anda 17.00 Kabar Petang 19.30 Jakarta Lawyers’Club 21.00 Apa Kabar Indonesia Malam 22.30 Highlight Powercross 23.00 Motoriderz 23.30 Kabar Arena

08.00 Naruto 09.30 Obsesi 10.30 Abdel & Temon 11.30 Hot Spot 12.00 Awas Ada Sule 13.00 Main Kata 14.00 Petualangan Panji 14.30 Deny Manusia Ikan 15.00 Handmade 15.30 Fokus Selebriti 16.30 Berita Global 17.00 Chalkzone 17.30 Spongebob 19:00 Awas Ada Sule 20.00 Big Movies 23.00 Big Movies

07.30 Selebrita Pagi 08.00 Aku Mau Tahu 09.00 Benar Benar Unik 10.00 Spotlite 11.00 Warna 11.30 Redaksi Siang 12.30 Si Bolang 13.00 Laptop Si Unyil 14.30 Anak Emas 15.00 Koki Cilik 16.00 Jejak Petualang 16.30 Redaksi Sore 17.00 Jejak Petualang 18.00 Beritawa 18.30 Hitam Putih 19.30 On The Spot 20.00 Opera Van Java 22.00BukanEmpatMata 23.30 Berburu 00.00 Jejak Misterius **m31/G


Sumatera Utara

C1 Kota Medan B. Aceh Binjai Bireuen B. Pidie G. Sitoli K. Jahe Kisaran Kutacane Langsa

Zhuhur 12:28 12:42 12:29 12:36 12:36 12:33 12:29 12:25 12:32 12:31

‘Ashar 15:55 16:09 15:56 16:03 16:03 15:59 15:56 15:51 15:58 15:58

Magrib 18:39 18:56 18:40 18:50 18:48 18:39 18:39 18:34 18:42 18:43

‘Isya

Imsak

Shubuh Syuruq

Kota

19:54 20:11 19:55 20:05 20:03 19:54 19:54 19:49 19:57 19:58

04:44 04:55 04:45 04:48 04:49 04:53 04:46 04:42 04:47 04:45

04:54 05:03 04:55 04:58 04:59 05:03 04:56 04:52 04:57 04:55

L.Seumawe 12:34 L. Pakam 12:28 Sei Rampah12:27 Meulaboh 12:38 P.Sidimpuan12:26 P. Siantar 12:27 Balige 12:27 R. Prapat 12:24 Sabang 12:42 Pandan 12:28

06:16 06:26 06:17 06:21 06:21 06:24 06:18 06:13 06:19 06:17

Zhuhur ‘Ashar 16:02 15:54 15:54 16:05 15:42 15:54 15:53 15:50 16:09 15:54

Magrib

‘Isya

Imsak

Shubuh Syuruq

Kota

Zhuhur ‘Ashar

Magrib

‘Isya

Imsak

Shubuh Syuruq

Kota

20:03 19:53 19:53 20:05 19:47 19:51 19:50 19:46 20:12 19:50

04:47 04:43 04:42 04:53 04:46 04:44 04:45 04:42 04:53 04:47

04:57 04:53 04:52 05:03 04:56 04:54 04:55 04:52 05:03 04:57

Sibolga Sidikalang Sigli Singkil Stabat Takengon T.Balai Tapaktuan Tarutung T.Tinggi

12:28 12:29 12:39 12:32 12:29 12:36 12:24 12:34 12:27 12:26

18:35 18:39 18:53 18:40 18:40 18:48 18:34 18:44 18:35 18:37

19:50 19:53 20:08 19:55 19:55 20:03 19:48 19:59 19:50 19:52

04:47 04:47 04:51 04:50 04:44 04:49 04:41 04:51 04:46 04:43

04:57 04:57 05:01 05:00 04:54 04:59 04:51 05:01 04:56 04:53

Panyabungan 12:25 Teluk Dalam12:32 Salak 12:30 Limapuluh 12:25 Parapat 12:27 GunungTua 12:24 Sibuhuan 12:24 Lhoksukon 12:34 D.Sanggul 12:28 Kotapinang 12:23 AekKanopan 12:24

06:19 06:15 06:14 06:25 06:17 06:15 06:17 06:14 06:25 06:19

15:54 15:56 16:06 15:58 15:56 16:03 15:51 16:01 15:54 15:53

06:19 06:18 06:24 06:22 06:16 06:21 06:13 06:22 06:18 06:14

BINJAI (Waspada) : Ketua DPW Partai Persatuan Pembangunan (PPP) Sumatera Utara H Fadly Nurzal (foto) berharap pem-bangunan di kota Binjai selama kepimpinan Walikota HM Idahamdanwakilwalikota TimbasTariganharuslebihbaik. Pasangan Idaham dan Timbas merupakan dukungan PPP, oleh sebab itu kader PPP di Binjai harus membantu pembangunan kota Binjai. “Amankan program Walikota Idaham dan Timbas di Binjai,” ujarnya ketika memberikan pidato politik, Senin (27/6) di Pendopo Umar Baki usai melantik kepengurusan DPC PPP Kota Binjai priode 2010-2015 . Fadly mengemukakan partai politik sebagai instrument untuk berbuat kebaikan. Sebab manusia dilahirkan di muka bumi dipercayakan sebagai pemimpin mewujudkan kemakmuran dan kebajikan terhadap umat. ApalagiPPPsebagaisatu-satunyapartaiIslam di Indonesia. Komitmen PPP sebagai partai islam

Maling Bobol Rumah Pamen Polda Di Binjai

Sambut HUT DS, Muspika Namorambe Gotroy NAMORAMBE (Waspada): Menyambut HUT ke-65 Kab. Deliserdang dan Bhayangkari, Muspika Namorambe bersama warga mengadakan gotong-royong kebersihan, Jumat (24/6). Gotongroyong diadakan di setiap desa di Kec. Namorambe yang difokuskan pada kebersihan drainase dilanjutkan dengan menanam pohon penghijauan secara serentak di setiap sekolah. Camat Namorambe HendraWijaya menyebutkan, pelaksanaan gotongroyong itu merupakan upaya untuk kembali menyadarkan masyarakat pentingnya budaya bergotongroyong. “Masyarakat kita masyarakat yang saling menghargai, memiliki toleransi tinggi, saling tolong menolong dan memiliki sifat bergotong royong,” ujar mantan Sekcam Patumbak ini. Dilanjutkan Hendra, untuk itu masyarakat perlu disadarkan kembali akan pentingnya bergotongroyong untuk tetap menjaga kebersihan dan kesehatan lingkungan.(c02)

IPM Sergai Bantu Perlengkapan Sekolah Warga T. Beringin TANJUNGBERINGIN (Waspada) : Ikatan Pelajar Muhammadiyah (IPM) Serdang Bedagai melaksanakan bhakti sosial berupa pembersihan Masjid Taqwa Muhammadiyah dengan membersihkan masjid itu dan pemberian bantuan perlengkapan sekolah berupa pakaian layak pakai, seragam sekolah dan buku tulis serta perlengkapan belajar lainnya kepada 50 anak yatim dan kurang mampu warga Desa Bagan Kuala, Kec.Tanjung Beringin, Minggu (26/6). Bhakti sosial itu merupakan rangkaian dari Pelatihan Kepemimpinan IPM Sergai yang dibuka di Perguruan Muhammadiyah Desa Pon, Kec. Sei Bamban, 24 Juni dan ditutup di Desa Bagan Kuala 26 Juni lalu. Kegiatan dibuka Ketua PD Muhammadiyah Sergai H Zubir HamzahyangdihadiriunsurpengurusPDMuhammadiyah,Aisyiyah, Pemuda Muhammadiyah dan Kepala Sekolah Perguruab. Muhammadiyah dan pelatihan diikuti 40 peserta dari utusan cabang IPM se-Sergai yang mayoritas berstatus pelajar. Ketua PD Muhammadiyah H. Zubir Hamzah dalam sambutannya mengatakan sangat mengapresiasi kegiatan tersebut dan menyampaikan bahwa pelajar Muhammadiyah merupakan generasi penerus tonggak persyarikatan Muhammadiyah yang harus terus didukung agar siap tampil menjadi pemimpin masa depan. (c03)

Maknai TP PKK Di Masyarakat LUBUKPAKAM (Waspada) : Bupati Deliserdang H Amri Tambunan mengajak seluruh kader PKK untuk memaknai keberadaannya di masyarakat sebagai kader pembangunan bangsa, ibu rumah tangga yang peka terhadap tuntutan kebutuhan dan permasalahan warga di sekelilingnaya. Karenanya sebagai kader diharapkan mampu bergerak bersama memberi solusi dan pemecahannya dengan memantapkan pelaksanaan 10 program PKK serta program penunjang lainnya sesuai dengan kebutuhan di desa dan kelurahannya saat ini. Hal itu ditegaskan bupati selaku Ketua Dewan Penyantun TPPKKDeliserdangdihadapan200-anpengurusTP-PKKkabupaten, kecamatan, desa dan kelurahan, pada Rakeda PKK Kab.Deliserdang 2011, di Brastagi Cottage, baru-baru ini. Bupati mengatakan kader PKK harus menjadi contoh dan panutan sebagai orang yang dituakan menjadi pimpinan dimana ia berada, karenanya melalui Rakerda PKK ini hendaknya dapat dimanfaatkan untuk berdiskusi, bertukar pikiran saling mengisi, menyempurnakan serta saling memberi informasi bagaimana kita melakukan dan langkah apa untuk melawan permasalahan yang melanda bangsa saat ini. KetuaTP PKK Deliserdang Ny Hj Anita AmriTambunan mengatakan, kader PKK harus mempunyai andil dalam percepatan pembangunandaerahmelaluikemampuankita denganmenerapkan 10 program pokok PKK. (a06)

15:51 15:58 15:56 15:52 15:54 15:51 15:50 16:01 15:55 15:49 15:51

Magrib

‘Isya

Imsak

Shubuh Syuruq

18:31 18:37 18:38 18:35 18:36 18:31 18:30 18:47 18:36 18:30 18:33

19:45 19:52 19:53 19:50 19:51 19:46 19:45 20:02 19:51 19:45 19:48

04:46 04:53 04:47 04:42 04:45 04:44 04:45 04:47 04:46 04:42 04:42

04:56 05:03 04:57 04:52 04:55 04:54 04:55 04:57 04:56 04:52 04:52

06:17 06:25 06:19 06:13 06:16 06:16 06:16 06:19 06:18 06:13 06:14

Pembangunan Di Binjai Harus Lebih Baik

BINJAI (Waspada): Gara-gara menggeber- geber (mengas-gas) sepeda motor akhirnya Afnes Pranata Ginting ,17, warga Jalan Apel, Kel Bandar Senembah, Kec Binjai Barat dibacok oleh B, 30, warga yang tidak jauh dari rumah korban, Minggu (26/6) Kapolres Binjai AKBP Dra Rina Sari Ginting ketika dikonfirmasi melalui Kasubag Humas AKP F Siagian, membenarkan tentang penganiayaan terhadap Afnes Pranata Ginting dan tersangka dijerat Pasal 351. Menurut sumber Waspada, kejadian tersebut sekitar pukul 14:30, ketika itu korban melintasi Jalan Apel dengan mengendarai sepeda motornya. Saat itu tersangka sedang duduk duduk di pinggir jalan bersama teman-temannya. Korban menggeber-geber sepeda motornya, tetapi tersangka merasa tak senang lalu mendatangi korban dan terjadi pertengkaran dan diakhiri pembacokan.(a05)

BINJAI (Waspada): Rumah kediaman Asisten II Pemko Binjai H Wahyudi SH di Jalan Kedondong Lk I, Kel bandar Senembah, Kec Binjai Barat, Sabtu (25/6) dibobol maling. Dalam kejadian itu korban kehilangan dua unit Laptop serta satu unit HP dan uang tunai yang diperkirakan seluruhnya Rp20 juta. Kejadian dilaporkan korban ke polisi dengan Lp/715/VI/ 2011/SPKT “B” 25 Juni 2011. Kapolres Binjai AKBP Dra Rina sari Ginting ketika dikonfirmasi Waspada melalui Kasat Reskrim AKP Roni Bonic SiK Senin (27/ 6), membenarkan. Ketika itu korban bangun pagi hendak buang air dan dilihatnya jendela belakang rumahnya sudah terbuka serta jerejak rusak.(a05)

Zhuhur ‘Ashar

Ketua DPW PPP Sumut H Fadli Nurzal

Gara-gara Geber Sepeda Motor Dibacok

Dua Laptop Dan Satu HP Asisten II Pemko Binjai Digondol Maling

Selasa 28 Juni 2011

18:48 18:38 18:38 18:50 18:33 18:36 18:35 18:32 18:56 18:35

Dihisab oleh: Tim Ahli Badan Hisab dan Rukyat (BHR) Sumut

BINJAI (Waspada): Rumah milik Pamen (Perwira Menengah) Polda Kompol Togu Simanjuntak yang juga mantan Kasat Reskrim Polres Binjai di Jalan Binjai Tanjung Pura, Kel Nangka, Kec Binjai Utara Senin (27/6) pukul 05:00 dibobol maling. Dalam kejadian itu korban kehilangan satu unit Laptop seharga Rp5 juta. Sementara, pihak Reskrim Polres Binjai begitu menerima pengaduan kemudian langsung mengadakan olehTempat Kejadian Perkara (TKP) dibawah pimpinan Aiptu Harmawadi. Kapolres Binjai AKBP Dra Rina Sari Ginting ketika dikonfirmasi Waspada melalui Kasat Reskrim AKP Roni Bonic SiK, membenarkan. Keterangan dikumpulkanWaspada menyebutkan, ketika itu Kompol H Togu Simanjuntak, SH hendak shalat subuh. Namun dilihatnya jendela umah terbuka serta jerjak besinya pun terbuka. Lalu ia memeriksa isi rumah, ternyata satu unit laptop miliknya di ruangan tamu sudah tidak ada lagi.(a05)

WASPADA

Waspada/Sapriadi

MENYALIN BBM jenis bensin dari sepeda motornya dan dimasukkan ke jerigen untuk di jual lagi dengan harga Rp 7 ribu perliter, setelah ikut antri di SPBU. Kegiatan itu kembali diulangi. Foto direkam, Senin (27/6).

BBM Langka Di Asahan

Transportasi Desa Terancam Lumpuh KISARAN (Waspada): Kelangkaan bahan bakar minyak (BBM) beberapa hari terakhir, mengakibatkan transportasi pedesaan Kab. Asahan terancam lumpuh. Hal itu diungkapkan Kepala Desa Gajah Sakti, Kec Bandarpulau, Asahan Imanan Nehe, saat dikonfirmasiWaspada via seluler, Senin (27/6). Diamengatakan,transportasi di desanya terancam macet, disebabkankelangkaanBBMdan kalaupun ada harganya melambung tinggi mencapai Rp 7 ribu per liter. “Dampak itu sangat nyata, karena wilayah pertanian dan perkebunan,sehinggamasyarakat terbentur saat membawa hasil panennya pulang ke rumah, dan tidak bisa dipungkiri pengeluaranpun bertambah, disebabkan mahalnya harga BBM,” ungkap Imana. Menurutnya,bilatransportasi pedesaanterganggu,makasecara otomatis penghasilan pedesaan juga ikut terganggu, dan hal itu sangat merugikan, mengingat makin meningkatnya kebutuhan masyarakat. ‘’Bilasituasiiniterusberlanjut, maka percepatan pembangunan akan terganggu. Pendapatan masyarakat otomatis berkurang, karena terbentur dengan dana operasional, sehingga bisa berdampak dengan pembayaran pajakbumibangunan(PBB)yang ikut juga tersendat,” ungkap Imanan Senada dengan itu Kepala

Desa Tamansari, Kec Pulaubandring, Alfian, mengatakan, bila kegiatan ini berlangsung lama, maka masyarakat desa akan terganggu. “Kita tidak tahu apa sebenarnya penyebab BBM langka, padahal sebelumnya aktivitas BBM berjalan dengan normal,” ungkap Alfian. Di lain tempat anggota KomisiBDPRDAsahan,AbdulKhoir Harahap dikonfirmasi Waspada, terkait dengan masalah ini, mengharapkan Pemkab Asahan mau berkoordinasi dengan Pertamina, terkait penyediaan BBM untuk wilayah Asahan, sehinggakelangkaaninibisadiatasi dengan cepat dan tidak mengganggu perekonomian masyarakat. “Harus ada jalan tengah yang diambil pemerintah dalam masalah ini, sehingga kekhawatiran di masyarakat dapat diatasi dengan cepat,” ungkap Khoir. Selain itu, lanjut Khoir, diharapkan pemerintah membuat tim pengawasan terhadap pendistribusian BBM di masyarakat, sehingga tidak disalurkan ke tempat yang bukan haknya. Karena hasil pedesaan sangat membantu roda perekonomian Asahan dari hasil panen. “Kita berharap masalah ini dapat selesai dengan cepat. Dan pengawasan terhadap penggunaan BBM tepat sasaran dengan mengutamakan kepentingan masyarakat banyak,” ungkap Khoir. Curang Pantauan Waspada, di beberapa SPU di Kisaran terlihat sejumlah mobil pribadi, dan ken-

daraan sepeda motor antri mengisi bensin, namun setelah penuh, bensin itu dikeluarkan kembali dam dimasukkan ke dalam jiregen untuk dijual. Sedangkanmobildansepeda motor itu kembali ikut antrian. Kegiatan itu terpaksa dilakukan karena adanya larangan SPBU mengisi minyak dalam jiregen. “Ini memang curang, tapi pemerintah dengan peraturannya mendidik kami melakukan hal ini, agar kami bisa menerima permintaan dari pedesaan dan perkotaan,” kata salah seorang warga yang melakukan kecurangan itu, ditemui Waspada. Sementara, Bupati Asahan TaufanGamaSimatupang,dikonfirmasi Waspada, melalui Kabag Humas Rahman Halim, mengatakan pihaknya telah melayangkansuratkePertaminaterkait kelangkaan BBM, dan diketahui pasokan minyak untuk wilayah Sumut dikurangi. Sedangkan alasan penguranganitubelumdiketahuidengan jelas. “Kita telah melayangkan surat itu, namun hingga saat ini belum ada balasan dari Pertamina,” ungkap Halim. Rahman juga mengakui adanya keluhan dari masyarakat, apa lagi para nelayan yang ada diwilayahSeikepayangyangtidak bisa melaut, sebab kelangkaan solar, sehingga pihaknya terus melakukan koordinasi dengan Pertamina, namun masalah ini belum terjawab. “Masyarakat diharapkan bersabar dengan situasi ini, dan jangan panik, karena Pemkab Asahan sedang mengusahakan yang terbaik untuk Asahan,” ungkap Rahman. (a15)

memberikan tantangan kepada pengurus P3 harus berprilaku Islam. Fadly juga menyebutkan P3 sebagai Islam yang terbuka, kecuali Ahmadiyah yang tidak dibenarkan. Fadly Nurzal yakin, Walikota HM Idaham akan membantu dan pengurus PPP Kota Binjai harus menunjukkan program yang positif,agar menambah kepercayaan kepadaumat,sehinggaPemilu2014, PPP bisa menambah tiga kursi menjadi enam kursi. Walikota Binjai HM Idaham dalam sambutannya mengemukakan PPP sebagai partai pendukung pada Pilkada mengajak bekerja sama untuk mensukseskan pembangunan di Kota Binjai. Pengurus PPP Binjai diharapkan mampu membina umat,sehingga posisi umat Islam 80 persen di Binjai bisa menaruh harapan untuk memperjuangkan harapan umat melalui PPP di Binjai. Ketua DPRD Binjai Haris Harto juga mengingkat mengurus partai merupakan pekerjaan yang tidak ada berhenti 24 jam harus mampu menerima warga terutama kader partai. (a04)

Polres Sergai Tegur Keras SPBU Firdaus SEIRAMPAH (Waspada) : Pasca penggerebekan polisi, Jumat (24/6) hingga beberapa truk tujuan Riau dan Jakarta terparkir di area SPBU Firdaus menunggu pasokan solar dari Pertamina. “Solar habis sejak, Sabtu (25/6) pasokan dari Pertamina belum masuk, bensin juga kosong,” ungkap pekerja SPBU itu. Beberapa pekan terakhir, kelangkaan solar di SPBU bukan karena pengurangan pasokan oleh Pertamina. Hal itu terjadi, kuat dugaan karena pengelola SPBU bertindak nakal, menjual BBM solar bersubsidi itu ke industri, seperti kilang-kilang padi besar di kawasan Sei Rampah, padahal BBM solar bersubsidi itu untuk masyarakat. Satuan Intel Polres Sergai, Jumat (24/6) menangkap basah transaksi BBM Bersubsidi solar dengan modus pengisian solar ke dalam puluhan

jerigen ukuran 35 liter yang diangkut dengan truk colt diesel. Disinyalir, truk colt diesel BK 9169YM milik pengusaha salah satu Kilang Padi di Sei Rampah. “Pihak SPBU kita berikan teguran keras, karena mereka mementingkan pengusaha dan pengecer, sehingga kita minta ratusan liter solar yang sudah dijual dikembalikan ke SPBU,” kata Humas Polres Sergai ZN Siregar. Pernyataan ini mengejutkan anggota DPRD yangmengikutiperkembanganmasalahini,Senin (27/6) di gedung dewan. Anggota dewan menyesalkan sikap Polres Sergai yang hanya memberikan teguran peringatan. Pelanggaran sudah terjadi, bahkan, banyak warga yang tahu,” ujar Pangeran Hutajulu, anggota DPRD dari Komisi A. (a08)

Konversi Minah Di Tobasa Diduga Tak Tepat Sasaran Di Laguboti Warga Dikutip Rp10 Ribu BALIGE (Waspada) : Pelaksanaan konversi minyak tanah (minah) ke gas LPG 3 kg diduga tidak tepat sasaran kepada masyarakat yang membutuhkan. Bahkan dalam melakukan pendistribusian gas 3 kg, di wilayah Kec.Laguboti ternyata warga dikenakan pengutipan sebesar Rp10 ribu yang berdalih untuk biaya distribusi ke rumah tangga, padahal program nasional konversi minah ini telah dicanangkan gratis. Kabag Perekonomian Pemkab Tobasa Hutajulu, Senin (27/6) mengatakan, program konversi minah ini memang gratis atau tidak dibenarkan dilakukan pengutipan. “Camat Laguboti sudah kita tegur setelah mendapat kabar dilakukan pengutipan distribusi LPG 3

kg kepada warga,” kata Jonni. Jonni mengatakan pelaksanaan program nasional konversi minah ini pemkab setempat kurangdilibatkan,sehinggakriteriadanpendataan rumah tangga yang layak mendapatkannya dilakukan langsung PT Pertamina melalui konsultannya. “UntukpendataandilakukanPTSehatPrama SejatikonsultanPTPertaminapada16kecamatan di Toba Samosir yang hasilnya terdapat 34.856 calon penerima, terdiri dari 34.434 rumah tangga dan 422 usaha mikro. Lalu hasil pendataan diverifikasi PT Kanta Karya Utama dan pendistribusian dilakukan PT SCO Prima Inovatindo,” kata Jonni. (a22)

Polisi Ringkus Pencuri Kabel Telkomsel Antar Provinsi INDRAPURA(Waspada): Dua tersangka percobaan pencurian kabel tower telkomsel diringkus Polsek Indrapura saat beraksi di Desa Sukaraja, Kec. Airputih, Kab. Batubara, Kamis (23/6). Kapolres Asahan melalui Kapolsek Indrapura AKP. MA Ritonga kepada Waspada, Jumat (24/ 6) mengatakan, tersangka diringkus berkat laporan dari masyarakat. Kedua tersangka tersebut PA, 23, warga Desa Bah Samkurang Kec Jorlang Hataran, Kab

Simalungun dan PS,28, Desa Surau Gading, Kec Batangsamo Ujung Batu, Kab Rokan Hulu. Disita barang bukti satu unit sepeda motor Suzuki Smash tanpa plat, tang pemotong kabel dan linggis. “Pelaku mengaku telah berulang kali mencuri kabel di Batubara, Perdagangan,Tiga Dolok, Prapat, Pematangsiantar dan Riau. Saat ini kedua tersangka mendekam di tahanan Polsek Indrapura. (c05)

Bupati Sergai Sampaikan LKPJ 2010 SEI RAMPAH(Waspada): Bupati Serdang Bedagai Ir. H.T. Erry Nuradi, M.Si menyampaikan nota pengantar Laporan KeteranganPertanggungjawaban (LKPJ) dan laporan pertanggungjawabanpelaksanaanAPBD 2010 pada Rapat Paripurna Dewan Perwakilan Rakyat Daerah (DPRD) Sergai, Rampah, Senin (20/6). Rapat yang dibuka Ketua DPRD Sergai H AzmiYuli Sitorus, SH, MSP tersebut turut dihadiri Wabup Ir. H. Soekirman, Wakil Ketua DPRD MY. Basrun, Drs H Sayuti Nur, MPd, Drs H Abdul Rahim, Sekdakab Drs H Haris Fadillah, MSi, unsur forum Pimpinan Daerah, para anggota DPRD Sergai, Asisten, Staf Ahli Bupati, Kepala SKPD, Camat, Ormas, Pers serta lainnya. Bupati Sergai HT Erry Nuradi dalamnotapengantarnyamenjelaskan, pencapaian target indikator makro Kabupaten Sergai tahun 2010, salah satunya Pertumbuhan ekonomi Kabupaten Sergai mengalami peningkatan

sebesar 0.22 persen dari 5.92 persenmenjadi6.14persenpada2010. Indikator sosial menggambarkan pencapaian tingkat kesejahteraan masyarakat, pada bidang kesehatan menunjukkan cakupan balita gizi buruk yang mendapat perawatan dan penemuan serta penanganan penderitapenyakitDBDditahun2010 sebesar 100 persen, angka kematian bayi 2010 masih sama seperti tahun 2009 yakni 26 per seribu, sedangkan angka kematian ibu mengalami penurunan dari 160 per 100 ribu kelahiran hidup pada 2009 menjadi 155 per 100 ribu kelahiran hidup pada 2010. Lebih lanjut Bupati menjelaskan,untukpelaksanaanurusan desentralisasi pada 2010 dirinci berdasarkan 26 urusan wajib dan 6 urusan pilihan. Di antaranya urusan wajib bidang pendidikan dengan sasaran memperluas kesempatan dalam memperoleh pendidikan serta meningkatkan mutu pendidikan dalam rangka peningkatankualitassumberdaya

manusia. Kinerja yang dicapai dalam pelaksanaanprogrampendidikan antaralainAngkaPartisipasiKasar (APK)SD103.23persen,SMP91.54 persen dan SMU 99.86 persen, Angka Partisipasi Murni (APM) SD86.92persen,SMP67.01persen dan SMU 68.14 persen serta penduduk yang menyelesaikan program wajib belajar 9 dan 12 tahun mencapai 93 persen, ungkap Bupati. Sementara, untuk urusan wajib bidang lingkungan hidup Bupati Sergai menjelaskan, penanganan sampah mencapai 53.84 persen, cakupan pengawasan terhadap pelaksanaan amdal 100 persen dan tempat pembuangan sampah/satuan penduduk sebesar 84.19 persen, dengan keluaran kegiatan diantaranya terlaksananya kegiatan pelaksanaan hari bumi, lingkungan dan cipta puspa melalui penanaman 600 pohon dan pelepasan 2.000 ekor bibit ikan, tingkat pelayanan kesehatan ibu dan bayi 85 persen.

Capaian kinerja urusan pertanian antara lain produksi padi 365.316 ton, jagung 35.355 ton, kedelai3.306ton,ubikayu123.380 ton dan semangka 155.054 ton, sedangkan untuk peternakan produksidaging1.963.128kg,telur ayam 275.000 butir, telur itik 87.000 butir dan untuk populasi ternak sapi sebanyak 37.338 ekor, kerbau1.505ekor,kambing57.804 ekor, domba 25.768 ekor serta unggas 3.800.719 ekor, tambah Bupati. Pada kesempatan yang sama Bupati Sergai H.T. Erry Nuradi jugamenyampaikanlaporanpertanggungjawaban pelaksanaan APBD Kabupaten Sergai tahun anggaran 2010 yang secara keseluruhan capaian target pendapatan daerah Rp.649.616.644. 193.93 dari target yang ditetapkan Rp.676.306.826.183.00 atau 96.05 persen, yang berasal dari Pendapatan Asli Daerah (PAD) sebesar Rp22.093.187.209.93 dari target yang ditetapkan Rp27.949. 040.000.00 atau 79.05 persen dan pendapatan transfer Rp611.580.

Waspada/Eddi Gultom

BUPATI Sergai Ir HT Erry Nuradi, MSi didampingi Wabup Ir H Soekirman tengah menyampaikan nota pengantar LKPJ dan pertanggungjawaban APBD 2010 pada rapat paripurna di DPRD Sergai, Senin (20/6). 296.984.00 dari target yang ditetapkan Rp627.703.036.086.00 atau 97.43 persen. Mengenai belanja daerah tahun anggaran 2010 Bupati Sergai menjelaskan, belanja daerah Pemerintah Kabupaten Sergai pada laporan pertanggungja-

waban pelaksanaan APBD tahun anggaran 2010 ditargetkan Rp.732.383.745.694.00,sedangkan realisasinyaRp666.468.396.241.00 atau sekitar 91.00 persen yang dibagiatasbelanjaoperasi,belanja modal dan belanja tak terduga.(a08)


Sumatera Utara

C2 Pemimpin Umum Dr. Hj. Rayati Syafrin Pemimpin Redaksi/Penanggung Jawab H. Prabudi Said Wakil Pemimpin Umum/Wapemred H. Teruna Jasa Said Wakil Penanggung Jawab H. Sofyan Harahap Redaktur Senior H. Azwir Thahir

Wartawan Kota Medan: Umum: Zulkifli Harahap, Amir Syarifuddin, Ismanto Ismail, Rudi Arman, Zulkifli Darwis, H. Abdullah Dadeh, H. Suyono, Ayu Kesumaningtyas, David Swayana, Gito AP, Rizaldi Anwar, M. Ferdinan Sembiring, M. Edison Ginting, Anum Purba, Sahrizal, Sulaiman Hamzah, Sugiarto, Rustam Effendi, Mursal Alfa Iswara, Andi Aria Tirtayasa, Maini Anggita, Silfa Humaira. Olahraga: Austin E. Antariksa, H. Syahputra MS, Setia Budi Siregar, Dedi Riono. Fotografer: Muhammad Faisal, Hang Tuah Jasa Said, Surya Effendi, Hamdani. Otomotif: Armansyah Thahir. Koran Masuk Sekolah/KMS: Dedek Juliadi, Hajrul Azhari Ritonga. Wartawan Jakarta: Andi Yanto Aritonang (Koordinator Liputan), Hermanto, H. Rama dhan Usman, Hasriwal AS, Nurhilal, Edi Supardi Emon, Agus Sumariyadi, Dian Warastuti, Aji K, Yuslan Kisra. Wartawan Sumatera Utara: Binjai: H. Riswan Rika, Nazelian Tanjung. Deli Serdang: H.M. Husni Siregar, Hotma Darwis Pasaribu, M. Suhandi Nasution. Serdang Bedagai: Eddi Gultom, Edi Sahputra. Stabat: H. Ibnu Kasir, Abdul Hakim. Pangkalan Brandan: Chairil Rusli, Asri Rais. Kabanjahe/ Berastagi: Dickson Pelawi, Basita Bukit, Dedek Mohan Basri Hasibuan, Micky Maliki. Tebing Tinggi: Muhammad Idris, Abdul Khalik. Pematang Siantar: Mulia Siregar, Edoard Sinaga. Simalungun: Ali Bey, Hasuna Damanik, Balas Sirait. Aek Kanopan: Indra Muheri Simatupang, Syahril Ilham. Rantau Prapat: H. Nazran Nazier, Armansyah Abdi, Neirul Nizam, Budi Surya Hasibuan. Kota Pinang: Hasanuddin, Deni Syafrizal Daulay. Pangururan: Edison Samosir. Balige: Jimmy Sitinjak. Sidikalang: Natar Manalu. Pakpak Bharat: Arlius Tumanggor. Tarutung: Parlindungan Hutasoit, Marolop Panggabean. Sibolga/Tapanuli Tengah: Zulfan Nasution, Alam Satriwal Tanjung. Padangsidimpuan: H. Syarifuddin Nasution, Sukri Falah Harahap, Ahmad Cerem Meha. Gunung Tua: Sori Parlah Harahap. Sibuhuan: Idaham Butarbutar, Syarif Ali Usman. Panyabungan: Munir Lubis, Sarmin Harahap, Alpin Lubis. Gunung Sitoli: Bothaniman Jaya Telaumbanua. Kisaran: Nurkarim Nehe (Koordinator Liputan Asahan, Batubara & Tanjungbalai), Bustami Chie Pit, Sapriadi. Batubara: Helmy Hasibuan, Agus Diansyah Hasibuan, Sahril, Iwan Hasibuan. Tanjung Balai: Rahmad Fansur Siregar, Rasudin Sihotang. Wartawan Aceh: Banda Aceh: Aldin Nainggolan (Ka Perwakilan), Iskandarsyah (Koordinator Liputan), Muhammad Zairin, Munawardi Ismail, Zafrullah, T. Mansursyah, T. Ardiansyah, Jaka Rasyid, Gito Rollies. Lhokseumawe: Bustami Saleh (Ka Perwakilan/Koordinator Liputan), M. Jakfar Ahmad, Zainal Abidin, Zainuddin Abdullah, Maimun. Kuala Simpang: Muhammad Hanafiah, Hasanul Hidayat. Langsa: H. Syahrul Karim, H. Ibnu Sa’dan, Agusni AH, H. Samsuar. Lhoksukon: Musyawir. Idi: Muhammad H. Ishak. Bireuen: HAR Djuli, Amiruddin. Takengon: Bahtiar Gayo, Irwandi. Sigli: Muhammad Riza, H. Rusli Ismail. Sabang: T. Zakaria Al-Bahri. Subulussalam: Khairul Boang Manalu. Tapaktuan: Zamzamy Surya. Blangpidie: Sudarmansyah Putra. Kutacane: Ali Amran. Blangkejeren: Bustanuddin, Wintoni. Bener Meriah: Irham Hakim. Singkil: Mansurdin. Sinabang: Muhammad Rapyan.

� Semua wartawan Waspada dilengkapi dengan kartu pers. Tidak dibenarkan menerima uang dalam bentuk apapun. Jangan layani dan segera laporkan ke pihak berwajib atau ke Sekretaris Redaksi bila ada oknum yang mengaku wartawan Waspada tetapi tidak bisa menunjukkan kartu pers yang sah, ditandatangani Pemimpin Redaksi �

Hubungi kami Penerbit: PT Penerbitan Harian Waspada Komisaris Utama: Tribuana Said Direktur Utama: dr. Hj. Rayati Syafrin, MBA, MM SIUPP: 065/SK/MENPEN/SIUPP/A.7/198 tanggal 25 Februari 1988 Anggota SPS No. 13/1947/02/A/2002 KANTOR PUSAT Jalan Letjen Suprapto/Brigjen Katamso No. 1 Medan 20151 Tel: (061) 4150858, Faks Redaksi: (061) 4510025, Faks Tata Usaha: (061) 4531010. E-mail Redaksi: redaksi@waspadamedan.com KANTOR PERWAKILAN DAN BIRO � Perwakilan dan Biro Jakarta: Jalan Siaga II No. 6 C Pejaten Barat, Pasar Minggu Jakarta Selatan. Tel: (021) 79197052, Faks: (021) 79199874. � Perwakilan dan Biro Banda Aceh: Jalan Ratu Syafiatuddin No. 21 C, Banda Aceh. Tel & Faks: (0651) 22385. � Perwakilan dan Biro Lhokseumawe: Jalan Iskandar Muda No. 65, Lhokseumawe. Tel: (0645) 42109. � Biro Asahan, Batubara & Tanjungbalai: Jalan Sutami No. 30 Kisaran. Tel: (0623) 41412. Harga iklan per mm kolom: Hitam-putih Rp. 11.000,-, berwarna Rp. 30.000,Halaman depan: hitam-putih Rp. 33.000,-, berwarna Rp. 90.000,Ukuran kolom: 40,5 mm. E-mail Iklan: iklan@waspadamedan.com Pencetak: PT Prakarsa Abadi Press, Jalan Sidorukun Medan. Isi di luar tanggung jawab percetakan

TG TIRAM(Waspada): Perairan Batubara menjadi sasaran empuk penyelundupan dari luar negeri sebelum sampai ke daratan maupun pelabuhan yang dituju, apakah ke Tanjungtiram, Pagurawan,KualaTanjungmaupunTanjungBalai. Hal itu memerlukan pengawasan pengamanan yang lebih efektif dalam menangkal usaha ilegal dimaksud. ‘’Diperkirakan belasan unit boat usaha penyelundupdariluarnegeriMalaysiamelintasdisekitar Pulau Salahnama Perairan Batubara dan buang jangkarmenungguwaktuyangtepatuntukmasuk ke alur Kuala Pelabuhan yang dituju,’’sebut beberapa nelayan diTanjungtiram kepadaWaspada, Senin (27/6). Menurutnya, penyelundup mengunakan

Waspada/Iwan Has

SALAH satu boat penyelundup berbobot 7 hingga 8 GT memuat barang bekas dari Malaysia buang jangkar di sekitar Pulau Salahnama Perairan Batubara, Rabu (22/6).

Gizi Buruk Masih Mengancam Warga Asahan KISARAN (Waspada) : Penyakit gizi buruk masih mengancamKabupatenAsahan,terkait dirawatnya seorang balita yang terindikasi penyakit itu di RSUD Kisaran, sedangkan program pemerintahdalammeningkatkan kesehatan masyarakat dinilai masih berjalan di tempat. Ancaman itu terbukti berdasarkan data dari RSUD Kisaran, terhitung Januari hingga Juni 2011, tercatat empat anak terindikasi penyakit gizi buruk, dan kini ada seorang balita lagi masih dirawat intensif. Anak malang itu Bela Safitri, 13 bulan, putri kelima dari Siti Aisyah,38, dan Murtazam, 44, warga DusunV, Desa Binjaiserbangan, Kecamatan Airjoma, sudah sakit-sakitan sejak berumur 6 bulan. Padahal menurut orang tuanya,imunisasinyasudahlengkap, dan hasil pemeriksaan awal ditemukan kelainan pada pencernaannya.“Anak saya masuk pada Rabu (22/6) dan hingga sampai Senin (27/6), anaknya belum ada mengeluarkan kotoran,” ungkap ibu pasien, Siti, di RSUD Kisaran. Siti menjelaskan, anaknya lahir dengan dengan berat normal (4 kilogram) dengan usia dalam kandungan sembilan bulan, danmengikutiimunisasilengkap. Namun dia mengakui belum begitu paham tentang perawatan bayi, disebabkan tidak adaa sosialisasi kesehatan di tempat tinggalnya. Data dihimpun, untuk penderita gizi buruk di Asahan 2010, ditemukan sebanyak tujuh balita, sedangkan tumor di kepala, ada satu orang bayi yang kini tidak diketahuidenganjelasbagaimana nasibnya.

Sakit Anak Salam Medan dan tenaga medis lainnya. Salam Ginting yang merupakan donatur utama dari pembangunan Masjid Salam Al-Qodir meminta agar masjid yang telah diresmikan ini dapat selalu diramaikan dengan kegiatan ibadah. “Jangan hanya ramai pada bulan Ramadhan dan hari-hari besar perayaan agama Islam saja, jadikanlahmasjidsebagaijantung daricentralkegiatanumatmuslim dalam bermasyarakan dan kehidupan sehari-hari “, ujarnya. Rahmatsyah Sembiring Meliala, mewakili keluarga besar ahli waris menyampaikan rasa terimakasih dan bersyukur atas berdirinya masjid tersebut. Dia harapkan masjid Salam Al-Qadir tidak hanya sebatas tempat shalat lima waktu, tapi lebih dari itu bisa menjadimediapendidikan,kegiatan sosial masyarakat dan media silatuhrami. Kakandepag Karo Mardinal Tarigan,MA dalam arahanya meminta agar masjid ini dapat ditata

Waspada/Sapriadi

BELA Safitri, 13 bulan, sedang makan dari suapan ibunya saat dirawat di RSUD Kisaran. Anak ini irawat selama enam hari, karena menderita gizi buruk, dan berat badannya hanya mencapai 5 kilogram, Senin (27/6). Sedangkan untuk hydro-sepalus bari ditemukan satu balita, dan kini masih hidup dan menjalani rujukan ke RSUD Medan. Sementara susfec TB Paru ditemukan pada bayi laki-laki yang berumur masih 10 bulan dan dengan berat badan hanya 5,9 kilogram. PositifTBParuMilier,sewaktu terindikasi awal November 2010 usianya masih enam bulan, Asal Kecamatan Airbatu, dan kini masih dalam perawatan jalan. Samahalnyadenganseorangputri berumur 10 tahun asal Kecamatan Mandoge, fositif TB Paru. Sedangkan yang menderita kelainan jantung sewaktu dilahirkan dan mengalami komplikasi penyakit hanya satu orang asal Kecamatan Seikepayang, dan hanya bertahan hidup sampai

Suami Aniaya Istri Dan Bayinya Pakai Bubur Panas Masuk Bui PEMATANGSIANTAR (Waspada) : SS, 40, alias Bagong, warga JalanPattimura,KelurahanTomuan,SiantarTimuryangtegamenyiram istri dan bayinya dengan bubur panas hingga melepuh akhirnya ditangkap dan dijebloskan ke ahanan Polres Pematangsiantar. “Pelaku sudah ditetapkan sebagai tersangka kasus kekerasan dalam rumah tangga (KDRT) dan ditahan di ruang tahanan Mapolres,” ujar Kapolres Pematangsiantar AKBP Alberd TB Sianipar melalui Kasubbag Humas AKP Altur Pasaribu dan Kasat Reskrim AKP Azharuddin di Mapolres, Senin (27/6). Seperti diberitakan, SS menyiram tubuh istrinya, Aisyah Azah, 35, dengan bubur panas dan mengenai bayinya laki-laki yang masih berusia satu bulan hingga sebagian tubuh korban mulai dari wajah sampaikekakibagiankananmelepuh.Meskiistrinyamenjeritkesakitan, namun SS masih menampari istrinya hingga bibir isterinya bengkak. Motif kasus itu karena pada Jumat (24/6) siang, bayi mereka yang hendak diberi istrinya makan bubur tidak mau makan dan terus menangis hingga SS emosi dan mengambil bubur yang baru dimasak dalam panci dan disiramkan ke tubuh istrinya. “SS mengakui perbuatannya dan menyebutkan tindakannya dilakukan karena kesal istrinya tidak bisa diajari dan malah melawan hingga terjadi pertengkaran. (a30)

kelola degan baik, kuhususnya dalam hal pengelolaan keuangan dan tanah wakaf masjid, sehingga didapat hasil yang maksimal utuk kebaikan umat diperbulan. Pengsyahadatan 9 Mualaf Peresmian masjid tersebut dirangkaikan dengan pengsyahadatan9Mualafdiantaranya Herbet Pardede. “Saya benarbenar merasa dilahirkan kembali, ini adalah kehidupan yang kedua bagi saya,” ujar Herbet. Pengakuan Herbet, selama ini ia hanya mendengar dan melihat Islam dari kejauhan saja. “Dulu bila saya mendengar kata Islam maka yang timbul dalam pikiran saya adalah teroris. Sampai suatu saat saya memutuskan untuk hidup di tengah kaum muslimin dan terus mengikuti rasa ingin tau tentang Islam denganbertanyalangsungkepada guru-guru islam,” katanya. Di samping membaca bukubuku Islam, kata Herbet, ia juga merenungkannya dan mengkaji

kapal nelayan tersebut membawa barang-barang bekas berharga seperti pakaian monza sampai springbad, ban mobil, dan tidak menutup kemungkinan elektronik dan gula untuk dijual di tanah air. ‘’Mereka yang berlabuh jangkar di sekitar pulauumumnyapenyelundupkesiangansehingga perlu menunggu waktu malam untuk sampai ke tujuan guna menghindari dari jeratan hukum,’’ katanya. Mungkin saja di antara mereka yang berlabuh sambil menunggu boat lain untuk mentransit barangbekasyangmerekabawa.’’Praktikinikesannya tak tersentuh hukum meskipun merugikan negara/daerah dalam bea cukai barang yang di bawa ke tanah air,’’kata Ijul nelayan jaring.(a13)

Disnaker Batubara Temukan Pelanggaran K3 PT Madjin INDRAPURA (Waspada) : DinasTenaga Kerja Batubara pada April lalu sudah menemukan adanya pelanggaran berbagai ketentuan dan peraturan ketenagakerjaan di PT Madjin Crumb Rubber Factory (CRF) Indrapura, Kecamatan Airputih, Batubara, namun hingga sekarang belum ada tindak lanjut. Pelanggaranketentuandanperaturantentang ketenagakerjaanyangberlakuitudinilaimelanggar dan mengabaikan pelaksanaan program Keselamatan dan Kesehatan Kerja (K3). Sebagaimana diberitakan pekan lalu, PT Madjin Indrapura melanggar program K3. Dari data yang diperoleh, Senin (27/6) mengatakan, Kepala Dinas Tenaga Kerja Batubara Marahanda memerintahkan Kasi Perlindungan Tenaga Kerja A Siregar melalui Surat Perintah Tugas tertanggal 29 Maret 2011 untuk melakukan

pemeriksaan ketenagakerjaan di PT Madjin CRF Airputih. Sesuai surat perintah ini, pemeriksaan dilakukan pada 31 Maret 2011. Dari pemeriksaan lapangan, staf tersebut ditemukan pelanggaran K3 di perusahaan ini. Di antaranya sistem pengupahan dan gaji lembur yang diduga tak sesuai ketentuan. Beberapa instalasi yang belum diuji ulang, pekerja pada bagian produksi tak memakai Alat Pelindung Diri (ADP) dan beberapa pelanggaran K3 lainnya. Hasil temuan ini sudah disampaikan kepada Kepala Disnaker, namun hingga saat ini tidak ada tindak lanjut berikutnya. Sehingga hal ini menimbulkan tanda tanya. Ada apa sebenarnya sehingga temuan itu seperti dipetieskan. Ketika hal ini akan dikonfirmasikan kepada Marahanda di Disnaker Batubara tak berhasil menemuinya. (c04)

Terlilit Hutang Pengangguran Nekat Merampok Kalung Emas

9 Mualaf Dan 252 Anak Dikhitan Di Perbulan Karo LAUBALENG (Waspada) : Warga muslim di Desa Perbulan, Kecamatan Lau Baleng, Kabupaten Karo, khususnya warga Dusun Kampung Jawa merasa bersyukur karena Masjid Salam Al-Qodir di kampung mereka telah diresmikan, Sabtu (25/6). Masjid Salam Al-Qodir dibangun di atas tanah wakaf keluarga besar almarhumah Qodir Sembiring Meliala yang diwasiatkan semasa Qodir Meliala masih hidup. Peresmian masjid yang dibangun sejak 3 tahun lalu ini dirangkaikan dengan pensyahadatan 9 mualaf dan khitanan massal 252 orang berlangsung sukses. Hadir dalam acara itu Kakandepag Karo H Mardinal Tarigan. Salam Ginting yang merupakan donator utama pembangunan masjid Rahmatsyah Sembiring Meliala mewakil ahli waris Qodir Sembiring, para donator antara lain Hj Hariaty Br Sebayang mewakili para donator dari Aceh Tenggara, drTommi dari Rumah

Selasa 28 Juni 2011

Perairan Batubara Sasaran Empuk Penyelundup

WASPADA

Pemimpin Perusahaan: Dr. Hj. Rayati Syafrin. Wakil Pemimpin Perusahaan: H. Bahtiar Tanjung. Iklan: Hj. Hilda Mulina (Kabag), Rumondang Siagian (Medan), Lulu (Jakarta). Redaktur Pelaksana Berita: Armin Rahmansyah Nasution. Redaktur Pelaksana Opini & Artikel: Dedi Sahputra. Redaktur Minggu & Akhir Pekan: Hendra DS. Redaktur Berita: H. Akmal AZ, H. Halim Hasan. Redaktur Medan: Muhammad Thariq. Redaktur Sumatera Utara: M. Zeini Zen. Redaktur Aceh: H.T. Dony Paridi. Redaktur Luar Negeri: H. Muhammad Joni. Redaktur Nusantara: Edward Thahir. Redaktur Olahraga: Jonny Ramadhan Silalahi. Redaktur Ekonomi: Armin R. Nasution. Redaktur Agama: H. Syarifuddin Elhayat. Litbang: H. Akmal AZ (Kabag). Humas: H. Erwan Effendi (Kabag), Aidi Yursal. Sekretaris Redaksi: Hj. Hartati Zein. Pemasaran: H. Subagio PN (Medan), Zultamser (Sumut), Aji Wahyudi (Aceh). Asisten Redaktur: David Swayana (Kota Medan, Infotainmen); Irwandi Harahap (Kota Medan); Feirizal Purba, Diurna Wantana (Sumatera Utara); Armansyah Thahir (Aceh, Otomotif); Austin Antariksa (Olahraga, KMS Kreasi); Syafriwani Harahap (Luar Negeri, Popular, Pariwisata); Rudi Faliskan (Berita); Hj. Hoyriah Siregar (Ekonomi); T. Junaidi (Hiburan); Hj. Erma Sujianti Tarigan (Agama), Hj. Neneng Khairiah Zen (KMS Remaja, Mode); Anum Purba (Keluarga); Hj. Ayu Kesumaningtyas (Kesehatan).

WASPADA

ulang atas kehidupan yang telah ia jalani di masa lalu dan di masa sekarang ini. Khitanan Massal Di samping peresmiaan masjid dan pengsyahadatan muallaf, juga dilaksanakaan khitanan massal yang diikuti 252 peserta dari 27 desa di Lau Baleng dan Mardinding yg terdiri dari anak-anak, remaja dan dewasa. SiswantaGintingselakuketua pelaksana menyampaikan terimakasih yang tak terhingga kepada semua pihak yang ikut membantuterlaksananyahajatan besar itu, baik itu berupa kemudahan,materi,tenaga,pikirandan doa. Kata Siswanta, di Masjid Salam Al-Qadir setiap malamnya sudah diadakan pengajian Iqro untuk anak-anak yang guru pembibingnya didatangkan dari Belawan,juga pengajian Tauhid untuk orang tua yang dibimbing oleh Ustadz Zulkarnaen dari Kutacane. (c09)

usai 4 tahun. Data itu yang hanya diketahui, namun tidak tertutup kemungkinan masih banyak lagi bayi, balita dan anak-anak di Asahan terindikasi penyakit gizi buruk dan penyakit lainnya, mengingat luasnya wilayah Asahan dan kedapatan penduduk. Menurut data dari BPS Kisaran,2008angkakematianbayi mencapai 30,5 persen, dengan prediksi seribu kelahiran ada 30 bayi yang meninggal. Sedangkan ada189.453wanitausiasubur(1549 tahun), sehingga diperhitungkan dari jumlah itu ada 568.359 kelahiran terjadi di seluruh penjuru daerah Asahan. Namun DinasKesehatanpada2008,hanya bisa menemukan 44 kasus kematian bayi berusia 0-29 hari, denganalasandatadariklinikdan ruma sakit swasta tidak masuk secara keseluruhan. Sedangkan 2009 ditemukan 151 kasus, dan 2010 ada 102 kasus. Kadis Kesehatan Asahan Habinsaran pernah mengatakan, pada 2010, Dinkes telah menganggarkan penanggulangan gizi pada balita di Kab Asahan sebesar Rp150 juta, dan meningkatkan kinerja posyandu dan bidan desa. Namun kenyataannya berdasarkan data, masalah gizi pada bayi masih belum diatasi baik. (a15)

PERBAUNGAN(Waspada): Akibat banyak terlilit hutang MN alias Ono,31, warga Lingkungan XI,Kelurahan Tualang, Kec. Perbaungan, Kab. Serdang Bedagai nekat melakukan perampokan terhadap korbannya Sumiati,32, warga Desa Sei Bamban,Kec.Sei Bamban,Kab.Serdang Bedagai saat sama sama berada didalam angkot jurusan Tanjung Morawa Tebing Tinggi, di Desa Pasar Bengkel, Kec.Perbaungan,Kab.Serdang Bedagai, Sabtu(25/6) pukul 17:30. Habis merampok kalung emas, korbannya teriak, akhirnya Muliono alias Ono (31) dihajar massa saat akan kabur dari angkot yang dinaikinya saat melintas di Desa Pasar Bengkel, Kecamatan Perbaungan, Sergai, Menurut sumber tersangka ini naik angkot jurusan Tanjung MorawaTebingTinggi. Setibanya di sekitar depan RSU Trianda Desa Pasar Bengkel MN alias Ono melakukan merampok kalung emas yang dipakai korban. Akibat kejadian itu korban berteriak menjerit jerit sehingga mengundang warga yang ada dilokasi kejadian. Sementara pelaku langsung turun dari angkot dan melarikan diri. Namun karena warga telah mengetahuinya lalu menangkap tersangka dan menghajarnya kemudian diserahkan ke Polsek Perbaungan.

“Untung pada saat itu ada polisi datang sehinggatersangkaselematdariamukmasa. Masak dia berani merampok didalam angkot, apa gak ada kerjaan lain,”ujar Pardi warga Pasar Bengkel. Sementara itu pengakuan Sumiati sebelum kejadian dia dari Medan hendak pulang kerumahnya di Sei Bamban. Karena penumpang sepi dia hanya bertiga didalam angkot, namun tiba-tiba naik tersangka dari Perbaungan. “Sejak dia naik aku curiga, karena matanya terus kearah penumpang,tak lama dia bergerak dan langsung merampok kalung emas yang ada dileherku, kemudian aku teriak, dan dia ditangkap warga,”ujar Sumiati. Ono saat diperiksa mengakui kalau dirinya nekat merampok akibat terlilit hutang sekitar Rp 3 juta dari sesesorang, sehingga saat ditagih, Ono bingung dan nekat perampok. “Aku sudah berusaha meminjam kepada keluarga, tetapi tidak ada yang mengasi, saat itulah muncul niatku untuk merampok,”kilahnya. Kapolsek Perbaungan AKP Marluddin S.Ag saat dikomfirmasi membenarkan kejadian itu. ”Tersangka diserahkan warga berikut barang bukti kalung emas 5 gram yang berhasil dirampoknya,” ujar Kapolsek.(a08)

Labusel Butuh RPH KOTAPINANG (Waspada): Pemkab Labusel belum memiliki Rumah Potong Hewan (RPH) sehingga pedagang terpaksa memotong hewannya secara pribadi. Akibatnya semua daging yang dipasarkan tidak dapat dipastikan aman, sehat, utuh dan halal. Hal itu diungkap Ketua Ikatan Cendekiawan Muslim se Indonesia (ICMI) Labusel, Abdullah MN Situmorang, Senin (27/6). Menurutnya, selama ini di Labusel hanya memiliki Tempat Pemotongan Hewan (TPH) pribadi, sehingga pengawasan sulit dilakukan. Padahal lanjut dia, pemerintah daerah (Pemda) menurut UU N0.18/2009 dan PP No 22/1983 tentang Kesehatan Masyarakat Veteriner, wajib menyediakan RPH. Di situ jelas diatur bupati/ wali kota wajib menyediakan RPH untuk menyediakan pangan yang aman. “Makanya kita sarankan Pemkab menyediakan RPH yang representatif,” katanya. Diamengungkapkan,setiapharinyapedagang memotong ratusan ekor ayam dan beberapa ekor lembudankambing.Semuanyaitudilakukan

pedagang secara pribadi, sehingga kesehatan dan kehalalannya belum terjamin. Padahal, kata dia, keberadaan RPH juga dapat meningkatkan PAD Labusel untuk kepentingan pembangunan. Kepala Dinas Pertanian, Perikanan dan Peternakan Pemkab Labusel, Selwin Marpaung yang dikonfirmasi mengakui tidak adanya RPH tersebut. Selama ini kata dia, pemotongan hewan dilakukan di TPH pribadi. “Setiap hari sedikitnya 3ekorlembudipotonguntukdipasarkankemasyarakat,” katanya. Menurutnya, Labusel memang memiliki RPH di kawasan Simaninggir, Kec Kotapinang, namun RPHpeninggalanPemkabLabuhanbatuitusudah belasan tahun tidak digunakan. Lagi pula kata Selwin, RPH tersebut sudah tidak representatif untuk digunakan. Karenanya pihaknyaberencanaakanmembangunRPHuntuk menyeleksi pemotongan hewan. Namun dia belum bisa memastikan kapan rencana itu akan direalisasikan. “Rencana sudah ada, namun masih kita cari lokasinya yang pas,” kata Selwin. (c18)


Sumatera Utara

WASPADA Selasa 28 Juni 2011

Pelanggan PDAM TSP Di Bagandalam Kesulitan Air Bersih

Gadis Di Bawah Umur Korban Cabul TALAWI (Waspada) : Seorang gadis di bawah umur menjadi korban perbuatan cabul dua lelaki warga Gunung Santi, Desa Panjang Kec Talawi, Kab. Batubara setelah berhasil membujuk korban untuk diantarkan pulang. Peristiwa itu terungkap ketika korban Bunga (nama samaran), 14, bersama orang tuanya Atik penduduk Desa Binjaibaru membuat laporan kepada Polsek Labuhan Ruku Resort Asahan, Kamis (23/6). Menurut keterangan, peristiwa itu berawal Minggu (19/6) saat korban sedang mandi di tempat pemandian di kawasan Dam Merbo Desa Sei Muka,Talawi yang lokasinya tidak jauh dari rumah kediaman neneknya. Seusai mandi tiba- tiba dirinya didatangi dua lelaki yang mengaku kenal dengan kakaknya yang menawarkan untuk mengantarkan pulang ke rumah. Karena waktu sudah menjelang Maghrib korban langsung mengikuti dan pelaku sempat menginapkannya selama dua malam di rumahnya sekaligus melakukan pencabulan. Kapolsek Labuhan Ruku AKP H Matondang melalui Kanit Reskrim Iptu A Siringoringo dihubungi wartawan membenarkan kejadian itu dan berkasnya sudah dilimpahkan ke Polres Asahan. (a13)

PT Nubika Jaya Bantu Siswa Berprestasi

T.TIRAM (Waspada) : Ratusan pelanggan PDAM TSP Asahan yang tinggal di Desa Bagandalam dan Sukamaju Tanjungtiram Batubara mengeluhkantidakmendapatdistribusiairbersih. Pembagian air terhenti dise but-sebut mesin pompa sumur bor di Bagandalam yang rusak. Samsir, warga Jl Solo Sukamaju, Minggu (26/ 6) menyesalkan petugas PD AM Tanjungtiram dinilai lamban seperti tidak mengerti memperbaiki mesin pompa rusak. “Sudah limo hari kami tak dapat air. Padahal kalau menaikkan rekening air copat Maunyo

Waspada/Helmy Has

BPBD Batubara Harus Waspadai Bahaya Kebakaran TANJUNGTIRAM (Waspada) : Badan Penanggulangan Bencana Daerah (BPBD) Batubara harus meningkatkan kewaspadaan bahaya kebakaran mengingat cuaca masuk musim kemarau saat ini. “Dalam kondisi musim kemarau menyebabkan suhu udara panas tinggi siang malam wajar aparat/petugas Damkar BPBD yang bermarkas di Tanjungtiram meningkatkan kewaspadaannya,” ujar Sofian T, warga Tanjungtiram, Minggu (26/6). Apalagi pihak Badan Mateorologi Klimatologi dan Geofisika (BMKG) Wilayah I Stasiun Bandara Polonia Medan sudah mengingatkan hal tersebut. Harapan warga perlu siaga mengingatkan pengalaman dua kali kebakaran di rumah Icam dan Udin K di Desa Ujungkubu. Korban ke cewa karena mobil Damkar baru tiba setelah rumah korban musnah dilalap api. Bahkan warga minta Pemkab Batubara memberikanpelatihankepadapasukanGeganadalammengantisipasi bila terjadi kebakaran, jangan sempat kejadian petugasnya tidak paham mengisi air atau tidak ada sopir khusus damkar. (a12)

Pembangunan Kantor SKPD Batubara Dipertanyakan LIMAPULUH (Waspada) : Penyidikan kasus dugaan korupsi pembangunan tujuh kantor SKPD Pemkab Batubara sampai pada pembelian lahan pertapakan dipertanyakan. Padahal tingkat penyidikan dilakukan Kejatisu tinggal mengarah kepada tersangka sebagaimana di beritakan media masa. ‘’Ini mencerminkan Kejatisu berpegang kepada komitmen dalam penegakan hukum memberantas setiap kasus tindak pidana korupsi,’’ tutur Ramadhan Zuhri, Jumat (24/6). Untuk menuntaskan penyidikan kasus tersebut pihak Kejatisu disebutkan membentuk tim dan turun kelapangan menelusuri lokasi sekaligusmelihatlangsungkondisipembangunankantoryangberpusat di Desa Perupuk dan Gambus Laut, Kec. Limapuluh. Meskipun perkantoran telah berfungsi dan di tempati masingmasing SKPD menjalankan administrasi pemerintahan. (a13)

Mantan Anggota DPRD Asahan/Batubara Telah Tiada T.TIRAM (Waspada) : Hidayat, kader PAN, mantan anggota DPRD Asahan/Batubara meninggal dunia, Sabtu (25/6) setelah menderita sesuatu penyakit. Almarhum meninggalkan seorang istri dan 5 anak. Menurut Ketua DPD PAN Batubara Yahdi Khohir Harahap, almarhum dikenal pejuang dalam tubuh partai (PAN) diTanjungtiram. Dia selama dua priode menduduki kursi di DPRD Asahan tahun 1999 -2004 kemudian 2004 sampai 2009 di DPRD Asahan/Batubara. Yahdi dalam ungkapan duka mengantar almarhum ke pekuburan keluarga di Kampung Lalang Sukamaju mengharapkan keluarga ditinggalkan sabar serta ikhlas dan minta putra/puteri almarhum dapat mengikuti jejak orang tuanya semasa hidupnya. (a12)

Langgar Tatib

Paripurna Pertanggungjawaban Anggaran Pendapatan Daerah T. Balai Harus Dibatalkan TANJUNGBALAI (Waspada) : Sekretaris Fraksi PDI Perjuangan Hakim Tjoa Kian Lie menyatakan, paripurna DPRD beragendakan Nota Pengantar Rancangan Pertanggungjawaban Pelaksanaan Anggaran Pendapatan Daerah Kota Tanjungbalai TA 2010 pada Jumat lalu, harus dibatalkan demi hukum. Alasan Hakim, paripurna itu melanggar tata tertib DPRD tentang persyaratan qorum suatu paripurna. “Tata tertib DPRD, sahnya suatu paripurna ditentu-

kan dari kehadiran fisik anggota legislatif,untukpengesahanPerda harus dihadiri oleh 2/3 dari anggota DPRD,” kata Hakim melalui saluran telefon, Minggu (26/6). Sementara, lanjut hakim, pada paripurna Jumat lalu itu, hanya dihadiri 10 anggota DPRD, padahal jumlah total wakil rakyat di Tanjungbalai sebanyak 25 orang. “ Berarti tidak sampai 2/ 3 anggota dewan yang hadir pada paripurna itu,” jelas Hakim. Untuk itu, Hakim mendesak pimpinan DPRD membatalkan paripurna tersebut, dan menunda jadwal agenda pertanggungjawaban APBD 2010 sampai ada penetapan dari Badan Musyawarah. Sebelumnya, kendati daftar kehadiran hanya ditandatangani

10 orang dari 25 anggota dewan, namun Sidang Paripurna Nota Pengantar Rancangan Pertanggung jawaban Pelaksanaan Anggaran Pendapatan Daerah Kota Tanjungbalai TA 2010 tetap berlangsung. Sekretaris Dewan Ramadhan Syahdan berdalih, absen memang ditandatangani 10 anggota DPRD,namunsaatparipurnaada 15 wakil rakyat yang hadir. Kata Syahdan, kelima anggota DPRD yang tidak menandatangani absen itu dianggap hadir karena mengikuti jalannya persidangan. Dan, menurut Syahdan, secara administratif, kehadiran 5 anggota dewan dianggap sah, sebab wujudnya ada. “ Kita tidak bisa memaksa mereka untuk membubuhkan tandatangan,” ujar Syahdan. (a14)

Palsukan Stempel, Staf Di Sekwan Labusel Diduga Fiktifkan Pengadaan ATK KOTAPINANG (Waspada) : Salah seorang staf di Sekretariat DPRD Labusel diduga memalsukan stempel toko untuk pembayaran faktur pembelian kebutuhan alat tulis kantor dan biaya penggandaan tahun anggaran 2009dan2010yangdisinyalirfiktif. Terungkapnya pemalsuan danpenyalahgunaanatributusaha itu berawal kedatangan sejumlah petugas Badan Pemeriksa Keuangan (BPK) melakukan verifikasi berkas ke Toko Gembira di Jl Sudirman, Kotapinang beberapa pekan lalu. Saat itu Ayen pemilik toko yang menjual ATK, fotokopi, dan jasa service komputer itu mengungkapkankepadapetugas bahwa stempel yang tertera di SPJ (surat pertanggungjawaban) milik Sekretariat DPRD tersebut

berbedadenganstempeltokonya. “Petugas BPK yang datang itu mempertanyakan keabsahan stempel di SPJ tersebut, ya setelah saya periksa ternyata stempel yang digunakan pada berkas SPJ tersebut palsu,” kata Ayen. Saat itu, lanjut Ayen, petugas BPK juga memintanya memperlihatkanstempelaslitokotersebut. Setelah dicocokkan, ternyata stempel itu memiliki perbedaan dengan stempel yang digunakan di SPJ tersebut. “Dari warnanya saja sudah berbeda,” kata Ayen. Pemalsuan terhadap atribut usahanya itu bukan pertama kali dilakukan oleh oknum di Sekretariat DPRD. Pada pertengahan 2010,Ayentelahmemperingatkan seorang staf DPRD yang ketahuan menggunakan stempel

tokonya. “Kalau gak salah namanya si Ali, dan saat itu saya masih memaafkan perbuatan mereka. Dan si Ali berjanji tidak mengulanginya lagi. Tapi mereka ulangi,” katanya. Sekretaris DPRD Labusel Naga Parlaungan Lubis yang dikonfirmasi, Minggu (26/6) tidak menampik tuduhan tersebut. Menurutnya,pihakBPKjugatelah memberi peringatan kepada mereka terkait persoalan itu. “Memang kemarin petugas BPK memperingatkan hal itu,” katanya. Dia mengaku, penggunaan atribut usaha itu di tahun anggaran 2009-2010 oleh oknum di lembaganya. Namun 2011 dia sudah memeriksa seluruh berkas dan dipastikan penggunaan stempel palsu tidak ada lagi. (c18)

Waspada/Ist

Bupati Batubara Terima Gelar Kehormatan Kanjeng Raden Ario LIMAPULUH (Waspada) : Bupati Batubara H OK Arya Zulkarnain menerima gelar kehormatan Kanjeng Raden Ario (KRA) dari Keraton Surakarta Hadiningrat, Solo, Jawa Tengah. Perjalanan prosesi wisuda gelar kehormatan tersebut berlangsung khidmat di Keraton Surakarta, Minggu (26/6). Kabag Humas Pemkab Batubara melalui Kabid Pemberitaan Muhammad Sukhri mengatakan, setelah diberi gelar, maka nama Bupati Batubara menjadi H Kanjeng Raden Ario OK Arya Zulkarnain. Prosesi wisuda dipimpin langsung Kanjeng Gusti Pangeran Haryo Puger, putra Paku Buwono 12. Sedangkan gelar kehormatan dibacakan oleh abdi dalem kerajaan Surakarta, disebutkan bahwa bupati berperan aktif dalam mengayomi masyarakat Jawa yang ada di Batubara. ’’Peran bupati ini meliputi pemberdayaan Sumber Daya Manusia (SDM) dan lain sebagainya,’’ terang Cecep yang akrab dipanggil tersebut. (a13)

LIMAPULUH (Waspada) : Kalangan nelayan di sekitar Perupuk, Gambus laut, Tanjungtiram merasa gembira terbetiknya niat Pemkab Batubara akan melakukan pengerukan alur di Kuala Tanjungtiram Batubara untuk mengatasi gangguanpelayarankeluarmasuksampan/boatnelayan. Wakil Ketua SNSU Sumut/Koordinator DPC SNSU Batubara, Syafrizal, Minggu (26/6) mendukung rencana Pemkab Batubara melakukan pe ngerukan KualaTanjungtiram sema kin dangkal mempersulit nelayan melaut. “Terlepas siapapun yang dipercaya mengerjakan pengerukan dengan syarat pasir kuarsa yang disedot jangan diambil atau diangkut ke

tempat lain,” pinta Syafrizal. Dia mengusulkan lumpur bercampur pasir kuarsa yang disedot ditimbunkan sepanjang pinggir kampung di Baganluar dan Bogak Seberang seba gai benteng pemukiman penduduk. Lebih baik sebelumnya dilakukan analisis teknis mengerjakannya, jangan di belakang hari menimbulkan keru gian bagi masyarakat nelayan Bila mungkin dimusyawarahkan melibatkan tokoh nelayan, masyarakat, Perguruan Tinggi (PT) bersama pejabat Pemkab Batubara. Diharapkan melalui musyawarah apapun keputusannya merupakan hasil yang dipertanggungjawabkan bersama. (a12)

Sambut Ramadhan, FPI Batubara Safari Dakwah Ke Tempat Maksiat LIMAPULUH(Waspada):Menyambutbulan suci Ramadhan, Front Pembela Islam (FPI) Batubara melaksanakan safari dakwah ke tempat - tempat yang diduga maksiat secara damai. Kepada Waspada, Minggu (26/6), Ketua FPI Batubara Ustadz MuhammadYusri mengatakan, safari dakwah secara damai ke tempat - tempat yang diduga sebagai lokasi maksiat ini sebelumnyatelahdiberitahukankePolresAsahan. “Kita tidak ingin niat untuk menyampaikan dakwahsecaradamaiiniditanggapinegatif,begitu pula untuk menghindarkan hal - hal yang tidak dinginkan, maka kita memberitahukan kepada yang berwajib,” kata Yusri.

Dijelaskannya, safari dakwah ini dilakukan sejak Sabtu (25/6) pukul 22:00 hingga Minggu (26/6) pukul 03:30. Sasaran dakwah FPI kali ini dimulai dari Kecamatan Talawi, Tanjungtiram, Limapuluh, Airputih dan Medang Deras. Dengan sasaran warung remang - remang, tempat perjudian, penjual minuman keras dan tempat biliar. “Alhamdulillah tidak terjadi tindakan yang anarkis maupun perlawanan, para pengunjung tempat - tempat tersebut lari berhamburan saat kita masuk, begitu pula tempat yang disebut durian begincu, semuanya berjalan damai,” ujarnya. (c05)

Puluhan Bal Pakaian Bekas Selundupun Lolos Di Batubara LIMAPULUH (Waspada) : Diduga puluhan bal pakaian bekas selundupan ‘lolos’ dari pengamatan petugas keamanan yang membongkar barang ilegal itu pada salah satu tangkahan nelayan di Dusun III, Desa Mesjidlama, Talawi, Batubara, Sabtu (25/6) malam. Menurut sumber, pada waktu bersamaan sekira pukul 23:30, Sabtu (25/6) di Dusun III Mesjidlama terjadi keributan datang sekelompok orang melakukan sweping di tempat permainan bilyard minta tempat tersebut ditutup. Usai aksi sweping, puluhan warga mendapat informasisebuahboatdidugamembawapuluhan bal pakaian bekas selundupan sandar pada tangkahannelayandisana. Tidakjelasapakahkegiatan membongkar barang ilegal itu diketahui petugas keamanan setempat. Yang pasti, sebut sumber, diperkirakan lebih 50 warga ikut membantu mengangkut barang

itu dari boat ke dalam prah mendapat upah Rp70 ribu per orang. “Setahu saya sudah dua kali penyelundupan pakaian bekas masuk membongkar barangnya di tangkahan Dusun III Mesjidlama tersebut. Tetapi belum ditangkap petugas setempat,” ujar warga. Kadus III Mesjidlama Udin L, Minggu (26/ 6) mengatakan agak ragu-ragu menjelaskan dugaanterjadinyaaksiselundupanbarangpakaian bekas di dusunnya. Tetapi dia mengakui ada yang memanggil supaya datang ke lokasi, namun dia tidak mau datang. Kapolsek Labuhanruku AKP H Matondang, Minggu (26/6) tidak mengetahui adanya kegiatan dugaan selundupan pakaian bekas di Dusun III Mesjlama. Kebetulan malam itu anggotanya mengamankan aksi sweping terhadap tempat biliar di tempat yang sama. (a12)

Massa Bersepedamotor Sweeping Usaha Biliar TALAWI (Waspada) : Massa bersepedamotor yang datang secara beriringan dari arah SimpangSianam,Kec.Limapuluh ‘sweping’ tempat usaha biliar Di Desa Masjid Lama, Kec. Talawi, Kab. Batubara, Sabtu (25/6) sekira pukul 23:00. ‘’Mungkin massa secara kebetulan melintas mengarah tujuanlaindanmelihatusahabiliar beroperasi, sehingga mereka berhenti dan mensweeping ke tempat usaha sambil menyuruh

keluar orang di dalamnya’’ kata seorang warga yang enggan menyebutkan jatidirinya melihat jalannya aksi dilakukan salah satu organisasi masyarakat itu. Setelah melakukan aksinya, massa mengenderai sekitar 20 sepeda motor itu, selanjutnya keluar melanjutkan perjalanan mengarah ke Simpang Empat Tanjungtiram. Menurut keterangan, perkembanganusahabiliartidaksaja ada di Desa Masjid Lama, akan

tetapisudahmenjangkauiwilayah pesisir dan kecamatan di Batubara. ‘’Maunya semua tempat disweepingsebabadakemungkinan yangtidakmemilikkiizin,’’tambah warga tadi. Camat Talawi Lutfhi yang dihubungi, Minggu (26/6) membenarkanaksiitumemintatempat usaha ditutup. Dalam aksinya merekajugamengambilbolabiliar dan membawanya pergi. (a13)

Dilema Sampah Di R. Prapat, Antara Kebijakan Dan Penanganan BUPATI Batubara H OK Arya Zulkarnain paling kiri saat berlangsung prosesi wisuda pemberian gelar kehormatan Kanjeng Raden Ario dari Keraton Surakarta Hadiningrat, Solo, Minggu (26/6).

petugas PDAM co pat pulak membolo mesin rusak tu,” ujar Samsir. Selamalimahariiniwargaterpaksamenyerbu air booring saling berebut mengisi jerigen dengan tarif Rp500 per jerigen. Kadus I Bagandalam Naharuddin membenarkan warganya sudah lima hari tak dapat air bersih PDAM,k arena mesin pompa rusak. “Sekarang warga antre berebut air sumur booring untuk keperluan memasak, tak mungkin mereka memasak pakai air laut,” ujar Naharuddin. (a12)

Pengerukan Kuala T. Tiram Perlu, Pasir Kuarsa Jangan Diambil WARGA Desa Bagandalam saling berebut mendapat air pada salah satu usaha sumur booring membeli dengan harga Rp500 per jerigen, Minggu (26/6).

KAMPUNGRAKYAT (Waspada) : PT Nubika Jaya, KebunTanjung Medan, Sabtu (25/6) pagi memberikan bantuan kepada siswa berprestasi di SDN 112239 Kampung Perlabian, Desa Perlabian, Kampung Rakyat, Labusel. Manajer Kebun PT Nubika Jaya, Ramses Silaen dalam kegiatan itu mengatakan, beasiswa itu merupakan bagian dari program Corporate Social Responbility (CSR) tahun 2011. Bantuan yang diberikanberupapakaianseragam,sepatu,tas,bukudanperlengkapan sekolah lainnya. Bantuan itu diberikan kepada siswa berprestasi, yakni mendapat ranking I sampai III. “Ini merupakan binaan karena selama ini hubungan antara perusahaan dengan masyarakat begitu harmonis. Jika melihat sambutan ini, apa yang kami berikan terlalu kecil, namun ini pelajaran agar ke depannya di tingkatkan,” katanya. Menurutnya, selama ini pihaknya sudah mengakomodir kepentingan masyarakat di sekitar perkebunan di antaranya 80 persen tenaga kerja yang direkrut adalah warga sekitar perkebunan. “Kita juga buat program bina lingkungan dan CSR,” katanya. Kepala SDN 112239 Kampung Rakyat Fitri Kasuma Siregar mengatakan bangga karena siswanya mendapat perhatian dari PT Nubika Jaya. Dia berharap ke depannya seluruh perusahaan di Kecamatan Kampung Rakyat melakukan hal serupa. (c18)

C3

PENANGANAN sampah di Kabupaten Labuhanbatu terkesan jalan di tempat, walaupun kabupaten yang kini berpenghasilan karet dan sawit tersebut sudah dipimpin banyak bupati terdahulu Periode 2010-2015 Labuhanbatu yang telah berusia 65 tahun tersebut dipimpin dr H Tigor Panusunan Siregar yang juga mantan Direktur Rumah Sakit Umum Daerah (RSUD) Rantauprapat dua priode. Sepuluh bulan sudah Tigor jadi Bupati setelah berhasil mengalahkanpasanganlainnyayang notabene istri mantan bupati periode lalu. Namun begitu, amatan Waspada di sejumlah lokasi, sampah yang telah meresahkan dan mencemari lingkungan tidak juga tertangani dengan baik. Padahal,selainmemilikiprogram Rakyat Tidak Lapar, Rakyat Tidak Bodoh, Tigor juga menyisipkan agar Rakyat Tidak Sakit.

Janji-jani kampanye Pilkada Bupati Labuhanbatu tahun lalu, katanya, telah dilaksanakan dan sebagiannya masih dalam tahap pelaksanaan.Pergantiansejumlah pejabat sudah dijalankan termasukKepalaDinasPasardanKebersihan (Dispaskeb). Akan tetapi, lagi-lagi, sampah yang menambah buruk wajah kota dan sekitar Rantauprapat masih terlihat menggunung, terlebih di sekitar Jalan Lintas Sumatera (Jalinsum) atau Jalan H Adam Malik/By Pass Rantauprapat. Terlihat berbeda dengan menangani warung-warung tenda birudiruasjalanyangsama.,sikap tidak perduli dengan kelangsungan hidup para rakyatnya, petugas yang diturunkan atas perintah Tigor waktu lalu untuk melakukan penertiban dengan gamblangnya merubuhkan gubuk-gubuk yangtadinyadijadikan lokasi berjualan dalam mencari nafkah warga.

Tangisan sejumlah bocah tidakmenyurutkanniatpenguasa untukmenghentikanpetugasnya dalam aksi pembersihan warung yang dikatakan lokasi tempat maksiat tersebut, namun dr Tigor Panusunan Siregar selaku bupati lupa permasalahan sampah tidak kalahpentingnyauntukditangani demi menyelamatkan warga dari berbagaiviruspenyakitdanmeredakan keresahan dari sampah yang mengeluarkan aroma busuk. Jika melihat kondisi saat ini dengan yang lalu, nyaris tidak ada perbedaan sistem penanganan sampah secara maksimal yang memang sejak dahulu telah menjadipermasalahan,akibatnya timbul kebingungan dibenak masyarakat dalam membedakan antara keberadaan sampah denganpola/sistemperjalananroda pemerintahan yang dipimpin dr HTigor Panusunan Siregar, khususnyamemanjakanwargatanpa sampah.(c07)

Waspada/Riswan Rika

WALIKOTA Binjai HM Idaham didampingi Wakil Walikota Timbas Tarigan dan Ka Dinas Kependudukan dan Catpil Iswan, S.Sos melihat proses pembuatan KTP .

Agustus 2011 Pemko Binjai Mulai Layani e-KTP Gratis BINJAI (Waspada): Agustus 2011, Pemko Binjai membuka pelayanan e KTP atau pembuatan KTP (Kartu Tanda Penduduk) biometrik dan chip berbasis Nomor Induk Kependudukan (NIK) secara nasional. Pemerintah Pusat melalui Kemendagri sudah mempersiapkan sarana dan prasarana pembuatan e KTP dengan Permendagri No.9/ 2011 tentang pedoman penerbitan KTP berbasis NIK secara nasional dan Permendagri No.10 /2011 tentang penerbitan dokumen pendaftaran penduduk sebagai akibat perubahan alamat. Kepala Dinas Kependudukan dan Catatan Sipil Kota Binjai Iswan,S.Sos, Jumat ( 24/6) menjelaskan,pembuataneKTPmerupakantugas berat. Sehingga Iswan memprogramkan pelayanan pendataan pembuatan e KTP di Kota Binjai dimulai Agustus 2011 akan bekerja ekstra keras. “ Kami akan bekerja sampai pukul 18:00 wib Bahkan hari liburpun harus kerja,”ujarnya. Sebab tenggat waktu 100 hari dikejar untuk penyelesaian pendataan masyarakat wajib KTP di Kota Binjai. Dalam program e KTP secara nasional, Kota Binjai termasuk tahap pertama 2011 Kementerian Dalam Negeri yang menetapkan 197 Kabupaten/Kota di Indonesia menjadi prioritas. Tahunberikutnya300daerahtingkatIIlainnya. KTP berbasis NIK secara nasional disebut KTP Elektronik adalah KTP memiliki spesifikasi dan format KTP nasional dengan sistim pengamanan khusus. Berlaku sebagai identitas resmi yang diterbitkan oleh Dinas Kependudukan dan Pencatatan Sipil. KTP elektronik berisi biodata, pas photo, sidik jari telunjuk kiri dan kanan dan tandatangan penduduk. Pendataan ini tentu memerlukan

waktu, terutama sidik jari. Menurut Iswan di Binjai dari data selama ini ada sekitar 204.778 penduduk wajib KTP. KadisKependudukandanCatatanSipilIswan mengemukakan program e KTP di Kota Binjai secara gratis. Bahkan, wajib KTP di Kota Binjai saat pendataan gratis pelayanan angkutan ke lokasi pendataan di Kantor Kecamatan. Mobilisasi ini sangat penting agar warga tidak ketinggalan untuk mengisi pendataan. Sebab jika terlambat merugikan masyarakat sendiri. Pemberian e KTP gratis oleh pemerintah ditentukan jangka waktunya. Oleh sebab itu Iswan berjanji akan ektra kerasmemberikanpelayanankepadamasyarakat dan diharap masyarakat harus tanggap terhadap pelayanan,agar tidak merugi. ‘’e KTP untuk mewujudkantidakterjadinyaKTPganda.Garisan sidik jari merupakan kekuasaan Allah SWT yang tidak pernah ditemukan sama, itulah kelebihannya,”ujarnya. SehinggapenyerahaneKTPsetelahpengisian personalisasi.Identifikasiadalahprosespenentuan melalui pemadanan sidik jari. Jika nanti tak sesuai e KTP tidak akan diserahkan. Disebutkan Kota Binjai,pendataan dilakukan di lima kecamatan, data terakomodasi saat ini Kecamatan Binjai Utara 59.994 orang, Binjai Selatan 38.93, Binjai Timur 43.015, Binjai Barat 33.673 dan Binjai Kota 29.191 orang. Iswan menyebutkan, daerah hanya mengisi pendataan yang akan dikirimkan ke biro pendataan di Kemendagri di Jakarta untuk dicetak e KTPnya. E KTP dilengkapi Chip bermanfaat untuk pengamanan data dan berfungsi multiguna. Dengan chip dimaksud, ID card, ATM card, Accsess card relatif mudah terintegrasi dengan sistim lain.(a04)


Sumatera Utara

C4

Massa HNSI Demo DPRD Sibolga

Waspada/Zulfan Nasution

MASSA dari Himpunan Nelayan Seluruh Indonesia (HNSI) Kota Sibolga dan Tapanuli Tengah, Senin (27/6) berunjuk rasa ke DPRD Sibolga dan Tapteng mendapat pengawalan ketat dari polisi.

Solar Langka, Di Pasaran Black Market Rp1,5 Juta Per Drum TANJUNGTIRAM (Waspada) Sebagian besar nelayan di KualaTanjungtiram Batubara tak melaut karena harga BBM jenis solar di black-market (pasar gelap) Rp1,5 juta per drum “Haiyamacammanapegilaut halgasolarsatutengahjutasedlum. Dali ka laut elok felai tak pegi laut la”sebut Udin S salah seorang pengecer solar menirukan keluhan pengusaha nelayan keturunan di Tanjungtiram, Senin (27/6) Menurut Udin akibat sulitnya

solar kehidupan keluarga nelayan makinparahditambahbebansaat inianak-anakmerekaakanmasuk sekolah. Seperti hari ini nelayan jaring timbul hanya dapat 2 basket ikan gembung atau 50 kg dijual harga Rp17 ribu per kg, berarti pendapatanRp850ribu.Sedangkandua jerigen sola Rp525 ribu, dapat gaji Rp15 ribu dan ikan makan Solar mahal hasil tangkapan ikan merosot, terlihat di gudang/ tangkahan di sungai Batubara

Kanan dan Kiri, berjejer ratusan boat bertambat tak melaut. Sementara pembagian solar di SPDN maupun APMS di Bogak, Minggu (26/6) sempat ricuh diserbu pembeli terdiri nelayan bercampur spekulan. Nelayan mengusulkan untuk mendapatkan solar hak nelayan kecil minta ditertibkan dengan cara setiap alat tangkap memakai kartu mengam bil solar di SPDN, APMS dan SBPU.(a12)

Hari Pertama PSB:

Pendaftar SMKN 1 Airputih Membludak INDRAPURA (Waspada): Pendaftar pada hari pertama Penerimaan Siswa Baru (PSB) di SMK Negeri 1 Airputih Kab. Batubara di Desa Sukaraja, Senin (27/ 6),membludak,sehinggamelebihi daya tampung sekolah itu. LiputanWaspada, 300 lebih pelajar SMP/MTs dari berbagai kecamatan menyerbu SMK N 1 Airputihuntukmendaftarsebagai siswabaru.Merekaterlihatantrian panjang dengan tertib mengikuti proses pendaftaran. Beberapa siswa harus pulang lagi,karenaadaberkasyangbelum dilengkapi, khususnya surat kesehatan dari instansi berwenang. Rijal Amin, salah seorang petugas PSB mengatakan, jumlah pendaftar hari pertama 288 orang

untuk semua jurusan. Menurutnya, SMK ini akan menerima murid baru 216 orang untuk enam kelas. Masing-masing dua kelas Teknik Komputer Jaringan (TKJ) dan Rekayasa Perangkat Lunak (RPL) serta satu kelas untukTeknik Sepeda Motor (TSM) dan Teknik Kenderaan Ringan (TKR). Jumlah pendaftar di hari pertama tahun ini meningkat dibanding hari pertama tahun sebelumnya. Diperkirakan jumlah pendaftar akan mencapai angka 700-an. Tidak dipungut pembayaranapapundalampendaftaran ini, ujar Rizal. Keterangan yang Waspada peroleh, sistim seleksi siswa baru di sekolah ini berdasarkan pem-

bobotan nilai UN. Jadi tidak berdasarkannilaiUNsemata.Setelah pembobotan nilai UN, maka hasilnya diperingkat (rangking). Peringkattertinggisampaijumlah daya tampung, yang diterima di SMKN 1 Airputih ini. Liputan Waspada lainnya, pendaftar siswa baru hari pertama di SMA Negeri 1 Airputih Tanjungkubah Indrapura juga membludak. KepalaSMAN1AirputihIshak Liza menjawabWaspada mengatakan, jumlah pendaftar di hari pertama ini 248 orang. Daya tampung sekolah ini 272 untuk tujuh kelas. “Satu kelas di antaranya untuk kelas Sekolah Berstandar Nasional.(c04)

Petugas Keamanan Kantor Bupati Tangkap Dua Remaja KISARAN (Waspada): Petugas keamanan Kantor Bupati Asahan, melaporkan dan menyerahkan dua remaja ke Polres Asahan, karena tetangkap tangan mencuri perhiasan pagar. Sabtu (25/6) malam. Informasi dihimpun Waspada, dua remaja itu berumur 16 tahun, mereka sengaja mencuri perhiasan pagar Kantor Bupati, hanya untuk mendapatkan uang jajan. Namun, aksi itu diketahui petugas keamanan, sehingga salah seorang dari mereka ditangkap, sedangkan seorang lagi berhasil melarikan diri. Petugas keamanan itu langsung mencari alamat dua remaja itu, dan menemui orang tuanya, kemudianmenyerahkankePolres untuk melakukan proses hukum.

Tidak lama berselang, orang tua remaja yang melarikan diri, datang bersama putranya dan menyerahkannya. Kini kedua remaja itu mendekam dalam bui, sedangkan orang tua mereka tidak mampu berbuat banyak, dan menyerahkan masalah ini kepada pihak hukum. “Kami tergolong keluarga prasejahtera, sehingga anak saya melanggar hukum hanya untuk mendapatkan uang jajan.Walau pun kami miskin, namun anak saya baru pertama kali melakukan hal ini. Sehingga untuk mematuhi hukum, saya serahkan anak saya sama polisi,” kata salah satu orang tua tersangka, ditemui Waspada, Minggu (26/6) di Mapolres Asahan. Sedangkan salah satu remaja yang menjadi tersangka, menga-

kui tindakan mereka, dan hal itu disebabkan karena keterbatasan ekonomi keluarga. “Kami berdua tidak ada berniat mencuri, namun ketika melintas jalan Akasia Kisaran (Sebelah kantor Bupati Asahan) kami melihat besi perhiasan pagar berbetuk trisula, sehingga kami merusak kemudian mengambilnya, dan berniat menjualnya kepada tukang botot. ‘’Namun aksi itu gagal karena ketahuanpetugas,”ungkapremaja itu di balik trali besi, sambil mengatakan satu di antara mereka masih duduk di kelas II SMP dan seoarang lagi putus sekolah. Kapolres Asahan AKBP Marzuki MM dikomfirmasi melalui Kasubag Humas AKP R Berutu membenarkan. (a15)

Pak Presiden Tolong Berikan Kami Minyak... KELANGKAAN Bahan Bakar Minyak (BBM) yang terjadi dua minggu terakhir membuat masyarakat dari berbagai lapisan terutama pelaku transportasi pengangkutan barang dan jasa mengalami gangguan. Hingga kini, sulitnya memperoleh kebutuhan primer itu tak kunjung selesai, malah sebaliknya semakin menyengsarakan masyarakat. Kesengsaraan itu kini dirasakan masyarakat nelayan kecil di KotaTanjungbalai dan sekitarnya, seperti Baganasahan dan Sei Kepayang, Kab. Asahan yang umumnya membeli minyak (BBM) dari SPBU diTanjungbalai. Mereka terlihat terduduk lesu di rerumputan SPBU dengan sabar menunggu sejak dinihari hinggamalamdisejumlahStasiun Pengisian Bahan Bakar Umum (SPBU) dengan harapan dapat diperbolehkan membeli minyak walau hanya sejerigen. Ada kaum bapak, kaum ibu, kakek-kakek,nenek-nenek, gadis, remajabahkananak-anak,dalam kondisi lemas memandangi karyawanSPBUyangdikawalketat polisi memasukkan corong pompa solarnya ke mobil pribadi, bus, dan truk. Mereka bagaikan warga miskin Negara Ethopia tengah memandangi hidangan lezat di meja para pejabat, sementara merekahanyabisamenikmatinya melalui pandangan dan menelan air liur sendiri. Rakyat Indonesia yang tergolong pra sejahtera itu tidak tahu lagi ke mana harus mengadu na-

Waspada/Rasudin Sihotang

PULUHAN nelayan kecil rela menunggu di salah satu SPBU di Kota Tanjungbalai walau mereka tidak memiliki kepastian akan memperoleh barang langka itu. sib, yang mereka tahu ialah pejabat pemerintah dan anggota DPR mulai tingkat terendah sampai tertinggi yang seharusnya melayani segenap kebutuhan mereka, hanya duduk manis menikmati secangkir kopi dan selembar koran di ruang ber AC, bergoyang di balik meja kerjanya. Memangkasihanrakyatkecil, nasib mereka kerap terabaikan. Saat ini yang mereka kenal hanya sosok seorang memiliki pamor besar di Indonesia. “Pak SBY, tolong berikan kami minyak solar, kami butuh hidup, jangan siksa kami seperti ini,”ucapKurniaDadang,nelayan kecil asal Teluknibung sembari menenteng jerigen miliknya. Dia telah dua hari tidak mendapatkan BBM, dan selama dua hari itu pulalah dia antri di SPBU. Imay juga ingin mengungkapkan isi hatinya yang tidak

terbendung lagi dimana saat ini sampansuaminyatelahtertambat sejak tiga hari lalu karena tidak diperbolehkan membeli BBM dengan jerigen. “Pak SBY, katanya kita ini negara demokrasi, dari rakyat, oleh rakyat dan untuk rakyat, di mana semua itu, kami nelayan kecil juga butuh hidup,” teriak ibu paruh baya histeris itu disaksikan puluhan orang. Itulah sekelumit ungkapan hati rakyat Indonesia yang saat ini mengalami kesulitan mencari penghidupan ditambah lagi susahnya mendapatkan BBM yang nota bene digunakan untuk mencari ikan demi menyambung kehidupan keluarga. Mudah-mudahan Presiden RI SBY di Jakarta berkenan mendengarkan ungkapan hati rakyatnyayangtengahdilandakesulitan. Rasudin Sihotang

PANDAN (Waspada) : Massa dari Himpunan Nelayan Seluruh Indonesia (HNSI) Kota Sibolga dan Tapanuli Tengah, Senin (27/ 6)mendatangiKantorDPRDKota Sibolga dan Tapanuli Tengah. Massa yang membawa sejumlah poster meminta anggota DPRD Sibolga dan Tapteng agar tidak tinggal diammelihatkondisi masyarakat khususnya para nelayan tradisional di Kota Sibolga dan Tapteng yang semakin hari semakin tidak menentu kesejahteraannya terkait kelangkaan BBM solar ditambah tindakan spekulan yang semakin marak terjadi dan merajalela. Massajugamemintaanggota

legislatif yang duduk di DPRD Kota Sibolga dan Tapteng agar tidak mengumbar janji yang selama ini dinilai telah membuat masyarakat begitu resah terkait aspirasi warga massa disinyalir terabaikan tanpa alasan pasti. “Kami meminta anggota DPRD Sibolga dan Tapteng agar tidaktinggaldiammelihatkondisi masyarakat nelayan tradisional di Kota Sibolga dan Tapteng dengan adanya kelangkaan BBM solar ini,” tegas Samsuir Tanjung dan Herman selaku Koordinator aksi di Sibolga dan Pandan. Yazrul Nazara, selaku Wakil Ketua HNSI Kota Sibolga menyebutkan kelangkaan BBM solar

di Kota Sibolga dan Tap.Teng telah belangsung selama satu bulan,danmenurutYazrulNazara apabilahaltersebutterusberlanjut maka tingkat pengangguran dan kriminalakansemakinmeningkat, pasalnya mata pencaharian masyarakat di Kota Sibolga dan Tapteng pada umumnya adalah nelayan. Dalam menyikapi tuntutan massa, Jamaluddin Pohan selaku Wakil Ketua DPRD Tapteng menjelaskan, pihaknya secepat mungkin menggelar pertemuan denganpihakanggotaDPRDKota Sibolga guna membahas hal tersebut, dan pihaknya berjanji akan segera memanggil pihak Depot Pertamina. (a23)

WASPADA Selasa 28 Juni 2011

Gunakan Surat Palsu, Sekdes Sirambas Ditahan PANYABUNGAN (Waspada) : Diduga akibat membuat dan menggunakan surat palsu, Sekretaris Desa Sirambas, Kecamatan Panyabungan Barat, AW, 38, terpaksa mendekam dalam tahanan Polres Madina sejak 14 Juni lalu. “Ia diduga melanggar KUHP Pasal 263 ayat 1 dan 2 tentang membuat dan menggunakan surat palsu serta pasal 266 membuat surat asli tapi palsu (Aspal), dengan ancaman hukuman 7 tahun penjara,” kata Kapolres Madina AKBP Fauzi Dalimunthe melalui Kasat Reskrim AKP Sarluman Siregar, Minggu (26/6). Dijelaskan, berdasarkan pengaduan warga dan hasil penyelidikan polisi, AW yang telah diangkat jadi PNS dari Sekdes pengangkatan tahun 2011, telah membut surat palsu di tahun 2004 tentang surat pengangkatan dirinya menjadi sekdes. Padahal, saat itu status AW sebenarnya sebagai kepala desa yang diperkuat dengan pengakuan sekdes NH masa itu menjabat sekdes. NH sendiri dikabarkan menyetujui pembuatan surat keterangan dengan iming-iming mendapat imbalan puluhan juta dari AW. Tapi, karena AW setelah diangkat jadi PNS tidak menepati janjinya sesuai kesepakatan, akhirnya NH mengadukan Abdul Wahab ke Polres Madina. Kabarnya, untuk memuluskan rencana, AW akan memberikan uang Rp 40 juta kepada NH. Ditahannya Sekdes Sirambas AW menjadi pembicaraan hangat warga di desa itu. Sebagian warga menilai penahanannya wajar karena telah berani membuat surat palsu dan penipuan.(c14)


Aceh

WASPADA Selasa 28 Juni 2011

C5

Hampir Semua Drainase Tidak Berfungsi KUALASIMPANG (Waspada): Hampir semua diainase (saluran) pembuangan di Kota Kualasimpang, Kabupaten Aceh Tamiang tak berfungsi, sehingga jika turun hujan badan jalan menjadi banjir. Pantauan Waspada, sejumlah drainase yang tidak berfungsi antara lain di kawasan Simpang Empat Jln.Kualasimpang-Rantau yang menyebabkan air tumpah ke badan jalan sehingga kondisi badan jalan rusak berat ,sehingga sangat menyulitkan warga. “Memang Pemkab Aceh Tamiang sudah menimbun badan jalan yang rusak berat dengan batu krikil, tapi percuma karena sete-

lah dua hari badan jalan kembali rusak berat akibat digenangi air buangan dari warungwarung kopi akibat drainase tidak berfungsi,” ungkap Amat ,warga kota Kualasimpang. Selain itu, drainase dekat SMA Alwashliyah Kota Kualasimpang juga tak berfungsi, sehingga jika hujan badan jalan digenangi air setinggi 30 cm-50 cm. “Bagaimana kota ini tidak banjir jika turun hujan, drainase yang ada sudah tumpet dipenuhi tanah bercampur sampah, sehinggaselokantidakadalagi,” terangDanramil Kota Kualasimpang, Kapten Inf Syamsul Bahri ketikaditanyadisela-selamembersihkanselokan dirinya bersama anggotanya.(b24)

H. Jauhari Amin Terima Zakat Award Dari Baitul Mal LANGSA (Waspada): H. Jauhari Amin salah seorang pengusaha di Kota Langsa mendapat Zakat Award untuk kategori perorangan dari Baitul Mal Kota Langsa. Penyerahan penghargaan bagi warga yang paling banyak memberikan zakat melalui Baitul Mal itu, berlangsung di Aula Pemko Langsa, dalam acara laporan tahunan Baitul Mal Langsa. Ketua Baitul Mal Langsa Aidil Fan pada kesempatan tersebut mengungkapkan, pemberian zakat award merupakan agenda rutin yang dilakukan Baitul Mal Langsa setiap tahunnya setelah melalui berbagai Kriteria penilaian. Untuk kategori perorangan, Baitul Mal Langsa telah memilih H Jauhari Amin sebagai salah seorang peraih penghargaan Zakat Award ini, kata Aidil Fan. Diungkapkan Aidil Fan, pada 2010 zakat Infaq dan Sedekah yang berhasil dikumpulkan Baitul Mal Langsa berjumlah Rp1.809.086.614, denganrincianZakatRp1.331.755.094,danInfaq/ Sedekah sebesar Rp477.331.520 . Penerimaan zakat, infaq dan sedekah tahun 2010 mengalami

kenaikan lebih dari 20% dari tahun 2009 yang berjumlah Rp.1.512.367.170, kata Aidil. Meski dekimian, Aidil Fan juga mengatakan sampai saat ini masih ada beberapa SKPD dan Sekolah yang belum menyalurkan Zakat dan Infaq melalui Baitul Mal Kota Langsa dengan alasan yang bermacam-macam. Dalam hal ini Walikota Langsa dimohon untuk menegur pimpinan dari masing-masing unit tersebut diatas agar di masa yang akan datang dapat menyalurkan Zakat dan Infaq nya kepada Baitul Mal Kota Langsa, demikian Aidil Fan. Sementara itu H Jauhari Amin peraih Zakat Award kategori perorangan, mengungkapkan rasa terharu atas penghargaan yang diterimanya. Meski sudah dua tahun berturut-turut menerima penghargaan Zakat Award, namun H Jauhari yang merupakan seorang pengusaha muda sukses dan pengurus berbagai organisasi masyarakat itu, mengaku sudah kewajibannya mengeluarkan zakat melalui lembaga yang benar.(b22)

Yayasan Advokasi Rakyat Aceh Ancam Tuntut RS PMI Aceh Utara KOTA LHOKSEUMAWE (Waspada): Irsadi Ishak, Ketua Yayasan Advokasi Rakyat Aceh, mengatakan, pihaknya akan menuntut pihak RS Palang Merah Indonesia (PMI) Aceh Utara. Pasalnya, selama ini yayasan tersebut menerima ratusan aduan masyarakat tentang pelayanan buruk yang diberikan pihak rumah sakit tersebut kepada pasien. Kata Irsadi, Kamis (23/6) pukul 08.00 pagi, Hardiyani, 38, warga Gampong Keude Mane, Kecamatan Muara Batu, Aceh Utara datang ke RS tersebut untuk bersalin. Setelah satu jam di RS itu, pasien kejang-kejang. Saat kondisi ini dilaporkan, petugas medis meminta pasien bersabar karena tidak ada dokter. Kata petugas dokter baru masuk ke RS PMI pada sore hari. Selanjutnya, kondisi Hardiyani semakin memburuk. Kembali keluarga pasien meminta petugas untuk memanggil dokter, namun jawabannya tetap sama yakni dokter sedang di luar. Tidak ada upaya dan perlakuan istime-

wa yang didapatkan pasien dari RS itu. Padahal saat itu, pasien sedang melawan maut. “Kata petugas, dokter sedang di luar dan tidak bisa masuk. Dokter baru bisa masuk sore hari. Petugas juga tidak mampu memberikan alasan yang jelas kenapa dokter tidak bisa masuk, sementara pasien sedang kritis. Karena takut akan terjadi hal-hal yang tidak diinginkan, akhirnya pasien kita rujuk ke RS Materna di Cunda, Kec, Muara Dua,” kata Irsadi Ishak. Menurut Irsadi Ishak, pengelolaan RS itu dilakukan secara tidak profesional. Untuk itu, Yayasan Advokasi Masyarakat Aceh meminta Pemda Aceh Utara untuk segera menutup RS tersebut. Karena selama ini telah ratusan pasien mengadu kepada pihaknya dan bahkan Pemda Aceh Utara mengetahui hal tersebut, namun seperti dibiarkan. Kepala RS PMI Aceh Utara yang dihubungi Waspada via telepon, tidak berhasil meskipun telah dicoba beberapa kali.(cmun)

Mulianya Aceh Karena Peran Ulama BIREUEN (Waspada): Gubernur Aceh Irwandi Yusuf mengatakan, mulianya Aceh selama ini karena peran ulama. Karena ulama memiliki peran penting dalam memuliakan Aceh. Maka antara ulama dengan Aceh bagian yang tidak dapat dipisahkan. “Tidak ada kemuliaan Aceh jika tidak ada ulama, karena itu seluruh lembaga pendidikan agama yang ada di Aceh, dayah-dayah dan pesantren supaya terus bekerja keras agar kader ulama di Aceh jangan putus,” katanya pada pembukaan Muktamar IX dan peringatan UltahYayasan Pendidikan Islam Darussa’adah ke 43 di pesantren Darussa’adah komplek Masjid Multazam, Cot Puuk Gandapura, Bireuen, kemarin,dihadiriratusansantri,pimpinandayah Darussa’adah se Aceh, Muspida dan pihak Muspika Kec. Gandapura serta undangan. Dia mengaskan, kejayaan Aceh jangan terputus dan dapat diraih kembali sebagaimana masa kejayaan Sultan Iskandar Muda. “Keberadaan Dayah Darussa’adah dan dayahdayah lainnya di Aceh senantiasa mendapat

perhatian utama dari pemerintah Aceh,” ujarnya. Di Aceh sudah terbentuk Badan Dayah yang senantiasa memberi perhatian untuk pengembangan dayah. Muktamar IX dan Ultah ke 43 Darussadah merupakan langkah konsolidasi dan penguatan internal lembaga yang dapat juga disebut langkah peningkatan kaderisasi ulama. Bupati Bireuen, Nurdin Abdul Rahman, mengharapkan dengan Muktamar diharapkan dayah dapat berperan lebih besar lagi, terutama dalam membina masyarakat, mendidik kader bangsa dan membangun kebersamaan. SekjenYPI Tgk Muhammad Siddiq Armia mengatakan, YPI sangat mendukung program-program percepatan pembangunan yang dijalankan pemerintah Aceh, terutama sektor pendidikan, pengiriman pelajar Aceh ke luar negeri khususnya ke negara-negara maju yang merupakan terobosan mengagumkan. (amh)

Waspada/Muhammad Hanafiah

DANRAMIL Kota Kualasimpang, Kapten Inf Syamsul Bahri bersama anggotanya sedang membersihkan selokan di Jl. A.Yani Kota Kualasimpang yang tertutup tanah dan sampah,sehingga air tidak bisa lagi mengalir akibat drainase yang ada tidak berfungsi.

15 Ribu Petani Padi Makmur Kesulitan Air MAKMUR, Bireun (Waspada): Muhammad, Ketua Asosiasi Geusyik Makmur, Kab. Bireuen, kepada Ir. Muhammad Azhari, SH. MH, anggota KomisiVI DPR RI mengadukan, 15 ribu petani di Kecamatan Makmur kesulitan air untuk bercocok tanam, akibatnya, para petani sering mengalami gagal panen. Agar petani tidak mengalami gagal panen di masa mendatang, Muhammad meminta Pemerintah Aceh melalui anggota DPR-RI untuk segera membangun saluran irigasi yang panjangnya kurang lebih delapan kilo meter. Sumber air dapat diambil dariKrueng Sawang, Aceh Utara. Akibat tidak ada saluran

irigasi dan saluran pembuang, pada musim penghujan, padipadi petani terendam banjir. “Gagal panen bukan hanya terjadi pada musim kemarau, tapi juga di musim penghujan. Kondisi ini membuat petani padi jauh dari kemakmuran. Padahal Kecamatan kita bernama Makmur,” kata Muhammad yang sisambut tawa masyarakat lainnya. Selain gagal panen, warga Kecamatan Makmur juga kesulitan untuk melintasi jalan kecamatan yang tembus ke Jalan Medan-Banda Aceh. Kondisi jalan di kecamatan itu cukup parah, selain berlubang juga berlumpur. Kondisi ini telah terjadi puluhan tahun. Panjang

jalan diperkirakan delapan kilometer. Akibat kondisi jalan seperti itu, pelajar dan mahasiswa sering terlambat ke sekolah. Persoalan lainnya, para geusyik di Kecmatan Makmur setiap bulan hanya memperoleh jerih Rp500 ribu. Jerih tersebut tidak sebanding dengan beban tugas yang diemban. “Persoalan yang kami alami sudah komplit. Semoga hal ini dapat diselesaikan oleh wakil kami yang ada di DPR-RI, agar kita semua benar-benar makmur,” kata Muhammad. Ir. Muhammad Azhari, SH,MH, anggota KomisiVI DPR RI mengatakan, khusus untuk jerih geusyik dia tidak boleh mencampur tangan, karena itu

MA Diminta Adil Dalam Kasus Tanah Di Cempedak PANTONLABU, Aceh Utara (Waspada): Mahkamah Agung diminta memberi putusan teradil untuk permohonan pemeriksaan tingkat kasasi atas putusan Pengadilan Tinggi Banda Aceh Nomor 42/Pdt/2010/ PTBNA terkait kasus sengketa tanah di Desa Cempedak, Tanah Jambo Aye, Aceh Utara, antara M Jafar Tgk H M Kasem dkk melawan Hamidah dkk. “Berdasarkan surat dari MA Kasasi itu sudah terdaftar dengan nomor register 234/pdt/ 2011 tertanggal 21 Juli 2011. Harapan kami selaku tergugat, MA memberikan putusan seadiladilnya, sesuai peraturan dan perundang-undangan yang berlaku,”harap M Jafar di Pantonlabu, Jumat (24/6).

Menurut Jafar, tanah dengan luas sekitar 20x18 meter itu berada persis di belakang pertokoan kawasan SPBU Panteubreuh Pantonlabu. Tanah itu warisan turun temurun dari ayahnya Tgk H M Kasem dan kakek buyutnya Tgk H Cek. Selama ini, tanah dimaksud memang dalam penguasaan M Jafar. “Pertengahan 2009, Hamidah dkk mengklaim tanah itu milik suaminya Alm Lidin dan keluarga kami digugat ke Pengadilan Negeri (PN) Lhoksukon. Tepat 21 Desember 2009, PN Lhoksukon memenangkan pihak Penggugat dan kami melakukan banding ke Pengadilan Tinggi (PT) Banda Aceh. Hasilnya, PT Banda Aceh juga memenangkan Penggugat, melalui

putusan tanggal 18 Agustus 2010,” kata M. Jafar. Sebagai masyarakat biasa yang awam soal proses peradilan, M Jafar mengaku tak berani memvonis Majelis Hakim PN Lhoksukon dan PT Banda Aceh, tidak adil.Tapi yang pasti, ia melihatadakejanggalanbesar,dimana Hamidah dkk mengaku membeli tanah itu dari pihak lain, yakni NyakYah dan Nyak Neubeut, sementaraNyakYahdanNyakNeubeut sendiri memastikan tidak pernah menjual tanah itu kepada Lidin atau Hamidah dkk. “Kami punya surat pernyataan dari Nyak Yah yang menegaskan dia tidak pernah menjual tanah itu ke keluarga almarhum Lidin atau Hamidah dkk.,” tandas M. Jafar.(cmus)

Pembangunan Transmigrasi Harus Berbasis Kawasan

Waspada/Nurkarim Nehe

STAF Pengajar Lembaga Pers Dr.Sutomo Warief Djajanto Basorie, Senin (27/6), secara simbolis menandatangani Buku Saku Wartawan untuk Koresponden Khairul Akhyar dari Kabupaten Bener Meriah Aceh, pertanda dimulainya Pelatihan Liputan Komprehensif yang diikuti 20 wartawan Waspada sampai tanggal 9 Juli.

Waspada Mencetak Sejarah MEDAN (Waspada): Suratkabar Harian Umum Nasional Waspada tidak sekedar meliput berita tetapi mencetak sejarah. “Waspada lahir dari rahim Revolusi, 11 Januari 1947, saat Kota Medan masih dikuasai asing. Sampai Belanda mengakui kedaulatan Indonesia, Waspada tercatat enam kali dibreidel Belanda,”ujar Warief Djajanto Basorie mengawali Pelatihan Liputan Komprehensif bagi 20 wartawan Waspada, di Bumi Warta Medan, Senin (27/6) sampai tanggal 9 Juli. Warief mengaku mendapat kehormatan diberi kepercayaan meningkatkan kualitas wartawanWaspada,karenamediacetaknasional yang memiliki kelas tersendiri ini harus terjaga kualitasnya, termasuk kinerja wartawannya. Sedangkan H.Sofyan Harahap Wapenjab Waspada dalam pengantar menegaskan, Pimpinan Waspada sangat antusias terhadap

program Pelatihan Liputan Komprehensif untuk penyegaran kualitas SDM wartawan sebagai salah satu unsur penting dalam media, memiliki daya saing dalam era teknologi modern dunia jurnalistik serta mampu eksklusif menampilkan karya di Waspada. Untuk kesempatan pertama, 20 wartawan Waspada yang mengikuti Pelatihan Liputan Komprehensif terdiri H.Abdullah Dadeh, Sahrizal, Siti Anum Purba, Zulkifli Darwis, Rustam Effendi, Sulaiman Hamzah, Mursal Alfa Iswara, Ismanto Ismail, M.Ferdinan Sembiring, Dedi Riono, Ayu Kusuma Ningtyas, Maini Anggita (Medan), Ahmad Cerem Meha Padangsisimpuan), Hotma Darwis Pasaribu (Deliserdang) Nurkarim Nehe, Rahmad Fansur Siregar, Rasudin Sihotang (Sumut), Khairul Akhyar, Munawardi Sulaiman dan Jaka Rasyid (Aceh). (a10)

REDELONG (Waspada): Pembangunan dan pengembangan kawasan transmigrasi diharapkan dapat menjadi tulang punggung dan motor penggerak pembangunan koridor ekonomi wilayah Aceh, sekaligus sebagai jawaban untuk membangun wilayah Aceh paska konflik. Demikian pernyataan yang disampaikan Dirjen Pembinaan Pengembangan Kawasan Transmigrasi (P2KTrans) Harry Hariawan Saleh, pada konferensi pers di Pendopo Bupati usai mengunjungi kawasan transmigrasi di Kabupaten Bener Meriah, Sabtu (25/6) sekira pukul 18:00 Dirjen P2KTrans menambahkan, pembangunan transmigrasi di Provinsi Aceh harus berbasis kawasan, yang nantinya diarahkan pada terbentuknya pusat-pusat pertumbuhan ekonomi baru atau mendukung pusat-pusat pertumbuhan yang sudah ada atau yang sedang berkembang. “Pembangunan kawasan transmigrasi harus mengacu pada Rencana Tata Ruang Provinsi dan Rencana Tata Ruang Kabupaten/Kota di Aceh. Pembangunan kawasan transmi-

grasi merupakan program Pemerintah Kabupaten yang didukung dan difasilitasi instansi lintas sektor pusat dan provinsi sesuai tugas dan kewenangannya,” jelas Harry Hariawan Saleh. Lanjutnya, rencana pembangunan dan pengembangan Aceh diarahkan pada bidang agribisnis yang dititik beratkan pada bidang pertanian, tanaman pangan untuk ketahanan dan swasembada pangan, dibidang perkebunan seperti kopi, karet, kelapa sawit dan nilam. Dibidang perikanan di sepanjang pantai barat dan timur, sementara untuk bidang peternakan yaitu penggemukan sapi dan industri susu di daerah pegunungan. “Pelaksanaan pembangunan transmigrasi di harapkan dapat menciptakan peningkatan dan percepatan pemerataan kesejahteraan masyarakat transmigrasi serta masyarakat yang bermukim di sekitar kawasan transmigrasi,” ujar Harry. Untuk pelaksanaan transmigrasi akan diprioritaskan untuk meningkatkan pemanfaatan areal pertanian di Provinsi Aceh, seluas 700.000 hektare yang didukung jaringan iri-

gasi teknis seluas 191.000 hektar, sehingga produksi padi diharapkan dapat ditingkatkan menjadi 2-3 kali panen/tahun yang selama ini telah mencapai sekitar delapan ton per hektar pertahunnya. “Peningkatan produksi sektor pertanian ini sekaligus sebagai upaya restorasi kebunkebun rakyat yang terlantar dampak konflik yang berkepanjangan sebelum deklarasi damai Helsinki,” ungkap Dirjen P2KTrans ini. Untuk mendukung pengembangan kawasan transmigrasi, kata Harry, pemerintah sepakat menggandeng keberadaan investor swasta untuk mendukung pembangunan perkebunan tebu dan pabrik gula. Saat ini tengah tahap studi kelayakan pembangunan perkebunan tebu dan pabrik gula. “Tahap awal, akan dibangun perkebunan tebu seluas 17.000 Ha di daerah Pintu Rime Gayo dan Timbang Gajah. Tahap kedua akan dibangun perkebunan tebu seluas 20.000 Ha dan satu pabrik pengolahan tebu di Kecamatan Syiah Utama Kabupaten Bener Meriah,” tambah Dirjen P2KTrans.(cih)

wewenang pemerintah provinsi dan Pemda masing-masing. Namun khusus untuk sarana irigasi dan jalan, dia memerintahkan setiap anggota dewan di Kabupaten Bireun yang berasal dari Partai Demokrat untuk menyisihkan dana aspirasi masing-masing. Kata dia, jumlah dana yang masuk ke Aceh cukup banyak mencapai Rp100 triliun. Seharusnya, tidak ada jalan yang berlubang dan tidak ada kecama-

tan yang tidak memiliki sarana irigasi. “Dana yang masuk ke Aceh mencapai Rp100 triliun. Jumlah ini cukup banyak, mampu mensejahterakan masyarakat yang tinggal di bumi Iskandar Muda ini. Saya tidak tahu, kenapa bisa terjadi seperti ini. Begitu pun, kepada anggota dewan Bireunyang berasal dari Partai Demokrat, tolong sisihkan dana aspirasi untuk dua kebutuhan tersebut,” pinta Ir. M. Azhari.(cmun)

Ikuti Pengajian, Sepedamotor Kades Hilang IDI (Waspada): Saat mengikuti pengajian rutin Jumat (24/ 6) malam, sekira pukul 20:30, sepedamotor jenis Yamaha Meo Soul milik Geuchik Keude Bagok, Kecamatan Nurussalam, berhasil diangkut maling yang diparkir persis di halaman meunasah (surau—red). Menurut keterangan, sepedamotor yang masih mentah berwarna merah itu diparkir persis di tangga meunasah. Tak disangka dua maling yang tidak dikenal diperkirakan langsung menghampiri sepmor yang menjadi targetnya dan dilarikan setelah dihidupkannya dengan menggunakan kunci rahasianya. Beberapa warga yang sempat melihatnya sempat mengejar, namun dua maling yang diduga sudah profesional itu berhasil kabur ke arah Idi Rayeuk (timur). “Saya tidak menduga sepmor yang terpakir dengan kunci setang ditangga meunasah berhasil dilarikan maling,” ujar Abdullah, Kades Keude Bagok seraya menambahkan, biasanya setiap Jumat malam sepmornya diparkir disana, tapi baru kali ini sang maling berhasil membawa kabur sepmor yang baru beberapa bulan dipakainya. Sementara itu, Kapolres Aceh Timur, AKBP Drs Ridwan Usman melalui Kapolsek Nurussalam, AKP Arniman Yusuf, saat dimintai keterangan, Minggu (26/6) membenarkan adanya kemalingan di wilayah hukumnya. “Kita langsung langsung melakukan pengejaran hingga ke pedalaman Idi Cut, tapi kedua maling berhasil kabur,” tandas Arniman. (cmad)

Satu Rumah Terbakar Di Gayo Lues BLANGKEJEREN (Waspada): Satu rumah milik Maad Aman Rus, 50, penduduk Desa Palok, Kecamatan Blangkejeren Kabupaten Gayo Lues dilalap si jago merah, Sabtu (25/7) sekira pukul 19:30. Menurut Keterangan warga, kebakaran diduga akibat kelalaian pemilik rumah yang mempunyai kios bensin. Pemilik rumah diduga akan mengambil bensin bersama seorang warga lainnya untuk keperluan menghidupkan mesin genset yang di pergunakan untuk kenduri disalah satu rumah warga, karena saat itu listrik dari Kota Blangkejeren mengalami pemadaman total di Desa Palok. Pantauan di lokasi kebakaran, ratusan warga berusaha memadamkan api, namun akibat angin yang cukup kencang api dengan cepat melalap rumah yang berkonstruksi kayu tersebut. Sementara 3 Unit Mobil Pemadam Kebakaran milik Pemkab Gayo Lues yang sampai di lokasi setengah jam setelah kebakaran segera memadamkan kobaran api, namun keadaan rumah tersebut sudah tinggal puing. Kerugian diperkirakan puluhan juta rupiah, dan seorang warga menderita luka ringan di kepala, sementara pemilik rumah dibantu warga berhasil menyelamatkan diri.(b35)

Waspada/Bustanuddin

SEJUMLAH warga Desa Palok, Kecamatan Blangkejeren, Gayo Lues, Minggu (26/6) membantu mengangkat sisa barang dari puingpuing rumah milik Ma’ad Aman Rus yang terbakar Sabtu malam sekira pukul 19.30 wib.


Aceh

C6

WASPADA Selasa 28 Juni 2011

Polres Abdya Bekuk Pengedar Sabu-sabu

Lagi, Beco Dibakar Di Pidie SIGLI (Waspada): Aksi pembakaran alat berat Escavator (Beko-red) milik perusahaan yang mengerjakan proyek pemasangan batu di mulut Kuala (Muara-red) Gigieng, Kecamatan Simpang Tiga, Kabupaten Pidie kembali berlanjut, Minggu (26/6) sekira pukul 20:30 Wib. Tahun lalu, Jumat (27/8) 2010, aksi serupa juga pernah terjadi di lokasi yang sama. Kala itu sebanyak dua unit Beko yang mengerjakan proyek sama juga dibakar, diduga dilakukan oleh lima pria yang sampai sekarang ini belum terindentifikasi. Kapolres Pidie AKBP Dumadi, SSTmk melalui Kasat Reskrim AKP Supriadi di dampingi Kapolsek Simpang Tiga Iptu Ikmal kepada Waspada, Senin (276) membenarkan telah terjadi peristiwa pembakaran satu unit alat berat jenis escavator (beko-red) yang sedang mengerjakan pembangunan mulut Muara Gigieng. Kejadian itu, sebut Supriadi terjadi, Minggu (26/6) sekira pukul 20: 30Wib. Namun sampai kini katanya, pihak korban belum melaporkan peristiwa tersebut secara resmi kepada polisi. “ Kita sudah datang ke lokasi kejadian terbakarnya beko tersebut di Muara Gigieng atas laporan warga. Tetapi pihak korban atau pemilik beko tersebut belum melaporkan secara resmi peristiwa itu,” kata Supriadi yang dibenarkan Kapolsek Simpang Tiga, Iptu Ikmal. Menurut Ikmal, setelah mendapat laporan dari masyarakat, pihaknya langsung menuju Tempat Kejadian Perkara (TKP). Di lokasi kejadian pihaknya menemukan satu unit beko sudah dibakar pada bagian operator. Hampir seluruh bagian dalam mobil tersebut ludes terbakar. “ Kita belum mengetahui berapa kerugian yang diderita, mungkin nanti jumlah kerugian itu akan dihitung oleh tim ahli” kata Ikmal. Pasca peristiwa tersebut, polisi sudah memeriksa seorang saksi yang bertindak sebagai penjaga alat berat tersebut. Dari keterangan saksi tersebut diungkapkan, pelaku diduga beberapa orang dan sebelum melakukan aksinyasempat mengancam menghabisi saksi. Karena takut lalu saksi menjauh dari pelaku. Tidak lama berselang, lalu escavator atau beko terbakar. (b20)

Pustaka Aceh Utara Di Bawah Standar LHOKSEUMAWE (Waspada): Perpustakaan Umum Kabupaten Aceh Utara masih kurang memadai dan masih belum memenuhi syarat, buku-buku masih kurang dan ruangannya yang sempit. “Hal ini membuat pengunjung yang setiap harinya mencapai ratusan tidak nyaman. Sedangkan buku-buku yang banyak diinginkan konsumen yaitu seperti Buku sejarah Birokarasi dan dan umum,” ungkap Kepala Perpustakaan, Drs. Jufri A. Gani di Lhokseumawe, kemarin Lambannya perhatian dari pemerintah membuat kondisi Perpustakaan belum memenuhi syarat dan masih kalah dengan daerah lain, padahal perpustakaan adalah kebutuhan penting bagi peningkatan minat baca dan mencerdaskan manusia yang tidak bisa diremehkan lagi dalam keadaan sekarang. “Kondisi ini sangat memperihatinkan karena yang jadi konsumen bukan hanya penduduk setempat, tapi juga dari luar daerah. Kebanyakan pelajar mahasiswa dari Universitas Malikussaleh Aceh Utara dan mereka yang kuliah di Politeknik Negeri Lhokseumawe yang sering ke perpustakaan ini,” ujarnya Jufri. Terkait dengan hal tersebut, Jufri berharap pemerintah lebih memerhatikan pembangunan perpustakaan di Lhoksukon, Aceh Utara Untuk, supaya mempercepat proses pembangunannya agar tidak menjadi bangunan terlantar.(b12)

Pemkab Takut Tertibkan Kios Di Aceh Tamiang KUALASIMPANG (Waspada): Pemkab Aceh Tamiang terkesan takut untuk membongkar kios yang menjual buah-buahan di tengah kota Kualasimpang yang disebutsebut dibacking oknum anggota DPRK Aceh Tamiang. Hal itu terlihat pada kegiatan gotong royong massal pembersihan dan penertiban kota Kualasimpang dan seputaran Karang Baru, menjelang pelaksanaan Musabaqah Tilawatil Qur’an (MTQ) XXX Aceh, 3-10 Juli mendatang. Pada gotong-royong massal di Kota Kualasimpang hadir Bupati Aceh Tamiang, Drs. H. Abdul Latief, Wakil Bupati Aceh Tamiang, H. Awaluddin, Sekda Aceh Tamiang, H. Syaiful Bahri, SH, sejumlah Kadis di lingkungan Pemkab Aceh Tamiang, Kapolres Aceh Tamiang, AKBP Drs. Armia Fahmi, Waka Polres, Kompol A. Azas Siagian dan lainnya. Ketika kegiatan berlangsung, aparat Satlantas dan petugas Dinas Perhubungan Kab. Aceh Tamiang memblokir badan Jl. Cut Nyak Dhien menuju Pasar Pagi dan menuju Jl. A. Yani Kota Kualasimpang. Sedangkan kios yang menjual buah-buahan di samping toko jam Garuda tak ada seorang pun berani membersihkan, seperti aparat Satpol PP dan pejabat lainnya terkesan takut karena disebut-sebut ‘dibacking’ oknum anggota DPRK Aceh Tamiang, Hamdani. Wakil Bupati Aceh Tamiang, H. Awaluddin dan Sekdakab Aceh Tamiang, H. Syaiful Bahri, SH ketika ditanya menyatakan Hamdani sudah berjanji membongkar kios tersebut. “Nanti kios itu akan dibongkarnya dari lokasi, tapi Hamdani tidak menyebutkan tanggal berapa. Dia hanya janji,” ungkap Sekdakab didampingi Kapolres AKBP Drs Armia Fahmi dan pejabat lainnya. Warga di daerah itu menyatakan, seharusnya sebagai anggota DPRK memberi contoh yang baik dan tidak mendirikan kios di lokasi.(b24)

Waspada/Muhammad Hanafiah

Tampak kios buah-buahan yang diduga dibacking oleh oknum anggota DPRK Aceh Tamiang tampak tetap amanaman saja dan belum ada seorangpun pihak terkait yang berani membersihkan kios ini dari tengah kota Kualasimpang.

Penerbangan Di Bandara SIM Banda Aceh Tiba (flight, asal, waktu) Garuda Indonesia

Berangkat (flight, tujuan, waktu)

GA 146 Jakarta/Medan

15:45

GA 147 Medan/Jakarta

16:20

Y6 537 Medan

19:15

Y6 538 Medan

07:30

JT 304 Jakarta JT 396 Jakarta/Medan

11:35 20:00

JT 397 Medan/Jakarta JT 307 Jakarta

06:40 12:15

SJ 010 Jakarta/Medan

12:55

SJ 011 Medan/Jakarta

13:25

AK 305 Kuala Lumpur *

12:20

AK 306 Kuala Lumpur*

12:45

FY 3401 Penang **

14:10

FY3400 Penang **

14:30

Batavia Air Lion Air

Sriwijaya Air Air Asia Fire Fly

* Setiap Senin, Rabu , Jumat dan Minggu. ** Setiap Selasa, Kamis dan Minggu.

BLANGPIDIE (Waspada): Satuan Narkoba Polres Aceh Barat Daya (Abdya) Sabtu (25/6) malam sekira pukul 23:30 berhasil membekuk dua pelaku pengedar Narkoba jenis sabu-sabu di kawasan jalan Guhang, Kec. Blangpidie, Kab. Aceh Barat Daya. Kedua tersangka pengedar sabu-sabu yang berhasil ditangkap masing-masing, JN, 38, warga Meudang Ara, Kec. Blangpidie, dan IB,33, warga Seunaloh, kecamatan yang sama. Keduanya ditangkap di kawasan jalan ketika menuju kota Blangpidie dengan menggunakan sepeda motor Satria FU. “Penangkapan kedua tersangka pengedar sabu-sabu berawal dari laporan masyarakat setelah kita kembangkan pada malam itu juga personel yang terdiri dari enam orang berhasil menangkap kedua pelaku berikut barang bukti di kawasan jalan Guhang,” papar Kapolres Abdya, AKBP Drs Subakti melalui Kasat Narkoba, Ipda T Zia Fahlevie, kepada Waspada Senin (27/6). Selain menangkap tersangka dan mengamankan barang bukti seberat 5,1 gram sabu-sabu, pihaknya juga berhasil mengamankan dua unit pipa alat pengisap sabu-sabu disaku baju tersangka tersebut. “Saat penyergapan BB-nya sempat dibuang ke selokan di pinggir jalan, sedangkan selang yang diduga alat pengisap berada di saku baju salah seorang pelaku,” papar Ipda T Zia Fahlevie. Diamensinyalirkeduatersangkayangberhasilditangkapituadalah pengedar sabu-sabu yang selama ini beroperasi di Abdya. Sedangkan barangnya menurut informasi yang diterima pihaknya dipasok dari luar daerah. “Jaringannya masih dalam tahap pengembangan, berat dugaan jaringan mereka berada di luar Abdya,” ungkapnya. (sdp)

Tabligh Akbar Mubaligh Waloni Malam Ini WaspadaMuhammad Riza

KAPOLSEK Simpang Tiga Iptu Ikmal terlihat memperhatikan escavator (beko-red) yang dibakar orang tidak dikenal (OTK) di Kuala Gigieng (Muara-red) Kecamatan Simpang Tiga, Pidie, Minggu (26/6).

Pemilukada Tidak Bypass KIP Langsa Latih PPS LANGSA (Waspada): Komisi Independen Pemilihan (KIP) Kota Langsa kian menunjukkan intensitas dengan berbagai aktivitas pelaksanaan tahapan. Tak ayal 200an Panitia Pemungutan Puara (PPS) di tingkat gampong dan para Ketua Panitia Pemilihan Kecamatan (PPK) diberikan pelatihan dan Bimbingan Teknis (Bimtek), Senin (27/6). Pelatihan dan Bimtek ini merupakan pemrosesan pelaksanaan dari tahapan-tahapan

Pemilukada Aceh yang tidak boleh terjadinya bypass (jalan pintas—red). “Pemilukada Aceh tidak boleh terjadinya bypass, karena semua tahapan dalam setiap pelaksanaannya harus melewati proses dan mekanisme dengan tetap mengacu kepada peraturan dan perundang-undangan yang ada,” seru Ketua KIP Kota Langsa Agusni AH,. Dalam sambutannya pada pembukaan Latihan dan Bimtek yang dipusatkan di Aula SMKK Negeri Langsa, Agusni AH mengatakan, penyelenggaraan Pemilukada Aceh tahun 2011 ini dibayangi dengan waktu yang sudah mepet. “Namun, bukan sesuatu yang tergesa-

Wagub Kukuhkan Pusat Penguatan Dan Penyelamatan Umat BANDA ACEH (Waspada): Dalam merespon keadaan Aceh yang semakin dinamis, Wagub Aceh Muhammad Nazar menyatakan semua ini harus ditangani secara sistematis dan berkelanjutan, bukan dengan cara reaksioner dan kepentingan politik jangka pendek. Penanganan secara sistematis dan berkelanjutan tersebut, menurut wagub, termasuk dalam hal memberikan respon dan menangani masalah penyesatan maupun upaya-upaya pemurtadan. “Semua langkah harus dilakukan terencana dan oleh semua pihak,” katanya. Pernyataan tersebut disampaikan Wagub Aceh Muhammad Nazar ketika memberikan sambutan pada acara pengukuhan Pusat Penguatan dan Penyelamatan Umat (P3U) di kompleks Dayah Al Islah Al Aziziah, Lueng Bata, Banda Aceh, Sabtu (25/6) malam. P3U dibentuk untuk memberikan respon sistimatis dan berkelanjutan terhadap kondisi umat Islam di Aceh yang berkualitas rendah serta berbagai upaya penyesatan dan pemurtadan. Muhammad Nazar sendiri termasuk sebagai pendiri dan perintis P3U tersebut, sekaligus didaulat menjadi Ketua Dewan Pembina. Kata Nazar, di antara langkah-langkah yang perlu dilaku-

kan adalah, semua pihak harus meningkatkan peran serta tanggungjawabnya sesuai dengan porsi masing-masing, tetapi saling terikat dan terpadu. Selain itu, pendidikan agama harus masuk ke seluruh lini sosial dan tidak boleh puas dengan kurikulum agama yang ada di sekolah maupun perguruan tinggi. Demikian juga dengan pemberlakuan mazhab ahlussunnah wal jamaah, juga perlu diqanunkan untuk mempermudah pengendalian umat dari penyimpangan. Dalam kegiatan deklarasi dan pengukuhan P3U tersebut juga turut dihadirkan Dr. MuhammadYahyaWaloni, mantan pendeta di Papua yang telah memeluk Islam serta aktif menjadi da’i di berbagai daerah di Indonesia. Dalam ceramahnya, Ustadz Muhammad Yahya Waloni mengakui bahwa persoalan penyimpangan agama selalu terjadi, apalagi ada agama yang membenarkan pemaksaan konversi agama lain ke dalam agama mereka. Sedangkan agama Islam, sebut Yahya, memiliki doktrin yang sangat humanis, yaitu tidak boleh ada paksaan dalam memasukkan agama kepada orang yang beda agama. Tapi Islam dapat diyakini dan dipeluk berdasarkan kesadaran sendiri serta hidayah dari Allah. (b07)

gesa sehingga menjadi alasan bagi segenap penyelenggara mengalami ketertinggalan dan kelalaian dalam melaksanakan tugasnya,” tegas Ketua PWI Aceh Timur, itu. Disebutkan, ketergesagesaan dalam melaksanakan setiap tahapan Pemilukada ini menjadi suatu hal paling “diharamkan.” “Begitupun, kelalaian dari setiap tahapan yang seyogyanya dikerjakan berdasarkan aturan dan perundang-undangan menjadi sesuatu paling dibenci sehingga dapat menimbulkan konsekuensi hukum dikemudian hari,” cetus Agusni AH lagi. Lebih lanjut dia mengisbatkan, konsekuensi hukum atas kesalahan-kesalahan yang dilakukan pihak penyelenggara mengahruskan semua yang terlibat di dalamnya agar bekerja sungguh-sungguh. “Kesungguhan dalam mengikuti pelatihan dan Bimtek ini merupakan langkah maju akan hasil

Pemilukada Kota Langsa khususnya dan Aceh umumnya yang bermartabat nantinya,” tukas wartawan itu Dalam kesempatan tersebut, Agusni AH menandaskan, sedikitnya dalam pelatihan ini ada tiga ikhwal mendasar yang meliputi tugas dan fungsi pokok yang harus dimengerti penyelenggara, proses pemutakhiran data pemilihdan verifikasi faktual calon perseorang. Setelah pembukaan acara pelatihan dan Bimtek dilanjutkan pengisian materi-materi tentang pelaksanaan Pemilukada secara konkrit, masingmasing komisioner KIP Kota Langsa mengetengahkan “Tata Cara Pemutakhiran Data Pemilih” oleh NgatimanT. Sedangkan Sayed mahdar melansir tentang “Tata CaraVerifikasi Faktual Calon Perseorangan.” Berikutnya Kasrun menghantarkan materi “Tentang Tata Kerja PPS” yang kesemuanya merupakan ikhwal krusial. (b26/b22)

BIREUEN (Waspada): Panitia Pengurus Hari Besar Islam (PHBI) Rabithah Thaliban Aceh (RTA) Kabupaten Bireuen Selasa (28/ 6) nanti malam, mengelar tabligh akbar dengan menghadirkan mubaligh Dr Muhammad Yahya Waloni, mantan pendeta GKI dan Mantan Rektor UKI Tanah Papua dari Jakarta. Ketua RTA Caban g Bireuen Tgk Syeh Khaliluddin yang didampingi Tgk Kasman ‘Arifa dan Rais ‘Am Tgk H Luthfi SM S.Sos.I melalui Mahdi seorang pengurus Masjid Besar Kutablang, kepada Waspada Senin (27/6) mengatakan, tabligh akbar yang mereka gelar itu berthemakan, anti pemurtadan, penodaan agama dan pendangkalan aqidah, sengaja meng-undang mubaligh Dr MuhammadYahya Waloni untuk mengisi ceramah itu, supaya dakwah yang disampaikan sesuaidenganthemaacaraitu. “Kitaberharapsemogaacarainiberjalan lancar dan kita harap juga kaum muslimin untuk datang mendengar ceramahitu,supayadapatdiambilpelajaransehinggadapatdiamalkan nantinya,” harapnya. (amh)

Hakim Vonis Lima Tahun Napi Kabur Dari Lapas LHOKSEUMAWE (Waspada):Majelis Hakim Pengadilan Negeri Lhokseumawe memvonis Rizal Antoni,32, lima tahun penjara karena berusaha lari dari LP Lhokseumawe, Senin (27/6). Rizal yang juga napi narkoba merupakan warga Mongeudong Lhokseumawe. Dia terbukti melanggar hukum karena melarikan diri dari Lembaga Pemasyarakatan dengan cara mengancam sipir pada 11 November 2010. Putusan itu dibacakan Hakim Ketua, Sadri SH didampingi Hakim Anggota Azhari SH MH dan IrfanToni SH dalam sidang yang dihadiri Jaksa Penuntut Umum (JPU) Rista Zulibar PA SH, serta terdakwa Rizal Antoni didampingi penasehat hukumnya Retno SH. Menurut Sadri, berdasarkan fakta-fakta yang terungkap dalam persidangan, terdakwa terbukti secara sah dan meyakinkan bersalah melakukan tindak pidana sebagaimana diatur dalam pasal 211 juncto pasal 214 ayat (1) KUHPidana. “Menjatuhkan pidana penjara selama lima tahun dengan perintah agar terdakwa tetap ditahan. Mengembalikan barang bukti mobil Kijang nomor polisi B 80 MS kepada yang berhak yaitu M Junaidi (warga Langsa-red),” katanya. Usai membaca putusan, Sadri menanyakan tanggapan terdakwa Rizal Antoni dan JPU Rista Zulibar. Setelah berkonsultasi dengan penasehat hukumnya, Retno, Rizal Antoni menyatakan menerima. JPU Rista juga menyatakan menerima, sehingga vonis tersebut menjadi inkrach atau berkekuatan hukum tetap. (b17)


Otomotif

WASPADA Selasa 28 JUNI 2011

C7

VW Kembangkan Temporary Auto-Pilot System Volkswagen (WW) sedang mengembangkan Temporary Auto-Pilot System yang memanfaatkan banyak parameter seperti cruise control

yang dipandu GPS dan lane assistance system (menjaga mobil tetap di lajurnya) sehingga pengemudi tidak perlu melakukan apa-apa.

Temporary Auto-Pilot System, bisa beradaptasi dengan kondisi pengendaraan.

Tawaran Atraktif Dari Audi A6

Ingin mendapatkan sedan Jerman yang cepat, elegan dan nyaman? Anda bisa

memboyong BMW 5-Series. Atau Mercedes-Benz E-Klasse E350, yang dilengkapi dengan

V6 3,5 liter 268 hp. Audi coba memberikan alternatifnya. Namun, Audi datang de-

Audi A6.

ngan harga yang lebih atraktif dari dua rivalnya tersebut. Adalah Audi A6 2012 yang akan dilepas dengan banderol AS$ 41.700 atau Rp357.8 jutaan di Eropa. Audi A6 akan tiba di pasaran menjelang akhir tahun nanti. Namun, dengan harga yang relatif murah, tentu saja ada kekurangan dari dua rivalnya tersebut. Baik Mercedes dan BMW menggunakan mesin V6. Sementara Audi A6 hanya bermodalkan mesin 2.0-liter 4-silinder yang menghasilkan 211 tenaga kuda. Selain itu, Audi menggunakan penggerak roda depan dan transmisi CVT. Jika Audi A6 2012 ingin bersaing ketat BMW dan Mercedes, setidaknya produsen mobil Jerman ini memilih mesin V6 3.0-liter TFSI turbocharged yang memiliki 310 tenaga kuda. Sayangnya, Audi sama sekali tidak memiliki rencana untuk mengubah A6 menggunakan mesin seperti dua rivalnya tersebut. (oz/m47)

Nissan - Mitsubishi Patungan Garap Mobil Kecil Produsen mobil asal Jepang Nissan-Mitsubishi memastikan bakal menghadirkan mobil kecil setelah membentuk perusahaan patungan NMKV, Co. Mobil kecil itu akan dirilis pada 2013 nanti. Hal itu disampaikan Presiden dan Chief Executive Officer NMKV, Co, Junichi Endo seperti dilansir, Rabu (22/6). Mo b i l k e c i l i t u a k a n

menjadi suksesor dari mobil Mitsubishi eK-Wagon yang juga dijual dengan nama Nissan Otti di Jepang. Kedua pabrikan Jepang itu akan mengembangkan platform mobil bersama-sama yang nantinya akan dijual oleh Nissan dan Mitsubishi. “Kami ingin meningkatkan pangsa pasar mobil mini setidaknya menjadi 20 persen

dari pangsa pasar mobil kecil Nissan-Mitsubishi yang saat ini mencapai 15 persen,” ujar Endo. Belum jelas kapasitas mesin yang bakal diusung pada mobil kecil tersebut, apakah bakal membenamkan mesin kapasitas pada mobil konsep kecil globalnya Mitsubishi yakni 1.000 cc dan 1.200 cc dan dengan transmisi

Piramida Tiger Hadir Di Kampus Aksi Hero Sport Honda hadir di Perguruan Tinggi Manajemen dan Ilmu Komputer(STMIK) Potensi Utama. Bekerjasama dengan beberapa Club Honda yakni Honda Mega Pro Club (HMPC), Tiger Independent Medan Club (TIME-C), dan Honda Club CS 1 (HCC One), brand berlambang sayap mengepak ini kembali menghadirkan kegiatan menarik bertajuk “ Honda Sport Heroes Goes To Campus In Action” yang berlangsung Sabtu, (25/6). Arifin Posmadi, General Manager CV. Indako Trading Co selaku main dealer Honda di wilayah Sumut mengungkapkan, menyambut baik dan mendukung gelaran ini, karena selain dapat memberikan hiburan di akhir pekan, ajang ini juga bermanfaat bagi mahasiswa dan masyarakat sebagai wadah menyalurkan kreativitas, aktualisasi diri, dan menunjukkan segala potensi yang dimiliki. Bob Subhan Riza, ST selaku Ketua Badan Penyelenggara Harian (BPH) Fakultas STMIK Potensi Utama mengungkapkan, sangat berbangga gelaran ini dapat berjalan dengan baik. “ Kami berterima kasih dengan Honda, salah satu pihak yang telah menunjukkan kepeduliannya pada generasi muda dengan memberikan hiburan-hiburan yang bersifat positif, khususnya kepada mahasiswa Potensi Utama “, ujarnya. Dari pagi hingga malam, Beragam kompetisi telah menyemarakkan suasana, Honda terus memanjakan para mahasiswa dan juga pengunjung yang memadati kampus dengan beragam

hiburan menarik khas anak muda. Dimulai dari pertunjukan lomba teater yang jalan ceritanya mampu mengocok perut hingga pengunjung tidak hentinya tertawa. Kemudian dilanjutkan dengan Sajian Gravity Keajaiban Dunia, dimana peserta dapat mengekspresikan kreativitasnya lewat gambar-gambar yang bertemakan keajaiban dunia. Bagi anak muda yang gemar ngeband, Honda kembali menjawab dahaga mereka dengan mengadakan Festival Band, tidak heran jika banyak sekali band-band muda berbakat yang ikutan gabung di acara keren ini. Honda juga menyediakan Foto Booth, dimana pengunjung dapat mengabadikan moment bahagianya bersama teman dan keluarga dengan berfoto bareng Honda CS 1. Kemeriahan semakin jelas terlihat ketika aksi ekstrim Freestyle akhirnya unjuk gigi, decak kagum tak hentinya mengiringi setiap aksi akrobatik berbahaya yang ditampilkan para anggota Club Honda, dari angkat roda depan,

hingga angkat roda belakang, dan dari aksi seorang diri hingga aksi beberapa orang dengan satu Honda. Hal yang paling menarik dan mengundang tepuk tangan pengunjung ketika mereka menampilkan aksi dengan membentuk Piramida dengan menggunakan dua Honda Tiger. Namun bukan Honda namanya jika tidak memperhatikan keselamatan dan kenyamanan pengendaranya, karena aksi ini juga dibarengi dengan perlengkapan safety riding, jadi tetap terlindungi. Gunarko Hartoyo, Promotion Manager CV. Indako Trading Co mengungkapkan aksi Freestyle ini memang sangat menarik untuk dinikmati. “Kami berharap kerjasama yang terjalin antara Honda dengan pihak kampus, khususnya STMIK Potensi Utama semakin baik lagi kedepannya, dan dapat kembali mempersembahkan acara berkelas yang tidak hanya manampilkan hiburan, namun juga berisikan nilai edukasi yang bermanfaat“, ujar Gunarko Hartoyo. (adv/m47)

Salah satu atraksi di kegiatan Honda Sport Heroes Goes To Campus In Action” di Medan, Sabtu, (25/6)

Berdasarkan penelitian itu, VW menyimpulkan system ini bisa beradaptasi dengan kondisi pengendaraan di jalan tol dengan kecepatan hingga 130km/jam. Pengemudi masih harus memonitor kondisi mobil. Setiap saat pengemudi bisa mengambil alih dengan mengaktifkan salah satu kendali mobil, missal kemudi atau rem. TAP system terus dikembangkan oleh VW dengan bantuan dari lembaga riset HAVEit (Highly Automated Vehicles or Intelligent Transport) yang didukung pendanaan dari Eropa. Sistem ini sudah berstatus complete working project saat di presentasikan di depan HAVEit. Prof Dr Jurgen Leohold, Executive Director of VW Group Research, menjelaskan, teknologi ini bukan hanya meningkatkan kenyamanan berkendara, tapi juga meningkatkan efisiensi dan mengurangi resiko bahaya di jalan. “Pengemdi tetap bertanggungjawab dan harus selalu mengontrol. Pengemudi bisa setiap saat mengambil alih atau menonaktifkan system kapan saja dan harus terusmenerus memonitor. Dan diatas semua itu, apa yang kita capai hari ini adalah tonggak penting dalam upaya untuk menciptakan accident-free driving.” Di AS, penelitian seperti ini sudah berlangsung lama dan intensif. Bahkan Google juga mengembangkan mobilmobil tanpa pengemudi dengan menggunakan Toyota Prius sebagai basisnya. Audi, anak perusahaan VW, bekerjasama dengan salah satu perguruan tinggi negeri di AS, juga mengembangkan teknologi serupa yang diaplikasikan di Audi TT. Puncaknya, Audi TT tanpa pengemudi itu ikut berpartisipasi dalam balapan gunung, Pikes Peak tahun lalu. (mkc/m47)

Car2go.

Car2go Mobil Ramah Lingkungan April lalu Daimler menciptakan sebuah produk mobil atas sebuah program kendaraan ekonomis bernama, Car2go. Kini Car2go telah hadir di Vancouver. Hadirnya Car2go di Vancouver ini dinilai akan sangat bermanfaat sebagai kendaraan mobilitas keseharian. Daimler telah menyediakan 225 unit Car2go yang hemat bahan bakar dan rendah emisi ini untuk memenuhi permintaan penyewaan mulai 18 Juni kemarin. Selama dua bulan terakhir diproduksi sekira 2000 masyarakat Vancouver telah terdaftar dan menerima kartu keanggotaan mereka dalam program mobil ekonomis ini. Dan kini mereka telah dapat mengendarai Car2go untuk melintasi jalan-jalan di Vancouver. Setelah respon sangat positif, Car2go telah memperpanjang masa pendaftaran gratis (yang mewakili nilai CAD35) sampai tanggal 3 Juli mendatang. Sebagai transportasi pili-

automatic CVT yang baru. Sebelumnya NMKV sudah mengucurkan dana 10 juta yen. Dana ini tergolong kecil karena perusahaan hanya bersifat joint venture. Kar yawannya pun tidak banyak yakni 35 orang saja. (mdn/dc/m47)

Penjualan Mobil Dan Motor Naik Tipis

Gabungan Industri Kendaraan Bermotor Indonesia (Gaikindo) mencatat penjualan kendaraan sepanjang Mei 2011 meningkat dibandingkan April. Namun, pasar otomotif nasional rupanya belum pulih dari badai gempa dan tsunami Jepang yang merontokkan penjualan mobil dunia, termasuk Indonesia. Dalam data yang diterima pekan lalu, pada Mei ini angka penjualan tercatat 61.055 unit, naik sedikit dari April yang hanya 60.702 unit. Sementara itu, angka penjualan bulanan sepanjang tahun ini tertinggi pada Maret, yaitu 82.058 unit. Penyokong utama penjualan kendaraan masih dari

Grup Astra, mencapai 32.153 unit, atau menguasai pangsa pasar hingga 53 persen. Grup Astra ini terdiri atas Toyota, Daihatsu, Isuzu, UD Trucks (dulu Nissan Diesel), dan Peugeot. Sementara itu, per merek, penyokong utama masih dipegang Toyota (19.554 unit), Mitsubishi (11.048 unit), Daihatsu (10.453 unit), Suzuki (7.520 unit), dan Honda (3.673 unit). Di pasar roda dua, Asosiasi Industri Sepeda Motor Indonesia (AISI) nyaris tak mencatat penurunan penjualan akibat gempa Jepang, 11 Maret 2011. Meski didominasi merek-merek asal Jepang, penju-

alan sepeda motor tetap tinggi. Pada Mei lalu, AISI mencatat penjualan sepeda motor nasional 706.293 unit, naik tipis dari April lalu yang hanya 705. 165 un it . Pen jua l a n bulanan tertinggi masih Maret, yaitu 710.635 unit. Bedanya, bila penjualan mobil paling rendah pada April, sepeda motor justru pada Februari, yaitu hanya 610.182 unit. Honda masih menjadi penyumbang tertinggi, yaitu 377.355 unit. Sementara itu, saingan terdekatnya, Yamaha mencatat 280.452 unit. Suzuki hanya 39.790 unit, Kawasaki 7.358 unit, dan TVS 1.293 unit. Sisanya merek lain. (vv/m47)

DAFTAR HARGA SEPEDA MOTOR:

HONDA: Revo 110 Fit Revo 110 SW Revo 110 CW Absolute Revo DX Revo Techno Scoopy Supra X 125 Jari jari Supra X 125 CW Supra X 125 Injec R Vario CW Vario Techno Std Vario Techno CBS Blade 110 CW Mega Pro Jari-jari Mega Pro Racing Tiger Racing CS 1 Beat CW Spacy Spoke Spacy CW CBR 250 Std CBR C-ABS SUZUKI Hayate

12.420.000 13.020.000 14.220.000 14.860.000 16.980.000 14.810.000 15.600.000 16.750.000 17.900.000 15.560.000 16.010.000 17.070.000 14.724.000 19.510.000 20.750.000 26.690.000 18.530.000 13.540.000 12.770.000 13.570.000 43.280.000 50.150.000 15.530.000

Shogun Axelo FL 125 SCD 15.300.000 Shogun Axelo FL 125 RCD 16.300.000 Shogun Axelo FL 125 RMCD 16.550.000 Satria FU 150CD 20.100.000 Spin UY 125S 12.925.000 Spin UY 125SC 13.500.000 Spin UY 125 Daytona 13.850.000 Sky Drive UK 125SC 14.400.000 Thunder EN 125KS 16.800.000 Titan FW 115D 11.875.000 Titan FW 115SD 12.975.000 Titan FW 115 SCD 14.050.000 Shogun FL 125 SD 14.625.000 Shogun FL 125 RCD 15.855.000 Shogun FL 125 RCMD 16.075.000 Shogun FL 125 RCDZ 16.305.000 Sky Wave UW 125 SC 15.430.000

YAMAHA: Vega ZR-DB 13.143.500 Mio 12.779.000 Mio CW 13.577.000 Mio Soul 14.601.000 Mio CW SE 14.569.000 Xeon 16.759.000 Jupiter Z 15.023.000 Jupiter Z CW 15.788.000 Jupiter Z CW SE 16.262.000 Jupiter MX CW 17.725.000 Jupiter MX AT CW 17.000.000 V-ixion 22.257.000 V-ixion SE 24.405.000 Byson 21.035.000 Scorpio Z CW 24.884.000 Lexam 16.814.000 (harga sewaktu-waktu dapat berubah) * Sumber main dealer di Medan

han berkelanjutan, Car2go juga memainkan peran di Kota tujuan Vancouver untuk menjadi ‘kota hijau’ di dunia tahun 2020. Kendaraan Car2go yang tersedia untuk disewa dapat dilihat di internet atau dengan aplikasi smartphone dan dapat digunakan selama diperlukan. Sewa hanya dapat diakhiri dengan meninggalkan kendaraan tersebut di setiap area tertentu yang telah ditentukan, seperti di beberapa tempat parkir di lingkungan pusat kota atau pemukiman dalam area bisnis, atau di salah satu ruang car2go khusus.

Anggota membayar pemakaian dengan penghitungan biaya per menit pemakaian dalam satu hari, atau dapat juga dengan hitungan per beberapa jam dalam satu hari. Harga yang ditentukan per menit atau pun per beberapa jam itu sudah termasuk biaya bahan bakar, parkir, jarak tempuh, asuransi, pemeliharaan dan navigasi GPS. Car2go kini memiliki jaringan global lebih dari 40.000 anggota dengan stok 1.000 unit kendaraan pintar ini. Program ini lebih lanjut akan memperluas di kota-kota Amerika lainnya Utara, dan Eropa pada 2011. (oz/m47)

Mercy Uji A-Class Terbaru Langkah Mercedes-Benz untuk menghadirkan A-Class terbaru sepertinya semakin dekat saja. Kini, Mercedes-Benz ternyata benar-benar fokus untuk menghadirkan New A-Class. Sebuah mobil Mercy A-Class terbaru tertangkap kamera ketika diuji coba di Eropa. Sayang tidak disebutkan nama tempat uji coba untuk model terbaru dari A-Class itu. Namun Anda tidak bakal menyangka jika Mercedes-Benz A-Class kali ini bukan A-Class yang pernah ditampilkan sebagai model terbaru A-Class 3 pintu di Shanghai Auto Show beberapa bulan lalu. Seperti dilansir autocar, pekan lalu, Mercedes-Benz A-Class kali ini mengadopsi 5 pintu. Wujudnya jelas berbeda dari versi 3 pintu. Hal itu diperkuat dengan pernyataan Kepala Disainer Mercedes-Benz, Gorden Wagener yakni yang menyebutkan bukan sebuah khayalan jika Mercedes-Benz menghadirkan A-Class 5 pintu. Apalagi ia mengatakan akan banyak perubahan pada Mercy A-Class terutama pada sisi bumper, grilee, kaca samping. “Jelas hal yang sangat nyata adalah 5 pintu dan kami akan membuat perubahan pada jendela, lampu depan, grilee, itu saja,” katanya. Saat ini Mercy A-Class digembar-gemborkan terinspirasi dari Mercy F800. Model tersebut digadang-gadang sebagai mobil Mercy dengan penampilan futuristik. Bahkan model lain bakal terlihat kuno jika disandingkan dengan Mercy F800. Belum jelas mesin yang bakal terbenam pada Mercy A-Class terbaru berikut kapan mobil tersebut dilempar ke pasar. Namun dikabarkan mobil anyar itu bakal memanfaatkan mesin kapasitas 2.000 cc 4 silinder teknologi BlueEFFICIENCY dengan tenaga 210 hp. (ac/dc/m47) jukkan peningkatan yang cu-kup signifikan dibanding bu-lan sebelumnya, hal ini terutama didukung oleh penjualan New Honda Jazz yang diluncurkan Mei lalu,” jelas Jonfis Fandy, Marketing & Aftersales Service Director PT Honda Prospect (mkc/m47) New HondaMotor. Jazz tetap memberikan kontribusi yang signifikan terhadap penjualan Honda.

TI

P

S

Benahi Knalpot

Lumrahnya mobil berusia lanjut, makin hari suara knalpot mulai berubah. Mau langsung ganti knalpot, perlu putar otak untuk keperluan belanja yang mendadak seperti ini. Mau dilas dengan maksud untuk menambal, juga bisa berisiko merembet ke hal lain akibat panas pijar las. Ada cara efektif untuk pertolongan pertama dengan biaya murah dengan risiko kecil, yaitu dengan menggunakan SealTape Aluminium yang biasa untuk menambal atap seng. Ternyata, ada SealTape yang khusus untuk menambal knalpot, yakni Aluminium Muffler Tape. Wujudnya berupa lembaran tipis aluminium yang berperekat di belakangnya. Setelah membaca manualnya, ternyata Muffler Tape ini, ketika terkena panas perekatnya akan merekat permanen setelah sekitar 30 menit perjalanan.Oke juga, apalagi harganya juga cukup murah, dengan ukuran lebar 4 cm dan panjang 1 meter. Caranya, setelah membeli Muffler Tape ini, bersihkan knalpot dari pasir dan debu hingga benar-benar bersih. Kemudian, rekatkan Muffler Tape pada bagian yang bolong. Ada bagian yang dilapis dua agar kuat. Setelah itu, coba nyalakan mesin. suara mobil menjadi lebih senyap seperti halnya tidak ada masalah dengan knalpot. (bbg sumber/m47)


Ekonomi & Bisnis

C8

WASPADA Selasa 28 Juni 2011

Dana Publik Di TabunganKu Capai Rp1,5 Triliun JAKARTA (Waspada): Bank Indonesia menargetkan hingga akhir 2011 program TabunganKu dapat meraup dana masyarakat hingga Rp5 triliun. Target itu setara dengan 10 persen dari target bank sentral hingga 2014 yang mencapai Rp50 triliun. Program TabunganKu pertama kali diluncurkan 20 Februari 2010 oleh Presiden Susilo Bambang Yudhoyono. Dalam program itu, bank sentral telah menggandeng 70 bank terdiri atas bank umum, Bank Pembangunan Daerah, bank konvensional, dan syariah. Terdapat juga 1.180 Bank Perkreditan Rakyat yang telah menyatakan kesediaannya untuk bergabung. "BI berharap hingga akhir

2011 bisa Rp5 triliun," kata Peneliti Eksekutif Biro Stabilitas Sistem Keuangan Bank Indon es i a , Pung k y Pur no mo Wibowo, saat ditemui di ruang pers BI, Jakarta, Senin (27/6). Pungky mengungkapkan, saldo TabunganKu hingga Maret 2011 tercatat sudah mencapai Rp1,5 triliun. Dari jumlah tersebut, sebanyak 1,4 juta masyarakat sudah menjadi nasabah TabunganKu di seluruh Indonesia. Jumlah paling dominan berasal dari wilayah Jawa Timur. Bank sentral di Tanah Air itu masih optimistis target saldo TabunganKu sebesar Rp50 triliun akan tercapai. Bahkan, BI siap mengintensifkan upaya mengedukasi masyarakat

mengenai masalah keuangan. "BI dalam mengimplementasikan hal tersebut turut bekerja sama dengan Kementerian Pendidikan Nasional untuk memberikan kurikulum di pendidikan dasar," jelasnya. Program membiasakan diri masyarakat menabung ini mensyaratkan setoran awal yang sangat ringan, yaitu Rp20.000 untuk bank umum dan Rp10.000 untuk BPR. Namun, melihat dari kondisi sosial Indonesia, meski industri perbankan di Indonesia sudah berkembang hampir 180 tahun, masyarakat yang memiliki rekening tabungan di perbankan nasional ternyata hanya sebanyak 60-70 juta orang. (vvn)

40 Juta Orang Tak Miliki Akses Perbankan JAKARTA (Wasapda): Bank Indonesia menyatakan, 40 juta penduduk Indonesia belum memiliki akses perbankan. Menurut Deputi Gubernur BI, Muliaman D Hadad, perbaikan akses perbankan akan berpengaruh pada perbaikan perekonomian Indonesia secara keseluruhan. "Kerja sama dengan Organisasi untuk Kerjasama dan Pengembangan Ekonomi (OECD) menjadi penting karena mereka telah memiliki pengalaman, sehingga bisa transfer pengalaman," ujarnya di Gedung Thamrin Bank Indonesia, Jakarta, Senin (27/6). Edukasi akan menjadi sektor paling ditingkatkan untuk

menggenjot inklusi atau akses finansial ini. Sebab, BI berasumsi bahwa finansial inklusi tidak dapat terjadi bila tidak didukung oleh pemberian pendidikan kepada masyarakat. "Edukasi bisa melalui formal (kurikulum) dan informal (seperti program khusus untuk nelayan atau TKI)," tuturnya. Finansial inklusi ini, diakui, telah mulai dilakukan oleh BI dalam tiga tahun ke belakang. Beberapa program yang telah dilakukan untuk mendukung finansial inklusi ini antara lain Tabunganku dan Ayo Ke Bank. Menurutnya beberapa program tersebut sejauh ini telah berjalan dengan baik dan terus dilakukan pengembangan.

"Sudah berjalan dan terus kita perbaiki. Contoh program Tabunganku sudah 1,4 juta nasabah dengan saldo Rp1,5 triliun dalam satu tahun. Mulai Februari 2010. Ini padahal konsentrasinya pada mikro," jelasnya. Sekertaris Deputi Jendral OECD, Richard Boucher, menyatakan OECD sangat mendukung inklusi keuangan oleh Indonesia sejak 3 tahun terakhir. Bentuk bantuan dari OECD, dia menjelaskan, tidak dalam bentuk uang seperti bank dunia, tetapi memberikan pengalaman kepada masyarakat. "OECD membantu pengembangan masyarakat melalui diskusi pertukaran pengalaman," ungkapnya. (vvn)

Uang Rp500 Tak Berlaku Di Perbatasan MIANGAS ( Waspada): Uang pecahan di bawah Rp500 ke bawah yang biasa digunakan di kota ternyata tidak laku di daerah perbatasan pulau terluar Indonesia. Hal ini dikarenakan tidak adanya harga barang dijual dengan harga pecahan tersebut. "Barang-barang apapun dijual tidak ada di bawah Rp1.000 jadi minimal ya segitu. Makanya uang Rp500 itu tidak laku," ungkap Camat Kepulau-

an Miangas, Perbatasan Indonesia-Filipina, SE Maarist ketika ditemui wartawan di Pulau Miangas Kabupaten Kepulauan Talaud, Sulawesi Utara, Minggu, (27/6). Lebih lanjut dijelaskan Maarist, layanan kas kelililing untuk penukaran rupiah yang diselenggarakan bank sentral sangat berguna untuk masyarakat. Pasalnya sebagian besar masyarakat menukarkan yang Rp500 ke bawah di pulau ini

dengan pecahan baru. Dan bukan hanya itu dia menambahkan masyarakat di daerah perbatasan ini sangat memerlukan bank untuk melakukan traksaksi keuangan seperti transfer. "Di sini tidak ada bank, jadi jika mau ke bank harus ke Tahuna atau ke pulau yang merupakan kabupaten. Itu bisa ditempuh dengan kapal biasa selama dua hari dua malam. Jadi masyarakat kesusahan," jelasnya. (okz)

DISKON ALATALAT SEKOLAH

Moratorium Berlaku

Pemerintah Wajib Sediakan 2,5 Juta Pekerjaan Setiap Tahun JAKARTA (Wasapda): Pasca kebijakan penghentian

Pengamat: Investasi Asing Ke Indonesia Meningkat JAKARTA (Antara): Pengamat pasar uang, Farial Anwar memperkirakan investasi asing ke pasar domestik akan meningkat, terutama dari investor Amerika Serikat (AS) dan Eropa, melihat pertumbuhan ekonomi nasional yang terus tumbuh. Pelaku asing lebih optimis menempatkan dananya di kawasan Asia, khususnya Indonesia yang ekonominya diperkirakan akan dapat mencapai tujuh persen, katanya yang juga Direktur Currency Management Group di Jakarta, Senin. Menurut Farial Anwar, Indonesia memiliki berbagai daya tarik seperti tingkat suku bunga rupiah mencapai 6,75 persen, stabilitas keamanan yang terjaga, serta kenyamanan berinvestasi yang mendorong mereka lebih tertarik ke pasar domestik. Arus modal asing yang masuk ke pasar domestik selama hanya bermain di pasar finansial seperti pasar saham, pasar uang, dan masuk ke instrumen Bank Indonesia, karena para hedge fund yang memiliki dana

itu melakukan investasi dalam jangka pendek, ucapnya. Karena itu, lanjut dia, pemerintah harus dapat menarik investor asing melakukan investasi dalam jangka panjang seperti membuat pabrik baru sehingga membuka lapangan kerja baru yang pada gilirannya memberikan pendapatan kepada masyarakat. "Kami optimis pemerintah sedang berusaha ke arah agar pertumbuhan ekonomi nasional dapat tumbuh lebih baik," ucapnya. Peluang makin besarnya arus modal asing ke Indonesia, menurut dia, sangatlah besar karena pertumbuhan ekonomi AS menurun, pengangguran meningkat bahkan penjualan properti merosot sebesar 30 persen. Selain itu, krisis utang terjadi di Eropa seperti Yunani yang diperkirakan akan mengalami gagal bayar, dan China yang ekonominya mulai melambat. Karena itu, menurut dia pemerintah harus dapat mempersiapkan diri lebih baik lagi

Petani Bergairah, Harga Getah Karet Di Labusel Membaik SEIKANAN (Waspada) : Petani karet di sejumlah daerah di Kabupaten Labusel dalam dua bulan terakhir kembali bergairah. Hal itu menyusul kembali membaiknya harga getah karet setelah sempat merosot tajam beberapa waktu lalu. Salah seorang agen pembelian getah di Kecamatan Sei Kanan, Rinal Nasution, Minggu (26/6) mengatakan, harga getah karet di tingkat petani saat ini berkisar Rp12 ribu hingga Rp14 ribu per kg atau naik Rp5 ribu dari harga dua bulan lalu sempat anjlok hingga Rp7 ribu per kg. Sementara harga di tingkat agen, kata dia, mencapai Rp17 ribu per kg atau naik dari harga sebelumnya mencapai Rp12 ribu per kg-nya. “Mulai dua bulan terakhir memang mengalami kenaikan, meski harga masih fluktuatif, namun ini sudah cukup menggairahkan bagi petani,” katanya. Hal senada dikatakan agen getah karet lainnya R Hasibuan. Menurutnya, harga penjualan mereka di pabrik saat ini mencapai Rp34.700 per kg. Harga itu, menurutnya, membaik dari pada dua bulan lalu yang sempat anjlok ke harga

Rp22 ribu-Rp27 ribu perkg. Namun harga Rp34.700 itu juga telah mengalami penurunan Rp500 dari harga sepekan lalu. “Kalau minggu lalu masih Rp35.200 per kg,” katanya. Dengan membaiknya harga karet tersebut, dia mengharapkan para petani karet untuk terus merawat areal perkebunannya. Ka re n a m e n u r u t n y a , sekarang ini harga karet cukup membantu untuk meningkatkan ekonomi masyarakat. Sebab, meski harga getah karet fluktuatif, namun jika getah dihasilkan berkualitas, maka harganya tetap tinggi. Dia mengatakan, selain berkebun kelapa sawit, sumber terbesar pendapatan ekonomi masyarakat di Labusel, adalah dari perkebunan karet. Menurutnya, hampir di setiap kecamatan terdapat petani yang sumber penghasilannya dari menyadap getah. “Saya pikir peningkatan ekonomi keluarga dari sektor perkebuan karet ini cukup menjanjikan. Waktu harga per kilogram karet masih Rp20 ribu, mereka minimal menghasilkan seratusan ribu per harinya,” katanya. (c18)

Waspada/Hamdani

Dua orang calon pembeli memperhatikan buku tulis dan peralatan sekolah lainnya di salah satu plaza di Kota Medan, Senin (27/6).Memasuki tahun ajaran baru, berbagai peralatan sekolah mulai mendapatkan diskon bervariasi. Mulai dari 10 hingga 30 persen perlusinya.

sementara (moratorium) pengiriman tenaga kerja Indonesia ke Arab Saudi, setiap tahun pemerintah setidaknya harus menyediakan 2,5 juta lapangan kerja baru untuk menampung masyarakat yang batal agar investor asing berminat untuk menginvestasikan dananya di dalam negeri. Apalagi sejumlah investor asing menyatakan, Indonesia masih merupakan pasar potensial yang perlu digarap lebih baik ketimbang di Amerika Serikat dan Eropa yang masih menerapkan tingkat suku bunga rendah, katanya.

menjadi TKI. Kementerian Tenaga Kerja dan Transmigrasi juga memperkirakan, setiap bulannya, akan ada 15 ribu-20 ribu warga Indonesia yang batal bekerja di negara Timur Tengah tersebut. Hal tersebut diutarakan

Menteri Tenaga Kerja dan Transmigrasi Muhaimin Iskandar disela Rapat Koordinator Menteri Perekonomian di Gedung Menko Perekonomian, Jakarta, Senin, (27/6). "Sedang dihitung. Diper-

kirakan harus menyediakan 2,5 juta lapangan kerja dalam setahun," kata dia. Me n u r u t Mu h a i m i n , seluruh instansi pemerintah seperti Kementerian Pekerjaan Umum saat ini terus menghitung kebutuhan tenaga kerja yang diperlukan untuk menangani TKI yang tidak dapat berangkat kerja. Selain instansi negara, pemerintah juga bakal menggiatkan program nasional pemberdayaan masyarakat Mandiri, program bidang kelautan, dan p r o g ra m p e m e r i n t a h d i berbagai sektor yang dianggap

bisa menyerap TKI yang batal bekerja di luar negeri. "Sebetulnya ini fokusnya saja, mengenai peningkatan tambahan antisipasi moratorium," ujar Muhaimin menjelaskan alasan program yang baru digagas setelah moratorium berlaku. Program PNPM Mandiri di sejumlah daerah, ujar Muhaimin, merupakan program yang mampu menjadi instrumen yang tepat untuk merekrut TKI. Selain itu, program pemerintah itu juga bisa membuka peluang usaha disamping upaya lain seperti menambah jenis pro-

gram dan jenis insentif kewirausahaan. Sejumlah daerah menjadi sasaran penyerapan TKI yang batal berangkat ini diantaranya Jawa Barat, Jawa Timur, dan Nusa Tenggara Barat. Daerahdaerah tersebut selama ini menjadi basis rekrtumen calon TKI. "Jadi semua kementerian itu diminta penghematan anggaran untuk diberikan program pemberdayaan dan pengurangan pengangguran di daerah berbasis TKI," kata dia. (vvn)

Dirut Pelindo I Resmikan Alat Baru Bernilai Rp 1 Triliun Lebih MEDAN (Waspada): Direktur Utama PT Pelabuhan Indonesia I (Persero) meresmikan pemakaian peralatan bongkar muat peti kemas dan kapal pandu bernilai Rp1 triliun lebih di Belawan International Container Terminal (BICT). Peresmian juga dirangkaikan dengan tanda syukur dengan makan bersama serta pemberian santunan kepada 80 anak yatim piatu yang juga dihadiri tokoh alim ulama di dermaga BICT, Sabtu (25/6). Direktur Utama PT Pelabuhan Indonesia I (Pelindo) Harry Sutanto mengatakan, penambahan peralaran baru ini merupakan kewajiban perusahaan untuk senantiasa meningkatan pelayanan. Menurut Dirut, peralatan baru ini diharapkan akan terjadi peningkatan pelayanan dan operasional hingga mencapai 700 Teus dari selama ini hanya berkisar 500 Teus saja. Pelindo I sebagai BUMN tetap terus meningkatkan pelayanannya seiring akan bertambahnya investasi saat ini sedang dilaksanakan, sehingga program pada tahun mendatang pelaksanaan bongkar muat peti kemas di BICT ini akan menjadi 1 juta Teus. Agar ini tercapai, Dirut atas nama segenap karyawan memohon doa restunya serta kerjasama yang baik dengan para pengguna jasa. Semoga kehadiran peralatan baru ini dapat bermanfaat untuk

Waspada/Zulkifli Darwis

Dirut Pelindo I, Otoritas Pelabuhan dan Syahbandar Belawan bersama melaksanakan tanda peresmian pelaratan baru. meningkatkan perekonomian di Sumatera Utara ini, jelasnya. Ketua Gafeksi Sumut Rizal menyambut baik investasi baru ini, namun pengguna jasa mengharapkan dengan penambahan alat baru ini juga diiringi dengan peningkatan pelayanan SDMnya , karena pelayanan selama ini masih ditemukan banyaknya keluhan. ‘’Peralatan baru tidak akan dapat berjalan baik apabila tidak diiringi dengan Sumber Daya Manusianya,’’ jelas Rizal. Peralatan baru yang diresmikan pemakaiannya saat itu untuk menunjang operasional di berbagai pelabuhan Sumut dan Riau. Untuk Pelabuhan Ca-

bang Belawan, Harbour Mobile Crane (HMC) kemampuan 104 ton dan 9 row sebanyak 1 unit bernilai Rp39 miliar. Excavator kemampuan 20 ton bernilai Rp1,4 m. 2 unit Forklift 3,5 ton Rp1,04 m. 2 unit Kapal Pandu Cepat (KPC) alumanium Rp14 m. Untuk BICT, 2 unit Container Crane (CC) 40 ton dengan investasi Rp141 miliar. 5 unit Rubber Tyred Gantry (RTG) bernilai Rp95 m. 18 unit Heat Truck senilai Rp19,7 m. Side Loader senilai Rp2,9 m dan 2 unit Harbour Mobile Crane (HMC) dengan nilai investasi Rp41,3 miliar. Cabang Pelabuhan Dumai,

Harga Emas Di Medan Jenis

Kadar 99,99%

Rp417.000

22 Karat

97%

Rp414.000

18 Karat

75%

Valuta Asing Di Medan

Harga

24 Karat (LM)

Rp399.000

17 Karat

70 %

Rp398.000

Emas Putih

75%

Rp399.000

Suasa

20 s/d 35%

Rp210.000

8 unit Dump Truck senilai Rp8,3 m. 8 unit Loador 12 ton senilai Rp18,63 m. 4 unit Excavator 20 ton senilai Rp5,5 m. 3 unit Forklif senilai Rp1,25 m. Harbour Mobile Crane (HMC) senilai Rp36 m dan Speed Boat senilai Rp750 juta. Cabang Pelabuhan Pekanbaru mendapat 4 unit Head Truck dan peralatan baru ini juga dioperasikan di Belawan Logistic Center (BLC) terdiri Side Loador senilai Rp14,2 m. 10 unit Head Truck senilai Rp11,3 m dan 2 unit Froklif senilai Rp1,6 m. Untuk Galangan Kapal mendapat Becho Long Arm senilai Rp 1,85 m. Pelabuhan Cabang Tanjung Pinang sebuah Speed Boat. Direktur Utama dalam temu persnya menjelaskan, penambahan peralatan baru ini dalam rangka program investasi secara besar besaran di tahun 2011 bernilai Rp1,9 Triliun. Sehingga investasi 2012 Pelindo I akan menambah lagi 3 CC kapasitas 40 ton dan 10 unit RTG dan tahun ini dalam proses pengerjaan penambahan dermaga 100 meter dan tahun 2012 kembali menambah dermaga sepanjang 350 meter. Invenstasi Pelindo I ini bertambah 400 persen dibanding 2010 hanya Rp450 miliar . Upaya ini dalam rangka upaya konkret manajemen dalam meningkatkan kualitas layanan memenuhi harapan customer, jelas Dirut Harry Sutanto.(m35)

(m38)

Mata Uang

Jual

Beli

Dolar AS Dolar Australia Franc Swiss Poundsterling Inggris Dolar Hongkong Yen Jepang Dolar Singapura Euro Ringgit Malaysia

8.520 9.145 8.620 14.068 1.169 106,32 6.930 12.457 2.870

8.500 9.120 8.454 13.783 1.148 106,02 6.905 12.425 2.800

President Direktur XL, Hasnul Suhaimi menerima penghargaan dari Pimpinan Perusahaan & Pimpinan Redaksi Majalah Swa, Kemal E Gani, disaksikan Martin Schwarz dari Lembaga Survey Stern Stewart & Co

XL Kembali Raih Beberapa Penghargaan Pencapaian kinerja XL dalam menyediakan layanan telekomunikasi yang terbaik bagi masyarakat kembali mendapatkan apresiasi. Di ajang penghargaan SWA 100 Indonesia Best Wealth Creators 2011 digelar majalah SWA XL berhasil meraih 3 jenis penghargaan yakni 1st Ranking of Indonesia Best Public Companies 2011 Based on WAI (Wealth Added Index) Method untuk kategori Telecommunication Services, ASEAN Best Public Companies 2011 based on WAI (Wealth Added Index) Method, dan Indonesia Best Public Companies 2011 Based on WAI (Wealth Added Index) Method. Penghargaan diterima secara langsung President Direktur XL, Hasnul Suhaimi di Jakarta Hasnul Suhaimi mengatakan ,“Penghargaan yang kami terima ini tentunya merupakan apresiasi atas pencapaian kerja keras kami selama ini, sekaligus tantangan bagi kami untuk terus melangkah kedepan dalam memberikan layanan yang lebih baik bagi pelanggan sekaligus juga meningkatkan value perusahaan”. Pemeringkatan 100 perusahaan terbaik di Indonesia dalam SWA 100 tahun 2011 ini menggunakan metode Wealth Added Index atau WAI, yang memungkinkan para pengelola perusahaan memadukan kinerja masa sekarang (Current Operating Value) atau COV, dan ekspektasi di masa depan (Future Growth Valie) atau FCH dengan kebutuhan pembiayaan dan return minimum yang diharapkan pemegang saham (required return). Sementara di ajang penghargaan PR Program & People of The Year 2011 diselenggarakan Majalah Marketing Mix, XL juga meraih 3 penghargaan yaitu kategori CEO untuk President Direktur XL, Hasnul Suhaimi, kategori Spoke Person untuk Head of Corporate Communications XL, Febriati Nadira, serta kategori Marketing PR Program untuk program XL NetRally. Hasnul Suhaimi dan Febriati Nadira dinilai panitia sebagai narasumber yang mampu menjalin dan menjaga hubungan baik dengan media. Adapun program XL Network Rally dipandang unik, interaktif, dan melibatkan partisipasi komunitas yang menjadi peserta program NetRally.

Waspada Selasa 29 Juni 2011  

waspada daily